BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80316_g1_i1 len=2603 path=[2581:0-2602]

Length=2603
                                                                      Score     E

ref|XP_011099456.1|  PREDICTED: probable beta-D-xylosidase 6           1012   0.0     
ref|XP_009612183.1|  PREDICTED: probable beta-D-xylosidase 6           1010   0.0     
emb|CDP02677.1|  unnamed protein product                                997   0.0     
ref|XP_002264031.2|  PREDICTED: probable beta-D-xylosidase 6            997   0.0     Vitis vinifera
emb|CBI25718.3|  unnamed protein product                                991   0.0     
gb|KDP32160.1|  hypothetical protein JCGZ_12621                         990   0.0     
ref|XP_009795794.1|  PREDICTED: probable beta-D-xylosidase 6            989   0.0     
gb|AFI25186.1|  putative beta-D-xylosidase                              984   0.0     
ref|XP_008385726.1|  PREDICTED: probable beta-D-xylosidase 6            982   0.0     
ref|XP_010254644.1|  PREDICTED: probable beta-D-xylosidase 6            978   0.0     
ref|XP_006466365.1|  PREDICTED: probable beta-D-xylosidase 6-like       976   0.0     
gb|KDO78723.1|  hypothetical protein CISIN_1g003606mg                   976   0.0     
ref|XP_004231972.1|  PREDICTED: probable beta-D-xylosidase 6            974   0.0     
ref|XP_008236660.1|  PREDICTED: probable beta-D-xylosidase 6 isof...    974   0.0     
ref|XP_007206430.1|  hypothetical protein PRUPE_ppa001583mg             973   0.0     
ref|XP_006426203.1|  hypothetical protein CICLE_v10024911mg             972   0.0     
ref|XP_011026854.1|  PREDICTED: probable beta-D-xylosidase 6 isof...    968   0.0     
ref|XP_002299457.1|  hypothetical protein POPTR_0001s10850g             967   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_006357757.1|  PREDICTED: probable beta-D-xylosidase 6-like       966   0.0     
ref|XP_007047697.1|  Glycosyl hydrolase family protein                  965   0.0     
ref|XP_004288313.1|  PREDICTED: probable beta-D-xylosidase 6-like       965   0.0     
ref|XP_003612944.1|  Beta-D-xylosidase                                  959   0.0     
ref|XP_010105119.1|  putative beta-D-xylosidase 6                       950   0.0     
ref|XP_003534261.1|  PREDICTED: probable beta-D-xylosidase 6-like       942   0.0     
ref|XP_006399554.1|  hypothetical protein EUTSA_v10012725mg             941   0.0     
ref|XP_006287090.1|  hypothetical protein CARUB_v10000252mg             941   0.0     
ref|XP_004512546.1|  PREDICTED: probable beta-D-xylosidase 6-like       940   0.0     
ref|XP_010023414.1|  PREDICTED: probable beta-D-xylosidase 6            939   0.0     
gb|KDO78722.1|  hypothetical protein CISIN_1g003606mg                   939   0.0     
gb|EYU44551.1|  hypothetical protein MIMGU_mgv1a001559mg                937   0.0     
ref|XP_002873465.1|  glycosyl hydrolase family 3 protein                937   0.0     
ref|XP_010453089.1|  PREDICTED: probable beta-D-xylosidase 6            936   0.0     
ref|XP_009122041.1|  PREDICTED: probable beta-D-xylosidase 6            935   0.0     
ref|XP_010491733.1|  PREDICTED: probable beta-D-xylosidase 6            934   0.0     
ref|NP_196618.1|  putative beta-D-xylosidase 6                          934   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010918501.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    928   0.0     
gb|KFK25328.1|  hypothetical protein AALP_AA8G098500                    924   0.0     
ref|XP_007158321.1|  hypothetical protein PHAVU_002G142900g             921   0.0     
ref|XP_008440505.1|  PREDICTED: probable beta-D-xylosidase 6            921   0.0     
ref|XP_009404942.1|  PREDICTED: probable beta-D-xylosidase 6            919   0.0     
ref|XP_010527498.1|  PREDICTED: probable beta-D-xylosidase 6            917   0.0     
ref|XP_009400278.1|  PREDICTED: probable beta-D-xylosidase 6            917   0.0     
ref|XP_004143540.1|  PREDICTED: probable beta-D-xylosidase 6-like       916   0.0     
ref|XP_004160150.1|  PREDICTED: probable beta-D-xylosidase 6-like       916   0.0     
ref|XP_010683056.1|  PREDICTED: probable beta-D-xylosidase 6            904   0.0     
dbj|BAC41913.1|  putative beta-xylosidase                               887   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_008796726.1|  PREDICTED: probable beta-D-xylosidase 6            887   0.0     
emb|CDX97026.1|  BnaC09g45990D                                          880   0.0     
ref|NP_001053392.1|  Os04g0530700                                       879   0.0     Oryza sativa Japonica Group [Japonica rice]
emb|CDX69822.1|  BnaA10g21710D                                          874   0.0     
ref|XP_003580200.2|  PREDICTED: probable beta-D-xylosidase 6            874   0.0     
ref|XP_006850394.1|  hypothetical protein AMTR_s00184p00056440          873   0.0     
ref|XP_002448225.1|  hypothetical protein SORBIDRAFT_06g023450          864   0.0     Sorghum bicolor [broomcorn]
dbj|BAJ94317.1|  predicted protein                                      860   0.0     
ref|XP_006653619.1|  PREDICTED: probable beta-D-xylosidase 6-like       858   0.0     
tpg|DAA36709.1|  TPA: putative O-Glycosyl hydrolase superfamily p...    856   0.0     
gb|EPS73741.1|  hypothetical protein M569_01013                         854   0.0     
gb|ABY48135.1|  beta-D-xylosidase                                       838   0.0     Medicago truncatula
gb|EEE61389.1|  hypothetical protein OsJ_15562                          827   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|KCW59657.1|  hypothetical protein EUGRSUZ_H02409                     806   0.0     
ref|XP_008236665.1|  PREDICTED: probable beta-D-xylosidase 6 isof...    808   0.0     
emb|CAJ86207.1|  B1011H02.4                                             805   0.0     Oryza sativa [red rice]
ref|XP_011026855.1|  PREDICTED: probable beta-D-xylosidase 6 isof...    773   0.0     
gb|KGN48676.1|  hypothetical protein Csa_6G497270                       765   0.0     
gb|KHN38910.1|  Putative beta-D-xylosidase 6                            738   0.0     
ref|XP_011098370.1|  PREDICTED: probable beta-D-xylosidase 7            742   0.0     
ref|XP_010061816.1|  PREDICTED: probable beta-D-xylosidase 7            734   0.0     
ref|XP_009782574.1|  PREDICTED: probable beta-D-xylosidase 7            731   0.0     
gb|KDP20226.1|  hypothetical protein JCGZ_09858                         729   0.0     
ref|XP_010664313.1|  PREDICTED: probable beta-D-xylosidase 7            728   0.0     
ref|NP_001167905.1|  uncharacterized protein LOC100381616               722   0.0     Zea mays [maize]
ref|XP_002513892.1|  Periplasmic beta-glucosidase precursor, puta...    726   0.0     Ricinus communis
ref|XP_008808183.1|  PREDICTED: probable beta-D-xylosidase 7            723   0.0     
ref|XP_009592501.1|  PREDICTED: probable beta-D-xylosidase 7            723   0.0     
ref|NP_001266114.1|  SlArf/Xyl4 protein precursor                       723   0.0     
ref|XP_006826952.1|  hypothetical protein AMTR_s00010p00188970          722   0.0     
ref|XP_006354009.1|  PREDICTED: probable beta-D-xylosidase 7-like       721   0.0     
gb|EYU23220.1|  hypothetical protein MIMGU_mgv1a001636mg                719   0.0     
ref|XP_010676938.1|  PREDICTED: probable beta-D-xylosidase 7            719   0.0     
gb|EYU39877.1|  hypothetical protein MIMGU_mgv1a018879mg                717   0.0     
gb|KDP20227.1|  hypothetical protein JCGZ_09859                         717   0.0     
emb|CDP01027.1|  unnamed protein product                                739   0.0     
gb|EYU33325.1|  hypothetical protein MIMGU_mgv1a001753mg                716   0.0     
ref|XP_010269208.1|  PREDICTED: probable beta-D-xylosidase 7            717   0.0     
emb|CDP01028.1|  unnamed protein product                                716   0.0     
ref|XP_011074159.1|  PREDICTED: probable beta-D-xylosidase 7            716   0.0     
gb|EYU33327.1|  hypothetical protein MIMGU_mgv1a001678mg                714   0.0     
ref|XP_011016184.1|  PREDICTED: probable beta-D-xylosidase 7            716   0.0     
ref|XP_011011483.1|  PREDICTED: probable beta-D-xylosidase 7            712   0.0     
ref|XP_008808189.1|  PREDICTED: probable beta-D-xylosidase 7            712   0.0     
ref|XP_010064766.1|  PREDICTED: probable beta-D-xylosidase 7            712   0.0     
ref|XP_009599906.1|  PREDICTED: probable beta-D-xylosidase 7            712   0.0     
gb|EYU33328.1|  hypothetical protein MIMGU_mgv1a001688mg                711   0.0     
ref|XP_002302285.1|  glycosyl hydrolase family 3 family protein         711   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_002306583.2|  hypothetical protein POPTR_0005s16660g             710   0.0     Populus trichocarpa [western balsam poplar]
ref|NP_001266109.1|  SlArf/Xyl3 protein precursor                       710   0.0     
gb|EYU23224.1|  hypothetical protein MIMGU_mgv1a001695mg                707   0.0     
ref|XP_006354074.1|  PREDICTED: probable beta-D-xylosidase 7-like       707   0.0     
ref|XP_009391118.1|  PREDICTED: probable beta-D-xylosidase 7            707   0.0     
ref|XP_006855294.1|  hypothetical protein AMTR_s00057p00049120          706   0.0     
ref|XP_009782575.1|  PREDICTED: probable beta-D-xylosidase 7            706   0.0     
ref|XP_009390583.1|  PREDICTED: probable beta-D-xylosidase 7            704   0.0     
ref|XP_002452540.1|  hypothetical protein SORBIDRAFT_04g027700          704   0.0     Sorghum bicolor [broomcorn]
ref|XP_011016128.1|  PREDICTED: probable beta-D-xylosidase 7            703   0.0     
ref|XP_010676949.1|  PREDICTED: probable beta-D-xylosidase 7            703   0.0     
gb|EYU33329.1|  hypothetical protein MIMGU_mgv1a001598mg                701   0.0     
gb|KHG13360.1|  putative beta-D-xylosidase 7 -like protein              700   0.0     
ref|XP_006354008.1|  PREDICTED: probable beta-D-xylosidase 7-like       700   0.0     
ref|XP_007018825.1|  Glycosyl hydrolase family protein isoform 3        725   0.0     
ref|XP_007018823.1|  Glycosyl hydrolase family protein isoform 1        725   0.0     
ref|XP_007018824.1|  Glycosyl hydrolase family protein isoform 2        724   0.0     
ref|XP_004301317.1|  PREDICTED: probable beta-D-xylosidase 7-like       698   0.0     
ref|XP_008445351.1|  PREDICTED: probable beta-D-xylosidase 7            698   0.0     
ref|XP_006434020.1|  hypothetical protein CICLE_v10000352mg             697   0.0     
gb|KDO80913.1|  hypothetical protein CISIN_1g004054mg                   697   0.0     
ref|XP_007136230.1|  hypothetical protein PHAVU_009G029300g             696   0.0     
ref|XP_008677748.1|  PREDICTED: uncharacterized protein LOC100502...    697   0.0     
ref|XP_006472631.1|  PREDICTED: probable beta-D-xylosidase 7-like       695   0.0     
gb|EYU23223.1|  hypothetical protein MIMGU_mgv1a001417mg                697   0.0     
gb|EYU23222.1|  hypothetical protein MIMGU_mgv1a021704mg                695   0.0     
ref|XP_008375790.1|  PREDICTED: probable beta-D-xylosidase 7            695   0.0     
ref|XP_007018826.1|  Glycosyl hydrolase family protein                  697   0.0     
gb|KHG02565.1|  putative beta-D-xylosidase 7                            696   0.0     
gb|EYU23824.1|  hypothetical protein MIMGU_mgv1a020334mg                693   0.0     
ref|XP_002489310.1|  hypothetical protein SORBIDRAFT_0010s010920        693   0.0     Sorghum bicolor [broomcorn]
ref|XP_008234021.1|  PREDICTED: probable beta-D-xylosidase 7            693   0.0     
ref|XP_009369659.1|  PREDICTED: probable beta-D-xylosidase 7            693   0.0     
ref|NP_177929.1|  putative beta-D-xylosidase 7                          692   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|AAK38482.1|  beta-D-xylosidase                                       692   0.0     Hordeum vulgare [barley]
ref|XP_002285805.1|  PREDICTED: probable beta-D-xylosidase 7            692   0.0     Vitis vinifera
ref|XP_011042236.1|  PREDICTED: probable beta-D-xylosidase 2            691   0.0     
ref|XP_011098380.1|  PREDICTED: probable beta-D-xylosidase 7            692   0.0     
ref|XP_004150696.1|  PREDICTED: probable beta-D-xylosidase 7-like       691   0.0     
ref|XP_007225247.1|  hypothetical protein PRUPE_ppa001675mg             691   0.0     
ref|XP_003577615.1|  PREDICTED: probable beta-D-xylosidase 7            691   0.0     
ref|XP_006647908.1|  PREDICTED: probable beta-D-xylosidase 7-like       691   0.0     
ref|NP_001130324.1|  putative O-Glycosyl hydrolase superfamily pr...    690   0.0     Zea mays [maize]
ref|XP_004163321.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    690   0.0     
ref|XP_002302758.2|  hypothetical protein POPTR_0002s19830g             689   0.0     Populus trichocarpa [western balsam poplar]
gb|EEC74020.1|  hypothetical protein OsI_08964                          689   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_006390030.1|  hypothetical protein EUTSA_v10018160mg             689   0.0     
ref|XP_009391117.1|  PREDICTED: probable beta-D-xylosidase 7            689   0.0     
ref|NP_001048140.1|  Os02g0752200                                       689   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_007140931.1|  hypothetical protein PHAVU_008G153300g             689   0.0     
ref|XP_011041424.1|  PREDICTED: probable beta-D-xylosidase 2            687   0.0     
ref|XP_011015623.1|  PREDICTED: probable beta-D-xylosidase 2            687   0.0     
ref|XP_003526589.1|  PREDICTED: probable beta-D-xylosidase 7-like...    687   0.0     
gb|EYU23226.1|  hypothetical protein MIMGU_mgv1a025071mg                686   0.0     
gb|AES97966.2|  glycoside hydrolase family 3 protein                    687   0.0     
gb|EMS60786.1|  putative beta-D-xylosidase 6                            681   0.0     
ref|XP_008344154.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    685   0.0     
ref|XP_009391116.1|  PREDICTED: probable beta-D-xylosidase 7            686   0.0     
ref|XP_004953945.1|  PREDICTED: probable beta-D-xylosidase 7-like       686   0.0     
dbj|BAK00077.1|  predicted protein                                      686   0.0     
emb|CBI19138.3|  unnamed protein product                                706   0.0     
ref|XP_010693351.1|  PREDICTED: probable beta-D-xylosidase 7            686   0.0     
ref|XP_002889174.1|  glycosyl hydrolase family 3 protein                684   0.0     
ref|XP_003544783.1|  PREDICTED: probable beta-D-xylosidase 7-like       684   0.0     
ref|XP_010914548.1|  PREDICTED: probable beta-D-xylosidase 2            683   0.0     
ref|XP_003615003.1|  Xylan 1 4-beta-xylosidase                          683   0.0     
gb|KHG02566.1|  putative beta-D-xylosidase 7                            684   0.0     
ref|XP_004513829.1|  PREDICTED: probable beta-D-xylosidase 7-like       682   0.0     
ref|NP_001067726.1|  Os11g0297800                                       682   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_003576084.1|  PREDICTED: probable beta-D-xylosidase 7 isof...    682   0.0     
ref|XP_003542472.1|  PREDICTED: probable beta-D-xylosidase 7-like       681   0.0     
ref|XP_009379698.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    680   0.0     
gb|KFK42187.1|  hypothetical protein AALP_AA2G222800                    680   0.0     
ref|XP_002975008.1|  hypothetical protein SELMODRAFT_103038             678   0.0     
ref|XP_006383491.1|  hypothetical protein POPTR_0005s16650g             678   0.0     
ref|XP_010937520.1|  PREDICTED: uncharacterized protein LOC105056876    702   0.0     
ref|XP_009354080.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    677   0.0     
ref|XP_008808663.1|  PREDICTED: beta-D-xylosidase 1-like                677   0.0     
ref|XP_004976326.1|  PREDICTED: probable beta-D-xylosidase 6-like       669   0.0     
ref|XP_010937054.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    677   0.0     
ref|XP_003615008.1|  Xylan 1 4-beta-xylosidase                          677   0.0     
ref|XP_002977427.1|  hypothetical protein SELMODRAFT_106899             677   0.0     
ref|XP_009347830.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    677   0.0     
ref|XP_002515300.1|  Beta-glucosidase, putative                         676   0.0     Ricinus communis
ref|XP_002270249.1|  PREDICTED: probable beta-D-xylosidase 2 isof...    676   0.0     Vitis vinifera
ref|XP_009383731.1|  PREDICTED: probable beta-D-xylosidase 2            676   0.0     
gb|KHG05051.1|  putative beta-D-xylosidase 2 -like protein              676   0.0     
ref|XP_008371868.1|  PREDICTED: probable beta-D-xylosidase 7            676   0.0     
ref|XP_010024778.1|  PREDICTED: putative beta-D-xylosidase              676   0.0     
ref|XP_006300771.1|  hypothetical protein CARUB_v10019845mg             675   0.0     
gb|KDP27887.1|  hypothetical protein JCGZ_18967                         675   0.0     
ref|XP_009401393.1|  PREDICTED: beta-D-xylosidase 4-like                675   0.0     
ref|XP_008339210.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    675   0.0     
ref|XP_002316021.1|  beta-D-xylosidase family protein                   674   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_007042636.1|  Glycosyl hydrolase family protein                  677   0.0     
ref|XP_008784548.1|  PREDICTED: LOW QUALITY PROTEIN: beta-xylosid...    673   0.0     
ref|XP_002963750.1|  hypothetical protein SELMODRAFT_80102              673   0.0     
ref|XP_003592512.1|  Xylosidase                                         673   0.0     
ref|XP_002302284.2|  glycosyl hydrolase family 3 family protein         671   0.0     Populus trichocarpa [western balsam poplar]
gb|AES97964.2|  glycoside hydrolase family 3 amino-terminal domai...    673   0.0     
ref|XP_009373165.1|  PREDICTED: probable beta-D-xylosidase 7            672   0.0     
ref|XP_010094323.1|  Beta-D-xylosidase 1                                672   0.0     
ref|XP_002974833.1|  hypothetical protein SELMODRAFT_101733             672   0.0     
ref|XP_003638778.1|  Xylan 1 4-beta-xylosidase                          671   0.0     
ref|XP_006301942.1|  hypothetical protein CARUB_v10022420mg             671   0.0     
ref|XP_004494414.1|  PREDICTED: probable beta-D-xylosidase 2-like       671   0.0     
gb|EPS70883.1|  hypothetical protein M569_03875                         668   0.0     
ref|XP_010428909.1|  PREDICTED: probable beta-D-xylosidase 7 isof...    670   0.0     
ref|XP_010472005.1|  PREDICTED: probable beta-D-xylosidase 7            669   0.0     
gb|KDP28242.1|  hypothetical protein JCGZ_14013                         669   0.0     
ref|XP_010416771.1|  PREDICTED: probable beta-D-xylosidase 7            669   0.0     
ref|XP_003520749.2|  PREDICTED: probable beta-D-xylosidase 2-like       670   0.0     
ref|XP_003519750.1|  PREDICTED: probable beta-D-xylosidase 2-like       668   0.0     
ref|XP_009593976.1|  PREDICTED: probable beta-D-xylosidase 2            667   0.0     
ref|XP_004500608.1|  PREDICTED: probable beta-D-xylosidase 7-like       676   0.0     
ref|XP_003615019.1|  hypothetical protein MTR_5g062650                  668   0.0     
ref|XP_010268028.1|  PREDICTED: probable beta-D-xylosidase 2            667   0.0     
ref|XP_004504774.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    667   0.0     
ref|XP_003547598.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    667   0.0     
ref|XP_011079568.1|  PREDICTED: probable beta-D-xylosidase 2            667   0.0     
ref|XP_003531557.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    667   0.0     
gb|KHG10349.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           666   0.0     
ref|XP_010687471.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    666   0.0     
gb|KDP30704.1|  hypothetical protein JCGZ_16402                         665   0.0     
ref|XP_010111676.1|  putative beta-D-xylosidase 5                       666   0.0     
ref|XP_009348894.1|  PREDICTED: putative beta-D-xylosidase              665   0.0     
ref|NP_001233910.1|  beta-D-xylosidase 1 precursor                      665   0.0     
ref|XP_010030625.1|  PREDICTED: probable beta-D-xylosidase 5            666   0.0     
ref|XP_006444470.1|  hypothetical protein CICLE_v10018959mg             665   0.0     
ref|XP_004301992.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    665   0.0     
ref|XP_006341844.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    665   0.0     
ref|XP_002264183.2|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    664   0.0     Vitis vinifera
ref|XP_008390557.1|  PREDICTED: putative beta-D-xylosidase              664   0.0     
gb|AFU54452.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase           664   0.0     
gb|AAP83934.1|  auxin-induced beta-glucosidase                          664   0.0     Oxybasis rubra [pigweed]
ref|XP_007043027.1|  Beta-D-xylosidase 4                                664   0.0     
ref|XP_004300463.1|  PREDICTED: probable beta-D-xylosidase 2-like       664   0.0     
gb|EAY80685.1|  hypothetical protein OsI_35867                          664   0.0     Oryza sativa Indica Group [Indian rice]
gb|AFU54451.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase           664   0.0     
ref|XP_010236106.1|  PREDICTED: probable beta-D-xylosidase 7            664   0.0     
ref|XP_008223305.1|  PREDICTED: putative beta-D-xylosidase              663   0.0     
ref|XP_008341125.1|  PREDICTED: putative beta-D-xylosidase              663   0.0     
ref|XP_010546362.1|  PREDICTED: beta-D-xylosidase 4                     663   0.0     
ref|XP_010261102.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    663   0.0     
ref|XP_003535953.1|  PREDICTED: probable beta-D-xylosidase 2            662   0.0     
ref|XP_011009934.1|  PREDICTED: putative beta-D-xylosidase              662   0.0     
ref|XP_011100796.1|  PREDICTED: beta-D-xylosidase 1                     662   0.0     
ref|XP_007051080.1|  Beta-xylosidase 2                                  663   0.0     
ref|XP_010679361.1|  PREDICTED: probable beta-D-xylosidase 2            661   0.0     
gb|AAX92971.1|  beta-D-xylosidase                                       662   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_006354073.1|  PREDICTED: probable beta-D-xylosidase 7-like       661   0.0     
ref|XP_009369955.1|  PREDICTED: putative beta-D-xylosidase              661   0.0     
ref|XP_003591420.1|  Beta xylosidase                                    661   0.0     
ref|XP_002268626.2|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    661   0.0     Vitis vinifera
ref|XP_007138975.1|  hypothetical protein PHAVU_009G254300g             661   0.0     
ref|XP_009628814.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    661   0.0     
ref|XP_004238520.1|  PREDICTED: probable beta-D-xylosidase 7            660   0.0     
ref|XP_010259348.1|  PREDICTED: putative beta-D-xylosidase              660   0.0     
ref|XP_009403180.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    660   0.0     
ref|XP_011020382.1|  PREDICTED: putative beta-D-xylosidase              660   0.0     
ref|XP_009801214.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    660   0.0     
gb|KEH31243.1|  beta-xylosidase/alpha-L-arabinofuranosidase-like ...    660   0.0     
ref|XP_002519194.1|  Periplasmic beta-glucosidase precursor, puta...    660   0.0     Ricinus communis
ref|XP_007225668.1|  hypothetical protein PRUPE_ppa001718mg             660   0.0     
ref|NP_001067725.1|  Os11g0297300                                       660   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_008669758.1|  PREDICTED: probable beta-D-xylosidase 7            659   0.0     
ref|XP_009757165.1|  PREDICTED: probable beta-D-xylosidase 2            659   0.0     
ref|XP_004979939.1|  PREDICTED: probable beta-D-xylosidase 2-like       659   0.0     
ref|XP_003531047.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    658   0.0     
gb|KHG14371.1|  Beta-D-xylosidase 1 -like protein                       659   0.0     
emb|CBI40687.3|  unnamed protein product                                657   0.0     
ref|XP_003546334.1|  PREDICTED: beta-D-xylosidase 1-like                658   0.0     
ref|XP_004979181.1|  PREDICTED: probable beta-D-xylosidase 7-like       658   0.0     
gb|AAX96800.1|  Glycosyl hydrolase family 3 C terminal domain, pu...    660   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_009804070.1|  PREDICTED: beta-D-xylosidase 1 isoform X1          657   0.0     
ref|XP_004300692.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    658   0.0     
gb|EMT10284.1|  hypothetical protein F775_52126                         657   0.0     
ref|XP_002513707.1|  Beta-glucosidase, putative                         657   0.0     Ricinus communis
ref|XP_010243340.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    656   0.0     
ref|XP_006419427.1|  hypothetical protein CICLE_v10004369mg             657   0.0     
ref|XP_004979171.1|  PREDICTED: probable beta-D-xylosidase 7-like       656   0.0     
sp|A5JTQ3.1|XYL2_MEDSV  RecName: Full=Beta-xylosidase/alpha-L-ara...    656   0.0     Medicago sativa subsp. x varia
ref|XP_003594795.1|  Beta xylosidase                                    656   0.0     
ref|XP_003554544.1|  PREDICTED: probable beta-D-xylosidase 2-like       656   0.0     
ref|XP_004976989.1|  PREDICTED: beta-D-xylosidase 4-like isoform X2     656   0.0     
ref|XP_007163167.1|  hypothetical protein PHAVU_001G212100g             656   0.0     
ref|XP_009782576.1|  PREDICTED: probable beta-D-xylosidase 7 isof...    655   0.0     
gb|EPS65933.1|  hypothetical protein M569_08842                         655   0.0     
ref|XP_006423474.1|  hypothetical protein CICLE_v10027856mg             655   0.0     
gb|EAY80660.1|  hypothetical protein OsI_35838                          655   0.0     
ref|XP_002866623.1|  beta-xylosidase 4                                  655   0.0     
ref|XP_003625957.1|  Beta-xylosidase                                    655   0.0     
dbj|BAO45878.1|  beta-D-xylosidase                                      655   0.0     
ref|XP_010069867.1|  PREDICTED: probable beta-D-xylosidase 2            655   0.0     
gb|EYU23074.1|  hypothetical protein MIMGU_mgv1a019840mg                654   0.0     
ref|XP_011015574.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    655   0.0     
emb|CDX88410.1|  BnaC06g38540D                                          654   0.0     
ref|XP_009106451.1|  PREDICTED: probable beta-D-xylosidase 7            654   0.0     
ref|XP_007035744.1|  Periplasmic beta-glucosidase, putative             654   0.0     
ref|XP_008353169.1|  PREDICTED: putative beta-D-xylosidase              654   0.0     
ref|XP_011046123.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    654   0.0     
ref|XP_010087253.1|  putative beta-D-xylosidase 2                       654   0.0     
ref|XP_004485551.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    654   0.0     
ref|XP_010466113.1|  PREDICTED: probable beta-D-xylosidase 5            654   0.0     
sp|A5JTQ2.1|XYL1_MEDSV  RecName: Full=Beta-xylosidase/alpha-L-ara...    654   0.0     
gb|KDO49896.1|  hypothetical protein CISIN_1g003980mg                   654   0.0     
ref|NP_001067709.2|  Os11g0291000                                       653   0.0     
gb|KHG02719.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           653   0.0     
ref|XP_011030348.1|  PREDICTED: probable beta-D-xylosidase 5            654   0.0     
ref|XP_003593145.1|  Beta-xylosidase/alpha-L-arabinofuranosidase        653   0.0     
ref|XP_011012436.1|  PREDICTED: probable beta-D-xylosidase 5            653   0.0     
emb|CDX87482.1|  BnaA07g33910D                                          652   0.0     
ref|XP_009150540.1|  PREDICTED: beta-D-xylosidase 4                     653   0.0     
ref|XP_006487370.1|  PREDICTED: probable beta-D-xylosidase 5-like       652   0.0     
ref|XP_004487789.1|  PREDICTED: beta-D-xylosidase 1-like                652   0.0     
ref|XP_002298197.2|  beta-glucosidase family protein                    652   0.0     
emb|CDY51290.1|  BnaA06g23560D                                          652   0.0     
ref|XP_002448619.1|  hypothetical protein SORBIDRAFT_06g030270          651   0.0     
ref|NP_001280797.1|  putative beta-D-xylosidase precursor               651   0.0     
ref|XP_008384517.1|  PREDICTED: probable beta-D-xylosidase 5            651   0.0     
ref|NP_001266104.1|  SlArf/Xyl1 protein precursor                       650   0.0     
ref|XP_006418321.1|  hypothetical protein EUTSA_v10006876mg             650   0.0     
ref|XP_002311398.2|  beta-D-xylosidase family protein                   650   0.0     
dbj|BAE44362.1|  alpha-L-arabinofuranosidase                            650   0.0     
ref|XP_010687347.1|  PREDICTED: probable beta-D-xylosidase 5            650   0.0     
ref|XP_010507856.1|  PREDICTED: probable beta-D-xylosidase 5            650   0.0     
ref|XP_003567059.2|  PREDICTED: beta-D-xylosidase 1-like                649   0.0     
ref|XP_010065530.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    650   0.0     
ref|XP_003577440.1|  PREDICTED: probable beta-D-xylosidase 7            649   0.0     
ref|NP_188596.1|  putative beta-D-xylosidase 5                          649   0.0     
ref|XP_009145766.1|  PREDICTED: probable beta-D-xylosidase 5            649   0.0     
emb|CDY56487.1|  BnaCnng30450D                                          649   0.0     
gb|EMS60504.1|  putative beta-D-xylosidase 7                            651   0.0     
emb|CDX81229.1|  BnaC09g06400D                                          648   0.0     
ref|XP_006306829.1|  hypothetical protein CARUB_v10008371mg             648   0.0     
ref|NP_201262.1|  beta-D-xylosidase 4                                   648   0.0     
ref|XP_006605998.1|  PREDICTED: probable beta-D-xylosidase 5-like       648   0.0     
ref|NP_001266107.1|  SlArf/Xyl2 protein precursor                       647   0.0     
ref|XP_009112141.1|  PREDICTED: beta-D-xylosidase 4-like                647   0.0     
dbj|BAG28345.1|  arabinofuranosidase                                    647   0.0     
dbj|BAB02547.1|  beta-1,4-xylosidase                                    650   0.0     
emb|CDY18705.1|  BnaA09g06900D                                          647   0.0     
ref|XP_002264114.2|  PREDICTED: probable beta-D-xylosidase 5            647   0.0     
ref|XP_008661822.1|  PREDICTED: uncharacterized protein LOC100279...    647   0.0     
ref|XP_002987446.1|  hypothetical protein SELMODRAFT_426206             647   0.0     
ref|XP_011087838.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    646   0.0     
ref|XP_002276351.1|  PREDICTED: putative beta-D-xylosidase              646   0.0     
ref|XP_010491609.1|  PREDICTED: beta-D-xylosidase 4-like                646   0.0     
ref|XP_006827121.1|  hypothetical protein AMTR_s00010p00246460          646   0.0     
ref|XP_006349198.1|  PREDICTED: probable beta-D-xylosidase 2-like       646   0.0     
ref|XP_008455235.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    646   0.0     
ref|XP_004289805.1|  PREDICTED: probable beta-D-xylosidase 5-like       650   0.0     
ref|XP_002527511.1|  Beta-glucosidase, putative                         647   0.0     
ref|XP_007159080.1|  hypothetical protein PHAVU_002G206800g             645   0.0     
ref|XP_007200621.1|  hypothetical protein PRUPE_ppa001656mg             645   0.0     
emb|CDY31313.1|  BnaA02g34280D                                          645   0.0     
ref|XP_003533205.2|  PREDICTED: beta-D-xylosidase 1-like                646   0.0     
gb|KFK28148.1|  hypothetical protein AALP_AA8G478800                    645   0.0     
ref|XP_006488872.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...    646   0.0     
ref|XP_004162442.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    644   0.0     
ref|XP_010484241.1|  PREDICTED: beta-D-xylosidase 4                     645   0.0     
ref|XP_010065527.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    645   0.0     
ref|XP_007148433.1|  hypothetical protein PHAVU_006G208200g             644   0.0     
ref|XP_004136155.1|  PREDICTED: probable beta-D-xylosidase 2-like       644   0.0     
gb|EYU35409.1|  hypothetical protein MIMGU_mgv1a001738mg                644   0.0     
ref|XP_004136861.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    644   0.0     
gb|KHN12900.1|  Beta-D-xylosidase 1                                     644   0.0     
ref|XP_009603126.1|  PREDICTED: probable beta-D-xylosidase 5            644   0.0     
ref|XP_007200259.1|  hypothetical protein PRUPE_ppa015037mg             644   0.0     
gb|AAS17751.2|  beta xylosidase                                         643   0.0     
ref|XP_006830079.1|  hypothetical protein AMTR_s00125p00113140          644   0.0     
ref|XP_010444394.1|  PREDICTED: beta-D-xylosidase 4-like                643   0.0     
ref|XP_006280038.1|  hypothetical protein CARUB_v10025915mg             643   0.0     
ref|XP_006352077.1|  PREDICTED: beta-D-xylosidase 1-like                643   0.0     
ref|NP_001145980.1|  putative O-Glycosyl hydrolase superfamily pr...    644   0.0     
ref|XP_008454298.1|  PREDICTED: probable beta-D-xylosidase 2 isof...    642   0.0     
ref|XP_004155509.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    644   0.0     
ref|XP_002980053.1|  hypothetical protein SELMODRAFT_112087             642   0.0     
dbj|BAF79669.1|  beta-D-xylosidase                                      642   0.0     
gb|KDP44489.1|  hypothetical protein JCGZ_16322                         643   0.0     
emb|CDO97479.1|  unnamed protein product                                639   0.0     
ref|XP_009390582.1|  PREDICTED: probable beta-D-xylosidase 7            638   0.0     
ref|XP_010461983.1|  PREDICTED: beta-D-xylosidase 4-like                642   0.0     
emb|CDY15255.1|  BnaC05g01340D                                          641   0.0     
ref|XP_008236322.1|  PREDICTED: probable beta-D-xylosidase 5            646   0.0     
gb|KFK42620.1|  hypothetical protein AALP_AA1G019000                    641   0.0     
ref|NP_001054038.1|  Os04g0640700                                       641   0.0     
ref|XP_008451490.1|  PREDICTED: probable beta-D-xylosidase 2            640   0.0     
ref|XP_002987447.1|  hypothetical protein SELMODRAFT_426207             641   0.0     
ref|XP_008235191.1|  PREDICTED: probable beta-D-xylosidase 2            641   0.0     
gb|AGR44452.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase 2         640   0.0     
ref|XP_002980054.1|  hypothetical protein SELMODRAFT_419541             641   0.0     
ref|XP_004295104.1|  PREDICTED: beta-D-xylosidase 1-like                640   0.0     
ref|XP_010457247.1|  PREDICTED: probable beta-D-xylosidase 2            640   0.0     
ref|XP_009130462.1|  PREDICTED: beta-D-xylosidase 4-like                640   0.0     
ref|NP_563659.1|  probable beta-D-xylosidase 2                          640   0.0     
gb|EYU18507.1|  hypothetical protein MIMGU_mgv1a001685mg                640   0.0     
ref|XP_010065531.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    640   0.0     
dbj|BAQ19511.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase          640   0.0     
gb|AAG10624.1|AC022521_2  Similar to xylosidase                         639   0.0     
emb|CAN82161.1|  hypothetical protein VITISV_035506                     645   0.0     
emb|CDX89954.1|  BnaA10g01280D                                          639   0.0     
ref|XP_010671663.1|  PREDICTED: beta-D-xylosidase 1                     639   0.0     
ref|XP_006369735.1|  glycosyl hydrolase family 3 family protein         639   0.0     
ref|XP_002889410.1|  hypothetical protein ARALYDRAFT_470222             639   0.0     
emb|CDY35825.1|  BnaC09g37570D                                          639   0.0     
gb|EPS60429.1|  hypothetical protein M569_14372                         639   0.0     
ref|XP_011087839.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    639   0.0     
dbj|BAD98523.1|  alpha-L-arabinofuranosidase / beta-D-xylosidase        639   0.0     
ref|XP_010424711.1|  PREDICTED: beta-D-xylosidase 4-like                639   0.0     
ref|XP_009119616.1|  PREDICTED: probable beta-D-xylosidase 2            638   0.0     
ref|XP_009122535.1|  PREDICTED: beta-D-xylosidase 3-like                638   0.0     
ref|XP_007225245.1|  hypothetical protein PRUPE_ppa001692mg             638   0.0     
ref|XP_009779847.1|  PREDICTED: probable beta-D-xylosidase 5            638   0.0     
ref|XP_008218886.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    637   0.0     
emb|CDX69892.1|  BnaA10g22410D                                          637   0.0     
ref|XP_010481135.1|  PREDICTED: probable beta-D-xylosidase 2            636   0.0     
gb|AAX92967.1|  beta-xylosidase, putative                               636   0.0     
ref|XP_011082425.1|  PREDICTED: probable beta-D-xylosidase 2            635   0.0     
ref|XP_010522822.1|  PREDICTED: probable beta-D-xylosidase 2            634   0.0     
emb|CDY46812.1|  BnaC02g43200D                                          635   0.0     
ref|XP_010068200.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    634   0.0     
gb|KFK25272.1|  hypothetical protein AALP_AA8G090500                    634   0.0     
ref|XP_004156823.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    634   0.0     
ref|XP_010546993.1|  PREDICTED: beta-D-xylosidase 1-like isoform X1     634   0.0     
ref|XP_004152230.1|  PREDICTED: probable beta-D-xylosidase 2-like       634   0.0     
ref|XP_006493288.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    633   0.0     
ref|XP_006351808.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    633   0.0     
ref|XP_009105246.1|  PREDICTED: beta-D-xylosidase 3-like                633   0.0     
gb|EYU18509.1|  hypothetical protein MIMGU_mgv1a001665mg                633   0.0     
gb|EYU18508.1|  hypothetical protein MIMGU_mgv1a001685mg                632   0.0     
ref|XP_007145157.1|  hypothetical protein PHAVU_007G215100g             632   0.0     
ref|XP_006399455.1|  hypothetical protein EUTSA_v10012739mg             632   0.0     
ref|XP_002320310.2|  hypothetical protein POPTR_0014s11730g             631   0.0     
emb|CDY01780.1|  BnaC06g28200D                                          631   0.0     
gb|KHN08645.1|  Putative beta-D-xylosidase 2                            630   0.0     
ref|XP_006298950.1|  hypothetical protein CARUB_v10015075mg             631   0.0     
ref|XP_002303181.1|  beta-glucosidase family protein                    631   0.0     
ref|XP_010103839.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2      631   0.0     
ref|XP_004151112.1|  PREDICTED: beta-D-xylosidase 1-like                630   0.0     
ref|XP_001784462.1|  predicted protein                                  629   0.0     
emb|CDY58860.1|  BnaCnng33860D                                          630   0.0     
emb|CBI22460.3|  unnamed protein product                                634   0.0     
emb|CDY33913.1|  BnaA02g30740D                                          630   0.0     
ref|XP_006432467.1|  hypothetical protein CICLE_v10000355mg             629   0.0     
ref|XP_009762535.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    629   0.0     
ref|XP_009378701.1|  PREDICTED: probable beta-D-xylosidase 2            630   0.0     
ref|XP_003580652.1|  PREDICTED: beta-D-xylosidase 4-like                629   0.0     
ref|XP_011004967.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    629   0.0     
ref|XP_008458374.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...    628   0.0     
ref|XP_009129779.1|  PREDICTED: beta-D-xylosidase 1-like                628   0.0     
ref|XP_010065529.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    629   0.0     
ref|XP_004230547.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    628   0.0     
emb|CDO98788.1|  unnamed protein product                                628   0.0     
ref|NP_196535.1|  beta-xylosidase 3                                     628   0.0     
ref|XP_010440503.1|  PREDICTED: beta-D-xylosidase 1                     627   0.0     
ref|XP_009339788.1|  PREDICTED: probable beta-D-xylosidase 2            627   0.0     
ref|XP_002489304.1|  hypothetical protein SORBIDRAFT_0010s007570        625   0.0     
ref|XP_009612011.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    627   0.0     
ref|XP_010482214.1|  PREDICTED: beta-D-xylosidase 1-like                626   0.0     
gb|EEE51984.1|  hypothetical protein OsJ_33664                          624   0.0     
ref|NP_199747.1|  bifunctional {beta}-D-xylosidase/{alpha}-L-arab...    625   0.0     
ref|XP_002885319.1|  beta-1,4-xylosidase                                628   0.0     
ref|XP_011092407.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    624   0.0     
dbj|BAJ90420.1|  predicted protein                                      624   0.0     
gb|KFK26586.1|  hypothetical protein AALP_AA8G267600                    623   0.0     
ref|XP_006653810.1|  PREDICTED: beta-D-xylosidase 4-like                623   0.0     
ref|XP_006280043.1|  hypothetical protein CARUB_v10025920mg             623   0.0     
dbj|BAJ90315.1|  predicted protein                                      623   0.0     
ref|XP_002865732.1|  beta-xylosidase 1                                  623   0.0     
ref|XP_006394136.1|  hypothetical protein EUTSA_v10003678mg             622   0.0     
emb|CBI22910.3|  unnamed protein product                                620   0.0     
ref|XP_006395069.1|  hypothetical protein EUTSA_v10003681mg             621   0.0     
gb|AAK38481.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase iso...    621   0.0     
emb|CDY05634.1|  BnaC02g39030D                                          620   0.0     
ref|XP_009151303.1|  PREDICTED: beta-D-xylosidase 1                     620   0.0     
gb|KCW68842.1|  hypothetical protein EUGRSUZ_F02442                     617   0.0     
emb|CDX85405.1|  BnaC07g27160D                                          618   0.0     
ref|XP_008386729.1|  PREDICTED: probable beta-D-xylosidase 2            618   0.0     
ref|XP_006663370.1|  PREDICTED: probable beta-D-xylosidase 7-like       613   0.0     
gb|EYU17588.1|  hypothetical protein MIMGU_mgv1a002957mg                611   0.0     
ref|XP_009111875.1|  PREDICTED: beta-D-xylosidase 1-like                617   0.0     
emb|CDO97277.1|  unnamed protein product                                617   0.0     
ref|XP_002489311.1|  hypothetical protein SORBIDRAFT_0010s012040        617   0.0     
ref|XP_010556264.1|  PREDICTED: beta-D-xylosidase 1-like                615   0.0     
gb|EYU46800.1|  hypothetical protein MIMGU_mgv1a018473mg                615   0.0     
ref|XP_002451244.1|  hypothetical protein SORBIDRAFT_05g026400          615   0.0     
gb|KCW68841.1|  hypothetical protein EUGRSUZ_F02441                     609   0.0     
ref|XP_008679504.1|  PREDICTED: probable beta-D-xylosidase 7            616   0.0     
ref|XP_010520456.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...    613   0.0     
ref|XP_004979182.1|  PREDICTED: probable beta-D-xylosidase 7-like       613   0.0     
emb|CDY21595.1|  BnaC09g46970D                                          617   0.0     
gb|KDO78122.1|  hypothetical protein CISIN_1g040836mg                   610   0.0     
ref|XP_003615006.1|  Xylan 1 4-beta-xylosidase                          607   0.0     
ref|XP_002873418.1|  beta-xylosidase 3                                  610   0.0     
ref|XP_010452969.1|  PREDICTED: beta-D-xylosidase 3-like                610   0.0     
ref|XP_006449655.1|  hypothetical protein CICLE_v10014315mg             611   0.0     
ref|XP_006468193.1|  PREDICTED: probable beta-D-xylosidase 5-like       610   0.0     
emb|CDY49607.1|  BnaA09g03310D                                          610   0.0     
gb|AFW65098.1|  putative O-Glycosyl hydrolase superfamily protein       611   0.0     
emb|CDY00033.1|  BnaC09g02680D                                          608   0.0     
ref|XP_010422950.1|  PREDICTED: beta-D-xylosidase 3 isoform X1          609   0.0     
dbj|BAK01582.1|  predicted protein                                      606   0.0     
gb|ACD93208.1|  beta xylosidase                                         606   0.0     
ref|XP_010531790.1|  PREDICTED: probable beta-D-xylosidase 7            600   0.0     
gb|KCW61272.1|  hypothetical protein EUGRSUZ_H04033                     603   0.0     



>ref|XP_011099456.1| PREDICTED: probable beta-D-xylosidase 6 [Sesamum indicum]
Length=799

 Score =  1012 bits (2616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/756 (67%), Positives = 620/756 (82%), Gaps = 7/756 (1%)
 Frame = -3

Query  2493  SKPQL--PCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             S PQL  PC+PP HSSYPFC++SLP   R  SLVS LT++EKIQ+LS+N SAIPRLGIP 
Sbjct  31    SGPQLQYPCRPPHHSSYPFCNSSLPAKTRALSLVSFLTLEEKIQQLSNNASAIPRLGIPP  90

Query  2319  YEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMF  2140
             YEWWSESLHGIA+NGPG++F+G VK+AT FPQVILTAAAFNR+LW ++A+A AVEA+AM 
Sbjct  91    YEWWSESLHGIASNGPGVSFNGTVKAATSFPQVILTAAAFNRSLWAAVASAIAVEAKAMH  150

Query  2139  NSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngR--  1966
             + GQAGLTFWAPN+N+F DPRWGRGQETPGEDPMV S YA+EYVR  QGQ  +    R  
Sbjct  151   SVGQAGLTFWAPNINIFRDPRWGRGQETPGEDPMVASAYAIEYVRAFQGQYYRSAARRDR  210

Query  1965  -KYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEP  1789
              KY L    + ++ + DDRLMLSACCKH TAYDLE W  F+RY+FNAVVT QDM DTY+ 
Sbjct  211   YKYGLQRRVLRDDNDADDRLMLSACCKHFTAYDLEKWGQFTRYNFNAVVTDQDMADTYQA  270

Query  1788  PFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQ  1609
             PF+SC+++G ASCLMC+YNAVNG+PACAN +LL+K RTDW F GYITSDCDAVATI+E Q
Sbjct  271   PFRSCIQQGNASCLMCSYNAVNGVPACANHNLLQKVRTDWNFRGYITSDCDAVATIYEDQ  330

Query  1608  QYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGL  1429
             +Y K+PE+A   ALKAGTDINCGTYMLR+M SA+E   V E DIDRALLNLF+VQ RLGL
Sbjct  331   KYTKTPEDAVAAALKAGTDINCGTYMLRHMMSAIEKGKVSEEDIDRALLNLFTVQIRLGL  390

Query  1428  FNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGP  1249
             F+G++   +F   GP+DVC+SE+R+LALEAARQGIVLLKNEQ FLPLD   +SSLAVIGP
Sbjct  391   FDGESTRNQFRDLGPEDVCTSENRKLALEAARQGIVLLKNEQNFLPLDVHAISSLAVIGP  450

Query  1248  MANTSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             +AN+++LGG YTG+PC  +S+L+GL EY++   +A+GC D+ CNST  FAEA+S+AKRA+
Sbjct  451   LANSTNLGGGYTGVPCNPRSILEGLQEYVNNIHHAAGCPDIPCNSTTDFAEALSVAKRAE  510

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
             YVI+V GLDLSQETEDHDRYSLLLPGHQMALV  +A VS KPL+LVLTGGGP+D+SFA  
Sbjct  511   YVIIVAGLDLSQETEDHDRYSLLLPGHQMALVTAVAAVSRKPLILVLTGGGPIDVSFAVG  570

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSR  709
             DP I S+LWIGYPGE GGKALS+I+FG YNP GRLP+TWYPESFT VPM+DMNMRADPSR
Sbjct  571   DPHIGSILWIGYPGETGGKALSDIIFGHYNPGGRLPMTWYPESFTSVPMSDMNMRADPSR  630

Query  708   GYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNE-  532
              YPGRTYRFY GE++Y FG+GLSY+SF+  LLSAPT++SL +SI  K   S+L + GN+ 
Sbjct  631   NYPGRTYRFYVGERIYGFGYGLSYTSFTYTLLSAPTKLSLRESIDAKRWSSMLYQRGNKL  690

Query  531   PYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVH  352
              YVHVDE+  C+SL F +++S+ NNG +DGS VV+LFS+A +    G+P++QLIGF+R+H
Sbjct  691   EYVHVDELPYCSSLRFQLKMSITNNGDIDGSEVVLLFSKA-SKILNGSPERQLIGFERIH  749

Query  351   VSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             V  +   ETS  ++PC+HLS  + +G++ILP GDHI
Sbjct  750   VLLHETAETSFEVDPCEHLSFADEQGNKILPTGDHI  785



>ref|XP_009612183.1| PREDICTED: probable beta-D-xylosidase 6 [Nicotiana tomentosiformis]
Length=791

 Score =  1010 bits (2611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/750 (68%), Positives = 613/750 (82%), Gaps = 6/750 (1%)
 Frame = -3

Query  2487  PQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWW  2308
             PQ PCQPP H  YPFC+ +LPI  R+ SL+SLLT+DEKI  LSDN ++IPRLG+PAYEWW
Sbjct  30    PQFPCQPP-HHKYPFCNKNLPISTRVQSLISLLTIDEKILHLSDNTTSIPRLGLPAYEWW  88

Query  2307  SESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQ  2128
             SESLHGIATNGPG+ F+G +K AT FPQVILTAAAFNRTLW SIA A AVEARAM+N G 
Sbjct  89    SESLHGIATNGPGVNFNGPIKGATSFPQVILTAAAFNRTLWHSIATAIAVEARAMYNLGH  148

Query  2127  AGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSG  1948
             AGLTFWAPN+N+F DPRWGRGQETPGEDPMVVS YA+EYV G QG   K K G +     
Sbjct  149   AGLTFWAPNINIFRDPRWGRGQETPGEDPMVVSAYAIEYVTGFQGLNPKAKTGNRNGFGK  208

Query  1947  NR--MPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSC  1774
              R  + E++ D +RLMLSACCKH TAYDLE W N +RY+FNAVVT+QDMEDT++ PF+SC
Sbjct  209   KRRFLKEDDNDGERLMLSACCKHFTAYDLEKWGNATRYNFNAVVTKQDMEDTFQAPFRSC  268

Query  1773  VEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKS  1594
             +++G+ASCLMC YN+VNG+PACA+K+LL+K RTDWGF+GYITSDCDAVATI+E Q+Y K+
Sbjct  269   IQQGKASCLMCTYNSVNGVPACADKELLDKVRTDWGFDGYITSDCDAVATIYENQKYTKT  328

Query  1593  PEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKA  1414
             PE+A  +ALKAGT+INCGTYMLR+MKSA +   V+E D+DRAL  LFSVQFRLGLF+G  
Sbjct  329   PEDAVAVALKAGTNINCGTYMLRHMKSAFQQGSVLEEDLDRALQYLFSVQFRLGLFDGNP  388

Query  1413  VNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTS  1234
              + +F +FG +DVC+S H  LAL+AARQGIVLLKN+QKFLPLDKT VS+LA++GPMAN S
Sbjct  389   ADGQFANFGAQDVCTSNHLNLALDAARQGIVLLKNDQKFLPLDKTSVSTLAIVGPMANVS  448

Query  1233  SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVV  1054
             S GG Y+G+PC LKS+ +G   +I++T YA+GCLDV CNST GF +A+SI K ADYVIVV
Sbjct  449   SPGGTYSGVPCKLKSIREGFHRHINRTLYAAGCLDVGCNSTAGFQDAISIVKEADYVIVV  508

Query  1053  VGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIA  874
              GLDLS+ETEDHDRYSLLLPG Q  LV  LA  S KP++LVLTGGGP+D+SFA+KDPRIA
Sbjct  509   AGLDLSEETEDHDRYSLLLPGQQTNLVTTLAAASKKPIILVLTGGGPVDVSFAEKDPRIA  568

Query  873   SVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGR  694
             S+LW+ YPGE GGKALSEI+FG  NP G+LP+TWY ESFTKVPM DMNMRADPS GYPGR
Sbjct  569   SILWVAYPGETGGKALSEIIFGYQNPGGKLPMTWYLESFTKVPMTDMNMRADPSNGYPGR  628

Query  693   TYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNE-PYVHV  517
             TYRFYTG+ +Y FGHGLSY+SFS +LLSAP+R+SLS + K+  +RSIL +G +   Y+HV
Sbjct  629   TYRFYTGDVLYGFGHGLSYTSFSSQLLSAPSRLSLSLA-KSNRKRSILAKGRSRLGYIHV  687

Query  516   DEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNG  337
             DEV +C+S  F V +S+ N+G MDGS V+MLFSR   ++  GAPQKQL+GFDRVHV    
Sbjct  688   DEVESCHSSKFFVHISVTNDGDMDGSHVLMLFSRVLQNFQ-GAPQKQLVGFDRVHVPARK  746

Query  336   VTETSISIEPCQHLSIVNVEGSRILPLGDH  247
               ETS+ ++PC+ LS  N +G+RIL LG+H
Sbjct  747   SVETSLLVDPCELLSFANDQGNRILALGEH  776



>emb|CDP02677.1| unnamed protein product [Coffea canephora]
Length=784

 Score =   997 bits (2578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/760 (67%), Positives = 611/760 (80%), Gaps = 21/760 (3%)
 Frame = -3

Query  2499  SYSKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             S S+ Q PC+PP +  Y FCDTSLPI  R  SL+SLLT+DEKIQ+LSDN + I RLGIPA
Sbjct  22    SCSQLQYPCKPP-YDKYQFCDTSLPIKTRAKSLISLLTLDEKIQQLSDNATQISRLGIPA  80

Query  2319  YEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMF  2140
             YEWWSESLHGIATNGPGI+F+G ++SATGFPQVILTAAAFNRTLWR IA A AVEARAM+
Sbjct  81    YEWWSESLHGIATNGPGISFNGTIQSATGFPQVILTAAAFNRTLWREIAKAVAVEARAMY  140

Query  2139  NSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKY  1960
             N GQAGLTF+APN+N+F DPRWGRGQETPGEDPMV S YA+EYV G QGQ          
Sbjct  141   NLGQAGLTFFAPNINIFRDPRWGRGQETPGEDPMVTSAYAIEYVTGFQGQ----------  190

Query  1959  SLSGNRMPEEE-----EDDDR---LMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDME  1804
             +  G++ P  E     +DD R   LMLSACCKH TAYDLE W   +RY F+A VT+QDME
Sbjct  191   NQRGSKHPYRERRFLNDDDQRSGSLMLSACCKHYTAYDLEKWGGHTRYDFDAKVTKQDME  250

Query  1803  DTYEPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVAT  1624
             DTY+PPFKSC+ +GRASCLMC+YN VNGIPACA++DLL KAR DWGF+GYITSDCDAVAT
Sbjct  251   DTYQPPFKSCIVQGRASCLMCSYNRVNGIPACADRDLLHKARNDWGFKGYITSDCDAVAT  310

Query  1623  IFEYQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQ  1444
             IFE   + K+ EEA  +ALKAGTDINCGTYMLR+MKSA++   V+E DIDRAL NLFSV 
Sbjct  311   IFENNNFTKTKEEAVAVALKAGTDINCGTYMLRHMKSAIDQGKVLEEDIDRALFNLFSVL  370

Query  1443  FRLGLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSL  1264
              +LGLF+G    R+F + G ++VCSSEH+ LALEAA QGIVLLKN QKFLP +K  +SS+
Sbjct  371   LQLGLFDGNPARRQFGNLGSQNVCSSEHKTLALEAAMQGIVLLKNNQKFLPWNKNDISSV  430

Query  1263  AVIGPMANTSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSI  1084
             A+IGPMANT ++GGDYTG  C  +S+L GL  Y+  T YA+GC DV CNST G  EA+SI
Sbjct  431   AIIGPMANTMNIGGDYTGFSCNPESILQGLKNYVEDTFYAAGCQDVPCNSTAGIPEALSI  490

Query  1083  AKRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDI  904
             AK A+YVIVV GLDLSQETED DRYSLLLPGHQMAL+  +A VS KP+VLVLTGGGP+D+
Sbjct  491   AKEAEYVIVVTGLDLSQETEDLDRYSLLLPGHQMALIRAVASVSKKPVVLVLTGGGPVDV  550

Query  903   SFAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMR  724
             SFA+ D +IAS++WIGYPGE GGKALS+I+FG+YNP GRLP+TWYPESFT +PM DM+MR
Sbjct  551   SFAEGDQQIASIIWIGYPGETGGKALSQILFGEYNPGGRLPMTWYPESFTSIPMTDMSMR  610

Query  723   ADPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNR  544
             ADPSRGYPGRTYRFYTGE+VY FGHGLSY++F+ ++LSAP R+SLS  +K K RR I   
Sbjct  611   ADPSRGYPGRTYRFYTGERVYGFGHGLSYTNFNYKILSAPARLSLSGQVKGKSRRYIRQG  670

Query  543   GGNE-PYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIG  367
             GGN   YV VD+V+ C+SL F V++S+ N+G +DGS+VV+LFS+ P S+  GAP++Q +G
Sbjct  671   GGNGLDYVLVDDVAYCDSLRFHVQISIINHGDIDGSQVVLLFSQVPKSFT-GAPERQTVG  729

Query  366   FDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             FDRVH       ETSI ++PC+HLSIVN +GS+ILPLGDH
Sbjct  730   FDRVHALAYRSVETSILVDPCEHLSIVNEQGSKILPLGDH  769



>ref|XP_002264031.2| PREDICTED: probable beta-D-xylosidase 6 [Vitis vinifera]
Length=795

 Score =   997 bits (2577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/750 (67%), Positives = 604/750 (81%), Gaps = 2/750 (0%)
 Frame = -3

Query  2493  SKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             + PQ PC PPT+S YPFC+TSLPI  R  SLVSLLT+ EKIQ+LSD  +AIPRL IPAYE
Sbjct  32    THPQFPCMPPTNSDYPFCNTSLPISTRAQSLVSLLTLSEKIQQLSDEAAAIPRLYIPAYE  91

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSESLHGIATNGPG++F+G V +AT FPQV+LTAA+FNR+LW SI +A AVEARAM+N 
Sbjct  92    WWSESLHGIATNGPGVSFNGTVSAATSFPQVLLTAASFNRSLWFSIGSAIAVEARAMYNV  151

Query  2133  GQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSL  1954
             GQAGLTFWAPN+N+F DPRWGRGQETPGEDPMV S YAVE+VRG QG   KG +  + ++
Sbjct  152   GQAGLTFWAPNINIFRDPRWGRGQETPGEDPMVASAYAVEFVRGFQGGNWKGGDEIRGAV  211

Query  1953  SGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSC  1774
                R+   + D D LMLSACCKHLTAYDLE W NFSRYSF+AVV+ QD+EDTY+PPF+SC
Sbjct  212   GKKRVLRGDSDGDGLMLSACCKHLTAYDLEKWGNFSRYSFDAVVSNQDLEDTYQPPFRSC  271

Query  1773  VEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKS  1594
             V++G+ASCLMC+YN VNG+PACA +DL +KA+T+WGF+GYITSDCDAVAT++EYQ YA S
Sbjct  272   VQQGKASCLMCSYNRVNGVPACARQDLFQKAKTEWGFKGYITSDCDAVATVYEYQHYANS  331

Query  1593  PEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKA  1414
             PE+A    LKAGTDINCG+YMLR+ +SA++   V E DIDRAL NLFSVQ RLGLF+G  
Sbjct  332   PEDAVADVLKAGTDINCGSYMLRHTQSAIDQGKVKEEDIDRALFNLFSVQMRLGLFDGDP  391

Query  1413  VNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTS  1234
              N  + + GPKDVC+ EHR LALEAARQGIVLLKN++KFLPLDK+R+SSLA+IGP A+  
Sbjct  392   ANGLYGNLGPKDVCTKEHRTLALEAARQGIVLLKNDKKFLPLDKSRISSLAIIGPQADQP  451

Query  1233  SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVV  1054
              LGG YTGIPC  +S+++GL  Y+ KTS+A+GC+DV C S  GF EAVSIA++AD V+VV
Sbjct  452   FLGGGYTGIPCKPESLVEGLKTYVEKTSFAAGCVDVPCLSDTGFDEAVSIARKADIVVVV  511

Query  1053  VGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIA  874
              GLDLSQETEDHDR SLLLPG QMAL++ +A    KPLVLVLTGGGPLD+SFA++DPRIA
Sbjct  512   AGLDLSQETEDHDRVSLLLPGKQMALISSVASAIQKPLVLVLTGGGPLDVSFAEQDPRIA  571

Query  873   SVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGR  694
             S+LWIGYPGE G KAL+EI+FGD+NP GRLP+TWYPESFT+VPMNDMNMRADP RGYPGR
Sbjct  572   SILWIGYPGEAGAKALAEIIFGDFNPGGRLPMTWYPESFTRVPMNDMNMRADPYRGYPGR  631

Query  693   TYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNE-PYVHV  517
             TYRFY G +VY FG GLSY+ F+ + +SAP +++L +S  T   +++  +   E  Y H+
Sbjct  632   TYRFYIGHRVYGFGQGLSYTKFAYQFVSAPNKLNLLRSSDTVSSKNLPRQRREEVNYFHI  691

Query  516   DEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNG  337
             +E+  C+SL F V +S+ N G MDGS VVMLFSR P     G P+KQLIGF RVH     
Sbjct  692   EELDTCDSLRFHVEISVTNVGDMDGSHVVMLFSRVP-KIVKGTPEKQLIGFSRVHTVSRR  750

Query  336   VTETSISIEPCQHLSIVNVEGSRILPLGDH  247
              TETSI ++PC+H SI N +G RI+PLGDH
Sbjct  751   STETSIMVDPCEHFSIANEQGKRIMPLGDH  780



>emb|CBI25718.3| unnamed protein product [Vitis vinifera]
Length=768

 Score =   991 bits (2561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/750 (66%), Positives = 594/750 (79%), Gaps = 23/750 (3%)
 Frame = -3

Query  2493  SKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             + PQ PC PPT+S YPFC+TSLPI  R  SLVSLLT+ EKIQ+LSD  +AIPRL IPAYE
Sbjct  26    THPQFPCMPPTNSDYPFCNTSLPISTRAQSLVSLLTLSEKIQQLSDEAAAIPRLYIPAYE  85

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSESLHGIATNGPG++F+G V +AT FPQV+LTAA+FNR+LW SI +A AVEARAM+N 
Sbjct  86    WWSESLHGIATNGPGVSFNGTVSAATSFPQVLLTAASFNRSLWFSIGSAIAVEARAMYNV  145

Query  2133  GQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSL  1954
             GQAGLTFWAPN+N+F DPRWGRGQETPGEDPMV S YAVE+V                  
Sbjct  146   GQAGLTFWAPNINIFRDPRWGRGQETPGEDPMVASAYAVEFV------------------  187

Query  1953  SGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSC  1774
                R  + + D D LMLSACCKHLTAYDLE W NFSRYSF+AVV+ QD+EDTY+PPF+SC
Sbjct  188   ---RGFQGDSDGDGLMLSACCKHLTAYDLEKWGNFSRYSFDAVVSNQDLEDTYQPPFRSC  244

Query  1773  VEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKS  1594
             V++G+ASCLMC+YN VNG+PACA +DL +KA+T+WGF+GYITSDCDAVAT++EYQ YA S
Sbjct  245   VQQGKASCLMCSYNRVNGVPACARQDLFQKAKTEWGFKGYITSDCDAVATVYEYQHYANS  304

Query  1593  PEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKA  1414
             PE+A    LKAGTDINCG+YMLR+ +SA++   V E DIDRAL NLFSVQ RLGLF+G  
Sbjct  305   PEDAVADVLKAGTDINCGSYMLRHTQSAIDQGKVKEEDIDRALFNLFSVQMRLGLFDGDP  364

Query  1413  VNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTS  1234
              N  + + GPKDVC+ EHR LALEAARQGIVLLKN++KFLPLDK+R+SSLA+IGP A+  
Sbjct  365   ANGLYGNLGPKDVCTKEHRTLALEAARQGIVLLKNDKKFLPLDKSRISSLAIIGPQADQP  424

Query  1233  SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVV  1054
              LGG YTGIPC  +S+++GL  Y+ KTS+A+GC+DV C S  GF EAVSIA++AD V+VV
Sbjct  425   FLGGGYTGIPCKPESLVEGLKTYVEKTSFAAGCVDVPCLSDTGFDEAVSIARKADIVVVV  484

Query  1053  VGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIA  874
              GLDLSQETEDHDR SLLLPG QMAL++ +A    KPLVLVLTGGGPLD+SFA++DPRIA
Sbjct  485   AGLDLSQETEDHDRVSLLLPGKQMALISSVASAIQKPLVLVLTGGGPLDVSFAEQDPRIA  544

Query  873   SVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGR  694
             S+LWIGYPGE G KAL+EI+FGD+NP GRLP+TWYPESFT+VPMNDMNMRADP RGYPGR
Sbjct  545   SILWIGYPGEAGAKALAEIIFGDFNPGGRLPMTWYPESFTRVPMNDMNMRADPYRGYPGR  604

Query  693   TYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNE-PYVHV  517
             TYRFY G +VY FG GLSY+ F+ + +SAP +++L +S  T   +++  +   E  Y H+
Sbjct  605   TYRFYIGHRVYGFGQGLSYTKFAYQFVSAPNKLNLLRSSDTVSSKNLPRQRREEVNYFHI  664

Query  516   DEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNG  337
             +E+  C+SL F V +S+ N G MDGS VVMLFSR P     G P+KQLIGF RVH     
Sbjct  665   EELDTCDSLRFHVEISVTNVGDMDGSHVVMLFSRVP-KIVKGTPEKQLIGFSRVHTVSRR  723

Query  336   VTETSISIEPCQHLSIVNVEGSRILPLGDH  247
              TETSI ++PC+H SI N +G RI+PLGDH
Sbjct  724   STETSIMVDPCEHFSIANEQGKRIMPLGDH  753



>gb|KDP32160.1| hypothetical protein JCGZ_12621 [Jatropha curcas]
Length=794

 Score =   990 bits (2559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/761 (67%), Positives = 610/761 (80%), Gaps = 8/761 (1%)
 Frame = -3

Query  2505  ATSYSK-PQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLG  2329
             +TS S+ P+ PCQPP ++SY FC+ SL I  R  SL+SLLT+ EKI +LSDN S IPRLG
Sbjct  20    STSISEIPKFPCQPPRYNSYTFCNQSLSITTRAQSLISLLTLQEKIFQLSDNASGIPRLG  79

Query  2328  IPAYEWWSESLHGIATNGPGITF-DGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavea  2152
             IP YEWWSESLHGIA NGPG++F +G V +ATGFPQVI+TAAAFNRTLW  I +A A+EA
Sbjct  80    IPPYEWWSESLHGIAINGPGVSFSNGPVSAATGFPQVIVTAAAFNRTLWFLIGSAIAIEA  139

Query  2151  rAMFNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgq--glkg  1978
             RAM+N GQAGLT+WAPN+NVF DPRWGRGQETPGEDPMV S YA+E+V+G QG      G
Sbjct  140   RAMYNVGQAGLTYWAPNINVFRDPRWGRGQETPGEDPMVASAYAIEFVKGFQGGNWKRNG  199

Query  1977  kngRKYSLSGNRMPEEE-EDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMED  1801
                 +Y     R+  E+ + DD LMLSACCKH T YDLE W NF RYSFNA+VT QD+ED
Sbjct  200   DGSGRYGFGEKRVLREDGKVDDGLMLSACCKHFTVYDLEKWGNFRRYSFNALVTEQDLED  259

Query  1800  TYEPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATI  1621
             TY+PPF+SC+++G+ASCLMC+YN VNG+PACA +DLL+KART+WGFEGYI SDCDAVATI
Sbjct  260   TYQPPFRSCIQQGKASCLMCSYNEVNGVPACAREDLLQKARTEWGFEGYIVSDCDAVATI  319

Query  1620  FEYQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQF  1441
             FEYQ Y KSP +A  IALKAG DINCG+Y+ R+ +SA++   + E DIDRALLNLFSVQ 
Sbjct  320   FEYQNYTKSPVDAVAIALKAGMDINCGSYLKRHAQSAVDKGELREEDIDRALLNLFSVQL  379

Query  1440  RLGLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLA  1261
             RLGLF+G     +F   GP+DVC+ EH+ LALEAARQGIVLLKN+ KFLPL+K  VSSLA
Sbjct  380   RLGLFDGDPKKGQFGKLGPQDVCTQEHKALALEAARQGIVLLKNDNKFLPLNKKAVSSLA  439

Query  1260  VIGPMANT-SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSI  1084
             +IG +AN+ SSLGGDYTG PC  +S+ DGL  YI KTSYA GC DV+C+S   F EA+ I
Sbjct  440   IIGSLANSASSLGGDYTGYPCNPQSLFDGLKAYIMKTSYAIGCHDVSCDSDAQFDEAMHI  499

Query  1083  AKRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDI  904
             AK AD+VI+V GLDLSQETEDHDR SLLLPG QM LV+ +A  S KP++LVLTGGGPLDI
Sbjct  500   AKSADFVIIVAGLDLSQETEDHDRVSLLLPGKQMNLVSSVAAASKKPVILVLTGGGPLDI  559

Query  903   SFAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMR  724
             SFAK+DPRIAS+LWIGYPGE G KAL+E++FG+YNP GRLP+TWYPE FTK+PMNDM MR
Sbjct  560   SFAKRDPRIASILWIGYPGEAGPKALAEVIFGEYNPGGRLPMTWYPEWFTKIPMNDMRMR  619

Query  723   ADPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNR  544
             ADPSRGYPGRTYRFYTG +VY FG GLSYS+++ + LSAP+++SLS+S+    R+ ILN+
Sbjct  620   ADPSRGYPGRTYRFYTGNRVYGFGEGLSYSNYTYKFLSAPSKLSLSKSLTATSRKRILNQ  679

Query  543   -GGNEPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIG  367
              GG   Y+H+DE+++CNSL F V++S+ N G MDGS VVMLFSR P  +  G P+KQLIG
Sbjct  680   SGGRFNYIHIDEMNSCNSLTFYVQISVTNAGDMDGSHVVMLFSRVPKFFE-GTPEKQLIG  738

Query  366   FDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             FDRVH S    TETSI I+PC+ LSIVN +G RI+ LGDH+
Sbjct  739   FDRVHTSSRKSTETSIFIDPCKDLSIVNEQGKRIMLLGDHV  779



>ref|XP_009795794.1| PREDICTED: probable beta-D-xylosidase 6 [Nicotiana sylvestris]
Length=791

 Score =   989 bits (2556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 497/741 (67%), Positives = 603/741 (81%), Gaps = 5/741 (1%)
 Frame = -3

Query  2460  HSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGIAT  2281
             H  YPFC+ +LPI  R+ SL+SLLT+DEKI  LSDN ++IPRLG+PAYEWWSESLHGIAT
Sbjct  38    HHKYPFCNKNLPISTRVQSLISLLTIDEKILHLSDNTTSIPRLGLPAYEWWSESLHGIAT  97

Query  2280  NGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWAPN  2101
             NGP + F+G +K AT FPQVILTAAAFNRTLW SIA A AVEARAM+N GQAGLTFWAPN
Sbjct  98    NGPAVNFNGQIKGATSFPQVILTAAAFNRTLWHSIATAIAVEARAMYNLGQAGLTFWAPN  157

Query  2100  VNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNR--MPEEE  1927
             +N+  DPRWGRGQETPGEDPMVVS YA+EYV G QG   K K G +      R  + E++
Sbjct  158   INILRDPRWGRGQETPGEDPMVVSAYAIEYVTGFQGLNPKAKKGNRNGYGKKRRVLKEDD  217

Query  1926  EDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCL  1747
              D +RLMLSACCKH TAYDLE W + +RY FNAVVT+QDMEDT++ PF+SC+++G+ASCL
Sbjct  218   NDGERLMLSACCKHFTAYDLEKWGDATRYDFNAVVTKQDMEDTFQAPFRSCIQQGKASCL  277

Query  1746  MCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIAL  1567
             MC+YN+VNG+PACA+K+LL+K RTDWGF+GYITSDCDAVATI+E Q+Y K+PE+A  +AL
Sbjct  278   MCSYNSVNGVPACADKELLDKVRTDWGFDGYITSDCDAVATIYENQKYTKTPEDAVAVAL  337

Query  1566  KAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESFG  1387
             KAGT+INCGTYMLR+MKSA +   V+E D+DRAL  LFSVQFRLGLF+G   + +F +FG
Sbjct  338   KAGTNINCGTYMLRHMKSAFQQGSVLEEDLDRALQYLFSVQFRLGLFDGNPADGQFANFG  397

Query  1386  PKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTSSLGGDYTGI  1207
              +DVC+S H  LAL+AARQGIVLLKN+QKFLPLDKT VS+LA++GPMAN SS GG Y+G+
Sbjct  398   VQDVCTSNHLNLALDAARQGIVLLKNDQKFLPLDKTSVSTLAIVGPMANVSSPGGTYSGV  457

Query  1206  PCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQET  1027
             PC LKS+ +G   +I++T YA+GCLDV CNST GF +A+SI K ADYVIVV GLDLS+ET
Sbjct  458   PCKLKSIREGFHRHINRTLYAAGCLDVGCNSTAGFQDAISIVKEADYVIVVAGLDLSEET  517

Query  1026  EDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGYPG  847
             EDHDRYSLLLPG Q  LV  LA  S KP++LVLTGGGP+D+SFA+KDPRIAS+LW+ YPG
Sbjct  518   EDHDRYSLLLPGQQTNLVTTLAAASKKPIILVLTGGGPVDVSFAEKDPRIASILWVAYPG  577

Query  846   EEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFYTGEK  667
             E GGKALSEI+FG  NP G+LP+TWY ESFTKVPM DMNMRADP+ GYPGRTYRFYTG  
Sbjct  578   ETGGKALSEIIFGYRNPGGKLPMTWYLESFTKVPMTDMNMRADPANGYPGRTYRFYTGNV  637

Query  666   VYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSIL-NRGGNEPYVHVDEVSNCNSL  490
             +Y FGHGLSY+SFS +LLSAP+R+SLS + K+  +RSIL  R     Y+HVDEV +C+S 
Sbjct  638   LYGFGHGLSYTSFSSQLLSAPSRLSLSLA-KSNRKRSILAKRRSRFGYIHVDEVESCHSS  696

Query  489   AFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSISIE  310
              F V +S+ N+GG DGS V+MLFSR   ++  GAPQKQL+GFDRVHV  +   ETS+ ++
Sbjct  697   KFFVHISVTNDGGRDGSHVLMLFSRVLQNFQ-GAPQKQLVGFDRVHVPAHKSVETSLLVD  755

Query  309   PCQHLSIVNVEGSRILPLGDH  247
             PC+ LS  N +G+RIL LG+H
Sbjct  756   PCELLSFANDQGNRILALGEH  776



>gb|AFI25186.1| putative beta-D-xylosidase [Nicotiana tabacum]
Length=791

 Score =   984 bits (2544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/741 (67%), Positives = 601/741 (81%), Gaps = 5/741 (1%)
 Frame = -3

Query  2460  HSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGIAT  2281
             H  Y FC+ +LPI  R+ SL+SLLT+DEKI  LSDN ++IPRLG+PAYEWWSESLHGIAT
Sbjct  38    HHKYTFCNKNLPISTRVQSLISLLTIDEKILHLSDNTTSIPRLGLPAYEWWSESLHGIAT  97

Query  2280  NGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWAPN  2101
             NGP + F+G +K  T FPQVILTAAAFNRTLW SIA A AVEARAM+N GQAGLTFWAPN
Sbjct  98    NGPAVNFNGQIKGVTSFPQVILTAAAFNRTLWHSIATAIAVEARAMYNLGQAGLTFWAPN  157

Query  2100  VNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNR--MPEEE  1927
             +N+  DPRWGRGQETPGEDPMVVS YA+EYV G QG   K K G +      R  + E++
Sbjct  158   INILRDPRWGRGQETPGEDPMVVSAYAIEYVTGFQGLNPKAKKGNRNGYGKKRRVLKEDD  217

Query  1926  EDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCL  1747
              D +RLMLSACCKH TAYDLE W + +RY FNAVVT+QDMEDT++ PF+SC+++G+ASCL
Sbjct  218   NDGERLMLSACCKHFTAYDLEKWGDATRYDFNAVVTKQDMEDTFQAPFRSCIQQGKASCL  277

Query  1746  MCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIAL  1567
             MC+YN+VNG+PACA+K+LL+K RTDWGF+GYITSDCDAVATI+E Q+Y K+PE+A  +AL
Sbjct  278   MCSYNSVNGVPACADKELLDKVRTDWGFDGYITSDCDAVATIYENQKYTKTPEDAVAVAL  337

Query  1566  KAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESFG  1387
             KAGT+INCGTYMLR+MKSA +   V+E D+DRAL  LFSVQFRLGLF+G   + +F +FG
Sbjct  338   KAGTNINCGTYMLRHMKSAFQQGSVLEEDLDRALQYLFSVQFRLGLFDGNPADGQFANFG  397

Query  1386  PKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTSSLGGDYTGI  1207
              +DVC+S H  LAL+AARQGIVLLKN+QKFLPLDKT VS+LA++GPMAN SS GG Y+G+
Sbjct  398   AQDVCTSNHLNLALDAARQGIVLLKNDQKFLPLDKTSVSTLAIVGPMANVSSPGGTYSGV  457

Query  1206  PCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQET  1027
             PC LKS+ +G   +I++T YA+GCLDV CNST GF +A+SI K ADYVIVV G DLS+ET
Sbjct  458   PCKLKSIREGFHRHINRTLYAAGCLDVGCNSTAGFQDAISIVKEADYVIVVAGSDLSEET  517

Query  1026  EDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGYPG  847
             EDHDRYSLLLPG Q  LV  LA  S KP++LVLTGGGP+D+SFA+KDPRIAS+LW+ YPG
Sbjct  518   EDHDRYSLLLPGQQTNLVTTLAAASKKPIILVLTGGGPVDVSFAEKDPRIASILWVAYPG  577

Query  846   EEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFYTGEK  667
             E GGKALSEI+FG  NP G+LP+TWY ESFTKVPM DMNMRADPS GYPGRTYRFYTG+ 
Sbjct  578   ETGGKALSEIIFGYQNPGGKLPMTWYLESFTKVPMTDMNMRADPSNGYPGRTYRFYTGDV  637

Query  666   VYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNE-PYVHVDEVSNCNSL  490
             +Y FGHGLSY+SFS +LLSAP+R+SLS + K+  +RSIL +G +   Y+HVDEV +C+S 
Sbjct  638   LYGFGHGLSYTSFSSQLLSAPSRLSLSLA-KSNRKRSILAKGRSRLGYIHVDEVESCHSS  696

Query  489   AFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSISIE  310
              F V +S+ N+G MDGS V+MLFSR   ++  GAPQKQL+GFDRVHV      ETS+ ++
Sbjct  697   KFFVHISVTNDGDMDGSHVLMLFSRVLQNFQ-GAPQKQLVGFDRVHVPARKYVETSLLVD  755

Query  309   PCQHLSIVNVEGSRILPLGDH  247
             PC+  S  N +G+RIL LG+H
Sbjct  756   PCELFSFANDQGNRILALGEH  776



>ref|XP_008385726.1| PREDICTED: probable beta-D-xylosidase 6 [Malus domestica]
Length=796

 Score =   982 bits (2538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/749 (66%), Positives = 601/749 (80%), Gaps = 8/749 (1%)
 Frame = -3

Query  2484  QLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWS  2305
             Q PC+PP HSSYPFC+ SLPIP R  SL+SLLT+ EKIQ+LS++ SAIPRLGIP YEWWS
Sbjct  39    QFPCKPPHHSSYPFCNNSLPIPTRAQSLISLLTLQEKIQQLSNSASAIPRLGIPPYEWWS  98

Query  2304  ESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA  2125
             ESLHGIATNGPG++F+G + SAT FPQVI+TAAAFNRTLW S+ AA AVEARAM+N GQA
Sbjct  99    ESLHGIATNGPGVSFNGTIPSATSFPQVIVTAAAFNRTLWFSVGAAIAVEARAMYNFGQA  158

Query  2124  GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGN  1945
             GLTFWAPN+N+F DPRWGRGQETPGEDPMV S YAVE+V+G QG G++        L   
Sbjct  159   GLTFWAPNINIFRDPRWGRGQETPGEDPMVASAYAVEFVKGFQGGGIR-----DGGLGAR  213

Query  1944  RMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEK  1765
             R+ E +E  D LMLSACCKH TAYDLE W NFSRYSFNAVV+ QD+EDTY+PPF+SC+++
Sbjct  214   RVLESDESGDSLMLSACCKHFTAYDLESWRNFSRYSFNAVVSEQDLEDTYQPPFRSCIQQ  273

Query  1764  GRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKSPEE  1585
             G+ASCLMC+YNAVNG+PACA KDLL+KAR +WGF+GYITSDCDAVAT+FEYQ Y KSPE+
Sbjct  274   GKASCLMCSYNAVNGVPACAQKDLLDKARNEWGFKGYITSDCDAVATVFEYQNYTKSPED  333

Query  1584  AAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNR  1405
             A    LKAGTDI+CGTY+LRN  S ++   V E DID+ALLNLFSVQ RLGLFNG     
Sbjct  334   AVADVLKAGTDIDCGTYLLRNTLSTIKQGKVQEEDIDKALLNLFSVQLRLGLFNGDPRKG  393

Query  1404  KFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTSS-L  1228
             KF S G +DVC+SEH+ LALEAARQGIVLLKN++KFLPL +    SLAVIGP+AN SS L
Sbjct  394   KFGSLGAQDVCTSEHKTLALEAARQGIVLLKNDKKFLPLKRGVXFSLAVIGPLANNSSLL  453

Query  1227  GGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVG  1048
             GGDYTGIPC  KS  +GL EY  +TSY +GC DV C S  GF +A+  AK+AD+V++VVG
Sbjct  454   GGDYTGIPCNPKSPFEGLQEYSTRTSYVAGCQDVPCLSDAGFEKAIYAAKKADFVVIVVG  513

Query  1047  LDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASV  868
             +D SQE EDHDR SLLLPG QMALV+ +A  S +P++LVL GGGPLD++FAK+D RIAS+
Sbjct  514   IDASQEREDHDRVSLLLPGKQMALVSSVAAASKEPVILVLAGGGPLDVTFAKEDLRIASI  573

Query  867   LWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTY  688
             LWIGYPGE GG+AL+E++FGD+NP GRLP+TWYPESFT VPMNDMNMRADPS GYPGRTY
Sbjct  574   LWIGYPGEAGGRALAEVIFGDFNPGGRLPMTWYPESFTNVPMNDMNMRADPSLGYPGRTY  633

Query  687   RFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNE-PYVHVDE  511
             RFYTG+++Y FGHGLSYSSF+  ++SAP ++SLS+  K  L R++L++ G+   ++H+DE
Sbjct  634   RFYTGDRIYGFGHGLSYSSFTYNIVSAPKKLSLSKPFKVDLSRNVLHQPGDVLDHLHIDE  693

Query  510   VSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVT  331
             V++C SL F V ++++NNG MDG   VMLFSR       G P +QLIGF+RV+   N  T
Sbjct  694   VTSCESLRFLVEIAVKNNGDMDGGHSVMLFSRV-PKVVKGVPVRQLIGFNRVYTXSNQYT  752

Query  330   ETSISIEPCQHLSIVNVEGSRILPLGDHI  244
               SI ++PC HLS  +  G RILPLG+H+
Sbjct  753   TASILVDPCTHLSFADEHGERILPLGEHV  781



>ref|XP_010254644.1| PREDICTED: probable beta-D-xylosidase 6 [Nelumbo nucifera]
Length=797

 Score =   978 bits (2529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/759 (64%), Positives = 600/759 (79%), Gaps = 18/759 (2%)
 Frame = -3

Query  2496  YSKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAY  2317
             +S PQ PCQ   H SYPFC+TSLPI AR  SLVSLLT  EKIQ+LS+N S I RLGIPAY
Sbjct  33    HSNPQFPCQLRQHQSYPFCNTSLPISARAQSLVSLLTPSEKIQQLSNNASQIERLGIPAY  92

Query  2316  EWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFN  2137
             EWWSESLHGIATNGPG++F+G++ SAT FPQV++ AA+FNR+LW ++A+A AVEARAM+N
Sbjct  93    EWWSESLHGIATNGPGVSFNGSIPSATSFPQVLVMAASFNRSLWFTVASAIAVEARAMYN  152

Query  2136  SGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYS  1957
              GQAGLTFWAPN+N+F DPRWGRGQETPGEDPMV + YA+EYV+G QG+  + + G K  
Sbjct  153   VGQAGLTFWAPNINIFRDPRWGRGQETPGEDPMVAAAYAIEYVKGFQGENKQDRFGEKRV  212

Query  1956  LSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKS  1777
             L G+   +E+ D  +L+LSACCKHLTAYDLE W NF+RY+FNAV+++QD+E+TY+PPF+S
Sbjct  213   LKGSD--DEDGDSGKLLLSACCKHLTAYDLEKWENFTRYTFNAVISQQDLEETYQPPFRS  270

Query  1776  CVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAK  1597
             CVE+GRASCLMC+YNAVNG+P+CA+K LL+KAR+DWGF+GYITSDCDAVATIFE+QQYA 
Sbjct  271   CVEEGRASCLMCSYNAVNGVPSCASKALLQKARSDWGFKGYITSDCDAVATIFEFQQYAN  330

Query  1596  SPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGK  1417
             SPE+A   ALKAG DINCGTYMLRN +SALE   + E DIDRAL NLFSVQ RLGLFNG 
Sbjct  331   SPEDAVADALKAGVDINCGTYMLRNTQSALEQGKIREEDIDRALFNLFSVQLRLGLFNGD  390

Query  1416  AVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANT  1237
              +       GP+DVCS EHR+LALEAA+QG+VLLKN++KFLPL K R +SLAVIGP AN 
Sbjct  391   LLKGHLGKLGPQDVCSPEHRKLALEAAKQGVVLLKNDKKFLPLKKNRFASLAVIGPTAND  450

Query  1236  S-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVI  1060
             S +LGG Y+G+PC   S ++G   Y  K SYA+GCLD+ C+S  GF  A+ +A++AD  I
Sbjct  451   SINLGGGYSGVPCNPTSFVEGFKAYTQKISYAAGCLDIPCDSDSGFTAAIHLARKADVAI  510

Query  1059  VVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPR  880
             VV GLD SQETED DR SLLLPG QM L++ +   S +P+VL+L GGGP+D+SFAK DPR
Sbjct  511   VVAGLDSSQETEDLDRVSLLLPGKQMDLISVIVQASKRPVVLILMGGGPIDVSFAKNDPR  570

Query  879   IASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYP  700
             IAS+LW+GYPGE GG+AL+E++FG +NP G+LP+TWYPESFT VPMNDM MR DPS GYP
Sbjct  571   IASILWVGYPGETGGQALAEVIFGKFNPGGKLPMTWYPESFTNVPMNDMRMRPDPSSGYP  630

Query  699   GRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPY--  526
             GRTYRFYTG  VYEFGHGLSY++++   LS PT++SL  S        ++    N P+  
Sbjct  631   GRTYRFYTGNTVYEFGHGLSYTNYTYNFLSVPTKLSLLAS------SVVVGSNNNMPHER  684

Query  525   ------VHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGF  364
                   + +DEV+ C++L F   +S+ NNG MDGS VVMLFSR P ++  GAPQKQLIGF
Sbjct  685   ADGLDSIRIDEVATCDALKFYAHISVINNGDMDGSHVVMLFSRVPATFT-GAPQKQLIGF  743

Query  363   DRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             DRVH   +  TETSI ++PC+HLS+VN +G+R+LPLG H
Sbjct  744   DRVHTVTHRATETSILVDPCKHLSVVNEQGTRVLPLGAH  782



>ref|XP_006466365.1| PREDICTED: probable beta-D-xylosidase 6-like [Citrus sinensis]
Length=808

 Score =   976 bits (2523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/759 (65%), Positives = 598/759 (79%), Gaps = 12/759 (2%)
 Frame = -3

Query  2493  SKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             +KP  PC+PP   SYPFC+TSL I  R  SL+SLLT+ EKIQ+LSDN SAIPRLGIPAYE
Sbjct  38    NKPDFPCKPPHFDSYPFCNTSLSISTRAKSLISLLTLQEKIQQLSDNASAIPRLGIPAYE  97

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSESLHGIA+NGPG+ F+G V S T FPQV+++AA+FNR+LW +I +A AVEARAM+N 
Sbjct  98    WWSESLHGIASNGPGVNFNGTVSSVTSFPQVLVSAASFNRSLWSNIGSAVAVEARAMYNL  157

Query  2133  GQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkn------  1972
             GQAGLTFWAPN+N+F DPRWGRGQETPGEDPMVVS YAVE+V+  QG+  K  +      
Sbjct  158   GQAGLTFWAPNINIFRDPRWGRGQETPGEDPMVVSAYAVEFVKSFQGENWKSDDGGIGFG  217

Query  1971  -gRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTY  1795
                K  L G    EE +  D LMLSACCKHL AYDLE W NFSRYSFNA++T QD EDT+
Sbjct  218   FREKRVLKG--FGEESDRGDELMLSACCKHLIAYDLEKWGNFSRYSFNAMITEQDTEDTF  275

Query  1794  EPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFE  1615
             +PPF+SC+E+G+ASC+MC+YN VNG+PAC   DL +KAR +WGF+GYITSDCDAVATIFE
Sbjct  276   QPPFRSCIEQGKASCIMCSYNQVNGVPACLRGDLFQKARNEWGFKGYITSDCDAVATIFE  335

Query  1614  YQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRL  1435
             YQ Y K+ E++A   LKAG DINCGT MLR+ +SA++   V E DIDRALLNLFSVQ RL
Sbjct  336   YQNYTKTHEDSAAGVLKAGMDINCGTCMLRHTQSAIDKGKVQEKDIDRALLNLFSVQLRL  395

Query  1434  GLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVI  1255
             GLFNG     K+   GP DVC+SEH++LAL+AARQGIVLLKN++KFLPL+K  VSSLA+I
Sbjct  396   GLFNGDPRKGKYGKLGPDDVCTSEHKKLALDAARQGIVLLKNDKKFLPLNKNAVSSLAII  455

Query  1254  GPMANT-SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAK  1078
             GP+ N  S +GG YTGIPC+ KS+L GL  Y+ KT YASGC DV CNS  GF EAV IAK
Sbjct  456   GPLVNNISQMGGGYTGIPCSPKSLLRGLEAYVSKTHYASGCHDVPCNSDAGFHEAVRIAK  515

Query  1077  RADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISF  898
             +AD+VIVV GLDL+QETED DR SLLLPG QM+LV  +A  S +P++LVLTGGGPLD+SF
Sbjct  516   KADFVIVVAGLDLTQETEDRDRVSLLLPGQQMSLVTSVARTSKRPVILVLTGGGPLDVSF  575

Query  897   AKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRAD  718
             A+ D +I+S+LWIGYPGE G KAL+EI+FGD+NP GRLP+TWYPESFTKVPMNDMNMRAD
Sbjct  576   AEADSQISSILWIGYPGEAGAKALAEIIFGDFNPGGRLPMTWYPESFTKVPMNDMNMRAD  635

Query  717   PSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGG  538
              SR YPGR+YRFYTG +VY FGHGLSY+++S + LSAP+ +++S S+K    ++IL + G
Sbjct  636   SSRQYPGRSYRFYTGTQVYGFGHGLSYTNYSYKFLSAPSELTISASLKAGSDKNILQQTG  695

Query  537   NE-PYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFD  361
             +   YVH+DEV++C SL F V++S+ N G +DGS VVMLF+R P   + G P+KQLIGFD
Sbjct  696   SRLDYVHIDEVTSCTSLRFHVQISVTNAGDVDGSHVVMLFARVP-KVSQGTPEKQLIGFD  754

Query  360   RVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             RVH    G  E S  ++PC+ LSI N  G RILPLG+H+
Sbjct  755   RVHTVAKGSKEISFGVDPCEQLSIANKHGRRILPLGNHV  793



>gb|KDO78723.1| hypothetical protein CISIN_1g003606mg [Citrus sinensis]
Length=808

 Score =   976 bits (2522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/759 (65%), Positives = 598/759 (79%), Gaps = 12/759 (2%)
 Frame = -3

Query  2493  SKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             +KP  PC+PP   SYPFC+TSL I  R  SL+SLLT+ EKIQ+LSDN SAIPRLGIPAYE
Sbjct  38    NKPDFPCKPPHFDSYPFCNTSLSISTRAKSLISLLTLQEKIQQLSDNASAIPRLGIPAYE  97

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSESLHGIA+NGPG+ F+G V S T FPQV+++AA+FNR+LW +I +A AVEARAM+N 
Sbjct  98    WWSESLHGIASNGPGVNFNGTVSSVTSFPQVLVSAASFNRSLWSNIGSAVAVEARAMYNL  157

Query  2133  GQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkn------  1972
             GQAGLTFWAPN+N+F DPRWGRGQETPGEDPMVVS YAVE+V+  QG+  K  +      
Sbjct  158   GQAGLTFWAPNINIFRDPRWGRGQETPGEDPMVVSAYAVEFVKSFQGENWKSDDGGIGFG  217

Query  1971  -gRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTY  1795
                K  L G    EE +  D LMLSACCKHL AYDLE W NFSRYSFNA++T QD EDT+
Sbjct  218   FREKRVLKG--FGEESDRGDELMLSACCKHLIAYDLEKWGNFSRYSFNAMITEQDTEDTF  275

Query  1794  EPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFE  1615
             +PPF+SC+E+G+ASC+MC+YN VNG+PAC   DL +KAR +WGF+GYITSDCDAVATIFE
Sbjct  276   QPPFRSCIEQGKASCIMCSYNQVNGVPACLRGDLFQKARNEWGFKGYITSDCDAVATIFE  335

Query  1614  YQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRL  1435
             YQ Y K+ E++A   LKAG DINCGT MLR+ +SA++   V E DIDRALLNLFSVQ RL
Sbjct  336   YQNYTKTHEDSAAGVLKAGMDINCGTCMLRHTQSAIDKGKVQEKDIDRALLNLFSVQLRL  395

Query  1434  GLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVI  1255
             GLFNG     K+   GP DVC+SEH++LAL+AARQGIVLLKN++KFLPL+K  VSSLA+I
Sbjct  396   GLFNGDPRKGKYGKLGPDDVCTSEHKKLALDAARQGIVLLKNDKKFLPLNKNAVSSLAII  455

Query  1254  GPMANT-SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAK  1078
             GP+ N  S +GG YTGIPC+ KS+L GL  Y+ KT YASGC DV CNS  GF EAV IAK
Sbjct  456   GPLVNNISQMGGGYTGIPCSPKSLLRGLEAYVSKTHYASGCHDVPCNSDAGFHEAVRIAK  515

Query  1077  RADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISF  898
             +AD+VIVV GLDL+QETED DR SLLLPG QM+LV  +A  S +P++LVLTGGGPLD+SF
Sbjct  516   KADFVIVVAGLDLTQETEDRDRVSLLLPGQQMSLVTSVARTSKRPVILVLTGGGPLDVSF  575

Query  897   AKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRAD  718
             A+ D +I+S+LWIGYPGE G KAL+EI+FGD+NP GRLP+TWYPESFTKVPMNDMNMRAD
Sbjct  576   AEADSQISSILWIGYPGEAGAKALAEIIFGDFNPGGRLPMTWYPESFTKVPMNDMNMRAD  635

Query  717   PSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGG  538
              SR YPGR+YRFYTG +VY FGHGLSY+++S + LSAP+ +++S S+K    ++IL + G
Sbjct  636   SSRQYPGRSYRFYTGTQVYGFGHGLSYTNYSYKFLSAPSELTISASLKAGSDKNILQQTG  695

Query  537   NE-PYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFD  361
             +   YVH+DEV++C SL F V++S+ N G +DGS VVMLF+R P   + G P+KQLIGFD
Sbjct  696   SRLDYVHIDEVTSCTSLRFHVQISVTNAGDVDGSHVVMLFARVP-KVSQGTPEKQLIGFD  754

Query  360   RVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             RVH    G  E S  ++PC+ LSI N  G RILPLG+H+
Sbjct  755   RVHTVAKGSKEISFGVDPCEQLSIANKHGRRILPLGNHV  793



>ref|XP_004231972.1| PREDICTED: probable beta-D-xylosidase 6 [Solanum lycopersicum]
Length=793

 Score =   974 bits (2519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/743 (66%), Positives = 596/743 (80%), Gaps = 7/743 (1%)
 Frame = -3

Query  2460  HSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGIAT  2281
             H  Y FC+  L I  R+HSL+SLLT+DEKI  LSDN ++IPRLG+PAYEWWSESLHGI  
Sbjct  38    HHKYKFCNKKLSISNRVHSLISLLTIDEKILHLSDNTTSIPRLGLPAYEWWSESLHGIGI  97

Query  2280  NGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWAPN  2101
             NGPGI F+G++KSAT FPQVILTAAAFNRTLW SIA+A AVEARAM+N+GQ+GLTFWAPN
Sbjct  98    NGPGINFNGSIKSATSFPQVILTAAAFNRTLWHSIASAIAVEARAMYNTGQSGLTFWAPN  157

Query  2100  VNVFVDPRWGRGQETPGEDPMVVSDYAVEYVr--glqgqglkgkngRKYSLSGNRMPEEE  1927
             +NVF DPRWGRGQETPGEDPMVVS YA+EYV            ++   +     R   +E
Sbjct  158   INVFRDPRWGRGQETPGEDPMVVSSYAIEYVTGFQQLNSKADKESSNGHVFGNTRRVLKE  217

Query  1926  EDD--DRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRAS  1753
             +DD  D+LMLSACCKH TAYDLE W + +RYSFNAVVTRQDMEDT++ PF+SC+++ +AS
Sbjct  218   DDDAGDKLMLSACCKHFTAYDLEKWGDATRYSFNAVVTRQDMEDTFQAPFRSCIQQAKAS  277

Query  1752  CLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGI  1573
             CLMC+YN+VNG+PACA+K LL+K RTDWGF+GYITSDCDAVATI+E Q Y ++PE+A  +
Sbjct  278   CLMCSYNSVNGVPACADKVLLDKVRTDWGFDGYITSDCDAVATIYENQNYTQTPEDAVAL  337

Query  1572  ALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFES  1393
             ALKAGT+INCGTYMLR +KSA +   V+E D+DRAL  LFSVQFRLGLF+G     +F  
Sbjct  338   ALKAGTNINCGTYMLRYVKSAFQQGSVLEEDLDRALQYLFSVQFRLGLFDGNPAKGQFAK  397

Query  1392  FGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTSSLGGDYT  1213
             FGP+DVC+S +  LAL+A RQGIVLLKN+QKFLPLDK R+S+LA++GPMAN SS GG YT
Sbjct  398   FGPQDVCTSNNLELALDAVRQGIVLLKNDQKFLPLDKRRISTLAIVGPMANVSSPGGTYT  457

Query  1212  GIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQ  1033
             G+PC LKS+ DG   +I++T YA+GCLDV CNST GF +A+SIAK ADYVIVV GLDLSQ
Sbjct  458   GVPCKLKSIRDGFHRHINRTLYAAGCLDVGCNSTAGFPDAISIAKEADYVIVVAGLDLSQ  517

Query  1032  ETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGY  853
             ETED DRYSLLLPGHQ  LV+ LA VS KP++LVLTGGGP+D+SFA+KDPRIAS+LW+ Y
Sbjct  518   ETEDLDRYSLLLPGHQTNLVSALAAVSKKPIILVLTGGGPIDVSFAEKDPRIASILWVAY  577

Query  852   PGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFYTG  673
             PGE GGKALSEI+FG  NP G+LP+TWY ES++KVPM +M+MRADP+ GYPGRTYRFYTG
Sbjct  578   PGETGGKALSEIIFGYQNPGGKLPMTWYLESYSKVPMTNMSMRADPASGYPGRTYRFYTG  637

Query  672   EKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNE-PYVHVDEVSNCN  496
             + +Y FGHGLSY+SFS  LLSAP R+SLS   K+  +RSIL +  +   Y+HVDEV +C+
Sbjct  638   DLLYGFGHGLSYTSFSSRLLSAPNRLSLSLG-KSNWKRSILAQEHSRLGYIHVDEVPSCS  696

Query  495   SLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSIS  316
                F + +S+ N+G MDGS V++LFSR P +   G+PQKQL+GFDRVHV      ETS+S
Sbjct  697   LSKFFIHISVTNDGDMDGSHVLLLFSRVPQNIQ-GSPQKQLVGFDRVHVPARKSVETSLS  755

Query  315   IEPCQHLSIVNVEGSRILPLGDH  247
             I PC+ LS  N +G+RIL LG+H
Sbjct  756   INPCEFLSFSNDQGNRILALGEH  778



>ref|XP_008236660.1| PREDICTED: probable beta-D-xylosidase 6 isoform X1 [Prunus mume]
Length=811

 Score =   974 bits (2517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/758 (65%), Positives = 597/758 (79%), Gaps = 10/758 (1%)
 Frame = -3

Query  2505  ATSYSKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGI  2326
             ++S S  Q PC+PP +SSYPFC+TSLPI  R  SL+SLLT+ EKIQ+LS+N SAIPRLGI
Sbjct  43    SSSNSDLQFPCKPPHYSSYPFCNTSLPITTRAQSLISLLTLREKIQQLSNNASAIPRLGI  102

Query  2325  PAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearA  2146
             P YEWWSESLHGIATNGPG++F+G + SAT FPQVI+TAAAFNRTLW  I +A AVEARA
Sbjct  103   PPYEWWSESLHGIATNGPGVSFNGTIPSATSFPQVIVTAAAFNRTLWSLIGSAIAVEARA  162

Query  2145  MFNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngR  1966
             M+N GQAGLTFWAPN+N+F DPRWGRGQETPGEDPMV S YA+E+V+G QG         
Sbjct  163   MYNLGQAGLTFWAPNINIFRDPRWGRGQETPGEDPMVASAYAIEFVKGFQGGNWGI----  218

Query  1965  KYSLSGNRMPEEEED---DDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTY  1795
             ++   G R   E  D   DD LMLSACCKH TAYDL+LW NFSRYSFNAVV+ QD+EDTY
Sbjct  219   RHDGFGERRVLEGHDGGSDDGLMLSACCKHFTAYDLDLWRNFSRYSFNAVVSEQDLEDTY  278

Query  1794  EPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFE  1615
             +PPF+SC++ G+ASCLMC+YNAVNG+PACA KDLL+KAR +WGF+GYITSDCDAVAT++E
Sbjct  279   QPPFRSCIQHGKASCLMCSYNAVNGVPACAQKDLLDKARNEWGFKGYITSDCDAVATVYE  338

Query  1614  YQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRL  1435
             YQ Y KS E+A    LKAGTDINCGT++ R+  S ++   V E DID+ALLNLFSVQ RL
Sbjct  339   YQNYTKSSEDAVADVLKAGTDINCGTFLFRHTLSTIKQGKVQEEDIDKALLNLFSVQLRL  398

Query  1434  GLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVI  1255
             GLF+G   N +F S GPKDVC+SEH+ LALEA RQGIVLLKN++KFLPL+K    SLAVI
Sbjct  399   GLFDGDPRNGQFGSLGPKDVCTSEHKTLALEATRQGIVLLKNDKKFLPLEKGVDFSLAVI  458

Query  1254  GPMANTSS-LGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAK  1078
             GP+AN +S LGG YTGIPC+ K + +GL EY  +  YA+GCLDV C S  GF EA+   K
Sbjct  459   GPLANNASLLGGGYTGIPCSSKGLFEGLQEYTKRALYAAGCLDVPCKSRAGFREAIHTVK  518

Query  1077  RADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISF  898
              AD V++VVGLDL+QE EDHDR SLLLPG QMALV+ +A  S +P++LVLTGGGPLD++F
Sbjct  519   MADIVVIVVGLDLTQEREDHDRVSLLLPGKQMALVSSVAAASKEPVILVLTGGGPLDVTF  578

Query  897   AKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRAD  718
             AK+DPRIAS+LWIGYPGE GG+AL+E++FGD+NP GRLP+TWYPESFT +PMNDMNMRAD
Sbjct  579   AKEDPRIASILWIGYPGESGGRALAEVLFGDFNPGGRLPMTWYPESFTNIPMNDMNMRAD  638

Query  717   PSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGG  538
             PS+GYPGRTYRFYTG ++Y FG GLSYS F+  ++SAP  + LS+ +K    R+IL++ G
Sbjct  639   PSKGYPGRTYRFYTGSRLYGFGDGLSYSKFTYNIVSAPKNLRLSRPLKVDSSRNILHQAG  698

Query  537   NE-PYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFD  361
             +   Y+H+DEV++C+SL F V +++ N G MDG   VMLFSR  T    GAP++QLIGF+
Sbjct  699   DTLDYLHIDEVTSCDSLRFFVEITVTNIGDMDGGHTVMLFSRM-TKVVKGAPKQQLIGFN  757

Query  360   RVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             RVH      T TSI ++PC H S  N  G  ILPLGDH
Sbjct  758   RVHTGSYKSTATSILVDPCTHFSFANDYGEWILPLGDH  795



>ref|XP_007206430.1| hypothetical protein PRUPE_ppa001583mg [Prunus persica]
 gb|EMJ07629.1| hypothetical protein PRUPE_ppa001583mg [Prunus persica]
Length=798

 Score =   973 bits (2515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/758 (65%), Positives = 596/758 (79%), Gaps = 10/758 (1%)
 Frame = -3

Query  2505  ATSYSKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGI  2326
             ++S S  Q PC+PP HSSYPFC+TSLPI  R  SL+SLLT+ EKIQ+LS+N SAIPRLGI
Sbjct  30    SSSNSDLQFPCKPPHHSSYPFCNTSLPITTRAQSLISLLTLREKIQQLSNNASAIPRLGI  89

Query  2325  PAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearA  2146
             P YEWWSESLHGIATNGPG++F+G + SAT FPQVI+TAAAFNRTLW  I +A AVEAR+
Sbjct  90    PPYEWWSESLHGIATNGPGVSFNGTIPSATSFPQVIVTAAAFNRTLWSLIGSAIAVEARS  149

Query  2145  MFNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngR  1966
             M+N GQAGLTFWAPN+N+F DPRWGRGQETPGEDPMV S YA+E+V G QG         
Sbjct  150   MYNLGQAGLTFWAPNINIFRDPRWGRGQETPGEDPMVASAYAIEFVNGFQGGNWGIT---  206

Query  1965  KYSLSGNRMPEEEED---DDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTY  1795
              +   G R   E  D   DD LMLSACCKH TAYDLELW NFSRYSFNAVV+ QD+EDTY
Sbjct  207   -HDGFGERRVLEGHDGGSDDGLMLSACCKHFTAYDLELWGNFSRYSFNAVVSEQDLEDTY  265

Query  1794  EPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFE  1615
             +PPF+SC+++G+ASCLMC+YNAVNG+PACA KDLL+KAR +WGF+GYITSDCDAVAT++E
Sbjct  266   QPPFRSCIQQGKASCLMCSYNAVNGVPACAQKDLLDKARNEWGFKGYITSDCDAVATVYE  325

Query  1614  YQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRL  1435
             YQ Y  S E+A    LKAG DINCGT++LR+  S ++   V E DID+ALLNLFSVQ RL
Sbjct  326   YQNYTTSSEDAVADVLKAGMDINCGTFLLRHTLSTIKKGKVQEEDIDKALLNLFSVQLRL  385

Query  1434  GLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVI  1255
             GLF+G   N +F S GPKDVC+SEH+ LALEA RQGIVLLKN++KFLPL+K    SLAVI
Sbjct  386   GLFDGDPRNGQFGSLGPKDVCTSEHKALALEATRQGIVLLKNDKKFLPLEKGVDFSLAVI  445

Query  1254  GPMANTSS-LGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAK  1078
             GP+AN +S LGG YTGIPC+ K + +GL EY  +  YA+GCLDV C S  GF EA+   K
Sbjct  446   GPLANNASLLGGGYTGIPCSSKGLFEGLQEYTKRALYAAGCLDVPCKSRAGFREAIHTVK  505

Query  1077  RADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISF  898
              AD+V++VVGLDL+QE EDHDR SLLLPG QMALV+ +A  S +P++LVLTGGGPLD++F
Sbjct  506   MADFVVIVVGLDLTQEREDHDRVSLLLPGKQMALVSSVAAASKEPVILVLTGGGPLDVTF  565

Query  897   AKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRAD  718
             AK+DPRIAS+LWIGYPGE GG+AL+E++FGD+NP GRLP+TWYPESFT +PMNDMNMRAD
Sbjct  566   AKEDPRIASILWIGYPGESGGRALAEVLFGDFNPGGRLPMTWYPESFTNIPMNDMNMRAD  625

Query  717   PSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGG  538
             PS+GYPGRTYRFYTG ++Y FG GLSYS F+  ++SAP ++ LS+ +K    R++L++ G
Sbjct  626   PSQGYPGRTYRFYTGSRLYGFGDGLSYSKFTYNIVSAPKKLRLSRPLKVDSSRNVLHQAG  685

Query  537   NE-PYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFD  361
             +   Y+H+DEV +C+SL F V +++ N G MDG   VMLFSR  T    GAP++QLIGF+
Sbjct  686   DTLDYLHIDEVISCDSLRFFVEITVTNIGDMDGGHTVMLFSRM-TKVVKGAPKQQLIGFN  744

Query  360   RVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             RVH      T TSI ++PC H S  N  G  ILPLGDH
Sbjct  745   RVHTGSYKSTATSILVDPCTHFSFANDYGEWILPLGDH  782



>ref|XP_006426203.1| hypothetical protein CICLE_v10024911mg [Citrus clementina]
 gb|ESR39443.1| hypothetical protein CICLE_v10024911mg [Citrus clementina]
Length=808

 Score =   972 bits (2513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/759 (65%), Positives = 597/759 (79%), Gaps = 12/759 (2%)
 Frame = -3

Query  2493  SKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             +KP  PC+PP   S PFC+TSL I  R  SL+SLLT+ EKIQ+LSDN SAIPRLGIPAYE
Sbjct  38    NKPDFPCKPPHFDSCPFCNTSLSISTRAKSLISLLTLQEKIQQLSDNASAIPRLGIPAYE  97

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSESLHGIA+NGPG+ F+G V S T FPQV+++AA+FNR+LW +I +A AVEARAM+N 
Sbjct  98    WWSESLHGIASNGPGVNFNGTVSSVTSFPQVLVSAASFNRSLWSNIGSAVAVEARAMYNL  157

Query  2133  GQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkn------  1972
             GQAGLTFWAPN+N+F DPRWGRGQETPGEDPMVVS YAVE+V+  QG+  K  +      
Sbjct  158   GQAGLTFWAPNINIFRDPRWGRGQETPGEDPMVVSAYAVEFVKSFQGENWKSDDGGIGFG  217

Query  1971  -gRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTY  1795
                K  L G    EE +  D LMLSACCKHL AYDLE W NFSRYSFNA++T QD EDT+
Sbjct  218   FREKRVLKG--FGEESDRGDELMLSACCKHLIAYDLEKWGNFSRYSFNAMITEQDTEDTF  275

Query  1794  EPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFE  1615
             +PPF+SC+E+G+ASC+MC+YN VNG+PAC   DL +KAR +WGF+GYITSDCDAVATIFE
Sbjct  276   QPPFRSCIEQGKASCIMCSYNQVNGVPACLRGDLFQKARNEWGFKGYITSDCDAVATIFE  335

Query  1614  YQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRL  1435
             YQ Y K+ E++A   LKAG DINCGT MLR+ +SA++   V E DIDRALLNLFSVQ RL
Sbjct  336   YQNYTKTHEDSAAGVLKAGMDINCGTCMLRHTQSAIDKGKVQEKDIDRALLNLFSVQLRL  395

Query  1434  GLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVI  1255
             GLFNG     K+   GP DVC+SEH++LAL+AARQGIVLLKN++KFLPL+K  VSSLA+I
Sbjct  396   GLFNGDPRKGKYGKLGPDDVCTSEHKKLALDAARQGIVLLKNDKKFLPLNKNAVSSLAII  455

Query  1254  GPMANT-SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAK  1078
             GP+ N  S +GG YTGIPC+ KS+L GL  Y+ KT YASGC DV CNS  GF EAV IAK
Sbjct  456   GPLVNNISQMGGGYTGIPCSPKSLLRGLEAYVSKTHYASGCHDVPCNSDAGFHEAVRIAK  515

Query  1077  RADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISF  898
             +AD+VIVV GLDL+QETED DR SLLLPG QM+LV  +A  S +P++LVLTGGGPLD+SF
Sbjct  516   KADFVIVVAGLDLTQETEDRDRVSLLLPGQQMSLVTSVARTSKRPVILVLTGGGPLDVSF  575

Query  897   AKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRAD  718
             A+ D +I+S+LWIGYPGE G KAL+EI+FGD+NP GRLP+TWYPESFTKVPMNDMNMRAD
Sbjct  576   AEADSQISSILWIGYPGEAGAKALAEIIFGDFNPGGRLPMTWYPESFTKVPMNDMNMRAD  635

Query  717   PSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGG  538
              SR YPGR+YRFYTG +VY FGHGLSY+++S + LSAP+ +++S S+K    ++IL + G
Sbjct  636   SSRQYPGRSYRFYTGTQVYGFGHGLSYTNYSYKFLSAPSELTISASLKAGSDKNILQQTG  695

Query  537   NE-PYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFD  361
             +   YVH+DEV++C SL F V++S+ N G +DGS VVMLF+R P   + G P+KQLIGFD
Sbjct  696   SRLDYVHIDEVTSCTSLRFHVQISVTNAGDVDGSHVVMLFARVP-KVSQGTPEKQLIGFD  754

Query  360   RVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             RVH    G  E S  ++PC+ LSI N  G RILPLG+H+
Sbjct  755   RVHTVAKGSKEISFGVDPCEQLSIANKHGRRILPLGNHV  793



>ref|XP_011026854.1| PREDICTED: probable beta-D-xylosidase 6 isoform X1 [Populus euphratica]
Length=800

 Score =   968 bits (2503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/759 (65%), Positives = 610/759 (80%), Gaps = 12/759 (2%)
 Frame = -3

Query  2487  PQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWW  2308
             PQ PC+PPTH++Y FC+ SLPI  R  SL+S LT+ EKIQ+LSDN S IPRLGIP YEWW
Sbjct  28    PQFPCKPPTHNTYSFCNKSLPITRRAQSLISHLTLQEKIQQLSDNASGIPRLGIPHYEWW  87

Query  2307  SESLHGIATNGPGITFD--GAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             SESLHGI+ NGPG++F   G V SATGFPQVI++AA+FNRTLW  I +A A+EARAM+N 
Sbjct  88    SESLHGISINGPGVSFKNGGPVTSATGFPQVIVSAASFNRTLWFLIGSAIAIEARAMYNV  147

Query  2133  GQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglq----gqglkgkngR  1966
             GQAGLTFWAPN+N+F DPRWGRGQETPGEDPMV S YA+E+V+G Q      G + ++  
Sbjct  148   GQAGLTFWAPNINIFRDPRWGRGQETPGEDPMVASAYAIEFVKGFQGGHWKNGTETESTG  207

Query  1965  KYSLSGNRM---PEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTY  1795
             ++ +   R+    + E +DD+LMLSACCKH TAYDLE W NFSRYSFNAVVT QDMEDTY
Sbjct  208   RHGIGQKRVLLGEDGEINDDKLMLSACCKHSTAYDLEKWGNFSRYSFNAVVTEQDMEDTY  267

Query  1794  EPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFE  1615
             +PPF+SC++KG+ASCLMC+YN VNG+PACA +DLL+K RT+WGF+GYITSDCDAVATIFE
Sbjct  268   QPPFRSCIQKGKASCLMCSYNEVNGVPACAREDLLQKTRTEWGFKGYITSDCDAVATIFE  327

Query  1614  YQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRL  1435
             YQ Y+KSPE+A  IALKAG DINCGTY+LRN +SA+E   + E DID+AL NLFSVQ RL
Sbjct  328   YQNYSKSPEDAVAIALKAGMDINCGTYVLRNAQSAVEKGKLQEEDIDQALHNLFSVQLRL  387

Query  1434  GLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVI  1255
             GLF+G     +F   GPK+VC+ EH+ LALEAARQGIVLLKN++KFLPL+K  VSSLA+I
Sbjct  388   GLFDGDPRKGQFGQLGPKNVCTKEHKTLALEAARQGIVLLKNDKKFLPLNKKDVSSLAII  447

Query  1254  GPMANTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAK  1078
             GP+AN + SLGGDY G PC  +S+ +GL  Y+ KTSYA GCLDVAC S   F +A+ +AK
Sbjct  448   GPLANKANSLGGDYAGYPCDPQSLFEGLKAYVKKTSYAIGCLDVACVSDTQFHKAIIVAK  507

Query  1077  RADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISF  898
             RA +VIVV GLDLSQETEDHDR SLLLPG QM+LV+ +A  S KP++LVLTGGGPLD+SF
Sbjct  508   RAGFVIVVAGLDLSQETEDHDRVSLLLPGKQMSLVSSVAAASKKPVILVLTGGGPLDVSF  567

Query  897   AKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRAD  718
             AK DPRIAS+LWIGYPGE G  AL+EI+FG+YNP GRLP+TWYPESFT+V M DMNMR +
Sbjct  568   AKGDPRIASILWIGYPGEAGANALAEIIFGEYNPGGRLPVTWYPESFTEVSMTDMNMRPN  627

Query  717   PSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGG  538
             PSRGYPGRTYRFYTG +VY FG GLSY++F+ ++LSAP+++SLS S+ +  R+ IL +GG
Sbjct  628   PSRGYPGRTYRFYTGNRVYGFGGGLSYTNFTYKILSAPSKLSLSGSLSSNSRKRILQQGG  687

Query  537   NE-PYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFD  361
                 Y++++E+++C+SL F +++ + N G MDG  VVMLFSR PT +  GAP+KQL+GFD
Sbjct  688   ERLSYININEITSCDSLRFYMQILVENVGNMDGGHVVMLFSRVPTVFR-GAPEKQLVGFD  746

Query  360   RVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             RVH   +  TE SI ++PC+HLS+ N +G +I+ LG HI
Sbjct  747   RVHTISHRSTEMSILVDPCEHLSVANEQGKKIMLLGGHI  785



>ref|XP_002299457.1| hypothetical protein POPTR_0001s10850g [Populus trichocarpa]
 gb|EEE84262.1| hypothetical protein POPTR_0001s10850g [Populus trichocarpa]
Length=780

 Score =   967 bits (2499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/753 (65%), Positives = 600/753 (80%), Gaps = 22/753 (3%)
 Frame = -3

Query  2505  ATSYSKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGI  2326
             + S + PQ PC+PPTH++Y FC+ SLPI  R  SL+S LT+ EKIQ+LSDN S IPRLGI
Sbjct  22    SKSVANPQFPCKPPTHNTYSFCNKSLPITRRAQSLISHLTLQEKIQQLSDNASGIPRLGI  81

Query  2325  PAYEWWSESLHGIATNGPGITFD--GAVKSATGFPQVILTAAAFNRTLWRSIaaaaavea  2152
             P YEWWSESLHGI+ NGPG++F   G V SATGFPQVI++AA+FNRTLW  I +A A+EA
Sbjct  82    PHYEWWSESLHGISINGPGVSFKNGGPVTSATGFPQVIVSAASFNRTLWFLIGSAIAIEA  141

Query  2151  rAMFNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkn  1972
             RAM+N GQAGLTFWAPN+N+F DPRWGRGQETPGEDPMV S YA+E+V+           
Sbjct  142   RAMYNVGQAGLTFWAPNINIFRDPRWGRGQETPGEDPMVASAYAIEFVK-----------  190

Query  1971  gRKYSLSGNRMPEE--EEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDT  1798
                    G     E  E +DD+LMLSACCKH TAYDLE W NFSRYSFNAVVT QDMEDT
Sbjct  191   ----GFQGGHWKNEDGEINDDKLMLSACCKHSTAYDLEKWGNFSRYSFNAVVTEQDMEDT  246

Query  1797  YEPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIF  1618
             Y+PPF+SC++KG+ASCLMC+YN VNG+PACA +DLL+K RT+WGF+GYITSDCDAVATIF
Sbjct  247   YQPPFRSCIQKGKASCLMCSYNEVNGVPACAREDLLQKPRTEWGFKGYITSDCDAVATIF  306

Query  1617  EYQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFR  1438
             EYQ Y+KSPE+A  IALKAG DINCGTY+LRN +SA+E   + E DIDRAL NLFSVQ R
Sbjct  307   EYQNYSKSPEDAVAIALKAGMDINCGTYVLRNAQSAVEKGKLQEEDIDRALHNLFSVQLR  366

Query  1437  LGLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAV  1258
             LGLF+G     +F   GPK+VC+ EH+ LALEAARQGIVLLKN++K LPL+K  VSSLA+
Sbjct  367   LGLFDGDPRKGQFGKLGPKNVCTKEHKTLALEAARQGIVLLKNDKKLLPLNKKAVSSLAI  426

Query  1257  IGPMANTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIA  1081
             IGP+AN + SLGGDYTG PC  +S+ +GL  Y+ KTSYA GCLDVAC S   F +A+ +A
Sbjct  427   IGPLANMANSLGGDYTGYPCDPQSLFEGLKAYVKKTSYAIGCLDVACVSDTQFHKAIIVA  486

Query  1080  KRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDIS  901
             KRAD+VI+V GLDLSQETE+HDR SLLLPG QM+LV+ +A  S KP++LVLTGGGPLD+S
Sbjct  487   KRADFVIIVAGLDLSQETEEHDRVSLLLPGKQMSLVSSVAAASKKPVILVLTGGGPLDVS  546

Query  900   FAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRA  721
             FAK DPRIAS+LWIGYPGE G KAL+EI+FG+YNP GRLP+TWYPESFT+V M DMNMR 
Sbjct  547   FAKGDPRIASILWIGYPGEAGAKALAEIIFGEYNPGGRLPMTWYPESFTEVSMTDMNMRP  606

Query  720   DPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRG  541
             +PSRGYPGRTYRFYTG +VY FG GLSY++F+ ++LSAP+++SLS S+ +  R+ IL +G
Sbjct  607   NPSRGYPGRTYRFYTGNRVYGFGGGLSYTNFTYKILSAPSKLSLSGSLSSNSRKRILQQG  666

Query  540   GNE-PYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGF  364
             G    Y++++E+++C+SL F +++ + N G MDG  VVMLFSR PT +  GAP+KQL+GF
Sbjct  667   GERLSYININEITSCDSLRFYMQILVENVGNMDGGHVVMLFSRVPTVFR-GAPEKQLVGF  725

Query  363   DRVHVSGNGVTETSISIEPCQHLSIVNVEGSRI  265
             DRVH   +  TE SI ++PC+HLS+ N +G +I
Sbjct  726   DRVHTISHRSTEMSILVDPCEHLSVANEQGKKI  758



>ref|XP_006357757.1| PREDICTED: probable beta-D-xylosidase 6-like [Solanum tuberosum]
Length=793

 Score =   966 bits (2498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/743 (65%), Positives = 594/743 (80%), Gaps = 7/743 (1%)
 Frame = -3

Query  2460  HSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGIAT  2281
             H  Y FC+  L I  R+HSL+SLLT+DEKI  LSDN ++IPRLG+PAYEWWSESLHGI T
Sbjct  38    HHKYTFCNKKLSISTRVHSLISLLTIDEKILHLSDNTTSIPRLGLPAYEWWSESLHGIGT  97

Query  2280  NGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWAPN  2101
             NGPGI F+G +KSAT FPQVILTAAAFNRTLW SIA+A AVEARAM+N+GQ+GLTFWAPN
Sbjct  98    NGPGINFNGPIKSATSFPQVILTAAAFNRTLWHSIASAIAVEARAMYNTGQSGLTFWAPN  157

Query  2100  VNVFVDPRWGRGQETPGEDPMVVSDYAVEYVr--glqgqglkgkngRKYSLSGNRMPEEE  1927
             +NVF DPRWGRGQETPGEDPMVVS YA+EYV            ++   +     R   +E
Sbjct  158   INVFRDPRWGRGQETPGEDPMVVSAYAIEYVTGFQELNSKADKESSNGHGFGNTRRVLKE  217

Query  1926  EDD--DRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRAS  1753
             +DD  D+LMLSACCKH TAYDLE W + +RY FNAVVT+QDMEDT++ PF+SC+++ +AS
Sbjct  218   DDDAGDKLMLSACCKHFTAYDLEKWGDATRYDFNAVVTKQDMEDTFQAPFRSCIQQAKAS  277

Query  1752  CLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGI  1573
             CLMC+YN+VNG+PACA+K LL+K RTDWGF+GYITSDCDAVATI+E Q Y K+PE+A  +
Sbjct  278   CLMCSYNSVNGVPACADKVLLDKVRTDWGFDGYITSDCDAVATIYENQNYTKTPEDAVAL  337

Query  1572  ALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFES  1393
             ALKAGT+INCGTYMLR++KSA +   V+E D+DRAL  LFSVQFRLGLF+G     +F  
Sbjct  338   ALKAGTNINCGTYMLRHVKSAFQQGSVLEEDLDRALQYLFSVQFRLGLFDGNPAKGQFAK  397

Query  1392  FGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTSSLGGDYT  1213
             FGP+DVC+S +  LAL+AARQGIVLLKN+QKFLPLDK  +S+LA++GPMAN SS GG YT
Sbjct  398   FGPQDVCTSNNLELALDAARQGIVLLKNDQKFLPLDKRSISTLAIVGPMANVSSPGGTYT  457

Query  1212  GIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQ  1033
             G+PC LKS+ +G   +I++T YA+GCLD+ CNST GF +A+SIAK ADYVIVV GLDLSQ
Sbjct  458   GVPCKLKSIHEGFHRHINRTLYAAGCLDIGCNSTAGFPDAISIAKEADYVIVVAGLDLSQ  517

Query  1032  ETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGY  853
             ETED DRYSLLLPG+Q  LV  LA VS KP++LVLTGGGP+D+SFA+KDPRIAS+LW+ Y
Sbjct  518   ETEDLDRYSLLLPGNQTNLVTALAAVSKKPIILVLTGGGPIDVSFAEKDPRIASILWVAY  577

Query  852   PGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFYTG  673
             PGE GGKALSEI+FG  NP G+LP+TWY ES+TKVPM +MNMRADP+  YPGRTYRFYTG
Sbjct  578   PGETGGKALSEIIFGYQNPGGKLPMTWYLESYTKVPMTNMNMRADPANDYPGRTYRFYTG  637

Query  672   EKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNE-PYVHVDEVSNCN  496
             + +Y FGHGLSY+SFS +LLSAP R+SLS   K+  +RSIL +  +   Y+HVDEV +C+
Sbjct  638   DPLYGFGHGLSYTSFSSQLLSAPNRLSLSLG-KSNWKRSILAQEHSRFGYIHVDEVPSCS  696

Query  495   SLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSIS  316
                F + +S+ N+G MDG+ V++LFSR P +   GAP KQL+GFDRVHV      ETS+S
Sbjct  697   LSKFFIHISVTNDGDMDGNHVLLLFSRVPQNIQ-GAPLKQLVGFDRVHVPARKSVETSLS  755

Query  315   IEPCQHLSIVNVEGSRILPLGDH  247
             I PC+ LS  N +G+RIL LG+H
Sbjct  756   INPCEFLSFSNDQGNRILALGEH  778



>ref|XP_007047697.1| Glycosyl hydrolase family protein [Theobroma cacao]
 gb|EOX91854.1| Glycosyl hydrolase family protein [Theobroma cacao]
Length=828

 Score =   965 bits (2495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/760 (63%), Positives = 600/760 (79%), Gaps = 7/760 (1%)
 Frame = -3

Query  2505  ATSYSKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGI  2326
             ++S   PQ PC+PP  +SYPFC+TSL I  R  SL+SLLT+ EKIQ+LS+N S IPRLGI
Sbjct  22    SSSNPNPQFPCEPPYFNSYPFCNTSLSITDRAQSLISLLTLREKIQQLSNNASGIPRLGI  81

Query  2325  PAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearA  2146
             P YEWWSESLHG+A+NGPG++F+G VK+AT FPQV++ AA+FNRTLW  I  A  VEA+A
Sbjct  82    PPYEWWSESLHGVASNGPGVSFNGIVKAATSFPQVLVMAASFNRTLWFKIGLAVGVEAKA  141

Query  2145  MFNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngR  1966
             M+N GQAGLTFWAPN+N+F DPRWGRGQETPGEDPMVVS YA+E+V+G QG    G    
Sbjct  142   MYNVGQAGLTFWAPNINIFRDPRWGRGQETPGEDPMVVSAYAIEFVKGFQGGSWGGSGTF  201

Query  1965  KYSLSGNRM--PEEEEDDDR---LMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMED  1801
             +    G R    +  +DD+R   LM SACCKH  AYDLE W NFSRYSFNAVVT+QDMED
Sbjct  202   RDRFRGKRALRGDNHDDDERGDGLMNSACCKHFIAYDLEKWENFSRYSFNAVVTKQDMED  261

Query  1800  TYEPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATI  1621
             TYEPPF+SC+++G+ASCLMC+YNA+NG+PACA  DLL+KAR +WGF+GYITSDCDAVAT+
Sbjct  262   TYEPPFRSCIQQGKASCLMCSYNAINGVPACARGDLLQKARNEWGFKGYITSDCDAVATV  321

Query  1620  FEYQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQF  1441
              E Q Y + PE+A    LKAG DINCG+Y++R+ ++ +E   + E DIDRALLNLFSVQ 
Sbjct  322   QEDQNYTRIPEDAVADVLKAGMDINCGSYLVRHTQTTIEQGKLQEMDIDRALLNLFSVQL  381

Query  1440  RLGLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLA  1261
             RLGLF+G     +F   G +++C+S+H+ LALEAARQGIVLLKN+++FLPL++  VSSLA
Sbjct  382   RLGLFDGDPRKGQFGKLGQQEICTSQHKMLALEAARQGIVLLKNKKRFLPLNRNAVSSLA  441

Query  1260  VIGPMANT-SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSI  1084
             +IGPMAN  S++GG Y+G+PC  KS+ +GL  Y+ + SYASGC DV C+S  GF EA+  
Sbjct  442   IIGPMANNISNMGGGYSGVPCDPKSLFEGLQGYVKQASYASGCSDVPCDSDAGFNEAILT  501

Query  1083  AKRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDI  904
             AK+AD+VIV+ GLDLSQETEDHDR SLLLPG QMALV+ +A  S KP++LVLTGGGPLD+
Sbjct  502   AKKADFVIVIAGLDLSQETEDHDRVSLLLPGKQMALVSSIAAASEKPIILVLTGGGPLDV  561

Query  903   SFAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMR  724
             SFA+ D +IAS+LW+GYPGE GGKAL+E++FGDYNP GRLP+TWYPESFT++PMNDM+MR
Sbjct  562   SFAEGDLKIASILWVGYPGEAGGKALAEVIFGDYNPGGRLPMTWYPESFTRIPMNDMDMR  621

Query  723   ADPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNR  544
             ADP RGYPGRTYRFYTG++VY FG GLSY+ F+ + L AP ++SLS+S      ++IL++
Sbjct  622   ADPFRGYPGRTYRFYTGKRVYGFGQGLSYTDFTYKFLFAPRKLSLSRSFTGTSSKNILHQ  681

Query  543   GGNEPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGF  364
                   VH+DEV++C+SL F V +S+ N G MDGS VVMLFSRAP  + G A +KQLI F
Sbjct  682   RQVLDSVHIDEVTSCDSLRFYVHISVTNVGDMDGSHVVMLFSRAPKIFQGTA-EKQLIAF  740

Query  363   DRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             DR+H S    T+TSI ++PC HLSI N  G RILPLGDH+
Sbjct  741   DRIHTSSYRSTKTSILVDPCNHLSIANEHGERILPLGDHV  780



>ref|XP_004288313.1| PREDICTED: probable beta-D-xylosidase 6-like, partial [Fragaria 
vesca subsp. vesca]
Length=763

 Score =   965 bits (2495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/751 (65%), Positives = 597/751 (79%), Gaps = 7/751 (1%)
 Frame = -3

Query  2487  PQLPCQPPTHSS-YPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEW  2311
             PQ PC  P H++ YPFC+TSLP   R  SLVSLLT++EKIQ+LS++ S IPRLGIP YEW
Sbjct  2     PQFPCSQPHHNTLYPFCNTSLPTSTRAQSLVSLLTLNEKIQQLSNSASGIPRLGIPPYEW  61

Query  2310  WSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSG  2131
             WSESLHGIATNGPG++F+G++ SAT FPQVI+TAAAFNRTLW  I +A AVEARAM+N G
Sbjct  62    WSESLHGIATNGPGVSFNGSIASATSFPQVIVTAAAFNRTLWNLIGSAIAVEARAMYNFG  121

Query  2130  QAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLS  1951
             QAGLTFWAPN+N+F DPRWGRGQETPGEDPMV S YAVE+V+G QG    G +G +    
Sbjct  122   QAGLTFWAPNINIFRDPRWGRGQETPGEDPMVASAYAVEFVKGFQGGSWGGGSGVRNGFG  181

Query  1950  GNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCV  1771
             G R+ EE    D LMLSACCKH TAYDLE+W  +SRYSFNAVV+ QD+EDTY+PPF+SC+
Sbjct  182   GRRVLEES---DGLMLSACCKHFTAYDLEMWGKYSRYSFNAVVSEQDLEDTYQPPFRSCI  238

Query  1770  EKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKSP  1591
             ++G+ASCLMC+YNAVNG+PACA+KDLL+K R +WGF+GYITSDCDAVAT+FEYQ Y K+ 
Sbjct  239   QQGKASCLMCSYNAVNGVPACADKDLLDKVREEWGFKGYITSDCDAVATVFEYQNYTKTI  298

Query  1590  EEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAV  1411
             E+A    LKAGTDINCGTY++RN  S ++   V E DIDRALLNLFSVQ RLGLF+G  +
Sbjct  299   EDAVADVLKAGTDINCGTYLVRNTLSTIKQGKVQEEDIDRALLNLFSVQLRLGLFDGDPI  358

Query  1410  NRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTSS  1231
               ++   GP+DVC+SEH+ LALEAARQGIVLLKN++KFLPL+K    SLAVIGP+AN +S
Sbjct  359   KGQYGRLGPQDVCTSEHKNLALEAARQGIVLLKNDKKFLPLNKGVDFSLAVIGPLANNAS  418

Query  1230  -LGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVV  1054
              LGG YTGIPC  K+  +GL EY   TSY +GC DV C+S  GF EA+  AK AD+ ++V
Sbjct  419   LLGGGYTGIPCNPKTPFEGLQEYRKGTSYTAGCHDVPCDSDTGFKEAIHAAKEADFSVIV  478

Query  1053  VGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIA  874
             VGLD SQE EDHDR SLLLPG QMALV+ +A  S  P++LVL GGGPLD+SFAKKDPRIA
Sbjct  479   VGLDASQEREDHDRVSLLLPGKQMALVSSVAAASKNPVILVLAGGGPLDVSFAKKDPRIA  538

Query  873   SVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGR  694
             S+L+IGYPGE GG+ALSEI+FGD+NP+GRL +TWY ESFT +PMNDMNMRADPSRGYPGR
Sbjct  539   SILYIGYPGETGGRALSEIIFGDFNPSGRLTMTWYFESFTNIPMNDMNMRADPSRGYPGR  598

Query  693   TYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGN-EPYVHV  517
             TYRFYTG +VY FGHGLSY++F+  ++SAPT++S+    K    +++L++ G+   Y+ +
Sbjct  599   TYRFYTGNRVYGFGHGLSYTNFTYNIVSAPTKLSIQTPFKVYSIKNVLHQAGDANGYLRL  658

Query  516   DEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNG  337
             DEVS+C+SL FSV + + N G MDGS  VML+SR P     GAP++QLIGF++VH   + 
Sbjct  659   DEVSSCDSLRFSVEIVVMNVGDMDGSHTVMLYSRVP-EIMKGAPKQQLIGFNQVHTISSK  717

Query  336   VTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
              T TSI ++PC HLS  N  G R++PLGDH+
Sbjct  718   STPTSILVDPCTHLSFANDYGERVMPLGDHM  748



>ref|XP_003612944.1| Beta-D-xylosidase [Medicago truncatula]
 gb|AES95902.1| glycoside hydrolase family 3 protein [Medicago truncatula]
Length=783

 Score =   959 bits (2479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/755 (64%), Positives = 590/755 (78%), Gaps = 16/755 (2%)
 Frame = -3

Query  2496  YSKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAY  2317
             ++ P  PC+PP HS YPFC+ SLPI  R  SL+SLLT+ +KI +LS+  S+I  LGIP+Y
Sbjct  26    FTTPDYPCKPP-HSHYPFCNISLPISTRTTSLISLLTLSDKINQLSNTASSISHLGIPSY  84

Query  2316  EWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFN  2137
             +WWSE+LHGIATNGPG+ F+G+VKSAT FPQVI++AAAFNR+LW  I  A  VE RAMFN
Sbjct  85    QWWSEALHGIATNGPGVNFNGSVKSATNFPQVIVSAAAFNRSLWFLIGYAVGVEGRAMFN  144

Query  2136  SGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYS  1957
              GQAGL+FWAPNVNVF DPRWGRGQETPGEDPMV S YAVE+VRG+QG     K      
Sbjct  145   VGQAGLSFWAPNVNVFRDPRWGRGQETPGEDPMVGSAYAVEFVRGIQGVDGIKKV-----  199

Query  1956  LSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKS  1777
                  + + + DDD LM+SACCKH TAYDLE W  FSRY+FNAVVT+QD+EDTY+PPF+ 
Sbjct  200   -----LNDHDSDDDGLMVSACCKHFTAYDLEKWGEFSRYNFNAVVTQQDLEDTYQPPFRG  254

Query  1776  CVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAK  1597
             CV++G+ASCLMC+YN VNG+PACA+KDLL   R  WGFEGYI SDCDAVAT+FEYQ+YAK
Sbjct  255   CVQQGKASCLMCSYNEVNGVPACASKDLLGLVRNKWGFEGYIASDCDAVATVFEYQKYAK  314

Query  1596  SPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGK  1417
             S E+A    LKAG DINCGT+MLR+ +SA+E  +V E D+DRAL NLFSVQ RLGLFNG 
Sbjct  315   SAEDAVADVLKAGMDINCGTFMLRHTESAIEQGLVKEEDLDRALFNLFSVQMRLGLFNGD  374

Query  1416  AVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANT  1237
                 KF   GP+DVC+ EH++LALEAARQGIVLLKN+ KFLPLDK    SLA+IGPMA T
Sbjct  375   PEKGKFGKLGPQDVCTPEHKKLALEAARQGIVLLKNDNKFLPLDKKDRVSLAIIGPMATT  434

Query  1236  SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIV  1057
             S LGG Y+GIPC+ +S+ DGL EY+   SYA GC DV C+S DGFA A+ IAK+AD+V++
Sbjct  435   SELGGGYSGIPCSPRSLYDGLKEYVKTISYAFGCSDVKCDSDDGFAVAIDIAKQADFVVI  494

Query  1056  VVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRI  877
             V GLD + ETED DR SLLLPG QM LV+ +A  S +P++LVLTGGGPLD+SFA+ +  I
Sbjct  495   VAGLDTTLETEDLDRVSLLLPGKQMDLVSRVAAASKRPVILVLTGGGPLDVSFAESNQLI  554

Query  876   ASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPG  697
              S+LWIGYPGE GGKAL+EI+FG++NPAGRLP+TWYPESFT VPMNDM MRADPSRGYPG
Sbjct  555   TSILWIGYPGEAGGKALAEIIFGEFNPAGRLPMTWYPESFTNVPMNDMGMRADPSRGYPG  614

Query  696   RTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPY---  526
             RTYRFYTG ++Y FGHGLSYS FS  +LSAP+++SLS++    LRRS+LN+   + +   
Sbjct  615   RTYRFYTGSRIYGFGHGLSYSDFSYRVLSAPSKLSLSKTTNGGLRRSLLNKVEKDVFEVD  674

Query  525   -VHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHV  349
              VHVDE+ NCNSL+FSV +S+ N G MDGS VVMLFS+ P +   G+P+ QL+G  R+H 
Sbjct  675   HVHVDELQNCNSLSFSVHISVMNVGDMDGSHVVMLFSKWPKNIQ-GSPESQLVGPSRLHT  733

Query  348   SGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
               N   ETSI  +PC+H S  + +G RILPLG+HI
Sbjct  734   VSNKSIETSILADPCEHFSFADEQGKRILPLGNHI  768



>ref|XP_010105119.1| putative beta-D-xylosidase 6 [Morus notabilis]
 gb|EXC03904.1| putative beta-D-xylosidase 6 [Morus notabilis]
Length=790

 Score =   950 bits (2456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/752 (63%), Positives = 599/752 (80%), Gaps = 5/752 (1%)
 Frame = -3

Query  2490  KPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEW  2311
             KP  PC+PP  +SY FC+TSLPI +R  SL+S LT+ EKI++LS+N SA+PRLGIPAY+W
Sbjct  25    KPLFPCEPPKQNSYQFCNTSLPISSRARSLISHLTLQEKIRQLSNNASAVPRLGIPAYQW  84

Query  2310  WSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSG  2131
             WSESLHG+ATNGPG++F+G++ +A  FPQV+L AA+FNR+LW S+A+A AVEARAM+N G
Sbjct  85    WSESLHGLATNGPGVSFNGSIAAAAAFPQVLLMAASFNRSLWSSVASAVAVEARAMYNYG  144

Query  2130  QAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVr--glqgqglkgkngRKYS  1957
             QAGLTFWAPNVNVF DPRWGRGQETPGEDPMV S +AVE+V+        ++   G K  
Sbjct  145   QAGLTFWAPNVNVFRDPRWGRGQETPGEDPMVGSAFAVEFVKGFQGGNGRIESGIGEKIR  204

Query  1956  LSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKS  1777
             +  +   +++     LMLSACCKHLTAYDLE+W +FSRY+FNAV+T QD EDTY+PPF+S
Sbjct  205   VLEDDQDDDDGKSGDLMLSACCKHLTAYDLEMWGSFSRYNFNAVITDQDFEDTYQPPFRS  264

Query  1776  CVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAK  1597
             CV++G+ASC+MC+YNAVNG+PACA KDLL +AR  WG +GYITSDCDAVAT+ EYQ Y K
Sbjct  265   CVQQGKASCVMCSYNAVNGVPACAQKDLLAQARDKWGLKGYITSDCDAVATVLEYQHYTK  324

Query  1596  SPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGK  1417
             +PE+A    LKAG DINCGTY+LR+  +A++ + V+E DIDRAL+NLFSVQ RLGLF+G 
Sbjct  325   NPEDAVADVLKAGMDINCGTYLLRHTLAAIQQEKVLEEDIDRALINLFSVQIRLGLFDGD  384

Query  1416  AVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANT  1237
                 K+   GP+DVC+SE ++LALEAARQGIVLLKN++KFLPL K  VSSLAVIGP+A+ 
Sbjct  385   PRKGKYGRLGPQDVCTSETKKLALEAARQGIVLLKNDKKFLPLKKDVVSSLAVIGPLADD  444

Query  1236  -SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVI  1060
              + LGG YTG+PC+ KS+ DG  +Y+ KTSYA+GC +V+C S +GF EA++IAK ADYV+
Sbjct  445   GTKLGGGYTGVPCSQKSLFDGFRDYVKKTSYAAGCFNVSCYSDEGFDEAINIAKEADYVV  504

Query  1059  VVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPR  880
             VV G+DLSQETEDHDR SLLLPG QMALV+ +A  S  P++LVLTGGGPLD+ FA+K P+
Sbjct  505   VVAGIDLSQETEDHDRVSLLLPGKQMALVSSVAAASKNPVILVLTGGGPLDVLFAEKSPQ  564

Query  879   IASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYP  700
             IAS++W+GYPG+EGG+AL+EI+FGD NP GRLP+TWYPE+FT VPMNDM MRADPSRGYP
Sbjct  565   IASMIWVGYPGQEGGRALAEIIFGDVNPGGRLPMTWYPEAFTNVPMNDMRMRADPSRGYP  624

Query  699   GRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNE-PYV  523
             GRTYRFYTG +VY FG GLSYS+++   LS P+++S+S S +   R + +++ G++  Y+
Sbjct  625   GRTYRFYTGSRVYAFGQGLSYSNYTYRFLSVPSKLSVSGSFEDAFRENAIHQVGDQLDYI  684

Query  522   HVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSG  343
             ++D V +C+SL FSV +S  N G MDG+ VV+LFSR P     GAP+KQLIGF  V+   
Sbjct  685   YIDAVPSCDSLRFSVEISTMNVGDMDGAHVVLLFSRPP-KVVQGAPEKQLIGFSSVNTIS  743

Query  342   NGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             NG T TSI ++ C HLS  N +G R+LPLGDH
Sbjct  744   NGSTSTSILVDSCMHLSFANEKGRRVLPLGDH  775



>ref|XP_003534261.1| PREDICTED: probable beta-D-xylosidase 6-like [Glycine max]
Length=780

 Score =   942 bits (2434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/740 (65%), Positives = 592/740 (80%), Gaps = 17/740 (2%)
 Frame = -3

Query  2454  SYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGIATNG  2275
             S+PFCDTSLP   R  SLVSLLT+ EKI  LS+N S+IPRLGIPAY+WWSESLHG+A NG
Sbjct  38    SHPFCDTSLPTLTRARSLVSLLTLPEKILLLSNNASSIPRLGIPAYQWWSESLHGLALNG  97

Query  2274  PGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWAPNVN  2095
             PG++F GAV SAT FPQVIL+AA+FNR+LW   AAA A EARAMFN GQAGLTFWAPN+N
Sbjct  98    PGVSFAGAVPSATSFPQVILSAASFNRSLWLRTAAAIAREARAMFNVGQAGLTFWAPNIN  157

Query  2094  VFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEEEDDD  1915
             +F DPRWGRGQETPGEDPM+ S YAVEYVRGLQ             LSG +     +DDD
Sbjct  158   LFRDPRWGRGQETPGEDPMLASAYAVEYVRGLQ------------GLSGIQDAVVVDDDD  205

Query  1914  RLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCLMCAY  1735
              LM+SACCKH TAYDL++W  FSRY+FNAVV++QD+EDTY+PPF+SC+++G+ASCLMC+Y
Sbjct  206   TLMVSACCKHFTAYDLDMWGQFSRYNFNAVVSQQDLEDTYQPPFRSCIQQGKASCLMCSY  265

Query  1734  NAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIALKAGT  1555
             N VNG+PACA+++LL  AR  WGF+GYITSDCDAVAT++EYQ+YAKS E+A    LKAG 
Sbjct  266   NEVNGVPACASEELLGLARDKWGFKGYITSDCDAVATVYEYQKYAKSQEDAVADVLKAGM  325

Query  1554  DINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESFGPKDV  1375
             DINCGT+MLR+ +SA+E   V E D+DRALLNLFSVQ RLGLF+G  +  +F   GPKDV
Sbjct  326   DINCGTFMLRHTESAIEQGKVKEEDLDRALLNLFSVQLRLGLFDGDPIRGRFGKLGPKDV  385

Query  1374  CSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTSSLGGDYTGIPCAL  1195
             C+ EH+ LAL+AARQGIVLLKN++KFLPLD+   +SLAVIGP+A T+ LGG Y+GIPC+ 
Sbjct  386   CTQEHKTLALDAARQGIVLLKNDKKFLPLDRDIGASLAVIGPLATTTKLGGGYSGIPCSS  445

Query  1194  KSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQETEDHD  1015
              S+ +GLGE+  + SYA GC DV C+S DGFAEA+  AK+AD+V++V GLD +QETEDHD
Sbjct  446   SSLYEGLGEFAERISYAFGCYDVPCDSDDGFAEAIDTAKQADFVVIVAGLDATQETEDHD  505

Query  1014  RYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGYPGEEGG  835
             R SLLLPG QM LV+ +A  S  P++LVL GGGPLD+SFA+K+P+IAS++W+GYPGE GG
Sbjct  506   RVSLLLPGKQMNLVSSVADASKNPVILVLIGGGPLDVSFAEKNPQIASIIWLGYPGEAGG  565

Query  834   KALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFYTGEKVYEF  655
             KAL+EI+FG++NPAGRLP+TWYPE+FT VPMN+M+MRADPSRGYPGRTYRFYTG +VY F
Sbjct  566   KALAEIIFGEFNPAGRLPMTWYPEAFTNVPMNEMSMRADPSRGYPGRTYRFYTGGRVYGF  625

Query  654   GHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNE----PYVHVDEVSNCNSLA  487
             GHGLS+S FS   LSAP++ISLS++IK   R+ +L +  NE     YV V+++ NCN L+
Sbjct  626   GHGLSFSDFSYNFLSAPSKISLSRTIKDGSRKRLLYQVENEVYGVDYVPVNQLQNCNKLS  685

Query  486   FSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSISIEP  307
             FSV +S+ N GG+DGS VVMLFS+ P     G+P+ QL+GF R+H   +  TETSI + P
Sbjct  686   FSVHISVMNLGGLDGSHVVMLFSKGP-KVVDGSPETQLVGFSRLHTISSKPTETSILVHP  744

Query  306   CQHLSIVNVEGSRILPLGDH  247
             C+HLS  + +G RILPLG H
Sbjct  745   CEHLSFADKQGKRILPLGPH  764



>ref|XP_006399554.1| hypothetical protein EUTSA_v10012725mg [Eutrema salsugineum]
 gb|ESQ41007.1| hypothetical protein EUTSA_v10012725mg [Eutrema salsugineum]
Length=796

 Score =   941 bits (2433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/758 (63%), Positives = 591/758 (78%), Gaps = 9/758 (1%)
 Frame = -3

Query  2493  SKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             S P+ PC+PP  SSYPFC+ SL I  R  SLVS LT+ EKI +LS+  +++PRLGIP YE
Sbjct  26    SHPKFPCKPPHFSSYPFCNVSLSIRQRALSLVSFLTLPEKIGQLSNTAASVPRLGIPPYE  85

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSESLHGIA NGPG++F+G+V SAT FPQVI++AA+FNRTLW  I +A AVE RAM+N+
Sbjct  86    WWSESLHGIADNGPGVSFNGSVSSATSFPQVIVSAASFNRTLWYEIGSAVAVEGRAMYNA  145

Query  2133  GQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSL  1954
             GQAGLTFWAPN+NVF DPRWGRGQETPGEDP VVS+Y VE+VRG Q +       R++  
Sbjct  146   GQAGLTFWAPNINVFRDPRWGRGQETPGEDPKVVSEYGVEFVRGFQERRKTKVLKRRFGD  205

Query  1953  SGNRMPEEEEDDD---RLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
               +    +++D     +LMLSACCKH TAYDLE W NF+RY FNAVVT QDMEDTY+PPF
Sbjct  206   DDDGDAHDDDDGGDDGKLMLSACCKHFTAYDLEKWGNFTRYDFNAVVTEQDMEDTYQPPF  265

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQY  1603
             +SC+  G+ASCLMC+YNAVNG+PACA +DLL+KAR +WGF+GYITSDCDAVATIFEYQ Y
Sbjct  266   QSCIRDGKASCLMCSYNAVNGVPACAQEDLLQKARAEWGFKGYITSDCDAVATIFEYQGY  325

Query  1602  AKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFN  1423
              KSPEEA   A+KAG DINCGTYMLRN +SA+E  +V E  +D+AL+NLF+VQ RLGLF+
Sbjct  326   TKSPEEAVADAIKAGVDINCGTYMLRNTRSAIEKGMVSEEQVDQALVNLFAVQLRLGLFD  385

Query  1422  GKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMA  1243
             G   +  +   G  D+CSS HR LALEAARQGIVLLKN+ K LPL+K RVSSLA+IGPMA
Sbjct  386   GDPRDGHYAKLGSNDICSSGHRNLALEAARQGIVLLKNDHKLLPLNKNRVSSLAIIGPMA  445

Query  1242  NT-SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADY  1066
             N  S++GG YTG PC  K++   L  Y+ KTSYASGC DV+C S  GF EA++IAK AD+
Sbjct  446   NNISNMGGTYTGKPCQQKTLFTELLNYVKKTSYASGCSDVSCGSGTGFGEAIAIAKGADF  505

Query  1065  VIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKD  886
             VIVV GLDLSQETED DR+SL LPG Q  LV+ +A VS KP++LVLTGGGP+D++FAK D
Sbjct  506   VIVVAGLDLSQETEDRDRFSLSLPGKQKDLVSSVAAVSKKPVILVLTGGGPVDVTFAKTD  565

Query  885   PRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRG  706
             PRI S++WIGYPGE GG+AL+EI+FGD+NP GRLP+TWYPESFT+V M+DM+MRAD SRG
Sbjct  566   PRIGSIIWIGYPGETGGQALAEIIFGDFNPGGRLPMTWYPESFTEVAMSDMHMRADSSRG  625

Query  705   YPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNE--  532
             YPGRTYRFYTG +VYEFG GLSY+ F  +++SAP+R+SL + +     + +L + G+E  
Sbjct  626   YPGRTYRFYTGPQVYEFGIGLSYTRFDYKIISAPSRLSLLKLLPQHSHKKLLLQNGDEVI  685

Query  531   PYVHVDE--VSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDR  358
              Y+ +D+  V++C SL F+VR S+ N G  DGS V+MLFSR P   + G P+KQLIGFDR
Sbjct  686   RYLELDDLGVNSCESLRFNVRFSVTNTGETDGSHVLMLFSRMPPVLS-GVPKKQLIGFDR  744

Query  357   VHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             VHV  N + ET   I+PC+ LS+ N  G R++PLG H+
Sbjct  745   VHVRSNEMIETVFVIDPCKQLSVANDAGKRVIPLGVHV  782



>ref|XP_006287090.1| hypothetical protein CARUB_v10000252mg, partial [Capsella rubella]
 gb|EOA19988.1| hypothetical protein CARUB_v10000252mg, partial [Capsella rubella]
Length=803

 Score =   941 bits (2433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/757 (63%), Positives = 586/757 (77%), Gaps = 8/757 (1%)
 Frame = -3

Query  2493  SKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             S PQ PC+PP  SSYPFC+ SL +  R  SLVSLLT+ EKI +LS+  +++PRLGIP YE
Sbjct  34    SHPQFPCKPPHFSSYPFCNVSLSVKQRAISLVSLLTLPEKIGQLSNTAASVPRLGIPPYE  93

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSESLHGIA NGPG++F+G++ SAT FPQVI++AA+FNRTLW  I +A AVEARAM+N 
Sbjct  94    WWSESLHGIADNGPGVSFNGSISSATSFPQVIVSAASFNRTLWYEIGSAVAVEARAMYNG  153

Query  2133  GQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSL  1954
             GQAGLTFWAPN+NVF DPRWGRGQETPGEDP VVS+Y VE+VRG Q    +    R++  
Sbjct  154   GQAGLTFWAPNINVFRDPRWGRGQETPGEDPKVVSEYGVEFVRGFQENRKRKVLKRRFGD  213

Query  1953  SGNRMPEEEE--DDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFK  1780
               +      +  DD +LMLSACCKH TAYDLE W NF+RY FNAVVT QDMEDTY+PPF+
Sbjct  214   GDDDDARYNDDGDDGKLMLSACCKHFTAYDLEKWGNFTRYDFNAVVTEQDMEDTYQPPFQ  273

Query  1779  SCVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYA  1600
             SC+  G+ASCLMC+YNAVNG+PACA + LL+KAR +WGFEGYITSDCDAVATIFEYQ Y 
Sbjct  274   SCITDGKASCLMCSYNAVNGVPACAQEHLLKKARIEWGFEGYITSDCDAVATIFEYQGYT  333

Query  1599  KSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNG  1420
             KSPEEA   A+KAG DINCGTYMLRN KSA+    V E  +D+ALLNLF+VQ RLGLF+G
Sbjct  334   KSPEEAVADAIKAGVDINCGTYMLRNTKSAILKGKVSEEQVDQALLNLFAVQLRLGLFDG  393

Query  1419  KAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN  1240
                   +   G  D+CSS+HR+LALEAARQGIVLLKN  K LPL+K  VSSLA++GPMAN
Sbjct  394   DPREGLYAKLGSNDICSSDHRKLALEAARQGIVLLKNVHKLLPLNKNHVSSLAIVGPMAN  453

Query  1239  T-SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYV  1063
               S++GG YTG PC   ++   L EY+ KTSYASGC DV+C+S +GF EAV+IAK ADYV
Sbjct  454   NISNMGGTYTGKPCQRTTLFTELLEYVKKTSYASGCSDVSCDSDNGFREAVAIAKGADYV  513

Query  1062  IVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDP  883
             IVV GLDLSQETED DR+SL LPG Q  LV+ +A VS KP++LVLTGGGP+D++FAK DP
Sbjct  514   IVVAGLDLSQETEDKDRFSLSLPGKQKDLVSSVAAVSKKPVILVLTGGGPVDVTFAKTDP  573

Query  882   RIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGY  703
             RI S++WIGYPGE GG+AL+EI+FGD+NP GRLP+TWYPESFT V M+DM+MRAD SRGY
Sbjct  574   RIGSIIWIGYPGETGGQALAEIIFGDFNPGGRLPMTWYPESFTDVAMSDMHMRADSSRGY  633

Query  702   PGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEP--  529
             PGRTYRFYTG +VY FG GLSY+ F  ++ SAPTR+SLS  +  +     L   G E   
Sbjct  634   PGRTYRFYTGPQVYSFGAGLSYTKFDYKITSAPTRLSLSALVPKQSSHKKLIIQGEEQLR  693

Query  528   YVHVDE--VSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRV  355
             ++ +D+  V++C SL F+V+V++ N+G +DGS V+MLFS+ P   + G P+KQLIGFDRV
Sbjct  694   FLQLDDATVNSCESLRFNVQVNVSNSGEIDGSHVLMLFSKMPQVIS-GVPEKQLIGFDRV  752

Query  354   HVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             HV    + ET + I+PC+HL + N  G R++PLG H+
Sbjct  753   HVRSKEMIETVLVIDPCKHLIVANDVGKRVIPLGIHV  789



>ref|XP_004512546.1| PREDICTED: probable beta-D-xylosidase 6-like [Cicer arietinum]
Length=788

 Score =   940 bits (2429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/757 (63%), Positives = 588/757 (78%), Gaps = 10/757 (1%)
 Frame = -3

Query  2502  TSYSKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIP  2323
             TS   P  PC+PP HS Y FCD SLPI  R++SL+SLLT+ +KIQ+LS+N S+IP LGIP
Sbjct  23    TSNPIPSYPCKPPHHSHYSFCDKSLPITTRVNSLISLLTLSDKIQQLSNNASSIPNLGIP  82

Query  2322  AYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAM  2143
              Y+WWSESLHGIATNGPG++F+G VKSAT FPQVI++AA+FNR+LW  I +A  VE R+M
Sbjct  83    PYQWWSESLHGIATNGPGVSFNGTVKSATDFPQVIVSAASFNRSLWFLIGSAVGVEGRSM  142

Query  2142  FNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             FN GQAGLT+WAPNVN+F DPRWGRGQETPGEDPM+ S YA+++VRGLQG         K
Sbjct  143   FNLGQAGLTYWAPNVNIFRDPRWGRGQETPGEDPMLASAYAIQFVRGLQGVQGI-----K  197

Query  1962  YSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
                  +     + DDD LM+SACCKH TAYDLE W  F+RY+FNAVV++QD+EDTY+PPF
Sbjct  198   TVFHDHHDHYHDHDDDGLMVSACCKHFTAYDLEKWGEFARYNFNAVVSQQDLEDTYQPPF  257

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQY  1603
             + CV++G+ASCLMC+YN VNG+PACA++DLL   R  WGFEGYITSDCDAVAT+FEYQ Y
Sbjct  258   RGCVQQGKASCLMCSYNEVNGVPACASEDLLGLVRNQWGFEGYITSDCDAVATVFEYQHY  317

Query  1602  AKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFN  1423
             AKSPE+     LKAG DINCGT +L + ++A+E  +V E D+DRAL NLFSVQ RLGLF+
Sbjct  318   AKSPEDTVADVLKAGVDINCGTSLLLHTEAAIEQGMVKEEDLDRALFNLFSVQMRLGLFD  377

Query  1422  GKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMA  1243
             G     KF   GP+DVC++EH+ LALEAARQGIVLLKN+ KFLPLD+   +SLA+IGPMA
Sbjct  378   GDPRRGKFGKLGPQDVCTTEHKTLALEAARQGIVLLKNDNKFLPLDRNDGASLAIIGPMA  437

Query  1242  NTSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYV  1063
              TS LGG Y+GIPC+ KS+ DGL  Y    SYA GC DV C+S DGFAEA+ IAK AD+V
Sbjct  438   TTSKLGGGYSGIPCSPKSLYDGLKGYAKTISYAFGCRDVPCDSDDGFAEAIDIAKEADFV  497

Query  1062  IVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDP  883
             +VV GLD + ETED DR SLLLPG QM LV+ +A  S +P++LVLTGGGPLD+SFA+ + 
Sbjct  498   VVVAGLDTTLETEDLDRVSLLLPGKQMDLVSHVAAASKRPVILVLTGGGPLDVSFAETNQ  557

Query  882   RIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGY  703
              IAS+LW+GYPGE GGKAL+EI+FG++NPAGRLP+TWYPESFT VPMNDM MRADPSRGY
Sbjct  558   LIASILWVGYPGEAGGKALAEIIFGEFNPAGRLPMTWYPESFTNVPMNDMRMRADPSRGY  617

Query  702   PGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNE---  532
             PGRTYRFYTG +VY FGHGLSYS FS + LSAP+++SLS+  K   R+S+LN+   +   
Sbjct  618   PGRTYRFYTGSRVYGFGHGLSYSDFSYKFLSAPSKLSLSRITKGGYRKSLLNKVEKDMSE  677

Query  531   -PYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRV  355
               +VHVDE+ NCNSL+F V +S+ N G ++GS VVMLFS+ P     G+P+ QL+GF R+
Sbjct  678   VDHVHVDELRNCNSLSFLVHISVMNLGDLNGSHVVMLFSKWPKVIQ-GSPETQLVGFSRL  736

Query  354   HVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             H   N   ETSI ++PC+H S  + +G  ILPLG H+
Sbjct  737   HTISNKSIETSILVDPCEHFSFADEQGKMILPLGHHV  773



>ref|XP_010023414.1| PREDICTED: probable beta-D-xylosidase 6 [Eucalyptus grandis]
Length=804

 Score =   939 bits (2427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/753 (64%), Positives = 576/753 (76%), Gaps = 21/753 (3%)
 Frame = -3

Query  2490  KPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEW  2311
             +P+ PC+PP    +PFC+ SLP PAR  SLVSLLT+ EKI  LSDN SA+PRLGIPAYEW
Sbjct  54    QPEFPCKPPRFHRHPFCNASLPAPARARSLVSLLTLREKILLLSDNASAVPRLGIPAYEW  113

Query  2310  WSESLHGIATNGPGITFD-GAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WSESLHGIATNGPG++F  G V SAT FPQV+L AAAFNRTLW ++ +A A EARAM+N 
Sbjct  114   WSESLHGIATNGPGVSFAAGPVGSATTFPQVLLMAAAFNRTLWSAVGSAIATEARAMYNV  173

Query  2133  GQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSL  1954
             GQ+GLTFWAPN+N+F DPRWGRGQETPGEDPMV S +AVE+V                  
Sbjct  174   GQSGLTFWAPNINIFRDPRWGRGQETPGEDPMVASAFAVEFVE---------------GF  218

Query  1953  SGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSC  1774
              G R   EEEDD  LMLSACCKH TAYDLE WH+ +RY+FNAVVT+QD++DT++PPF+SC
Sbjct  219   QGGRGGSEEEDDG-LMLSACCKHFTAYDLEKWHDLTRYNFNAVVTQQDLQDTFQPPFQSC  277

Query  1773  VEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKS  1594
             +++G+ASCLMCAYN VNG+PACA +DLL+KAR DWGF+GYITSDCDAVATIFEYQ + K+
Sbjct  278   IQQGKASCLMCAYNEVNGVPACAMQDLLQKARVDWGFKGYITSDCDAVATIFEYQHFVKT  337

Query  1593  PEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKA  1414
              E+A   ALKAG DINCG++++RN +SA+E   V E DIDRALLNLFSVQ RLG+F+G  
Sbjct  338   REDAVADALKAGMDINCGSFLVRNTESAVEQGKVGEEDIDRALLNLFSVQLRLGIFDGDP  397

Query  1413  VNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMA-NT  1237
                +F   GPKDVC SE+R LALEAARQGIVLLKNE KFLP  +  VSSLAVIGP A N 
Sbjct  398   RKGQFGRLGPKDVCKSENRMLALEAARQGIVLLKNENKFLPFREDVVSSLAVIGPHARNI  457

Query  1236  SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIV  1057
             S++ G YTGIPC  KS+ + L  Y+  TS+A+GC D+ CN++D F EAV  AK+ADYVIV
Sbjct  458   SNMLGSYTGIPCRQKSLFEELQAYVQMTSHAAGCQDIPCNASDAFHEAVLAAKKADYVIV  517

Query  1056  VVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRI  877
             VVGLDL+QETED DR SLLLPG QM LV+ +A  S  P+VLVLTGGGPLD+SFA+ DPRI
Sbjct  518   VVGLDLTQETEDLDRVSLLLPGQQMDLVSSIAATSKNPIVLVLTGGGPLDVSFAQNDPRI  577

Query  876   ASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPG  697
             AS+LWIGYPGE GGKAL+EI+FGD NP GRLP+TWY ESFTKVPMN+MNMRADPS GYPG
Sbjct  578   ASILWIGYPGEAGGKALAEIIFGDVNPGGRLPVTWYTESFTKVPMNNMNMRADPSHGYPG  637

Query  696   RTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTK-LRRSILNRGGNEPYVH  520
             RTYRFYTG++VY +GHGLSY+ F  +  SAP +++L +S +    R  +L        + 
Sbjct  638   RTYRFYTGDRVYGYGHGLSYTDFHYKFQSAPVKLTLLKSSRANPYRNRVLREAEGLASLD  697

Query  519   VDEVS-NCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSG  343
             + E+  +C+SL F V++S+ N G M GS VVMLFSRAP     G PQKQLIGFDRVH   
Sbjct  698   IAEIEGSCDSLKFRVQISVTNVGDMKGSHVVMLFSRAP-RLIRGTPQKQLIGFDRVHTFP  756

Query  342   NGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             N   ETSI ++PC H S+VN  G R L  G H+
Sbjct  757   NRSIETSILVDPCDHFSVVNESGRRTLVGGGHV  789



>gb|KDO78722.1| hypothetical protein CISIN_1g003606mg [Citrus sinensis]
Length=790

 Score =   939 bits (2426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/759 (63%), Positives = 583/759 (77%), Gaps = 30/759 (4%)
 Frame = -3

Query  2493  SKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             +KP  PC+PP   SYPFC+TSL I  R  SL+SLLT+ EKIQ+LSDN SAIPRLGIPAYE
Sbjct  38    NKPDFPCKPPHFDSYPFCNTSLSISTRAKSLISLLTLQEKIQQLSDNASAIPRLGIPAYE  97

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSESLHGIA+NGPG+ F+G V S T FPQV+++AA+FNR+LW +I +A AVEARAM+N 
Sbjct  98    WWSESLHGIASNGPGVNFNGTVSSVTSFPQVLVSAASFNRSLWSNIGSAVAVEARAMYNL  157

Query  2133  GQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkn------  1972
             GQAGLTFWAPN+N+F DPRWGRGQETPGEDPMVVS YAVE+V+  QG+  K  +      
Sbjct  158   GQAGLTFWAPNINIFRDPRWGRGQETPGEDPMVVSAYAVEFVKSFQGENWKSDDGGIGFG  217

Query  1971  -gRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTY  1795
                K  L G    EE +  D LMLSACCKHL AYDLE W NFSRYSFNA++T QD EDT+
Sbjct  218   FREKRVLKG--FGEESDRGDELMLSACCKHLIAYDLEKWGNFSRYSFNAMITEQDTEDTF  275

Query  1794  EPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFE  1615
             +PPF+SC+E+G+ASC+MC+YN VNG+PAC   DL +KAR +WGF+GYITSDCDAVATIFE
Sbjct  276   QPPFRSCIEQGKASCIMCSYNQVNGVPACLRGDLFQKARNEWGFKGYITSDCDAVATIFE  335

Query  1614  YQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRL  1435
             YQ Y K+ E++A   LKA                  +   V E DIDRALLNLFSVQ RL
Sbjct  336   YQNYTKTHEDSAAGVLKA------------------DKGKVQEKDIDRALLNLFSVQLRL  377

Query  1434  GLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVI  1255
             GLFNG     K+   GP DVC+SEH++LAL+AARQGIVLLKN++KFLPL+K  VSSLA+I
Sbjct  378   GLFNGDPRKGKYGKLGPDDVCTSEHKKLALDAARQGIVLLKNDKKFLPLNKNAVSSLAII  437

Query  1254  GPMANT-SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAK  1078
             GP+ N  S +GG YTGIPC+ KS+L GL  Y+ KT YASGC DV CNS  GF EAV IAK
Sbjct  438   GPLVNNISQMGGGYTGIPCSPKSLLRGLEAYVSKTHYASGCHDVPCNSDAGFHEAVRIAK  497

Query  1077  RADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISF  898
             +AD+VIVV GLDL+QETED DR SLLLPG QM+LV  +A  S +P++LVLTGGGPLD+SF
Sbjct  498   KADFVIVVAGLDLTQETEDRDRVSLLLPGQQMSLVTSVARTSKRPVILVLTGGGPLDVSF  557

Query  897   AKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRAD  718
             A+ D +I+S+LWIGYPGE G KAL+EI+FGD+NP GRLP+TWYPESFTKVPMNDMNMRAD
Sbjct  558   AEADSQISSILWIGYPGEAGAKALAEIIFGDFNPGGRLPMTWYPESFTKVPMNDMNMRAD  617

Query  717   PSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGG  538
              SR YPGR+YRFYTG +VY FGHGLSY+++S + LSAP+ +++S S+K    ++IL + G
Sbjct  618   SSRQYPGRSYRFYTGTQVYGFGHGLSYTNYSYKFLSAPSELTISASLKAGSDKNILQQTG  677

Query  537   NE-PYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFD  361
             +   YVH+DEV++C SL F V++S+ N G +DGS VVMLF+R P   + G P+KQLIGFD
Sbjct  678   SRLDYVHIDEVTSCTSLRFHVQISVTNAGDVDGSHVVMLFARVP-KVSQGTPEKQLIGFD  736

Query  360   RVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             RVH    G  E S  ++PC+ LSI N  G RILPLG+H+
Sbjct  737   RVHTVAKGSKEISFGVDPCEQLSIANKHGRRILPLGNHV  775



>gb|EYU44551.1| hypothetical protein MIMGU_mgv1a001559mg [Erythranthe guttata]
Length=796

 Score =   937 bits (2422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/759 (64%), Positives = 593/759 (78%), Gaps = 12/759 (2%)
 Frame = -3

Query  2502  TSYSKP-QLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGI  2326
             T   KP + PC PP H+SYPFC+TSLP   R  SL+SLL +DEKIQ+LS+N SA+PRLGI
Sbjct  29    TPIQKPVEYPCLPP-HNSYPFCNTSLPFKTRAQSLISLLHLDEKIQQLSNNASAVPRLGI  87

Query  2325  PAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearA  2146
             P YEWWSESLHGI+ NGPG++F+G ++SATGFPQVI+TAAAFNR+LW ++AAA AVEA A
Sbjct  88    PPYEWWSESLHGISYNGPGVSFNGTIESATGFPQVIVTAAAFNRSLWSAVAAAVAVEAVA  147

Query  2145  MFNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngR  1966
             M  +GQAGLT+WAPN+N+F DPRWGRGQETPGEDPMV SDY+V YVR  QGQ    ++  
Sbjct  148   MRGAGQAGLTYWAPNINIFRDPRWGRGQETPGEDPMVTSDYSVAYVRAFQGQNRPVED--  205

Query  1965  KYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPP  1786
               +    R    ++D DRLMLSACCKH TAYDLE W  F+RY+FNA+VT +DM DTY+ P
Sbjct  206   --TYGRRRRVLSDDDGDRLMLSACCKHFTAYDLEKWGQFTRYNFNAIVTDRDMADTYQVP  263

Query  1785  FKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQ  1606
             FKSC+++G ASCLMC+YNAVNGIPACAN DLL+KAR +W F+GYITSDCDAVATI+E Q+
Sbjct  264   FKSCIQQGNASCLMCSYNAVNGIPACANHDLLQKARNEWNFKGYITSDCDAVATIYEDQK  323

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             Y K+PE+A   ALKAGTDI CGTYM  +M SA +   V E DIDRALLNLF+VQ RLGLF
Sbjct  324   YTKTPEDAVAAALKAGTDITCGTYMSLHMMSAFKQDKVSEEDIDRALLNLFTVQLRLGLF  383

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPM  1246
             +G+    +F   GP+DVC+SEHR+LALEA +QGIVLLKNE+K LPLDK  VSSLAVIGPM
Sbjct  384   DGELARNRFAETGPQDVCNSEHRKLALEAVQQGIVLLKNEKKLLPLDKHLVSSLAVIGPM  443

Query  1245  ANTSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADY  1066
             AN+++LGG Y G+PC   S+L+GL EY++   +A GC DV+CN    FAEAVS+A++ADY
Sbjct  444   ANSTNLGGTYVGVPCNPISILEGLKEYVNTVYHAVGCQDVSCNWKADFAEAVSVAEKADY  503

Query  1065  VIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKD  886
             VI V GLDLSQETED DR +LLLPG+QM LV  +A V  KPL+LVLTGGGP+D+SFA  D
Sbjct  504   VIFVAGLDLSQETEDLDRNTLLLPGYQMELVLSVAAVCKKPLILVLTGGGPVDVSFAVGD  563

Query  885   PRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRG  706
             PR+  V+WIGYPGE GG ALSEI+FG YNP GRLP+TWYPESFT VPM DMNMRADPSR 
Sbjct  564   PRVGGVIWIGYPGETGGTALSEIIFGQYNPGGRLPVTWYPESFTSVPMTDMNMRADPSRN  623

Query  705   YPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLS--QSIKTKLRRSILNRGG--  538
             YPGRTYRFYTG+++Y FG+GLSY+SF+ +LLSAP R+SL    S   + R+ +L + G  
Sbjct  624   YPGRTYRFYTGDQIYRFGYGLSYTSFTYKLLSAPRRLSLRGPTSKAARQRKHMLYQTGKD  683

Query  537   NEPYVHVDEVSN-CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFD  361
             N  YV+VDEV+  C SL F V +SL NNG M G  VV+LF++A +    G+P+++LIGF+
Sbjct  684   NLDYVYVDEVARYCGSLRFEVEISLTNNGDMGGDEVVLLFAKA-SKRIEGSPERELIGFE  742

Query  360   RVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             RVHV   G  +T   ++PC+  S V+V G RIL +GDHI
Sbjct  743   RVHVKSGGSGQTRFKVDPCEQFSTVDVSGERILLIGDHI  781



>ref|XP_002873465.1| glycosyl hydrolase family 3 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49724.1| glycosyl hydrolase family 3 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=796

 Score =   937 bits (2422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/757 (63%), Positives = 592/757 (78%), Gaps = 9/757 (1%)
 Frame = -3

Query  2493  SKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             S PQ PC+PP  SSYPFC+ SL I  R  SLVSLLT+ EKI +LS   +++PRLGIP YE
Sbjct  26    SHPQFPCKPPHFSSYPFCNVSLSIKQRAISLVSLLTLPEKIGQLSTTAASVPRLGIPPYE  85

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSESLHG+A NGPG++F+G++ +AT FPQVI++AA+FNRTLW  I +A AVEARAM+N 
Sbjct  86    WWSESLHGLADNGPGVSFNGSISAATSFPQVIVSAASFNRTLWYEIGSAVAVEARAMYNG  145

Query  2133  GQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSL  1954
             GQAGLTFWAPN+N+F DPRWGRGQETPGEDP VVS+Y VE+VRG Q +  +     ++  
Sbjct  146   GQAGLTFWAPNINLFRDPRWGRGQETPGEDPKVVSEYGVEFVRGFQEKKKRKVLKTRFGS  205

Query  1953  SG--NRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFK  1780
                 +    +++ D +LMLSACCKH TAYDLE W NF+RY FNAVVT QDMEDTY+PPF+
Sbjct  206   DNVDDDARYDDDADGKLMLSACCKHFTAYDLEKWGNFTRYDFNAVVTEQDMEDTYQPPFE  265

Query  1779  SCVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYA  1600
             +C++ G+ASCLMC+YNAVNG+PACA  DLL+KAR +WGF+GYITSDCDAVATIFEYQ Y 
Sbjct  266   TCIKDGKASCLMCSYNAVNGVPACAQGDLLQKARVEWGFDGYITSDCDAVATIFEYQGYT  325

Query  1599  KSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNG  1420
             KSPEEA   A+KAG DINCGTYMLRN +SA+E   V E  +DRALLNLF+VQ RLGLF+G
Sbjct  326   KSPEEAVADAIKAGVDINCGTYMLRNTQSAIEQGKVSEELVDRALLNLFAVQLRLGLFDG  385

Query  1419  KAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN  1240
                   +   G  D+CSS+HR+LALEAARQGIVLLKN+ K LPL+K  VSSLA++GPMAN
Sbjct  386   DPRGGHYGKLGSNDICSSDHRKLALEAARQGIVLLKNDYKLLPLNKNHVSSLAIVGPMAN  445

Query  1239  T-SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYV  1063
               S++GG YTG PC  K++   L EY+ KTSYASGC DV+C S  GF EAV+IAK AD+V
Sbjct  446   NISNMGGTYTGKPCQRKTLFTELLEYVKKTSYASGCSDVSCVSDTGFGEAVAIAKGADFV  505

Query  1062  IVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDP  883
             IVV GLDLSQETED DR+SL LPG Q  LV+ +A VS KP++LVLTGGGP+D++FAK DP
Sbjct  506   IVVAGLDLSQETEDKDRFSLSLPGKQKDLVSSVAAVSKKPVILVLTGGGPVDVTFAKTDP  565

Query  882   RIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGY  703
             RI S++WIGYPGE GG+AL+EI+FGD+NP GRLP+TWYPESF  VPM+DM+MRAD SRGY
Sbjct  566   RIGSIIWIGYPGETGGQALAEIIFGDFNPGGRLPITWYPESFADVPMSDMHMRADSSRGY  625

Query  702   PGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSI--KTKLRRSILNRGGNE-  532
             PGRTYRFYTG +VY FG GLSY+ F  +++SAP R+SLS+ +  ++  ++ +L  G  + 
Sbjct  626   PGRTYRFYTGPQVYSFGTGLSYTKFDYKIISAPIRLSLSELLPQQSSHKKQLLQHGEEQL  685

Query  531   PYVHVDE--VSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDR  358
              Y+ +D+  V++C SL F+VRV++RN G +DGS V+MLFS+     + G P+KQLIGFDR
Sbjct  686   QYIQLDDVMVNSCESLRFNVRVNVRNTGEIDGSHVLMLFSKMARVLS-GVPEKQLIGFDR  744

Query  357   VHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             VH+  N + ET   I+PC++LS+ N  G R++PLG H
Sbjct  745   VHIRSNEMMETVFVIDPCKYLSVANDVGKRVIPLGIH  781



>ref|XP_010453089.1| PREDICTED: probable beta-D-xylosidase 6 [Camelina sativa]
Length=798

 Score =   936 bits (2420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/759 (63%), Positives = 590/759 (78%), Gaps = 11/759 (1%)
 Frame = -3

Query  2493  SKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             S PQ PC+PP  SSYPFC+ SL I  R  SLVSLLT+ EKI +LS+  +++PRLGIP YE
Sbjct  27    SHPQFPCKPPHFSSYPFCNVSLSIKQRAISLVSLLTLTEKIGQLSNTAASVPRLGIPPYE  86

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSESLHGIA NGPG++F+G++ SAT FPQVI++AA+FNRTLW  I +A AVEARAM+N 
Sbjct  87    WWSESLHGIADNGPGVSFNGSISSATSFPQVIVSAASFNRTLWYEIGSAVAVEARAMYNG  146

Query  2133  GQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSL  1954
             GQAGLTFWAPN+NVF DPRWGRGQETPGEDP VVS+Y VE+VRG Q    +    R++  
Sbjct  147   GQAGLTFWAPNINVFRDPRWGRGQETPGEDPKVVSEYGVEFVRGFQENRKRKVLKRRFG-  205

Query  1953  SGNRMPEE---EEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
              G+ +      + DD +LMLSACCKH TAYDLE W NF+RY FNAVVT QDMEDTY+PPF
Sbjct  206   DGDGVDARYDDDGDDGKLMLSACCKHFTAYDLEKWGNFTRYDFNAVVTEQDMEDTYQPPF  265

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQY  1603
             +SC+  G+ASCLMC+YNAVNG+PACA +DLL+KAR +WGFEGYITSDCDAVATIFEYQ Y
Sbjct  266   QSCIRDGKASCLMCSYNAVNGVPACAQEDLLKKARVEWGFEGYITSDCDAVATIFEYQGY  325

Query  1602  AKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFN  1423
              KSPEEA   A+KAG DINCGTYMLRN KSA+    V E  +D+ALLNLF+VQ RLGLF+
Sbjct  326   TKSPEEAVADAIKAGVDINCGTYMLRNTKSAIVKGKVTEEQVDQALLNLFAVQLRLGLFD  385

Query  1422  GKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMA  1243
             G      +   G  D+CSS+HR+LALEAARQGIVLLKN+ K LPL K  VSSLA++GPMA
Sbjct  386   GDPREGLYAKLGSNDICSSDHRKLALEAARQGIVLLKNDHKLLPLKKNHVSSLAIVGPMA  445

Query  1242  NT-SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADY  1066
             N  S++GG YTG PC  K++   L +Y+ KTSY SGC DV+C+S +GF EAV+IAK AD+
Sbjct  446   NNISNMGGTYTGKPCQRKTLFTELLKYVKKTSYVSGCSDVSCDSDNGFGEAVAIAKGADF  505

Query  1065  VIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKD  886
             VIVV GLDLSQETED DR SL LPG Q  LV+ +A  S KP++LVLTGGGP+D++FAK D
Sbjct  506   VIVVAGLDLSQETEDKDRVSLSLPGKQKDLVSSVAAASKKPVILVLTGGGPVDVTFAKTD  565

Query  885   PRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRG  706
             PRI S++WIGYPGE GG+AL+EI+FGD+NP G+LP+TWYPESFT V M+DM+MRAD SRG
Sbjct  566   PRIGSIIWIGYPGETGGQALAEIIFGDFNPGGKLPMTWYPESFTDVAMSDMHMRADSSRG  625

Query  705   YPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSI-KTKLRRSILNRGGNEP  529
             YPGRTYRFYTG +VY FG GLSY+ F  ++ SAPTR+SLS+ + +    + +L + G E 
Sbjct  626   YPGRTYRFYTGPQVYSFGTGLSYTKFDYKITSAPTRLSLSELLPQQSSHKKLLQQHGEEQ  685

Query  528   --YVHVDE--VSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFD  361
               Y+ +D+  V++C +L F+V+V++ N G +DGS V+M+FS+ P   + G P+KQLIGFD
Sbjct  686   LRYLQLDDAMVNSCETLRFNVQVNVSNAGEIDGSHVLMMFSKMPPVIS-GVPEKQLIGFD  744

Query  360   RVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             RVHV  N V ET   I+PC+HL + N  G R++PLG H+
Sbjct  745   RVHVRSNEVIETVFMIDPCKHLIVANDVGKRVIPLGIHV  783



>ref|XP_009122041.1| PREDICTED: probable beta-D-xylosidase 6 [Brassica rapa]
Length=792

 Score =   935 bits (2417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/758 (63%), Positives = 587/758 (77%), Gaps = 12/758 (2%)
 Frame = -3

Query  2493  SKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             S P+ PCQPP HSSYPFC+ SL    R HSLVSLLT+ EKI +LS+  +++PRLGIP YE
Sbjct  23    SNPKFPCQPPHHSSYPFCNISLSTTKRAHSLVSLLTLPEKIGQLSNTAASLPRLGIPPYE  82

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSESLHG+A NGPG++F+G++ SAT FPQVI++AAAFNRTLWR I +A AVE RAM+N 
Sbjct  83    WWSESLHGLADNGPGVSFNGSIASATSFPQVIVSAAAFNRTLWRGIGSAVAVEGRAMYNG  142

Query  2133  GQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSL  1954
             GQAGLT+WAPN+NVF DPRWGRGQETPGEDP VVS+Y VE+VRG Q          K SL
Sbjct  143   GQAGLTYWAPNINVFRDPRWGRGQETPGEDPKVVSEYGVEFVRGFQEVKKTNVL--KSSL  200

Query  1953  SGNRMPEEEEDDD---RLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
                   +++ D D   +LMLSACCKH TAYDLE W NF+RY FNAVVT QDMEDTY+PPF
Sbjct  201   GDGGHDDDDGDGDGDGKLMLSACCKHFTAYDLEKWGNFTRYDFNAVVTEQDMEDTYQPPF  260

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQY  1603
             +SC+E G+ASCLMC+YNAVNG+PACA +DLL+KAR DWGF+GYITSDCDAVATIF+YQ Y
Sbjct  261   QSCIEDGKASCLMCSYNAVNGVPACARQDLLQKARVDWGFKGYITSDCDAVATIFDYQGY  320

Query  1602  AKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFN  1423
               S EEA   A+KAG DINCGTYM+R+ ++A++   V E  IDRALLNLF+VQ RLGLF+
Sbjct  321   TNSAEEAVADAIKAGVDINCGTYMVRHTQAAIDKGKVSEEQIDRALLNLFAVQLRLGLFD  380

Query  1422  GKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMA  1243
             G     ++   G  D+CSS HR LALEAARQGIVLLKN+ K LPL K+ VSSLA+IGPMA
Sbjct  381   GNPKQGRYAKLGANDICSSSHRELALEAARQGIVLLKNDHKLLPLKKSHVSSLAIIGPMA  440

Query  1242  NT-SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADY  1066
             N  SS+GG YTG PC  K++   L EY+ KTSYASGC DVAC+S   F EAV++AK AD+
Sbjct  441   NNISSMGGTYTGKPCQRKTLFTELLEYVKKTSYASGCSDVACDSPAAFKEAVAVAKGADF  500

Query  1065  VIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKD  886
             VI+V GLDL+QETED DR SL LPG Q  LV  +A  S KP++LVLTGGGP+D++FAK D
Sbjct  501   VIIVAGLDLTQETEDKDRVSLSLPGKQRDLVTSIAAASKKPVILVLTGGGPVDVTFAKTD  560

Query  885   PRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRG  706
             PRI S++WIGYPGE GG+AL+EI+FGD+NP GRLP+TWYP+SF++V M+DM+MRAD +RG
Sbjct  561   PRIGSIVWIGYPGETGGRALAEILFGDFNPGGRLPMTWYPQSFSEVAMSDMHMRADLARG  620

Query  705   YPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSI--KTKLRRSILNRG-GN  535
             YPGRTYRFYTG +VY+FG GLSY+ F  E+LSAPTR+ LS+ I   +  ++ +L +G G 
Sbjct  621   YPGRTYRFYTGPEVYKFGTGLSYTEFDYEILSAPTRLGLSEVIPQDSSHKKLLLQKGEGE  680

Query  534   EPYVHVDE--VSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFD  361
               Y+ +D+  V +C SL FSVR S+RN G MDGS V+ML+SR P   + G P++QLIGF+
Sbjct  681   LRYLQLDDLAVDSCESLKFSVRFSVRNTGEMDGSHVLMLYSRMPRVLS-GVPERQLIGFE  739

Query  360   RVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             RVHV  + + E    I+PC+ LS+ N  G R++PLG H
Sbjct  740   RVHVRSSEMVEAEFVIDPCKQLSVANDVGKRVIPLGVH  777



>ref|XP_010491733.1| PREDICTED: probable beta-D-xylosidase 6 [Camelina sativa]
Length=800

 Score =   934 bits (2415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/760 (62%), Positives = 591/760 (78%), Gaps = 11/760 (1%)
 Frame = -3

Query  2493  SKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             S PQ PC+PP  SSYPFC+ SL I  R  SLVS LT+ EK+ +LS+  +++PRLGIP YE
Sbjct  27    SHPQFPCKPPHFSSYPFCNVSLSIKQRAISLVSFLTLTEKVGQLSNTAASVPRLGIPPYE  86

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSESLHGIA NGPG++F+G++ SAT FPQVI++A++FNRTLW  I +A AVEARAM+N 
Sbjct  87    WWSESLHGIADNGPGVSFNGSISSATSFPQVIVSASSFNRTLWYEIGSAVAVEARAMYNG  146

Query  2133  GQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYS-  1957
             GQAGLTFWAPN+NVF DPRWGRGQETPGEDP VVS+Y VE+VRG Q    +    R++  
Sbjct  147   GQAGLTFWAPNINVFRDPRWGRGQETPGEDPKVVSEYGVEFVRGFQENRKRKVLTRRFGD  206

Query  1956  --LSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
               +  +   +++ DD +LM+SACCKH TAYDLE W NF+RY FNAVVT QDMEDTY+PPF
Sbjct  207   GVVDDDARYDDDGDDGKLMVSACCKHFTAYDLEKWGNFTRYDFNAVVTEQDMEDTYQPPF  266

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQY  1603
             +SC+  G+ASCLMC+YNAVNG+PACA +DLL+KAR +WGFEGYITSDCDAVATIFEYQ Y
Sbjct  267   QSCIRDGKASCLMCSYNAVNGVPACAQEDLLKKARVEWGFEGYITSDCDAVATIFEYQGY  326

Query  1602  AKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFN  1423
              KSPEEA   A+KAG DINCGTYMLRN KSA+    V E  +D+ALLNLF+VQ RLGLF+
Sbjct  327   TKSPEEAVADAIKAGVDINCGTYMLRNTKSAILKGKVSEEQVDQALLNLFAVQLRLGLFD  386

Query  1422  GKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMA  1243
             G      +   G  D+CSS+HR+LALEAARQGIVLLKN+ K LPL K  VSSLA++GPMA
Sbjct  387   GDPREGLYAKLGSNDICSSDHRKLALEAARQGIVLLKNDHKLLPLKKNHVSSLAIVGPMA  446

Query  1242  NT-SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADY  1066
             N  S++GG YTG PC  K++   L EY+ KTSY SGC DV+C+S +GF EA++IAK AD+
Sbjct  447   NNISNMGGTYTGKPCQRKTLFTELLEYVKKTSYVSGCSDVSCDSDNGFGEALAIAKGADF  506

Query  1065  VIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKD  886
             VIVV GLDLSQETED DR SL LPG Q  LV+ +A VS KP++LVLTGGGP+D++FAK D
Sbjct  507   VIVVAGLDLSQETEDKDRVSLSLPGKQRDLVSSVAAVSKKPVILVLTGGGPVDVTFAKTD  566

Query  885   PRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRG  706
             PRI S++WIGYPGE GG+AL+EI+FGD+NP G+LP+TWYPESFT V M+DM+MRAD SRG
Sbjct  567   PRIGSIIWIGYPGETGGQALAEIIFGDFNPGGKLPMTWYPESFTDVAMSDMHMRADSSRG  626

Query  705   YPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSI--KTKLRRSILNRGGNE  532
             YPGRTYRFYTG +VY FG GLSY+ F  ++ SAPTR+SLS+ +  ++  ++ +L  G  E
Sbjct  627   YPGRTYRFYTGPQVYSFGTGLSYTKFDYKITSAPTRLSLSELLPQQSSHKKLLLQHGEEE  686

Query  531   P--YVHVDE--VSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGF  364
                Y+ +D+  V++C +L F VRV++ N G +DGS V+M++S+ P   + G P+KQLIGF
Sbjct  687   QLRYLQLDDAMVTSCETLRFHVRVNVSNTGEIDGSHVLMMYSKMPPVIS-GVPEKQLIGF  745

Query  363   DRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             DRVHV  N + ET   I+PC+HL + N  G R++PLG H+
Sbjct  746   DRVHVHSNEMIETVFVIDPCKHLIVANDVGKRVIPLGIHV  785



>ref|NP_196618.1| putative beta-D-xylosidase 6 [Arabidopsis thaliana]
 sp|Q9LXA8.1|BXL6_ARATH RecName: Full=Probable beta-D-xylosidase 6; Short=AtBXL6; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB89387.1| beta-xylosidase-like protein [Arabidopsis thaliana]
 gb|AAL09717.1| AT5g10560/F12B17_90 [Arabidopsis thaliana]
 gb|AED91563.1| putative beta-D-xylosidase 6 [Arabidopsis thaliana]
Length=792

 Score =   934 bits (2413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/754 (63%), Positives = 585/754 (78%), Gaps = 5/754 (1%)
 Frame = -3

Query  2493  SKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             S PQ PC+PP  SSYPFC+ SL I  R  SLVSLL + EKI +LS+  +++PRLGIP YE
Sbjct  26    SHPQFPCKPPHFSSYPFCNVSLSIKQRAISLVSLLMLPEKIGQLSNTAASVPRLGIPPYE  85

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSESLHG+A NGPG++F+G++ +AT FPQVI++AA+FNRTLW  I +A AVE RAM+N 
Sbjct  86    WWSESLHGLADNGPGVSFNGSISAATSFPQVIVSAASFNRTLWYEIGSAVAVEGRAMYNG  145

Query  2133  GQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSL  1954
             GQAGLTFWAPN+NVF DPRWGRGQETPGEDP VVS+Y VE+VRG Q +  +    R++S 
Sbjct  146   GQAGLTFWAPNINVFRDPRWGRGQETPGEDPKVVSEYGVEFVRGFQEKKKRKVLKRRFSD  205

Query  1953  SGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSC  1774
               +    +++ D +LMLSACCKH TAYDLE W NF+RY FNAVVT QDMEDTY+PPF++C
Sbjct  206   DVDDDRHDDDADGKLMLSACCKHFTAYDLEKWGNFTRYDFNAVVTEQDMEDTYQPPFETC  265

Query  1773  VEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKS  1594
             +  G+ASCLMC+YNAVNG+PACA  DLL+KAR +WGFEGYITSDCDAVATIF YQ Y KS
Sbjct  266   IRDGKASCLMCSYNAVNGVPACAQGDLLQKARVEWGFEGYITSDCDAVATIFAYQGYTKS  325

Query  1593  PEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKA  1414
             PEEA   A+KAG DINCGTYMLR+ +SA+E   V E  +DRALLNLF+VQ RLGLF+G  
Sbjct  326   PEEAVADAIKAGVDINCGTYMLRHTQSAIEQGKVSEELVDRALLNLFAVQLRLGLFDGDP  385

Query  1413  VNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANT-  1237
                ++   G  D+CSS+HR+LALEA RQGIVLLKN+ K LPL+K  VSSLA++GPMAN  
Sbjct  386   RRGQYGKLGSNDICSSDHRKLALEATRQGIVLLKNDHKLLPLNKNHVSSLAIVGPMANNI  445

Query  1236  SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIV  1057
             S++GG YTG PC  K++   L EY+ KTSYASGC DV+C+S  GF EAV+IAK AD+VIV
Sbjct  446   SNMGGTYTGKPCQRKTLFTELLEYVKKTSYASGCSDVSCDSDTGFGEAVAIAKGADFVIV  505

Query  1056  VVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRI  877
             V GLDLSQETED DR SL LPG Q  LV+ +A VS KP++LVLTGGGP+D++FAK DPRI
Sbjct  506   VAGLDLSQETEDKDRVSLSLPGKQKDLVSHVAAVSKKPVILVLTGGGPVDVTFAKNDPRI  565

Query  876   ASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPG  697
              S++WIGYPGE GG+AL+EI+FGD+NP GRLP TWYPESFT V M+DM+MRA+ SRGYPG
Sbjct  566   GSIIWIGYPGETGGQALAEIIFGDFNPGGRLPTTWYPESFTDVAMSDMHMRANSSRGYPG  625

Query  696   RTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSI-KTKLRRSILNRGGNEPYVH  520
             RTYRFYTG +VY FG GLSY+ F  ++LSAP R+SLS+ + +    +  L  G    Y+ 
Sbjct  626   RTYRFYTGPQVYSFGTGLSYTKFEYKILSAPIRLSLSELLPQQSSHKKQLQHGEELRYLQ  685

Query  519   VDE--VSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVS  346
             +D+  V++C SL F+VRV + N G +DGS VVMLFS+ P   + G P+KQLIG+DRVHV 
Sbjct  686   LDDVIVNSCESLRFNVRVHVSNTGEIDGSHVVMLFSKMPPVLS-GVPEKQLIGYDRVHVR  744

Query  345   GNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
              N + ET   I+PC+ LS+ N  G R++PLG H+
Sbjct  745   SNEMMETVFVIDPCKQLSVANDVGKRVIPLGSHV  778



>ref|XP_010918501.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-D-xylosidase 6 
[Elaeis guineensis]
Length=777

 Score =   928 bits (2398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/752 (63%), Positives = 588/752 (78%), Gaps = 15/752 (2%)
 Frame = -3

Query  2484  QLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWS  2305
             + PC+ P +S YPFC+ SLP+ AR  SLVSLLT+DEKIQ+LS+  +A+PRLG+P Y+WWS
Sbjct  22    RYPCERPCNS-YPFCNASLPVAARARSLVSLLTLDEKIQQLSNTAAAVPRLGLPPYQWWS  80

Query  2304  ESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA  2125
             ESLHG+A NGPG+ F+G V+SAT FPQVIL+AAAFNRTLWR++A A A+EARAM+N GQA
Sbjct  81    ESLHGLAPNGPGVFFNGTVRSATAFPQVILSAAAFNRTLWRAVAKAIAIEARAMYNVGQA  140

Query  2124  GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGN  1945
             GLTFWAPN+N+F DPRWGRGQETPGEDPM+ S Y++EYV+G QG+              +
Sbjct  141   GLTFWAPNINIFRDPRWGRGQETPGEDPMLTSAYSIEYVKGFQGEYDGDVQ--------D  192

Query  1944  RMPEEE--EDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCV  1771
             R+ E    E    +M+SACCKH TAYDL+ WHNFSRY+FNAVVT QDMEDT++PPF+SC+
Sbjct  193   RIGESRILERSGEMMVSACCKHYTAYDLDHWHNFSRYTFNAVVTEQDMEDTFQPPFQSCI  252

Query  1770  EKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKSP  1591
             E+G ASCLMC+YN VNG+PACA  DLL+KAR  WGFEGYITSDCDAVA I+E Q Y  SP
Sbjct  253   EEGHASCLMCSYNQVNGVPACARGDLLQKARKQWGFEGYITSDCDAVAIIYENQSYTNSP  312

Query  1590  EEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAV  1411
             E +    LKAG DINCGTY+LR    A++  IV E DIDRALLNLFSVQ RLGLF+G   
Sbjct  313   EASIADVLKAGMDINCGTYLLRYTGKAVKLGIVREEDIDRALLNLFSVQLRLGLFDGNPA  372

Query  1410  NRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TS  1234
             N +F   GP ++C+ EHR LALEAARQGIVLLKN+Q FLPL K +VSSLA+IGP  N T+
Sbjct  373   NNRFGELGPSNICTKEHRELALEAARQGIVLLKNDQSFLPLRKNKVSSLAIIGPAGNDTN  432

Query  1233  SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVV  1054
              LGGDYTG+PC   S+ +GL  Y+ +TS+A+GC+DV CNSTDGF  AV++A++A+ V++V
Sbjct  433   ILGGDYTGVPCRPTSLFEGLQAYVPRTSFAAGCIDVPCNSTDGFEAAVAVARKAEVVVMV  492

Query  1053  VGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIA  874
              GL+L++E E+HDR SLLLPG QM LVN +A VS KPLVLVL GGGP+DISFAK +P I 
Sbjct  493   AGLNLTEENEEHDRISLLLPGEQMDLVNAIAKVSKKPLVLVLMGGGPVDISFAKDNPGIG  552

Query  873   SVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGR  694
             S+LWIGYPGE GG+A++E +FG++NP GRLP+TWYPESFTK+PMNDM+MRADPSRGYPGR
Sbjct  553   SILWIGYPGEVGGQAVAEALFGEFNPGGRLPVTWYPESFTKMPMNDMHMRADPSRGYPGR  612

Query  693   TYRFYTGEKVYEFGHGlsyssfslellSAPTRISL-SQSIKTKLRRS-ILNRGGNEPYVH  520
             TYRFYTGE VY FG+GLSYSS+S + LS P ++S+ S S +  +R+     R     Y+H
Sbjct  613   TYRFYTGEVVYRFGYGLSYSSYSYKFLSVPEKLSVPSSSTEANIRKEPPYARKDGLDYLH  672

Query  519   VDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGN  340
             +DE+S+C +L F V++S+ N G MDGS  V+LFSR+  +   G+PQKQLIGF RVH +  
Sbjct  673   IDEISSCKALRFYVQISVINGGNMDGSHTVLLFSRSRANIK-GSPQKQLIGFKRVHTTAG  731

Query  339   GVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
               TE  I+++PC+HLS VN EG R+L LG H+
Sbjct  732   KATEARITVDPCKHLSTVNEEGRRVLLLGAHL  763



>gb|KFK25328.1| hypothetical protein AALP_AA8G098500 [Arabis alpina]
Length=791

 Score =   924 bits (2387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/757 (62%), Positives = 593/757 (78%), Gaps = 14/757 (2%)
 Frame = -3

Query  2493  SKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             S P  PC+PP  +SYPFC+TSL I  R  SLVSLLT+ EKI +LS+   ++PRLGIP YE
Sbjct  28    SHPNFPCKPPHFTSYPFCNTSLSITQRAQSLVSLLTLSEKIGQLSNTAGSVPRLGIPPYE  87

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSESLHGIA NGPG++F+G+V +AT FPQVI++AA+FNRTLW  I +A +VEARAM+N+
Sbjct  88    WWSESLHGIADNGPGVSFNGSVSAATAFPQVIVSAASFNRTLWYEIGSAVSVEARAMYNA  147

Query  2133  GQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSL  1954
             GQAGLTFWAPN+NVF DPRWGRGQETPGEDP VVS+Y VE+V+G Q +  K    R++  
Sbjct  148   GQAGLTFWAPNINVFRDPRWGRGQETPGEDPTVVSEYGVEFVKGFQERRKKKVLRRRFGY  207

Query  1953  SGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSC  1774
                    +++DD +LM+SACCKH TAYDLE W NF+RY FNAVVT QDMEDTY+PPF+SC
Sbjct  208   V------DDDDDGKLMVSACCKHFTAYDLEKWGNFTRYDFNAVVTEQDMEDTYQPPFQSC  261

Query  1773  VEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKS  1594
             +  G+ASCLMC+YNAVNG+PACA +DLL KAR +WGF+GYITSDCDAV TIF+YQ Y  S
Sbjct  262   IRDGKASCLMCSYNAVNGVPACAREDLLTKARVEWGFKGYITSDCDAVGTIFDYQGYTNS  321

Query  1593  PEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKA  1414
             PEEA  IA+KAG DINCGTYMLRN KSA+E  +V +  +DRALLNLF VQ RLGLF+G  
Sbjct  322   PEEAVAIAIKAGVDINCGTYMLRNTKSAIEKGMVSKEQLDRALLNLFVVQLRLGLFDGNP  381

Query  1413  VNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANT-  1237
                ++   G  D+CSS HR+LALEAARQGIVLLKN+ K LPL+K RVSSLA++GPMAN  
Sbjct  382   REGRYGKLGSSDICSSGHRKLALEAARQGIVLLKNDHKLLPLNKNRVSSLAIVGPMANNI  441

Query  1236  SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIV  1057
             S++GG YTG PC  K++   L +Y+ KTSYASGC DV+C+S+ GF EAV+IAK AD+VIV
Sbjct  442   SNMGGTYTGKPCQRKTLFTELLQYVKKTSYASGCSDVSCDSSSGFGEAVAIAKGADFVIV  501

Query  1056  VVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRI  877
             V GLDL+QETED DR SL LPG Q  LV+ +A VS KP++LVLTGGGP+D+SFAK +P+I
Sbjct  502   VAGLDLTQETEDKDRVSLSLPGKQKDLVSSIAAVSKKPVILVLTGGGPVDVSFAKTNPKI  561

Query  876   ASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPG  697
              S++WIGYPGE GG+AL+EI+FGD+NP GRLP+TWYPESF KVPM+DM+MRA+ SRGYPG
Sbjct  562   GSIIWIGYPGETGGQALAEIIFGDFNPGGRLPMTWYPESFAKVPMSDMHMRANSSRGYPG  621

Query  696   RTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSI--KTKLRRSILNRGGNEP--  529
             RTYRFYTG +VYEFG GLSY+ F  +++SAP+++ LS+ +  +   ++ +L  G  E   
Sbjct  622   RTYRFYTGPQVYEFGTGLSYTKFDYKIISAPSKLILSEKLLPQPSHKKLLLQNGEEEELR  681

Query  528   YVHVDE--VSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRV  355
             Y+ +D+  V++C SL F+VRV + N G + GS V+ML+S+ P   + G P+KQLIGFDRV
Sbjct  682   YLQLDDSSVNSCVSLRFNVRVRVTNTGDIHGSHVLMLYSKMPPVLS-GVPEKQLIGFDRV  740

Query  354   HVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             HV  N + ET   I+PC+ L++ N  G R++ LG+H+
Sbjct  741   HVGSNEIVETVFVIDPCKDLTVANDVGKRVIALGNHV  777



>ref|XP_007158321.1| hypothetical protein PHAVU_002G142900g [Phaseolus vulgaris]
 gb|ESW30315.1| hypothetical protein PHAVU_002G142900g [Phaseolus vulgaris]
Length=774

 Score =   921 bits (2381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/750 (63%), Positives = 583/750 (78%), Gaps = 31/750 (4%)
 Frame = -3

Query  2475  CQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESL  2296
             C+ P H SYPFCD S P   R  SLVSLLT+ EKIQ LSDN S+IPRLGIPAYEWWSESL
Sbjct  33    CKLP-HHSYPFCDASHPTLTRARSLVSLLTLPEKIQLLSDNASSIPRLGIPAYEWWSESL  91

Query  2295  HGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLT  2116
             HGIA NGPG++F+G + SATGFPQVIL+AA+FNR+LW   AAA A EARAMFN GQAGLT
Sbjct  92    HGIAPNGPGVSFNGTIPSATGFPQVILSAASFNRSLWFRTAAAIAREARAMFNVGQAGLT  151

Query  2115  FWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMP  1936
             FWAPN+N+F DPRWGRGQETPGEDPM+ S Y+VEYVRGLQ             LSG +  
Sbjct  152   FWAPNINLFRDPRWGRGQETPGEDPMLSSAYSVEYVRGLQ------------GLSGIQEA  199

Query  1935  ---EEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEK  1765
                ++++DDD LM+SACCKH TAYDL+ W  F+RY+FNAVV++QDMED+Y+PPF+SC+++
Sbjct  200   VGDDDDDDDDALMVSACCKHFTAYDLDKWKQFARYNFNAVVSQQDMEDSYQPPFRSCIQQ  259

Query  1764  GRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKSPEE  1585
             G+ASCLMC+YN VNG+PACA+++LL  AR  WGF+GYITSDCDAVAT++EYQ Y KS E+
Sbjct  260   GKASCLMCSYNEVNGVPACASEELLGLARDKWGFKGYITSDCDAVATVYEYQNYTKSSED  319

Query  1584  AAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNR  1405
             A    LKAG D +CGT+MLR+ KSA+E   V E DIDRALLNLFSVQ RLGLF+G  V  
Sbjct  320   AVADVLKAGLDTDCGTFMLRHTKSAIEQGKVKEEDIDRALLNLFSVQLRLGLFDGDPVRG  379

Query  1404  KFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTSSLG  1225
             +F   GPKDVC+ EH+ LALEAARQGIVLLKN++KFLPL++   +SLAVIGPMA T+ LG
Sbjct  380   RFGKLGPKDVCTPEHKTLALEAARQGIVLLKNDKKFLPLNRDIGASLAVIGPMATTTKLG  439

Query  1224  GDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGL  1045
             GDY+GIPC+L S+ +GL E+  + S+A GC DV+C S DGF EAV  AK+AD+V++VVGL
Sbjct  440   GDYSGIPCSLTSIYEGLREFAERISFALGCHDVSCESDDGFGEAVHTAKQADFVVIVVGL  499

Query  1044  DLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVL  865
             D +QETEDHDR SLLLP          A  S  P++LVL GGGPLD+SFAK++ +IAS+L
Sbjct  500   DGTQETEDHDRVSLLLP----------ADASKNPVILVLIGGGPLDVSFAKENKKIASIL  549

Query  864   WIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYR  685
             W+GYPGE GGKAL+EI+FG++NP GRLP+TWYPE+FT VPMNDMNMRADPSRGYPGRTYR
Sbjct  550   WVGYPGEAGGKALAEIIFGEFNPVGRLPMTWYPEAFTNVPMNDMNMRADPSRGYPGRTYR  609

Query  684   FYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNE----PYVHV  517
             FYTG +VY FGHGLSYS FS   LSAP+ ISLS+  K   R+ +L++ G E     Y+ +
Sbjct  610   FYTGSRVYGFGHGLSYSHFSYNFLSAPSEISLSRITKDGFRKRLLHQAGKEVNGVDYIPI  669

Query  516   DEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNG  337
             +E+ NCNS +FSVR+S+ N G +DG  VVMLFS+ P     G+P+ QL+GF  +H   N 
Sbjct  670   NELQNCNSFSFSVRISVTNLGDLDGGHVVMLFSKGP-KVVDGSPETQLVGFSSLHTVSNK  728

Query  336   VTETSISIEPCQHLSIVNVEGSRILPLGDH  247
              T+TSI + PC+HLS  + EG RILP+G H
Sbjct  729   STDTSILVHPCEHLSFADEEGKRILPMGPH  758



>ref|XP_008440505.1| PREDICTED: probable beta-D-xylosidase 6 [Cucumis melo]
Length=783

 Score =   921 bits (2380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/764 (62%), Positives = 582/764 (76%), Gaps = 27/764 (4%)
 Frame = -3

Query  2499  SYSKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             S S  Q PC P  H SYPFC+ SL   AR  SLVSLLT+DEKIQ+LS+N S+IPRLGIP+
Sbjct  20    SSSDFQFPCNPSLHQSYPFCNKSLSFTARAQSLVSLLTLDEKIQQLSNNASSIPRLGIPS  79

Query  2319  YEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMF  2140
             Y+WWSE LHGIATNGPG++F+G + SAT FPQVI+TAA+FNRTLW  I +A AVEARAMF
Sbjct  80    YQWWSEGLHGIATNGPGVSFNGPITSATIFPQVIVTAASFNRTLWFLIGSAIAVEARAMF  139

Query  2139  NSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKY  1960
             N GQ GLT WAPN+N+F DPRWGRGQETPGEDPMV S Y++++VRGLQ            
Sbjct  140   NVGQCGLTIWAPNINIFRDPRWGRGQETPGEDPMVASAYSIQFVRGLQ------------  187

Query  1959  SLSGNRMPEEE------EDDD---RLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDM  1807
               SGN M E E      E+D+    LM+SACCKH TAYDLE W+NFSRY+F++VVT QD+
Sbjct  188   --SGNWMKEHEIRNGVLEEDNGMGSLMVSACCKHFTAYDLEKWNNFSRYTFDSVVTEQDL  245

Query  1806  EDTYEPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVA  1627
              DTY+PPF+SC+++G+ASCLMC+YNAVNG+PACAN DLL+KAR DWG +GYITSDCDAVA
Sbjct  246   GDTYQPPFRSCIQQGKASCLMCSYNAVNGVPACANPDLLKKARNDWGLKGYITSDCDAVA  305

Query  1626  TIFEYQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSV  1447
             T++EYQ+Y  +PE+A    LKAG DINCGT+MLR+ KSA++   V E ++D AL+NLFSV
Sbjct  306   TVYEYQKYTDTPEDAVADVLKAGLDINCGTFMLRSTKSAIDQGKVKEEELDSALINLFSV  365

Query  1446  QFRLGLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSS  1267
             Q RLG F+G      F   G ++VC+++H+ LALEAARQGIVLLKNE +FLPLDK  +SS
Sbjct  366   QARLGFFDGNPREGMFGELGAQNVCTAQHKTLALEAARQGIVLLKNENRFLPLDKNAISS  425

Query  1266  LAVIGPMANTSS-LGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAV  1090
             L VIG +AN SS L G Y G+PC+  S+++G  EY     +ASGCLDV C S  GF EA+
Sbjct  426   LTVIGSLANDSSKLLGGYAGVPCSPMSLVEGFQEYAETIFFASGCLDVPCASDSGFDEAI  485

Query  1089  SIAKRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpL  910
              IAK+ D+VIVV GLD SQETED DR SLLLPG QM LV+ +A VS KP++LVL GGGPL
Sbjct  486   LIAKKTDFVIVVAGLDASQETEDLDRVSLLLPGRQMDLVSSVASVSKKPIILVLIGGGPL  545

Query  909   DISFAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMN  730
             DISFAKKD R+AS+LWIG PGE GGKAL+E++FGDYNP GRLP+TWYP+SFT VPMNDM+
Sbjct  546   DISFAKKDSRVASILWIGNPGEAGGKALAEVIFGDYNPGGRLPVTWYPQSFTNVPMNDMH  605

Query  729   MRADPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSI-  553
             MR +PSRGYPGRTYRFYTG++VY FG GLSY+SF   LLSAP ++SL   I+   RR I 
Sbjct  606   MRPNPSRGYPGRTYRFYTGDRVYGFGEGLSYTSFKYRLLSAPKKLSLLGKIEMSRRRIIP  665

Query  552   -LNRGGNEPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQ  376
              +  G N  Y+ V+EV +C+ L F V +S+ N G  DGS VVM+FS  P     G PQ+Q
Sbjct  666   QVGDGVNMSYMEVEEVESCDLLRFEVELSVSNVGEFDGSHVVMMFSEFPKVLT-GTPQRQ  724

Query  375   LIGFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             LIGFDR++V  N   E+SI ++PC H+S+ +  G +++PLGDHI
Sbjct  725   LIGFDRLYVKRNQSAESSIMVDPCNHVSLADEYGKKVIPLGDHI  768



>ref|XP_009404942.1| PREDICTED: probable beta-D-xylosidase 6 [Musa acuminata subsp. 
malaccensis]
Length=876

 Score =   919 bits (2374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/749 (62%), Positives = 580/749 (77%), Gaps = 27/749 (4%)
 Frame = -3

Query  2487  PQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWW  2308
             P++PC+ P +SS+PFC+TSLP+  R  +LVSLLT+ EKIQ+LS+   A+PRLG+P +EWW
Sbjct  125   PKVPCESPNYSSFPFCNTSLPVAVRARNLVSLLTLPEKIQQLSNTAGAVPRLGLPTFEWW  184

Query  2307  SESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQ  2128
             SESLHGIA NGPG+ F+G+V++AT FPQVILTAAAFNRTLWR++A A AVEARAM+N GQ
Sbjct  185   SESLHGIAVNGPGVAFNGSVRAATEFPQVILTAAAFNRTLWRAVARAIAVEARAMYNVGQ  244

Query  2127  AGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSG  1948
             AGLT+WAPN+N+F DPRWGRGQETPGEDP+V S+YAVEYV+G Q                
Sbjct  245   AGLTYWAPNINIFRDPRWGRGQETPGEDPLVASEYAVEYVKGFQ----------------  288

Query  1947  NRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVE  1768
                   E     +MLSACCKH TAYDL+ W N++RY F+A VT QDMEDTY+PPF+SC++
Sbjct  289   GEYDNGEAGSSSMMLSACCKHYTAYDLDRWGNYTRYIFDAQVTEQDMEDTYQPPFESCIK  348

Query  1767  KGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKSPE  1588
             +G ASCLMCAYN VNG+PACA  DLLEKAR +WGF+GY+TSDCDAVA I+E QQY+ SPE
Sbjct  349   EGHASCLMCAYNQVNGVPACARGDLLEKARKEWGFDGYVTSDCDAVAIIYEDQQYSSSPE  408

Query  1587  EAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVN  1408
             ++    LKAG DINCGTY+LR  +SA+++  V E DID+ALLNLFSVQ RLG+F+G    
Sbjct  409   DSIASVLKAGMDINCGTYLLRFTESAVKSGKVQEEDIDQALLNLFSVQLRLGVFDGDHAK  468

Query  1407  RKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSS  1231
              +F   GPK++C+ EHR LALEA RQGIVLLKNE+  LPL K  VSS+A+IGP A+ TS 
Sbjct  469   NRFGHLGPKNLCTQEHRELALEAVRQGIVLLKNEEGLLPLRKHEVSSVAIIGPAASYTSV  528

Query  1230  LGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVV  1051
              GGDYTG PC   S L+GL  Y+ +T++A+GC+D+ C +T GF EAV IAK AD V++V 
Sbjct  529   YGGDYTGFPCNPTSFLEGLRSYVPRTTFAAGCMDMPCETTVGFEEAVDIAKDADIVVMVA  588

Query  1050  GLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIAS  871
             GL+L++ETED DR+SLLLPG QM LV  +A VS KPL+LVL GGGP+D+SFAK+DP +AS
Sbjct  589   GLNLTEETEDLDRHSLLLPGKQMDLVRSIASVSKKPLILVLIGGGPIDVSFAKEDPLVAS  648

Query  870   VLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRT  691
             +LWIGYPGE GG+AL+E +FGD NP GRLP+TWYPESFT VPM DMNMRADPSRGYPGRT
Sbjct  649   ILWIGYPGEVGGQALAEALFGDLNPGGRLPVTWYPESFTSVPMTDMNMRADPSRGYPGRT  708

Query  690   YRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDE  511
             YRFYTG+ VYEFG+GLSYS++S + LS P +I L++S   + R  +         VH++E
Sbjct  709   YRFYTGKAVYEFGYGLSYSNYSYKFLSMPEKIRLARSSAMRGRLDV---------VHIEE  759

Query  510   VSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVT  331
             V++C+++ F V+VS+ NNGG+DGS  V+LFSR+ T+   G P KQLIGF+RV  +    T
Sbjct  760   VASCDAMRFHVQVSVINNGGVDGSHTVLLFSRSGTN-VRGVPLKQLIGFERVRTTCYEAT  818

Query  330   ETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             E +I ++PC+HLS VN  G R+LPLG H+
Sbjct  819   EVTILVDPCKHLSTVNEHGQRVLPLGAHV  847



>ref|XP_010527498.1| PREDICTED: probable beta-D-xylosidase 6 [Tarenaya hassleriana]
Length=797

 Score =   917 bits (2369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/754 (63%), Positives = 583/754 (77%), Gaps = 6/754 (1%)
 Frame = -3

Query  2493  SKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             S P  PC+PP  +SYPFC TSLPI  R  SL+SLL++ EK+ +LS+  SA+PRLGIP YE
Sbjct  32    SGPDFPCKPPNFNSYPFCKTSLPIRQRALSLISLLSLPEKLGQLSNTASAVPRLGIPPYE  91

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSESLHGIA NGPG++F+G+V SAT FPQVI++AA+FNRTLW  I ++ AVE RAM+N 
Sbjct  92    WWSESLHGIADNGPGVSFNGSVSSATSFPQVIVSAASFNRTLWFEIGSSVAVEGRAMYNV  151

Query  2133  GQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSL  1954
             GQAGLTFWAPN+NVF DPRWGRGQETPGEDP+VVS+Y VE+VRG Q         R++  
Sbjct  152   GQAGLTFWAPNINVFRDPRWGRGQETPGEDPLVVSEYGVEFVRGFQEGSKAKVLRRRFGD  211

Query  1953  SGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSC  1774
               +   + ++ DD+LMLSACCKH TAYDLE W N +RY+FNAVVT QDMEDTY+PPF+ C
Sbjct  212   DDDDH-DHDDVDDKLMLSACCKHFTAYDLEKWGNSTRYNFNAVVTEQDMEDTYQPPFRGC  270

Query  1773  VEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKS  1594
             ++ G+ASCLMC+YNAV+G+PACA  DLL+KAR +WGF GYITSDCDAVATIFEYQ+Y K+
Sbjct  271   IQDGKASCLMCSYNAVDGVPACARGDLLQKARAEWGFNGYITSDCDAVATIFEYQRYTKT  330

Query  1593  PEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKA  1414
             PEEA   AL AG DINCGTYMLRN  SA+E   V E  ID ALL+LFSVQ RLGLF+G  
Sbjct  331   PEEAVADALNAGVDINCGTYMLRNTHSAIELGKVREDQIDEALLHLFSVQLRLGLFDGDP  390

Query  1413  VNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMA-NT  1237
                +F   G  D+C   HR+LALEAA+QGIVLLKN+   LPL+K  VSSLA+IGPMA N 
Sbjct  391   RKGQFAKLGLDDICDPSHRKLALEAAKQGIVLLKNDMDLLPLNKNDVSSLAIIGPMANNV  450

Query  1236  SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIV  1057
             S++GG YTG PC  K++  GL E++ KTSYA+GC DV+C+S  GFAEA+SIAK AD V+V
Sbjct  451   SNIGGGYTGKPCEPKTLFHGLLEFVRKTSYAAGCPDVSCDSGTGFAEALSIAKEADIVVV  510

Query  1056  VVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRI  877
             V GLDLSQETED DR SL LPG Q  LV+ +A VS KP++LVLTGGGP D+SFAK +PRI
Sbjct  511   VAGLDLSQETEDLDRVSLALPGRQQDLVSRVASVSKKPVILVLTGGGPTDVSFAKTEPRI  570

Query  876   ASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPG  697
              S+LWIGYPGE GG+AL+EI+FGD+NP GRLP+TWYPESFT+VPM DMNMRADP RGYPG
Sbjct  571   GSILWIGYPGETGGQALAEIIFGDHNPGGRLPITWYPESFTEVPMTDMNMRADPPRGYPG  630

Query  696   RTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSIL-NRGGNEPYVH  520
             RTYRFYTG +VY FGHGLSY+ FS +++SAP  + LS+      R+ +L +R     ++ 
Sbjct  631   RTYRFYTGPQVYPFGHGLSYTKFSYKIISAPISLILSELFSQPSRKKLLQHREEQLKFLR  690

Query  519   VDE--VSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVS  346
             +DE  VS+C SL F VRV++ N G MDGS V+MLF   P  +A G P+KQLIGFDRV V 
Sbjct  691   LDEVSVSSCESLRFEVRVAVTNTGEMDGSDVLMLFWTMPAVFA-GVPRKQLIGFDRVLVR  749

Query  345   GNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
              +GVTE+   +EPC+HL++ N  G R++ +G H+
Sbjct  750   SHGVTESVFVVEPCKHLTVANGAGKRVIAIGAHV  783



>ref|XP_009400278.1| PREDICTED: probable beta-D-xylosidase 6 [Musa acuminata subsp. 
malaccensis]
Length=778

 Score =   917 bits (2369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/757 (62%), Positives = 580/757 (77%), Gaps = 33/757 (4%)
 Frame = -3

Query  2487  PQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWW  2308
             P+  C+PP ++S+PFC+TSLP+ AR  +LVSLLT+ EKIQ+LS+  +A+PRLG+PAY+WW
Sbjct  32    PKAACEPPGYASFPFCNTSLPVHARARALVSLLTLPEKIQQLSNGAAAVPRLGLPAYQWW  91

Query  2307  SESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQ  2128
             SESLHG+A+NGPG+ F G V++ATGFPQVIL+AAAFNRTLWR++A A AVEARAM N GQ
Sbjct  92    SESLHGVASNGPGVAFGGPVRAATGFPQVILSAAAFNRTLWRALARAIAVEARAMHNVGQ  151

Query  2127  AGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSG  1948
             AGLTFWAPN+N+F DPRWGRGQETPGEDP+V S+YAV+YV+                  G
Sbjct  152   AGLTFWAPNINIFRDPRWGRGQETPGEDPLVASEYAVQYVK---------------GFQG  196

Query  1947  NRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVE  1768
                 +       +MLSACCKH TAYDLE W NF+RY+FNA VT QDMEDTY+PPF+SC++
Sbjct  197   EY--DGGGSSSSMMLSACCKHYTAYDLEKWGNFTRYTFNAQVTEQDMEDTYQPPFRSCIQ  254

Query  1767  KGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKSPE  1588
             +G ASCLMC+YN VNG+PACA  DLLE+AR +WGF+GY+TSDCDAVA I+E Q+Y+ SPE
Sbjct  255   EGFASCLMCSYNQVNGVPACARGDLLERARKEWGFQGYVTSDCDAVAIIYEDQKYSASPE  314

Query  1587  EAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVN  1408
             ++    LKAG DINCGTYMLR  +SA++   V E DIDRALLNLFSVQ RLGLF+G    
Sbjct  315   DSIADVLKAGMDINCGTYMLRFTESAVKMGKVQEEDIDRALLNLFSVQLRLGLFDGVRAK  374

Query  1407  RKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTSSL  1228
             ++F   GP  +C++EHR+LALEAARQGIVLLKN++ FLPL K  VSSLA+IGP A+ +S+
Sbjct  375   KRFGWLGPDSICTAEHRQLALEAARQGIVLLKNDRGFLPLRKHEVSSLAIIGPAADDASI  434

Query  1227  -GGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVV  1051
              GGDYTG+PC   + LDG+  Y+ +TS A GC+DV C S DGF EAV+ AK AD VIVV 
Sbjct  435   YGGDYTGVPCDPITFLDGIRSYVPRTSSAPGCIDVPCKSKDGFEEAVTAAKFADVVIVVA  494

Query  1050  GLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIAS  871
             GL+L++ETEDHDR SLLLPG QM LV  +AG S  P+VLVL GGGP+D+SFA  DP +AS
Sbjct  495   GLNLTEETEDHDRVSLLLPGKQMDLVRAVAGASKAPVVLVLMGGGPIDVSFAADDPLVAS  554

Query  870   VLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRT  691
             +LWIGYPGE GG+AL+E +FGD NP GRLP+TWYPESFT VPMNDMNMRADPSRGYPGRT
Sbjct  555   ILWIGYPGEVGGQALAEALFGDANPGGRLPVTWYPESFTDVPMNDMNMRADPSRGYPGRT  614

Query  690   YRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPY-----  526
             YRFYTG+ VYEFG GLSYSS+S + L AP RI LS S       S ++R    PY     
Sbjct  615   YRFYTGKAVYEFGDGLSYSSYSYKFLRAPQRIRLSGSSA----ESYIDR--EPPYATKDG  668

Query  525   ---VHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRV  355
                + V+EVS+C++L F V+VS+ N G +DGS  V+LF R P +   G+P+KQLIGF+RV
Sbjct  669   RDLLGVEEVSSCDALRFRVQVSVVNKGDVDGSHAVLLFWR-PRAIGEGSPRKQLIGFERV  727

Query  354   HVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             H +  G  E  I ++PC+HLS+VN +G R+LPLG  +
Sbjct  728   HATAGGEAEAEIVVDPCKHLSVVNEKGRRLLPLGAQV  764



>ref|XP_004143540.1| PREDICTED: probable beta-D-xylosidase 6-like [Cucumis sativus]
Length=777

 Score =   916 bits (2368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/763 (62%), Positives = 582/763 (76%), Gaps = 27/763 (4%)
 Frame = -3

Query  2499  SYSKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             S S  Q PC    H SYPFC+ SL   AR  SLVSLLT+DEKIQ+LS+N S+IPRLGIP+
Sbjct  14    SSSDFQFPCNSSLHPSYPFCNRSLSFTARAQSLVSLLTLDEKIQQLSNNASSIPRLGIPS  73

Query  2319  YEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMF  2140
             Y+WWSE LHGIATNGPG++F+G++ SAT FPQV++TAA+FNRTLW  I +A AVEARAMF
Sbjct  74    YQWWSEGLHGIATNGPGVSFNGSITSATSFPQVLVTAASFNRTLWFLIGSAIAVEARAMF  133

Query  2139  NSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKY  1960
             N GQ GLT WAPN+N+F DPRWGRGQETPGEDPMV S Y++++VRGLQ            
Sbjct  134   NVGQCGLTIWAPNINIFRDPRWGRGQETPGEDPMVASAYSIQFVRGLQ------------  181

Query  1959  SLSGNRMPEEE------EDDD---RLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDM  1807
               SGN M E E      E+D+    LM+SACCKH TAYDLE W+NF+RY+F++VVT QD+
Sbjct  182   --SGNWMKEHEIRNEVLEEDNGMGSLMVSACCKHFTAYDLEKWNNFTRYTFDSVVTEQDL  239

Query  1806  EDTYEPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVA  1627
              DTY+PPF+SC+++G+ASCLMC+YNAVNG+PACAN DLL+KAR DWG +GYITSDCDAVA
Sbjct  240   GDTYQPPFRSCIQQGKASCLMCSYNAVNGVPACANPDLLKKARNDWGLKGYITSDCDAVA  299

Query  1626  TIFEYQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSV  1447
             T++EYQ+Y  +PE+A    LKAG DINCGT+MLR  KSA++   V E ++D AL+NLFSV
Sbjct  300   TVYEYQKYTDTPEDAIADVLKAGMDINCGTFMLRGTKSAIDQGKVREEELDSALINLFSV  359

Query  1446  QFRLGLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSS  1267
             Q RLG F+G     KF   G +DVC+++H+ LALEAARQGIVLLKNE KFLPLDK  +SS
Sbjct  360   QARLGFFDGNPREGKFGELGAQDVCTAQHKTLALEAARQGIVLLKNENKFLPLDKNAISS  419

Query  1266  LAVIGPMANTSS-LGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAV  1090
             L VIG +AN SS L G Y G+PC+  S+++G  EY     +ASGCLDV C S + F +A+
Sbjct  420   LTVIGSLANDSSKLLGGYAGVPCSPMSLVEGFQEYAETIFFASGCLDVPCASDNRFEDAI  479

Query  1089  SIAKRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpL  910
              IAK+AD+VI V GLD SQETED DR SLLLPG QM LV+ +A VS KP++LVL GGGPL
Sbjct  480   LIAKKADFVIAVAGLDASQETEDLDRVSLLLPGKQMDLVSSVASVSKKPIILVLIGGGPL  539

Query  909   DISFAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMN  730
             DISFAKKD R+AS+LWIG PGE GGKAL+E++FGDYNP GRLP+TWYP+SFT VPMNDM+
Sbjct  540   DISFAKKDSRVASILWIGNPGEAGGKALAEVIFGDYNPGGRLPVTWYPQSFTNVPMNDMH  599

Query  729   MRADPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSI-  553
             MR +PSRGYPGRTYRFYTG+++Y FG GLSY+SF   LLSAP +++L    +T  RR I 
Sbjct  600   MRPNPSRGYPGRTYRFYTGDRIYGFGEGLSYTSFKYRLLSAPKKVNLLGKAETSRRRIIP  659

Query  552   -LNRGGNEPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQ  376
              +  G N  Y+ V+EV +C+ L F V++S+ N G  DGS VVM+FS  P     G PQ+Q
Sbjct  660   QVRDGVNMSYMEVEEVESCDLLRFEVKLSVSNIGEFDGSHVVMMFSEFPKVLT-GTPQRQ  718

Query  375   LIGFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             LIGFDR++V  N   E+SI ++PC H+S+ +  G R++PLGDH
Sbjct  719   LIGFDRLYVKRNQSAESSIMVDPCNHVSLADEYGKRVIPLGDH  761



>ref|XP_004160150.1| PREDICTED: probable beta-D-xylosidase 6-like, partial [Cucumis 
sativus]
Length=767

 Score =   916 bits (2367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/763 (62%), Positives = 582/763 (76%), Gaps = 27/763 (4%)
 Frame = -3

Query  2499  SYSKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             S S  Q PC    H SYPFC+ SL   AR  SLVSLLT+DEKIQ+LS+N S+IPRLGIP+
Sbjct  4     SSSDFQFPCNSSLHPSYPFCNRSLSFTARAQSLVSLLTLDEKIQQLSNNASSIPRLGIPS  63

Query  2319  YEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMF  2140
             Y+WWSE LHGIATNGPG++F+G++ SAT FPQV++TAA+FNRTLW  I +A AVEARAMF
Sbjct  64    YQWWSEGLHGIATNGPGVSFNGSITSATSFPQVLVTAASFNRTLWFLIGSAIAVEARAMF  123

Query  2139  NSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKY  1960
             N GQ GLT WAPN+N+F DPRWGRGQETPGEDPMV S Y++++VRGLQ            
Sbjct  124   NVGQCGLTIWAPNINIFRDPRWGRGQETPGEDPMVASAYSIQFVRGLQ------------  171

Query  1959  SLSGNRMPEEE------EDDD---RLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDM  1807
               SGN M E E      E+D+    LM+SACCKH TAYDLE W+NF+RY+F++VVT QD+
Sbjct  172   --SGNWMKEHEIRNEVLEEDNGMGSLMVSACCKHFTAYDLEKWNNFTRYTFDSVVTEQDL  229

Query  1806  EDTYEPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVA  1627
              DTY+PPF+SC+++G+ASCLMC+YNAVNG+PACAN DLL+KAR DWG +GYITSDCDAVA
Sbjct  230   GDTYQPPFRSCIQQGKASCLMCSYNAVNGVPACANPDLLKKARNDWGLKGYITSDCDAVA  289

Query  1626  TIFEYQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSV  1447
             T++EYQ+Y  +PE+A    LKAG DINCGT+MLR  KSA++   V E ++D AL+NLFSV
Sbjct  290   TVYEYQKYTDTPEDAIADVLKAGMDINCGTFMLRGTKSAIDQGKVREEELDSALINLFSV  349

Query  1446  QFRLGLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSS  1267
             Q RLG F+G     KF   G +DVC+++H+ LALEAARQGIVLLKNE KFLPLDK  +SS
Sbjct  350   QARLGFFDGNPREGKFGELGAQDVCTAQHKTLALEAARQGIVLLKNENKFLPLDKNAISS  409

Query  1266  LAVIGPMANTSS-LGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAV  1090
             L VIG +AN SS L G Y G+PC+  S+++G  EY     +ASGCLDV C S + F +A+
Sbjct  410   LTVIGSLANDSSKLLGGYAGVPCSPMSLVEGFQEYAETIFFASGCLDVPCASDNRFEDAI  469

Query  1089  SIAKRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpL  910
              IAK+AD+VI V GLD SQETED DR SLLLPG QM LV+ +A VS KP++LVL GGGPL
Sbjct  470   LIAKKADFVIAVAGLDASQETEDLDRVSLLLPGKQMDLVSSVASVSKKPIILVLIGGGPL  529

Query  909   DISFAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMN  730
             DISFAKKD R+AS+LWIG PGE GGKAL+E++FGDYNP GRLP+TWYP+SFT VPMNDM+
Sbjct  530   DISFAKKDSRVASILWIGNPGEAGGKALAEVIFGDYNPGGRLPVTWYPQSFTNVPMNDMH  589

Query  729   MRADPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSI-  553
             MR +PSRGYPGRTYRFYTG+++Y FG GLSY+SF   LLSAP +++L    +T  RR I 
Sbjct  590   MRPNPSRGYPGRTYRFYTGDRIYGFGEGLSYTSFKYRLLSAPKKVNLLGKAETSRRRIIP  649

Query  552   -LNRGGNEPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQ  376
              +  G N  Y+ V+EV +C+ L F V++S+ N G  DGS VVM+FS  P     G PQ+Q
Sbjct  650   QVRDGVNMSYMEVEEVESCDLLRFEVKLSVSNIGEFDGSHVVMMFSEFPKVLT-GTPQRQ  708

Query  375   LIGFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             LIGFDR++V  N   E+SI ++PC H+S+ +  G R++PLGDH
Sbjct  709   LIGFDRLYVKRNQSAESSIMVDPCNHVSLADEYGKRVIPLGDH  751



>ref|XP_010683056.1| PREDICTED: probable beta-D-xylosidase 6 [Beta vulgaris subsp. 
vulgaris]
Length=795

 Score =   904 bits (2337),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/751 (63%), Positives = 589/751 (78%), Gaps = 8/751 (1%)
 Frame = -3

Query  2490  KPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEW  2311
             K +  C PP  +SYPFC+TSLP   R  +L+SLLT+ EKI  L +N S IPRLGIP Y+W
Sbjct  37    KLKFSCNPP-QNSYPFCNTSLPHSTRSQNLLSLLTLPEKISFLCNNFSGIPRLGIPPYQW  95

Query  2310  WSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSG  2131
             WSESLHGIATNGPGI F+G +KSAT FPQV+ +AA+FN++LW  I++A +VE R+M+NSG
Sbjct  96    WSESLHGIATNGPGINFNGPIKSATMFPQVLNSAASFNKSLWFEISSAISVEGRSMYNSG  155

Query  2130  QAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLS  1951
             QAGLTFWAPN+N+F DPRWGRGQETPGEDP+VVS + VE+V+G QGQ     +G  Y+  
Sbjct  156   QAGLTFWAPNINIFRDPRWGRGQETPGEDPLVVSSFGVEFVKGFQGQFFGNGDGYNYNYG  215

Query  1950  GNRMPEEEEDDD-RLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSC  1774
               ++ EE+EDDD  LMLSACCKH TAYDLE W NFSRYSFNAVVT QDMEDTY+PPFKSC
Sbjct  216   KKKVLEEDEDDDGLLMLSACCKHFTAYDLEKWGNFSRYSFNAVVTEQDMEDTYQPPFKSC  275

Query  1773  VEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKS  1594
             +++G+ASCLMC+YN+VNGIPACA  DLLEK R+DWGF GYITSDCDAVATI+EY  Y  +
Sbjct  276   IQQGKASCLMCSYNSVNGIPACARGDLLEKVRSDWGFRGYITSDCDAVATIYEYHSYVTT  335

Query  1593  PEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKA  1414
              E+A   ALKAG DINCGTYML   +SA+E   + + DIDRAL NL SV  RLGLFNG  
Sbjct  336   AEDAIADALKAGVDINCGTYMLYYTESAIEKGKLKQEDIDRALKNLLSVLLRLGLFNGDP  395

Query  1413  VNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-T  1237
             +N  F   G +DVC+ +H+RLALEAAR+G+VLLKN   FLPL+K ++SSLA+IGP AN T
Sbjct  396   LNGMFGKLGSQDVCTQKHQRLALEAAREGVVLLKNYDNFLPLNKHQISSLAIIGPGANST  455

Query  1236  SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIV  1057
             S L G Y+G+PC  K+ ++GL  YI +TSY  GCLDVAC S   F EA+ +A+ +DYVI+
Sbjct  456   SQLWGGYSGVPCNAKTYVEGLQTYIKETSYVGGCLDVACESNSMFDEALLVAEVSDYVIL  515

Query  1056  VVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRI  877
             VVGLDL+QETED DR +LLLPG QM LV+ +A VS +P++LVLTGGGPLD+SFA+++ RI
Sbjct  516   VVGLDLTQETEDKDRVTLLLPGKQMELVSLVASVSRRPVILVLTGGGPLDVSFAEENSRI  575

Query  876   ASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPG  697
             AS+LW+GYPGE GGKAL+E++FGD+NP GRLP+TWYPESFTK+PMN+MNMRADPS  YPG
Sbjct  576   ASILWLGYPGEAGGKALAEVIFGDHNPGGRLPMTWYPESFTKIPMNNMNMRADPSHLYPG  635

Query  696   RTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHV  517
             RT+RFYTG+ VY+FGHGLSY++++ +LLSAP  +++    K+   R +  R G   YV  
Sbjct  636   RTHRFYTGKVVYKFGHGLSYTNYTYKLLSAPITLNVFTENKSN-SRILYQRIG---YVST  691

Query  516   DEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNG  337
             DE+ +C+SL F+V +S+ N G MDGS VVML+S+   +   GAP+KQLIGF RVH + +G
Sbjct  692   DELFSCDSLRFNVEISVMNAGFMDGSHVVMLYSKTSRN-VDGAPRKQLIGFSRVHTTAHG  750

Query  336   VTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
              TETSI ++PC+HLS  N  G R+L LG+HI
Sbjct  751   STETSIVVDPCEHLSFANEHGKRVLHLGEHI  781



>dbj|BAC41913.1| putative beta-xylosidase [Arabidopsis thaliana]
Length=732

 Score =   887 bits (2293),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/716 (63%), Positives = 559/716 (78%), Gaps = 5/716 (1%)
 Frame = -3

Query  2379  EKIQRLSDNNSAIPRLGIPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAF  2200
             EKI +LS+  +++PRLGIP YEWWSESLHG+A NGPG++F+G++ +AT FPQVI++AA+F
Sbjct  4     EKIGQLSNTAASVPRLGIPPYEWWSESLHGLADNGPGVSFNGSISAATSFPQVIVSAASF  63

Query  2199  NRTLWRSIaaaaavearAMFNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYA  2020
             NRTLW  I +A AVE RAM+N GQAGLTFWAPN+NVF DPRWGRGQETPGEDP VVS+Y 
Sbjct  64    NRTLWYEIGSAVAVEGRAMYNGGQAGLTFWAPNINVFRDPRWGRGQETPGEDPKVVSEYG  123

Query  2019  VEYVrglqgqglkgkngRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRY  1840
             VE+VRG Q +  +    R++S   +    +++ D +LMLSACCKH TAYDLE W NF+RY
Sbjct  124   VEFVRGFQEKKKRKVLKRRFSDDVDDDRHDDDADGKLMLSACCKHFTAYDLEKWGNFTRY  183

Query  1839  SFNAVVTRQDMEDTYEPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFE  1660
              FNAVVT QDMEDTY+PPF++C+  G+ASCLMC+YNAVNG+PACA  DLL+KAR +WGFE
Sbjct  184   DFNAVVTEQDMEDTYQPPFETCIRDGKASCLMCSYNAVNGVPACAQGDLLQKARVEWGFE  243

Query  1659  GYITSDCDAVATIFEYQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESD  1480
             GYITSDCDAVATIF YQ Y KSPEEA   A+KAG DINCGTYMLR+ +SA+E   V E  
Sbjct  244   GYITSDCDAVATIFAYQGYTKSPEEAVADAIKAGVDINCGTYMLRHTQSAIEQGKVSEEL  303

Query  1479  IDRALLNLFSVQFRLGLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQK  1300
             +DRALLNLF+VQ RLGLF+G     ++   G  D+CSS+HR+LALEA RQGIVLLKN+ K
Sbjct  304   VDRALLNLFAVQLRLGLFDGDPRRGQYGKLGSNDICSSDHRKLALEATRQGIVLLKNDHK  363

Query  1299  FLPLDKTRVSSLAVIGPMANT-SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVA  1123
              LPL+K  VSSLA++GPMAN  S++GG YTG PC  K++   L EY+ KTSYASGC DV+
Sbjct  364   LLPLNKNHVSSLAIVGPMANNISNMGGTYTGKPCQRKTLFTELLEYVKKTSYASGCSDVS  423

Query  1122  CNSTDGFAEAVSIAKRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKp  943
             C+S  GF EAV+IAK AD+VIVV GLDLSQETED DR SL LPG Q  LV+ +A VS KP
Sbjct  424   CDSDTGFGEAVAIAKGADFVIVVAGLDLSQETEDKDRVSLSLPGKQKDLVSHVAAVSKKP  483

Query  942   lvlvltgggpLDISFAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPE  763
             ++LVLTGGGP+D++FAK DPRI S++WIGYPGE GG+AL+EI+FGD+NP GRLP TWYPE
Sbjct  484   VILVLTGGGPVDVTFAKNDPRIGSIIWIGYPGETGGQALAEIIFGDFNPGGRLPTTWYPE  543

Query  762   SFTKVPMNDMNMRADPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQ  583
             SFT V M+DM+MRA+ SRGYPGRTYRFYTG +VY FG GLSY+ F  ++LSAP R+SLS+
Sbjct  544   SFTDVAMSDMHMRANSSRGYPGRTYRFYTGPQVYSFGTGLSYTKFEYKILSAPIRLSLSE  603

Query  582   SI-KTKLRRSILNRGGNEPYVHVDE--VSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRA  412
              + +    +  L  G    Y+ +D+  V++C SL F+VRV + N G +DGS VVMLFS+ 
Sbjct  604   LLPQQSSHKKQLQHGEELRYLQLDDVIVNSCESLRFNVRVHVSNTGEIDGSHVVMLFSKM  663

Query  411   PTSYAGGAPQKQLIGFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             P   + G P+KQLIG+DRVHV  N + ET   I+PC+ LS+ N  G R++PLG H+
Sbjct  664   PPVLS-GVPEKQLIGYDRVHVRSNEMMETVFVIDPCKQLSVANDVGKRVIPLGSHV  718



>ref|XP_008796726.1| PREDICTED: probable beta-D-xylosidase 6 [Phoenix dactylifera]
Length=790

 Score =   887 bits (2291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/752 (62%), Positives = 578/752 (77%), Gaps = 7/752 (1%)
 Frame = -3

Query  2484  QLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWS  2305
             Q PC+ P H+SYPFC+ SLP+  R   LVSLLT+DEKIQ+LS++ +A+PRLG+P Y+WWS
Sbjct  27    QYPCKRP-HNSYPFCNASLPVATRAGYLVSLLTLDEKIQQLSNSAAAVPRLGLPPYQWWS  85

Query  2304  ESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA  2125
             ESLHG+A NGPG+ F+G V+SAT FPQVIL+AAAFNRTLW +I+ A AVEARAM+N GQA
Sbjct  86    ESLHGLAPNGPGVFFNGTVRSATVFPQVILSAAAFNRTLWHAISRAIAVEARAMYNVGQA  145

Query  2124  GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVr--glqgqglkgkngRKYSLS  1951
             GLTFWAPN+N+F DPRWGRGQETPGEDPM+ SDYAVEYVR    +  G       +  +S
Sbjct  146   GLTFWAPNINIFRDPRWGRGQETPGEDPMLTSDYAVEYVRGFQGEDDGDLEDRIGESRIS  205

Query  1950  GNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCV  1771
                          +M+SACCKH TAYDL+ W +FSRY+FNA VT+QDMEDT++PPF+SC+
Sbjct  206   EGSRRGGGGGAGEMMVSACCKHYTAYDLDQWEDFSRYTFNAAVTKQDMEDTFQPPFRSCI  265

Query  1770  EKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKSP  1591
             E+G ASCLMC+YN VNG+PACA  DLL+KAR +WG EGYITSDCDAVA I+E Q Y  SP
Sbjct  266   EEGHASCLMCSYNQVNGVPACARGDLLQKARKEWGLEGYITSDCDAVAIIYEDQNYTNSP  325

Query  1590  EEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAV  1411
             E++    LKAG DINCGTY++R    A+   IV E DIDRALLNLFSVQ RLGLF+G   
Sbjct  326   EDSIADVLKAGMDINCGTYLVRYTGQAVRLGIVREEDIDRALLNLFSVQLRLGLFDGNPA  385

Query  1410  NRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TS  1234
               +F   GP D+C+ EHR LALEAARQGIVLLKN++ FLPL K +V SLA+IGP  N T+
Sbjct  386   KNRFGELGPSDICTKEHRELALEAARQGIVLLKNDRSFLPLRKNKVGSLAIIGPAGNDTN  445

Query  1233  SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVV  1054
              LGGDYTG+PC   S+ +GL  YI  TS+A+GC+DV C+  DGF  AV++A++AD V+VV
Sbjct  446   ILGGDYTGVPCHPTSLFEGLQTYIAGTSFAAGCIDVPCDLKDGFKAAVAVARKADVVVVV  505

Query  1053  VGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIA  874
              GL+L++ETEDHDR SLLLPG QM LVN +A VS KPLVLVL GGGP+D+SFAK +PRI 
Sbjct  506   AGLNLTEETEDHDRISLLLPGEQMDLVNAIAKVSRKPLVLVLMGGGPVDVSFAKDNPRIG  565

Query  873   SVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGR  694
             S+LWIGYPGE GG+A++E +FG++NP GRLP+TWYPESFTKVPMNDM+MRADPSRGYPGR
Sbjct  566   SILWIGYPGEVGGQAVAEALFGEFNPGGRLPVTWYPESFTKVPMNDMHMRADPSRGYPGR  625

Query  693   TYRFYTGEKVYEFGHGlsyssfslellSAPTRISL-SQSIKTKLRRSILN-RGGNEPYVH  520
             TYRFYTGE VY FG+GLSYSS+S +  S P +IS+ S S +  +R+   + R      + 
Sbjct  626   TYRFYTGEVVYRFGYGLSYSSYSYKFFSVPEKISVRSSSTEAYIRKEPQDARRDGLDSLR  685

Query  519   VDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGN  340
             +DE+S+C +L F V++S+ N G MDGS  V+LF+R+ T+   G+P+KQLIGF+RVH +  
Sbjct  686   IDEISSCKALTFYVQISVINGGNMDGSNTVLLFARS-TANIKGSPKKQLIGFERVHTTAG  744

Query  339   GVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
               TE  I + PC+HLS VN EG  +LPLG H+
Sbjct  745   RATEARIMVNPCKHLSTVNEEGQWVLPLGAHV  776



>emb|CDX97026.1| BnaC09g45990D [Brassica napus]
Length=751

 Score =   880 bits (2274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/756 (60%), Positives = 558/756 (74%), Gaps = 51/756 (7%)
 Frame = -3

Query  2493  SKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             S P+ PCQPP HSSYPFC+ SL    R  SLVSLLT+ EKI +LS+  +++PRLGIP YE
Sbjct  25    SNPKFPCQPPHHSSYPFCNISLSTTKRALSLVSLLTLPEKITQLSNTAASVPRLGIPPYE  84

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSESLHG+A NGPG++F+G++ SAT FPQVI++AA+FNRTLWR I +A AVE RAM+N 
Sbjct  85    WWSESLHGLADNGPGVSFNGSISSATSFPQVIVSAASFNRTLWREIGSAVAVEGRAMYNG  144

Query  2133  GQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSL  1954
             GQAGLT+WAPN+NVF DPRWGRGQETPGEDP VVS+Y VE+VRGL              L
Sbjct  145   GQAGLTYWAPNINVFRDPRWGRGQETPGEDPKVVSEYGVEFVRGLGNGDDDDDGDGGKLL  204

Query  1953  SGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSC  1774
                              SACCKH TAYDLE W NF+RY FNAVVT QDMEDTY+PPF+SC
Sbjct  205   L----------------SACCKHFTAYDLEKWGNFTRYDFNAVVTEQDMEDTYQPPFQSC  248

Query  1773  VEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKS  1594
             +E G+ASCLMC+YNAVNG+PACA +DLL+KAR DWGF+GYITSDC               
Sbjct  249   IEDGKASCLMCSYNAVNGVPACARQDLLQKARVDWGFKGYITSDC---------------  293

Query  1593  PEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKA  1414
                          DINCGTYM+R+ +SA++   V E  IDRALLNLF+VQ RLGLF+G  
Sbjct  294   ------------VDINCGTYMVRHTQSAIDKGKVSEEQIDRALLNLFAVQLRLGLFDGNP  341

Query  1413  VNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANT-  1237
                ++   G  D+CSS HR LALEAARQGIVLLKN+ K LPL K+ VSSLA+IGPMAN  
Sbjct  342   KQGRYAKLGSNDICSSSHRELALEAARQGIVLLKNDHKLLPLKKSNVSSLAIIGPMANNI  401

Query  1236  SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIV  1057
             SS+GG YTG PC  K++   L EY+ KTSYASGC DVAC+S  GF EAV+IAK AD+VIV
Sbjct  402   SSMGGTYTGKPCQRKTLFSELLEYVKKTSYASGCSDVACDSPAGFKEAVAIAKGADFVIV  461

Query  1056  VVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRI  877
             V GLDL+QETED DR SL LPG Q  LV  +A  S KP++LVLTGGGP+D++FAK DPRI
Sbjct  462   VAGLDLTQETEDKDRVSLSLPGKQRDLVTSIAAASKKPVILVLTGGGPVDVTFAKTDPRI  521

Query  876   ASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPG  697
              S++WIGYPGE GG+AL+EI+FGD+NP GRLP+TWYP+SF++V M+DM+MRAD SRGYPG
Sbjct  522   GSIVWIGYPGETGGQALAEILFGDFNPGGRLPMTWYPQSFSEVAMSDMHMRADSSRGYPG  581

Query  696   RTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSI---KTKLRRSILNRG-GNEP  529
             RTYRFYTG++VY+FG GLSY+ F  ++LSAPTR+ LS+ I    +  ++ +L +G G   
Sbjct  582   RTYRFYTGDQVYKFGTGLSYTEFDYKILSAPTRLGLSEVILQDSSSHKKLLLQKGEGELR  641

Query  528   YVHVDE--VSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRV  355
             Y  +D+  V++C SL F+VR S+RN G MDGS V+ML+SR P   + G P++QLIGF+RV
Sbjct  642   YFQLDDLAVNSCESLRFNVRFSVRNTGEMDGSHVLMLYSRMPRVLS-GVPERQLIGFERV  700

Query  354   HVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             HV  + + E    I+PC+HLS+ N  G R++PLG H
Sbjct  701   HVRSSEMVEAEFVIDPCKHLSVANDVGKRVIPLGVH  736



>ref|NP_001053392.1| Os04g0530700 [Oryza sativa Japonica Group]
 emb|CAD41212.2| OSJNBa0074L08.23 [Oryza sativa Japonica Group]
 emb|CAE03865.2| OSJNBa0081C01.11 [Oryza sativa Japonica Group]
 dbj|BAF15306.1| Os04g0530700 [Oryza sativa Japonica Group]
 gb|EEC77690.1| hypothetical protein OsI_16749 [Oryza sativa Indica Group]
Length=770

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/749 (59%), Positives = 558/749 (74%), Gaps = 25/749 (3%)
 Frame = -3

Query  2478  PCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSES  2299
             PC  P  S+YPFC+ +LP PAR  +LVSLLT+DEKI +LS+  +  PRLG+P +EWWSES
Sbjct  29    PCASPAASAYPFCNATLPFPARARALVSLLTLDEKIAQLSNTAAGAPRLGVPPFEWWSES  88

Query  2298  LHGIATNGPGITFD-GAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAG  2122
             LHG+  NGPG+ F  G V+SAT FPQVIL+AAAFNR+LWR+ A A AVEARAM N+GQAG
Sbjct  89    LHGVCDNGPGVNFSSGPVRSATIFPQVILSAAAFNRSLWRAAARAIAVEARAMHNAGQAG  148

Query  2121  LTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNR  1942
             LTFWAPN+NVF DPRWGRGQETPGEDP VVS Y+VEYV+G                    
Sbjct  149   LTFWAPNINVFRDPRWGRGQETPGEDPAVVSAYSVEYVKG--------------------  188

Query  1941  MPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKG  1762
                +  ++ R+MLSACCKH  AYDLE W  F+RY+FNA V  QDMEDTY+PPFKSC+++G
Sbjct  189   FQRDYGEEGRMMLSACCKHYIAYDLEKWRGFTRYTFNAKVNAQDMEDTYQPPFKSCIQEG  248

Query  1761  RASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEA  1582
             RASCLMC+YN VNG+PACA KD+L++AR +WGF+GYITSDCDAVA I E Q Y  S E++
Sbjct  249   RASCLMCSYNQVNGVPACARKDILQRARDEWGFQGYITSDCDAVAIIHENQTYTASDEDS  308

Query  1581  AGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRK  1402
               + LKAG DINCG++++R+ KSA+E   V E DI+ AL NLFSVQ RLG F+    N+ 
Sbjct  309   IAVVLKAGMDINCGSFLIRHTKSAIEKGKVQEEDINHALFNLFSVQLRLGFFDKTNENQW  368

Query  1401  FESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTSS-LG  1225
             F   GP +VC++EHR LA EA RQG VLLKN+  FLPL ++ V  +A+IGP AN    LG
Sbjct  369   FTQLGPNNVCTTEHRELAAEAVRQGTVLLKNDNGFLPLKRSEVGHIALIGPAANDPYILG  428

Query  1224  GDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGL  1045
             GDYTG+PC   + + G+  Y+ KT++A+GC DV CNSTDGF EA+  AKRAD V+++ GL
Sbjct  429   GDYTGVPCHSTTFVKGMQAYVPKTTFAAGCKDVPCNSTDGFGEAIEAAKRADVVVLIAGL  488

Query  1044  DLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVL  865
             +L++ETEDHDR SLLLPG QM L++ +A V+ KP+VLVL GGGP+D+SFAK DPRIAS+L
Sbjct  489   NLTEETEDHDRVSLLLPGRQMDLIHTVASVTKKPVVLVLMGGGPVDVSFAKHDPRIASIL  548

Query  864   WIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYR  685
             WIGYPGE GG  L EI+FG YNP G+LP+TWYPESFT VPM+DMNMRAD SRGYPGRTYR
Sbjct  549   WIGYPGEVGGNVLPEILFGKYNPGGKLPITWYPESFTAVPMDDMNMRADASRGYPGRTYR  608

Query  684   FYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKL--RRSILNRGGNEPYVHVDE  511
             FYTG+ VY FG+GLSYS +S  +L AP +ISLS+S    L  R+    R     YV V++
Sbjct  609   FYTGDVVYGFGYGLSYSKYSYSILQAPKKISLSRSSVPDLISRKPAYTRRDGVDYVQVED  668

Query  510   VSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVT  331
             +++C +L F V +S+ N+G MDGS  V+LF+ +  S+  G+P KQL+GF+RVH +    T
Sbjct  669   IASCEALQFPVHISVSNDGAMDGSHAVLLFASSKPSFP-GSPIKQLVGFERVHTAAGRST  727

Query  330   ETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             +  I+++PC+ +S  N EG+R+L LG H+
Sbjct  728   DVEITVDPCKLMSFANTEGTRVLFLGTHV  756



>emb|CDX69822.1| BnaA10g21710D [Brassica napus]
Length=744

 Score =   874 bits (2259),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/755 (60%), Positives = 560/755 (74%), Gaps = 54/755 (7%)
 Frame = -3

Query  2493  SKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             S P+ PCQPP HSS+PFC+ SL    R HSLVSLLT+ EKI +LS+  +++PRLGIP YE
Sbjct  23    SNPKFPCQPPHHSSFPFCNISLSTTKRAHSLVSLLTLPEKIGQLSNTAASVPRLGIPPYE  82

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSESLHG+A NGPG++F+G++ SAT FPQVI++AAAFNRTLWR I +A AVE RAM+N 
Sbjct  83    WWSESLHGLADNGPGVSFNGSIASATSFPQVIVSAAAFNRTLWRGIGSAVAVEGRAMYNG  142

Query  2133  GQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSL  1954
             GQAGLT+WAPN+NVF DPRWGRGQETPGEDP VVS+Y V+   G                
Sbjct  143   GQAGLTYWAPNINVFRDPRWGRGQETPGEDPKVVSEYGVDLGDGGH--------------  188

Query  1953  SGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSC  1774
                   ++++ D +LMLSACCKH TAYDLE W NF+RY FNAVVT QDMEDTY+PPF+SC
Sbjct  189   ------DDDDGDGKLMLSACCKHFTAYDLEKWGNFTRYDFNAVVTEQDMEDTYQPPFQSC  242

Query  1773  VEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKS  1594
             +E G+ASCLMC+YNAVNG+PACA +DLL+KAR DWGF+GYITSDC               
Sbjct  243   IEDGKASCLMCSYNAVNGVPACARQDLLQKARVDWGFKGYITSDC---------------  287

Query  1593  PEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKA  1414
                          DINCGTYM+R+ ++A++   V E  IDRALLNLF+VQ RLGLF+G  
Sbjct  288   ------------VDINCGTYMVRHTQAAIDKGKVSEEQIDRALLNLFAVQLRLGLFDGNP  335

Query  1413  VNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANT-  1237
                ++   G  D+CSS HR LALEAARQGIVLLKN+ K LPL K  VSSLA+IGPMAN  
Sbjct  336   KQGRYAKLGANDICSSSHRELALEAARQGIVLLKNDHKLLPLKKRHVSSLAIIGPMANNI  395

Query  1236  SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIV  1057
             SS+GG YTG PC  K++   L EY+ KTSYASGC DVAC+S  GF EAV++ K AD+VIV
Sbjct  396   SSMGGTYTGKPCQRKTLFTELLEYVKKTSYASGCSDVACDSPAGFKEAVAVTKGADFVIV  455

Query  1056  VVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRI  877
             V GLDL+QETED DR SL LPG Q  LV  +A  S KP++LVLTGGGP+D++FAK DPRI
Sbjct  456   VAGLDLTQETEDKDRVSLSLPGKQRDLVTSIAAASKKPVILVLTGGGPVDVTFAKTDPRI  515

Query  876   ASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPG  697
              S++WIGYPGE GG+AL+EI+FGD+NP GRLP+TWYP+SF++V M+DM+MRAD +RGYPG
Sbjct  516   GSIVWIGYPGETGGRALAEILFGDFNPGGRLPMTWYPQSFSEVAMSDMHMRADLARGYPG  575

Query  696   RTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSI--KTKLRRSILNRGGNE-PY  526
             RTYRFYTG +VY+FG GLSY+ F  E+LSAPTR+ LS+ I   +  ++ +L +G  E  Y
Sbjct  576   RTYRFYTGPEVYKFGTGLSYTEFDYEILSAPTRLGLSEVIPQDSSHKKLLLQKGKGELRY  635

Query  525   VHVDE--VSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVH  352
             + +++  V +C SL F+VR S+RN G MDGS V+ML+SR P   + G P++QLIGF+RVH
Sbjct  636   LQLNDLAVDSCESLRFNVRFSVRNTGEMDGSHVLMLYSRMPKVLS-GVPERQLIGFERVH  694

Query  351   VSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             V  + + E    I+PC+HLS+ N  G R++PLG H
Sbjct  695   VRSSEMVEAEFVIDPCKHLSVANDVGKRVIPLGVH  729



>ref|XP_003580200.2| PREDICTED: probable beta-D-xylosidase 6 [Brachypodium distachyon]
Length=799

 Score =   874 bits (2257),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/741 (59%), Positives = 560/741 (76%), Gaps = 25/741 (3%)
 Frame = -3

Query  2451  YPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGIATNGP  2272
             YPFCD SLP P R  +LVSLLT+DEKI +LS+  + +PRLGIP YEWWSESLHG+A NGP
Sbjct  65    YPFCDASLPFPVRARALVSLLTLDEKIAQLSNTAAGVPRLGIPPYEWWSESLHGLADNGP  124

Query  2271  GITFD-GAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWAPNVN  2095
             G+ F  G V +AT FPQVIL+AA+FNR+LWR++A A AVEARAM N+GQAGLT+WAPN+N
Sbjct  125   GVNFSSGPVGAATIFPQVILSAASFNRSLWRAVAEAVAVEARAMHNAGQAGLTYWAPNIN  184

Query  2094  VFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEEEDDD  1915
             VF DPRWGRGQETPGEDP V++ Y+VEYV                   G +    +  + 
Sbjct  185   VFRDPRWGRGQETPGEDPAVIAAYSVEYV------------------KGFQGEYGDGKEG  226

Query  1914  RLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCLMCAY  1735
             R+MLSACCKH  AYDLE W NF+RY+FNA V  QD EDTYEPPFKSC+++GRASCLMC+Y
Sbjct  227   RMMLSACCKHYVAYDLEKWGNFTRYTFNAKVNEQDFEDTYEPPFKSCIQEGRASCLMCSY  286

Query  1734  NAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIALKAGT  1555
             N VNG+PACA KDLL+K R +WGF+GY+ SDCDAV  I+ YQ Y  S E++  I LKAG 
Sbjct  287   NQVNGVPACARKDLLQKVRDEWGFQGYVVSDCDAVGIIYGYQNYTNSDEDSIAIVLKAGM  346

Query  1554  DINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESFGPKDV  1375
             DINCG++++R+ KSA++   + E DI+ AL NLFSVQ RLGLF+  + N+ F   GP ++
Sbjct  347   DINCGSFLIRHTKSAIQKGKITEEDINHALFNLFSVQLRLGLFDKTSGNQWFTQLGPSNI  406

Query  1374  CSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTSS-LGGDYTGIPCA  1198
             C+ EHR LA EAARQG VLLKN+  FLPL ++ VS +A+IGP+AN +  +GGDYTG+PC 
Sbjct  407   CTKEHRELAAEAARQGTVLLKNDNSFLPLKRSEVSHIAIIGPVANDAYIMGGDYTGVPCN  466

Query  1197  LKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQETEDH  1018
               + L G+   + +T+ A+GC D++CNSTDGF EA+ +AKRAD V+++ GL+L+QETED 
Sbjct  467   PTTFLKGMQAVVPQTTIAAGCKDISCNSTDGFGEAIEVAKRADIVVLIAGLNLTQETEDL  526

Query  1017  DRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGYPGEEG  838
             DR SLLLPG QM L+N +A V+ KPLVLV+TGGGP+D+SFAK+D RIASVLWIGYPGE G
Sbjct  527   DRVSLLLPGKQMDLINSIASVTKKPLVLVITGGGPVDVSFAKQDKRIASVLWIGYPGEVG  586

Query  837   GKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFYTGEKVYE  658
             G+ L EI+FG+YNP G+LP+TWYPESFT VPMNDMNMRADPSR YPGRTYRFYTG+ VY 
Sbjct  587   GQVLPEILFGEYNPGGKLPITWYPESFTAVPMNDMNMRADPSRSYPGRTYRFYTGDVVYG  646

Query  657   FGHGlsyssfslellSAPTRISLSQSIKTKL---RRSILNRGGNEPYVHVDEVSNCNSLA  487
             FG+GLSYS +S  ++ APT+ISLS+S        +R+   R G + YV V+++++C S+ 
Sbjct  647   FGYGLSYSKYSYNIIQAPTKISLSRSSAVDFISTKRAHTRRDGLD-YVQVEDIASCESIK  705

Query  486   FSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSISIEP  307
             FSV +S+ N+G MDGS  V+LF+R+ +S   G P KQL+GF+R++ +    T   I+++P
Sbjct  706   FSVHISVANDGAMDGSHAVLLFTRSKSSVP-GFPLKQLVGFERLYAAAGKATNVEITVDP  764

Query  306   CQHLSIVNVEGSRILPLGDHI  244
             C+ +S  N EG R+L LG H+
Sbjct  765   CKLMSSANTEGRRVLLLGSHL  785



>ref|XP_006850394.1| hypothetical protein AMTR_s00184p00056440 [Amborella trichopoda]
 gb|ERN11975.1| hypothetical protein AMTR_s00184p00056440 [Amborella trichopoda]
Length=798

 Score =   873 bits (2256),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/766 (59%), Positives = 560/766 (73%), Gaps = 40/766 (5%)
 Frame = -3

Query  2487  PQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWW  2308
             PQ  C+PP H  YPFC++SLP   R   L+S L + +KI +LS+  ++IP LGIPAYEWW
Sbjct  41    PQFSCKPP-HDCYPFCNSSLPTKIRAQDLLSRLFLSDKILQLSNGAASIPHLGIPAYEWW  99

Query  2307  SESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQ  2128
             SESLHG+A NGPG+TF+G+V SAT FPQVIL+ ++FN +LW S+A++   EARAM N GQ
Sbjct  100   SESLHGLAPNGPGVTFNGSVTSATIFPQVILSTSSFNSSLWFSLASSIGDEARAMHNVGQ  159

Query  2127  AGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSG  1948
             AGLTFWAPN+N+F DPRWGRGQET GEDP+V S YAVEYVR                  G
Sbjct  160   AGLTFWAPNINIFRDPRWGRGQETCGEDPLVASVYAVEYVR---------------GFQG  204

Query  1947  NRMPEEEEDDDRLM--------------LSACCKHLTAYDLELWHNFSRYSFNAVVTRQD  1810
                PE E  DD LM              LSACCKH TAYDLE   N +RY+FNA V++QD
Sbjct  205   E--PEFEGLDDELMRDKRILIPRDSKLKLSACCKHFTAYDLENAENVTRYTFNAKVSKQD  262

Query  1809  MEDTYEPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLL-EKARTDWGFEGYITSDCDA  1633
             +EDTY+PPFKSC++ G ASCLMC+YN +NGIP+CA  DLL + AR +WGFEGYITSDCDA
Sbjct  263   LEDTYQPPFKSCIQDGHASCLMCSYNQLNGIPSCARYDLLTQTARNEWGFEGYITSDCDA  322

Query  1632  VATIFEYQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLF  1453
             VA I+E Q+YA SPE+A    LKAG DINCGTY+LR    A+E   VVESDIDRALLNLF
Sbjct  323   VAVIYEDQRYAPSPEDAVADVLKAGMDINCGTYLLRYTAFAVEQGKVVESDIDRALLNLF  382

Query  1452  SVQFRLGLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRV  1273
             SVQ RLGLF+G    ++F   GP DVC+++HR+LALEA RQGIVLLKN + FLPL K++V
Sbjct  383   SVQIRLGLFDGFPNKQRFAGLGPNDVCNAKHRKLALEATRQGIVLLKNTKSFLPLTKSKV  442

Query  1272  SSLAVIGPMA-NTSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAE  1096
             SS+A+IGP A N S L GDY+G PC   ++ +GL  Y+  T+Y+ GCLD+AC S+DGF E
Sbjct  443   SSMAIIGPAAHNASLLNGDYSGTPCNPTTLFEGLRTYVKNTAYSLGCLDIACESSDGFGE  502

Query  1095  AVSIAKRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltggg  916
             A+ +AK AD V VV GLDL+QETEDHDR SL+LPG Q  L+  +A  S  P++L+L GGG
Sbjct  503   AIDVAKTADIVAVVAGLDLTQETEDHDRVSLILPGKQRGLITSIAHASKGPVILILVGGG  562

Query  915   pLDISFAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMND  736
             P+D+SF K+DPRIAS+LWIGYPGE GG+A++E++FGD NP GRLP+TWYPESFT VPM D
Sbjct  563   PIDVSFTKEDPRIASILWIGYPGETGGEAVAEVLFGDVNPGGRLPVTWYPESFTSVPMTD  622

Query  735   MNMRADPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRS  556
             MNMR DPSRGYPGRTYRFYTGE VY FGHGLSYS FS E LS P  +S+    K +L  S
Sbjct  623   MNMRPDPSRGYPGRTYRFYTGEVVYPFGHGLSYSEFSYEFLSLPKFLSVP---KVELLSS  679

Query  555   ILN--RGGNEPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQ  382
               +  R     Y++++EV  C +L F VRVS+ N+GGMDGS VV+L+S++P   + GAP+
Sbjct  680   TPDTLRTNQVDYIYIEEVETCEALRFYVRVSVLNDGGMDGSHVVLLYSKSPARIS-GAPK  738

Query  381   KQLIGFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             KQLIGF RVH      TE    + PC++LS VN  G R+L +G+H+
Sbjct  739   KQLIGFKRVHTKSKQPTEAVFFVNPCENLSNVNEHGERVLEIGNHV  784



>ref|XP_002448225.1| hypothetical protein SORBIDRAFT_06g023450 [Sorghum bicolor]
 gb|EES12553.1| hypothetical protein SORBIDRAFT_06g023450 [Sorghum bicolor]
Length=766

 Score =   864 bits (2233),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/752 (58%), Positives = 560/752 (74%), Gaps = 29/752 (4%)
 Frame = -3

Query  2478  PCQPP--THSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWS  2305
             PC  P    S+YPFCD SL IPAR  +LVSLLT+DEKI +LS+    +PRLGIP Y+WWS
Sbjct  23    PCASPYSGSSAYPFCDASLSIPARARALVSLLTLDEKIAQLSNTAGGVPRLGIPPYQWWS  82

Query  2304  ESLHGIATNGPGITFD-GAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQ  2128
             ESLHG+A NGPG+ F  G V++AT FPQVIL+ AAFNR+LWR++A A A EA  M N+GQ
Sbjct  83    ESLHGLADNGPGVNFSSGPVRAATTFPQVILSTAAFNRSLWRAVAEAVATEALGMHNAGQ  142

Query  2127  AGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSG  1948
             AGLT+WAPN+N+F DPRWGRGQET GEDP V + Y++EYV+G                  
Sbjct  143   AGLTYWAPNINIFRDPRWGRGQETSGEDPAVAAAYSLEYVKG------------------  184

Query  1947  NRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVE  1768
                  E+ ++ R+ LSACCKH TAYD+E W  FSRY+FNA V  QD+EDTY+PPFK+C++
Sbjct  185   --FQGEQGEEGRIRLSACCKHYTAYDMEKWEGFSRYTFNAKVNAQDLEDTYQPPFKTCIQ  242

Query  1767  KGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKSPE  1588
             + RASCLMCAYN VNG+P CANKDLL+K R +WGF+GYITSDCDAVA I E Q Y KS E
Sbjct  243   EARASCLMCAYNQVNGVPMCANKDLLQKTRDEWGFQGYITSDCDAVAIIHENQTYTKSDE  302

Query  1587  EAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVN  1408
             ++  I LKAG DINCG++++R+ KSA+E   V E DIDRAL NLFSVQ RLG+F+    N
Sbjct  303   DSIAIVLKAGMDINCGSFLVRHTKSAVEKGKVQEQDIDRALFNLFSVQLRLGIFDKPNNN  362

Query  1407  RKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSS  1231
             +     GP +VC+ EHR LA EA RQG VLLKN+  FLPL ++ V  +A+IGP AN   +
Sbjct  363   QWSTQLGPNNVCTKEHRELAAEAVRQGAVLLKNDHSFLPLKRSEVRHVAIIGPSANDVYA  422

Query  1230  LGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVV  1051
             +GGDYTG+ C   + L G+  Y  +T++A+GC DV+CNST+ F EA++ AKRAD V+VV 
Sbjct  423   MGGDYTGVACNPTTFLKGIQAYATQTTFAAGCKDVSCNSTELFGEAIAAAKRADIVVVVA  482

Query  1050  GLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIAS  871
             GL+L++E ED DR SLLLPG QM+L++ +A V+ KPLVLVL GGGP+D+SFAK+DPRIAS
Sbjct  483   GLNLTEEREDFDRVSLLLPGKQMSLIHAVASVAKKPLVLVLLGGGPVDVSFAKQDPRIAS  542

Query  870   VLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRT  691
             +LW+GYPGE GG+ L EI+FG+YNP G+L +TWYPESFT +PM DMNMRADPSRGYPGRT
Sbjct  543   ILWLGYPGEVGGQVLPEILFGEYNPGGKLAMTWYPESFTAIPMTDMNMRADPSRGYPGRT  602

Query  690   YRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKL---RRSILNRGGNEPYVH  520
             YRFYTG+ VY FG+GLSYS +S  +LSAP +I++S+S    +   + S + R G + +V 
Sbjct  603   YRFYTGDVVYGFGYGLSYSKYSYSILSAPKKITMSRSSVLDIISRKPSYIRRDGLD-FVK  661

Query  519   VDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGN  340
              +++++C +LAFSV V++ N+G MDGS  V+LF+R+ +S   G P KQL+GF+RVH +  
Sbjct  662   TEDIASCEALAFSVHVAVSNHGSMDGSHAVLLFARSKSSVP-GFPIKQLVGFERVHTAAG  720

Query  339   GVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
               +   IS++PC+H+S  N EG R+L LGDH+
Sbjct  721   SASNVEISVDPCKHMSAANPEGKRVLLLGDHV  752



>dbj|BAJ94317.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=772

 Score =   860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/747 (58%), Positives = 553/747 (74%), Gaps = 23/747 (3%)
 Frame = -3

Query  2475  CQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESL  2296
             C     +SY FCD SLP P R  +LVSLLT+DEKI +LS+  + +PRLG+P YEWWSESL
Sbjct  30    CASAEANSYAFCDGSLPFPVRARALVSLLTLDEKIAQLSNTAAGVPRLGVPPYEWWSESL  89

Query  2295  HGIATNGPGITFD-GAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGL  2119
             HG+A NGPG+ F  G V +AT FPQVIL+AAAFNR+LWR++A A AVEARAM N+GQAGL
Sbjct  90    HGLADNGPGVNFSSGPVAAATIFPQVILSAAAFNRSLWRAVAEAVAVEARAMHNAGQAGL  149

Query  2118  TFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRM  1939
             T+WAPN+NVF DPRWGRGQETPGEDP +++ Y+VEYV                   G + 
Sbjct  150   TYWAPNINVFRDPRWGRGQETPGEDPAMIAAYSVEYV------------------KGFQG  191

Query  1938  PEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGR  1759
                +  + R+MLSACCKH  AYDLE W  F+RY+FNA V  QD EDTYEPPFKSC+++GR
Sbjct  192   EYGDGREGRMMLSACCKHYIAYDLEKWGKFARYTFNAEVNAQDFEDTYEPPFKSCIQEGR  251

Query  1758  ASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAA  1579
             ASCLMC+YN VNG+PACA KDLL+K R +WGF+GYI SDCDAVA I E Q Y  S E++ 
Sbjct  252   ASCLMCSYNQVNGVPACARKDLLQKIRDEWGFKGYIVSDCDAVAIIHENQTYTSSDEDSV  311

Query  1578  GIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKF  1399
              I LKAG D+NCG++++R+ KSA+E   + E DI+ AL NLFSVQ RLGLF     N+ F
Sbjct  312   AIVLKAGMDVNCGSFLIRHTKSAIEKGKIQEEDINHALYNLFSVQLRLGLFEKANENQWF  371

Query  1398  ESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTSS-LGG  1222
                GP +VC+ EHR LA EA RQG VLLKN+  FLPL +++VS +A+IG  AN +  +GG
Sbjct  372   TRLGPSNVCTKEHRELAAEAVRQGTVLLKNDNSFLPLKRSKVSHIALIGAAANDAYIMGG  431

Query  1221  DYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLD  1042
             DYTG+PC   + L G+  ++ +T+ A+GC DV+C+S DGF EA+  AKRAD V+V+ GL+
Sbjct  432   DYTGVPCDPITFLKGMQAFVPQTTVAAGCKDVSCDSPDGFGEAIEAAKRADIVVVIAGLN  491

Query  1041  LSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLW  862
             L+QE+ED DR +LLLPG Q  LVN +A V+ KP+VLV+TGGGP+D++FAK+DPRIASVLW
Sbjct  492   LTQESEDLDRVTLLLPGRQQDLVNIIASVTKKPIVLVITGGGPVDVAFAKQDPRIASVLW  551

Query  861   IGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRF  682
             IGYPGE GG+ L EI+FG+YNP G+LP+TWYPESFT VPMNDMNMRADPSRGYPGRTYRF
Sbjct  552   IGYPGEVGGQVLPEILFGEYNPGGKLPMTWYPESFTAVPMNDMNMRADPSRGYPGRTYRF  611

Query  681   YTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKL--RRSILNRGGNEPYVHVDEV  508
             YTGE VY FG+GLSYS +S  ++ AP RISLS S    L  R+    R     YV V+++
Sbjct  612   YTGEVVYGFGYGLSYSKYSYNIVQAPQRISLSHSPVPGLISRKPAYTRRDGLDYVQVEDI  671

Query  507   SNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTE  328
             ++C SL FSV +S+ N+G MDGS  V+LF+R+ +S   G P KQL+GF+RV+ +      
Sbjct  672   ASCESLVFSVHISVANDGAMDGSHAVLLFARSKSSVP-GFPLKQLVGFERVYTAAGSSKN  730

Query  327   TSISIEPCQHLSIVNVEGSRILPLGDH  247
              +I+++PC+++S  N EG R+L LG H
Sbjct  731   VAITVDPCKYMSAANTEGRRVLLLGSH  757



>ref|XP_006653619.1| PREDICTED: probable beta-D-xylosidase 6-like [Oryza brachyantha]
Length=733

 Score =   858 bits (2217),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/733 (59%), Positives = 543/733 (74%), Gaps = 25/733 (3%)
 Frame = -3

Query  2430  LPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGIATNGPGITFD-G  2254
             +P PAR  +LVSLLT+DEKI +LS+  + +PRLGIP +EWWSESLHG+  NGPGI F  G
Sbjct  8     MPFPARARALVSLLTLDEKIAQLSNTAAGVPRLGIPPFEWWSESLHGVCDNGPGINFSSG  67

Query  2253  AVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWAPNVNVFVDPRW  2074
              V+SAT FPQVIL+AAAFNR+LWR++A A AVEARAM NSGQAGLTFWAPN+NVF DPRW
Sbjct  68    PVRSATTFPQVILSAAAFNRSLWRTVAQAIAVEARAMHNSGQAGLTFWAPNINVFRDPRW  127

Query  2073  GRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEEEDDDRLMLSAC  1894
             GRGQETPGEDP V+S Y+VEYV+                  G+   E      R+MLSAC
Sbjct  128   GRGQETPGEDPAVISAYSVEYVK---------------GFQGDYGEE-----GRMMLSAC  167

Query  1893  CKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCLMCAYNAVNGIP  1714
             CKH  AYDLE W  F+RY+F+A V  QDMEDTY+PPFKSC+++GRASCLMC+YN VNG+P
Sbjct  168   CKHYIAYDLEKWKGFTRYTFDAKVNVQDMEDTYQPPFKSCIQEGRASCLMCSYNQVNGVP  227

Query  1713  ACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIALKAGTDINCGTY  1534
             ACA KD+L+KAR +WGF+GY+TSDCDAVA I E Q Y  S E++  + LKAG DINCG++
Sbjct  228   ACARKDILQKARDEWGFQGYVTSDCDAVAIIHENQTYTVSDEDSVAVVLKAGMDINCGSF  287

Query  1533  MLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESFGPKDVCSSEHRR  1354
             ++R+ KSA+E   + E DI+ AL NLFSVQ RLG F+    N+ F   GP +VC+ EHR 
Sbjct  288   LIRHTKSAIEKGKIQEEDINHALFNLFSVQLRLGFFDQSNGNQWFTQLGPNNVCTREHRE  347

Query  1353  LALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTSS-LGGDYTGIPCALKSVLDG  1177
             LA EA RQG VLLKN+  FLPL ++ V  +A+IGP A+    LGGDYTG+PC   + + G
Sbjct  348   LAAEAVRQGAVLLKNDNSFLPLKRSEVGHIAIIGPGADDPYILGGDYTGVPCDSTTFVKG  407

Query  1176  LGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQETEDHDRYSLLL  997
             +  Y+ +T++A+GC DV CNSTDGF EA+  AKRAD V+++ GL+L++ETEDHDR SLLL
Sbjct  408   MQTYVSQTTFAAGCKDVPCNSTDGFGEAIEAAKRADIVVLIAGLNLTEETEDHDRVSLLL  467

Query  996   PGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGYPGEEGGKALSEI  817
             PG QM LV+ +AGV+ KPLVLVL GGGP+D+SFAK DP IAS+LWIGYPGE GG  L EI
Sbjct  468   PGSQMDLVHAIAGVTKKPLVLVLLGGGPVDVSFAKHDPHIASILWIGYPGEVGGHVLPEI  527

Query  816   VFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFYTGEKVYEFGHGlsy  637
             +FG YNP G+LP+TWYPESFT VPMNDMNMRAD SRGYPGRTYRFYTG+ VY FG+GLSY
Sbjct  528   LFGKYNPGGKLPITWYPESFTAVPMNDMNMRADESRGYPGRTYRFYTGDVVYGFGYGLSY  587

Query  636   ssfslellSAPTRISLSQSIKTKL--RRSILNRGGNEPYVHVDEVSNCNSLAFSVRVSLR  463
             S +S   L AP +ISLS S    L  R+    R     Y  V+++++C +L F V +S+ 
Sbjct  588   SKYSYSFLQAPKKISLSHSSLPDLISRKPAYTRRDGLDYAQVEDIASCEALQFPVHISVS  647

Query  462   NNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSISIEPCQHLSIVN  283
             N+G MDGS  V+LF+R+  S+  G+P KQL+GF+RVH      T+  I+++PC+ +S  N
Sbjct  648   NDGTMDGSHAVLLFARSKPSFP-GSPIKQLVGFERVHTVAGRSTDLGITVDPCKLMSSAN  706

Query  282   VEGSRILPLGDHI  244
              EG R+L LG H+
Sbjct  707   TEGRRVLFLGTHV  719



>tpg|DAA36709.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=769

 Score =   856 bits (2211),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/750 (57%), Positives = 552/750 (74%), Gaps = 26/750 (3%)
 Frame = -3

Query  2478  PCQPP-THSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSE  2302
             PC  P + S+YPFCD SL IPAR  +LVSLLT+DEKI +LS+    +PRLGIP Y+WWSE
Sbjct  27    PCASPYSTSAYPFCDASLSIPARARALVSLLTLDEKIAQLSNTAGGVPRLGIPPYQWWSE  86

Query  2301  SLHGIATNGPGITFD-GAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA  2125
             SLHG+A NGPG+ F  G V++AT FPQVIL+ AAFNR+LWR++A A A EA  M N+GQA
Sbjct  87    SLHGLADNGPGVNFSSGPVRAATDFPQVILSTAAFNRSLWRAVAEAVATEALGMHNAGQA  146

Query  2124  GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGN  1945
             GLT+WAPN+N+F DPRWGRGQET GEDP V + Y++EYV+G                   
Sbjct  147   GLTYWAPNINIFRDPRWGRGQETSGEDPAVAAAYSLEYVKG-------------------  187

Query  1944  RMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEK  1765
                 EE ++ R+ LSACCKH TAYD+E W  FSRY+FNA V  QD+EDTY+PPFK+C+++
Sbjct  188   -FQGEEGEEGRIRLSACCKHYTAYDMEKWEGFSRYTFNAKVNAQDLEDTYQPPFKTCIQE  246

Query  1764  GRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKSPEE  1585
              RASCLMCAYN VNG+P CA+KDLL+K R +WGF+GYITSDCDAVA I E Q Y KS E+
Sbjct  247   ARASCLMCAYNQVNGVPMCAHKDLLQKTRDEWGFQGYITSDCDAVAIIHENQTYTKSGED  306

Query  1584  AAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNR  1405
             +  I LKAG DINCG++++R+ KSA+E   + E DIDRAL NLFSVQ RLG+F+  + N+
Sbjct  307   SIAIVLKAGMDINCGSFLVRHTKSAIEKGKIQEEDIDRALFNLFSVQLRLGIFDKPSNNQ  366

Query  1404  KFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTS-SL  1228
              F   GP  VC+ EHR LA EA RQG VLLKN+  FLPL ++ V  +A+IGP AN + ++
Sbjct  367   WFSQLGPNSVCTKEHRELAAEAVRQGAVLLKNDHNFLPLKRSEVRHVAIIGPSANDAYAM  426

Query  1227  GGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVG  1048
             GGDYTG+PC   + L G+  Y  +TS+A GC D +CNSTD F EAV  AKRAD V+V+ G
Sbjct  427   GGDYTGVPCNPTTFLKGIQAYATQTSFAPGCKDASCNSTDLFGEAVEAAKRADIVVVIAG  486

Query  1047  LDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASV  868
             L+L++E ED DR SLLLPG QM L++ +A V+ KPLVLVL GGGP+D+SFAK+DPRIAS+
Sbjct  487   LNLTEEREDFDRVSLLLPGKQMGLIHAIASVAKKPLVLVLLGGGPVDVSFAKQDPRIASI  546

Query  867   LWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTY  688
             LW+GYPGE GG+ L EI+FG+YNP G+LP+TWYPESFT +PM DMNMRADPSRGYPGRTY
Sbjct  547   LWLGYPGEVGGQVLPEILFGEYNPGGKLPITWYPESFTAIPMTDMNMRADPSRGYPGRTY  606

Query  687   RFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKL--RRSILNRGGNEPYVHVD  514
             RFYTG+ VY FG+GLSYS +S  + SAP +I++S+S    +  R+    R      V  +
Sbjct  607   RFYTGDVVYGFGYGLSYSKYSYSISSAPKKITVSRSSDLGIISRKPAYTRRDGLGSVKTE  666

Query  513   EVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGV  334
             ++++C +L FSV V++ N+G MDGS  V+LF+R+ +S   G P KQL+GF+ VH +    
Sbjct  667   DIASCEALVFSVHVAVSNHGSMDGSHAVLLFARSKSSVP-GFPIKQLVGFESVHTAAGSA  725

Query  333   TETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             +   I+++PC+ +S  N EG R+L LG H+
Sbjct  726   SNVEITVDPCKQMSAANPEGKRVLLLGAHV  755



>gb|EPS73741.1| hypothetical protein M569_01013, partial [Genlisea aurea]
Length=770

 Score =   854 bits (2207),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/742 (60%), Positives = 551/742 (74%), Gaps = 21/742 (3%)
 Frame = -3

Query  2460  HSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGIAT  2281
             H  Y FC+ SLPI  R  SL+SLLT+DEKI+ L  N S I RLGIP Y WWSESLHGIA 
Sbjct  32    HGDYEFCNNSLPIDRRSRSLISLLTLDEKIRLLCSNASGISRLGIPPYLWWSESLHGIAD  91

Query  2280  NGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWAPN  2101
             NGPG++F G+++SAT FPQV+L AA FNR+LWR++A+A  VEA AM + GQAGLT++APN
Sbjct  92    NGPGVSFQGSIRSATNFPQVLLAAATFNRSLWRAVASAIGVEALAMHSVGQAGLTYFAPN  151

Query  2100  VNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEEED  1921
             +N+F DPRWGRGQETPGEDP V S YAVEYV     Q L G   R+ +L           
Sbjct  152   INIFRDPRWGRGQETPGEDPYVASAYAVEYV--KGFQWLDGVVSRRRTLGNGDF--HGGG  207

Query  1920  DDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCLMC  1741
             D RLMLSACCKHLTAYDLE W  F+RY+FNAV+T QDM DTY+ PF+SCVEKG ASC+MC
Sbjct  208   DRRLMLSACCKHLTAYDLEKWGQFTRYNFNAVITPQDMADTYQVPFRSCVEKGGASCVMC  267

Query  1740  AYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIALKA  1561
             +YN+VNG+PACAN+ LL++ARTDW   GYI SDCDAVATI+E Q + K+PE+A   ALKA
Sbjct  268   SYNSVNGVPACANRRLLQQARTDWNLRGYIASDCDAVATIYENQNFTKTPEDAVAAALKA  327

Query  1560  GTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESFGP-  1384
             GTDINCG+YMLR+MKSA E   V E DID+A+LNL SVQFRLG+F+G +   + + F P 
Sbjct  328   GTDINCGSYMLRHMKSAFEQGKVSEGDIDKAVLNLLSVQFRLGIFDGAS--SRGDEFAPE  385

Query  1383  KDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTSSLGGDYTGIP  1204
             +DVCSS+H +LALEA +QGIVLLKN+   LP D   + SLA+IGP+AN++++GGDYTGIP
Sbjct  386   EDVCSSDHLKLALEATKQGIVLLKNDANLLPFDSYGIDSLALIGPLANSTNIGGDYTGIP  445

Query  1203  CALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQETE  1024
             C   S+LDGL   + +  Y SGC DV CNST GFAEAVSI++R++YV+VV GLDL +ETE
Sbjct  446   CHQSSILDGLRRVVDRVHYVSGCQDVRCNSTVGFAEAVSISRRSEYVVVVAGLDLGEETE  505

Query  1023  DHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGYPGE  844
             D DRYSLLLPG+QM L++E+A +S  PLVLV+  GGP+D+SFA  DP I SVLWIGYPGE
Sbjct  506   DKDRYSLLLPGYQMQLIHEIAALSKNPLVLVIVSGGPVDVSFAVDDPCIGSVLWIGYPGE  565

Query  843   EGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFYTGEKV  664
              GG+ALSE++FG YNP GRLP+TWYPESFT+VPMNDMN+RADPSR YPGRT+RFYTG+ V
Sbjct  566   SGGEALSEVIFGRYNPGGRLPVTWYPESFTRVPMNDMNLRADPSRDYPGRTHRFYTGDVV  625

Query  663   YEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEVSN--CNSL  490
             +EFGHGLSY++F+ E +S P  +    S  +            + ++ VD+V +  C S 
Sbjct  626   FEFGHGLSYTNFTHEFVSVPRELRFFGSSSSA-----------KNHIKVDDVPSAFCASS  674

Query  489   AFSVRVSLRNNGGMDGSRVVMLFSRAPT-SYAGGAPQKQLIGFDRVHVSGNGVTETSISI  313
              F V +S+RN G +DGS VV LF + P  S   G P++Q+IGF RVHV    +      +
Sbjct  675   RFRVDISVRNEGDVDGSHVVFLFWKVPEGSDVKGVPRRQVIGFQRVHVPARRMVTAEFDV  734

Query  312   EPCQHLSIVNVEGSRILPLGDH  247
             +PC+ LS  +  G R++ L DH
Sbjct  735   DPCRDLSFADENGDRVILLPDH  756



>gb|ABY48135.1| beta-D-xylosidase [Medicago truncatula]
Length=776

 Score =   838 bits (2164),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/768 (58%), Positives = 553/768 (72%), Gaps = 48/768 (6%)
 Frame = -3

Query  2496  YSKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAY  2317
             ++ P  PC+PP HS YPFC+ SLPI  R  SL+SLLT+ +KI +LS+  S+I  LGIP+Y
Sbjct  25    FTTPDYPCKPP-HSHYPFCNISLPISTRTTSLISLLTLSDKINQLSNTASSISHLGIPSY  83

Query  2316  EWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFN  2137
             +WWSE+LHGIATNGPG+ F+G+VKSAT FPQVI++AAAFNR+LW  I  A  VE RAMFN
Sbjct  84    QWWSEALHGIATNGPGVNFNGSVKSATNFPQVIVSAAAFNRSLWFLIGYAVGVEGRAMFN  143

Query  2136  SGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYS  1957
              GQAGL+FWAPNVNVF DPRWGRGQETPGEDPMV S YAVE+VRG+QG     K      
Sbjct  144   VGQAGLSFWAPNVNVFRDPRWGRGQETPGEDPMVGSAYAVEFVRGIQGVDGIKKV-----  198

Query  1956  LSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKS  1777
                  + + + DDD LM+SACCKH TAYDLE W  FSRY+FNAVV      +TY+PPF+ 
Sbjct  199   -----LNDHDSDDDGLMVSACCKHFTAYDLEKWGEFSRYNFNAVV------NTYQPPFRG  247

Query  1776  CVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGY-ITSDCDAVATIF-EYQQY  1603
             CV++G+ASCLMC+YN VNG+PACA+KDLL   R  WGFEG  I      +  +F   +  
Sbjct  248   CVQQGKASCLMCSYNEVNGVPACASKDLLGLVRNKWGFEGVGILPQTVMLWLLFLSIKSM  307

Query  1602  AKSPEEAAGIALKA-----------GTDINCGTYMLRNMKSALENKIVVESDIDRALLNL  1456
                P+    + LK              DINCGT+MLR+ +SA+E  +V E D+DRAL NL
Sbjct  308   QNLPKMLLLMFLKQVFFYVFENLWFCMDINCGTFMLRHTESAIEQGLVKEEDLDRALFNL  367

Query  1455  FSVQFRLGLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTR  1276
             FSVQ RLGLFNG     KF   GP+DVC+ EH++LALEAARQGIVLLKN+ KFLPLDK  
Sbjct  368   FSVQMRLGLFNGDPEKGKFGKLGPQDVCTPEHKKLALEAARQGIVLLKNDNKFLPLDKKD  427

Query  1275  VSSLAVIGPMANTSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAE  1096
               SLA+IGPMA TS LGG Y+GIPC+ +S+ DGL EY+   SYA GC DV C+S DGFA 
Sbjct  428   RVSLAIIGPMATTSELGGGYSGIPCSPRSLYDGLKEYVKTISYAFGCSDVKCDSDDGFAV  487

Query  1095  AVSIAKRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltggg  916
             A+ IAK+AD+V++V GLD + ETED DR SLLLPG QM LV+ +A  S +P++LVLTGGG
Sbjct  488   AIDIAKQADFVVIVAGLDTTLETEDLDRVSLLLPGKQMDLVSRVAAASKRPVILVLTGGG  547

Query  915   pLDISFAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMND  736
             PLD+SFA+ +  I S+LWIGYP              D++ AGRLP+TWYPESFT VPMND
Sbjct  548   PLDVSFAESNQLITSILWIGYP-------------VDFDAAGRLPMTWYPESFTNVPMND  594

Query  735   MNMRADPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRS  556
             M MRADPSRGYPGRTYRFYTG ++Y FGHGLSYS FS  +LSAP+++SLS++    LRRS
Sbjct  595   MGMRADPSRGYPGRTYRFYTGSRIYGFGHGLSYSDFSYRVLSAPSKLSLSKTTNGGLRRS  654

Query  555   ILNRGGNEPY----VHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGA  388
             +LN+   + +    VHVDE+ NCNSL+FSV +S+ N G MDGS VVMLFS+ P +   G+
Sbjct  655   LLNKVEKDVFEVDHVHVDELQNCNSLSFSVHISVMNVGDMDGSHVVMLFSKWPKNIQ-GS  713

Query  387   PQKQLIGFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             P+ QL+G  R+H   N   ETSI  +PC+H S  + +G RILPLG+HI
Sbjct  714   PESQLVGPSRLHTVSNKSIETSILADPCEHFSFADEQGKRILPLGNHI  761



>gb|EEE61389.1| hypothetical protein OsJ_15562 [Oryza sativa Japonica Group]
Length=771

 Score =   827 bits (2136),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/758 (57%), Positives = 545/758 (72%), Gaps = 42/758 (6%)
 Frame = -3

Query  2478  PCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPR---------LGI  2326
             PC  P  S+YPFC+ +LP PAR  +LVSLLT+DEKI +L  +    P          +G+
Sbjct  29    PCASPAASAYPFCNATLPFPARARALVSLLTLDEKIAQLLQHRRGRPPPRRPALRVVVGV  88

Query  2325  PAYEWWSESLHGIATNGPGITF-DGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavear  2149
             P+           AT GPG T   G V+SAT FPQVIL+AAAFNR+LWR+ A A AVEAR
Sbjct  89    PS--------TASATTGPGSTSPRGPVRSATIFPQVILSAAAFNRSLWRAAARAIAVEAR  140

Query  2148  AMFNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkng  1969
             AM N+GQAGLTFWAPN+NVF DPRWGRGQETPGEDP VVS Y+VEYV+G           
Sbjct  141   AMHNAGQAGLTFWAPNINVFRDPRWGRGQETPGEDPAVVSAYSVEYVKG-----------  189

Query  1968  RKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEP  1789
                         +  ++ R+MLSACCKH  AYDLE W  F+RY+FNA V  QDMEDTY+P
Sbjct  190   ---------FQRDYGEEGRMMLSACCKHYIAYDLEKWRGFTRYTFNAKVNAQDMEDTYQP  240

Query  1788  PFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQ  1609
             PFKSC+++GRASCLMC+YN VNG+PACA KD+L++AR +WGF+GYITSDCDAVA I E Q
Sbjct  241   PFKSCIQEGRASCLMCSYNQVNGVPACARKDILQRARDEWGFQGYITSDCDAVAIIHENQ  300

Query  1608  QYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGL  1429
              Y  S E++  + LKAG DINCG++++R+ KSA+E   V E DI+ AL NLFSVQ RLG 
Sbjct  301   TYTASDEDSIAVVLKAGMDINCGSFLIRHTKSAIEKGKVQEEDINHALFNLFSVQLRLGF  360

Query  1428  FNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGP  1249
             F+    N+ F   GP +VC++EHR LA EA RQG VLLKN+  FLPL ++ V  +A+IGP
Sbjct  361   FDKTNENQWFTQLGPNNVCTTEHRELAAEAVRQGTVLLKNDNGFLPLKRSEVGHIALIGP  420

Query  1248  MANTSS-LGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRA  1072
              AN    LGGDYTG+PC   + + G+  Y+ KT++A+GC DV CNSTDGF EA+  AKRA
Sbjct  421   AANDPYILGGDYTGVPCHSTTFVKGMQAYVPKTTFAAGCKDVPCNSTDGFGEAIEAAKRA  480

Query  1071  DYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAK  892
             D V+++ GL+L++ETEDHDR SLLLPG QM L++ +A V+ KP+VLVL GGGP+D+SFAK
Sbjct  481   DVVVLIAGLNLTEETEDHDRVSLLLPGRQMDLIHTVASVTKKPVVLVLMGGGPVDVSFAK  540

Query  891   KDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPS  712
              DPRIAS+LWIGYPGE GG  L EI+FG YNP G+LP+TWYPESFT VPM+DMNMRAD S
Sbjct  541   HDPRIASILWIGYPGEVGGNVLPEILFGKYNPGGKLPITWYPESFTAVPMDDMNMRADAS  600

Query  711   RGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKL--RRSILNRGG  538
             RGYPGRTYRFYTG+ VY FG+GLSYS +S  +L AP +ISLS+S    L  R+    R  
Sbjct  601   RGYPGRTYRFYTGDVVYGFGYGLSYSKYSYSILQAPKKISLSRSSVPDLISRKPAYTRRD  660

Query  537   NEPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDR  358
                YV V+++++C +L F V +S+ N+G MDGS  V+LF+ +  S+  G+P KQL+GF+R
Sbjct  661   GVDYVQVEDIASCEALQFPVHISVSNDGAMDGSHAVLLFASSKPSFP-GSPIKQLVGFER  719

Query  357   VHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             VH +    T+  I+++PC+ +S  N EG+R+L LG H+
Sbjct  720   VHTAAGRSTDVEITVDPCKLMSFANTEGTRVLFLGTHV  757



>gb|KCW59657.1| hypothetical protein EUGRSUZ_H02409 [Eucalyptus grandis]
Length=658

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/659 (63%), Positives = 501/659 (76%), Gaps = 20/659 (3%)
 Frame = -3

Query  2211  AAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVV  2032
             AAAFNRTLW ++ +A A EARAM+N GQ+GLTFWAPN+N+F DPRWGRGQETPGEDPMV 
Sbjct  2     AAAFNRTLWSAVGSAIATEARAMYNVGQSGLTFWAPNINIFRDPRWGRGQETPGEDPMVA  61

Query  2031  SDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHN  1852
             S +AVE+V                   G R   EEEDD  LMLSACCKH TAYDLE WH+
Sbjct  62    SAFAVEFVE---------------GFQGGRGGSEEEDDG-LMLSACCKHFTAYDLEKWHD  105

Query  1851  FSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKARTD  1672
              +RY+FNAVVT+QD++DT++PPF+SC+++G+ASCLMCAYN VNG+PACA +DLL+KAR D
Sbjct  106   LTRYNFNAVVTQQDLQDTFQPPFQSCIQQGKASCLMCAYNEVNGVPACAMQDLLQKARVD  165

Query  1671  WGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIV  1492
             WGF+GYITSDCDAVATIFEYQ + K+ E+A   ALKAG DINCG++++RN +SA+E   V
Sbjct  166   WGFKGYITSDCDAVATIFEYQHFVKTREDAVADALKAGMDINCGSFLVRNTESAVEQGKV  225

Query  1491  VESDIDRALLNLFSVQFRLGLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLK  1312
              E DIDRALLNLFSVQ RLG+F+G     +F   GPKDVC SE+R LALEAARQGIVLLK
Sbjct  226   GEEDIDRALLNLFSVQLRLGIFDGDPRKGQFGRLGPKDVCKSENRMLALEAARQGIVLLK  285

Query  1311  NEQKFLPLDKTRVSSLAVIGPMA-NTSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGC  1135
             NE KFLP  +  VSSLAVIGP A N S++ G YTGIPC  KS+ + L  Y+  TS+A+GC
Sbjct  286   NENKFLPFREDVVSSLAVIGPHARNISNMLGSYTGIPCRQKSLFEELQAYVQMTSHAAGC  345

Query  1134  LDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGV  955
              D+ CN++D F EAV  AK+ADYVIVVVGLDL+QETED DR SLLLPG QM LV+ +A  
Sbjct  346   QDIPCNASDAFHEAVLAAKKADYVIVVVGLDLTQETEDLDRVSLLLPGQQMDLVSSIAAT  405

Query  954   SNKplvlvltgggpLDISFAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLT  775
             S  P+VLVLTGGGPLD+SFA+ DPRIAS+LWIGYPGE GGKAL+EI+FGD NP GRLP+T
Sbjct  406   SKNPIVLVLTGGGPLDVSFAQNDPRIASILWIGYPGEAGGKALAEIIFGDVNPGGRLPVT  465

Query  774   WYPESFTKVPMNDMNMRADPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRI  595
             WY ESFTKVPMN+MNMRADPS GYPGRTYRFYTG++VY +GHGLSY+ F  +  SAP ++
Sbjct  466   WYTESFTKVPMNNMNMRADPSHGYPGRTYRFYTGDRVYGYGHGLSYTDFHYKFQSAPVKL  525

Query  594   SLSQSIKTK-LRRSILNRGGNEPYVHVDEVS-NCNSLAFSVRVSLRNNGGMDGSRVVMLF  421
             +L +S +    R  +L        + + E+  +C+SL F V++S+ N G M GS VVMLF
Sbjct  526   TLLKSSRANPYRNRVLREAEGLASLDIAEIEGSCDSLKFRVQISVTNVGDMKGSHVVMLF  585

Query  420   SRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             SRAP     G PQKQLIGFDRVH   N   ETSI ++PC H S+VN  G R L  G H+
Sbjct  586   SRAP-RLIRGTPQKQLIGFDRVHTFPNRSIETSILVDPCDHFSVVNESGRRTLVGGGHV  643



>ref|XP_008236665.1| PREDICTED: probable beta-D-xylosidase 6 isoform X2 [Prunus mume]
Length=782

 Score =   808 bits (2086),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/760 (58%), Positives = 538/760 (71%), Gaps = 43/760 (6%)
 Frame = -3

Query  2505  ATSYSKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGI  2326
             ++S S  Q PC+PP +SSYPFC+TSLPI  R  SL+SLLT+ EKIQ+LS+N SAIPRLGI
Sbjct  43    SSSNSDLQFPCKPPHYSSYPFCNTSLPITTRAQSLISLLTLREKIQQLSNNASAIPRLGI  102

Query  2325  PAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearA  2146
             P YEWWSESLHGIATNGPG++F+G + SAT FPQVI+TAAAFNRTLW  I +A AVEARA
Sbjct  103   PPYEWWSESLHGIATNGPGVSFNGTIPSATSFPQVIVTAAAFNRTLWSLIGSAIAVEARA  162

Query  2145  MFNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngR  1966
             M+N GQAGLTFWAPN+N+F DPRWGRGQETPGEDPMV S YA+E+V+G QG         
Sbjct  163   MYNLGQAGLTFWAPNINIFRDPRWGRGQETPGEDPMVASAYAIEFVKGFQGGNWGI----  218

Query  1965  KYSLSGNRMPEEEED---DDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTY  1795
             ++   G R   E  D   DD LMLSACCKH TAYDL+LW NFSRYSFNAV          
Sbjct  219   RHDGFGERRVLEGHDGGSDDGLMLSACCKHFTAYDLDLWRNFSRYSFNAV----------  268

Query  1794  EPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDW--GFEGYITSDCDAVATI  1621
                    +   R S      +        A+KD+  +    W       IT     +  +
Sbjct  269   --SMGFLLVHRRISWTKLGMSG-------ASKDISPQTVMLWPQSMSIRITLKVLKMQLL  319

Query  1620  FEYQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQF  1441
                +Q            L  GTDINCGT++ R+  S ++   V E DID+ALLNLFSVQ 
Sbjct  320   MFLKQ------------LFVGTDINCGTFLFRHTLSTIKQGKVQEEDIDKALLNLFSVQL  367

Query  1440  RLGLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLA  1261
             RLGLF+G   N +F S GPKDVC+SEH+ LALEA RQGIVLLKN++KFLPL+K    SLA
Sbjct  368   RLGLFDGDPRNGQFGSLGPKDVCTSEHKTLALEATRQGIVLLKNDKKFLPLEKGVDFSLA  427

Query  1260  VIGPMANTSSL-GGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSI  1084
             VIGP+AN +SL GG YTGIPC+ K + +GL EY  +  YA+GCLDV C S  GF EA+  
Sbjct  428   VIGPLANNASLLGGGYTGIPCSSKGLFEGLQEYTKRALYAAGCLDVPCKSRAGFREAIHT  487

Query  1083  AKRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDI  904
              K AD V++VVGLDL+QE EDHDR SLLLPG QMALV+ +A  S +P++LVLTGGGPLD+
Sbjct  488   VKMADIVVIVVGLDLTQEREDHDRVSLLLPGKQMALVSSVAAASKEPVILVLTGGGPLDV  547

Query  903   SFAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMR  724
             +FAK+DPRIAS+LWIGYPGE GG+AL+E++FGD+NP GRLP+TWYPESFT +PMNDMNMR
Sbjct  548   TFAKEDPRIASILWIGYPGESGGRALAEVLFGDFNPGGRLPMTWYPESFTNIPMNDMNMR  607

Query  723   ADPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNR  544
             ADPS+GYPGRTYRFYTG ++Y FG GLSYS F+  ++SAP  + LS+ +K    R+IL++
Sbjct  608   ADPSKGYPGRTYRFYTGSRLYGFGDGLSYSKFTYNIVSAPKNLRLSRPLKVDSSRNILHQ  667

Query  543   GGNE-PYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIG  367
              G+   Y+H+DEV++C+SL F V +++ N G MDG   VMLFSR  T    GAP++QLIG
Sbjct  668   AGDTLDYLHIDEVTSCDSLRFFVEITVTNIGDMDGGHTVMLFSRM-TKVVKGAPKQQLIG  726

Query  366   FDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             F+RVH      T TSI ++PC H S  N  G  ILPLGDH
Sbjct  727   FNRVHTGSYKSTATSILVDPCTHFSFANDYGEWILPLGDH  766



>emb|CAJ86207.1| B1011H02.4 [Oryza sativa Indica Group]
Length=738

 Score =   805 bits (2079),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/749 (56%), Positives = 529/749 (71%), Gaps = 57/749 (8%)
 Frame = -3

Query  2478  PCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSES  2299
             PC  P  S+YPFC+ +LP PAR  +LVSLLT+DEKI +LS+  +  PRLG+P +EWWSES
Sbjct  29    PCASPAASAYPFCNATLPFPARARALVSLLTLDEKIAQLSNTAAGAPRLGVPPFEWWSES  88

Query  2298  LHGIATNGPGITFD-GAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAG  2122
             LHG+  NGPG+ F  G V+SAT FPQVIL+AAAFNR+LWR+ A A AVEARAM N+GQAG
Sbjct  89    LHGVCDNGPGVNFSSGPVRSATIFPQVILSAAAFNRSLWRAAARAIAVEARAMHNAGQAG  148

Query  2121  LTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNR  1942
             LTFWAPN+NVF DPRWGRGQETPGEDP VVS Y+VEYV+G                    
Sbjct  149   LTFWAPNINVFRDPRWGRGQETPGEDPAVVSAYSVEYVKG--------------------  188

Query  1941  MPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKG  1762
                +  ++ R+MLSACCKH  AYDLE W  F+RY+FNA                      
Sbjct  189   FQRDYGEEGRMMLSACCKHYIAYDLEKWRGFTRYTFNA----------------------  226

Query  1761  RASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEA  1582
                        VNG+PACA KD+L++AR +WGF+GYITSDCDAVA I E Q Y  S E++
Sbjct  227   ----------KVNGVPACARKDILQRARDEWGFQGYITSDCDAVAIIHENQTYTASDEDS  276

Query  1581  AGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRK  1402
               + LKAG DINCG++++R+ KSA+E   V E DI+ AL NLFSVQ RLG F+    N+ 
Sbjct  277   IAVVLKAGMDINCGSFLIRHTKSAIEKGKVQEEDINHALFNLFSVQLRLGFFDKTNENQW  336

Query  1401  FESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTSS-LG  1225
             F   GP +VC++EHR LA EA RQG VLLKN+  FLPL ++ V  +A+IGP AN    LG
Sbjct  337   FTQLGPNNVCTTEHRELAAEAVRQGTVLLKNDNGFLPLKRSEVGHIALIGPAANDPYILG  396

Query  1224  GDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGL  1045
             GDYTG+PC   + + G+  Y+ KT++A+GC DV CNSTDGF EA+  AKRAD V+++ GL
Sbjct  397   GDYTGVPCHSTTFVKGMQAYVPKTTFAAGCKDVPCNSTDGFGEAIEAAKRADVVVLIAGL  456

Query  1044  DLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVL  865
             +L++ETEDHDR SLLLPG QM L++ +A V+ KP+VLVL GGGP+D+SFAK DPRIAS+L
Sbjct  457   NLTEETEDHDRVSLLLPGRQMDLIHTVASVTKKPVVLVLMGGGPVDVSFAKHDPRIASIL  516

Query  864   WIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYR  685
             WIGYPGE GG  L EI+FG YNP G+LP+TWYPESFT VPM+DMNMRAD SRGYPGRTYR
Sbjct  517   WIGYPGEVGGNVLPEILFGKYNPGGKLPITWYPESFTAVPMDDMNMRADASRGYPGRTYR  576

Query  684   FYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKL--RRSILNRGGNEPYVHVDE  511
             FYTG+ VY FG+GLSYS +S  +L AP +ISLS+S    L  R+    R     YV V++
Sbjct  577   FYTGDVVYGFGYGLSYSKYSYSILQAPKKISLSRSSVPDLISRKPAYTRRDGVDYVQVED  636

Query  510   VSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVT  331
             +++C +L F V +S+ N+G MDGS  V+LF+ +  S+  G+P KQL+GF+RVH +    T
Sbjct  637   IASCEALQFPVHISVSNDGAMDGSHAVLLFASSKPSFP-GSPIKQLVGFERVHTAAGRST  695

Query  330   ETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             +  I+++PC+ +S  N EG+R+L LG H+
Sbjct  696   DVEITVDPCKLMSFANTEGTRVLFLGTHV  724



>ref|XP_011026855.1| PREDICTED: probable beta-D-xylosidase 6 isoform X2 [Populus euphratica]
Length=612

 Score =   773 bits (1996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/575 (68%), Positives = 467/575 (81%), Gaps = 10/575 (2%)
 Frame = -3

Query  2487  PQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWW  2308
             PQ PC+PPTH++Y FC+ SLPI  R  SL+S LT+ EKIQ+LSDN S IPRLGIP YEWW
Sbjct  28    PQFPCKPPTHNTYSFCNKSLPITRRAQSLISHLTLQEKIQQLSDNASGIPRLGIPHYEWW  87

Query  2307  SESLHGIATNGPGITFD--GAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             SESLHGI+ NGPG++F   G V SATGFPQVI++AA+FNRTLW  I +A A+EARAM+N 
Sbjct  88    SESLHGISINGPGVSFKNGGPVTSATGFPQVIVSAASFNRTLWFLIGSAIAIEARAMYNV  147

Query  2133  GQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglq----gqglkgkngR  1966
             GQAGLTFWAPN+N+F DPRWGRGQETPGEDPMV S YA+E+V+G Q      G + ++  
Sbjct  148   GQAGLTFWAPNINIFRDPRWGRGQETPGEDPMVASAYAIEFVKGFQGGHWKNGTETESTG  207

Query  1965  KYSLSGNRM---PEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTY  1795
             ++ +   R+    + E +DD+LMLSACCKH TAYDLE W NFSRYSFNAVVT QDMEDTY
Sbjct  208   RHGIGQKRVLLGEDGEINDDKLMLSACCKHSTAYDLEKWGNFSRYSFNAVVTEQDMEDTY  267

Query  1794  EPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFE  1615
             +PPF+SC++KG+ASCLMC+YN VNG+PACA +DLL+K RT+WGF+GYITSDCDAVATIFE
Sbjct  268   QPPFRSCIQKGKASCLMCSYNEVNGVPACAREDLLQKTRTEWGFKGYITSDCDAVATIFE  327

Query  1614  YQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRL  1435
             YQ Y+KSPE+A  IALKAG DINCGTY+LRN +SA+E   + E DID+AL NLFSVQ RL
Sbjct  328   YQNYSKSPEDAVAIALKAGMDINCGTYVLRNAQSAVEKGKLQEEDIDQALHNLFSVQLRL  387

Query  1434  GLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVI  1255
             GLF+G     +F   GPK+VC+ EH+ LALEAARQGIVLLKN++KFLPL+K  VSSLA+I
Sbjct  388   GLFDGDPRKGQFGQLGPKNVCTKEHKTLALEAARQGIVLLKNDKKFLPLNKKDVSSLAII  447

Query  1254  GPMANTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAK  1078
             GP+AN + SLGGDY G PC  +S+ +GL  Y+ KTSYA GCLDVAC S   F +A+ +AK
Sbjct  448   GPLANKANSLGGDYAGYPCDPQSLFEGLKAYVKKTSYAIGCLDVACVSDTQFHKAIIVAK  507

Query  1077  RADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISF  898
             RA +VIVV GLDLSQETEDHDR SLLLPG QM+LV+ +A  S KP++LVLTGGGPLD+SF
Sbjct  508   RAGFVIVVAGLDLSQETEDHDRVSLLLPGKQMSLVSSVAAASKKPVILVLTGGGPLDVSF  567

Query  897   AKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPA  793
             AK DPRIAS+LWIGYPGE G  AL+EI+FG+YNP 
Sbjct  568   AKGDPRIASILWIGYPGEAGANALAEIIFGEYNPG  602



>gb|KGN48676.1| hypothetical protein Csa_6G497270 [Cucumis sativus]
Length=646

 Score =   765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/645 (61%), Positives = 487/645 (76%), Gaps = 27/645 (4%)
 Frame = -3

Query  2145  MFNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngR  1966
             MFN GQ GLT WAPN+N+F DPRWGRGQETPGEDPMV S Y++++VRGLQ          
Sbjct  1     MFNVGQCGLTIWAPNINIFRDPRWGRGQETPGEDPMVASAYSIQFVRGLQ----------  50

Query  1965  KYSLSGNRMPEEE------EDDD---RLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQ  1813
                 SGN M E E      E+D+    LM+SACCKH TAYDLE W+NF+RY+F++VVT Q
Sbjct  51    ----SGNWMKEHEIRNEVLEEDNGMGSLMVSACCKHFTAYDLEKWNNFTRYTFDSVVTEQ  106

Query  1812  DMEDTYEPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDA  1633
             D+ DTY+PPF+SC+++G+ASCLMC+YNAVNG+PACAN DLL+KAR DWG +GYITSDCDA
Sbjct  107   DLGDTYQPPFRSCIQQGKASCLMCSYNAVNGVPACANPDLLKKARNDWGLKGYITSDCDA  166

Query  1632  VATIFEYQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLF  1453
             VAT++EYQ+Y  +PE+A    LKAG DINCGT+MLR  KSA++   V E ++D AL+NLF
Sbjct  167   VATVYEYQKYTDTPEDAIADVLKAGMDINCGTFMLRGTKSAIDQGKVREEELDSALINLF  226

Query  1452  SVQFRLGLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRV  1273
             SVQ RLG F+G     KF   G +DVC+++H+ LALEAARQGIVLLKNE KFLPLDK  +
Sbjct  227   SVQARLGFFDGNPREGKFGELGAQDVCTAQHKTLALEAARQGIVLLKNENKFLPLDKNAI  286

Query  1272  SSLAVIGPMANTSS-LGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAE  1096
             SSL VIG +AN SS L G Y G+PC+  S+++G  EY     +ASGCLDV C S + F +
Sbjct  287   SSLTVIGSLANDSSKLLGGYAGVPCSPMSLVEGFQEYAETIFFASGCLDVPCASDNRFED  346

Query  1095  AVSIAKRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltggg  916
             A+ IAK+AD+VI V GLD SQETED DR SLLLPG QM LV+ +A VS KP++LVL GGG
Sbjct  347   AILIAKKADFVIAVAGLDASQETEDLDRVSLLLPGKQMDLVSSVASVSKKPIILVLIGGG  406

Query  915   pLDISFAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMND  736
             PLDISFAKKD R+AS+LWIG PGE GGKAL+E++FGDYNP GRLP+TWYP+SFT VPMND
Sbjct  407   PLDISFAKKDSRVASILWIGNPGEAGGKALAEVIFGDYNPGGRLPVTWYPQSFTNVPMND  466

Query  735   MNMRADPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRS  556
             M+MR +PSRGYPGRTYRFYTG+++Y FG GLSY+SF   LLSAP +++L    +T  RR 
Sbjct  467   MHMRPNPSRGYPGRTYRFYTGDRIYGFGEGLSYTSFKYRLLSAPKKVNLLGKAETSRRRI  526

Query  555   I--LNRGGNEPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQ  382
             I  +  G N  Y+ V+EV +C+ L F V++S+ N G  DGS VVM+FS  P     G PQ
Sbjct  527   IPQVRDGVNMSYMEVEEVESCDLLRFEVKLSVSNIGEFDGSHVVMMFSEFPKVLT-GTPQ  585

Query  381   KQLIGFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             +QLIGFDR++V  N   E+SI ++PC H+S+ +  G R++PLGDH
Sbjct  586   RQLIGFDRLYVKRNQSAESSIMVDPCNHVSLADEYGKRVIPLGDH  630



>gb|KHN38910.1| Putative beta-D-xylosidase 6 [Glycine soja]
Length=605

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/602 (62%), Positives = 474/602 (79%), Gaps = 17/602 (3%)
 Frame = -3

Query  2040  MVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLEL  1861
             M+ S YAVEYVRGLQ             LSG +     +DDD LM+SACCKH TAYDL++
Sbjct  1     MLASAYAVEYVRGLQ------------GLSGIQDAVVVDDDDTLMVSACCKHFTAYDLDM  48

Query  1860  WHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKA  1681
             W  FSRY+FNAVV++QD+EDTY+PPF+SC+++G+ASCLMC+YN VNG+PACA+++LL  A
Sbjct  49    WGQFSRYNFNAVVSQQDLEDTYQPPFRSCIQQGKASCLMCSYNEVNGVPACASEELLGLA  108

Query  1680  RTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALEN  1501
             R  WGF+GYITSDCDAVAT++EYQ+YAKS E+A    LKAG DINCGT+MLR+ +SA+E 
Sbjct  109   RDKWGFKGYITSDCDAVATVYEYQKYAKSQEDAVADVLKAGMDINCGTFMLRHTESAIEQ  168

Query  1500  KIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIV  1321
               V E D+DRALLNLFSVQ RLGLF+G  +  +F   GPKDVC+ EH+ LAL+AARQGIV
Sbjct  169   GKVKEEDLDRALLNLFSVQLRLGLFDGDPIRGRFGKLGPKDVCTQEHKTLALDAARQGIV  228

Query  1320  LLKNEQKFLPLDKTRVSSLAVIGPMANTSSLGGDYTGIPCALKSVLDGLGEYIHKTSYAS  1141
             LLKN++KFLPLD+   +SLAVIGP+A T+ LGG Y+GIPC+  S+ +GLGE+  + SYA 
Sbjct  229   LLKNDKKFLPLDRDIGASLAVIGPLATTTKLGGGYSGIPCSSSSLYEGLGEFAERISYAF  288

Query  1140  GCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELA  961
             GC DV C+S DGFAEA+  AK+AD+V++V GLD +QETEDHDR SLLLPG QM LV+ +A
Sbjct  289   GCYDVPCDSDDGFAEAIDTAKQADFVVIVAGLDATQETEDHDRVSLLLPGKQMNLVSSVA  348

Query  960   GVSNKplvlvltgggpLDISFAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLP  781
               S  P++LVL GGGPLD+SFA+K+P+IAS++W+GYPGE GGKAL+EI+FG++NPAGRLP
Sbjct  349   DASKNPVILVLIGGGPLDVSFAEKNPQIASIIWLGYPGEAGGKALAEIIFGEFNPAGRLP  408

Query  780   LTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPT  601
             +TWYPE+FT VPMN+M+MRADPSRGYPGRTYRFYTG +VY FGHGLS+S FS   LSAP+
Sbjct  409   MTWYPEAFTNVPMNEMSMRADPSRGYPGRTYRFYTGGRVYGFGHGLSFSDFSYNFLSAPS  468

Query  600   RISLSQSIKTKLRRSILNRGGNE----PYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRV  433
             +ISLS++IK   R+ +L +  NE     YV V+++ NCN L+FSV +S+ N GG+DGS V
Sbjct  469   KISLSRTIKDGSRKRLLYQVENEVYGVDYVPVNQLQNCNKLSFSVHISVMNLGGLDGSHV  528

Query  432   VMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLG  253
             VMLFS+ P     G+P+ QL+GF R+H   +  TETSI + PC+HLS  + +G RILP+G
Sbjct  529   VMLFSKGP-KVVDGSPETQLVGFSRLHTISSKPTETSILVHPCEHLSFADKQGKRILPMG  587

Query  252   DH  247
              H
Sbjct  588   PH  589



>ref|XP_011098370.1| PREDICTED: probable beta-D-xylosidase 7 [Sesamum indicum]
Length=786

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/748 (52%), Positives = 506/748 (68%), Gaps = 30/748 (4%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P+ SSYPFCD  L +  R   LVS LT+DEKI +L +  SAIPRLGIP Y+WWSE+LHG+
Sbjct  46    PSTSSYPFCDVHLSVHDRARDLVSRLTLDEKISQLINKASAIPRLGIPYYQWWSEALHGV  105

Query  2286  ATN---GPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GL  2119
             A       G++F+G +++AT FPQVILTAAAF+  LW  IA     EARA++N G+A G+
Sbjct  106   AVAIGVENGVSFNGTIRAATSFPQVILTAAAFDADLWYQIAKVIGTEARAIYNEGEAIGM  165

Query  2118  TFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRM  1939
             TFW+PN+N+F DPRWGRGQETPGEDP++   YAV +VR                + G+  
Sbjct  166   TFWSPNINIFRDPRWGRGQETPGEDPLLTGKYAVSFVR---------------GIQGDSF  210

Query  1938  PEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGR  1759
                   D RL +SACCKH TAYDL+ W    R++F+A VT+QDM DT++PPFKSCVE+GR
Sbjct  211   EGGSLKDGRLQVSACCKHFTAYDLDNWKGVDRFTFDAHVTKQDMADTFQPPFKSCVEEGR  270

Query  1758  ASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEA  1582
             AS +MCAYN VNG+P CA+ +LL K AR +WGF+GYITSDCDAV+ I+E Q+YAKS E+A
Sbjct  271   ASGIMCAYNLVNGVPNCADYNLLTKTARGEWGFQGYITSDCDAVSLIYEKQKYAKSHEDA  330

Query  1581  AGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRK  1402
                 LKAG D+NCG Y+  + KSA+E   V ESDIDRAL NLFSV+ RLGLFNG    + 
Sbjct  331   VADVLKAGMDVNCGLYLANHTKSAVEQGKVSESDIDRALYNLFSVRMRLGLFNGSPSEQS  390

Query  1401  FESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTS-SLG  1225
             + + G  D+C+ EH+ LALEAAR GIVLLKN  K LPL K++  SLAVIGP AN + +L 
Sbjct  391   YGNLGRNDICTPEHQDLALEAARGGIVLLKNSAKLLPLSKSKTKSLAVIGPNANVAKTLL  450

Query  1224  GDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGL  1045
             G+Y G PC   + L+GL  Y+ KT +  GC DV C S    ++AV +AK ADYVI+V+GL
Sbjct  451   GNYAGPPCKTITPLEGLMSYVKKTKFHPGCEDVNCTSA-ATSQAVKLAKSADYVILVMGL  509

Query  1044  DLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVL  865
             +  +E+E+ DR  L+LPG Q +L+  +A  + KP+VLV+  GGP+DISFAK DP+I  +L
Sbjct  510   NQERESEELDREDLVLPGQQQSLITSIAKAAKKPVVLVMLCGGPVDISFAKNDPKIGGIL  569

Query  864   WIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYR  685
             W GYPGE GGKA++EI+FGD+NP GRLPLTWYP+ F  +PM DM MR+DPS GYPGRTYR
Sbjct  570   WAGYPGEAGGKAIAEIIFGDHNPGGRLPLTWYPKDFINIPMTDMRMRSDPSSGYPGRTYR  629

Query  684   FYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEV-  508
             FY GEKV+EFG+GLSY+++S +       +S+SQS       S  +R  +  Y+ V ++ 
Sbjct  630   FYQGEKVFEFGYGLSYTNYSYKF------VSVSQSKLDFKTLSTTDRPEHSGYISVADIG  683

Query  507   -SNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVT  331
               +C     S  V + N G M G   V+LF R        +P KQL+GF +V ++     
Sbjct  684   SESCEKAKVSAVVKVENEGKMAGKHPVLLFLRRDHKGGNASPVKQLVGFQKVSLNAKQKG  743

Query  330   ETSISIEPCQHLSIVNVEGSRILPLGDH  247
                  + PC+H S  + +G+ ++  GD 
Sbjct  744   SVEFEVSPCEHFSRASKDGTLVIESGDQ  771



>ref|XP_010061816.1| PREDICTED: probable beta-D-xylosidase 7 [Eucalyptus grandis]
Length=780

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/755 (51%), Positives = 504/755 (67%), Gaps = 32/755 (4%)
 Frame = -3

Query  2487  PQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             P   C P  P+  S+PFC  SLPI  R   LVS LT+DEKI +L  +  AIPRLG+PAYE
Sbjct  31    PPFSCDPSSPSTKSFPFCKASLPISKRAQDLVSRLTLDEKILQLVSSTPAIPRLGVPAYE  90

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSESLHG++  G GI FDG +KSAT FPQVILTAA+F+  LW  I      EARA++N+
Sbjct  91    WWSESLHGVSNAGRGIHFDGTIKSATSFPQVILTAASFDADLWYRIGQVIGTEARAVYNA  150

Query  2133  GQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYS  1957
             GQA G+TFWAPN+N+F DPRWGRGQETPGEDP+V   YAV YVR                
Sbjct  151   GQATGMTFWAPNINIFRDPRWGRGQETPGEDPLVTGKYAVSYVR---------------G  195

Query  1956  LSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKS  1777
             + G+R     +    L  SACCKH TAYDL+ W    RY F+A VT QDM DT++PPF+ 
Sbjct  196   VQGDRPQGGGKSRGGLQASACCKHFTAYDLDRWKGVDRYDFDAQVTAQDMADTFQPPFQK  255

Query  1776  CVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYA  1600
             C++ G+AS +MCAYN VNG+P+CA+ +LL   AR  W F GYITSDCDAV+ +++ Q+YA
Sbjct  256   CIQDGKASGIMCAYNRVNGVPSCADYNLLSNIARRQWSFHGYITSDCDAVSIMYDNQKYA  315

Query  1599  KSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNG  1420
             K+PE+A   ALKAG D+NCGTY+  + KSA+E + V  S+IDRAL NLFSV+ RLGLFNG
Sbjct  316   KTPEDAVADALKAGMDVNCGTYLQNHTKSAVEQRKVSVSEIDRALHNLFSVRMRLGLFNG  375

Query  1419  KAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN  1240
                 + F + GP  VCS +H+ LALEAAR GIVLLKN++K LPL +++ +SLAVIGP AN
Sbjct  376   DPKKQPFGNIGPDQVCSQKHQDLALEAARSGIVLLKNKEKHLPLQRSKSASLAVIGPNAN  435

Query  1239  TSS-LGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYV  1063
              +S L G+Y G PC   ++L  L  Y+  T Y  GC DV C+S    A+AV +AK AD+V
Sbjct  436   KASNLLGNYAGPPCKSVTLLQALQSYVKDTRYQPGCDDVVCSSPQ-IAQAVEVAKAADHV  494

Query  1062  IVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDP  883
             ++++GLD +QE ED DR  L+LPG Q   +  +A  + KP++LV+  GGP+DI FA+ D 
Sbjct  495   VLIMGLDQTQEREDFDRVDLVLPGRQQEFITTVAQAAKKPVILVILCGGPVDIRFARDDQ  554

Query  882   RIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGY  703
              I S+LW GYPGE GG ALSEI+FG++NP GRLP+TWYP+ FT+VPM DM MR +PS GY
Sbjct  555   NIGSILWAGYPGEAGGMALSEIIFGEHNPGGRLPVTWYPQEFTRVPMTDMRMRPEPSTGY  614

Query  702   PGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRI-SLSQSIKTKLRRSILNRGGNEPY  526
             PGRTYRFY G+ ++E+GHGLSY+ +S + +S    +  LSQS K++   +      +  Y
Sbjct  615   PGRTYRFYQGQSIFEYGHGLSYTEYSYKFISVTRELFYLSQSAKSQPDEA---SDASPRY  671

Query  525   VHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSR--APTSYAGGAPQKQLIGFDR  358
               V ++    C    F   V ++N+G M G   V+LF R   P+S   G+P KQL+ F  
Sbjct  672   RLVSDLGADFCKKSNFVATVKVKNHGDMVGKHPVLLFVRHAKPSS---GSPMKQLVAFQS  728

Query  357   VHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLG  253
             V + G    +  +++ PC HLS  N  G  IL  G
Sbjct  729   VELKGGETMKVQLALNPCDHLSRANENGVMILEEG  763



>ref|XP_009782574.1| PREDICTED: probable beta-D-xylosidase 7 [Nicotiana sylvestris]
Length=772

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/766 (50%), Positives = 498/766 (65%), Gaps = 35/766 (5%)
 Frame = -3

Query  2502  TSYSKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLG  2329
             T  ++P   C    P   S  FC ++LPI  R   LVS LT+DEKI +L ++  AIPRLG
Sbjct  18    TESTQPPFSCDSSLPLTKSLKFCQSALPISVRAKDLVSRLTLDEKISQLVNSAPAIPRLG  77

Query  2328  IPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavear  2149
             IPAYEWWSESLHG+   G GI F+G++  AT FPQVILTAA+F+  LW  I      EAR
Sbjct  78    IPAYEWWSESLHGVGAAGRGIFFNGSINGATSFPQVILTAASFDENLWYRIGQVIGREAR  137

Query  2148  AMFNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkn  1972
              ++N+G+A G+TFWAPN+N+F DPRWGRGQET GEDP +   YA+ YVR           
Sbjct  138   GVYNAGEAVGMTFWAPNINIFRDPRWGRGQETAGEDPTMTGKYAIRYVR-----------  186

Query  1971  gRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYE  1792
                  + G+     +     L  SACCKH TAYDL+ W    R+SFNA+VT QDM DT++
Sbjct  187   ----GVQGDSFEGGKLKKGHLQASACCKHFTAYDLDQWKTLDRFSFNAIVTPQDMADTFQ  242

Query  1791  PPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFE  1615
             PPF+ C++K +AS +MC+YN+VNGIP+CAN +LL K AR  WGF GYITSDCDAV  + +
Sbjct  243   PPFQDCIQKAQASGIMCSYNSVNGIPSCANYNLLTKTARQQWGFHGYITSDCDAVQVMHD  302

Query  1614  YQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRL  1435
               +YAK+PE+AA  ALKAG D+NCG Y+ +  KSA+  K V E+ +DRAL NLFS++ RL
Sbjct  303   NHKYAKTPEDAAAFALKAGMDVNCGDYLRKYTKSAIMQKKVSEAHVDRALHNLFSIRMRL  362

Query  1434  GLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVI  1255
             GLFNG    + F +  P  VC+ +H+ LALEAAR GIVLLKN  K LPL K + +SLAVI
Sbjct  363   GLFNGNPTKQLFGNISPNLVCAQQHQELALEAARSGIVLLKNTGKLLPLSKAKTNSLAVI  422

Query  1254  GPMANTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAK  1078
             GP AN++  L G+Y G PC    +L  L  Y+    Y  GC  V C S     +AV+ AK
Sbjct  423   GPNANSAYVLRGNYDGPPCKSIEILKALSGYVKTVQYHPGCYAVNCTSV-AIDQAVNAAK  481

Query  1077  RADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISF  898
               DYV++V+GLD  QE E  DR  L+LPG Q  L+  +A  + KP++LVL  GGP+D+SF
Sbjct  482   NVDYVVLVMGLDQGQEREQFDRDDLVLPGQQEKLITSVAKAAKKPVILVLLSGGPVDVSF  541

Query  897   AKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRAD  718
             AK +P+I S+LW GYPGE GG ALSEI+FG++NP G+LP+TWYP+ F K+PM DM MR +
Sbjct  542   AKINPKIGSILWAGYPGEAGGLALSEIIFGEHNPGGKLPITWYPQDFVKIPMTDMRMRPN  601

Query  717   PSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSA-PTRISLSQSIKTKLRRSILNRG  541
             P+ GYPGRTYRFY G KV+EFG+GLSY+++S E  SA P  + L+Q   TK     +   
Sbjct  602   PATGYPGRTYRFYKGPKVFEFGYGLSYTTYSYEFNSATPKTVQLNQLSTTK----TVQDS  657

Query  540   GNEPYVHVDE--VSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIG  367
              +  YV V+E  + NC    FS  VS++N+G MDG   V+LF +       G+P KQL+G
Sbjct  658   DSIRYVSVEEMGIDNCEKAKFSAHVSVKNSGEMDGKHPVLLFVKQDDKVQNGSPVKQLVG  717

Query  366   FDRVHVSGNGVTETSISIEPCQHLSIVN-------VEGSRILPLGD  250
             F  V +     +E    I PC+HLS  N        EGSR L +GD
Sbjct  718   FQSVSLKAGENSEIVFEISPCEHLSSANEDGLMMIEEGSRYLVVGD  763



>gb|KDP20226.1| hypothetical protein JCGZ_09858 [Jatropha curcas]
Length=779

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/772 (52%), Positives = 507/772 (66%), Gaps = 46/772 (6%)
 Frame = -3

Query  2502  TSYSKPQLPCQ--PPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLG  2329
             T  ++P   C    P+   YPFC TSLPI  R+  LVS LT+DEKI +L D   AIPRLG
Sbjct  24    TESAQPPFSCDLSNPSAKLYPFCQTSLPISKRVEDLVSRLTLDEKISQLVDTAPAIPRLG  83

Query  2328  IPAYEWWSESLHGIA-----TNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaa  2164
             IPAYEWWSE+LHG+A     +   GI F+G +KSAT FPQVILTAA+F+  LW  I    
Sbjct  84    IPAYEWWSEALHGVAFLPDVSQRQGIHFNGTIKSATSFPQVILTAASFDTHLWYRIGQVT  143

Query  2163  avearAMFNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqg  1987
               EARA++N+GQA G+TFWAPN+N++ DPRWGRGQETPGEDPMV   YAV +VRG+QG  
Sbjct  144   GKEARAIYNAGQATGMTFWAPNINIYRDPRWGRGQETPGEDPMVTGKYAVSFVRGVQGD-  202

Query  1986  lkgkngRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDM  1807
                      S  G  + E       L  SACCKH TAYD++ W N +R+ FNA VT QD+
Sbjct  203   ---------SFEGGAIGEH------LQASACCKHFTAYDMDKWQNMTRFIFNARVTLQDL  247

Query  1806  EDTYEPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAV  1630
              DTY+PPF+SC+++G+AS +MCAYN VNG+P CA+ +LL K AR  W F+GYITSDCDAV
Sbjct  248   ADTYQPPFRSCIQEGKASGIMCAYNQVNGVPNCADYNLLSKTARGQWNFQGYITSDCDAV  307

Query  1629  ATIFEYQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFS  1450
             + I++ Q+Y  SPE+A    LKAG D++CG+Y+    KSA++ K V ES+IDRAL NLFS
Sbjct  308   SIIYDDQRYVNSPEDAVADVLKAGMDVDCGSYLQSYTKSAVKKKKVAESEIDRALKNLFS  367

Query  1449  VQFRLGLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVS  1270
             V+ RLGLFNG    + + +     VCS EH+ LALEAAR+GIVLLKN  K LPL K++ +
Sbjct  368   VRMRLGLFNGNPTKQPYGNINADVVCSQEHQALALEAAREGIVLLKNSNKLLPLSKSKTN  427

Query  1269  SLAVIGPMA-NTSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEA  1093
             SLAVIGP A N+S+L G+Y G PC   + L GL +YI  T Y  GC  VAC+ST    +A
Sbjct  428   SLAVIGPNADNSSTLLGNYAGPPCKTVTPLQGLQKYIKNTRYHRGCDTVACSSTT-VDQA  486

Query  1092  VSIAKRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggp  913
             V IAK AD V++V+GLD +QE E+HDR  L+LPG Q  L+  +A  + KP++LVL  GGP
Sbjct  487   VKIAKEADQVVLVMGLDQTQEKEEHDRDDLVLPGKQQMLITSVAQAAKKPVILVLLSGGP  546

Query  912   LDISFAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDM  733
             +D+SFAK D  I S+LW GYPGE GG AL+EI+FGDYNP GRLP+TWYP+ FTK+PM DM
Sbjct  547   VDVSFAKYDKNIGSILWAGYPGEAGGDALAEIIFGDYNPGGRLPVTWYPQDFTKIPMTDM  606

Query  732   NMRADPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAP---TRISLSQSIKTKLR  562
              MR  PS GYPGRTYRFY G+KV+EFG+G   S  +     AP    +ISL   I  KL 
Sbjct  607   RMRPQPSSGYPGRTYRFYKGKKVFEFGYG--LSYSNYSYEFAPLMQNKISLRSKIDQKLE  664

Query  561   RSILNRGGNEPYVHVDEVSN-CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAP  385
              S         Y  V E+   C   + SV V + N+G M G   V+LF R P     G P
Sbjct  665   DST-----PVSYRSVSEIGELCEKSSLSVTVRVENHGEMAGKHPVLLFLRQP-ELGNGRP  718

Query  384   QKQLIGFDRVHVSGNGVTETSISIEPCQHLSIVNV-------EGSRILPLGD  250
              K+L+GF    ++     E    + PC+HLS  N        EGS+ L +GD
Sbjct  719   MKKLVGFQTAKLNAGEKVEIEYKLSPCEHLSRANEDGLMVIDEGSQFLNVGD  770



>ref|XP_010664313.1| PREDICTED: probable beta-D-xylosidase 7 [Vitis vinifera]
Length=774

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/761 (52%), Positives = 500/761 (66%), Gaps = 35/761 (5%)
 Frame = -3

Query  2502  TSYSKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLG  2329
             T  S P   C    P   SY FC+T+L I  R   L+S LT+DEKI +L  + ++IPRLG
Sbjct  27    TESSSPPFACDSSDPLTKSYAFCNTTLRISQRASDLISRLTLDEKISQLISSAASIPRLG  86

Query  2328  IPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavear  2149
             IPAYEWWSE+LHGI  +  GI F+G ++SAT FPQVILTAA+F+  LW  I  A  +E R
Sbjct  87    IPAYEWWSEALHGI-RDRHGIRFNGTIRSATSFPQVILTAASFDAHLWYRIGQAIGIETR  145

Query  2148  AMFNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkn  1972
             AM+N+GQA G+TFWAPN+N+F DPRWGRGQETPGEDP+V   YAV YVR           
Sbjct  146   AMYNAGQAMGMTFWAPNINIFRDPRWGRGQETPGEDPVVAGKYAVSYVR-----------  194

Query  1971  gRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYE  1792
                  L G+    E    D L  SACCKH TAYDL+ W +  RY+F+A VT QD+ DTY+
Sbjct  195   ----GLQGDTF--EGGKVDVLQASACCKHFTAYDLDNWTSIDRYTFDARVTMQDLADTYQ  248

Query  1791  PPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFE  1615
             PPF+SC+E+GRAS LMCAYN VNG+P CA+ +LL K AR  WGF+GYI SDCDAV+ + +
Sbjct  249   PPFRSCIEEGRASGLMCAYNLVNGVPNCADFNLLSKTARGQWGFDGYIVSDCDAVSLVHD  308

Query  1614  YQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRL  1435
              Q YAKSPE+A  I L AG D+ CG Y+ ++ KSA+  K + ES+IDRALLNLF+V+ RL
Sbjct  309   VQGYAKSPEDAVAIVLTAGMDVACGGYLQKHAKSAVSQKKLTESEIDRALLNLFTVRMRL  368

Query  1434  GLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVI  1255
             GLFNG      F + GP  VCS+EH+ LALEAAR GIVLLKN  + LPL K    SLAVI
Sbjct  369   GLFNGNPRKLPFGNIGPDQVCSTEHQTLALEAARSGIVLLKNSDRLLPLSKGETLSLAVI  428

Query  1254  GPMAN-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAK  1078
             GP AN T +L G+Y G PC   S L GL  Y++ T Y +GC DVAC+S      AV +AK
Sbjct  429   GPNANATDTLLGNYAGPPCKFISPLQGLQSYVNNTMYHAGCNDVACSSAS-IENAVDVAK  487

Query  1077  RADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISF  898
             +ADYV++V+GLD +QE E +DR  L+LPG Q  L+  +A  + KP+VLVL  GGP+DISF
Sbjct  488   QADYVVLVMGLDQTQEREKYDRLDLVLPGKQEQLITGVAKAAKKPVVLVLLCGGPVDISF  547

Query  897   AKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRAD  718
             AK    I S+LW GYPGE GG A++E +FGD+NP GRLP+TWYP+ F K+PM DM MR +
Sbjct  548   AKGSSNIGSILWAGYPGEAGGAAIAETIFGDHNPGGRLPVTWYPKDFIKIPMTDMRMRPE  607

Query  717   PSRGYPGRTYRFYTGEKVYEFGHGlsys-sfslellSAPTRISLSQSIKTKLRRSILNRG  541
             P  GYPGRT+RFYTG+ V+EFG+GLSYS      L   P ++ L+Q   T +        
Sbjct  608   PQSGYPGRTHRFYTGKTVFEFGNGLSYSPYSYEFLSVTPNKLYLNQPSTTHVVE------  661

Query  540   GNEPYVHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIG  367
              N  Y  V E+    C +  FS  +++RN G M G   V+LF +   +   G+P KQL+G
Sbjct  662   -NSGYASVSELGTEFCEAKKFSALIAVRNGGKMAGKHPVLLFVKQAKA-GNGSPMKQLVG  719

Query  366   FDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             F  V +     +     + PC+HLS  N +G  ++  G H+
Sbjct  720   FQNVFLDAGESSNVEFILSPCEHLSRANKDGLMVMEQGIHL  760



>ref|NP_001167905.1| uncharacterized protein LOC100381616 [Zea mays]
 gb|ACN26462.1| unknown [Zea mays]
Length=630

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/637 (56%), Positives = 465/637 (73%), Gaps = 24/637 (4%)
 Frame = -3

Query  2145  MFNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngR  1966
             M N+GQAGLT+WAPN+N+F DPRWGRGQET GEDP V + Y++EYV+G            
Sbjct  1     MHNAGQAGLTYWAPNINIFRDPRWGRGQETSGEDPAVAAAYSLEYVKG------------  48

Query  1965  KYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPP  1786
                        EE ++ R+ LSACCKH TAYD+E W  FSRY+FNA V  QD+EDTY+PP
Sbjct  49    --------FQGEEGEEGRIRLSACCKHYTAYDMEKWEGFSRYTFNAKVNAQDLEDTYQPP  100

Query  1785  FKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQ  1606
             FK+C+++ RASCLMCAYN VNG+P CA+KDLL+K R +WGF+GYITSDCDAVA I E Q 
Sbjct  101   FKTCIQEARASCLMCAYNQVNGVPMCAHKDLLQKTRDEWGFQGYITSDCDAVAIIHENQT  160

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             Y KS E++  I LKAG DINCG++++R+ KSA+E   + E DIDRAL NLFSVQ RLG+F
Sbjct  161   YTKSGEDSIAIVLKAGMDINCGSFLVRHTKSAIEKGKIQEEDIDRALFNLFSVQLRLGIF  220

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPM  1246
             +  + N+ F   GP  VC+ EHR LA EA RQG VLLKN+  FLPL ++ V  +A+IGP 
Sbjct  221   DKPSNNQWFSQLGPNSVCTKEHRELAAEAVRQGAVLLKNDHNFLPLKRSEVRHVAIIGPS  280

Query  1245  ANTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             AN + ++GGDYTG+PC   + L G+  Y  +TS+A GC D +CNSTD F EAV  AKRAD
Sbjct  281   ANDAYAMGGDYTGVPCNPTTFLKGIQAYATQTSFAPGCKDASCNSTDLFGEAVEAAKRAD  340

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
              V+V+ GL+L++E ED DR SLLLPG QM L++ +A V+ KPLVLVL GGGP+D+SFAK+
Sbjct  341   IVVVIAGLNLTEEREDFDRVSLLLPGKQMGLIHAIASVAKKPLVLVLLGGGPVDVSFAKQ  400

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSR  709
             DPRIAS+LW+GYPGE GG+ L EI+FG+YNP G+LP+TWYPESFT +PM DMNMRADPSR
Sbjct  401   DPRIASILWLGYPGEVGGQVLPEILFGEYNPGGKLPITWYPESFTAIPMTDMNMRADPSR  460

Query  708   GYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKL--RRSILNRGGN  535
             GYPGRTYRFYTG+ VY FG+GLSYS +S  + SAP +I++S+S    +  R+    R   
Sbjct  461   GYPGRTYRFYTGDVVYGFGYGLSYSKYSYSISSAPKKITVSRSSDLGIISRKPAYTRRDG  520

Query  534   EPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRV  355
                V  +++++C +L FSV V++ N+G MDGS  V+LF+R+ +S   G P KQL+GF+ V
Sbjct  521   LGSVKTEDIASCEALVFSVHVAVSNHGSMDGSHAVLLFARSKSSVP-GFPIKQLVGFESV  579

Query  354   HVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             H +    +   I+++PC+ +S  N EG R+L LG H+
Sbjct  580   HTAAGSASNVEITVDPCKQMSAANPEGKRVLLLGAHV  616



>ref|XP_002513892.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis]
 gb|EEF48475.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis]
Length=774

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/763 (51%), Positives = 503/763 (66%), Gaps = 40/763 (5%)
 Frame = -3

Query  2493  SKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             ++P   C P  P+ SS+ FC TSLPI  R+  LVS LT+DEKI +L  +  +IPRLGIPA
Sbjct  25    TEPPFSCDPSNPSTSSFLFCKTSLPISQRVRDLVSRLTLDEKISQLVSSAPSIPRLGIPA  84

Query  2319  YEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMF  2140
             YEWWSE+LHG+A  G GI F+GA+K+AT FPQVILTAA+F+   W  I      EARA++
Sbjct  85    YEWWSEALHGVANVGRGIHFEGAIKAATSFPQVILTAASFDAYQWYRIGQVIGREARAVY  144

Query  2139  NSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             N+GQA G+TFWAPN+N+F DPRWGRGQETPGEDP+V   YAV YVRG+QG          
Sbjct  145   NAGQATGMTFWAPNINIFRDPRWGRGQETPGEDPLVTGKYAVSYVRGVQGD---------  195

Query  1962  YSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
              S  G ++         L  SACCKH TAYDL+ W   +R+ F+A VT QD+ DTY+PPF
Sbjct  196   -SFQGGKL------KGHLQASACCKHFTAYDLDNWKGVNRFVFDARVTMQDLADTYQPPF  248

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQ  1606
             +SCV++G+AS +MCAYN VNGIP+CA+ +LL + AR  W F GYI SDCDAV+ I++ Q 
Sbjct  249   QSCVQQGKASGIMCAYNRVNGIPSCADFNLLSRTARGQWDFHGYIASDCDAVSIIYDNQG  308

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             YAKSPE+A    LKAG D+NCG+Y+ ++ K+A+E K + E+ IDRAL NLFSV+ RLGLF
Sbjct  309   YAKSPEDAVVDVLKAGMDVNCGSYLQKHTKAAVEQKKLPEASIDRALHNLFSVRMRLGLF  368

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPM  1246
             NG    + F + GP  VCS EH+ LALEAAR GIVLLKN  + LPL K++  SLAVIGP 
Sbjct  369   NGNPTEQPFSNIGPDQVCSQEHQILALEAARNGIVLLKNSARLLPLQKSKTVSLAVIGPN  428

Query  1245  ANT-SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             AN+  +L G+Y G PC   + L  L  Y+  T Y SGC  V C+S     +AV IAK  D
Sbjct  429   ANSVQTLLGNYAGPPCKTVTPLQALQYYVKNTIYYSGCDTVKCSSAS-IDKAVDIAKGVD  487

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
              V++++GLD +QE E+ DR  L+LPG Q  L+  +A  +  P+VLVL  GGP+DISFAK 
Sbjct  488   RVVMIMGLDQTQEREELDRLDLVLPGKQQELITNVAKSAKNPIVLVLLSGGPVDISFAKY  547

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSR  709
             D  I S+LW GYPGE GG AL+EI+FGD+NP G+LP+TWYP+ F KVPM DM MR DPS 
Sbjct  548   DENIGSILWAGYPGEAGGIALAEIIFGDHNPGGKLPMTWYPQEFVKVPMTDMRMRPDPSS  607

Query  708   GYPGRTYRFYTGEKVYEFGHGls-yssfslellSAPTRISLSQSIKTKL-------RRSI  553
             GYPGRTYRFY G  V+EFG+GLS           + T++ L+QS   ++       R ++
Sbjct  608   GYPGRTYRFYKGRNVFEFGYGLSYSKYSYELKYVSQTKLYLNQSSTMRIIDNSDPVRATL  667

Query  552   LNRGGNEPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQL  373
             + + G E          C    FSV+V + N G M G   V+LF+R    +  G P++QL
Sbjct  668   VAQLGAE---------FCKESKFSVKVGVENQGEMAGKHPVLLFARH-ARHGNGRPRRQL  717

Query  372   IGFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             IGF  V ++     E    + PC+H S  N +G R++  G H 
Sbjct  718   IGFKSVILNAGEKAEIEFELSPCEHFSRANEDGLRVMEEGTHF  760



>ref|XP_008808183.1| PREDICTED: probable beta-D-xylosidase 7 [Phoenix dactylifera]
Length=772

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/767 (52%), Positives = 513/767 (67%), Gaps = 49/767 (6%)
 Frame = -3

Query  2493  SKPQLPCQP--PTHSSYPFCDT-SLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIP  2323
             + P   C P  P+ +S+ FC T SLPI  R+  L++ LT++EKI +L D   +IPRLGIP
Sbjct  24    ADPPFSCDPSSPSTNSFTFCKTTSLPIDKRVDDLIAHLTLEEKIAQLGDIAPSIPRLGIP  83

Query  2322  AYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAM  2143
             AY+WWSESLHG++ +G GI F+G + SAT FPQVILTAA+FN  +W  I  A  +EARA+
Sbjct  84    AYKWWSESLHGVSDSGRGIHFNGTIHSATSFPQVILTAASFNPRIWYQIGQAIGIEARAV  143

Query  2142  FNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngR  1966
             +N+GQA GLTFW+PN+N+F DPRWGRGQETPGEDPM  S YA  YVRGLQG         
Sbjct  144   YNNGQAEGLTFWSPNINIFRDPRWGRGQETPGEDPMTTSKYAAVYVRGLQGD--------  195

Query  1965  KYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPP  1786
               S  G    E       L  SACCKH TAYDL+ W    RY+FNA+V+ QD EDTY+PP
Sbjct  196   --SFKGGSSAE-------LKASACCKHFTAYDLDNWKGNIRYTFNALVSAQDFEDTYQPP  246

Query  1785  FKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQ  1609
             FKSCVE+GRAS +MC+YN VNG+P CA+ +LL K AR  WGF GYITSDCDAV+ I + Q
Sbjct  247   FKSCVEEGRASGIMCSYNRVNGVPTCADHNLLSKTARGSWGFYGYITSDCDAVSIIHDSQ  306

Query  1608  QYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGL  1429
              YAK+PE+A G  LKAG D+NCG Y+ +  KSA++   + E DI+RAL NLFS++ RLGL
Sbjct  307   GYAKTPEDAVGDVLKAGMDVNCGNYVQKYAKSAVQQGKLSEGDINRALHNLFSIRMRLGL  366

Query  1428  FNGKAVNRKFESFG---PKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAV  1258
             FNG   N K+E++G   P  VC+ +H+ LALEAAR GIVLLKN    LPL K++V SL V
Sbjct  367   FNG---NPKYEAYGKIAPSQVCTQKHQNLALEAARDGIVLLKNSVNILPLSKSKVKSLGV  423

Query  1257  IGPMANTSS-LGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIA  1081
             IG  AN ++ L G+Y G PC   + L+ L  Y+  T Y SGC   AC S+   +EAV +A
Sbjct  424   IGLNANNATKLLGNYAGPPCKSITPLEALQSYVKDTRYLSGCDTAACTSSST-SEAVQLA  482

Query  1080  KRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDIS  901
             +  DYV++ +GLDL QE ED DR  L+LPG Q +L+  +A  + +P++LVL  GGP+DI+
Sbjct  483   RSVDYVVMFMGLDLEQEREDLDRVDLVLPGMQQSLITSVARAAKRPVILVLLCGGPVDIT  542

Query  900   FAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRA  721
             FAK + +I  +LW GYPGE GG A+++++FG++NP GRLP+TWYP+SFT VPM DM MRA
Sbjct  543   FAKYEKKIGGILWAGYPGEAGGLAIAQVIFGEHNPGGRLPVTWYPQSFTSVPMTDMRMRA  602

Query  720   DPSRGYPGRTYRFYTGEKVYEFGHGlsyssfsle-llSAPTRISLSQSIKT-------KL  565
             DP+ GYPGRTYRFYTG+ VY FG GLSYS++S E    +  +I L++SI          L
Sbjct  603   DPASGYPGRTYRFYTGKPVYSFGFGLSYSTYSYEFSAESENKIYLNKSISLDAFKMSGSL  662

Query  564   RRSILNRGGNEPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAP  385
                I N G             C  L FS  V ++N+G MDG   V+LF R P +   G P
Sbjct  663   SYDITNMGSEA----------CKKLKFSTVVGVKNHGPMDGKHPVLLFLRWPNALH-GRP  711

Query  384   QKQLIGFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
              KQLIGF  VH+      +    + PC+HLS  N++G+++L  G H 
Sbjct  712   MKQLIGFQSVHLKAGERADVKFVVSPCKHLSRTNIDGAKLLDQGSHF  758



>ref|XP_009592501.1| PREDICTED: probable beta-D-xylosidase 7 [Nicotiana tomentosiformis]
Length=775

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/763 (50%), Positives = 495/763 (65%), Gaps = 35/763 (5%)
 Frame = -3

Query  2493  SKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             ++P   C    P   S  FC ++LPI  R   LVS LT+DEKI +L ++  AIPRLGIPA
Sbjct  24    TQPPFSCDSSLPLTKSLKFCQSALPISVRAKDLVSRLTLDEKISQLVNSAPAIPRLGIPA  83

Query  2319  YEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMF  2140
             YEWWSESLHG+   G GI F+G++  AT FPQVILTAA+F+  LW  I      EAR ++
Sbjct  84    YEWWSESLHGVGAAGRGIFFNGSIVGATSFPQVILTAASFDENLWYRIGQVIGREARGVY  143

Query  2139  NSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             N+G+A G+TFWAPN+N+F DPRWGRGQETPGEDP +   YA+ YVR              
Sbjct  144   NAGEAVGMTFWAPNINIFRDPRWGRGQETPGEDPSMSGKYAIRYVR--------------  189

Query  1962  YSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
               + G+     +     L  SACCKH TAYDL+ W    R+SFNA+VT QDM DT++PPF
Sbjct  190   -GVQGDSFEGGKLKKGHLQASACCKHFTAYDLDQWKTLDRFSFNAIVTPQDMADTFQPPF  248

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQ  1606
             + C++K +AS +MC+YN+VNGIP+CAN +LL K AR  WGF GYITSDCDAV  + +  +
Sbjct  249   QDCIQKAQASGIMCSYNSVNGIPSCANYNLLTKTARQQWGFHGYITSDCDAVQVMHDNHK  308

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             YAK+PE+AA  ALKAG D+NCG Y+ +  KSA+  K V E+ +DRAL NLFS++ RLGLF
Sbjct  309   YAKTPEDAAAFALKAGMDVNCGDYLRKYTKSAIMQKKVSEAHVDRALHNLFSIRMRLGLF  368

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPM  1246
             NG    + F +  P  VC+ +H+ LALEAAR GIVLLKN  K LPL K + +SLAVIGP 
Sbjct  369   NGNPTKQLFGNISPNLVCAQQHQELALEAARSGIVLLKNTGKLLPLSKAKTNSLAVIGPN  428

Query  1245  ANTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             AN++  L G+Y G PC    +L  L  Y+    Y  GC  V C S     +AV+ AK  D
Sbjct  429   ANSAYVLRGNYDGPPCKSIEILKALSGYVKTVQYHPGCNAVNCTSA-AIDQAVNAAKNVD  487

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
             YV++V+GLD  QE E  DR  L+LPG Q  L+N +A  + KP++LVL  GGP+D+SFAK 
Sbjct  488   YVVLVMGLDQGQEREQFDRDDLVLPGQQEKLINSVAKAAKKPVILVLLSGGPVDVSFAKI  547

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSR  709
             + +I S+LW GYPGE GG AL+EI+FG++NP G+LP+TWYP+ F K+PM DM MR +P+ 
Sbjct  548   NTKIGSILWAGYPGEAGGLALAEIIFGEHNPGGKLPITWYPQEFVKIPMTDMRMRPNPAT  607

Query  708   GYPGRTYRFYTGEKVYEFGHGlsyssfslellSA-PTRISLSQSIKTKLRRSILNRGGNE  532
             GYPGRTYRFY G KV+EFG+GLSY+++S E     P  + L+Q    K  + +     + 
Sbjct  608   GYPGRTYRFYKGPKVFEFGYGLSYTTYSYEFSYGTPKTVQLNQLSTAKTVQGL----DSI  663

Query  531   PYVHVDE--VSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDR  358
              Y  V+E  + NC    FS  VS++N+G MDG   V+LF +       G+P KQL+GF  
Sbjct  664   RYTSVEEMGIDNCEKAKFSAHVSVKNSGEMDGKHPVLLFVKQDEKVQNGSPVKQLVGFQS  723

Query  357   VHVSGNGVTETSISIEPCQHLSIVN-------VEGSRILPLGD  250
             V +     +E    I PC+HLS  N        EGSR L +GD
Sbjct  724   VSLKAGENSEIVFEISPCEHLSSANEDGLMMIEEGSRYLVVGD  766



>ref|NP_001266114.1| SlArf/Xyl4 protein precursor [Solanum lycopersicum]
 dbj|BAL44719.1| SlArf/Xyl4 [Solanum lycopersicum]
Length=775

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/763 (50%), Positives = 497/763 (65%), Gaps = 36/763 (5%)
 Frame = -3

Query  2493  SKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             ++P   C    P   S  FC T LPI  R+  LVS LT+DEKI +L ++  AIPRLGIPA
Sbjct  25    TQPPFSCDSSNPQTKSLKFCQTGLPISVRVLDLVSRLTLDEKISQLVNSAPAIPRLGIPA  84

Query  2319  YEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMF  2140
             YEWWSESLHG+ + G GI F+G++  AT FPQVILTAA F+  LW  I     VEAR ++
Sbjct  85    YEWWSESLHGVGSAGKGIFFNGSIAGATSFPQVILTAATFDENLWYRIGQVIGVEARGVY  144

Query  2139  NSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             N+GQA G+TFWAPN+N+F DPRWGRGQETPGEDP++   YA+ YVR              
Sbjct  145   NAGQAIGMTFWAPNINIFRDPRWGRGQETPGEDPIMTGKYAIRYVR--------------  190

Query  1962  YSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
               + G+     +     L  SACCKH TAYDL+ W N  R+SFNA+VT QDM DT++PPF
Sbjct  191   -GVQGDSFNGGQLKKGHLQASACCKHFTAYDLDQWKNLDRFSFNAIVTPQDMADTFQPPF  249

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQ  1606
             + C++K +AS +MC+YN+VNGIP+CAN +LL K AR  WGF GYITSDCDAV  + +  +
Sbjct  250   QDCIQKAQASGIMCSYNSVNGIPSCANYNLLTKTARQQWGFHGYITSDCDAVQVMHDNHR  309

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             Y  +PE++   ALKAG DI+CG Y+ +  KSA+  K V +  IDRAL NLFS++ RLGLF
Sbjct  310   YGNTPEDSTAFALKAGMDIDCGDYLKKYTKSAVMKKKVSQVHIDRALHNLFSIRMRLGLF  369

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPM  1246
             NG    + + +  P  VC+ +H++LALEAAR GIVLLKN  K LPL K + +SLAVIG  
Sbjct  370   NGDPRKQLYGNISPSQVCAPQHQQLALEAARNGIVLLKNTGKLLPLSKAKTNSLAVIGHN  429

Query  1245  ANTSS-LGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             AN +  L G+Y G PC    +L  L  Y     Y  GC    C S +   +AV+IA+ AD
Sbjct  430   ANNAYILRGNYDGPPCKYIEILKALVGYAKSVQYQQGCNAANCTSAN-IDQAVNIARNAD  488

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
             YV++++GLD +QE E  DR  L+LPG Q  L+N +A  + KP++LV+  GGP+DISFAK 
Sbjct  489   YVVLIMGLDQTQEREQFDRDDLVLPGQQENLINSVAKAAKKPVILVILSGGPVDISFAKY  548

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSR  709
             +P+I S+LW GYPGE GG AL+EI+FG++NP G+LP+TWYP++F K+PM DM MR DP  
Sbjct  549   NPKIGSILWAGYPGEAGGIALAEIIFGEHNPGGKLPVTWYPQAFVKIPMTDMRMRPDPKT  608

Query  708   GYPGRTYRFYTGEKVYEFGHGlsyssfslellSA-PTRISLSQSIKTKLRRSILNRGGNE  532
             GYPGRTYRFY G KVYEFG+GLSY+++S    SA P  I L+Q +  K     +    + 
Sbjct  609   GYPGRTYRFYKGPKVYEFGYGLSYTTYSYGFHSATPNTIQLNQLLSVK----TVENSDSI  664

Query  531   PYVHVDEV--SNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDR  358
              Y  VDE+   NC    FS  VS+ N+G MDG   V+LF +   +   G+P KQL+GF  
Sbjct  665   RYTFVDEIGSDNCEKAKFSAHVSVENSGEMDGKHPVLLFVKQDKA-RNGSPIKQLVGFQS  723

Query  357   VHVSGNGVTETSISIEPCQHLSIVN-------VEGSRILPLGD  250
             V +     ++    I PC+HLS  N        EGSR L +GD
Sbjct  724   VSLKAGENSQLVFEISPCEHLSSANEDGLMMIEEGSRYLVVGD  766



>ref|XP_006826952.1| hypothetical protein AMTR_s00010p00188970 [Amborella trichopoda]
 gb|ERM94189.1| hypothetical protein AMTR_s00010p00188970 [Amborella trichopoda]
Length=778

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/745 (51%), Positives = 504/745 (68%), Gaps = 22/745 (3%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P+ SS+ FC TSL I  R+  L+S LT++EK+ +L +   AI RLGIP+Y+WWSESLHG+
Sbjct  36    PSTSSFKFCTTSLSINERVWDLISHLTLEEKVSQLVNTAPAISRLGIPSYQWWSESLHGV  95

Query  2286  ATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GLTFW  2110
             +  GPGI F+G ++SAT FPQVILTA++FNR +W  I  AA  EARA++N+GQA GLTFW
Sbjct  96    SNIGPGIRFNGTIRSATSFPQVILTASSFNREIWYQIGQAAGKEARAIYNAGQANGLTFW  155

Query  2109  APNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEE  1930
             APN+N+F DPRWGRGQETPGEDP V   YAV YVRGLQG           S+ G+R P  
Sbjct  156   APNINIFRDPRWGRGQETPGEDPTVTGKYAVAYVRGLQGD----------SIDGSRGPTV  205

Query  1929  EEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASC  1750
                  RL  SACCKHLTAYDL+ W   +RY+FNA V+ QD+ DTY+PPF+ CVE+G AS 
Sbjct  206   -----RLRASACCKHLTAYDLDKWEGTTRYTFNAAVSSQDLADTYQPPFQRCVEEGHASG  260

Query  1749  LMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGI  1573
             +MCAYN VNG+P CA+ DLL K AR+ WGF GYITSDCDAV  I + Q YA +PE+A G 
Sbjct  261   IMCAYNRVNGVPNCADYDLLTKTARSRWGFYGYITSDCDAVGIIHDSQSYAATPEDAVGD  320

Query  1572  ALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFES  1393
              L+AG D+NCG+YM ++  SA++     ESD++RAL +LFS++ RLGLF+G        +
Sbjct  321   VLRAGMDVNCGSYMQQHTMSAIQQGKAKESDVNRALHHLFSIRIRLGLFDGNPTKLPDGN  380

Query  1392  FGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANT-SSLGGDY  1216
              GP  VCS+EH+ LAL+AAR+GIVLLKN  K LPL K  + S AVIGP AN   +L G+Y
Sbjct  381   IGPNIVCSNEHQYLALQAAREGIVLLKNSPKVLPLSKNAIKSFAVIGPNANNPQTLLGNY  440

Query  1215  TGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLS  1036
              G PC + S L  L  Y+  T +A GC  VAC S     EAV++A+ AD+V++V+GLD S
Sbjct  441   AGPPCNILSPLQALQRYVKHTQFAHGCDLVACTSEALIDEAVNVARAADHVVLVMGLDQS  500

Query  1035  QETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIG  856
             QE E+ DR SL LPGHQ  L+  ++  + KP+VLVL  GGP+D+SFAK++ +I +++W G
Sbjct  501   QEREELDRVSLSLPGHQERLITMVSQAAKKPVVLVLLCGGPVDVSFAKRNSKIGAMVWAG  560

Query  855   YPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFYT  676
             YPGE GG AL+EI+FG++NP G+LP+TWYPE FTK+PM +M MR D + GYPGRTYRFY 
Sbjct  561   YPGEAGGTALAEIIFGEHNPGGKLPMTWYPEEFTKIPMTNMRMRPDLNSGYPGRTYRFYR  620

Query  675   GEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEVSN--  502
             G +V+ +GHG    S       +P    L  ++      S+ N+        +D++ +  
Sbjct  621   GREVFRYGHG-LSYSTYSYEFLSPAITPLYLNLSLYRDPSLSNQDSEHLIYDIDQLGSEA  679

Query  501   CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETS  322
             C+ + FS  V +RN+G MDG  VV+LFSR P   +  AP++QL+ F  V++    + E  
Sbjct  680   CDQVQFSTTVRVRNSGQMDGQHVVLLFSRPPV-VSNDAPKRQLVDFKSVYLKAGEMREVH  738

Query  321   ISIEPCQHLSIVNVEGSRILPLGDH  247
               + PC+H +    +G R+   G H
Sbjct  739   FELRPCEHFAGTLEDGRRVFEGGPH  763



>ref|XP_006354009.1| PREDICTED: probable beta-D-xylosidase 7-like [Solanum tuberosum]
Length=775

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/765 (50%), Positives = 496/765 (65%), Gaps = 40/765 (5%)
 Frame = -3

Query  2493  SKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             ++P   C    P   S  FC T LPI  R+  LVS LT+DEKI +L ++  AIPRLGIPA
Sbjct  25    TQPPFSCDSSNPQTKSLKFCQTGLPISVRVQDLVSRLTLDEKISQLVNSAPAIPRLGIPA  84

Query  2319  YEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMF  2140
             YEWWSESLHG+ + G GI F+G++  AT FPQVILTAA F+  LW  I     VEAR ++
Sbjct  85    YEWWSESLHGVGSAGKGIFFNGSIAGATSFPQVILTAATFDENLWYRIGQVIGVEARGVY  144

Query  2139  NSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             N+GQA G+TFWAPN+N+F DPRWGRGQETPGEDP++   YA+ YVR              
Sbjct  145   NAGQAIGMTFWAPNINIFRDPRWGRGQETPGEDPIMTGKYAIRYVR--------------  190

Query  1962  YSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
               + G+     +     L  SACCKH TAYDL+ W N  R+SFNA+VT QDM DT++PPF
Sbjct  191   -GVQGDSFNGGQLKKGHLQASACCKHFTAYDLDQWKNLDRFSFNAIVTPQDMADTFQPPF  249

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQ  1606
             + C++K +AS +MC+YN+VNGIP+CAN +LL K AR  WGF GYITSDCDAV  + +  +
Sbjct  250   QDCIQKAQASGIMCSYNSVNGIPSCANYNLLTKTARQQWGFHGYITSDCDAVQVMHDNHR  309

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             Y  +PE++   ALKAG DI+CG Y+ +  KSA+  K V +  IDRAL NLFS++ RLGLF
Sbjct  310   YGNTPEDSTAFALKAGMDIDCGDYLKKYTKSAVMKKKVSQVHIDRALHNLFSIRMRLGLF  369

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPM  1246
             NG    + + +  P  VC+ +H+ LALEAAR GIVLLKN  K LPL K + +SLAVIG  
Sbjct  370   NGDPRKQLYGNISPSLVCAPQHQELALEAARNGIVLLKNTGKLLPLSKAKTNSLAVIGHN  429

Query  1245  ANTSS-LGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             AN +  L G+Y G PC    +L  L  Y     Y  GC    C S D   +AV+IA  AD
Sbjct  430   ANNAYILRGNYDGPPCKYIEILKALVGYAKSVQYQQGCNAANCTSAD-INQAVNIATNAD  488

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
             YV++V+GLD +QE E  DR  L+LPG Q  L+N +A  + KP++LV+  GGP+DISFAK 
Sbjct  489   YVVLVMGLDQTQEREQFDRDDLVLPGQQENLINSVAKAAKKPVILVILSGGPVDISFAKY  548

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSR  709
             +P+I S+LW GYPGE GG AL+EI+FG++NP G+LP+TWYP++F K+PM DM MR DP  
Sbjct  549   NPKIGSILWAGYPGEAGGIALAEIIFGEHNPGGKLPVTWYPQAFVKIPMTDMRMRPDPKT  608

Query  708   GYPGRTYRFYTGEKVYEFGHGlsyssfslellSA-PTRISLSQ--SIKTKLRRSILNRGG  538
             GYPGRTYRFY G KVYEFG+GLSY+++S    SA P  + L+Q  S+KT      +    
Sbjct  609   GYPGRTYRFYKGPKVYEFGYGLSYTTYSYGFHSATPNTVQLNQLSSVKT------VENSD  662

Query  537   NEPYVHVDEV--SNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGF  364
             +  Y  VDE+   NC    FS  VS+ N+G MDG   V+LF +   +   G P KQL+GF
Sbjct  663   SIRYTSVDEIGSDNCEKAKFSAHVSVENSGEMDGKHPVLLFVKQDKA-RNGRPIKQLVGF  721

Query  363   DRVHVSGNGVTETSISIEPCQHLSIVN-------VEGSRILPLGD  250
               V +     ++    I PC+HLS  N        EGSR L +GD
Sbjct  722   QSVSLKAGEDSQLVFEISPCEHLSSANEDGLMMIEEGSRYLVVGD  766



>gb|EYU23220.1| hypothetical protein MIMGU_mgv1a001636mg [Erythranthe guttata]
Length=781

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/755 (51%), Positives = 497/755 (66%), Gaps = 35/755 (5%)
 Frame = -3

Query  2487  PQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             P   C    P+  SY FC+  LPI  R H L++ LT+DEKI +L    SAIPRLGIP YE
Sbjct  34    PPFSCDASDPSTKSYRFCNVDLPIGKRAHDLITRLTLDEKISQLVSKASAIPRLGIPYYE  93

Query  2313  WWSESLHGIA---TNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAM  2143
             WWSE+LHG+A   +   GI F+G +++AT FPQVILTAA F+  LW  IA     EARA+
Sbjct  94    WWSEALHGVAGAFSVETGIAFNGTIRAATSFPQVILTAATFDEKLWYRIAKVIGTEARAI  153

Query  2142  FNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngR  1966
             +N G++ G+TFW+PN+N+F DPRWGRGQETPGEDP + S YAV +VR             
Sbjct  154   YNEGESIGMTFWSPNINIFRDPRWGRGQETPGEDPFLTSKYAVSFVR-------------  200

Query  1965  KYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPP  1786
                + G+     +  D  L+ SACCKHLTAYDLE W   +R++FNA VT+QDM DTY+PP
Sbjct  201   --GIQGDSFEGGDLKDGHLLASACCKHLTAYDLESWDGNNRFTFNAHVTKQDMADTYQPP  258

Query  1785  FKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQ  1609
             FKSCVEKGR+S +MCAYN VNG+P CA+ DLL K AR  WGF+GYITSDCDAV+ I+E Q
Sbjct  259   FKSCVEKGRSSGIMCAYNLVNGVPNCADYDLLTKTARGKWGFKGYITSDCDAVSLIYEKQ  318

Query  1608  QYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGL  1429
              YAKSPEE     LKAG D+NCG Y+  + KSA+E   V ESDIDRAL NLFSV+ RLGL
Sbjct  319   HYAKSPEEVVADVLKAGMDVNCGDYLANHTKSAVEKGKVSESDIDRALHNLFSVRMRLGL  378

Query  1428  FNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGP  1249
             FNG      + +    ++C+ +H+ LALE AR GIVLLKN    LPL K++  SLAVIGP
Sbjct  379   FNGNPSELPYGNLSRNNICTRKHQDLALEVARDGIVLLKNSANLLPLSKSKTESLAVIGP  438

Query  1248  MANTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRA  1072
              AN S +L G+Y G PC   + L GL  Y+ +  +  GC  + C S D  +EAV IA+ A
Sbjct  439   NANVSKTLLGNYAGRPCKTITPLQGLTNYVERIGFHKGCETINCTSIDS-SEAVRIAESA  497

Query  1071  DYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAK  892
             DYV++V+GL+  +E E+ DR  L+LPG Q  L+  +A  + +P++LVL  GGP+DISFAK
Sbjct  498   DYVVLVMGLNQDREREELDREDLVLPGKQQKLIKRVAKAAKRPVILVLLCGGPVDISFAK  557

Query  891   KDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPS  712
              + +I  +LW GYPGE GGKA++EI+FGD+NP GRLP+TWYP+ F +VPM DM MR DP 
Sbjct  558   NNRKIGGILWAGYPGEAGGKAIAEIIFGDHNPGGRLPITWYPKDFIEVPMTDMRMRPDPW  617

Query  711   RGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNE  532
              G+PGRTYRFY GEKV+EFG+GLSYS FS +       + +S+S     R S   R  N 
Sbjct  618   SGFPGRTYRFYQGEKVFEFGYGLSYSKFSYKF------VYVSRSKLDLKRLSTTER--NP  669

Query  531   PYVHVDEV--SNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDR  358
              YV V ++   +C    F   VS++N G M G   V+LF R   +   G+P KQL+GF  
Sbjct  670   EYVPVSDIITKSCEEAKFLAIVSVKNEGDMAGKHSVLLFVRHDEA-GNGSPVKQLVGFQT  728

Query  357   VHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLG  253
             V ++    T     I PCQH +  + +G+ ++  G
Sbjct  729   VRLNAKEKTNVEFEINPCQHFARASEDGTMVIESG  763



>ref|XP_010676938.1| PREDICTED: probable beta-D-xylosidase 7 [Beta vulgaris subsp. 
vulgaris]
Length=778

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/758 (50%), Positives = 507/758 (67%), Gaps = 30/758 (4%)
 Frame = -3

Query  2493  SKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             ++P   C    P    Y FC   LPI  R   L++ LT+DEK+ +L +   +IPRLGIPA
Sbjct  27    TEPPFACDSSNPNTKHYTFCRADLPIRKRAKDLIARLTLDEKVSQLVNTAPSIPRLGIPA  86

Query  2319  YEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMF  2140
             YEWWSE+LHG+A  GPG++  G +++AT FPQVILTAA+F+  LW  I  A   EAR ++
Sbjct  87    YEWWSEALHGVADAGPGVSLYGTIRAATSFPQVILTAASFDVRLWYRIGQAIGKEARGVY  146

Query  2139  NSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             N GQA G+TFWAPN+N+F DPRWGRGQETPGEDP++   YA+ +VR              
Sbjct  147   NEGQAKGMTFWAPNINIFRDPRWGRGQETPGEDPLMTGKYAMYFVR--------------  192

Query  1962  YSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
               L G+   +  +    L  SACCKH TAYDL+ WHN +RY F+A VT QD+ DTY+PPF
Sbjct  193   -GLQGDSF-QGGQKLSHLQASACCKHFTAYDLDRWHNITRYVFDAHVTAQDLADTYQPPF  250

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQ  1606
             +SC+ +GRAS +MCAYN VNG+P CA+ +LL K AR  W F+GYITSDCDAV+ I + Q 
Sbjct  251   ESCIHQGRASGIMCAYNRVNGVPNCADYNLLTKIARGKWAFDGYITSDCDAVSIIHDAQG  310

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             YAK+PE+A    LKAG D+NCG+Y+    KSA++ + V E+ +DRAL NLF+V+ RLGLF
Sbjct  311   YAKAPEDAIADVLKAGMDVNCGSYLQNYTKSAVQQRKVPEAQLDRALENLFAVRMRLGLF  370

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPM  1246
             +G     +F + GP  VC+ E R LAL+AA+ GIVLLKN  K LP  K +  SLAVIGP 
Sbjct  371   DGNPRKLQFGNIGPAQVCTRESRALALKAAQSGIVLLKNNNKLLPFPKEKTLSLAVIGPN  430

Query  1245  ANTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             A+T+ +L G+Y G PC   + L  L  Y+  T Y  GC  VAC+S     EAV+IAK AD
Sbjct  431   ADTALTLLGNYHGRPCTSITPLKALQSYVKNTRYHPGCNKVACSSAS-IQEAVAIAKGAD  489

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
             YV++++GLD +QE ED+DR  L+LPG Q  L+ ++A  + KP+VLV+  GGP+DI+FAK 
Sbjct  490   YVVLIMGLDQTQEREDYDRTDLVLPGKQHNLITQVARAAKKPVVLVILSGGPVDIAFAKV  549

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSR  709
             D  I S++W GYPGE GG AL++++FGD+NP G+LP+TWYP  F KVPM DM MRADPS 
Sbjct  550   DTHIGSIVWAGYPGEAGGVALAQVIFGDHNPGGKLPMTWYPRIFIKVPMTDMRMRADPSS  609

Query  708   GYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTR-ISLSQSIKTKLRRSILNRGGNE  532
             GYPGRTY+FY G KV+EFGHGLSY+++S + +S P + ++L+    TK+ +++     + 
Sbjct  610   GYPGRTYKFYRGRKVFEFGHGLSYTTYSYKFISVPQKSLNLNSVGSTKMAKNL----DSA  665

Query  531   PYVHVD--EVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDR  358
              YV V   E  +C ++ FS  V + N G M G+  V+++ R   +   G+P KQL+GF+ 
Sbjct  666   RYVIVSDMESESCKTMKFSATVGVENGGEMAGNHPVLMYVRQENT-TNGSPMKQLVGFES  724

Query  357   VHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             V++     TE    + PC+HLS  N +G  ++  G H 
Sbjct  725   VNLKAGEKTEIQFELSPCEHLSRANQDGLMVVEEGTHF  762



>gb|EYU39877.1| hypothetical protein MIMGU_mgv1a018879mg [Erythranthe guttata]
Length=757

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/742 (52%), Positives = 494/742 (67%), Gaps = 21/742 (3%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P   ++ FC T+LPI  R+H L++ LT+DEKI +L ++  AIPRLGI AYEWWSE+LHG+
Sbjct  32    PKTKTFGFCKTNLPIDERVHDLITRLTIDEKISQLVNSAPAIPRLGISAYEWWSEALHGV  91

Query  2286  ATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GLTFW  2110
             +  G G++F+G +K AT FPQVIL+A+ F+  LW  I  A   EARAM+N GQ  G+ FW
Sbjct  92    SGWGLGVSFNGTIKGATSFPQVILSASTFDSNLWYRIGQAIGKEARAMYNQGQVKGMAFW  151

Query  2109  APNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEE  1930
             APNVN+F DPRWGRG ETPGEDP+V   YAV +VRG+QG           + + +++  +
Sbjct  152   APNVNIFRDPRWGRGHETPGEDPLVAGKYAVAFVRGIQGD----------NYNNDKVEGQ  201

Query  1929  EEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASC  1750
             E ++  L  SACCKH TAYDL+ W   SR  F+A VT+QD+ DTY+PPFKSC+++GRAS 
Sbjct  202   ENNNGILQASACCKHFTAYDLDNWKGVSRLGFDAKVTKQDLADTYQPPFKSCIQEGRASG  261

Query  1749  LMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGI  1573
             +MCAYN VNG+P CA+ DLL K AR +WGF+GYI SDC+AVA I +  +YAK PE+A   
Sbjct  262   IMCAYNRVNGVPNCADYDLLTKTARGEWGFQGYIVSDCNAVAVIHDVHKYAKLPEDAVAD  321

Query  1572  ALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFES  1393
              LKAG D++CG+Y+    KSALE K ++ESDIDRAL NLFSVQ RLG FNG    + F  
Sbjct  322   VLKAGMDVDCGSYLSTYTKSALEQKKMLESDIDRALHNLFSVQMRLGFFNGNPNTQPFGK  381

Query  1392  FGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTS-SLGGDY  1216
              GP   C+ EH++LALEAA  GIVLLKN    LPL KT  SSLAVIGP AN +  L G+Y
Sbjct  382   IGPDQACTQEHQQLALEAAHNGIVLLKNSNNRLPLSKT--SSLAVIGPNANNAYVLLGNY  439

Query  1215  TGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLS  1036
              G PC    V   +  Y    SY  GC DV C   D  A AV  AK AD V++V+GL+ S
Sbjct  440   EGRPCKSVEVFRAIQSYAPNASYEGGCKDVNCAVAD-VASAVRTAKDADDVVLVMGLNYS  498

Query  1035  QETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIG  856
              ETEDHDR  L+LPG Q  L+  +A  S KP+VLVL  GGP+D+SFAK DP+I S+LW G
Sbjct  499   LETEDHDRVDLVLPGQQEELIKAVAAASKKPVVLVLICGGPVDVSFAKDDPKIGSILWAG  558

Query  855   YPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFYT  676
             YPGE GG AL++I++G +NP G+LP+TWYP+ F KVPM DM MR DPS GYPGRTYRFY 
Sbjct  559   YPGEAGGIALADILYGQHNPGGKLPVTWYPKDFIKVPMTDMRMRPDPSSGYPGRTYRFYN  618

Query  675   GEKVYEFGHGlsyssfslell-SAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEVSNC  499
             G KV+EFG+GLSY++ S E + S P  + L+Q   T    S      N   V     +NC
Sbjct  619   GPKVFEFGYGLSYTTHSYEFIPSTPNTLHLNQLTPT----SQTTNETNSLSVSKIGANNC  674

Query  498   NSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSI  319
               L FS  V ++N G M G   V+LF R   +   G P KQL+GF+ V ++         
Sbjct  675   EKLKFSTHVGVKNTGNMIGKHPVLLFVRHERNSNTGRPLKQLVGFESVSLNAGESGVIEF  734

Query  318   SIEPCQHLSIVNVEGSRILPLG  253
              ++PC+HLS VN +G  ++  G
Sbjct  735   VLDPCEHLSTVNEDGDMVIDRG  756



>gb|KDP20227.1| hypothetical protein JCGZ_09859 [Jatropha curcas]
Length=773

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/761 (51%), Positives = 499/761 (66%), Gaps = 36/761 (5%)
 Frame = -3

Query  2493  SKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             ++P   C P  P+  SY FC T+LPI  R+  LVS LT+DEKI +L  +  AIPRLGIPA
Sbjct  24    TQPPFSCDPSNPSTGSYLFCKTTLPISQRVRDLVSRLTLDEKISQLVSSAPAIPRLGIPA  83

Query  2319  YEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMF  2140
             YEWWSE+LHG+A  G GI F G+++SAT FPQVILTAA+F+   W  I      EARA++
Sbjct  84    YEWWSEALHGVANVGRGIHFQGSIQSATSFPQVILTAASFDAYQWYRIGQVIGREARAVY  143

Query  2139  NSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             N+GQA G+TFWAPN+N+F DPRWGRGQETPGEDP+V   YAV YVRG+QG          
Sbjct  144   NAGQATGMTFWAPNINIFRDPRWGRGQETPGEDPLVTGKYAVSYVRGIQGD---------  194

Query  1962  YSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
              S  G ++      +  L  SACCKH TAYDL+ W   +R+ F+A VT QD+ DTY+PPF
Sbjct  195   -SFQGGKL------EGHLQASACCKHFTAYDLDNWKGVNRFVFDARVTMQDLADTYQPPF  247

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQ  1606
             +SCV++G+AS +MCAYN VNG+P+CA+ +LL K AR  WGF GYITSDCDAV+ I+  Q 
Sbjct  248   QSCVQQGKASGIMCAYNRVNGVPSCADYNLLSKTARGQWGFHGYITSDCDAVSIIYNNQG  307

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             YAKSPE+A    LKAG D+NCG+Y+ ++ K+A++ K + ES IDRAL NLFSV+ RLGLF
Sbjct  308   YAKSPEDAVVDVLKAGMDVNCGSYLQKHTKAAVQQKKLPESAIDRALHNLFSVRMRLGLF  367

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPM  1246
             NG  + + F + GP  VCS EH+ LALEAAR GIVLLKN  + LPL K++  SLAVIGP 
Sbjct  368   NGNPMEQPFSNIGPDQVCSQEHQMLALEAARNGIVLLKNSARLLPLSKSKTISLAVIGPN  427

Query  1245  ANTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             A+++ +L G+Y G PC   + L  L  YI  T Y  GC  V C S     +AV+++K  D
Sbjct  428   ADSAQTLLGNYAGPPCKSVTPLQALQYYIKNTIYDPGCDTVQCTSAS-IDKAVNVSKGVD  486

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
             +V++++GLD +QE E+ DR  L+LPG Q  L+  +A  +  P++LVL  GGP+D+SFAK 
Sbjct  487   HVVLIMGLDQTQEREELDRTDLVLPGKQQELITNVAKSAKNPIILVLLSGGPIDVSFAKY  546

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSR  709
             D  I S+LW GYPGE GG AL+EI+FGD+NP GRLP+TWYP+ F KVPM DM MR D S 
Sbjct  547   DKNIGSILWAGYPGEAGGTALAEIIFGDHNPGGRLPMTWYPQEFVKVPMTDMRMRPDSSS  606

Query  708   GYPGRTYRFYTGEKVYEFGHGls-yssfslellSAPTRISLSQSIKTKLRRSILNRGGNE  532
             GYPGRTYRFY G  V+ FG+GLS      +    +  ++ L+QS       S +   G+ 
Sbjct  607   GYPGRTYRFYKGRNVFNFGYGLSYSKYSYVLKSVSQNKLYLNQS-------STMRIIGDS  659

Query  531   PYVHVDEVSN-----CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIG  367
               V    VS+     C    F VRV + N G M G   ++LF R    +  G P+KQLIG
Sbjct  660   DSVRTAVVSDMRTEFCEQSKFLVRVGVENQGEMAGKHPILLFVRH-AKHGNGRPRKQLIG  718

Query  366   FDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             F  V +S     E    + PC+H S  N +G  ++  G H 
Sbjct  719   FKSVILSAGEKAEIEFELSPCEHFSRANEDGLMVIEEGRHF  759



>emb|CDP01027.1| unnamed protein product [Coffea canephora]
Length=1426

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/746 (53%), Positives = 496/746 (66%), Gaps = 29/746 (4%)
 Frame = -3

Query  2454  SYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGIATNG  2275
             S+ FC T+LPIPAR   LVS LT+DEKI +L +   AIPRLGIPAY+WWSE+LHG+A  G
Sbjct  690   SFSFCKTTLPIPARARDLVSRLTIDEKISQLVNTAPAIPRLGIPAYQWWSEALHGVANAG  749

Query  2274  PGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GLTFWAPNV  2098
             PGITF+G +++AT FPQVILTAA+F+  LW SI      EARA++N GQA G+TFWAPN+
Sbjct  750   PGITFNGNIRAATSFPQVILTAASFDVHLWYSIGQVVGKEARAVYNEGQATGMTFWAPNI  809

Query  2097  NVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEEEDD  1918
             N+F DPRWGRGQETPGEDPMV   YAV YVR                + G+       + 
Sbjct  810   NIFRDPRWGRGQETPGEDPMVTGKYAVSYVR---------------GVQGDSFQGGMLNH  854

Query  1917  DRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCLMCA  1738
               L  SACCKH TAYDL+ W   +R+SF+A VT QD+ DT++PPF+SC++ G+AS +MCA
Sbjct  855   GELQASACCKHFTAYDLDNWKGITRFSFDARVTEQDLADTFQPPFRSCIQDGQASGIMCA  914

Query  1737  YNAVNGIPACANKDLL-EKARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIALKA  1561
             YN VNG+P CAN DLL + AR  WGF GYITSDCDAV+ I+E  +YA +PE+A    LKA
Sbjct  915   YNRVNGVPPCANHDLLTQTARKQWGFHGYITSDCDAVSIIYEQHKYAGTPEDAVADVLKA  974

Query  1560  GTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESFGPK  1381
             G D+NCG Y+L   KSA   K V ESDIDRAL NLFSV+ RLGLFNG      + S GP 
Sbjct  975   GMDVNCGYYLLNYTKSAFLQKKVSESDIDRALHNLFSVRMRLGLFNGDPKKLLYGSIGPD  1034

Query  1380  DVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTS-SLGGDYTGIP  1204
              VC+ EH+ LALEAAR GIVLLKN  K LPL K +++SLAVIGP AN +  + G+Y G P
Sbjct  1035  QVCTKEHQELALEAARNGIVLLKNSAKLLPLSK-KITSLAVIGPNANNAFVMLGNYQGPP  1093

Query  1203  CALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQETE  1024
             C   +V   L +Y+    Y  GC  V C S     +AV+ AK ADYV++V+GLD  +ETE
Sbjct  1094  CISVAVYKALQDYVPNAVYHEGCNAVNCTSA-AIDDAVNAAKGADYVVLVMGLDQGEETE  1152

Query  1023  DHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGYPGE  844
               DR SL LPG Q +L+  +A  +NKP++LVL  GGP+D+SFAK +P+I S+LW GYPG+
Sbjct  1153  QLDRESLTLPGQQESLITAVANAANKPVILVLLCGGPVDVSFAKDNPKIGSILWAGYPGQ  1212

Query  843   EGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFYTGEKV  664
              GG ALSEI+FGD+NP GRLPLTWYP+ F  +PM DM MR DPS GYPGRTYRFY G+KV
Sbjct  1213  AGGIALSEILFGDHNPGGRLPLTWYPKEFVNIPMTDMRMRPDPSSGYPGRTYRFYNGKKV  1272

Query  663   YEFGHGlsyssfsle-llSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEVSNCNSLA  487
             +EFG+GLSYS++S   +  A + + L+Q   T    +  +       V      +C    
Sbjct  1273  FEFGYGLSYSTYSYNFVKVAQSTLYLNQLSATAQVTATSSNAARHLAVSEMNTDSCEKAK  1332

Query  486   FSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSISIEP  307
             FS  V + N+G + G   V+LF R   +   G P KQLIGF RV +      E   ++ P
Sbjct  1333  FSTVVGVENSGDLAGKHPVLLFVRQAKA-TNGNPIKQLIGFQRVSLDAGAKAEIEFTLSP  1391

Query  306   CQHLS-------IVNVEGSRILPLGD  250
             C+HLS       +V  EGSR L +GD
Sbjct  1392  CEHLSGANEDGLMVIEEGSRYLVVGD  1417


 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/730 (48%), Positives = 459/730 (63%), Gaps = 76/730 (10%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P   S+PFC+T+L +  R+  LVS LT+DEKI +L D+  AIPRL I A+EWWSE+LHGI
Sbjct  34    PLAQSFPFCNTTLALDHRVQDLVSRLTLDEKISQLVDSAPAIPRLNISAFEWWSEALHGI  93

Query  2286  ATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GLTFW  2110
             + +G GI F+G + +AT FPQVILTAA+F+  LW +I+ A   EARA +N GQA G+TFW
Sbjct  94    SESGKGILFNGTLTAATVFPQVILTAASFDACLWYNISQAIGKEARAFYNEGQALGVTFW  153

Query  2109  APNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEE  1930
             APN+N+F DPRWGRGQETPGEDP V   YAV YVR                + G+     
Sbjct  154   APNINIFRDPRWGRGQETPGEDPSVAESYAVSYVR---------------GIQGDSFDGG  198

Query  1929  EEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQ---DMEDTYEPPFKSCVEKGR  1759
             +  D  L +SACCKH TAYDL+ W   +R+ FNA  + Q   D+ DTYEPPF+SC+++G+
Sbjct  199   QLKDGHLQVSACCKHFTAYDLDNWDGVTRFVFNANASNQTISDLADTYEPPFESCIQQGQ  258

Query  1758  ASCLMCAYNAVNGIPACANKDLL-EKARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEA  1582
             A+ LMCAYN +NG+P CA+ +LL E  R +WGF+GYI SDCDAVA I + Q YAK PE+A
Sbjct  259   ATGLMCAYNLLNGVPNCADYNLLTETVRGEWGFKGYIASDCDAVAVIHDDQGYAKLPEDA  318

Query  1581  AGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRK  1402
                 LKAG D++CG++++     A++ K + ESD+DRAL NLFS++ RLGLFNG     +
Sbjct  319   VADVLKAGMDVDCGSFLMNYTGRAVQQKKLSESDLDRALHNLFSIRMRLGLFNGDPTRLE  378

Query  1401  FESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTS-SLG  1225
             + + GP+ VCS EH+ LALEAAR GIVLLKN    LPL K    SLAVIGP ANTS +  
Sbjct  379   YGNIGPEQVCSQEHQDLALEAARDGIVLLKNSYNLLPLPKAETVSLAVIGPNANTSETFA  438

Query  1224  GDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGL  1045
             G+Y G+PC   ++   LG Y     Y  GC+ V C S+   AEA+ +A+ ADYV++V+GL
Sbjct  439   GNYHGLPCKNITIFQALGSYTKNAVYLQGCVGVNCTSS-ATAEALGVAQEADYVVLVMGL  497

Query  1044  DLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVL  865
             D SQE E+ DR  L+LPG Q  L+                     +I+   K+P I  +L
Sbjct  498   DQSQEREELDRTELVLPGQQETLIK--------------------NITLHAKNPVILVLL  537

Query  864   WIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYR  685
               GYPGE GG AL++I+FGD+NP  RLP+TWYPE F KVPM DM MR++PS GYPGRTYR
Sbjct  538   SGGYPGEAGGIALAQIIFGDHNPGDRLPVTWYPEDFIKVPMTDMRMRSEPSTGYPGRTYR  597

Query  684   FYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHV--DE  511
             FYTG KVYEFG+G                  LS S  T+             +VHV  D+
Sbjct  598   FYTGPKVYEFGYG------------------LSYSNYTR------------EFVHVTPDK  627

Query  510   VSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVT  331
             +   N+  FS ++++ N G + G   V+LF +   +   G+PQKQLI F     S + + 
Sbjct  628   IY-INNKKFSTKIAVENRGNLPGKHPVLLFVKQ-ANLTIGSPQKQLIAFRSPPFSCDKLN  685

Query  330   ETSISIEPCQ  301
               S S   C+
Sbjct  686   SQSDSFSFCK  695



>gb|EYU33325.1| hypothetical protein MIMGU_mgv1a001753mg [Erythranthe guttata]
Length=764

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/756 (51%), Positives = 505/756 (67%), Gaps = 44/756 (6%)
 Frame = -3

Query  2487  PQLPCQP---PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAY  2317
             P   C+    P+  SYPFC+  LPI  R H L++ LT+DEKI +L +  SAIPRLGIP Y
Sbjct  25    PPFSCESSTNPSTKSYPFCNVGLPIGKRAHDLIARLTLDEKISQLVNKASAIPRLGIPYY  84

Query  2316  EWWSESLHGIATN---GPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearA  2146
             +WWSE+LHG+A       G++F G +++AT FPQVILTAA F+  LW  +A     EARA
Sbjct  85    QWWSEALHGVAVAFGVENGVSFKGNIRAATSFPQVILTAATFDANLWYRVAKVIGTEARA  144

Query  2145  MFNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkng  1969
             ++N G+A G+TFW+PN+N+F DPRWGRGQETPGEDP + S YAV +VR            
Sbjct  145   IYNEGEAIGMTFWSPNINIFRDPRWGRGQETPGEDPFLTSKYAVSFVR------------  192

Query  1968  RKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEP  1789
                 + G+     +  D RL +SACCKHLTAYDL+ W    R++F+A VT+QDM DTY+P
Sbjct  193   ---GIQGDSFEGGDLKDGRLQVSACCKHLTAYDLDHWKEVDRFTFDAHVTKQDMADTYQP  249

Query  1788  PFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEY  1612
             PFKSCVE+GRAS +MCAYN VNG+P CA+ DLL K AR +WGF+GYITSDCDAV+ ++E 
Sbjct  250   PFKSCVEQGRASGIMCAYNLVNGVPNCADYDLLTKTARGEWGFQGYITSDCDAVSLLYEK  309

Query  1611  QQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLG  1432
             Q+Y+KS E+A    LKAG D+NCG Y+  + KSA+E   V ESDIDRAL NLFSV+ RLG
Sbjct  310   QKYSKSHEDAVADVLKAGMDVNCGDYLANHTKSAVEKGKVSESDIDRALYNLFSVRMRLG  369

Query  1431  LFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIG  1252
             LFNG      +      D+C+ EH+ LALE AR GIVLLKN    LPL K++  SLAVIG
Sbjct  370   LFNGNPSQLLYGDLSRNDICTPEHQDLALEVARDGIVLLKNSANLLPLSKSQTKSLAVIG  429

Query  1251  PMANTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKR  1075
             P AN S +L G+Y G PC   + L GL +YI K  +  GC ++ C + +  ++AV +AK 
Sbjct  430   PNANVSKTLVGNYAGPPCKTITPLQGLTDYIEKIKFHEGCENINC-TINAKSKAVKLAKS  488

Query  1074  ADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFA  895
             AD+V++V+GL+  +E+ED DR  L+LPG Q + +  ++  + KP+VLVL  GGP+DISFA
Sbjct  489   ADHVVLVMGLNQEEESEDRDREELVLPGEQQSFIMSVSEAAKKPVVLVLLCGGPVDISFA  548

Query  894   KKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADP  715
             K +P+I S+LW GYPGE GGKA++EI+FGD+NP GRLPLTWYP+ F K+PM DM MR DP
Sbjct  549   KNNPKIGSILWAGYPGEAGGKAIAEIIFGDHNPGGRLPLTWYPKDFIKIPMTDMRMRPDP  608

Query  714   SRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGN  535
             S GYPGRTYRFY GEKVYEFG+GLSYS++S +       +S+ QS K   +         
Sbjct  609   SSGYPGRTYRFYQGEKVYEFGYGLSYSNYSYKF------VSVGQS-KLDFKN--------  653

Query  534   EPYVHVDEVS--NCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFD  361
               Y+ V ++S  +C +  FS  VS+ N G M G   V++F R   +     P KQL+GF 
Sbjct  654   --YILVSDISSKSCENAKFSAIVSVENEGSMAGKHSVLIFVRHDEAGNRSRPMKQLVGFQ  711

Query  360   RVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLG  253
              V ++    T     I PCQH +  + +G+ I+  G
Sbjct  712   IVRLNAKEKTNVEFEINPCQHFTRASEDGTMIIESG  747



>ref|XP_010269208.1| PREDICTED: probable beta-D-xylosidase 7 [Nelumbo nucifera]
Length=823

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/764 (51%), Positives = 510/764 (67%), Gaps = 35/764 (5%)
 Frame = -3

Query  2493  SKPQLPC--QPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             ++P   C  + P  +SY FC+ SLPIP R+  LVS LT+DEKI +L +N  AIPRLGIP+
Sbjct  67    TQPPFACDSKNPATASYTFCNPSLPIPQRVKDLVSRLTLDEKISQLVNNAPAIPRLGIPS  126

Query  2319  YEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMF  2140
             YEWWSE+LHG+ + G GI  +G +K AT FPQVIL+AA+F+  LW  IA A  VEARA++
Sbjct  127   YEWWSEALHGVTSAGRGIQLNGIIKGATSFPQVILSAASFDAHLWYRIAKAIGVEARAIY  186

Query  2139  NSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             N+GQA GLTFWAPN+N+F DPRWGRGQETPGEDP+V S YA+ YVR              
Sbjct  187   NAGQASGLTFWAPNINIFRDPRWGRGQETPGEDPLVTSAYAISYVR--------------  232

Query  1962  YSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
               L G+   E  +    L  SACCKH TAYDL+ W+  +RY F+A V+ QD+ DTY+PPF
Sbjct  233   -GLQGDSY-EGGKLGVHLQASACCKHFTAYDLDNWNGTTRYGFDARVSLQDLADTYQPPF  290

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQ  1606
              SC+ +GRAS +MCAYN VNGIP+CA+ +LL K AR  WGF GYITSDCDAV+ I +   
Sbjct  291   HSCINQGRASGIMCAYNRVNGIPSCADYNLLSKTARGQWGFNGYITSDCDAVSIIRDTHH  350

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             YA++PE+A G  L+AG D+NCG+Y+ +  KSA++ K V ESDIDRAL  LFSV+ RLGLF
Sbjct  351   YARTPEDAVGDVLRAGMDVNCGSYLQKYTKSAVQQKKVSESDIDRALHELFSVRMRLGLF  410

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRV----SSLAV  1258
             NG  V + F +  PK+VCS EH  LA+EAA   IVLLKN  K LP+   R      S+AV
Sbjct  411   NGNPVQQPFGNISPKNVCSEEHGNLAIEAAANSIVLLKNSDKLLPIPVPRSLANSISVAV  470

Query  1257  IGPMANT-SSLGGDYTGIPC--ALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVS  1087
             IGP AN   +L G+Y G PC  +  S+L G+  YI    Y +GC  VAC+S     EAV+
Sbjct  471   IGPNANVEQTLLGNYAGPPCYSSAPSILHGILGYIPDAKYHAGCDSVACSSAS-INEAVA  529

Query  1086  IAKRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLD  907
             +A+  DYVI+V+GLD +QE E+ DR SLLLPG Q AL+  ++  + KP+VLV+  GGP+D
Sbjct  530   LARTVDYVILVMGLDQTQEKEEKDRDSLLLPGKQNALITSVSRAAKKPVVLVILSGGPVD  589

Query  906   ISFAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNM  727
             ISFAK D +I S+LW GYPG+ GG A++ I+FGD NP GRLP+TWYP+ FTKVPM DM M
Sbjct  590   ISFAKYDKKIGSILWAGYPGQAGGTAVAGIIFGDQNPGGRLPVTWYPQEFTKVPMTDMRM  649

Query  726   RADPSRGYPGRTYRFYTGEKVYEFGHGlsyss-fslellSAPTRISLSQSIKTKLRRSIL  550
             R D + GYPGRTYRFY G+ V+EFGHGLSYS+        +  ++ L +++ T    ++ 
Sbjct  650   RPDLASGYPGRTYRFYKGKTVFEFGHGLSYSNFSYAFSSVSQKQLYLKENVTT---YAVK  706

Query  549   NRGGNEPYVHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQ  376
                 +  Y+ V E+    C+ + FSV V + N G M G   V+LF R    +  G+P KQ
Sbjct  707   EDSNSMRYISVTEMGEERCDRMKFSVVVEVTNYGEMAGKHSVLLFKRQ-VKHQHGSPMKQ  765

Query  375   LIGFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             L+GF  +H++     +    ++PC+HLS V  +G  ++  G H 
Sbjct  766   LVGFQSLHLNVGERAKIEFVLKPCEHLSKVREDGLSVIEEGSHF  809



>emb|CDP01028.1| unnamed protein product [Coffea canephora]
Length=781

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/760 (50%), Positives = 506/760 (67%), Gaps = 32/760 (4%)
 Frame = -3

Query  2499  SYSKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGI  2326
             S   P   C    P   SYPFC+T+L I  R+  LVS LT+DEKI++L ++  AIP L I
Sbjct  27    STQAPLFSCDSSNPLTKSYPFCNTTLAINERVEDLVSRLTLDEKIEQLVNSAPAIPSLNI  86

Query  2325  PAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearA  2146
              AY+WWSE LHGI+ +G GI F+G + +AT FPQVIL AA+F+  LW  +  A   EARA
Sbjct  87    SAYQWWSEGLHGISRHGKGIKFNGTIAAATMFPQVILAAASFDTHLWYRMGQAIGREARA  146

Query  2145  MFNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkng  1969
              +N GQ  G+T+WAPN+N+F DPRWGRGQETPGEDP++ S+YAV YVR            
Sbjct  147   FYNEGQGTGMTYWAPNINIFRDPRWGRGQETPGEDPLLASNYAVSYVR------------  194

Query  1968  RKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEP  1789
                 + G+     +  D  L  SACCKH TAYDL+ W+  +RY F+A VT QD+ DTY+P
Sbjct  195   ---GIQGDSFEGGQLKDGHLQASACCKHFTAYDLDNWNGVNRYIFDAKVTEQDLADTYQP  251

Query  1788  PFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEY  1612
             PFKSC+EKG+AS +MCAYN +NG+P CA+  LL K  R  WGF+GYI SDCDAVA + + 
Sbjct  252   PFKSCIEKGQASGVMCAYNRINGVPNCADYSLLTKTVREQWGFQGYIASDCDAVAVMHDN  311

Query  1611  QQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLG  1432
             Q YAK PE+A    LKAG D++CG+Y+L+  KSA+E K + ES+IDRAL NLFS++ RLG
Sbjct  312   QGYAKLPEDAVADVLKAGMDVDCGSYLLKYSKSAIEQKKLPESEIDRALRNLFSIRMRLG  371

Query  1431  LFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIG  1252
             LF+G   + KF + GP+ VC+ EH+ LALE AR GIVLLKN    LPL K +  SLA+IG
Sbjct  372   LFDGSPRSLKFGNIGPEQVCTQEHQDLALEIARDGIVLLKNSNSLLPLPKDKTISLAIIG  431

Query  1251  PMANTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKR  1075
             P ANTS +L G+Y G+PC   ++   +  Y+    Y  GC  V C S     EA+  AK 
Sbjct  432   PNANTSQTLLGNYEGLPCKNITIFQAIQSYLQSAVYHQGCDAVNCTSV-ALNEALDAAKD  490

Query  1074  ADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFA  895
             ADYVI+V+GLD +QE E +DR  L+LPG Q +LV  +A  + KP++LV+  GGP+DISFA
Sbjct  491   ADYVILVMGLDQTQEREKYDRMELMLPGKQESLVKSIALAAKKPIILVVLCGGPVDISFA  550

Query  894   KKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADP  715
             K DP+I S+LW GYPGE GG A++EI+FGD+NP GRLP+TWYP+ F +VPM DM MR++P
Sbjct  551   KDDPKIGSILWAGYPGEAGGTAVAEIIFGDHNP-GRLPVTWYPKDFVQVPMTDMRMRSEP  609

Query  714   SRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAP-TRISLSQSIKTKLRRSILNRGG  538
             + GYPGRTY+FY G KV+EFG+GL YS+FS E +     ++ L+Q +  K     L   G
Sbjct  610   ASGYPGRTYKFYNGVKVFEFGYGLGYSNFSYEFVHVTFKKLYLNQLLPAK----ALKFTG  665

Query  537   NEPYVHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSR-APTSYAGGAPQKQLIG  367
                Y+ + E++N  C+S  FS +V+++N G M     V+LF R A   Y  G+PQKQLIG
Sbjct  666   PHRYLSISELNNEHCDSTEFSAKVAVKNLGEMTSKHPVLLFVRQAKLGY--GSPQKQLIG  723

Query  366   FDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             F  + +      E    ++PC+HLS  N +G  ++  G +
Sbjct  724   FQSITLGAGERAEVDFVLKPCEHLSKANRDGFMVIEEGSY  763



>ref|XP_011074159.1| PREDICTED: probable beta-D-xylosidase 7 [Sesamum indicum]
Length=792

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/762 (51%), Positives = 506/762 (66%), Gaps = 34/762 (4%)
 Frame = -3

Query  2505  ATSYSKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRL  2332
             A S   P   C P  P+  S PFC+T LPI +R   LVS LT+DEK+Q+L +   A+PRL
Sbjct  37    AESDHSPPFSCDPSNPSTKSLPFCNTQLPISSRAKDLVSRLTLDEKVQQLVNTADAVPRL  96

Query  2331  GIPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavea  2152
              I AYEWWSE+LHG++ +G G+TF+G V +AT FPQVIL AA+F+  LW  IA A   EA
Sbjct  97    NISAYEWWSEALHGVSRHGKGVTFNGTVTAATMFPQVILAAASFDSQLWYRIAQAIGDEA  156

Query  2151  rAMFNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgk  1975
             RA+FN GQA G+TFWAPN+N+F DPRWGRGQETPGEDP V  +YAV YVR          
Sbjct  157   RAVFNVGQAKGMTFWAPNINIFRDPRWGRGQETPGEDPFVAGEYAVAYVR----------  206

Query  1974  ngRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTY  1795
                   + G+     +  D  L  SACCKH TA+DL+ W+  +RY F+A+V++QD+ DTY
Sbjct  207   -----GIQGDSFGGGQLRDGHLKASACCKHYTAHDLDNWNGVTRYVFDAIVSKQDLADTY  261

Query  1794  EPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIF  1618
             +PPF++CVE+G+AS +MCAYN VNG+P+CA+ DLL K AR  WGF+GYI SDCDAVA I 
Sbjct  262   QPPFRACVEQGQASGIMCAYNRVNGVPSCADYDLLTKTARQQWGFQGYIASDCDAVAIIH  321

Query  1617  EYQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFR  1438
             + Q YAK PE+A    LKAG D+NCG Y+ +   SA+  K V E DIDRAL NLFSV+ R
Sbjct  322   DQQGYAKEPEDAVADVLKAGMDVNCGGYLKKYTTSAVAKKKVSELDIDRALENLFSVRMR  381

Query  1437  LGLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAV  1258
             LGLFNG   N ++    P  VCS  H  LALEAA+ GIVLLKN+   LP  +    SLAV
Sbjct  382   LGLFNGDPRNLQYGDIDPSQVCSQNHLDLALEAAKFGIVLLKNDVGLLPFSRAGTKSLAV  441

Query  1257  IGPMANTSSLG-GDYTGIPCALKSVLDGLGEY-IHKTSYASGCLDVACNSTDGFAEAVSI  1084
             IGP AN S +  G+Y G+PC   ++L+ L +Y +  T Y  GC  V C S     EAV  
Sbjct  442   IGPNANDSGVFLGNYEGLPCKKITILEALEQYYVSSTKYHQGCDFVNCTSA-FIDEAVET  500

Query  1083  AKRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDI  904
             AK+AD V++V+GLD + E E HDR  L LPG Q +LV  +A  + +P+VLVL  GGP+D+
Sbjct  501   AKQADDVVLVMGLDQTLEREKHDRVELGLPGKQESLVISVAEAAKRPVVLVLLCGGPVDV  560

Query  903   SFAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMR  724
             SFAK++P++ S+LW GYPGE GG A+++ +FGD+NP GRLP+TWYP+ F KVPM DM MR
Sbjct  561   SFAKENPKVGSILWAGYPGEAGGVAVAQTLFGDHNPGGRLPVTWYPKDFVKVPMTDMRMR  620

Query  723   ADPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQS---IKTKLRRSI  553
             ADPS GYPGRTYRFY G KVYEFGHGLSY+++S +       +S+SQ+   +   L  + 
Sbjct  621   ADPSTGYPGRTYRFYNGPKVYEFGHGLSYTNYSYKF------VSVSQNTLFLNNSLHENT  674

Query  552   LNRGGNEPYVHVDEV--SNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQK  379
             + + G+ P+V V E+   +CN + FS +V ++N G M G   V+LF R   +  G A  K
Sbjct  675   VRQSGSVPFVPVAELGTQSCNRMMFSTKVRVKNPGEMPGKHPVLLFVRIENAGRGKA-MK  733

Query  378   QLIGFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLG  253
             QL+GF  V +S     E +  + PC+ LS  + +G  ++  G
Sbjct  734   QLVGFRSVSLSPGETKEIAFVVNPCRDLSYADEDGVMLIAEG  775



>gb|EYU33327.1| hypothetical protein MIMGU_mgv1a001678mg [Erythranthe guttata]
Length=774

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/743 (52%), Positives = 494/743 (66%), Gaps = 22/743 (3%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P   ++ FC  +LPI  R+H L++ LT+DEKI +L ++  AIPRLGI AYEWWSE+LHG+
Sbjct  32    PKTQTFGFCKANLPIDERVHDLITRLTIDEKISQLVNSAPAIPRLGISAYEWWSEALHGV  91

Query  2286  ATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GLTFW  2110
             +  G G++F+G +K AT FPQVIL+A+ F+  LW  I  A   EARAM+N GQ  G+ FW
Sbjct  92    SGYGLGVSFNGTIKGATSFPQVILSASTFDSNLWYRIGQAIGKEARAMYNQGQVKGMAFW  151

Query  2109  APNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEE  1930
             APNVN+F DPRWGRG ETPGEDP+V   YAV +VRG+QG           + + +++  +
Sbjct  152   APNVNIFRDPRWGRGHETPGEDPLVAGKYAVAFVRGIQGD----------NYNNDKVEGQ  201

Query  1929  EEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASC  1750
             E ++  L  SACCKH TAYDL+ W   SR  F+A VT+QD+ DTY+PPFKSC+++GRAS 
Sbjct  202   ENNNGILQASACCKHFTAYDLDNWKGVSRLGFDAKVTKQDLADTYQPPFKSCIQEGRASG  261

Query  1749  LMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGI  1573
             +MCAYN VNG+P CA+ DLL K AR +WGF+GYI SDC+AVA I +  +YAK PE+A   
Sbjct  262   IMCAYNRVNGVPNCADYDLLTKTARGEWGFQGYIVSDCNAVAVIHDVHKYAKLPEDAVAD  321

Query  1572  ALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFES  1393
              LKAG D++CG+Y+    KSALE K ++ESDIDRAL NLFSVQ RLG FNG    + F  
Sbjct  322   VLKAGMDVDCGSYLSTYTKSALEQKKMLESDIDRALHNLFSVQMRLGFFNGNPNTQPFGK  381

Query  1392  FGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTS-SLGGDY  1216
              GP   C+ EH++LALEAA  GIVLLKN    LPL KT  SSLAVIGP AN +  L G+Y
Sbjct  382   IGPDQACTQEHQQLALEAAHNGIVLLKNSNNRLPLSKT--SSLAVIGPNANNAYVLLGNY  439

Query  1215  TGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLS  1036
              G PC    V   +  Y    SY  GC DV C   D  A AV  AK AD V++V+GL+ S
Sbjct  440   EGRPCKSVEVFRAIQSYAPNASYEGGCKDVNCAVAD-VASAVRTAKDADDVVLVMGLNYS  498

Query  1035  QETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIG  856
              ETEDHDR  L+LPG Q  L+  +A  S KP+VLVL  GGP+D+SFAK DP+I S+LW G
Sbjct  499   LETEDHDRVDLVLPGQQEGLIRAVAAASKKPVVLVLICGGPVDVSFAKDDPKIGSILWAG  558

Query  855   YPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFYT  676
             YPGE GG AL++I++G +NP G+LP+TWYP+ F KVPM DM MR DPS GYPGRTYRFY 
Sbjct  559   YPGEAGGIALADILYGQHNPGGKLPVTWYPKDFIKVPMTDMRMRPDPSSGYPGRTYRFYN  618

Query  675   GEKVYEFGHGlsyssfslellSA-PTRISLSQSIKTKLRRSILNRGGNEPYVHVDEVSNC  499
             G KV+EFG+GLSY++ S E +S+ P  + L+Q   T    S      N   V     +NC
Sbjct  619   GPKVFEFGYGLSYTTHSYEFISSTPNTLHLNQLTPT----SQTTNETNSLSVSKIGANNC  674

Query  498   NSLAFSVRVSLRNNGGMDGSRVVMLFSRAP-TSYAGGAPQKQLIGFDRVHVSGNGVTETS  322
               L FS  V ++N G M G   V++F R    S   G P KQL+GF+ V ++     E  
Sbjct  675   EKLKFSTHVGVKNTGNMPGKHPVLIFVRHERNSNITGRPLKQLVGFESVSLNAGESGEIE  734

Query  321   ISIEPCQHLSIVNVEGSRILPLG  253
               ++PC+HLS  N +G  ++  G
Sbjct  735   FVLDPCEHLSTANEDGDMVIEEG  757



>ref|XP_011016184.1| PREDICTED: probable beta-D-xylosidase 7 [Populus euphratica]
Length=805

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/752 (51%), Positives = 493/752 (66%), Gaps = 38/752 (5%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P+  ++PFC+T+LPI  R   LVS LT+DEKI +L ++   IPRLGIP YEWWSE+LHG+
Sbjct  67    PSTEAFPFCETTLPISQRARDLVSRLTLDEKISQLVNSAPPIPRLGIPGYEWWSEALHGV  126

Query  2286  ATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GLTFW  2110
             +  GPGI F+  +K AT FPQVILTAA+F+   W  I  A   EARA++N+GQA G+TFW
Sbjct  127   SNAGPGIHFNDNIKGATSFPQVILTAASFDAYQWYRIGQAIGKEARALYNAGQATGMTFW  186

Query  2109  APNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEE  1930
             APN+N+F DPRWGRGQETPGEDP+V   YA  YV+G+QG           S  G ++   
Sbjct  187   APNINIFRDPRWGRGQETPGEDPLVTGRYAASYVKGVQGD----------SFEGGKI---  233

Query  1929  EEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASC  1750
                   L  SACCKH TAYDL+ W   +R+ F+A VT QD+ DTY+PPFKSCVE+GRAS 
Sbjct  234   ---KGHLQASACCKHFTAYDLDNWKGMNRFVFDARVTMQDLADTYQPPFKSCVEEGRASG  290

Query  1749  LMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGI  1573
             +MCAYN VNG+P+CA+ +LL K AR  WGF GYITSDCDAV+ I + Q YAKSPE+A   
Sbjct  291   IMCAYNKVNGVPSCADSNLLSKTARAQWGFRGYITSDCDAVSIIHDDQGYAKSPEDAVVD  350

Query  1572  ALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFES  1393
              LKAG D+NCG+Y+L++ K A+E K + ESDID+AL NLFSV+ RLGLFNG+   + F +
Sbjct  351   VLKAGMDVNCGSYLLKHAKVAVEQKKLSESDIDKALHNLFSVRMRLGLFNGRPEGQLFGN  410

Query  1392  FGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTSS-LGGDY  1216
              GP  VCS EH+ LALEAAR GIVLLKN  + LPL K++  SLAVIGP AN+   L G+Y
Sbjct  411   IGPDQVCSQEHQILALEAARNGIVLLKNSARLLPLSKSKTKSLAVIGPNANSGQMLLGNY  470

Query  1215  TGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLS  1036
              G PC   + L  L  YI +T Y   C  V C+S      AV +AK AD+V++++GLD +
Sbjct  471   AGPPCRFVTPLQALQSYIKQTVYHPACDTVQCSSAS-VDRAVDVAKGADHVVLMMGLDQT  529

Query  1035  QETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIG  856
             QE E+ DR  LLLPG Q  L+  +A  +  P++LVL  GGP+DISFAK D  I S+LW G
Sbjct  530   QEREELDRTDLLLPGKQQELIIAVAKAAKNPVILVLFSGGPVDISFAKNDKNIGSILWAG  589

Query  855   YPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFYT  676
             YPGE G  AL+EI+FGD+NP GRLP+TWYP+ F KVPM DM MR + S GYPGRTYRFY 
Sbjct  590   YPGEGGAIALAEIMFGDHNPGGRLPMTWYPQEFVKVPMTDMGMRPEASSGYPGRTYRFYK  649

Query  675   GEKVYEFGHGls-yssfslellSAPTRISLSQSIKTKL-------RRSILNRGGNEPYVH  520
             G  V+EFGHG+S           +   + L+QS    +       R ++++  G E    
Sbjct  650   GRTVFEFGHGISYSKYSYELTSVSQNTLYLNQSSTMHIINDFDSVRSTLISELGTE----  705

Query  519   VDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGN  340
               E S C +     R+ ++N+G + G   V+LF+R    +  G P+KQLIGF  V +   
Sbjct  706   FCEQSKCRA-----RIGVKNHGEVAGKHPVLLFARQ-EKHGNGRPRKQLIGFQSVVLDAG  759

Query  339   GVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
                E    I PC+HLS  N +G  ++  G H 
Sbjct  760   ERAEIEFEISPCEHLSRANEDGLMVMEEGRHF  791



>ref|XP_011011483.1| PREDICTED: probable beta-D-xylosidase 7 [Populus euphratica]
Length=773

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/760 (51%), Positives = 500/760 (66%), Gaps = 34/760 (4%)
 Frame = -3

Query  2493  SKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             ++P   C    PT  ++PFC T+LPI  R   LVS LT+DEKI +L ++   IPRLGIP 
Sbjct  24    TQPPFSCDSSNPTTKTFPFCKTTLPISQRATDLVSRLTLDEKISQLVNSAQPIPRLGIPG  83

Query  2319  YEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMF  2140
             Y+WWSE+LHGIA  GPGI F+G +K AT FPQVIL+AA+F+   W  I+ A   EARA++
Sbjct  84    YQWWSEALHGIAYAGPGIRFNGTIKRATSFPQVILSAASFDANQWYRISQAIGKEARALY  143

Query  2139  NSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             N+GQA G+TFWAPN+N+F DPRWGRGQETPGEDP++   YAV YVR              
Sbjct  144   NAGQAAGMTFWAPNINIFRDPRWGRGQETPGEDPLMTGKYAVSYVR--------------  189

Query  1962  YSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
               L G+   +  E +  L  SACCKH TAYDLE W+  SRY F+A VT QD+ DTY+PPF
Sbjct  190   -GLQGDSF-KGGEINGPLQASACCKHFTAYDLENWNGTSRYVFDAHVTAQDLADTYQPPF  247

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLL-EKARTDWGFEGYITSDCDAVATIFEYQQ  1606
             KSCVE+GRAS +MCAYN VNGIP CA+ + L + AR  WGF+GYITSDCDAV+ I + Q 
Sbjct  248   KSCVEEGRASGIMCAYNRVNGIPNCADSNFLSQTARAQWGFDGYITSDCDAVSIIHDAQG  307

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             YAK+PE+A    LKAG D+NCG+Y+ ++ K+A++ K +  S+IDRAL NLFSV+ RLGLF
Sbjct  308   YAKTPEDAVVAVLKAGMDVNCGSYLQQHTKAAVDQKKLSLSEIDRALHNLFSVRMRLGLF  367

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPM  1246
             NG    ++F + GP  VCS E++ LAL+AAR GIVLLKN    LPL K++  SLAVIGP 
Sbjct  368   NGNPTGQQFGNIGPDQVCSKENQMLALDAARNGIVLLKNSAGLLPLSKSKTMSLAVIGPN  427

Query  1245  ANT-SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNST--DGFAEAVSIAKR  1075
             AN+  +L G+Y G PC L + L  L  YI  T    GC  V C+S   DG   AV++AK 
Sbjct  428   ANSVQTLLGNYAGPPCKLVTPLQALQSYIKHTIPYPGCDSVQCSSASIDG---AVNVAKG  484

Query  1074  ADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFA  895
             AD+V++++GLD +QE E  DR  L+LPG Q  L+  +A  +  P+VLVL  GGP+DISFA
Sbjct  485   ADHVVLIMGLDDTQEKEGLDRRDLVLPGKQQELIISVAKAAKNPVVLVLLSGGPVDISFA  544

Query  894   KKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADP  715
             K D  I S+LW GYPGE G  AL+EI+FGD+NP G+LP+TWYP+ F KVPM DM MRA+ 
Sbjct  545   KNDKNIGSILWAGYPGEAGAIALAEIIFGDHNPGGKLPMTWYPQEFVKVPMTDMRMRAET  604

Query  714   SRGYPGRTYRFYTGEKVYEFGHGls-yssfslellSAPTRISLSQSIKTKLRRSILNRGG  538
             S GYPGRTYRFY G  V+EFG+GLS           +  ++ L+QS  + + +  +N   
Sbjct  605   SSGYPGRTYRFYRGPTVFEFGYGLSYSKYTYELRAVSQNKLYLNQS--STMHK--INNFD  660

Query  537   NEPYVHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGF  364
             +   + V E+    C    F VR+ + N+G M G   V+LF+R  T    G P+KQL+GF
Sbjct  661   SVLSILVSELGTEFCEHNKFPVRIEVENHGEMVGKHPVLLFARQ-TKQGNGRPRKQLVGF  719

Query  363   DRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
               V +      E    + PC+HLS  N +G  ++  G H 
Sbjct  720   RSVQLGAGERAEIEFEVSPCEHLSRTNEDGLMVMEEGTHF  759



>ref|XP_008808189.1| PREDICTED: probable beta-D-xylosidase 7 [Phoenix dactylifera]
Length=771

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/745 (50%), Positives = 496/745 (67%), Gaps = 26/745 (3%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P+  S+ FC+T+LPI  R+  L+S LT++EKI +L D+  +IPRLG+PAYEWWSESLHG+
Sbjct  35    PSTKSFTFCETTLPIDKRVDDLISRLTLEEKISQLGDSAPSIPRLGVPAYEWWSESLHGV  94

Query  2286  ATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GLTFW  2110
             +  G G+ F G +++AT FPQVILTAA+FN  +W  I      EARA++N+GQA GLTFW
Sbjct  95    SNWGRGMHFTGPIRTATSFPQVILTAASFNPQIWYQIGQVIGTEARAIYNNGQAQGLTFW  154

Query  2109  APNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEE  1930
             APNVN+F DPRWGRGQETPGEDP+  S YA  +VR                L G+    E
Sbjct  155   APNVNIFRDPRWGRGQETPGEDPVTASKYAASFVR---------------GLQGDSF--E  197

Query  1929  EEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASC  1750
                   L  SACCKH TAYD++ W   SR++F+A+V+ QD+EDTY+PPFKSCVE+GRASC
Sbjct  198   GGSSAELKASACCKHYTAYDMDNWGGKSRFTFDAIVSAQDLEDTYQPPFKSCVEEGRASC  257

Query  1749  LMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGI  1573
             +MC+YN+VNG+P CA+ +LL K AR  WG  GYI SDCDAVATI +   YAK+PE+A G 
Sbjct  258   IMCSYNSVNGVPTCADSNLLSKTARDSWGLYGYIASDCDAVATIRDAHVYAKTPEDAVGD  317

Query  1572  ALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFES  1393
             ALKAG D++CG Y+     SA++   + E DI+RAL NL S + RLGLFNG   ++ + +
Sbjct  318   ALKAGLDLDCGNYVQEYAMSAVQQGKLSEEDINRALRNLISTRMRLGLFNGNPASQLYSN  377

Query  1392  FGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANT-SSLGGDY  1216
               P  VC+ EH+ LALEAAR GIVLLKN    LPL +++V+SL VIGP AN+   L G+Y
Sbjct  378   IAPNQVCTQEHQDLALEAARDGIVLLKNSINTLPLSRSKVTSLGVIGPNANSVMKLIGNY  437

Query  1215  TGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLS  1036
              G PC   + L  L  Y+  T Y SGC   ACN +   +EAV +A   DYV++ +GLD  
Sbjct  438   AGPPCKYITPLQVLQSYVKDTRYLSGCDTAACNPSS-VSEAVQLASSVDYVVMFMGLDQD  496

Query  1035  QETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIG  856
             QE E  DR +L+LPG Q +L+  +A  + +P++LVL  GGP+DI+FAK + +I S+LW G
Sbjct  497   QEREGLDRVNLVLPGMQQSLITSVARAAKRPVILVLLCGGPVDITFAKYEEKIGSILWAG  556

Query  855   YPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFYT  676
             YPGE GG A+++++FG++NP G+LP+TWYP+SFT VPM +M MRADP+ GYPGRTYRFYT
Sbjct  557   YPGEAGGLAIAQVIFGEHNPGGKLPVTWYPQSFTSVPMTNMRMRADPASGYPGRTYRFYT  616

Query  675   GEKVYEFGHGls-yssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEVSNC  499
             G+ V++FG+GLS  +        +   I +++SI     +       N   +   +   C
Sbjct  617   GKTVFDFGYGLSFSNYSYQFSAESENTIYMNKSISLGAFKMSDTLSYN---ITSMDSEAC  673

Query  498   NSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSI  319
               L FS  V ++N+G MDG   V+LF R P +   G P KQLIGF  VH+     T+   
Sbjct  674   EKLKFSTVVGVKNHGPMDGKHPVLLFLRWP-NVLHGRPMKQLIGFQSVHLKAGERTDVKF  732

Query  318   SIEPCQHLSIVNVEGSRILPLGDHI  244
              + PC+HLS  N++G+++L  G H 
Sbjct  733   VVSPCKHLSRTNIDGAKVLDQGSHF  757



>ref|XP_010064766.1| PREDICTED: probable beta-D-xylosidase 7 [Eucalyptus grandis]
Length=781

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/769 (50%), Positives = 503/769 (65%), Gaps = 37/769 (5%)
 Frame = -3

Query  2505  ATSYSKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRL  2332
             ATS   P   C P  P+ +S+PFC+ SLPI  R   LV  LT+DEKI +L  +   IPRL
Sbjct  26    ATSAQPPPFSCDPSGPSTTSFPFCNASLPISQRAQDLVYRLTLDEKISQLVSSAPTIPRL  85

Query  2331  GIPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavea  2152
             GIPAYEWWSESLHG++ +GPGI F+G ++SAT FPQVILTAA+F+  LW  I  A   EA
Sbjct  86    GIPAYEWWSESLHGVSESGPGIRFNGTIRSATSFPQVILTAASFDANLWYRIGQAIGTEA  145

Query  2151  rAMFNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgk  1975
             RA++NSGQA G+TFWAPN+N+F DPRWGRGQETPGEDP+V   YAV YVR          
Sbjct  146   RAVYNSGQAKGMTFWAPNINIFRDPRWGRGQETPGEDPLVTGKYAVSYVR----------  195

Query  1974  ngRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTY  1795
                   + G+           L  SACCKH TAYDL+ W   +R+ F+A VT QDM DT+
Sbjct  196   -----GVQGDAFQGGGNPRGSLQASACCKHFTAYDLDNWKGVNRFVFDARVTAQDMADTF  250

Query  1794  EPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIF  1618
             +PPF+ C++ G+AS +MCAYN VNG+P CA+ +LL   AR  W F+GYITSDC  VA I+
Sbjct  251   QPPFQKCIQDGKASGIMCAYNRVNGVPNCADYNLLSNIARGQWSFDGYITSDCGGVAIIY  310

Query  1617  EYQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFR  1438
             E Q YA++PE+A    LKAG D+NCG Y+ R+ KS +E K V  S+I+RAL NLFSV+ R
Sbjct  311   ENQGYAETPEDAVADVLKAGMDVNCGDYLKRHTKSTVEQKKVSVSEINRALHNLFSVRMR  370

Query  1437  LGLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAV  1258
             LGLF+G    + F + GP  VCS +H+ LALEAAR GI+LLKN +K LPL +T   SLAV
Sbjct  371   LGLFDGDPKKQPFGNIGPDQVCSQKHQDLALEAARSGIMLLKNIEKRLPLQRTESMSLAV  430

Query  1257  IGPMANTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIA  1081
             IGP AN +  L G+Y G PC   ++L  L  Y+  T Y  GC DV C+S    A+A+ +A
Sbjct  431   IGPNANNAWKLLGNYAGPPCKSVTLLQALQNYVKDTRYQPGCDDVECSSPQ-IAQAMEVA  489

Query  1080  KRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDIS  901
             K AD+V++++GLD +QE E+ DR  L+LPG Q   +  +A  + KP++LV+  GGP+DI 
Sbjct  490   KAADHVVLIMGLDQTQERENFDRVDLVLPGRQQEFITTVAQATKKPVILVILCGGPVDIR  549

Query  900   FAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRA  721
             FA+ D  I S+LW GYPGE GG ALSEI+FG+YNP GRLP+TWYP  FT VPM DM MR 
Sbjct  550   FARDDQNIGSILWAGYPGEAGGMALSEIIFGEYNPGGRLPVTWYPREFTTVPMTDMRMRP  609

Query  720   DPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRI--SLSQSIKTKLRRSILN  547
             +PS GYPGRTYRFY G+ V+E+G+GLSY+  S + +S  T++   L+QS K++L  +  +
Sbjct  610   EPSTGYPGRTYRFYQGQSVFEYGYGLSYTEHSYKFISV-TKVLFYLNQSPKSQLDEASDD  668

Query  546   RGGNEPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSR--APTSYAGGAPQKQL  373
                  P   +   + C    F V V ++N+G M G   V+LF R   P+S    +P KQL
Sbjct  669   SPRYRPVSDLG-AAFCKKSNFVVTVEVKNHGDMVGKHPVLLFVRHAKPSSR---SPVKQL  724

Query  372   IGFDRVHVSGNGVTETSISIEPCQHLS-------IVNVEGSRILPLGDH  247
             + F  V + G    E  +++ PC HLS       ++  EG R L +GD 
Sbjct  725   VAFQSVELKGGETVEVRLALNPCDHLSRADENGVMILEEGRRFLRVGDQ  773



>ref|XP_009599906.1| PREDICTED: probable beta-D-xylosidase 7 [Nicotiana tomentosiformis]
Length=777

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/764 (50%), Positives = 502/764 (66%), Gaps = 34/764 (4%)
 Frame = -3

Query  2505  ATSYSKPQLPCQPPTH--SSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRL  2332
             +T  ++P   C       +S+PFC+ SLPIP R+H LVS LT+DEKI +L +    IPRL
Sbjct  24    STESTQPPFSCDSSNSVTNSFPFCNNSLPIPQRVHDLVSRLTLDEKILQLVNAAPEIPRL  83

Query  2331  GIPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavea  2152
             GI AYEWWSE LHG++ +G G  F+G +K+AT FPQ+ILTA+ F+  LW  IA A   EA
Sbjct  84    GISAYEWWSEGLHGVSRHGKGTLFNGTIKAATMFPQIILTASTFDENLWYRIAQAIGKEA  143

Query  2151  rAMFNSGQ-AGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgk  1975
             RA++N+GQ  G+T WAPN+N+F DPRWGRGQETPGEDPM+V  Y V YVR          
Sbjct  144   RAVYNAGQLKGMTLWAPNINIFRDPRWGRGQETPGEDPMMVGKYGVAYVR----------  193

Query  1974  ngRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTY  1795
                   L G+     +  D  L  SACCKH  A DL+ W+NFSRY+F+A V +QD+ D+Y
Sbjct  194   -----GLQGDSFEGGKLQDGHLQASACCKHFIAQDLDNWYNFSRYTFDAHVMKQDLADSY  248

Query  1794  EPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIF  1618
             EPPFKSCVE+G+AS LMCAYN VNGIP CAN DLL   AR  WGF+GYI SDCDAVA + 
Sbjct  249   EPPFKSCVEQGKASSLMCAYNLVNGIPNCANFDLLTTTAREQWGFQGYIVSDCDAVAIMH  308

Query  1617  EYQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFR  1438
              +Q YAK PE+A    L+AG D+NCG+Y+    KSALE + V ESDIDRAL NLFS++ R
Sbjct  309   THQGYAKEPEDAVAATLRAGMDVNCGSYLKSYTKSALEKQKVKESDIDRALHNLFSIRMR  368

Query  1437  LGLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAV  1258
             LGLFNG     ++      +VCS EHR LALEAAR GIVLLKN  K LPL K + +SLAV
Sbjct  369   LGLFNGDPKKLEYGDISSVEVCSQEHRALALEAARNGIVLLKNSAKLLPLSKIKTTSLAV  428

Query  1257  IGPMANTSS-LGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIA  1081
             IGP AN S  L G+Y G PC   ++L GL EY+  T+Y  GC  V C S     EAV IA
Sbjct  429   IGPKANDSEVLLGNYEGYPCKNVTLLQGLQEYVKNTTYHPGCNFVNCTSA-AIDEAVDIA  487

Query  1080  KRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDIS  901
             K+ADYV++++GLD + E E  DR  L LPG Q +L+  +   + KP++LVL  GGP+D+S
Sbjct  488   KKADYVVLIMGLDQTLEREKLDRTELGLPGMQESLITAIVQAAPKPVILVLMCGGPVDVS  547

Query  900   FAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRA  721
             FAK++  I ++LW+GYPGE G  AL+EI+FG++NP G+LP+TWYP+ F K+ M DM MR 
Sbjct  548   FAKENQNIGAILWVGYPGEGGATALAEILFGEHNPGGKLPVTWYPKEFNKISMTDMRMRP  607

Query  720   DPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRG  541
               S GYPGRTYRFY G KV+EFG+GLSY+ +S         +S++Q  K   +   +N+ 
Sbjct  608   LSSTGYPGRTYRFYNGPKVFEFGYGLSYTDYSYAF------VSVNQD-KLHFKNLKVNKA  660

Query  540   ---GNEPYVHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQ  376
                G+   + V +V +  CN+   +V+V+++N G M G   ++LF R  +S     P+K 
Sbjct  661   TENGSALSIDVSDVGSEVCNNAMIAVKVAVKNQGEMAGKHPLLLFLRH-SSTMDEIPRKT  719

Query  375   LIGFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             LIGF  V++     T  +  ++PC+H +  N  GS ++  G + 
Sbjct  720   LIGFKSVNLEARESTHIAFDVKPCEHFTRANRYGSLVIDEGKYF  763



>gb|EYU33328.1| hypothetical protein MIMGU_mgv1a001688mg [Erythranthe guttata]
Length=773

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/747 (51%), Positives = 487/747 (65%), Gaps = 39/747 (5%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P+  SYPFC+  LPI  R H LVS LT+DEKI +L +  SA+PRLGIP Y+WWSE+LHG+
Sbjct  40    PSTKSYPFCNVDLPIEKRAHDLVSRLTLDEKISQLVNKASAVPRLGIPYYQWWSEALHGV  99

Query  2286  ATNG---PGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GL  2119
             A       G  F+G +++AT FPQVILTAA F+  LW  I      EARA++N G+A G+
Sbjct  100   AMATGVENGFAFNGTIRAATSFPQVILTAATFDENLWYQIGKVIGAEARAIYNEGEAIGM  159

Query  2118  TFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRM  1939
             T W+PN+N+F DPRWGRGQETPGEDP + S YAV +VR                + G+  
Sbjct  160   TLWSPNINIFRDPRWGRGQETPGEDPFMTSKYAVSFVR---------------GIQGDSF  204

Query  1938  PEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGR  1759
                +  D RL  SACCKH TAYDLE W+  +R++FNA VT+QDM DTY+PPFKSCVE+GR
Sbjct  205   EGGQLKDGRLQASACCKHFTAYDLESWNGNNRFTFNAHVTKQDMADTYQPPFKSCVEQGR  264

Query  1758  ASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEA  1582
             AS +MCAYN VNG+P CA+ DLL K AR +WGF+GYI SDCDAV+ I+E Q Y+KS E+A
Sbjct  265   ASGVMCAYNLVNGVPNCADYDLLTKTARGEWGFQGYIVSDCDAVSLIYEKQNYSKSHEDA  324

Query  1581  AGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRK  1402
                 LKAG D+NCG+Y+  + KSA+E   V ESDIDRAL NLF+V+ RLGLFNG      
Sbjct  325   VADVLKAGMDVNCGSYLAEHTKSAIEKGKVSESDIDRALYNLFTVRMRLGLFNGNPRKLP  384

Query  1401  FESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTS-SLG  1225
             + +   KDVCS +H+ LALE AR GIVLLKN    LPL K+   SLAVIGP AN S +L 
Sbjct  385   YGNLRRKDVCSHKHQNLALEVARDGIVLLKNSANLLPLSKSETKSLAVIGPNANDSRTLV  444

Query  1224  GDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGL  1045
             G+Y G PC   + L GL +YI KT +  GC  V C S     E + ++K ADYV++V+G+
Sbjct  445   GNYAGPPCKTITPLQGLMKYIKKTKFHPGCNSVNCTSIAS-REVIKLSKSADYVVLVMGI  503

Query  1044  DLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVL  865
             +   E E+ DR  L+LPG Q  LV  +A  +  P++LVL  GGP+DISFAK + +I S+L
Sbjct  504   NQDHEREELDREDLVLPGQQQDLVMRVAEAAKNPIILVLLCGGPVDISFAKDNSKIGSIL  563

Query  864   WIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYR  685
             W GYPGE GGKA++EIVFGD+NP GRLP+TWYP+ F KVPM DM MR DPS GYPGRTYR
Sbjct  564   WAGYPGEAGGKAIAEIVFGDHNPGGRLPMTWYPKDFVKVPMTDMRMRPDPSSGYPGRTYR  623

Query  684   FYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRR-SILNRGGNEPYVHVDEV  508
             FY GEKV+EFG+GLSYS++S        +   S  IK   ++ S+ +R GN   + V ++
Sbjct  624   FYQGEKVFEFGYGLSYSNYSY-------KFISSSKIKLDFKKSSVGSRVGNLGDISVSDI  676

Query  507   --SNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGV  334
                +C    FSV V + N G M G   V+LF R           KQL+GF  V +     
Sbjct  677   GLESCEKAKFSVIVRVENEGNMAGKHPVLLFLRHDQG-------KQLVGFQTVKLGAKEK  729

Query  333   TETSISIEPCQHLSIVNVEGSRILPLG  253
                   + PC+  S    +G+ ++  G
Sbjct  730   ANVEFRVNPCEQFSRAIEDGTMVIGSG  756



>ref|XP_002302285.1| glycosyl hydrolase family 3 family protein [Populus trichocarpa]
 gb|EEE81558.1| glycosyl hydrolase family 3 family protein [Populus trichocarpa]
Length=773

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/763 (50%), Positives = 493/763 (65%), Gaps = 40/763 (5%)
 Frame = -3

Query  2493  SKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             ++P   C    P+  ++PFC+T+LPI  R   LVS LT+DEKI +L ++   IPRLGIP 
Sbjct  24    TQPPFSCDSSNPSTKAFPFCETTLPISQRARDLVSRLTLDEKISQLVNSAPPIPRLGIPG  83

Query  2319  YEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMF  2140
             YEWWSE+LHG++  GPGI F+  +K AT FPQVILTAA+F+   W  I  A   EARA++
Sbjct  84    YEWWSEALHGVSNAGPGIHFNDNIKGATSFPQVILTAASFDAYQWYRIGQAIGKEARALY  143

Query  2139  NSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             N+GQA G+TFWAPN+N+F DPRWGRGQETPGEDP+V   YA  YV+G+QG          
Sbjct  144   NAGQATGMTFWAPNINIFRDPRWGRGQETPGEDPLVTGLYAASYVKGVQGD---------  194

Query  1962  YSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
              S  G ++         L  SACCKH TAYDL+ W   +R+ F+A VT QD+ DTY+PPF
Sbjct  195   -SFEGGKI------KGHLQASACCKHFTAYDLDNWKGMNRFVFDARVTMQDLADTYQPPF  247

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQ  1606
             KSCVE+GRAS +MCAYN VNG+P+CA+ +LL K AR  WGF GYITSDCDAV+ I + Q 
Sbjct  248   KSCVEQGRASGIMCAYNKVNGVPSCADSNLLSKTARAQWGFRGYITSDCDAVSIIHDDQG  307

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             YAKSPE+A    LKAG D+NCG+Y+L++ K A+E K + ESDID+AL NLFSV+ RLGLF
Sbjct  308   YAKSPEDAVVDVLKAGMDVNCGSYLLKHAKVAVEQKKLSESDIDKALHNLFSVRMRLGLF  367

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPM  1246
             NG+   + F + GP  VCS EH+ LALEAAR GIVLLKN  + LPL K++  SLAVIGP 
Sbjct  368   NGRPEGQLFGNIGPDQVCSQEHQILALEAARNGIVLLKNSARLLPLSKSKTKSLAVIGPN  427

Query  1245  ANTSS-LGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             AN+   L G+Y G PC   + L  L  YI +T Y   C  V C+S      AV +AK AD
Sbjct  428   ANSGQMLLGNYAGPPCRFVTPLQALQSYIKQTVYHPACDTVQCSSAS-VDRAVDVAKGAD  486

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
              V++++GLD +QE E+ DR  LLLPG Q  L+  +A  +  P+VLVL  GGP+DISFAK 
Sbjct  487   NVVLMMGLDQTQEREELDRTDLLLPGKQQELIIAVAKAAKNPVVLVLFSGGPVDISFAKN  546

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSR  709
             D  I S+LW GYPGE G  AL+EIVFGD+NP GRLP+TWYP+ F KVPM DM MR + S 
Sbjct  547   DKNIGSILWAGYPGEGGAIALAEIVFGDHNPGGRLPMTWYPQEFVKVPMTDMGMRPEASS  606

Query  708   GYPGRTYRFYTGEKVYEFGHGls-yssfslellSAPTRISLSQSIKTKL-------RRSI  553
             GYPGRTYRFY G  V+EFG+G+S           +   + L+QS    +       R ++
Sbjct  607   GYPGRTYRFYRGRSVFEFGYGISYSKYSYELTAVSQNTLYLNQSSTMHIINDFDSVRSTL  666

Query  552   LNRGGNEPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQL  373
             ++  G E          C       R+ ++N+G M G   V+LF+R    +  G P+KQL
Sbjct  667   ISELGTE---------FCEQNKCRARIGVKNHGEMAGKHPVLLFARQ-EKHGNGRPRKQL  716

Query  372   IGFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             IGF  V +      E    + PC+HLS  N +G  ++  G H 
Sbjct  717   IGFQSVVLGAGERAEIEFEVSPCEHLSRANEDGLMVMEEGRHF  759



>ref|XP_002306583.2| hypothetical protein POPTR_0005s16660g [Populus trichocarpa]
 gb|EEE93579.2| hypothetical protein POPTR_0005s16660g [Populus trichocarpa]
Length=773

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/761 (50%), Positives = 496/761 (65%), Gaps = 36/761 (5%)
 Frame = -3

Query  2493  SKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             ++P   C    P+  ++PFC T+LPI  R + LVS LT++EKI +L ++   IPRLGIP 
Sbjct  24    TQPPFSCDSSNPSTKTFPFCKTTLPISQRANDLVSRLTLEEKISQLVNSAQPIPRLGIPG  83

Query  2319  YEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMF  2140
             Y+WWSE+LHG+A  GPGI F+G +K AT FPQVIL+AA+F+   W  I+ A   EARA++
Sbjct  84    YQWWSEALHGVAYAGPGIRFNGTIKRATSFPQVILSAASFDANQWYRISQAIGKEARALY  143

Query  2139  NSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             N+GQA G+TFWAPN+N+F DPRWGRGQETPGEDP++   YAV YVR              
Sbjct  144   NAGQATGMTFWAPNINIFRDPRWGRGQETPGEDPLMTGKYAVSYVR--------------  189

Query  1962  YSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
               L G+   +  E    L  SACCKH TAYDLE W+  SRY F+A VT QD+ DTY+PPF
Sbjct  190   -GLQGDSF-KGGEIKGPLQASACCKHFTAYDLENWNGTSRYVFDAYVTAQDLADTYQPPF  247

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQ  1606
             KSCVE+GRAS +MCAYN VNGIP CA+ + L + AR  WGF+GYI SDCDAV+ I + Q 
Sbjct  248   KSCVEEGRASGIMCAYNRVNGIPNCADSNFLSRTARAQWGFDGYIASDCDAVSIIHDAQG  307

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             YAK+PE+A    LKAG D+NCG+Y+ ++ K+A++ K +  S+IDRAL NLFSV+ RLGLF
Sbjct  308   YAKTPEDAVVAVLKAGMDVNCGSYLQQHTKAAVDQKKLTISEIDRALHNLFSVRMRLGLF  367

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPM  1246
             NG    ++F + GP  VCS E++ LAL+AAR GIVLLKN    LPL K++  SLAVIGP 
Sbjct  368   NGNPTGQQFGNIGPDQVCSQENQILALDAARNGIVLLKNSAGLLPLSKSKTMSLAVIGPN  427

Query  1245  ANT-SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             AN+  +L G+Y G PC L + L  L  YI  T    GC  V C+S      AV++AK AD
Sbjct  428   ANSVQTLLGNYAGPPCKLVTPLQALQSYIKHTIPYPGCDSVQCSSAS-IVGAVNVAKGAD  486

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
             +V++++GLD +QE E  DR  L+LPG Q  L+  +A  +  P+VLVL  GGP+DISFAK 
Sbjct  487   HVVLIMGLDDTQEKEGLDRRDLVLPGKQQELIISVAKAAKNPVVLVLLSGGPVDISFAKN  546

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSR  709
             D  I S+LW GYPGE G  AL+EI+FGD+NP G+LP+TWYP+ F KVPM DM MR + S 
Sbjct  547   DKNIGSILWAGYPGEAGAIALAEIIFGDHNPGGKLPMTWYPQEFVKVPMTDMRMRPETSS  606

Query  708   GYPGRTYRFYTGEKVYEFGHGls-yssfslellSAPTRISLSQSIKTKLRRSILNRGGNE  532
             GYPGRTYRFY G  V+EFG+GLS           +  ++ L+QS       S +++  N 
Sbjct  607   GYPGRTYRFYKGPTVFEFGYGLSYSKYTYELRAVSQNKLYLNQS-------STMHKINNF  659

Query  531   PYVHVDEVSN-----CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIG  367
               V    VS      C    F VR+ ++N+G M G   V+LF+R  T    G P+KQL+G
Sbjct  660   DSVLSLLVSELGTEFCEHNKFPVRIEVKNHGEMAGKHPVLLFARQ-TKQGNGRPRKQLVG  718

Query  366   FDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             F  V +S     E    + PC+HLS  N +G  ++  G H 
Sbjct  719   FHSVQLSAGERAEIEFEVSPCEHLSRTNEDGLMVMEEGTHF  759



>ref|NP_001266109.1| SlArf/Xyl3 protein precursor [Solanum lycopersicum]
 dbj|BAL44718.1| SlArf/Xyl3 [Solanum lycopersicum]
Length=777

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/763 (50%), Positives = 498/763 (65%), Gaps = 34/763 (4%)
 Frame = -3

Query  2502  TSYSKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLG  2329
             T  +KP   C    P  SSYPFC+ +LPIP R++ LVS LTVDEKI +L +    IPRLG
Sbjct  25    TESTKPPFSCDSSNPNTSSYPFCNAALPIPQRVNDLVSRLTVDEKILQLVNGAPEIPRLG  84

Query  2328  IPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavear  2149
             I AYEWWSE LHGI+ +G G  F+G +K+AT FPQ+ILTA++F+  LW  IA A   EAR
Sbjct  85    ISAYEWWSEGLHGISRHGKGTLFNGTIKAATQFPQIILTASSFDENLWYRIAQAIGREAR  144

Query  2148  AMFNSGQ-AGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkn  1972
             A++N+GQ  G+T WAPN+N+  DPRWGRGQETPGEDPM+V  Y V YVR           
Sbjct  145   AVYNAGQLKGITLWAPNINILRDPRWGRGQETPGEDPMMVGKYGVAYVR-----------  193

Query  1971  gRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYE  1792
                  L G+     +  D  L  SACCKH  A D++ WHNFSRY+F+A V +QD+ D+YE
Sbjct  194   ----GLQGDSFEGGKLKDGHLQTSACCKHFIAQDMDNWHNFSRYTFDAQVLKQDLADSYE  249

Query  1791  PPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFE  1615
             PPFK CVE+G+AS +MCAYN VNGIP CAN DLL   AR  WG +GYI SDCDAV  ++ 
Sbjct  250   PPFKDCVEQGKASSVMCAYNLVNGIPNCANFDLLTTTARGKWGLQGYIVSDCDAVDKMYS  309

Query  1614  YQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRL  1435
              Q YAK PE+A    LKAG D+NCG+++    KSALE + V ESDIDRAL NLFSV+ RL
Sbjct  310   EQHYAKEPEDAVAATLKAGMDVNCGSHLKTYTKSALEKQKVKESDIDRALHNLFSVRMRL  369

Query  1434  GLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVI  1255
             GLFNG     ++      +VCS EHR LA+EAAR G VLLKN  + LPL K + +SLAVI
Sbjct  370   GLFNGDPSKLEYGDISAAEVCSEEHRALAVEAARSGSVLLKNSNRLLPLSKMKTASLAVI  429

Query  1254  GPMANTSS-LGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAK  1078
             GP AN S  L G+Y G  C   ++  GL  Y+  T Y  GC  + C S     EAV+IAK
Sbjct  430   GPKANDSEVLLGNYEGFSCKNVTLFQGLQGYVANTMYHPGCDFINCTSP-AIDEAVNIAK  488

Query  1077  RADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISF  898
             +ADYV++V+GLD + E E  DR  L LPG Q  L+  +A  ++KP++LVL  GGP+D++F
Sbjct  489   KADYVVLVMGLDQTLEREKFDRTELGLPGMQEKLITSIAEAASKPVILVLMCGGPVDVTF  548

Query  897   AKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRAD  718
             AK +P+I  +LW+GYPGE G  AL++I+FG++NP GR P+TWYP+ F KV MNDM MR +
Sbjct  549   AKDNPKIGGILWVGYPGEGGAAALAQILFGEHNPGGRSPVTWYPKEFNKVAMNDMRMRPE  608

Query  717   PSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIK---TKLRRSILN  547
              S GYPGRTYRFY G KV+EFG+GLSY+++S    S      L ++ K   +  + S+LN
Sbjct  609   SSSGYPGRTYRFYNGPKVFEFGYGLSYTNYSYTFASVSKNQLLFKNPKINQSTEKGSVLN  668

Query  546   RGGNEPYVHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQL  373
                    + V +V    CNS   +V+V+++N G M G   V+LF +  +S     P+K L
Sbjct  669   -------IAVSDVGPEVCNSAMITVKVAVKNQGEMAGKHPVLLFLKH-SSTVDEVPKKTL  720

Query  372   IGFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             IGF  V++     T+ +  ++PC+H +  N +G+ ++  G H 
Sbjct  721   IGFKSVNLEAGANTQVTFDVKPCEHFTRANRDGTLVIDEGKHF  763



>gb|EYU23224.1| hypothetical protein MIMGU_mgv1a001695mg [Erythranthe guttata]
Length=772

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/748 (51%), Positives = 487/748 (65%), Gaps = 38/748 (5%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P+  SYPFC+  LPI  R H LVS LT++EKI +L +  SAIPRLGIP Y+WWSE+LHG+
Sbjct  40    PSTKSYPFCNVDLPIGKRAHDLVSRLTLNEKISQLVNKASAIPRLGIPYYQWWSEALHGV  99

Query  2286  ATN---GPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GL  2119
             A       G  F+G +++AT FPQVILTAA F+  LW  IA     E RA++N G+A G+
Sbjct  100   AGTLGVDTGFFFNGTIRAATSFPQVILTAATFDAHLWYRIAKVIGTEGRAIYNEGEATGM  159

Query  2118  TFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRM  1939
             TFW+PN+N+F DPRWGRGQETPGEDP + S Y V +VR                + G+  
Sbjct  160   TFWSPNINIFRDPRWGRGQETPGEDPFMTSKYGVSFVR---------------GIQGDSF  204

Query  1938  PEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGR  1759
                +  D RL+ SACCKHLTAYDLE W+  SR++F+A VT+QDM DTY+PPFKSCVE+GR
Sbjct  205   EGGDLKDGRLLASACCKHLTAYDLESWNGNSRFTFDAHVTKQDMADTYQPPFKSCVEQGR  264

Query  1758  ASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEA  1582
             AS +MCAYN VNG+P CA+ DLL K AR +WGF+GYITSDC AV+ ++  Q Y+KS E+A
Sbjct  265   ASGIMCAYNLVNGVPNCADYDLLTKTARREWGFQGYITSDCGAVSLLYGTQNYSKSHEDA  324

Query  1581  AGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRK  1402
                 LKAG D+ CG Y+  + KSA+E   V E DIDRAL NLF+++ RLGLFNG      
Sbjct  325   VADVLKAGLDVECGNYLTNHTKSAIEKGKVSEHDIDRALRNLFTIRMRLGLFNGNPSEHV  384

Query  1401  FESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTS-SLG  1225
             + +    DVCS EH+ LALE AR GIVLLKN    LPL K++  SLAVIGP +N S +L 
Sbjct  385   YGNLSRNDVCSPEHQDLALEVARDGIVLLKNSANLLPLSKSKTKSLAVIGPNSNVSETLL  444

Query  1224  GDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGL  1045
             G Y G PC   + L GL  Y+ KT +  GC  V C S     EA  IA+ ADYV++V+G+
Sbjct  445   GSYAGPPCKTITPLQGLMNYVKKTEFHKGCETVNCTSIAS-REATRIARSADYVVLVMGI  503

Query  1044  DLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVL  865
             +   E ED DR  L+LPG Q +L+  +A  +  P++LVL  GGP+DISFAK +P+I  +L
Sbjct  504   NQDFEREDLDREDLVLPGQQQSLIRSVANAAKNPVILVLLCGGPVDISFAKNNPKIGGIL  563

Query  864   WIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYR  685
             W GYPGE GGKA++EI+FGD+NP GRLP+TWYP+ F K+PM DM MR D + GYPGRTYR
Sbjct  564   WAGYPGEAGGKAIAEIIFGDHNPGGRLPVTWYPKDFIKIPMTDMRMRPDRASGYPGRTYR  623

Query  684   FYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEV-  508
             FY GEKVYEFG+GLSYS++S +       +S+ QS   KL     N G     V V ++ 
Sbjct  624   FYQGEKVYEFGYGLSYSNYSYKF------VSVGQS---KLDFKPENSGD----VSVSDIG  670

Query  507   -SNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVT  331
                C    FSV VS+ N G M G   V+LF +        +P KQL+GF  V ++ N   
Sbjct  671   FETCEKSKFSVVVSVENEGEMAGKNSVLLFLKRDEPLK-DSPTKQLVGFQTVRLNANEKA  729

Query  330   ETSISIEPCQHLSIVNVEGSRILPLGDH  247
                  I PCQH +  + +G  ++  G H
Sbjct  730   NVEFEINPCQHFARASEDGKMVIESGTH  757



>ref|XP_006354074.1| PREDICTED: probable beta-D-xylosidase 7-like [Solanum tuberosum]
Length=775

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/767 (50%), Positives = 494/767 (64%), Gaps = 42/767 (5%)
 Frame = -3

Query  2502  TSYSKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLG  2329
             T  ++P   C    P  SS+PFC+ SLPI  R++ LVS LTVDEKI +L +    IPRLG
Sbjct  23    TESTEPPFSCDSSNPNTSSFPFCNNSLPISQRVNDLVSRLTVDEKILQLVNGAPEIPRLG  82

Query  2328  IPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavear  2149
             I AYEWWSE LHG++ +G G  F+G +K+AT FPQ+ILTA+ F+  LW  IA A   EAR
Sbjct  83    ISAYEWWSEGLHGVSRHGKGTFFNGTIKAATQFPQIILTASTFDENLWYRIAQAIGKEAR  142

Query  2148  AMFNSGQ-AGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkn  1972
             A++N+GQ  G+T WAPN+N+F DPRWGRGQETPGEDPMVV  Y V YVR           
Sbjct  143   AVYNAGQLKGMTLWAPNINIFRDPRWGRGQETPGEDPMVVGKYGVAYVR-----------  191

Query  1971  gRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYE  1792
                  L G+     +  D  L  SACCKH  A D++ W+NFSRY+F+A V +QD+ D+YE
Sbjct  192   ----GLQGDSFEGGKLKDGHLQTSACCKHFIAQDMDTWNNFSRYTFDAHVLKQDLADSYE  247

Query  1791  PPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFE  1615
             PPFK+CVE+G+AS +MCAYN VNGIP CAN DLL   AR  WG +GYI SDCDAVA ++ 
Sbjct  248   PPFKNCVEQGKASSVMCAYNLVNGIPNCANFDLLTTTARGKWGLQGYIVSDCDAVAIMYT  307

Query  1614  YQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRL  1435
             +Q YAK PE+A    L+AG D+NCG+++ +  KSALE + + ESDIDRAL NLFSV+ RL
Sbjct  308   HQGYAKEPEDAVAATLRAGMDVNCGSHLKKYTKSALEKQKIQESDIDRALHNLFSVRMRL  367

Query  1434  GLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVI  1255
             GLFNG     ++      +VCS EHR LALEAAR GIVLLKN  + LPL K + +SLAVI
Sbjct  368   GLFNGDPRKLEYGDISAAEVCSQEHRALALEAARNGIVLLKNSDRLLPLSKMKTTSLAVI  427

Query  1254  GPMANTSS-LGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAK  1078
             GP AN S  L G+Y G PC   ++L GL  Y+   +Y  GC  + C S     EAV IAK
Sbjct  428   GPKANDSEVLLGNYEGYPCKNVTLLQGLQGYVENITYHPGCDFINCTSA-AIDEAVDIAK  486

Query  1077  RADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISF  898
             +ADYV++V+GLD + E E  DR  L LPG Q  LV  +A  ++KP++LVL  GGP+D++F
Sbjct  487   KADYVVLVMGLDQTLEREKLDRTELGLPGMQERLVTAIAEAASKPVILVLMCGGPVDVTF  546

Query  897   AKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRAD  718
             AK +  I  +LW+GYPGE G  AL+EI+FG +NP G+LP+TWYP+ F K+PMNDM MR  
Sbjct  547   AKDNQNIGGILWVGYPGEGGATALAEIIFGKHNPGGKLPVTWYPKEFNKIPMNDMRMRPV  606

Query  717   PSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGG  538
              S GYPGRTYRFY G K++EFG+GLSY           T  S S +  +K +    N  G
Sbjct  607   SSYGYPGRTYRFYNGPKIFEFGYGLSY-----------TNYSYSFASVSKHQLHFKNPKG  655

Query  537   NEPYVH-------VDEV--SNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAP  385
             N+   H       V +V    CN+   +V+V ++N G M G   V+LF R   +     P
Sbjct  656   NKVTKHSSVLNIAVSDVGLEVCNNAMITVKVGVKNGGEMAGKHPVLLFLRHSDT-VDEVP  714

Query  384   QKQLIGFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             +K LIGF  V++     T  +  ++PC+H +  N +G+ ++  G + 
Sbjct  715   RKTLIGFKSVNLEAGANTHVTFDVKPCEHFTRANRDGTFVIDEGKYF  761



>ref|XP_009391118.1| PREDICTED: probable beta-D-xylosidase 7 [Musa acuminata subsp. 
malaccensis]
Length=778

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/763 (51%), Positives = 503/763 (66%), Gaps = 38/763 (5%)
 Frame = -3

Query  2496  YSKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIP  2323
             +S P + C P  P+  +  FC T+LPI  R   L+S LT++EKIQ+L D    IPRLG+P
Sbjct  28    FSSPPIACDPASPSTRNLGFCQTTLPIDKRASDLISRLTLEEKIQQLDDQAPEIPRLGVP  87

Query  2322  AYEWWSESLHGIATNGPGITFDG-AVKSATGFPQVILTAAAFNRTLWRSIaaaaavearA  2146
              Y WWSE+LHG++  G G+ F G  + +AT FPQVILTAA+FN  LW  I  A AVEARA
Sbjct  88    KYNWWSEALHGLSNGGHGMHFIGRTIPNATSFPQVILTAASFNPDLWYRIGQAIAVEARA  147

Query  2145  MFNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkng  1969
             ++N+GQA GLTFW+PNVN+F DPRWGRGQETPGEDP   S YAV +VR            
Sbjct  148   LYNAGQADGLTFWSPNVNIFRDPRWGRGQETPGEDPTTASKYAVSFVR------------  195

Query  1968  RKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEP  1789
                 L G+      E   +LM SACCKHLTAYDL+ W    RY+F+A VT QDMEDT++P
Sbjct  196   ---GLQGDS--PTGERSGQLMASACCKHLTAYDLDSWKGTVRYTFDARVTAQDMEDTFQP  250

Query  1788  PFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEY  1612
             PF+SCVE+GRA+C+MC+YN VNG+P CA+ +LL K A+  WG +GYI SDC AV  ++  
Sbjct  251   PFRSCVEQGRATCVMCSYNRVNGVPTCADYNLLTKQAKNLWGLDGYIASDCAAVDFMYGA  310

Query  1611  QQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLG  1432
               YAK+ EEA   ALKAG DINCG  M +++ +A++N  + ESDIDRAL N FS++ +LG
Sbjct  311   SHYAKTLEEAVSYALKAGVDINCGKVMNQHVGAAIKNGNLSESDIDRALFNAFSLRMKLG  370

Query  1431  LFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIG  1252
             LFNG           P  VCS+EH+ LAL+AA+ GIVLLKN    LPL ++ V+SL VIG
Sbjct  371   LFNGDPQKLPSGDIPPSQVCSTEHKNLALQAAQDGIVLLKNTGNTLPLARSNVTSLGVIG  430

Query  1251  PMAN-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKR  1075
             P AN   SL G+Y G PC + + L+ L   I  T + +GC  VACN T    EAV +A  
Sbjct  431   PNANFPPSLMGNYNGPPCVVITPLEALQSSIKNTRFEAGCNIVACNVTK-IPEAVQLASS  489

Query  1074  ADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFA  895
              DYVI+ +GLD  QE E  DR  LLLPG Q  L++++A  + KP++LVL  GGPLDI+FA
Sbjct  490   VDYVIMFMGLDQDQEQEGLDRTDLLLPGMQQTLISKVAEAAKKPIILVLLSGGPLDITFA  549

Query  894   KKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADP  715
             K DPRI ++LW GYPGE GG A+S I+FGD+NP G+LP+TWYP+ FTKVPM DM MRADP
Sbjct  550   KNDPRIGAILWAGYPGEAGGSAISSIIFGDHNPGGKLPVTWYPQEFTKVPMTDMRMRADP  609

Query  714   SRGYPGRTYRFYTGEKVYEFGHGlsyssfsle-llSAPTRISLSQSIKTKLRRSILNRGG  538
             + GYPGRTYRFY G+ VY+FG+GLSYSS S E    A T I L+ S+  + +        
Sbjct  610   ATGYPGRTYRFYNGKPVYQFGYGLSYSSHSYEFEAGAATSIYLNNSLSPQAQP-------  662

Query  537   NEPYVHVDEVSN-----CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQL  373
             N+P     ++++     C  L  S  VS++N+G M G   V+LFSR P++   G P KQL
Sbjct  663   NDPNTLSYDIASLGFNTCGELKISATVSVKNHGPMAGRHPVLLFSRWPST-EHGRPAKQL  721

Query  372   IGFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             +GF  VH+     T+   S+  C+HLS V  +G R+L  G H 
Sbjct  722   VGFQSVHLEAGESTKVEFSLSACEHLSRVMDDGRRVLDKGSHF  764



>ref|XP_006855294.1| hypothetical protein AMTR_s00057p00049120 [Amborella trichopoda]
 gb|ERN16761.1| hypothetical protein AMTR_s00057p00049120 [Amborella trichopoda]
Length=768

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/740 (50%), Positives = 488/740 (66%), Gaps = 28/740 (4%)
 Frame = -3

Query  2454  SYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGIATNG  2275
             S+PFCD SLPI AR+  L+  LT+ EK + L +N   + RLG+P YEWWSE+LHG++  G
Sbjct  37    SFPFCDRSLPINARVSDLIRRLTLPEKTRLLVNNAEGLARLGVPHYEWWSEALHGVSNVG  96

Query  2274  PGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWAPNVN  2095
             PG  F G V  AT FPQVILTAA+FN +LW  I  A + EARAM+N G AGLTFW+PNVN
Sbjct  97    PGTRFGGNVPGATSFPQVILTAASFNSSLWEEIGQAVSTEARAMYNEGLAGLTFWSPNVN  156

Query  2094  VFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEEEDDD  1915
             +F DPRWGRGQETPGEDP VV  YA  YV                   G +   + +D +
Sbjct  157   IFRDPRWGRGQETPGEDPTVVGRYAGRYV------------------RGLQNAFDAKDPN  198

Query  1914  RLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCLMCAY  1735
             RL ++ACCKH TAYDL+ W    R+ F+A V++QD+EDTY+PPF++CV +GRA+ +MC+Y
Sbjct  199   RLKVAACCKHYTAYDLDNWKGVDRFHFDAKVSKQDLEDTYQPPFETCVVEGRAASVMCSY  258

Query  1734  NAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIALKAG  1558
             N VNGIP CA+ +LL K  R DWG  GYI SDCD+V   ++ Q Y  +PE+AA IA+K+G
Sbjct  259   NQVNGIPTCADPNLLTKTIRGDWGLNGYIVSDCDSVGVFYDSQHYTATPEDAAAIAIKSG  318

Query  1557  TDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESFGPKD  1378
              D++CG ++  +   A+    V E DID+AL N F+VQ RLG+F+G    + F   G KD
Sbjct  319   LDLDCGPFLAEHTGEAMRKGKVSERDIDQALTNTFTVQMRLGMFDGNPAAQPFGQLGHKD  378

Query  1377  VCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSLGGDYTGIPC  1201
             VC+  H++LALEAARQGIVLLKN +  LPL   RV ++AVIGP A+ T ++ G+Y G+PC
Sbjct  379   VCTPPHQQLALEAARQGIVLLKNHRAALPLLPARVRTVAVIGPNADATFTMIGNYAGVPC  438

Query  1200  ALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQETED  1021
                S + G+  Y  K  Y  GC  VAC +TD F  A+  A+ +D  I+V+GLD S E E 
Sbjct  439   GYTSPVQGIRRYA-KAIYQPGCRGVACPTTDLFRPAIEAAQNSDATIMVMGLDQSIEAEL  497

Query  1020  HDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGYPGEE  841
              DR  LLLPGHQ  L+  ++  S  P+VLVL  GGP+D+SFAK + R+  ++W GYPG+ 
Sbjct  498   RDREDLLLPGHQQELIQSVSMASRGPVVLVLMSGGPIDVSFAKDNNRVPGIIWAGYPGQA  557

Query  840   GGKALSEIVFGDYNPAGRLPLTWYPESF-TKVPMNDMNMRADPSRGYPGRTYRFYTGEKV  664
             GG+A+++IVFG YNP G+LP+TWYP+ + TK+PM  MNMR DPS+GYPGRTYRFYTG  V
Sbjct  558   GGQAIADIVFGQYNPGGKLPMTWYPQEYVTKLPMTSMNMRPDPSKGYPGRTYRFYTGNTV  617

Query  663   YEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEVSNCNSLAF  484
             Y FGHG SY+ F+  +  AP+ +S+    K    R   N   +   V V   + C+ L  
Sbjct  618   YPFGHGSSYTKFTESIAQAPSMVSVPLDGKHGCFR---NDTVSCQAVRVSH-TRCSGLFM  673

Query  483   SVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSISIEPC  304
             S+ + + N G MDGS VV ++S  P  +  GAP KQL+GF R+H+  N   +    I+ C
Sbjct  674   SLHIDVNNIGPMDGSHVVFVYSTPPQGH--GAPSKQLVGFRRIHLPSNSQQQARFDIDVC  731

Query  303   QHLSIVNVEGSRILPLGDHI  244
             + LSIV+  G + LP+G H+
Sbjct  732   RDLSIVDQFGLKKLPIGSHL  751



>ref|XP_009782575.1| PREDICTED: probable beta-D-xylosidase 7 [Nicotiana sylvestris]
Length=777

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/764 (50%), Positives = 500/764 (65%), Gaps = 34/764 (4%)
 Frame = -3

Query  2505  ATSYSKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRL  2332
             +T  ++P   C    P   S+PFC+ +LPIP R++ LVS L ++EKI +L +    IPRL
Sbjct  24    STESTQPPFSCDSSNPVTISFPFCNATLPIPQRVNDLVSRLKLEEKILQLVNAAPEIPRL  83

Query  2331  GIPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavea  2152
             GI AYEWWSE LHG++ +G G  F+G +K+AT FPQ+ILTA+ F+  LW  IA A   EA
Sbjct  84    GISAYEWWSEGLHGVSRHGKGTLFNGTIKAATMFPQIILTASTFDENLWYRIAQAIGKEA  143

Query  2151  rAMFNSGQ-AGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgk  1975
             RA++N+GQ  G+T WAPN+N+F DPRWGRGQETPGEDPM+V  Y V YVR          
Sbjct  144   RAVYNAGQLKGMTLWAPNINIFRDPRWGRGQETPGEDPMMVGKYGVAYVR----------  193

Query  1974  ngRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTY  1795
                   L G+     +  D  L  SACCKH  A DL+ W+NFSRY+F+A V +QD+ D+Y
Sbjct  194   -----GLQGDSFEGGKLQDGHLQASACCKHFIAQDLDNWYNFSRYTFDARVMKQDLADSY  248

Query  1794  EPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIF  1618
             EPPFKSCVE+G+AS LMCAYN VNGIP CAN DLL K AR  WGF+GYI SDCDAVA + 
Sbjct  249   EPPFKSCVEQGKASSLMCAYNLVNGIPNCANFDLLTKIAREQWGFQGYIVSDCDAVAIMH  308

Query  1617  EYQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFR  1438
              +Q YAK PE+A    L+AG D+NCG+Y+    KSA+E + V ESDIDRAL NLFS++ R
Sbjct  309   THQGYAKEPEDAVAATLRAGMDVNCGSYLKSYTKSAVEKQKVKESDIDRALHNLFSIRMR  368

Query  1437  LGLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAV  1258
             LGLFNG     ++      +VCS +HR LALEAAR GIVLLKN  K LPL K + +SLAV
Sbjct  369   LGLFNGDPRKLEYGDISSVEVCSQQHRALALEAARNGIVLLKNSAKLLPLSKIKTTSLAV  428

Query  1257  IGPMANTSS-LGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIA  1081
             IGP AN S  L G+Y G PC   ++L GL EY+  T Y  GC  V C S     EAV IA
Sbjct  429   IGPKANDSEVLLGNYEGYPCKNVTLLQGLQEYVKNTMYHPGCNFVNCTSA-AIDEAVDIA  487

Query  1080  KRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDIS  901
             K+AD V++++GLD + E E  DR  L LPG Q +L+ E+   ++K ++LVL  GGP+D+S
Sbjct  488   KKADCVVLIMGLDQTLEREKLDRTELGLPGMQESLITEITQAASKSVILVLMCGGPVDVS  547

Query  900   FAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRA  721
             FAK +  I ++LW+GYPGE G  AL+EI+FG++NP GRLP+TWYP+ F K+ M DM MR 
Sbjct  548   FAKDNQNIGAILWVGYPGEGGATALAEILFGEHNPGGRLPVTWYPKEFNKISMTDMRMRP  607

Query  720   DPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRG  541
               S GYPGRTYRFY G KV+EFG+GLSY+++S          S++Q  K   +   +N+ 
Sbjct  608   LSSTGYPGRTYRFYNGPKVFEFGYGLSYTAYSYAFA------SVNQD-KLHFKNPKVNKA  660

Query  540   ---GNEPYVHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQ  376
                G+   + V EV++  CN+   +V+V+++N G   G   V+LF R  +S     P+K 
Sbjct  661   TENGSVLNIAVSEVASEVCNNAMITVKVAVKNQGERAGRHPVLLFLRHSSS-MDEVPRKT  719

Query  375   LIGFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             LIGF  V++     T  +  ++PC+H +  N  GS ++  G + 
Sbjct  720   LIGFKSVNLEAGESTHIAFDVKPCEHFTRANRYGSLVIDEGKYF  763



>ref|XP_009390583.1| PREDICTED: probable beta-D-xylosidase 7 [Musa acuminata subsp. 
malaccensis]
Length=773

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/760 (52%), Positives = 504/760 (66%), Gaps = 36/760 (5%)
 Frame = -3

Query  2493  SKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             S P   C P  P+   Y FC T+LPI  R+  LVS L ++EKI +L D   AIPRLG+P+
Sbjct  26    STPPFACDPINPSTPYYAFCKTTLPIDKRVSDLVSRLNLEEKIPQLGDVAPAIPRLGVPS  85

Query  2319  YEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMF  2140
             Y+WWSE+LHG++  G GI F+G ++SAT FPQVILTAA+FN  LW  I  A  +EARA++
Sbjct  86    YKWWSEALHGLSLWGRGIHFNGTIRSATSFPQVILTAASFNPRLWYRIGQAIGMEARAIY  145

Query  2139  NSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             N GQA GLTFW+PNVN+F DPRWGRGQETPGEDPM  S YAV +VRGLQG          
Sbjct  146   NMGQAEGLTFWSPNVNIFRDPRWGRGQETPGEDPMTASKYAVYFVRGLQGD---------  196

Query  1962  YSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
              S  G R         +L  SACCKH TAYD++ W   SRY+F+A VT QDMEDTY+PPF
Sbjct  197   -SFRGRR-------SGQLKASACCKHYTAYDMDNWKGNSRYTFDARVTAQDMEDTYQPPF  248

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQ  1606
             +SC+++GRA+C+MC+YN VNG+P CA+ +LL K AR  WGF GYI SDCDAVA I+    
Sbjct  249   RSCIKQGRATCVMCSYNRVNGVPTCADYNLLSKTARGLWGFNGYIASDCDAVALIYGADG  308

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             YAKS E++    LKAG D+NCG Y+ +   SA++   + ES+I+RAL NLFS++ RLGLF
Sbjct  309   YAKSAEDSVADVLKAGMDLNCGDYVQKYAGSAVKEGKLSESEINRALHNLFSLRMRLGLF  368

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPM  1246
             NG    +   +     +CS EH+ LALEAA+ GIVLLKN    LPL ++RV+SL VIGP 
Sbjct  369   NGSPKQQASGAIFANQICSKEHQDLALEAAQDGIVLLKNTANLLPLARSRVTSLGVIGPN  428

Query  1245  ANTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             AN    L G+Y G PC   + L  L  Y+  T Y +GC   AC S+    +AV +AK  D
Sbjct  429   ANVGYKLLGNYGGPPCKGITPLGALQTYVGSTRYVAGCDSAACTSSS-INDAVQLAKSVD  487

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
             YVI+ +GLD  QE ED DR  L+LPG Q AL++ +AG + +P++LVL  GGP+DI+FAK 
Sbjct  488   YVIMFMGLDQDQEREDLDRVDLVLPGMQQALISNVAGAAKRPIILVLLSGGPVDITFAKL  547

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSR  709
             D RI  +LW GYPGE GG A++ I+FG++NP GRLP+TWYP+ FT+VPM DM MRADP+ 
Sbjct  548   DGRIGGILWAGYPGEAGGLAIARIIFGEHNPGGRLPVTWYPQEFTRVPMIDMRMRADPAS  607

Query  708   GYPGRTYRFYTGEKVYEFGHGlsyssfsle-llSAPTRISL--SQSIKTKLRRSILNRGG  538
             GYPGRTYRFYTG+ VY FGHGLSY+++S E    A T I L  SQ ++      I     
Sbjct  608   GYPGRTYRFYTGKPVYRFGHGLSYTTYSYEFEAEAVTSIYLNNSQPLQATANSDI-----  662

Query  537   NEPYVHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGF  364
               P  +++ + +  C  L  S  VS++N+G + G   V+LFSR P+   G A  KQLIGF
Sbjct  663   --PSYNIESIGSDACGKLKLSAAVSVKNHGPIAGKHPVLLFSRWPSLQHGRA-VKQLIGF  719

Query  363   DRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
               VH+     T+   S+ PCQ LS    +G+R+L  G H 
Sbjct  720   KSVHLEAGESTKVVFSLWPCQQLSRAMGDGTRVLDRGSHF  759



>ref|XP_002452540.1| hypothetical protein SORBIDRAFT_04g027700 [Sorghum bicolor]
 gb|EES05516.1| hypothetical protein SORBIDRAFT_04g027700 [Sorghum bicolor]
Length=784

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/755 (51%), Positives = 492/755 (65%), Gaps = 25/755 (3%)
 Frame = -3

Query  2493  SKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             S+P   C      + PFCDT+LPI  R+  LVS LTV EKI +L D + AIPRLG+PAY+
Sbjct  36    SEPPYTCGAGAPPNIPFCDTALPIDRRVDDLVSRLTVAEKISQLGDESPAIPRLGVPAYK  95

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSE+LHG+A  G GI  DG +++AT FPQVILTAA+FN  LW  I     VEARA++N+
Sbjct  96    WWSEALHGVANAGRGIHLDGPLRAATSFPQVILTAASFNPHLWYRIGQVIGVEARAVYNN  155

Query  2133  GQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYS  1957
             GQA GLTFWAPN+NVF DPRWGRGQETPGEDP +   YA  +VRG+Q           Y 
Sbjct  156   GQAEGLTFWAPNINVFRDPRWGRGQETPGEDPTMTGKYAAVFVRGVQ----------GYG  205

Query  1956  LSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKS  1777
             ++G   P    D   L  SACCKH TAYDLE W   +RY ++A VT QD+EDTY PPFKS
Sbjct  206   VAG---PVNSTD---LEASACCKHFTAYDLENWKGITRYVYDAKVTAQDLEDTYNPPFKS  259

Query  1776  CVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYA  1600
             CVE G AS +MC+YN VNG+P CA+ +LL K AR  WGF GYITSDCDAV+ I + Q YA
Sbjct  260   CVEDGHASGIMCSYNRVNGVPTCADYNLLSKTARQSWGFYGYITSDCDAVSIIHDAQGYA  319

Query  1599  KSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNG  1420
             K+ E+A    LKAG D+NCG Y+ +   SAL+   + E DI+RAL NLF+V+ RLGLFNG
Sbjct  320   KTSEDAVADVLKAGMDVNCGGYVQKYGASALQQGKITEQDINRALHNLFTVRMRLGLFNG  379

Query  1419  KAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN  1240
                  ++ + GP  VC+ EH+ LALEAA+ GIVLLKN+   LPL K+ V+SLAVIG  AN
Sbjct  380   DPRRNRYGNIGPDQVCTQEHQDLALEAAQDGIVLLKNDGGALPLSKSGVASLAVIGFNAN  439

Query  1239  -TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYV  1063
               +SL G+Y G PC   + L  L  Y+  TS+ +GC   ACN T    EAV  A  AD V
Sbjct  440   NATSLLGNYFGPPCVTVTPLQVLQGYVKDTSFVAGCNSAACNVTT-IPEAVQAASSADSV  498

Query  1062  IVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDP  883
             ++ +GLD +QE E+ DR  L LPG Q  L+  +A  + KP++LVL  GGP+D+SFAK +P
Sbjct  499   VLFMGLDQNQEREEVDRLDLTLPGQQQTLIESVANAAKKPVILVLLCGGPVDVSFAKTNP  558

Query  882   RIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGY  703
             +I ++LW GYPGE GG A+++++FG++NP GRLP+TWYP+ FTKVPM DM MRADP+ GY
Sbjct  559   KIGAILWAGYPGEAGGIAIAQVLFGEHNPGGRLPVTWYPQDFTKVPMTDMRMRADPATGY  618

Query  702   PGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPY-  526
             PGRTYRFY G  V+ FG+GLSYS +S   ++ P     S S    L+      GG   Y 
Sbjct  619   PGRTYRFYRGPTVFNFGYGLSYSKYSHRFVTKPPP---SMSNVAGLKALATTAGGVATYD  675

Query  525   VHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAG-GAPQKQLIGFDRVHV  349
             V       C+ L F   V ++N+G MDG   V++F R P +  G G P +QLIGF  +H+
Sbjct  676   VEAIGSETCDRLKFPAVVRVQNHGPMDGKHPVLVFLRWPNATDGSGRPARQLIGFQSLHL  735

Query  348   SGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
                        + PC+H S    +G +++  G H 
Sbjct  736   RATQTAHVEFEVSPCKHFSRATEDGRKVIDQGSHF  770



>ref|XP_011016128.1| PREDICTED: probable beta-D-xylosidase 7 [Populus euphratica]
Length=777

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/757 (52%), Positives = 493/757 (65%), Gaps = 43/757 (6%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P+   YPFC T LPI  R+  LVS LT+DEKI +L D    IPRLGIPAYEWWSE+LHG+
Sbjct  37    PSTKLYPFCQTKLPISQRVEDLVSRLTLDEKISQLVDTAPGIPRLGIPAYEWWSEALHGV  96

Query  2286  A---TNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GL  2119
             A   T   GI F+G ++ AT FPQVILTAA+F+  LW  I      EAR ++N+GQA G+
Sbjct  97    ALQTTVRQGIRFNGTIRFATSFPQVILTAASFDAHLWYRIGQVIGKEARGIYNAGQATGM  156

Query  2118  TFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRM  1939
             TFWAPN+N+F DPRWGRGQETPGEDP V   YAV YVRG+QG           S  G  +
Sbjct  157   TFWAPNINIFRDPRWGRGQETPGEDPFVAGKYAVSYVRGVQGD----------SFGGGTL  206

Query  1938  PEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGR  1759
              E+      L  SACCKH TAYDL+ W   +R+ F+A VT QD+ DTY+PPF+SC+++G+
Sbjct  207   GEQ------LQASACCKHFTAYDLDKWKGMNRFIFDAQVTLQDLADTYQPPFQSCIQEGK  260

Query  1758  ASCLMCAYNAVNGIPACANKDLL-EKARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEA  1582
             AS +MCAYN VNG+P CA+ +LL +KAR  WGF GYITSDCDAVA I + Q YAKSPE+A
Sbjct  261   ASGIMCAYNRVNGVPNCADYNLLSKKARGQWGFYGYITSDCDAVAIIHDDQGYAKSPEDA  320

Query  1581  AGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRK  1402
                 LKAG D+NCG Y+    KSA++ K + ES+IDRAL NLFS++ RLGLFNG    + 
Sbjct  321   VADVLKAGMDVNCGDYLKNYTKSAVKKKKLPESEIDRALHNLFSIRMRLGLFNGNPAKQP  380

Query  1401  FESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTSS-LG  1225
             + +  P  VCS EH+ LAL+AA+ GIVLLKN  K LPL K    SLAVIGP AN S+ L 
Sbjct  381   YGNIAPDQVCSQEHQALALKAAQDGIVLLKNPDKLLPLSKLETKSLAVIGPNANNSTKLL  440

Query  1224  GDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGL  1045
             G+Y G PC   + L GL  YI  T Y  GC  VAC+S     +AV I K AD VI+V+GL
Sbjct  441   GNYFGPPCKTVTPLQGLQNYIKNTRYHPGCSRVACSSAS-INQAVKITKAADQVILVMGL  499

Query  1044  DLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVL  865
             D +QE EDHDR  L+LPG Q  L+  +A  + KP+VLVL  GGP+D+SFAK D  I S++
Sbjct  500   DQTQEKEDHDRVDLVLPGKQRELIAAVAKAAKKPVVLVLFCGGPVDVSFAKYDQNIGSII  559

Query  864   WIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYR  685
             W GYPGE GG AL++I+FGD+NP GRLP+TWYP+ FTKVPM DM MR   S GYPGRTYR
Sbjct  560   WAGYPGEAGGTALAQIIFGDHNPGGRLPMTWYPQDFTKVPMTDMRMRPQLSSGYPGRTYR  619

Query  684   FYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEVS  505
             FY G+KV+EFG+GLSYS++S         ++     K  LR S      N   +    +S
Sbjct  620   FYNGKKVFEFGYGLSYSNYSY-------ELASDTQNKLHLRASSNQLTKNSNTIRHKLIS  672

Query  504   N-----CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGN  340
             +     C    F+V V ++N+GGM G   V+LF R         P K+L+GF  V+++  
Sbjct  673   DIGKELCEKSKFTVTVRVKNHGGMAGKHPVLLFVRQANP-GNERPIKKLVGFQTVNLNAG  731

Query  339   GVTETSISIEPCQHLS-------IVNVEGSRILPLGD  250
                E    + PC+HLS       +V  EGS+   +GD
Sbjct  732   ENAEIQYELSPCEHLSSPDDRGLMVMEEGSQFFLIGD  768



>ref|XP_010676949.1| PREDICTED: probable beta-D-xylosidase 7 [Beta vulgaris subsp. 
vulgaris]
Length=782

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/743 (50%), Positives = 503/743 (68%), Gaps = 26/743 (3%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P+  ++ FC   LPI  R   LV+ LT DEK+ +L +   AIPRLGIPAY+WWSE+LHG+
Sbjct  41    PSTDTFAFCRVDLPIRQRAKDLVARLTFDEKVFQLVNTAPAIPRLGIPAYQWWSEALHGV  100

Query  2286  ATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GLTFW  2110
             A  G G+TF G +++AT FPQVILTAA+F+  LW  I  A   EARA +N GQA G+TFW
Sbjct  101   AAVGRGVTFSGTIRNATSFPQVILTAASFDVHLWYRIGQAIGREARAFYNEGQAKGMTFW  160

Query  2109  APNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEE  1930
             APN+N+F DPRWGRGQETPGEDP V   YA+++VRGLQG           S  G +M   
Sbjct  161   APNINIFRDPRWGRGQETPGEDPWVAGKYAMQFVRGLQGD----------SFEGGQM---  207

Query  1929  EEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASC  1750
                   L  SACCKH TAYDL+ W+ F+RY F+A VT QDM DTY+PPF+SC+ +GRAS 
Sbjct  208   ---RGHLQASACCKHFTAYDLDRWNGFTRYRFDAQVTAQDMADTYQPPFESCIHQGRASG  264

Query  1749  LMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGI  1573
             +MCAYN VNG+P CA+ +LL + AR  W F+GYITSDCDAV+ I + Q +A++PE+A G 
Sbjct  265   IMCAYNRVNGVPNCADYNLLTRTAREKWSFDGYITSDCDAVSLIHQAQGFAETPEDAVGD  324

Query  1572  ALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFES  1393
              LKAG D+NCG+Y+L   KSA+E   VVE+++DRAL NLF+V+ RLGLFNG   + ++ S
Sbjct  325   VLKAGMDLNCGSYLLNYTKSAVEQGKVVEAEVDRALENLFAVRMRLGLFNGNPKDLQYGS  384

Query  1392  FGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTS-SLGGDY  1216
              GP DVC+ E + LALEAARQGIVLLKN+ K LPL K +  SLAVIGP A+ + +L G+Y
Sbjct  385   LGPADVCTQESKALALEAARQGIVLLKNKDKLLPLPKEQTFSLAVIGPNADAALTLLGNY  444

Query  1215  TGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLS  1036
              G PC   S+L  L  Y+  T Y  GC +VAC+S     EA +IA+ ADYV++++GLD +
Sbjct  445   RGRPCNSISLLQALQNYVENTIYHPGCENVACSSAS-IEEASNIAEAADYVVLIMGLDTT  503

Query  1035  QETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIG  856
             QETE  DR +L+LPG Q  L+ ++A V+ +P+VLVL  GGP+D++FAK D  I  ++W G
Sbjct  504   QETEGLDRLNLVLPGEQHNLIQQVARVAKRPVVLVLLCGGPVDVTFAKIDANIGGIIWAG  563

Query  855   YPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFYT  676
             YPG+ GG AL+EI+FGDYNP G+LP+TWYP+ F +VPM DM MRADPS GYPGRTY+FY 
Sbjct  564   YPGQAGGVALAEIIFGDYNPGGKLPMTWYPQQFVEVPMTDMRMRADPSSGYPGRTYKFYQ  623

Query  675   GEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHV--DEVSN  502
             G  V+EFG GLSY+S++   +S          + T     ++    +  Y  V   +   
Sbjct  624   GSTVFEFGDGLSYTSYNYNFISVTPNTQYLNLVGTI---KVVEYSYSTKYAIVLDKDSGP  680

Query  501   CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETS  322
             C+++ F   + + N G + G   V+L++R   +   G+P K+L+GF+ V+++    TE  
Sbjct  681   CSTMKFIATIGVTNEGDVAGKHPVLLYARKENA-INGSPIKKLVGFESVYLNAGEQTEIQ  739

Query  321   ISIEPCQHLSIVNVEGSRILPLG  253
               + PC+HLS  + +G  ++  G
Sbjct  740   FELNPCKHLSRADQDGVMVVEEG  762



>gb|EYU33329.1| hypothetical protein MIMGU_mgv1a001598mg [Erythranthe guttata]
Length=787

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/750 (51%), Positives = 496/750 (66%), Gaps = 30/750 (4%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P   ++ FC+T+L I  R+  LVS LT+DEKI +L  +  A+PRLG+PAYEWWSE+LHG+
Sbjct  39    PQTRTFRFCETTLSIHQRVQDLVSRLTLDEKISQLVSSAPAVPRLGVPAYEWWSEALHGV  98

Query  2286  ATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaa-vearAMFNSGQA-GLTF  2113
             +  G G++F+G +  AT FPQVIL+A+ F+  L  ++A  A   EARAM+N GQ  G+TF
Sbjct  99    SGYGRGVSFNGRISGATSFPQVILSASTFDSRLCTALARYAIGKEARAMYNEGQVKGMTF  158

Query  2112  WAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPE  1933
             WAPNVN+F DPRWGRG ETPGEDP+V   YAV +VRG+QG                ++  
Sbjct  159   WAPNVNIFRDPRWGRGHETPGEDPLVAGKYAVAFVRGIQGDIYNY----------GKVEG  208

Query  1932  EEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRAS  1753
              + ++  L  SACCKH TAYDL+ W   SR+ F+A VT+QD+ DTY+PPFKSC+++GRAS
Sbjct  209   RQINNGHLQASACCKHFTAYDLDSWKGVSRFGFDAKVTKQDLADTYQPPFKSCIQEGRAS  268

Query  1752  CLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAG  1576
              +MCAYN VNG+P CA+ DLL K AR +WGF GYITSDCDAV+ I +  +YA+ PE+A  
Sbjct  269   GIMCAYNRVNGVPNCADYDLLTKTARGEWGFHGYITSDCDAVSIIRDNHKYARLPEDAVA  328

Query  1575  IALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFE  1396
               LKAG D+NCGTY+    KSA++ K V ESDIDRAL NLFSV+ RLGLFNG      F 
Sbjct  329   DVLKAGMDVNCGTYLKNYTKSAIQQKKVRESDIDRALHNLFSVRMRLGLFNGNPNKNIFG  388

Query  1395  SFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTS-SLGGD  1219
               GP  VC+ +H++LALE+AR GIVLLKN    LP  K + ++LAVIGP AN + +L G+
Sbjct  389   QIGPNQVCTQQHQQLALESARNGIVLLKNSANLLPFPK-KTATLAVIGPNANNAHALLGN  447

Query  1218  YTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDL  1039
             Y G PC    +   L  Y     Y +GC D+ C   D    AV  AK+ADYV++V+GLD 
Sbjct  448   YEGPPCKSVEIFKALQGYASNVLYHNGCNDMGCTFAD-IGSAVGTAKKADYVVLVMGLDQ  506

Query  1038  SQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWI  859
             SQE EDHDR  L+LPG Q  L+  +A  S KP+VLVL  GGP+D+SFAK DP+I S+LW 
Sbjct  507   SQEREDHDRVDLVLPGQQEGLIRAVAAASKKPVVLVLVCGGPVDVSFAKGDPKIGSILWA  566

Query  858   GYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFY  679
             GYPGE GG ALSEI+FG++NP G+LP+TWYP+ F +VPM DM MR DPS  YPGRTYRFY
Sbjct  567   GYPGEAGGVALSEILFGEHNPGGKLPVTWYPKDFIRVPMTDMRMRPDPSSRYPGRTYRFY  626

Query  678   TGEKVYEFGHGlsyssfslell-SAPTRISLSQ----SIKTKLRRSILNRGGNEPYVHVD  514
              G KV+EFG+GLSY+ +S E + S P  I L+Q    S +     SI+        + V 
Sbjct  627   NGPKVFEFGYGLSYTKYSYEFMPSTPNTIHLNQLTPNSHQATDETSIIRS------LSVS  680

Query  513   EVS--NCNSLAFSVRVSLRNNGGMDGSRVVMLFSR-APTSYAGGAPQKQLIGFDRVHVSG  343
             E+   NC  L FS  V + N G M G   V+LF R   TS   G P K+L+GF+ V +  
Sbjct  681   EIGTHNCEKLKFSTHVGVENTGNMTGKHPVLLFVRHETTSNINGRPSKELVGFESVSLDA  740

Query  342   NGVTETSISIEPCQHLSIVNVEGSRILPLG  253
                 E    ++PC++LS  N +G  ++  G
Sbjct  741   RERAEIEFVLDPCENLSTANEDGVMVIEEG  770



>gb|KHG13360.1| putative beta-D-xylosidase 7 -like protein [Gossypium arboreum]
Length=769

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/764 (51%), Positives = 499/764 (65%), Gaps = 43/764 (6%)
 Frame = -3

Query  2493  SKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             ++P   C    P   +Y FC T LPI  R   LVS LT+DEKI +L ++  AIPRLGIPA
Sbjct  21    TQPPFACDSSNPETKNYLFCQTELPITQRARDLVSRLTLDEKISQLVNSAPAIPRLGIPA  80

Query  2319  YEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMF  2140
             YEWWSE+LHG++  GPG+ FDG +K+AT FPQVILTAA+F+   W  I  A   EARAM+
Sbjct  81    YEWWSEALHGVSNVGPGVRFDGTIKAATSFPQVILTAASFDPYQWYRIGQAIGREARAMY  140

Query  2139  NSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             N+G+A G+TFWAPN+N+F DPRWGRGQETPGEDP VV  YAV YVRG+QG          
Sbjct  141   NAGEANGMTFWAPNINIFRDPRWGRGQETPGEDPFVVGKYAVSYVRGVQGD---------  191

Query  1962  YSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
              +  G ++         L  SACCKH TAYDL+ W   +R+ F+A VT QD+ DTY+PPF
Sbjct  192   -TFQGGKL------HGHLQASACCKHFTAYDLDNWKGTNRFLFDARVTVQDLADTYQPPF  244

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQ  1606
             + CV  GRAS +MCAYN VNG+P+CA+  LL K  R +W F+GY+TSDCDAVA I   Q 
Sbjct  245   EKCVRDGRASGVMCAYNRVNGVPSCADSSLLFKTVRGEWDFKGYVTSDCDAVAIIHNDQG  304

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             YAK+PE+A    LKAG D+NCG+Y+    KSA+  K + ES +DRAL NL++V+ RLGLF
Sbjct  305   YAKAPEDAVVDVLKAGMDLNCGSYLQNYTKSAVLQKKLPESQVDRALHNLYAVRMRLGLF  364

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPM  1246
             NG  V   F + G   +CS EH+ LALEAAR GIVLLKN+ K LPL K+ +S LAVIGP 
Sbjct  365   NGNPVPNPFGNIGADQICSPEHQILALEAARNGIVLLKNDAKLLPLPKSTMS-LAVIGPN  423

Query  1245  ANT-SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             AN+  +L G+Y G PC   + L  L  Y+  T Y  GC  V+C ST    +AV IAKRAD
Sbjct  424   ANSPQTLIGNYAGPPCKSVTPLQALESYVKNTVYHPGCDTVSC-STGAIDKAVDIAKRAD  482

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
             YV++++GLD ++E E  DR  L LPG Q  L+  +A  + +P+VLVL  GGP+DISFAK 
Sbjct  483   YVVLIMGLDQTEEREALDRVDLFLPGRQQELIVSVAKAAKRPVVLVLLSGGPIDISFAKD  542

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSR  709
             DPRI  + W GYPGE GG AL+E++FGD+NP GRLP+TWYP+ FTKVPM DM MR + S 
Sbjct  543   DPRIGGIFWAGYPGEGGGNALAEVIFGDHNPGGRLPVTWYPQDFTKVPMTDMRMRPESSL  602

Query  708   GYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISL-------SQSIKTKLRRSIL  550
              YPGRTYRFY G+ V+EFG+GLSYS +S       TR+S        S S+ TK     +
Sbjct  603   DYPGRTYRFYKGDTVFEFGYGLSYSKYSYSF----TRVSQNNLYLNHSSSLHTKETSDSV  658

Query  549   NRGGNEPYVHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQ  376
                    Y+ V EV    C+    +V V ++NNG + G   V+L+ R   ++  G P+KQ
Sbjct  659   R------YMLVSEVGAEICDERKITVHVGVKNNGELAGKHPVLLYVRH-GNHGNGRPKKQ  711

Query  375   LIGFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             LIGF  V +SG  + E    + PC+HLS  N  G  ++  G H 
Sbjct  712   LIGFRSVILSGGEMGEIQFEVNPCEHLSRANEYGLMVMEEGRHF  755



>ref|XP_006354008.1| PREDICTED: probable beta-D-xylosidase 7-like [Solanum tuberosum]
Length=774

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/760 (49%), Positives = 496/760 (65%), Gaps = 28/760 (4%)
 Frame = -3

Query  2502  TSYSKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLG  2329
             T  ++P   C    P  SS+PFC+ +LPI  R++ LVS LTVDEKI +L +    IPRLG
Sbjct  22    TESTEPPFSCDSSNPNTSSFPFCNAALPISQRVNDLVSRLTVDEKILQLVNGAPEIPRLG  81

Query  2328  IPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavear  2149
             I AYEWWSE LHGI+ +G G  F+G +K+AT FPQ+ILTA++F+  LW  IA A   EAR
Sbjct  82    ISAYEWWSEGLHGISRHGKGTLFNGTIKAATQFPQIILTASSFDENLWYRIAQAIGREAR  141

Query  2148  AMFNSGQ-AGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkn  1972
             A++N+GQ  G+T WAPN+N+  DPRWGRGQETPGEDPM+V  Y V YVR           
Sbjct  142   AVYNAGQLKGITLWAPNINILRDPRWGRGQETPGEDPMMVGKYGVAYVR-----------  190

Query  1971  gRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYE  1792
                  L G+     +  D  L  SACCKH  A D++ WHNFSRY+F+A V +QD+ D+YE
Sbjct  191   ----GLQGDSFEGGKLKDGHLQTSACCKHFIAQDMDNWHNFSRYTFDAQVLKQDLADSYE  246

Query  1791  PPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFE  1615
             PPFK+CVE+G+AS +MCAYN VNGIP CAN DLL   AR  WG +GYI SDCDAV  ++ 
Sbjct  247   PPFKNCVEQGKASSVMCAYNLVNGIPNCANFDLLTTTARGKWGLQGYIVSDCDAVEKMYT  306

Query  1614  YQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRL  1435
              Q YAK PE+A    LKAG D+NCG+++ +  KSALE + V ESDI+RAL NLFSV+ RL
Sbjct  307   EQHYAKEPEDAVAATLKAGMDVNCGSHLKKYTKSALEKQKVKESDINRALHNLFSVRMRL  366

Query  1434  GLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVI  1255
             GLFNG     ++      +VCS EHR LA+EAAR G VLLKN  + LPL K + +SLAVI
Sbjct  367   GLFNGDPSKLEYGDISAAEVCSQEHRALAVEAARSGSVLLKNSNRLLPLSKMKATSLAVI  426

Query  1254  GPMANTSS-LGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAK  1078
             GP AN S  L G+Y G  C   ++  GL  Y+  T Y  GC  + C S     EAV+IAK
Sbjct  427   GPKANDSEVLLGNYEGYSCKNVTLFQGLQGYVANTMYHPGCDFINCTSP-AIDEAVNIAK  485

Query  1077  RADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISF  898
             +ADYV++V+GLD + E E  DR  L LPG Q  L+  +A  ++KP++LVL  GGP+D++F
Sbjct  486   KADYVVLVMGLDQTLEREKFDRTELGLPGMQEKLITAIAEAASKPVILVLMCGGPVDVTF  545

Query  897   AKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRAD  718
             AK + +I  +LW+GYPGE G  AL++I+FG++NP GR P+TWYP+ F KVPMNDM MR +
Sbjct  546   AKDNQKIGGILWVGYPGEGGAAALAQILFGEHNPGGRSPVTWYPKEFNKVPMNDMRMRPE  605

Query  717   PSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGG  538
              S GYPGRTYRFY G KV+EFG+GLSY+++S         +S +Q +    + +     G
Sbjct  606   SSSGYPGRTYRFYNGPKVFEFGYGLSYTNYSYTF----ASVSKNQLLFKNPKINKATENG  661

Query  537   NEPYVHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGF  364
             +   + V +V    CN+   +++V+++N G M G   V+LF +  ++     P+K LIGF
Sbjct  662   SVLNIAVSDVGPEVCNNAMITIKVAVKNQGEMAGKHPVLLFLKH-SNTVDEVPRKTLIGF  720

Query  363   DRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
               V++     T  +  ++PC+H +  N +G+ ++  G H 
Sbjct  721   KSVNLEAGANTHVTFDVKPCEHFTRANRDGTLVIDEGKHF  760



>ref|XP_007018825.1| Glycosyl hydrolase family protein isoform 3 [Theobroma cacao]
 gb|EOY16050.1| Glycosyl hydrolase family protein isoform 3 [Theobroma cacao]
Length=1593

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/754 (53%), Positives = 506/754 (67%), Gaps = 43/754 (6%)
 Frame = -3

Query  2493  SKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             ++P   C P  P+  +YPFC T+LPI  R   LVS LT+DEKI +L ++  AIPRLGIPA
Sbjct  24    TQPPFSCDPSDPSTKNYPFCQTTLPISQRARDLVSRLTLDEKISQLVNSAPAIPRLGIPA  83

Query  2319  YEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMF  2140
             YEWWSE+LHG+A  GPGI FDG++K+AT FPQVILTAA+F+   W  I      EARA++
Sbjct  84    YEWWSEALHGVANVGPGIKFDGSIKAATSFPQVILTAASFDAYQWYRIGQVIGREARAIY  143

Query  2139  NSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             N+GQA G+TFWAPN+N+F DPRWGRGQETPGEDP+V   YAV YVRG+QG          
Sbjct  144   NAGQARGMTFWAPNINIFRDPRWGRGQETPGEDPLVTGKYAVSYVRGVQGDI--------  195

Query  1962  YSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
                 G ++      +  L  SACCKH TAYDL+ W   +R+ F+A VT QD+ DTY+PPF
Sbjct  196   --FQGGKL------NGHLQASACCKHFTAYDLDNWKGVNRFVFDARVTVQDLADTYQPPF  247

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQ  1606
             KSCV+ GRAS +MCAYN VNG+P+CA+ +LL K  R +W F+GYITSDCDAVA I   Q 
Sbjct  248   KSCVQDGRASGIMCAYNRVNGVPSCADSNLLSKTLRGEWDFKGYITSDCDAVAIIHNDQG  307

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             YAKSPE+A    LKAG D+NCG+Y+ +  KSA+  K + ES+IDRAL NLF+V+ RLGLF
Sbjct  308   YAKSPEDAVVDVLKAGMDLNCGSYLQKYSKSAVLQKKLPESEIDRALHNLFAVRMRLGLF  367

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPM  1246
             NG      F + G   VCS EH+ LALEAAR GIVLLKNE+K LPL K  VS LAVIGP 
Sbjct  368   NGNPAQHPFGNIGTDQVCSPEHQILALEAARNGIVLLKNEEKLLPLPKATVS-LAVIGPN  426

Query  1245  ANT-SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             AN+  +L G+Y G PC   + L  L  Y+  T Y  GC  V+C ST    +AV IAK+AD
Sbjct  427   ANSPQTLLGNYAGPPCKSVTPLQALQSYVKNTVYHPGCDTVSC-STGVIDKAVDIAKQAD  485

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
             YV++++GLD +QE E+ DR  LLLPG Q  L+  +A  + +P+VLVL  GGP+D+SFAK 
Sbjct  486   YVVLIMGLDQTQEKEELDRVDLLLPGRQQELITSVAKAAKRPVVLVLLSGGPIDVSFAKD  545

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSR  709
             DPRI  + W GYPGE GG AL+EIVFGD+NP GRLP+TWYP+ FTKVPM DM MR + S 
Sbjct  546   DPRIGGIFWAGYPGEGGGIALAEIVFGDHNPGGRLPVTWYPQEFTKVPMTDMRMRPESSS  605

Query  708   GYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISL-------SQSIKTKLRRSIL  550
              YPGRTYRFY G+KV+EFG+GLSYS +S E     TR+S        S S  T +    +
Sbjct  606   EYPGRTYRFYKGDKVFEFGYGLSYSKYSYEF----TRVSQNNVYLNHSSSFHTTVTSDSV  661

Query  549   NRGGNEPYVHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQ  376
                    Y  V E+    C+   F+V V ++N+G M G   V+LF+R   ++  G P+KQ
Sbjct  662   R------YKLVSELGAEVCDQRKFTVCVGVKNHGEMAGKHPVLLFARH-GNHGDGRPKKQ  714

Query  375   LIGFDRVHVSGNGVTETSISIEPCQHLSIVNVEG  274
             L+GF  V +S   + E    + PC+HLS  N  G
Sbjct  715   LVGFQSVILSAGEMAEIQFEVSPCEHLSRANEYG  748


 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/764 (51%), Positives = 507/764 (66%), Gaps = 39/764 (5%)
 Frame = -3

Query  2493  SKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             ++P   C    P   SYPFC T+LPI  R+  L+S LT+DEKI +L ++   IPRLGIP 
Sbjct  841   TQPPFSCDTSDPRTKSYPFCKTTLPINQRVQDLISRLTLDEKISQLVNSAPPIPRLGIPG  900

Query  2319  YEWWSESLHGIA---TNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavear  2149
              EWWSE+LHG+A   +   GI F+G ++SAT FPQVILTAA+F+  LW  I  A  +EAR
Sbjct  901   DEWWSEALHGVAFLASVSQGIRFNGTIQSATSFPQVILTAASFDAHLWFRIGQAIGIEAR  960

Query  2148  AMFNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkn  1972
              ++N+GQA G+TFWAPN+N++ DPRWGRGQETPGEDP+V   YAV +VRG+QG       
Sbjct  961   GIYNAGQARGMTFWAPNINIYRDPRWGRGQETPGEDPLVTGKYAVSFVRGIQGD------  1014

Query  1971  gRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYE  1792
                 S  G  + E       L +SACCKH TAYDL+ W   +R+ FNA V+ QD+ DTY+
Sbjct  1015  ----SFEGGMLGEH------LQVSACCKHFTAYDLDNWKGVNRFVFNAKVSLQDLADTYQ  1064

Query  1791  PPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFE  1615
             PPF+SC+++G+AS +MCAYN VNG+P CA+ +LL K AR  WGF GYITSDCDAV+ + E
Sbjct  1065  PPFQSCIQQGKASGIMCAYNRVNGVPNCADYNLLSKTARGQWGFNGYITSDCDAVSIMHE  1124

Query  1614  YQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRL  1435
              Q YAK PE+A    LKAG D+NCG Y+    KSA++ + +  S+IDRAL NLFSV+ RL
Sbjct  1125  KQGYAKVPEDAVADVLKAGMDVNCGNYLKNYTKSAVKKRKLPMSEIDRALHNLFSVRMRL  1184

Query  1434  GLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVI  1255
             GLFNG    + F + G   VCS EH+ LALEAAR GIVLLKN    LPL KT+ +SLAVI
Sbjct  1185  GLFNGNPTKQPFGNIGSDQVCSQEHQNLALEAARNGIVLLKNTDSLLPLSKTKTTSLAVI  1244

Query  1254  GPMANTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNS--TDGFAEAVSI  1084
             GP AN++ +L G+Y G PC   + L  L  Y   T Y  GC  V C+S  TD   +AV I
Sbjct  1245  GPNANSAKTLVGNYAGPPCKSITPLQALQSYAKDTRYHPGCSAVNCSSALTD---QAVKI  1301

Query  1083  AKRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDI  904
             AK AD+V++V+GLD +QE EDHDR  L+LP  Q  L++ +A  +  P++LVL  GGP+DI
Sbjct  1302  AKGADHVVLVMGLDQTQEREDHDRVDLVLPAKQQNLISSIARAAKNPVILVLLSGGPVDI  1361

Query  903   SFAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMR  724
             +FAK D  I S+LW GYPGE GG AL+EI+FGD+NP GRLP+TWYP+SF KVPM DM MR
Sbjct  1362  TFAKYDQHIGSILWAGYPGEAGGLALAEIIFGDHNPGGRLPVTWYPQSFIKVPMTDMRMR  1421

Query  723   ADPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslell-SAPTRISLS-QSIKTKLRRSIL  550
              +PS GYPGRTYRFY G KV+EFG+GLSYS +S E L     ++ L+ QS    +  S  
Sbjct  1422  PEPSSGYPGRTYRFYQGPKVFEFGYGLSYSKYSYEFLPVTQNKVYLNHQSCNKMVENSNP  1481

Query  549   NRGGNEPYVHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQ  376
              R     Y+ V E++   C+   F V+V ++N+G M G+  V+LF R       G P KQ
Sbjct  1482  VR-----YMPVSEIAKELCDKRKFPVKVGVQNHGEMAGTHPVLLFVRQ-AKVGNGRPMKQ  1535

Query  375   LIGFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             L+GF  V+++     E    + PC+HLS  N +G  ++  G H 
Sbjct  1536  LVGFHSVNLNAGERVEIEFELSPCEHLSRANEDGLMVIEEGPHF  1579



>ref|XP_007018823.1| Glycosyl hydrolase family protein isoform 1 [Theobroma cacao]
 gb|EOY16048.1| Glycosyl hydrolase family protein isoform 1 [Theobroma cacao]
Length=1593

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/754 (53%), Positives = 506/754 (67%), Gaps = 43/754 (6%)
 Frame = -3

Query  2493  SKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             ++P   C P  P+  +YPFC T+LPI  R   LVS LT+DEKI +L ++  AIPRLGIPA
Sbjct  24    TQPPFSCDPSDPSTKNYPFCQTTLPISQRARDLVSRLTLDEKISQLVNSAPAIPRLGIPA  83

Query  2319  YEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMF  2140
             YEWWSE+LHG+A  GPGI FDG++K+AT FPQVILTAA+F+   W  I      EARA++
Sbjct  84    YEWWSEALHGVANVGPGIKFDGSIKAATSFPQVILTAASFDAYQWYRIGQVIGREARAIY  143

Query  2139  NSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             N+GQA G+TFWAPN+N+F DPRWGRGQETPGEDP+V   YAV YVRG+QG          
Sbjct  144   NAGQARGMTFWAPNINIFRDPRWGRGQETPGEDPLVTGKYAVSYVRGVQGDI--------  195

Query  1962  YSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
                 G ++      +  L  SACCKH TAYDL+ W   +R+ F+A VT QD+ DTY+PPF
Sbjct  196   --FQGGKL------NGHLQASACCKHFTAYDLDNWKGVNRFVFDARVTVQDLADTYQPPF  247

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQ  1606
             KSCV+ GRAS +MCAYN VNG+P+CA+ +LL K  R +W F+GYITSDCDAVA I   Q 
Sbjct  248   KSCVQDGRASGIMCAYNRVNGVPSCADSNLLSKTLRGEWDFKGYITSDCDAVAIIHNDQG  307

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             YAKSPE+A    LKAG D+NCG+Y+ +  KSA+  K + ES+IDRAL NLF+V+ RLGLF
Sbjct  308   YAKSPEDAVVDVLKAGMDLNCGSYLQKYSKSAVLQKKLPESEIDRALHNLFAVRMRLGLF  367

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPM  1246
             NG      F + G   VCS EH+ LALEAAR GIVLLKNE+K LPL K  VS LAVIGP 
Sbjct  368   NGNPAQHPFGNIGTDQVCSPEHQILALEAARNGIVLLKNEEKLLPLPKATVS-LAVIGPN  426

Query  1245  ANT-SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             AN+  +L G+Y G PC   + L  L  Y+  T Y  GC  V+C ST    +AV IAK+AD
Sbjct  427   ANSPQTLLGNYAGPPCKSVTPLQALQSYVKNTVYHPGCDTVSC-STGVIDKAVDIAKQAD  485

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
             YV++++GLD +QE E+ DR  LLLPG Q  L+  +A  + +P+VLVL  GGP+D+SFAK 
Sbjct  486   YVVLIMGLDQTQEKEELDRVDLLLPGRQQELITSVAKAAKRPVVLVLLSGGPIDVSFAKD  545

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSR  709
             DPRI  + W GYPGE GG AL+EIVFGD+NP GRLP+TWYP+ FTKVPM DM MR + S 
Sbjct  546   DPRIGGIFWAGYPGEGGGIALAEIVFGDHNPGGRLPVTWYPQEFTKVPMTDMRMRPESSS  605

Query  708   GYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISL-------SQSIKTKLRRSIL  550
              YPGRTYRFY G+KV+EFG+GLSYS +S E     TR+S        S S  T +    +
Sbjct  606   EYPGRTYRFYKGDKVFEFGYGLSYSKYSYEF----TRVSQNNVYLNHSSSFHTTVTSDSV  661

Query  549   NRGGNEPYVHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQ  376
                    Y  V E+    C+   F+V V ++N+G M G   V+LF+R   ++  G P+KQ
Sbjct  662   R------YKLVSELGAEVCDQRKFTVCVGVKNHGEMAGKHPVLLFARH-GNHGDGRPKKQ  714

Query  375   LIGFDRVHVSGNGVTETSISIEPCQHLSIVNVEG  274
             L+GF  V +S   + E    + PC+HLS  N  G
Sbjct  715   LVGFQSVILSAGEMAEIQFEVSPCEHLSRANEYG  748


 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/764 (51%), Positives = 507/764 (66%), Gaps = 39/764 (5%)
 Frame = -3

Query  2493  SKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             ++P   C    P   SYPFC T+LPI  R+  L+S LT+DEKI +L ++   IPRLGIP 
Sbjct  841   TQPPFSCDTSDPRTKSYPFCKTTLPINQRVQDLISRLTLDEKISQLVNSAPPIPRLGIPG  900

Query  2319  YEWWSESLHGIA---TNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavear  2149
              EWWSE+LHG+A   +   GI F+G ++SAT FPQVILTAA+F+  LW  I  A  +EAR
Sbjct  901   DEWWSEALHGVAFLASVSQGIRFNGTIQSATSFPQVILTAASFDAHLWFRIGQAVGIEAR  960

Query  2148  AMFNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkn  1972
              ++N+GQA G+TFWAPN+N++ DPRWGRGQETPGEDP+V   YAV +VRG+QG       
Sbjct  961   GIYNAGQARGMTFWAPNINIYRDPRWGRGQETPGEDPLVTGKYAVSFVRGIQGD------  1014

Query  1971  gRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYE  1792
                 S  G  + E       L +SACCKH TAYDL+ W   +R+ FNA V+ QD+ DTY+
Sbjct  1015  ----SFEGGMLGEH------LQVSACCKHFTAYDLDNWKGVNRFVFNAKVSLQDLADTYQ  1064

Query  1791  PPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFE  1615
             PPF+SC+++G+AS +MCAYN VNG+P CA+ +LL K AR  WGF GYITSDCDAV+ + E
Sbjct  1065  PPFQSCIQQGKASGIMCAYNRVNGVPNCADYNLLSKTARGQWGFNGYITSDCDAVSIMHE  1124

Query  1614  YQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRL  1435
              Q YAK PE+A    LKAG D+NCG Y+    KSA++ + +  S+IDRAL NLFSV+ RL
Sbjct  1125  KQGYAKVPEDAVADVLKAGMDVNCGNYLKNYTKSAVKKRKLPMSEIDRALHNLFSVRMRL  1184

Query  1434  GLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVI  1255
             GLFNG    + F + G   VCS EH+ LALEAAR GIVLLKN    LPL KT+ +SLAVI
Sbjct  1185  GLFNGNPTKQPFGNIGSDQVCSQEHQNLALEAARNGIVLLKNTDSLLPLSKTKTTSLAVI  1244

Query  1254  GPMANTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNS--TDGFAEAVSI  1084
             GP AN++ +L G+Y G PC   + L  L  Y   T Y  GC  V C+S  TD   +AV I
Sbjct  1245  GPNANSAKTLVGNYAGPPCKSITPLQALQSYAKDTRYHPGCSAVNCSSALTD---QAVKI  1301

Query  1083  AKRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDI  904
             AK AD+V++V+GLD +QE EDHDR  L+LP  Q  L++ +A  +  P++LVL  GGP+DI
Sbjct  1302  AKGADHVVLVMGLDQTQEREDHDRVDLVLPAKQQNLISSIARAAKNPVILVLLSGGPVDI  1361

Query  903   SFAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMR  724
             +FAK D  I S+LW GYPGE GG AL+EI+FGD+NP GRLP+TWYP+SF KVPM DM MR
Sbjct  1362  TFAKYDQHIGSILWAGYPGEAGGLALAEIIFGDHNPGGRLPVTWYPQSFIKVPMTDMRMR  1421

Query  723   ADPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslell-SAPTRISLS-QSIKTKLRRSIL  550
              +PS GYPGRTYRFY G KV+EFG+GLSYS +S E L     ++ L+ QS    +  S  
Sbjct  1422  PEPSSGYPGRTYRFYQGPKVFEFGYGLSYSKYSYEFLPVTQNKVYLNHQSCNKMVENSNP  1481

Query  549   NRGGNEPYVHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQ  376
              R     Y+ V E++   C+   F V+V ++N+G M G+  V+LF R       G P KQ
Sbjct  1482  VR-----YMPVSEIAKELCDKRKFPVKVGVQNHGEMAGTHPVLLFVRQ-AKVGNGRPMKQ  1535

Query  375   LIGFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             L+GF  V+++     E    + PC+HLS  N +G  ++  G H 
Sbjct  1536  LVGFHSVNLNAGERVEIEFELSPCEHLSRANEDGLMVIEEGPHF  1579



>ref|XP_007018824.1| Glycosyl hydrolase family protein isoform 2 [Theobroma cacao]
 gb|EOY16049.1| Glycosyl hydrolase family protein isoform 2 [Theobroma cacao]
Length=1597

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/754 (53%), Positives = 506/754 (67%), Gaps = 43/754 (6%)
 Frame = -3

Query  2493  SKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             ++P   C P  P+  +YPFC T+LPI  R   LVS LT+DEKI +L ++  AIPRLGIPA
Sbjct  24    TQPPFSCDPSDPSTKNYPFCQTTLPISQRARDLVSRLTLDEKISQLVNSAPAIPRLGIPA  83

Query  2319  YEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMF  2140
             YEWWSE+LHG+A  GPGI FDG++K+AT FPQVILTAA+F+   W  I      EARA++
Sbjct  84    YEWWSEALHGVANVGPGIKFDGSIKAATSFPQVILTAASFDAYQWYRIGQVIGREARAIY  143

Query  2139  NSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             N+GQA G+TFWAPN+N+F DPRWGRGQETPGEDP+V   YAV YVRG+QG          
Sbjct  144   NAGQARGMTFWAPNINIFRDPRWGRGQETPGEDPLVTGKYAVSYVRGVQGDI--------  195

Query  1962  YSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
                 G ++      +  L  SACCKH TAYDL+ W   +R+ F+A VT QD+ DTY+PPF
Sbjct  196   --FQGGKL------NGHLQASACCKHFTAYDLDNWKGVNRFVFDARVTVQDLADTYQPPF  247

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQ  1606
             KSCV+ GRAS +MCAYN VNG+P+CA+ +LL K  R +W F+GYITSDCDAVA I   Q 
Sbjct  248   KSCVQDGRASGIMCAYNRVNGVPSCADSNLLSKTLRGEWDFKGYITSDCDAVAIIHNDQG  307

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             YAKSPE+A    LKAG D+NCG+Y+ +  KSA+  K + ES+IDRAL NLF+V+ RLGLF
Sbjct  308   YAKSPEDAVVDVLKAGMDLNCGSYLQKYSKSAVLQKKLPESEIDRALHNLFAVRMRLGLF  367

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPM  1246
             NG      F + G   VCS EH+ LALEAAR GIVLLKNE+K LPL K  VS LAVIGP 
Sbjct  368   NGNPAQHPFGNIGTDQVCSPEHQILALEAARNGIVLLKNEEKLLPLPKATVS-LAVIGPN  426

Query  1245  ANT-SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             AN+  +L G+Y G PC   + L  L  Y+  T Y  GC  V+C ST    +AV IAK+AD
Sbjct  427   ANSPQTLLGNYAGPPCKSVTPLQALQSYVKNTVYHPGCDTVSC-STGVIDKAVDIAKQAD  485

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
             YV++++GLD +QE E+ DR  LLLPG Q  L+  +A  + +P+VLVL  GGP+D+SFAK 
Sbjct  486   YVVLIMGLDQTQEKEELDRVDLLLPGRQQELITSVAKAAKRPVVLVLLSGGPIDVSFAKD  545

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSR  709
             DPRI  + W GYPGE GG AL+EIVFGD+NP GRLP+TWYP+ FTKVPM DM MR + S 
Sbjct  546   DPRIGGIFWAGYPGEGGGIALAEIVFGDHNPGGRLPVTWYPQEFTKVPMTDMRMRPESSS  605

Query  708   GYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISL-------SQSIKTKLRRSIL  550
              YPGRTYRFY G+KV+EFG+GLSYS +S E     TR+S        S S  T +    +
Sbjct  606   EYPGRTYRFYKGDKVFEFGYGLSYSKYSYEF----TRVSQNNVYLNHSSSFHTTVTSDSV  661

Query  549   NRGGNEPYVHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQ  376
                    Y  V E+    C+   F+V V ++N+G M G   V+LF+R   ++  G P+KQ
Sbjct  662   R------YKLVSELGAEVCDQRKFTVCVGVKNHGEMAGKHPVLLFARH-GNHGDGRPKKQ  714

Query  375   LIGFDRVHVSGNGVTETSISIEPCQHLSIVNVEG  274
             L+GF  V +S   + E    + PC+HLS  N  G
Sbjct  715   LVGFQSVILSAGEMAEIQFEVSPCEHLSRANEYG  748


 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/768 (51%), Positives = 507/768 (66%), Gaps = 43/768 (6%)
 Frame = -3

Query  2493  SKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             ++P   C    P   SYPFC T+LPI  R+  L+S LT+DEKI +L ++   IPRLGIP 
Sbjct  841   TQPPFSCDTSDPRTKSYPFCKTTLPINQRVQDLISRLTLDEKISQLVNSAPPIPRLGIPG  900

Query  2319  YEWWSESLHGIA---TNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIa----aaaa  2161
              EWWSE+LHG+A   +   GI F+G ++SAT FPQVILTAA+F+  LW  I      A  
Sbjct  901   DEWWSEALHGVAFLASVSQGIRFNGTIQSATSFPQVILTAASFDAHLWFRIVYDYIQAVG  960

Query  2160  vearAMFNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqgl  1984
             +EAR ++N+GQA G+TFWAPN+N++ DPRWGRGQETPGEDP+V   YAV +VRG+QG   
Sbjct  961   IEARGIYNAGQARGMTFWAPNINIYRDPRWGRGQETPGEDPLVTGKYAVSFVRGIQGD--  1018

Query  1983  kgkngRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDME  1804
                     S  G  + E       L +SACCKH TAYDL+ W   +R+ FNA V+ QD+ 
Sbjct  1019  --------SFEGGMLGEH------LQVSACCKHFTAYDLDNWKGVNRFVFNAKVSLQDLA  1064

Query  1803  DTYEPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVA  1627
             DTY+PPF+SC+++G+AS +MCAYN VNG+P CA+ +LL K AR  WGF GYITSDCDAV+
Sbjct  1065  DTYQPPFQSCIQQGKASGIMCAYNRVNGVPNCADYNLLSKTARGQWGFNGYITSDCDAVS  1124

Query  1626  TIFEYQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSV  1447
              + E Q YAK PE+A    LKAG D+NCG Y+    KSA++ + +  S+IDRAL NLFSV
Sbjct  1125  IMHEKQGYAKVPEDAVADVLKAGMDVNCGNYLKNYTKSAVKKRKLPMSEIDRALHNLFSV  1184

Query  1446  QFRLGLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSS  1267
             + RLGLFNG    + F + G   VCS EH+ LALEAAR GIVLLKN    LPL KT+ +S
Sbjct  1185  RMRLGLFNGNPTKQPFGNIGSDQVCSQEHQNLALEAARNGIVLLKNTDSLLPLSKTKTTS  1244

Query  1266  LAVIGPMANTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNS--TDGFAE  1096
             LAVIGP AN++ +L G+Y G PC   + L  L  Y   T Y  GC  V C+S  TD   +
Sbjct  1245  LAVIGPNANSAKTLVGNYAGPPCKSITPLQALQSYAKDTRYHPGCSAVNCSSALTD---Q  1301

Query  1095  AVSIAKRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltggg  916
             AV IAK AD+V++V+GLD +QE EDHDR  L+LP  Q  L++ +A  +  P++LVL  GG
Sbjct  1302  AVKIAKGADHVVLVMGLDQTQEREDHDRVDLVLPAKQQNLISSIARAAKNPVILVLLSGG  1361

Query  915   pLDISFAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMND  736
             P+DI+FAK D  I S+LW GYPGE GG AL+EI+FGD+NP GRLP+TWYP+SF KVPM D
Sbjct  1362  PVDITFAKYDQHIGSILWAGYPGEAGGLALAEIIFGDHNPGGRLPVTWYPQSFIKVPMTD  1421

Query  735   MNMRADPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslell-SAPTRISLS-QSIKTKLR  562
             M MR +PS GYPGRTYRFY G KV+EFG+GLSYS +S E L     ++ L+ QS    + 
Sbjct  1422  MRMRPEPSSGYPGRTYRFYQGPKVFEFGYGLSYSKYSYEFLPVTQNKVYLNHQSCNKMVE  1481

Query  561   RSILNRGGNEPYVHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGA  388
              S   R     Y+ V E++   C+   F V+V ++N+G M G+  V+LF R       G 
Sbjct  1482  NSNPVR-----YMPVSEIAKELCDKRKFPVKVGVQNHGEMAGTHPVLLFVRQ-AKVGNGR  1535

Query  387   PQKQLIGFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             P KQL+GF  V+++     E    + PC+HLS  N +G  ++  G H 
Sbjct  1536  PMKQLVGFHSVNLNAGERVEIEFELSPCEHLSRANEDGLMVIEEGPHF  1583



>ref|XP_004301317.1| PREDICTED: probable beta-D-xylosidase 7-like [Fragaria vesca 
subsp. vesca]
Length=776

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/771 (51%), Positives = 515/771 (67%), Gaps = 44/771 (6%)
 Frame = -3

Query  2502  TSYSKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLG  2329
             T  ++P   C    P+  S+ FC T+LPI  R+H LVS LT+DEKI +L ++   IPRLG
Sbjct  21    TESTQPPYSCDSSNPSTESFLFCKTTLPINQRVHDLVSRLTLDEKISQLVNSAPPIPRLG  80

Query  2328  IPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavear  2149
             IP+YEWWSE+LHG+A  G GI     + SAT FPQVILTAA+FN  LW  I     +EAR
Sbjct  81    IPSYEWWSEALHGVADVGKGIRLYSTINSATSFPQVILTAASFNEHLWYRIGQVIGIEAR  140

Query  2148  AMFNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkn  1972
             A++N+GQA G+TFWAPN+N+F DPRWGRGQETPGEDP++ + Y+V YVRG+QG       
Sbjct  141   AVYNAGQATGMTFWAPNINIFRDPRWGRGQETPGEDPLMTAKYSVAYVRGVQGD------  194

Query  1971  gRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYE  1792
                 S  G ++    +    L  SACCKH TAYDL+ W+N +R+ FNA VT+QD+ DTY+
Sbjct  195   ----SYEGGKL----KVGGHLQASACCKHFTAYDLDNWNNVTRFGFNAKVTQQDLADTYQ  246

Query  1791  PPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFE  1615
             PPFKSCVE+G+AS +MCAYN VNG+P+CA+ +LL K AR +WGF GYITSDCDAV+ I++
Sbjct  247   PPFKSCVEQGKASGIMCAYNQVNGVPSCADHNLLTKTARGEWGFHGYITSDCDAVSIIYD  306

Query  1614  YQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRL  1435
              Q YAK PE+A    LKAG D+NCGTY+  + K+A++ K +  S ID+AL NLFS++ RL
Sbjct  307   VQGYAKHPEDAVVDVLKAGMDVNCGTYLQNHTKNAVQQKKLPVSYIDKALHNLFSIRMRL  366

Query  1434  GLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVI  1255
             GLF+G      F + GP+ VCS +H+ LALEAA  GIVLLKN  K LPL K++  SLAVI
Sbjct  367   GLFDGNPTKLPFGNIGPEKVCSKQHQALALEAAEDGIVLLKNAGKLLPLPKSKGISLAVI  426

Query  1254  GPMANTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVAC-NSTDGFAEAVSIA  1081
             GP AN S +L G+Y G PC L + L GL  Y  KT Y  GC  V C N T    +AV +A
Sbjct  427   GPNANASETLLGNYHGPPCKLITPLQGLLGYAKKTVYHPGCDTVKCPNPT--IDQAVRVA  484

Query  1080  KRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDIS  901
             ++ADYV+++VGLD  +E E HDR  L LPG Q  L++ +A  + KP++LV+  GGP+DIS
Sbjct  485   QQADYVVLIVGLDQGEEREAHDRDHLNLPGKQQQLISSVAKAAKKPVILVILSGGPVDIS  544

Query  900   FAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRA  721
              AK +P+I S+LW GYPGE GG AL+E++FGD+NP GRLP+TWY + + K  M DM MR 
Sbjct  545   AAKYNPKIGSILWAGYPGEAGGSALAEVIFGDHNPGGRLPVTWYTQDYIKTLMTDMRMRP  604

Query  720   DPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPT--RISLSQ-SIKTKLRRSIL  550
             D   GYPGRTYRFYTG++V++FG+GLSYS+++   +S+ T  ++ L++ S+    + S  
Sbjct  605   DKRSGYPGRTYRFYTGKRVFDFGYGLSYSNYAYNFVSSVTQNKVYLNESSVGLAAKNSDS  664

Query  549   NRGGNEPYVHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLF--SRAPTSYAGGAPQ  382
              R     Y  V ++    C    F V V  +N G M G   V+LF   + PT+   G+P 
Sbjct  665   GR-----YQLVSDLGEELCEKKLFKVTVGAKNEGEMAGKHPVLLFVSRKNPTN---GSPM  716

Query  381   KQLIGFDRVHVSGNGVTETSISIEPCQHLS-------IVNVEGSRILPLGD  250
             KQL+GF  V +S     E    + PC+HLS       +V  EGSR L +GD
Sbjct  717   KQLVGFKSVILSAGEKAELEFMLNPCEHLSHANEDGWMVVEEGSRFLVVGD  767



>ref|XP_008445351.1| PREDICTED: probable beta-D-xylosidase 7 [Cucumis melo]
Length=783

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/761 (51%), Positives = 492/761 (65%), Gaps = 30/761 (4%)
 Frame = -3

Query  2505  ATSYSKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRL  2332
             A S S+P   C    P   + PFC TSLPI  R   LVS LT+DEK+ +L +   AIPRL
Sbjct  30    AGSSSQPPYACDSSNPLTKTLPFCRTSLPIKLRARDLVSRLTLDEKVLQLVNTAPAIPRL  89

Query  2331  GIPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavea  2152
             GIPAYEWWSE+LHG+A  G GI  +G + +AT FPQVILTAA+F+  LW  I  A   EA
Sbjct  90    GIPAYEWWSEALHGVADVGYGIRLNGTIPAATSFPQVILTAASFDENLWYQIGQAIGTEA  149

Query  2151  rAMFNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgk  1975
             RA++N+GQA G+TFW PN+N+F DPRWGRGQETPGEDP++   Y+V YVRG+QG      
Sbjct  150   RAVYNAGQAKGMTFWTPNINIFRDPRWGRGQETPGEDPLMTGKYSVAYVRGIQGD-----  204

Query  1974  ngRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTY  1795
                  ++ G ++  E      L  SACCKH TAYDL+ W+  +RY F+A VT QDM DTY
Sbjct  205   -----AIEGGKLGNE------LKASACCKHFTAYDLDRWNGMTRYVFDAKVTMQDMADTY  253

Query  1794  EPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLE-KARTDWGFEGYITSDCDAVATIF  1618
             +PPF+SCVEKG+AS +MCAYN VNG+P+CA+  LL   AR  W F GYITSDCDAV+ I 
Sbjct  254   QPPFESCVEKGKASGIMCAYNRVNGVPSCADHHLLTATARKQWKFNGYITSDCDAVSIIH  313

Query  1617  EYQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFR  1438
             + Q YAKSPE+A    L+AG D+NCGTY+  + KSA+E   V  S IDRAL NLF+V+ R
Sbjct  314   DAQDYAKSPEDAVADVLRAGMDVNCGTYLKEHTKSAVEMNKVSISYIDRALRNLFTVRMR  373

Query  1437  LGLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAV  1258
             LGLF+G      F   GP  VCS +H+ LAL+AAR+GIVLLKN  K LPL K+   SLAV
Sbjct  374   LGLFDGNPTKLPFGQIGPDQVCSRQHQNLALQAAREGIVLLKNSAKLLPLSKSNTYSLAV  433

Query  1257  IGPMANT-SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIA  1081
             IG   N   +L G+Y GIPC   +   GL  YI  T Y  GC    C     + +AV IA
Sbjct  434   IGHNGNDPKTLRGNYAGIPCKSVTPFQGLNSYIKNTLYHRGCNYANCTEATIY-QAVKIA  492

Query  1080  KRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDIS  901
             K  DYV++V+GLD +QE ED DR  L LPG Q  L+ ++A  + +P++LV+  GGP+DIS
Sbjct  493   KSVDYVVLVMGLDQTQEREDFDRMELGLPGKQDELIAKVAEAAKRPVILVILSGGPVDIS  552

Query  900   FAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRA  721
              AK + +I S+LW GYPG+ GG A++EI+FGD+NP GRLPLTWYP  F K PM DM MRA
Sbjct  553   SAKYNEKIGSILWAGYPGQAGGTAIAEIIFGDHNPGGRLPLTWYPRDFIKFPMTDMRMRA  612

Query  720   DPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRG  541
             D S GYPGRTYRFY G KVYEFG+GLSYS+   E     T +S S+ + +    S   + 
Sbjct  613   DSSTGYPGRTYRFYNGPKVYEFGYGLSYSNHIYEF----TSVSESKLLLSHPTASQPAKN  668

Query  540   GN-EPYVHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLI  370
              +   Y  V E+    C S   +V V +RN G M     V+LF + P+    G+P KQL+
Sbjct  669   SDLVSYRLVSELDKKFCESKTVNVTVGVRNEGEMGSKHSVLLFVK-PSKPINGSPVKQLV  727

Query  369   GFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             GF RV ++    +E    + PC H+S  + EG  I+  G +
Sbjct  728   GFKRVEINAGERSEIEFLVSPCDHVSKASEEGVMIIEEGSY  768



>ref|XP_006434020.1| hypothetical protein CICLE_v10000352mg [Citrus clementina]
 gb|ESR47260.1| hypothetical protein CICLE_v10000352mg [Citrus clementina]
Length=776

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/761 (50%), Positives = 506/761 (66%), Gaps = 36/761 (5%)
 Frame = -3

Query  2493  SKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             ++P   C P  P+  ++PFC T+LPI  R   LVS LT+DEKI +L ++  AIPRLGIPA
Sbjct  27    TQPPFSCDPSNPSTETFPFCKTTLPISQRARDLVSRLTLDEKISQLVNSAPAIPRLGIPA  86

Query  2319  YEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMF  2140
             YEWWSE+LHG+A  G GI F+G ++ AT FPQVILTAA+F+  LW  I  A  +EARA++
Sbjct  87    YEWWSEALHGVAGVGKGIFFNGTIRGATSFPQVILTAASFDSYLWYRIGQAIGLEARALY  146

Query  2139  NSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             N+GQA G+TFWAPN+N+F DPRWGRGQETPGEDP+V   YAV YVRG+QG          
Sbjct  147   NAGQAIGMTFWAPNINIFRDPRWGRGQETPGEDPLVTGKYAVSYVRGVQGD---------  197

Query  1962  YSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
              + +G ++        +L  SACCKH TAYDL+ W   +RY F+A VT QD+ DTY+PPF
Sbjct  198   -TFNGGKL------KGKLQASACCKHFTAYDLDNWKGTTRYKFDARVTMQDLADTYQPPF  250

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQ  1606
             +SCV++GRAS +MCAYN VNGIP+CA+++LL K AR  WGF GYITSDCDAV+ I++ + 
Sbjct  251   ESCVKQGRASGIMCAYNRVNGIPSCADRNLLSKTARRLWGFHGYITSDCDAVSIIYDAEG  310

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             YAKSPE+A    LKAG D+NCG+++ ++ K+A++ K + ES+IDRAL NLFSV+ RLGLF
Sbjct  311   YAKSPEDAVVDVLKAGMDVNCGSFLQKHTKAAVKQKKLPESEIDRALHNLFSVRMRLGLF  370

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPM  1246
             NG    + F   G   VCS  H+ LAL+AA+ GIVLLKN    LPL K++  SLA+IGP 
Sbjct  371   NGNPTMQPFGKIGADVVCSPAHQVLALQAAQDGIVLLKNSHGLLPLPKSKSVSLALIGPN  430

Query  1245  ANTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             AN++ +L G+Y G  C   + L  L  Y+  T Y  GC  VAC+S     +AV+IAK AD
Sbjct  431   ANSAKTLLGNYAGPSCRSITPLQALQNYVENTVYYPGCDTVACSSAS-IDKAVNIAKGAD  489

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
             +V++++GLD +QE E+ DR  L+LPG Q  L+  +A  + KP++LVL  GGP+DI+FAK 
Sbjct  490   HVVLIMGLDQTQEKEELDRVDLVLPGRQQELITRVAEAAKKPVILVLLCGGPVDITFAKH  549

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSR  709
             D  I S+LW GYPGE G  AL+E++FGD+NP GRLP+TWYP+ + KVPM DM MR   + 
Sbjct  550   DRNIGSILWAGYPGEAGAVALAEVIFGDHNPGGRLPMTWYPQDYIKVPMTDMKMRPQATS  609

Query  708   GYPGRTYRFYTGEKVYEFGHGlsyssfsle-llSAPTRISLSQSIKTKLRRSILNRGGNE  532
             G PGRTYRFY G++V+ FG GLSYS +S +    +  ++ L+QS  TK+         N+
Sbjct  610   GNPGRTYRFYEGKEVFPFGCGLSYSKYSYKFKSVSQNKLYLNQSSSTKMVE-------NQ  662

Query  531   PYVHVDEVSN-----CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIG  367
               VH   V       C +  F V + ++N+G M G   V+LF + P     G P KQL+G
Sbjct  663   DVVHYKSVPELGTEFCETRKFLVTIGVKNHGEMAGKHPVLLFVK-PARRGNGRPIKQLVG  721

Query  366   FDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             F  V ++     E    + PC+ LS    +G  ++  G H 
Sbjct  722   FQSVILNAKEKAEIVFELSPCESLSRAREDGLMVIEEGTHF  762



>gb|KDO80913.1| hypothetical protein CISIN_1g004054mg [Citrus sinensis]
Length=776

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/761 (50%), Positives = 505/761 (66%), Gaps = 36/761 (5%)
 Frame = -3

Query  2493  SKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             ++P   C P  P+  ++PFC T+LPI  R   LVS LT+DEKI +L ++  AIPRLGIPA
Sbjct  27    TQPPFSCDPSNPSTETFPFCKTTLPISQRARDLVSRLTLDEKISQLVNSAPAIPRLGIPA  86

Query  2319  YEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMF  2140
             YEWWSE+LHG+A  G GI F+G ++ AT FPQVILTAA+F+  LW  I  A  +EARA++
Sbjct  87    YEWWSEALHGVAGVGKGIFFNGTIRGATSFPQVILTAASFDSYLWYRIGQAIGLEARALY  146

Query  2139  NSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             N+GQA G+TFWAPN+N+F DPRWGRGQETPGEDP+V   YAV YVRG+QG          
Sbjct  147   NAGQAIGMTFWAPNINIFRDPRWGRGQETPGEDPLVTGKYAVSYVRGVQGD---------  197

Query  1962  YSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
              + +G ++        +L  SACCKH TAYDL+ W   +RY F+A VT QD+ DTY+PPF
Sbjct  198   -TFNGGKL------KGKLQASACCKHFTAYDLDNWKGTTRYKFDARVTMQDLADTYQPPF  250

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQ  1606
             +SCV++GRAS +MCAYN VNGIP+CA+++LL K AR  WGF GYITSDCDAV+ I++ + 
Sbjct  251   ESCVKQGRASGIMCAYNRVNGIPSCADRNLLSKTARRQWGFHGYITSDCDAVSIIYDAEG  310

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             YAKSPE+A    LKAG D+NCG+++ ++ K+A++ K + ES+IDRAL NLFSV+ RLGLF
Sbjct  311   YAKSPEDAVVDVLKAGMDVNCGSFLQKHTKAAVKQKKLPESEIDRALHNLFSVRMRLGLF  370

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPM  1246
             NG    + F   G   VCS  H+ LAL+AA+ GIVLLKN    LPL K++  SLA+IGP 
Sbjct  371   NGNPTMQPFGKIGADVVCSPAHQVLALQAAQDGIVLLKNSHGLLPLPKSKSVSLALIGPN  430

Query  1245  ANTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             AN++ +L G+Y G  C   + L  L  Y+  T Y  GC  VAC+S     +AV IAK AD
Sbjct  431   ANSAKTLLGNYAGPSCRSITPLQALQNYVENTVYYPGCDTVACSSAS-IDKAVDIAKGAD  489

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
             +V++++GLD +QE E+ DR  L+LPG Q  L+  +A  + KP++LVL  GGP+DI+FAK 
Sbjct  490   HVVLMMGLDQTQEKEELDRVDLVLPGRQQELITRVAEAAKKPVILVLLCGGPVDITFAKY  549

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSR  709
             D  I S+LW GYPGE G  AL+E++FGD+NP GRLP+TWYP+ + KVPM DM MR   + 
Sbjct  550   DRNIGSILWAGYPGEAGAVALAEVIFGDHNPGGRLPMTWYPQDYIKVPMTDMKMRPQATS  609

Query  708   GYPGRTYRFYTGEKVYEFGHGlsyssfsle-llSAPTRISLSQSIKTKLRRSILNRGGNE  532
             G PGRTYRFY G++V+ FG GLSYS +S +    +  ++ L+QS  TK+         N+
Sbjct  610   GNPGRTYRFYEGKEVFPFGCGLSYSKYSYKFKAVSQNKLYLNQSSSTKMVE-------NQ  662

Query  531   PYVHVDEVSN-----CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIG  367
               VH   V       C +  F V + ++N+G M G   V+LF + P     G P KQL+G
Sbjct  663   DVVHYKSVPELGTEFCETRKFLVTIGVKNHGEMAGKHPVLLFVK-PARRGNGRPIKQLVG  721

Query  366   FDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             F  V ++     E    + PC+ LS    +G  ++  G H 
Sbjct  722   FQSVILNAKEKAEIVFELSPCESLSRAREDGLMVIEEGTHF  762



>ref|XP_007136230.1| hypothetical protein PHAVU_009G029300g [Phaseolus vulgaris]
 gb|ESW08224.1| hypothetical protein PHAVU_009G029300g [Phaseolus vulgaris]
Length=773

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/760 (51%), Positives = 502/760 (66%), Gaps = 31/760 (4%)
 Frame = -3

Query  2493  SKPQLPC--QPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             S P   C    P+  SYPFC+  LPIP R   L+S LT+ EK+ +L +   +IPRLGIPA
Sbjct  21    SNPPFACDWSNPSSKSYPFCNPKLPIPQRTKDLLSRLTLQEKLSQLVNTAPSIPRLGIPA  80

Query  2319  YEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMF  2140
             Y+WWSE+LHG+ + GPGI F+ ++ SAT FPQVIL+AA F+  LW  I  A  +EARA++
Sbjct  81    YQWWSEALHGVGSVGPGIRFNASISSATSFPQVILSAATFDSLLWYRIGRAIGIEARAIY  140

Query  2139  NSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             N+GQA GLTFWAPN+N+F DPRWGRGQETPGEDP++ S YAV YVRGLQG          
Sbjct  141   NAGQAQGLTFWAPNINIFRDPRWGRGQETPGEDPLLTSGYAVSYVRGLQGD---------  191

Query  1962  YSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
              S  G ++         L  SACCKH TAYDL+ W    R+ F+A V+ QD+ DTY+PPF
Sbjct  192   -SFHGGKL------RGHLQASACCKHFTAYDLDNWKGVDRFLFDARVSLQDLADTYQPPF  244

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQ  1606
             +SCV++G AS +MCAYN VNG+P+CA+ +LL K AR +W F GYITSDC AV  I + Q 
Sbjct  245   QSCVQQGGASGIMCAYNRVNGVPSCADFNLLTKTARKEWHFRGYITSDCGAVGIIHDQQG  304

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             +AKS E+A    L+AG D+ CGTY+  + KSA+  K V  S+IDRAL NLFS++ RLGLF
Sbjct  305   FAKSSEDAVADVLRAGMDVECGTYLTDHAKSAVLQKKVSMSEIDRALHNLFSIRMRLGLF  364

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVS-SLAVIGP  1249
             +G   +  F   GP  VCS EH+ LALEAAR GIVLLKN    LPL KT  S SLAVIGP
Sbjct  365   DGNPSSLPFGMIGPNHVCSKEHQYLALEAARNGIVLLKNSPTLLPLPKTSPSISLAVIGP  424

Query  1248  MANTS--SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKR  1075
              AN S  +L G+Y G PC   ++L G   Y+    Y  GC      S+    +AV +AK+
Sbjct  425   NANASPLTLLGNYAGPPCKSVTILQGFQHYVKNAVYHPGCDGGPKCSSAQIEQAVEVAKK  484

Query  1074  ADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFA  895
              DYV++V+GLD S+E E+ DR  L LPG Q+ LVN +A  S KP++LVL  GGP+DIS A
Sbjct  485   VDYVVLVMGLDQSEEREERDRIHLDLPGKQLELVNSVAEASKKPVILVLLCGGPVDISSA  544

Query  894   KKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADP  715
             K + +I  +LW GYPGE GG AL++I+FGD+NP GRLP+TWYP+ + KVPM DM MRADP
Sbjct  545   KYNHKIGGILWAGYPGELGGIALAQIIFGDHNPGGRLPVTWYPKDYIKVPMTDMRMRADP  604

Query  714   SRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAP-TRISLSQSIKTKLRRSILNRGG  538
             S GYPGRTYRFY G KVY+FG+GLSYS +S E +S    ++ L+QS  T L   ++    
Sbjct  605   STGYPGRTYRFYKGPKVYDFGYGLSYSKYSYEFVSVTHAKLHLNQS-STHL---MVENSE  660

Query  537   NEPYVHVDEV--SNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGF  364
                Y  V E+    C S++ SV V ++N+G M G   V+LF R P +   G P KQL+GF
Sbjct  661   TVRYKLVSELGEQTCQSMSLSVTVRVQNHGSMVGKHPVLLFMR-PKNQKSGNPVKQLVGF  719

Query  363   DRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
               V +    +T    ++ PC+HLS  N +G+ I+  G  +
Sbjct  720   QSVMLDAGEMTHVGFAVSPCEHLSRANEDGAMIIEEGSQV  759



>ref|XP_008677748.1| PREDICTED: uncharacterized protein LOC100502339 isoform X1 [Zea 
mays]
 gb|AFW65094.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=774

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/758 (49%), Positives = 498/758 (66%), Gaps = 36/758 (5%)
 Frame = -3

Query  2487  PQLPCQPPTHSS---YPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAY  2317
             P   C P +  +     FCD +L    R   LVS LT  EKI +L D    +PRLG+P Y
Sbjct  29    PPFSCGPSSAEASEGLAFCDVTLAPAQRAADLVSRLTAAEKIAQLGDQAPGVPRLGVPGY  88

Query  2316  EWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFN  2137
             +WW+E+LHG+AT+G G+ FD AV++AT FPQV+LTAAAF+  LW  I  A   EARA+FN
Sbjct  89    KWWNEALHGLATSGKGLHFDAAVRAATSFPQVLLTAAAFDDDLWLRIGQAIGREARALFN  148

Query  2136  SGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKY  1960
              GQA GLT W+PNVN+F DPRWGRGQETPGEDP V S YAV +VR               
Sbjct  149   VGQAEGLTIWSPNVNIFRDPRWGRGQETPGEDPAVASRYAVAFVR---------------  193

Query  1959  SLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFK  1780
              + GN           L  SACCKH TAYDLE W+  +RYSF A VT QD+EDT+ PPF+
Sbjct  194   GIQGN------SSSSLLQTSACCKHATAYDLEDWNGVARYSFVARVTEQDLEDTFNPPFR  247

Query  1779  SCVEKGRASCLMCAYNAVNGIPACANKDLLE-KARTDWGFEGYITSDCDAVATIFEYQQY  1603
             SCV + +ASC+MCAY A+NG+PACAN DLL    R DWG +GY+ SDCDAVA + + Q+Y
Sbjct  248   SCVVEAKASCVMCAYTAINGVPACANSDLLTGTVRGDWGLDGYVASDCDAVAIMRDAQRY  307

Query  1602  AKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFN  1423
             A +PE+A  ++LKAG DI+CG+Y+ ++  +A++   + E DID+AL NL++V+ RLG F+
Sbjct  308   APTPEDAVAVSLKAGLDIDCGSYVQQHAAAAIQQGKLTEQDIDKALTNLYAVRMRLGHFD  367

Query  1422  GKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMA  1243
             G      +   G  D+C+ EHR LALEAA+ GIVLLKN+   LPLD++ V+S AVIGP A
Sbjct  368   GDPRKNMYGVLGAADICTPEHRNLALEAAQDGIVLLKNDGGILPLDRSTVTSAAVIGPNA  427

Query  1242  NTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACN--STDGFAEAVSIAKRA  1072
             N   +L  +Y G PC   + L GL  Y++   + +GC   AC+  +TD   +AV++A   
Sbjct  428   NDGMALIANYFGPPCESTTPLKGLQSYVNDVRFLAGCNSAACDVAATD---QAVALAGSE  484

Query  1071  DYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAK  892
             DYV + +GL   QE+E  DR SLLLPG Q +L+  +A  S +P++LVL  GGP+DI+FA+
Sbjct  485   DYVFLFMGLSQKQESEGKDRTSLLLPGMQQSLITAVADASKRPVILVLLSGGPVDITFAQ  544

Query  891   KDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPS  712
              +P+I ++LW GYPG+ GG A+++++FGD+NP+GRLP+TWYPE FTKVPM DM MRADP+
Sbjct  545   SNPKIGAILWAGYPGQAGGLAIAKVLFGDHNPSGRLPVTWYPEEFTKVPMTDMRMRADPT  604

Query  711   RGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNE  532
              GYPGR+YRFY G  VY+FG+GLSYS+FS  L+   +  +LS ++ T LR ++  + G+ 
Sbjct  605   SGYPGRSYRFYQGNTVYKFGYGLSYSTFSRRLVHGTSVPALSSTLLTGLRETMTPQDGDR  664

Query  531   PYVHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDR  358
              Y HVD +    C  L F   V ++N+G MDG   V++F R P +   G P  QLIGF  
Sbjct  665   SY-HVDAIGTEGCEQLKFPAMVEVQNHGPMDGKHSVLMFLRWPNTKQ-GRPASQLIGFRS  722

Query  357   VHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
              H+      +    I PC+H S V  +G +++ +G H 
Sbjct  723   QHLKAGETAKLRFDISPCKHFSRVRADGRKVIDIGSHF  760



>ref|XP_006472631.1| PREDICTED: probable beta-D-xylosidase 7-like [Citrus sinensis]
Length=776

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/761 (50%), Positives = 503/761 (66%), Gaps = 36/761 (5%)
 Frame = -3

Query  2493  SKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             ++P   C P  P+  ++PFC T+LPI  R   LVS LT+DEKI +L ++  AIPRLGIPA
Sbjct  27    TQPPFSCDPSNPSTETFPFCKTTLPISQRARDLVSRLTLDEKISQLVNSAPAIPRLGIPA  86

Query  2319  YEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMF  2140
             YEWWSE+LHG+A  G GI F+G ++ AT FPQVILTAA+F+  LW  I  A  +EARA++
Sbjct  87    YEWWSEALHGVAGVGKGIFFNGTIRGATSFPQVILTAASFDSYLWYRIGQAIGLEARALY  146

Query  2139  NSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             N+GQA G+TFWAPN+N+F DPRWGRGQETPGEDP+V   YAV YVRG+QG          
Sbjct  147   NAGQAIGMTFWAPNINIFRDPRWGRGQETPGEDPLVTGKYAVSYVRGVQGD---------  197

Query  1962  YSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
              + +G ++         L  SACCKH TAYDL+ W   +RY F+A VT QD+ DTY+PPF
Sbjct  198   -TFNGGKL------KGNLQASACCKHFTAYDLDNWKGTTRYKFDARVTMQDLADTYQPPF  250

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQ  1606
             +SCV++GRAS +MCAYN VNGIP+CA+++LL K AR  WGF GYITSDCDAV+ I + Q 
Sbjct  251   ESCVKQGRASGIMCAYNRVNGIPSCADRNLLSKTARRQWGFHGYITSDCDAVSIIHDAQG  310

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             YAKSPE+A    LKAG D+NCG+++ ++ K+A++ K + ES+IDRAL NLFSV+ RLGLF
Sbjct  311   YAKSPEDAVVDVLKAGMDVNCGSFLQKHTKAAVKQKKLPESEIDRALHNLFSVRMRLGLF  370

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPM  1246
             NG    + F   G   VCS  H+ LAL+AA+ GIVLLKN    LPL K++  SLA+IGP 
Sbjct  371   NGNPTTQPFGKIGADVVCSPAHQVLALQAAQDGIVLLKNSHGLLPLPKSKSVSLALIGPN  430

Query  1245  ANTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             AN++ +L G+Y G  C   + L  L  Y+  T Y  GC  VAC+S     +AV IAK AD
Sbjct  431   ANSAKTLLGNYAGPSCRSITPLQALQNYVENTVYYPGCDTVACSSAS-IDKAVDIAKGAD  489

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
             +V++++GLD +QE E+ DR  L+LPG Q  L+  +A  + KP++LVL  GGP+DI+FAK 
Sbjct  490   HVVLMMGLDQTQEKEELDRVDLVLPGRQQELITRVAEAAKKPVILVLLCGGPVDITFAKY  549

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSR  709
             D  I S+LW GYPGE G  AL+E++FGD+NP GRLP+TWYP+ + KVPM DM MR   + 
Sbjct  550   DRNIGSILWAGYPGEAGAVALAEVIFGDHNPGGRLPMTWYPQDYIKVPMTDMKMRPQATS  609

Query  708   GYPGRTYRFYTGEKVYEFGHGlsyssfsle-llSAPTRISLSQSIKTKLRRSILNRGGNE  532
             G PGRTYRFY G++V+ FG GLSYS +S +    +  ++ L+QS  TK+  S       +
Sbjct  610   GNPGRTYRFYEGKEVFPFGCGLSYSKYSYKFKAVSQNKLYLNQSSSTKMVES-------Q  662

Query  531   PYVHVDEVSN-----CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIG  367
               VH   V       C +  F V + ++N+G M G   V+LF + P     G P KQL+G
Sbjct  663   DVVHYKSVPELGTEFCETRKFLVTIGVKNHGEMAGKHPVLLFVK-PARRGNGRPIKQLVG  721

Query  366   FDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             F  V ++     E    + PC+ LS    +G  ++  G H 
Sbjct  722   FQSVILNAKEKAEIVFELSPCESLSRAREDGLMVIEEGTHF  762



>gb|EYU23223.1| hypothetical protein MIMGU_mgv1a001417mg [Erythranthe guttata]
Length=823

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/755 (50%), Positives = 495/755 (66%), Gaps = 40/755 (5%)
 Frame = -3

Query  2487  PQLPC--QPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             P   C  + P+  S+PFC+  LP+  R + LVS L++DEKI +L +   AIPRLGIP Y+
Sbjct  72    PPFSCDSENPSTKSFPFCNVDLPLHERAYDLVSRLSLDEKISQLVNTAPAIPRLGIPDYQ  131

Query  2313  WWSESLHGIATN---GPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAM  2143
             WWSE+LHG+A +     GITF G++++AT FPQVILTAA F+  LW  IA A   EARA+
Sbjct  132   WWSEALHGVAGSMVAASGITFGGSIQAATSFPQVILTAATFDEKLWYRIAKAIGTEARAI  191

Query  2142  FNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngR  1966
             +N G+A G+TFW+PNVN+F DPRWGRGQETPGEDP + S YAV +VR             
Sbjct  192   YNEGEAQGMTFWSPNVNIFRDPRWGRGQETPGEDPFMTSKYAVSFVR-------------  238

Query  1965  KYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPP  1786
                + G+     +  D RL+ SACCKH TAYDLE W+  SR++F+A VT QDM DTY+PP
Sbjct  239   --GIQGDSFEGGQLKDGRLLASACCKHFTAYDLESWNGNSRFTFDARVTEQDMADTYQPP  296

Query  1785  FKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQ  1609
             FK+CV+ GRAS +MCAYN+VNG+P CA+ DLL K AR +WGF+GY+ SD  AV  +FE Q
Sbjct  297   FKTCVKDGRASGIMCAYNSVNGVPNCADYDLLTKTARGEWGFQGYVVSDDQAVTHLFEMQ  356

Query  1608  QYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGL  1429
             +Y+KSPE+A    LKAG D+ CG Y+  + KSA+E   V +SDIDRAL N F+++ RLGL
Sbjct  357   KYSKSPEDAVADVLKAGLDVECGDYLANHAKSAVEKGKVSKSDIDRALHNSFTIRMRLGL  416

Query  1428  FNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGP  1249
             FNG      + +    DVCS EH+ LA+E AR GIVLLKN    LPL K++  SLAVIGP
Sbjct  417   FNGNPSKHVYGNLSRNDVCSPEHQDLAVEVARDGIVLLKNSANLLPLSKSKTKSLAVIGP  476

Query  1248  MANTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRA  1072
              +N S +L G Y G PC   + L GL  Y+ +  +  GC  V C S     E + +A+ A
Sbjct  477   NSNVSETLLGSYAGPPCKTITPLQGLMNYVERIEFHQGCETVNCTSI-ASRETMRLARSA  535

Query  1071  DYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAK  892
             DYV++V+G++   E ED DR  L+LPG Q +L+  +A  +  P++LVL  GGP+DISFAK
Sbjct  536   DYVVLVMGINQDFEREDLDREDLVLPGQQQSLIMSVAKAAKNPVILVLLCGGPVDISFAK  595

Query  891   KDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPS  712
              +P+I  +LW GYPG  GGKA++EI+FGD+NP GRLP+TWYP+ F K+PM DM MR DPS
Sbjct  596   NNPKIGGILWAGYPGGAGGKAIAEIIFGDHNPGGRLPVTWYPKDFNKIPMTDMRMRPDPS  655

Query  711   RGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNE  532
              GYPGRTYRFY GEKVYEFG+GLSYS++S +       +S+ QS   KL   + N G   
Sbjct  656   SGYPGRTYRFYQGEKVYEFGYGLSYSNYSYKF------VSVGQS---KLDVKLENSGD--  704

Query  531   PYVHVDEV--SNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDR  358
               + V ++    C    +SV VS+ N G M G   V+LF++       G+P KQL+GF  
Sbjct  705   --ISVSDIGYETCEKAKYSVIVSVENEGDMVGKNPVLLFAKR-DEVVKGSPVKQLVGFQP  761

Query  357   VHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLG  253
             V ++          + PC+HLS  + +G+ ++  G
Sbjct  762   VRLNAKEKDNVEFEVNPCEHLSRASEDGTMVIESG  796



>gb|EYU23222.1| hypothetical protein MIMGU_mgv1a021704mg [Erythranthe guttata]
Length=783

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/758 (50%), Positives = 492/758 (65%), Gaps = 35/758 (5%)
 Frame = -3

Query  2487  PQLPCQPPTHS--SYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             P   C     S  S+PFC++ LPI  R   L+S L++DEKI +L +  SA+PRLGIP Y+
Sbjct  26    PPFSCDSAVTSTKSFPFCNSDLPIHERARDLISRLSLDEKISQLVNKASAVPRLGIPYYQ  85

Query  2313  WWSESLHGIA---TNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAM  2143
             WWSESLHGIA   T   G+TFD  +KSAT FPQVILTA+ F+  LW  IA     EARA+
Sbjct  86    WWSESLHGIAGSTTADSGVTFDETIKSATSFPQVILTASTFDENLWYRIAKVMGKEARAI  145

Query  2142  FNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngR  1966
             +N G A G+TFW+PNVN+F DPRWGRGQETPGEDP + S YAV +VR             
Sbjct  146   YNEGHAVGMTFWSPNVNIFRDPRWGRGQETPGEDPFLTSKYAVSFVR-------------  192

Query  1965  KYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPP  1786
                + G+ +   +  D  L  SACCKHLTAYDLE W+  SR++F+A+VT+QDM DT++P 
Sbjct  193   --GIQGDSLEGGDLRDGHLQASACCKHLTAYDLESWNGNSRFTFDALVTKQDMSDTFQPS  250

Query  1785  FKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQ  1609
             FKSCV+ GRAS +MCAYN+VNG+P C + DLL K  R +WGF+GYI SD  AV  ++E Q
Sbjct  251   FKSCVKDGRASGVMCAYNSVNGVPNCVDYDLLTKTVRGEWGFQGYIASDDHAVPHLYEMQ  310

Query  1608  QYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGL  1429
              Y+KS E+A    LKAG D+ CG Y+  + KSA++   V E DIDRAL NLF+V+ RLGL
Sbjct  311   NYSKSHEDAVADVLKAGMDVECGDYLANHTKSAIQMGKVSEFDIDRALHNLFTVRMRLGL  370

Query  1428  FNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGP  1249
             FNG      + +    D+C+ EH+ LALE AR GIVLLKN    LPL K++  SLAVIGP
Sbjct  371   FNGNPNQLPYGNLSRNDICTHEHQDLALEVARDGIVLLKNSANLLPLSKSKTMSLAVIGP  430

Query  1248  MANTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRA  1072
              AN S +L G Y G PC   + L GL  Y+ KT +  GC  V C S     E + +A+ A
Sbjct  431   NANVSGTLLGSYAGPPCKTITPLQGLMNYVRKTEFHQGCETVNCTSIAS-RETMRLARSA  489

Query  1071  DYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAK  892
             DYV++V+G++   E ED DR  L+LPG Q +L+  +A  +  P++LVL  GGP+D+SFAK
Sbjct  490   DYVVLVMGINQDFEREDLDREDLVLPGQQQSLIMSVAKAAKNPVILVLLCGGPVDVSFAK  549

Query  891   KDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPS  712
              +P+I S+LW GYPGE GGKA++EI+FGD+NP GRLP+TWYP+ F K+PM DM MR+DP 
Sbjct  550   HNPKIGSILWTGYPGEAGGKAIAEIIFGDHNPGGRLPMTWYPKDFIKIPMTDMRMRSDPL  609

Query  711   RGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNE  532
              GYPGRTYRFY GEKVYEFG+GLSYS++S + ++        + +   +R   L R    
Sbjct  610   SGYPGRTYRFYQGEKVYEFGYGLSYSNYSYKFVNVGKNNLNVKRLSNAMR---LKR----  662

Query  531   PY-VHVDEV--SNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFD  361
             PY + V ++    C +  FSV VS+ N G M G   V+LF R   +   G+P KQL+GF 
Sbjct  663   PYEIPVSDIGFEKCENAKFSVNVSVENEGEMAGKNSVLLFVRRDEA-VKGSPVKQLVGFQ  721

Query  360   RVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
              V ++          I PC+H S  + +G+ ++  G H
Sbjct  722   TVKLNAKEKANVEFEINPCEHFSSASEDGTLVIQSGTH  759



>ref|XP_008375790.1| PREDICTED: probable beta-D-xylosidase 7 [Malus domestica]
Length=787

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/755 (51%), Positives = 493/755 (65%), Gaps = 33/755 (4%)
 Frame = -3

Query  2502  TSYSKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLG  2329
             T  ++P   C    P+ SSYPFC T+LPI  R+  L+S LT+DEKI +L ++   IPRLG
Sbjct  30    TESTQPPYSCDSSQPSTSSYPFCKTTLPINQRVQDLISRLTLDEKISQLVNSAPPIPRLG  89

Query  2328  IPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavear  2149
             IP+YEWWSE+LHG+A  G GI     +  AT FPQVILTAA+FN  LW  I      EAR
Sbjct  90    IPSYEWWSEALHGVADVGKGIKLYPTIHXATSFPQVILTAASFNDHLWYRIGQVIGTEAR  149

Query  2148  AMFNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkn  1972
             A++N+GQA G+TFWAPN+N+F DPRWGRGQETPGEDP V   YAV YVRG+QG    G  
Sbjct  150   AVYNAGQATGMTFWAPNINIFRDPRWGRGQETPGEDPTVTGRYAVSYVRGVQGDSFYGG-  208

Query  1971  gRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYE  1792
               K+ L             RL  SACCKH TAYDL+ W+N +R+ F+A VT+QD+ DTY+
Sbjct  209   --KHKLGAG---------GRLQASACCKHFTAYDLDNWNNITRFGFDACVTQQDLADTYQ  257

Query  1791  PPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFE  1615
             PPF+ CV++G+AS +MCAYN +NG+P+CA+ +LL K AR  W F GYITSDCDAV+ I++
Sbjct  258   PPFQKCVQEGQASGIMCAYNRINGVPSCADHNLLTKVARGQWDFHGYITSDCDAVSIIYD  317

Query  1614  YQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRL  1435
              Q YAK PE+A    LKAG D+NCG+Y+  + KSA+  K +  S IDRAL NLFSV+ RL
Sbjct  318   VQGYAKKPEDAVVDVLKAGMDVNCGSYLKDHTKSAVXQKKLXVSKIDRALHNLFSVRMRL  377

Query  1434  GLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVI  1255
             GLF+G  +N+ + + GP  VCS  H+ LALEAA+ GIVLLKN  + LPL K +  SLAVI
Sbjct  378   GLFDGNPLNQPYGTIGPDQVCSQLHQALALEAAQDGIVLLKNSGRLLPLPKAKAXSLAVI  437

Query  1254  GPMANT-SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAK  1078
             GP AN   +L G+Y G PC   + L+ L  Y    +Y  GC  V C     F EA   AK
Sbjct  438   GPHANALEALLGNYHGPPCKSITPLEALQGYAKNINYHPGCDSVKCPQA-AFDEAAGTAK  496

Query  1077  RADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISF  898
              ADYV+++VGLD SQE E+ DR  L LPG Q  L++ +A V+ KP++LV+  GGP+DISF
Sbjct  497   EADYVVLIVGLDQSQEREELDRLHLGLPGQQQELISSVAKVAKKPVILVILSGGPVDISF  556

Query  897   AKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRAD  718
             AK +  I S+LW GYPGE GG AL+EI+FG++NP GRLP+ WY E + K+PM DM MR +
Sbjct  557   AKHNKNIGSILWAGYPGEAGGIALAEIIFGEHNPGGRLPMAWYTEDYVKMPMTDMRMRCE  616

Query  717   PSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISL---SQSIKTKLRRSILN  547
             P  GYPGRTYRFYTG+KV++FG+GLSYS++  +  SA ++  L     SI    + S   
Sbjct  617   PKTGYPGRTYRFYTGKKVFDFGYGLSYSNYVYKFSSAASQNKLYLNESSISPTAKSSDSG  676

Query  546   RGGNEPYVHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLF--SRAPTSYAGGAPQK  379
             R     Y  V ++    C     SVRV + N+G M G   V+LF   + P +   G P K
Sbjct  677   R-----YQLVQDLGGEFCEXKKLSVRVRVHNHGEMVGKHPVLLFVGEKKPKN---GRPMK  728

Query  378   QLIGFDRVHVSGNGVTETSISIEPCQHLSIVNVEG  274
             QL+GF  V +S     E    + PC+H S  N EG
Sbjct  729   QLVGFKSVILSAGERAEIEFDLNPCEHFSHANEEG  763



>ref|XP_007018826.1| Glycosyl hydrolase family protein [Theobroma cacao]
 gb|EOY16051.1| Glycosyl hydrolase family protein [Theobroma cacao]
Length=840

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/791 (49%), Positives = 498/791 (63%), Gaps = 66/791 (8%)
 Frame = -3

Query  2505  ATSYSKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRL  2332
             A S  +P   C    P   SYPFC T+LPI  R+  L+S LT+DEKI +L ++   I RL
Sbjct  30    AQSTDQPPFSCDSSDPLTKSYPFCKTTLPINQRVQDLISRLTLDEKISQLVNSAPPISRL  89

Query  2331  GIPAYEWWSESLHGIA---TNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaa  2161
             GIP YEWWSE+LHG+A       GI F+G ++SAT FPQVILTAA+F+  LW  I  A+ 
Sbjct  90    GIPGYEWWSEALHGVAFVANISQGIRFNGTIQSATSFPQVILTAASFDPYLWYRIGQASP  149

Query  2160  ve------------------------arAMFNSGQA-GLTFWAPNVNVFVDPRWGRGQET  2056
             +                         AR ++N+GQA G+TFW PN+N++ DPRWGRGQET
Sbjct  150   ITNILSIYFFSITSIFLIRRLAIGIEARGIYNAGQARGMTFWTPNINIYRDPRWGRGQET  209

Query  2055  PGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEEEDDDRLMLSACCKHLTA  1876
             PGEDP+V   YAV +VRG+QG           S  G ++ E       L +SACCKH TA
Sbjct  210   PGEDPLVTGKYAVSFVRGIQGD----------SFEGGKLGEN------LQVSACCKHFTA  253

Query  1875  YDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCLMCAYNAVNGIPACANKD  1696
             YDL+ W   +R+ F+A VT QD+ DTY+PPF+SC++KG+AS +MCAYN +NG+P CA+ +
Sbjct  254   YDLDNWKGINRFVFDANVTLQDLADTYQPPFQSCIQKGKASGVMCAYNRINGVPNCADYN  313

Query  1695  LLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIALKAGTDINCGTYMLRNM  1519
             LL K AR  WGF+GYIT+DCDAV+ I++ Q YAK PE+A    LKAG DI+CG Y+    
Sbjct  314   LLSKTARGQWGFDGYITADCDAVSIIYDEQGYAKEPEDAVADVLKAGMDIDCGEYLKNYT  373

Query  1518  KSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESFGPKDVCSSEHRRLALEA  1339
             +SA++ K V  ++IDRAL NLFS++ RLGLFNG    + F + G   VCS EH  LALEA
Sbjct  374   ESAVKKKKVSVTEIDRALHNLFSIRMRLGLFNGNPTKQPFGNVGSDQVCSQEHLNLALEA  433

Query  1338  ARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSLGGDYTGIPCALKSVLDGLGEYI  1162
             AR GIVLLKN    LPL KT+ +SLAVIGP AN T +L G+Y G PC   + L GL  YI
Sbjct  434   ARNGIVLLKNTDNLLPLSKTKTNSLAVIGPNANSTETLVGNYAGPPCEPITPLQGLQSYI  493

Query  1161  HKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQETEDHDRYSLLLPGHQM  982
               T+Y  GC  V C S+D   +AV IA  AD V++V+GLD +QE E HDR  L+LPG+Q 
Sbjct  494   KNTNYHPGCSTVNC-SSDLTDQAVKIAAGADRVVLVMGLDQTQEREAHDRVDLVLPGNQQ  552

Query  981   ALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGYPGEEGGKALSEIVFGDY  802
              L++ +   +NKP++LVL  GGP+DISFAK D  I S++W GYPGE GG+AL+EI+FGD+
Sbjct  553   KLISSIVRAANKPVILVLLCGGPVDISFAKNDQNIGSIIWAGYPGEAGGQALAEIIFGDH  612

Query  801   NPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFYTGEKVYEFGHGlsyssfsl  622
             NP GRLP+TWYP+SF K+PM DM MR +PS GYPGRTYRFY G KV+EFG+GLSY     
Sbjct  613   NPGGRLPMTWYPQSFIKIPMTDMRMRPEPSSGYPGRTYRFYQGPKVFEFGYGLSY-----  667

Query  621   ellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEVSN-----CNSLAFSVRVSLRNN  457
                   +  S      T+ +  + N+  ++  V    VS      C    F V V ++NN
Sbjct  668   ------SNYSYEILPVTQNKVYLNNQSSDKMAVAYKSVSEMGPELCEKSKFPVTVGVQNN  721

Query  456   GGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSISIEPCQHLSIVNVE  277
             G M G   V+LF R       G P KQL+GF+ V +      E    + PC+HLS  N  
Sbjct  722   GEMSGKHAVLLFVRQAKP-GNGRPMKQLVGFNSVDLKAGERAEIKFELSPCEHLSSANEG  780

Query  276   GSRILPLGDHI  244
             G  ++  G H 
Sbjct  781   GLMVIDEGSHF  791



>gb|KHG02565.1| putative beta-D-xylosidase 7 [Gossypium arboreum]
Length=808

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/762 (51%), Positives = 502/762 (66%), Gaps = 34/762 (4%)
 Frame = -3

Query  2493  SKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             S+P   C    P   SYPFC  +LPI  R+  L+S LT+DEKI +L ++   IPRLGIP 
Sbjct  55    SRPPFACDSSHPLTKSYPFCKPTLPINQRVQDLISRLTLDEKISQLVNSAPPIPRLGIPE  114

Query  2319  YEWWSESLHGIATN---GPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavear  2149
             YEWWSE+LHG+A       G++ +G ++SAT FPQVILTAA+F+  LW  I  A   EAR
Sbjct  115   YEWWSEALHGVAYFPGLHTGMSLNGTIQSATSFPQVILTAASFDVHLWYRIGQAIGREAR  174

Query  2148  AMFNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkn  1972
             A++N+GQA G+TFWAPN+N+F DPRWGRGQETPGEDP+V   YAV +VR           
Sbjct  175   AIYNAGQATGMTFWAPNINIFRDPRWGRGQETPGEDPVVTGKYAVSFVR-----------  223

Query  1971  gRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYE  1792
                  + G+   E  +    L  SACCKH TAYDL+ W   +R+ FNA V+ QD+ DTY 
Sbjct  224   ----GIQGDTF-EGGKLGHHLQASACCKHFTAYDLDNWKGVNRFVFNAKVSLQDLADTYM  278

Query  1791  PPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFE  1615
             PPF+SC+E+G+AS +MCAYN VNG+P CA+ +LL K AR  WGF+GYITSDCDAV+ I E
Sbjct  279   PPFRSCIEEGKASGIMCAYNRVNGVPNCADYNLLSKTARAQWGFDGYITSDCDAVSIIHE  338

Query  1614  YQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRL  1435
              Q YAK PE+A    LKAG D+NCG Y+    KSA+  + +  S+IDRAL NLFSV+ RL
Sbjct  339   EQGYAKLPEDAVADVLKAGMDVNCGNYLKNYTKSAVVKRKLPISEIDRALHNLFSVRMRL  398

Query  1434  GLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVI  1255
             GLF+G  + + F   GP  VCS EH+ LALEAAR  IVLLKN  + LP  K + +SLAVI
Sbjct  399   GLFDGNPLQQPFGKIGPDQVCSQEHQNLALEAARNSIVLLKNTYRVLPFSKAKTTSLAVI  458

Query  1254  GPMANTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNS--TDGFAEAVSI  1084
             GP AN++ +L G+Y GIPC   + L GL  Y+    Y  GC  V C+   TD   +AV +
Sbjct  459   GPNANSAKTLLGNYAGIPCKTVTPLQGLQRYVKDIRYHPGCNAVNCSYALTD---QAVKV  515

Query  1083  AKRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDI  904
             AK A+YV++V+GLD +QE E+ DR  L+L   Q  L++ LA  +  P+VLVL  GGP+DI
Sbjct  516   AKGAEYVVLVMGLDQTQEREELDRVDLVLSPKQQNLISTLARAAKNPVVLVLLSGGPVDI  575

Query  903   SFAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMR  724
             SFAK D  I S+LW GYPGE GG AL+EI+FGD+NP GRLP+TWYP+SF KVPM DM MR
Sbjct  576   SFAKNDKHIGSILWAGYPGEAGGLALAEIIFGDHNPGGRLPVTWYPQSFVKVPMTDMRMR  635

Query  723   ADPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslell-SAPTRISLSQSIKTKLRRSILN  547
              +PS GYPGRTYRFY G+KV+EFG+GLSYS++S E L  A  ++ L+  IK+   ++ L 
Sbjct  636   PEPSSGYPGRTYRFYQGQKVFEFGYGLSYSNYSYEFLPVAQNKVYLNHQIKSP--KAELE  693

Query  546   RGGNEPYVHVDEV-SNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLI  370
                   +V V E+ +   S    V V  +N+G M G   ++LF R+  +   G P+KQL+
Sbjct  694   NSNALKHVPVSELGTELCSKRIPVTVRAQNHGDMAGRHPLLLFVRSAKA-GNGRPEKQLV  752

Query  369   GFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             GF  V ++     +    + PC+HLS VN +G  ++  G H+
Sbjct  753   GFQSVILNAGERADVEFELSPCEHLSTVNEDGLMVIEEGSHL  794



>gb|EYU23824.1| hypothetical protein MIMGU_mgv1a020334mg, partial [Erythranthe 
guttata]
Length=755

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/745 (50%), Positives = 483/745 (65%), Gaps = 38/745 (5%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P+  SYPFC+  LPI  R   LVS LT+DEKI +L +  SA+PRLGIP Y+WWSE+LHG+
Sbjct  25    PSTKSYPFCNVDLPIEKRARDLVSRLTLDEKISQLVNEASAVPRLGIPYYQWWSEALHGV  84

Query  2286  ATNGP---GITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GL  2119
               + P   G+ F+G +K+AT FPQVILTAA F+  LW  +A     E RA++N GQ  G+
Sbjct  85    GGSTPAQSGVLFNGTIKAATSFPQVILTAATFDEYLWYRMAKVMGTETRALYNEGQVTGM  144

Query  2118  TFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRM  1939
             TF++PN+N+F DP WGRGQETPGEDP + S YAV YVR                + G+  
Sbjct  145   TFFSPNINIFRDPSWGRGQETPGEDPFLTSKYAVSYVR---------------GIQGDSF  189

Query  1938  PEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGR  1759
                   D RL  SACCKHLTAYDLE W+  SR++FNA VT+QDM DTY+ PFK CV++G+
Sbjct  190   EGGNLKDGRLQASACCKHLTAYDLESWNGNSRFTFNARVTKQDMVDTYQLPFKRCVQEGQ  249

Query  1758  ASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEA  1582
             AS ++CAYN VNG+P C N DLL K  R +WGF+GYITSD  AV  ++E Q Y+KSPE+A
Sbjct  250   ASGILCAYNFVNGVPNCVNYDLLTKTVRGEWGFQGYITSDFHAVNHLYEKQNYSKSPEDA  309

Query  1581  AGIALKAGTDINCGTYMLRNMKSALENKIVVESD-IDRALLNLFSVQFRLGLFNGKAVNR  1405
                 LKAG DI CG+Y++ + KSA+E   V ESD IDRAL NLFSV+ RLGLFNG     
Sbjct  310   VSDVLKAGMDIECGSYLVNHTKSAVEKGKVSESDDIDRALYNLFSVRMRLGLFNGNPSEL  369

Query  1404  KFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTS-SL  1228
              + +    DVCS EH+ LALE AR GIVLLKN    LPL K    SLAVIGP AN S +L
Sbjct  370   PYGNLSRNDVCSPEHQDLALEVARDGIVLLKNSANILPLSKFTTKSLAVIGPNANVSDTL  429

Query  1227  GGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVG  1048
              GDY G PC   + L GL  Y+ K  +  GC  + C S         ++K ADYV++V+G
Sbjct  430   LGDYAGPPCKTVTPLQGLMNYVKKIEFHEGCEAINCTSIASIKVVKELSKSADYVVLVMG  489

Query  1047  LDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASV  868
             L+  +E ED DR  L+LPG Q +LV  +A  +  P++LVL  GGP+DISFAK +P+I  +
Sbjct  490   LNQDREGEDLDREDLVLPGEQQSLVMNVANAAKNPVILVLLCGGPVDISFAKGNPKIGGI  549

Query  867   LWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTY  688
             LW GYPG  GGKA++EI+FGD+NP GRLP+TWYP+ F K+PM D+ MR DPS GYPGRTY
Sbjct  550   LWAGYPGGAGGKAIAEIIFGDHNPGGRLPMTWYPKDFIKIPMTDVRMRPDPSSGYPGRTY  609

Query  687   RFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEV  508
             +FY GEKVYEFG+GLSYS++S +       +S+S+S    L   +++  G+         
Sbjct  610   KFYQGEKVYEFGYGLSYSNYSYKF------VSVSESKLKNLGNILVSNIGS---------  654

Query  507   SNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTE  328
              +C +  F V VS+ N G M G   V+LF R   +   G+P KQL+GF  V ++ +    
Sbjct  655   GSCENAKFLVIVSVENEGRMVGKHPVLLFLRRDKA-VKGSPVKQLVGFQTVKLNADEKAN  713

Query  327   TSISIEPCQHLSIVNVEGSRILPLG  253
                 I PC+H S    +G+ ++ LG
Sbjct  714   VEFEINPCEHFSRATEDGTMVIDLG  738



>ref|XP_002489310.1| hypothetical protein SORBIDRAFT_0010s010920 [Sorghum bicolor]
 gb|EES20103.1| hypothetical protein SORBIDRAFT_0010s010920 [Sorghum bicolor]
Length=772

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/760 (48%), Positives = 495/760 (65%), Gaps = 39/760 (5%)
 Frame = -3

Query  2487  PQLPCQPPTHSS---YPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAY  2317
             P   C P +  +     FCD +L    R   LVS LT  EKI +L D  + +PRLG+P Y
Sbjct  26    PPFSCGPTSAEASEGLAFCDVTLSPAQRAADLVSRLTPAEKIAQLGDQATGVPRLGVPGY  85

Query  2316  EWWSESLHGIATNGPGITFD--GAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAM  2143
             +WW+E+LHG+AT+G G+ FD  G V++AT FPQV+LTAAAF+  LW  I  A   EARA+
Sbjct  86    KWWNEALHGLATSGKGLHFDVVGGVRAATSFPQVLLTAAAFDDDLWFRIGQAIGREARAL  145

Query  2142  FNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngR  1966
             FN GQA GLT W+PNVN+F DPRWGRGQETPGEDP V S YAV +VR             
Sbjct  146   FNVGQAEGLTIWSPNVNIFRDPRWGRGQETPGEDPAVASRYAVAFVR-------------  192

Query  1965  KYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPP  1786
                + GN           L  SACCKH TAYDLE W+  +RYSF A VT QD+EDT+ PP
Sbjct  193   --GIQGN------SSSSLLQTSACCKHATAYDLEDWNGVARYSFVARVTAQDLEDTFNPP  244

Query  1785  FKSCVEKGRASCLMCAYNAVNGIPACANKDLLE-KARTDWGFEGYITSDCDAVATIFEYQ  1609
             F+SCV +G+ASC+MCAY A+NG+PACAN DLL    R DWG +GY+ SDCDAVA + + Q
Sbjct  245   FRSCVVEGKASCIMCAYTAINGVPACANTDLLTGTVRGDWGLDGYVASDCDAVAIMRDAQ  304

Query  1608  QYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGL  1429
             +YA +PE+A  ++LKAG DI+CG+Y+ ++  +A++   + E DID+AL+NLF+V+ RLG 
Sbjct  305   RYAPTPEDAVAVSLKAGLDIDCGSYIQQHATAAIQQGKLTELDIDKALVNLFAVRMRLGH  364

Query  1428  FNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGP  1249
             F+G      + +    D+C+ EHR LALEAA+ GIVLLKN+   LPLD++ V+S AVIGP
Sbjct  365   FDGDPRKNMYGALSAADICTPEHRSLALEAAQDGIVLLKNDGGILPLDRSTVTSAAVIGP  424

Query  1248  MANTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNS--TDGFAEAVSIAK  1078
              +N   +L  +Y G PC   + L GL  Y++   + +GC   AC+   TD   +AV ++ 
Sbjct  425   NSNDGMALIANYFGPPCESTTPLQGLQSYVNNVRFLAGCSSAACDVAVTD---QAVVLSG  481

Query  1077  RADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISF  898
               DYV + +GL   QE+E  DR SLLLPG Q +L+  +A  S +P++LVL  GGP+DI+F
Sbjct  482   SEDYVFLFMGLSQQQESEGKDRTSLLLPGMQQSLITAVADASKRPVILVLLSGGPVDITF  541

Query  897   AKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRAD  718
             A+ +P+I ++LW GYPG+ GG A+++++FGD+NP+GRLP+TWYPE FTKVPM DM MRAD
Sbjct  542   AQSNPKIGAILWAGYPGQAGGLAIAKVLFGDHNPSGRLPMTWYPEDFTKVPMTDMRMRAD  601

Query  717   PSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGG  538
             P+ GYPGR+YRFY G  VY+FG+GLSYS+FS  LL   +  +LS ++   LR ++   G 
Sbjct  602   PTSGYPGRSYRFYQGNAVYKFGYGLSYSTFSSRLLYGTSMPALSSTVLAGLRETVTEEGD  661

Query  537   NEPYVHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGF  364
                  H+D++    C  L F   V ++N+G MDG    ++F R P +  GG P  QLIGF
Sbjct  662   RS--YHIDDIGTDGCEQLKFPAMVEVQNHGPMDGKHSALMFLRWPNTN-GGRPASQLIGF  718

Query  363   DRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
                H+           I PC+H S V  +G +++ +G H 
Sbjct  719   MSQHLKAGETANLRFDISPCEHFSRVRADGMKVIDIGSHF  758



>ref|XP_008234021.1| PREDICTED: probable beta-D-xylosidase 7 [Prunus mume]
Length=781

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/765 (50%), Positives = 501/765 (65%), Gaps = 32/765 (4%)
 Frame = -3

Query  2502  TSYSKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLG  2329
             T  ++P   C    P+ SSYPFC T+LPI  R+  LVS LT+DEKI +L ++   IPRLG
Sbjct  26    TESTQPPYACDSSQPSTSSYPFCKTALPINQRVQDLVSRLTLDEKISQLVNSAPPIPRLG  85

Query  2328  IPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavear  2149
             IP+YEWWSE+LHG+A  G GI   G + +AT FPQVILTAA+FN  LW  I      EAR
Sbjct  86    IPSYEWWSEALHGVADVGKGINLYGTISNATSFPQVILTAASFNEHLWYRIGQVIGTEAR  145

Query  2148  AMFNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkn  1972
             A++N+GQA G+TFWAPN+N+F DPRWGRGQETPGEDP+VV  YAV YVRG+QG       
Sbjct  146   ALYNAGQATGMTFWAPNINIFRDPRWGRGQETPGEDPLVVGKYAVSYVRGVQGD------  199

Query  1971  gRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYE  1792
                 S  G ++    +   RL  SACCKH TAYDL+ W + +R+ F+A V+ QD+ DTY+
Sbjct  200   ----SFEGGKL----KVGGRLQASACCKHFTAYDLDNWKSVTRFGFDARVSEQDLADTYQ  251

Query  1791  PPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFE  1615
             PPFKSCV++G+AS +MCAYN VNG+P+CA+ +LL K AR  W F GYITSDCDAV+ I +
Sbjct  252   PPFKSCVQQGQASGIMCAYNRVNGVPSCADYNLLTKVARGQWDFHGYITSDCDAVSIIRD  311

Query  1614  YQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRL  1435
              Q YAK+PE+A G  LKAG D+NCG+Y+  + KSA++ K +  S+IDRAL NLFS++ RL
Sbjct  312   VQGYAKTPEDAVGDVLKAGMDVNCGSYLKDHTKSAVQQKKLDVSEIDRALRNLFSIRMRL  371

Query  1434  GLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVI  1255
             GLF+G  + + + + GP   CS EH+ LALEAA+ GIVLLKN  + LPL K++  SLAVI
Sbjct  372   GLFDGSPLEQPYGNIGPDQACSKEHQALALEAAQDGIVLLKNSGRLLPLPKSKAISLAVI  431

Query  1254  GPMANTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAK  1078
             GP AN S +L G+Y G PC   + L  L  Y   T+Y +GC  V C       +AV  AK
Sbjct  432   GPNANASVTLLGNYHGRPCKSITPLKALQGYAKYTNYEAGCDTVKCPQAT-IDKAVEAAK  490

Query  1077  RADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISF  898
              ADYV++++GLD SQE E HDR  L LPG Q  L++ +A  + KP++LV+  GGP+DI+ 
Sbjct  491   AADYVVLIMGLDQSQEREAHDRRHLGLPGKQQELISSVAKAAKKPVILVILSGGPVDITP  550

Query  897   AKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRAD  718
             AK D +I  + W GYPGE GG AL+EI+FGD+NP GRLP+TWY + + K+PM DM MR D
Sbjct  551   AKYDKKIGGIFWAGYPGEAGGIALAEIIFGDHNPGGRLPVTWYTQDYVKIPMTDMRMRPD  610

Query  717   PSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGG  538
                GYPGRTYRFY G  VY+FG GLSYS++  E  SA  +  L  +  +   +   +  G
Sbjct  611   TKTGYPGRTYRFYKGGNVYDFGFGLSYSNYIYEFASAIAQNKLYLNESSISSKVKSSDAG  670

Query  537   NEPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLF--SRAPTSYAGGAPQKQLIGF  364
                 V       C    F VRV+++N+G M G   V+LF   + P +   G+P KQL+GF
Sbjct  671   RFRLVPDLSEEFCEKKKFPVRVAVKNHGEMVGKHPVLLFVGQKNPNN---GSPMKQLVGF  727

Query  363   DRVHVSGNGVTETSISIEPCQHLS-------IVNVEGSRILPLGD  250
               V +S     E    + PC+HLS       +V  EGS  L +GD
Sbjct  728   QSVILSAGERAELEFILNPCEHLSHANEGGLMVVEEGSYFLQVGD  772



>ref|XP_009369659.1| PREDICTED: probable beta-D-xylosidase 7 [Pyrus x bretschneideri]
Length=784

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/755 (51%), Positives = 494/755 (65%), Gaps = 33/755 (4%)
 Frame = -3

Query  2502  TSYSKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLG  2329
             T  ++P   C    P+ SSYPFC T+LPI  R+  L+S LT+DEKI +L ++   I RLG
Sbjct  27    TESTQPPYSCDSSQPSTSSYPFCKTTLPINQRVQDLISRLTLDEKISQLVNSAPPILRLG  86

Query  2328  IPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavear  2149
             IP+YEWWSE+LHG+A  G GI     + +AT FPQVILTAA+FN  LW  I  A   EAR
Sbjct  87    IPSYEWWSEALHGVADVGKGIKLYPTIHNATSFPQVILTAASFNDHLWYRIGQAIGTEAR  146

Query  2148  AMFNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkn  1972
             A++N+GQA G+TFWAPN+N+F DPRWGRGQETPGEDP V   YAV YVRG+QG       
Sbjct  147   AVYNAGQATGMTFWAPNINIFRDPRWGRGQETPGEDPTVTGRYAVSYVRGVQGD------  200

Query  1971  gRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYE  1792
                 S  G +   E     RL  SACCKH TAYDL+ W+N +R+ F+A VT+QD+ DTY+
Sbjct  201   ----SFYGGK--HELGAGGRLQASACCKHFTAYDLDNWNNITRFGFDARVTQQDLADTYQ  254

Query  1791  PPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFE  1615
             PPF+ CV++G+AS LMCAYN +NG+P+CA+ +LL K AR  W F GYITSDCDAV+ I +
Sbjct  255   PPFQKCVQEGQASGLMCAYNRINGVPSCADHNLLTKVARGQWDFHGYITSDCDAVSIIHD  314

Query  1614  YQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRL  1435
              Q YAK PE+A    LKAG D+NCG+Y+  + KSA+E K +  S IDRAL NLFSV+ RL
Sbjct  315   VQGYAKKPEDAVVDVLKAGMDVNCGSYLKDHTKSAVEQKKLEVSKIDRALHNLFSVRMRL  374

Query  1434  GLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVI  1255
             GLF+G  +N+ + S GP  VCS  H+ LALEAA+ GIVLLKN  + LPL K +  SLAVI
Sbjct  375   GLFDGSPLNQPYGSIGPDQVCSQLHQALALEAAQDGIVLLKNSGRLLPLPKAKAISLAVI  434

Query  1254  GPMANT-SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAK  1078
             GP AN   +L G+Y G PC   + L+ L  Y    +Y  GC  V C     F EA   AK
Sbjct  435   GPHANALEALLGNYHGPPCKSITPLEALQGYAKNINYHLGCDSVECPQA-AFDEAAGTAK  493

Query  1077  RADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISF  898
              ADYV+++VGLD SQE E+ DR  L LPG Q  L+  +A V+ KP++LV+  GGP+DISF
Sbjct  494   EADYVVLIVGLDQSQEREELDRLQLGLPGKQQELIRSVAKVAKKPVILVILSGGPVDISF  553

Query  897   AKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRAD  718
             AK +  I S+LW GYPGE GG AL+EI+FG++NP GRLP+ WY + + K+PM DM MR +
Sbjct  554   AKHNKNIGSILWAGYPGEAGGIALAEIIFGEHNPGGRLPMAWYTQDYVKMPMTDMRMRCE  613

Query  717   PSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISL---SQSIKTKLRRSILN  547
             P  GYPGRTYRFYTG+KV++FG+GLSYS++  +  SA ++  L     SI    + S   
Sbjct  614   PKTGYPGRTYRFYTGKKVFDFGYGLSYSNYVYKFSSAASQNKLYLNESSISPTAKSSDSG  673

Query  546   RGGNEPYVHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLF--SRAPTSYAGGAPQK  379
             R     Y  V ++    C     SVRV + N+G M G   V+LF   + P +   G P K
Sbjct  674   R-----YQLVQDLGGEFCEKKKLSVRVRVHNHGEMAGKHPVLLFVGEKKPKN---GRPMK  725

Query  378   QLIGFDRVHVSGNGVTETSISIEPCQHLSIVNVEG  274
             QL+GF  V +S     E    + PC+HLS  N EG
Sbjct  726   QLVGFKSVILSAGERAEIEFDLNPCEHLSHANEEG  760



>ref|NP_177929.1| putative beta-D-xylosidase 7 [Arabidopsis thaliana]
 sp|Q9SGZ5.2|BXL7_ARATH RecName: Full=Probable beta-D-xylosidase 7; Short=AtBXL7; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL57631.1| At1g78060/F28K19_32 [Arabidopsis thaliana]
 gb|AEE36063.1| putative beta-D-xylosidase 7 [Arabidopsis thaliana]
Length=767

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/759 (51%), Positives = 488/759 (64%), Gaps = 38/759 (5%)
 Frame = -3

Query  2487  PQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             P   C P  PT   Y FC T LPI  R   LVS LT+DEKI +L +    IPRLG+PAYE
Sbjct  22    PPHSCDPSNPTTKLYQFCRTDLPIGKRARDLVSRLTIDEKISQLVNTAPGIPRLGVPAYE  81

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSE+LHG+A  GPGI F+G VK+AT FPQVILTAA+F+   W  IA     EAR ++N+
Sbjct  82    WWSEALHGVAYAGPGIRFNGTVKAATSFPQVILTAASFDSYEWFRIAQVIGKEARGVYNA  141

Query  2133  GQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYS  1957
             GQA G+TFWAPN+N+F DPRWGRGQETPGEDPM+   YAV YVR                
Sbjct  142   GQANGMTFWAPNINIFRDPRWGRGQETPGEDPMMTGTYAVAYVR---------------G  186

Query  1956  LSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKS  1777
             L G+     +   + L  SACCKH TAYDL+ W   +RY FNA V+  D+ +TY+PPFK 
Sbjct  187   LQGDSFDGRKTLSNHLQASACCKHFTAYDLDRWKGITRYVFNAQVSLADLAETYQPPFKK  246

Query  1776  CVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYA  1600
             C+E+GRAS +MCAYN VNGIP+CA+ +LL + AR  W F GYITSDCDAV+ I++ Q YA
Sbjct  247   CIEEGRASGIMCAYNRVNGIPSCADPNLLTRTARGQWAFRGYITSDCDAVSIIYDAQGYA  306

Query  1599  KSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNG  1420
             KSPE+A    LKAG D+NCG+Y+ ++ KSAL+ K V E+DIDRALLNLFSV+ RLGLFNG
Sbjct  307   KSPEDAVADVLKAGMDVNCGSYLQKHTKSALQQKKVSETDIDRALLNLFSVRIRLGLFNG  366

Query  1419  KAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN  1240
                   + +  P +VCS  H+ LAL+AAR GIVLLKN  K LP  K  VSSLAVIGP A+
Sbjct  367   DPTKLPYGNISPNEVCSPAHQALALDAARNGIVLLKNNLKLLPFSKRSVSSLAVIGPNAH  426

Query  1239  -TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYV  1063
                +L G+Y G PC   + LD L  Y+    Y  GC  VAC S     +AV+IAK AD+V
Sbjct  427   VVKTLLGNYAGPPCKTVTPLDALRSYVKNAVYHQGCDSVAC-SNAAIDQAVAIAKNADHV  485

Query  1062  IVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDP  883
             ++++GLD +QE ED DR  L LPG Q  L+  +A  + KP+VLVL  GGP+DISFA  + 
Sbjct  486   VLIMGLDQTQEKEDFDRVDLSLPGKQQELITSVANAAKKPVVLVLICGGPVDISFAANNN  545

Query  882   RIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGY  703
             +I S++W GYPGE GG A+SEI+FGD+NP GRLP+TWYP+SF  + M DM MR+  + GY
Sbjct  546   KIGSIIWAGYPGEAGGIAISEIIFGDHNPGGRLPVTWYPQSFVNIQMTDMRMRS--ATGY  603

Query  702   PGRTYRFYTGEKVYEFGHGlsyssfsle-llSAPTRISLSQSIKT----KLRRSILNRGG  538
             PGRTY+FY G KVYEFGHGLSYS++S      A T + L+QS        +R ++++  G
Sbjct  604   PGRTYKFYKGPKVYEFGHGLSYSAYSYRFKTLAETNLYLNQSKAQTNSDSVRYTLVSEMG  663

Query  537   NEPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGA-PQKQLIGFD  361
              E          C+     V V + N G M G   V++F+R       G   +KQL+GF 
Sbjct  664   KE---------GCDVAKTKVTVEVENQGEMAGKHPVLMFARHERGGEDGKRAEKQLVGFK  714

Query  360   RVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
              + +S     E    I  C+HLS  N  G  +L  G + 
Sbjct  715   SIVLSNGEKAEMEFEIGLCEHLSRANEFGVMVLEEGKYF  753



>gb|AAK38482.1| beta-D-xylosidase [Hordeum vulgare]
Length=777

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/758 (50%), Positives = 491/758 (65%), Gaps = 32/758 (4%)
 Frame = -3

Query  2493  SKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             + P   C  P  SS  FCD  LPI  R   LVS LT++EKI +L D + A+ RLG+PAY+
Sbjct  30    ADPPFSCGAP--SSAAFCDRRLPIEQRAADLVSKLTLEEKISQLGDESPAVDRLGVPAYK  87

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSE+LHG+A  G G+  DG +++AT FPQVILTAA+FN  LW  I      EAR ++N+
Sbjct  88    WWSEALHGVANAGRGVHLDGPLRAATSFPQVILTAASFNPHLWYRIGQVIGTEARGVYNN  147

Query  2133  GQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYS  1957
             GQA GLTFWAPN+NVF DPRWGRGQETPGEDP +   YA  +VRG+QG          Y 
Sbjct  148   GQAEGLTFWAPNINVFRDPRWGRGQETPGEDPTMTGKYAAVFVRGVQG----------YG  197

Query  1956  LSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKS  1777
             +SG        +   L  SACCKH TAYDLE W   +R++F+A VT QD+ DTY PPFKS
Sbjct  198   MSG------AINSSDLEASACCKHFTAYDLENWKGVTRFAFDAKVTEQDLADTYNPPFKS  251

Query  1776  CVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYA  1600
             CVE G AS +MC+YN VNG+P CA+ +LL K AR DW F GYITSDCDAVA I + Q YA
Sbjct  252   CVEDGGASGIMCSYNRVNGVPTCADHNLLSKTARGDWSFNGYITSDCDAVAIIHDVQGYA  311

Query  1599  KSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNG  1420
             K+PE+A    LKAG D+NCG Y+  +  SA +   +   DIDRAL NLF+++ RLGLF+G
Sbjct  312   KAPEDAVADVLKAGMDVNCGGYIQTHGVSAYQQGKITGEDIDRALRNLFAIRMRLGLFDG  371

Query  1419  KAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN  1240
                  ++ + G   VCS EH+ LAL+AAR GIVLLKN+   LPL K++VSSLAVIGP  N
Sbjct  372   NPKYNRYGNIGADQVCSKEHQDLALQAARDGIVLLKNDGAALPLSKSKVSSLAVIGPNGN  431

Query  1239  TSSLG-GDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYV  1063
              +SL  G+Y G PC   + L  L  Y+    +  GC    CN ++   EAV  A  ADYV
Sbjct  432   NASLLLGNYFGPPCISVTPLQALQGYVKDARFVQGCNAAVCNVSN-IGEAVHAAGSADYV  490

Query  1062  IVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDP  883
             ++ +GLD +QE E+ DR  L LPG Q +LVN +A  + KP++LVL  GGP+D++FAK +P
Sbjct  491   VLFMGLDQNQEREEVDRLELGLPGMQESLVNSVADAAKKPVILVLLCGGPVDVTFAKNNP  550

Query  882   RIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGY  703
             +I +++W GYPG+ GG A+++++FGD+NP GRLP+TWYP+ FT VPM DM MRADPS GY
Sbjct  551   KIGAIVWAGYPGQAGGIAIAQVLFGDHNPGGRLPVTWYPKEFTAVPMTDMRMRADPSTGY  610

Query  702   PGRTYRFYTGEKVYEFGHGlsyssfs---lellSAPTRISLSQSIKTKLRRSILNRGGNE  532
             PGRTYRFY G+ VY FG+GLSYS +S       + P  +S  + +K   R S     G  
Sbjct  611   PGRTYRFYKGKTVYNFGYGLSYSKYSHRFASKGTKPPSMSGIEGLKATARASA---AGTV  667

Query  531   PYVHVDEVS--NCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDR  358
              Y  V+E+    C+ L F   V ++N+G MDG  +V+LF R P +   G P  QLIGF  
Sbjct  668   SY-DVEEMGAEACDRLRFPAVVRVQNHGPMDGGHLVLLFLRWPNA-TDGRPASQLIGFQS  725

Query  357   VHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             VH+  +        + PC+HLS    +G +++  G H 
Sbjct  726   VHLRADEAAHVEFEVSPCKHLSRAAEDGRKVIDQGSHF  763



>ref|XP_002285805.1| PREDICTED: probable beta-D-xylosidase 7 [Vitis vinifera]
Length=774

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/760 (52%), Positives = 506/760 (67%), Gaps = 30/760 (4%)
 Frame = -3

Query  2499  SYSKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGI  2326
             S   P   C    P+  SY FC T+LPIP R+  LVS LT+DEKI +L ++  AIPRLGI
Sbjct  23    STQSPPFSCDSSNPSTKSYHFCKTTLPIPDRVRDLVSRLTLDEKISQLVNSAPAIPRLGI  82

Query  2325  PAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearA  2146
             PAYEWWSE+LHG+A  GPGI F+G ++SAT FPQVILTAA+F+  LW  I  A  VEARA
Sbjct  83    PAYEWWSEALHGVADAGPGIRFNGTIRSATSFPQVILTAASFDVHLWYRIGRAIGVEARA  142

Query  2145  MFNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkng  1969
             ++N+GQ  G+TFWAPN+N+F DPRWGRGQETPGEDP+V   YAV YVRG+QG        
Sbjct  143   VYNAGQTKGMTFWAPNINIFRDPRWGRGQETPGEDPLVTGSYAVSYVRGVQGD-------  195

Query  1968  RKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEP  1789
                 L G +   E      L  SACCKH TAYDL+ W    R+ F+A VT QD+ DTY+P
Sbjct  196   ---CLRGLKRCGE------LQASACCKHFTAYDLDDWKGIDRFKFDARVTMQDLADTYQP  246

Query  1788  PFKSCVEKGRASCLMCAYNAVNGIPACANKDLL-EKARTDWGFEGYITSDCDAVATIFEY  1612
             PF  C+E+GRAS +MCAYN VNG+P+CA+ +LL   AR  W F+GYITSDCDAV+ I + 
Sbjct  247   PFHRCIEEGRASGIMCAYNRVNGVPSCADFNLLTNTARKRWNFQGYITSDCDAVSLIHDS  306

Query  1611  QQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLG  1432
               +AK+PE+A    LKAG D+NCGTY+L + KSA+  K + ES++DRAL NLF+V+ RLG
Sbjct  307   YGFAKTPEDAVVDVLKAGMDVNCGTYLLNHTKSAVMQKKLPESELDRALENLFAVRMRLG  366

Query  1431  LFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIG  1252
             LFNG    + +   GP  VCS EH+ LAL+AAR GIVLLKN Q+ LPL K +  SLAVIG
Sbjct  367   LFNGNPKGQPYGDIGPNQVCSVEHQTLALDAARDGIVLLKNSQRLLPLPKGKTMSLAVIG  426

Query  1251  PMANT-SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKR  1075
             P AN+  +L G+Y G PC   + L  L  Y+  T Y  GC  VAC S+    +AV IA++
Sbjct  427   PNANSPKTLIGNYAGPPCKFITPLQALQSYVKSTMYHPGCDAVAC-SSPSIEKAVEIAQK  485

Query  1074  ADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFA  895
             ADYV++V+GLD +QE E HDR  L+LPG Q  L+  +A  + KP+VLVL  GGP+DISFA
Sbjct  486   ADYVVLVMGLDQTQEREAHDRLDLVLPGKQQQLIICVANAAKKPVVLVLLSGGPVDISFA  545

Query  894   KKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADP  715
             K    I S+LW GYPG  GG A++E +FGD+NP GRLP+TWYP+ FTK+PM DM MR + 
Sbjct  546   KYSNNIGSILWAGYPGGAGGAAIAETIFGDHNPGGRLPVTWYPQDFTKIPMTDMRMRPES  605

Query  714   SRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAP-TRISLSQSIKTKLRRSILNRGG  538
             + GYPGRTYRFYTGEKV+EFG+GLSYS++S E +     ++  +QS        +     
Sbjct  606   NSGYPGRTYRFYTGEKVFEFGYGLSYSTYSCETIPVTRNKLYFNQSSTAH----VYENTD  661

Query  537   NEPYVHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGF  364
             +  Y  V E+    C+S   S+ + +RN+G M G   V+LF R   + A G+P KQL+ F
Sbjct  662   SIRYTSVAELGKELCDSNNISISIRVRNDGEMAGKHSVLLFVRRLKASA-GSPIKQLVAF  720

Query  363   DRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
               VH++G    +    + PC+H S  N +G  ++  G H 
Sbjct  721   QSVHLNGGESADVGFLLNPCEHFSGPNKDGLMVIEEGTHF  760



>ref|XP_011042236.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/757 (46%), Positives = 493/757 (65%), Gaps = 34/757 (4%)
 Frame = -3

Query  2502  TSYSKPQLPCQPP--THSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLG  2329
             TS +     C P   T  ++PFC   LPI +R+  L+  +T+ EK+  L ++ +A+PRLG
Sbjct  20    TSEALDAFACDPEDGTSRNFPFCQVKLPIQSRVGDLIGRMTLQEKVGLLVNDAAAVPRLG  79

Query  2328  IPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavear  2149
             I  YEWWSE+LHG++  GPG  F G    AT FPQVI T+A+FN TLW +I    + EAR
Sbjct  80    IKGYEWWSEALHGVSNVGPGTQFGGVFPGATSFPQVITTSASFNATLWEAIGQVVSDEAR  139

Query  2148  AMFNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkng  1969
             AMFN G AGLTFW+PNVN+F DPRWGRGQETPGEDP+VV  YA  YVR            
Sbjct  140   AMFNGGVAGLTFWSPNVNIFRDPRWGRGQETPGEDPVVVGKYAASYVR------------  187

Query  1968  RKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEP  1789
                 L GN       D DRL ++ACCKH TAYDL+ W+   R+ FNA V++QDMEDT++ 
Sbjct  188   ---GLQGN-------DGDRLKVAACCKHFTAYDLDNWNGVDRFHFNAQVSKQDMEDTFDV  237

Query  1788  PFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEY  1612
             PF+ CV++G+ + +MC+YN VNGIP CA+  LL+K  R  W  +GYI SDCD+V   +  
Sbjct  238   PFRMCVKEGKVASVMCSYNQVNGIPTCADPKLLKKTVRGRWKLDGYIVSDCDSVGVYYSQ  297

Query  1611  QQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLG  1432
             Q Y  +PEEAA  A+KAG D++CG +++++ + A++  ++ E++I+ ALLN  +VQ RLG
Sbjct  298   QHYTTTPEEAAADAIKAGLDLDCGPFLVQHTEDAVKKGLLNEAEINNALLNTLTVQMRLG  357

Query  1431  LFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIG  1252
             +F+G+  ++ + + GPKDVC+  H+ LALEAARQGIVLLKN+   LPL      S+A+IG
Sbjct  358   MFDGEPSSKPYGNLGPKDVCTPAHQELALEAARQGIVLLKNQGPPLPLSTRHHQSVAIIG  417

Query  1251  PMAN-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKR  1075
             P +N T ++ G+Y G+ C   + L G+  Y  KT Y  GC DVAC S   F  A+  A++
Sbjct  418   PNSNVTVTMIGNYAGVACGYTTPLQGIARYA-KTIYQQGCADVACVSDQQFGAAMDAARQ  476

Query  1074  ADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFA  895
             AD  ++V+GLD S E E  DR  LLLPG Q  L++++A  S  P +LVL  GGP+D+SFA
Sbjct  477   ADATVLVMGLDQSIEAESRDRTDLLLPGRQQELISKVAAASKGPTILVLMSGGPIDVSFA  536

Query  894   KKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESF-TKVPMNDMNMRAD  718
             + DP+I  ++W GYPG+ GG A+S+++FG  NP G+LP+TWYP+ + T +PM +M MR  
Sbjct  537   ENDPKIGGIVWAGYPGQAGGAAISDVLFGTTNPGGKLPMTWYPQDYVTNLPMTNMAMRPS  596

Query  717   PSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGG  538
              S GYPGRTYRFY G+ VY FGHG+SY++F   + SAPT +S+      +  R+    G 
Sbjct  597   TSNGYPGRTYRFYKGKVVYPFGHGISYTNFVHTIASAPTMVSVPLDGHRQASRNATISGK  656

Query  537   NEPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDR  358
                  H    + CN L+F V+V ++N G MDG+  ++++S+ P  +   AP KQL+ F++
Sbjct  657   AIRVTH----ARCNRLSFGVQVDVKNTGSMDGTHTLLVYSKPPAGHW--APLKQLVAFEK  710

Query  357   VHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             VHV+        I++  C+ LS+V+  G R +P+G H
Sbjct  711   VHVTAGTQRRVGINVHVCKFLSVVDRSGIRRIPMGAH  747



>ref|XP_011098380.1| PREDICTED: probable beta-D-xylosidase 7 [Sesamum indicum]
Length=787

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/739 (51%), Positives = 483/739 (65%), Gaps = 28/739 (4%)
 Frame = -3

Query  2448  PF-CDTSLP--IPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGIATN  2278
             PF CD+S P  I  R   LVS LT+DEKI +L ++  AIPRLG+PAYEWWSE+LHG++  
Sbjct  53    PFSCDSSDPALIHQRARDLVSRLTLDEKISQLVNSAPAIPRLGVPAYEWWSEALHGVSGY  112

Query  2277  GPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GLTFWAPN  2101
             G GITF G +  AT FPQVIL+A+ F+  LW  I  A   EAR ++N GQA G+TFWAPN
Sbjct  113   GRGITFGGRISGATSFPQVILSASTFDSHLWYRIGQAIGKEARGVYNEGQAKGMTFWAPN  172

Query  2100  VNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEEED  1921
             +N++ DPRWGRGQETPGEDP+V   Y+V +VR                + G+R    +  
Sbjct  173   INIYRDPRWGRGQETPGEDPLVAGRYSVAFVR---------------GIQGDRYNGGQTG  217

Query  1920  DDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCLMC  1741
                L+ SACCKH TAYDL+ W  F+R  F+A VT+QD+ DTY+PPF+SCVE+GRAS +MC
Sbjct  218   --HLLASACCKHFTAYDLDNWKGFNRLGFDAKVTKQDLADTYQPPFRSCVEEGRASGIMC  275

Query  1740  AYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIALK  1564
             AYN VNG+P CA+ +LL K AR +WGF GYITSDCDAV TI +  +YA+ PE+A    L 
Sbjct  276   AYNRVNGVPNCADYNLLTKTARGEWGFHGYITSDCDAVLTIHDDHKYARLPEDAVADVLN  335

Query  1563  AGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESFGP  1384
             AG D+NCG+Y+    KSA+E K + ES +DRAL NLF+V+ RLGLFNG   ++ F + GP
Sbjct  336   AGMDVNCGSYLKNYTKSAIEQKKLSESQVDRALHNLFAVRMRLGLFNGNPKHQLFGNIGP  395

Query  1383  KDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMA-NTSSLGGDYTGI  1207
               VC+ EH+ LALEAAR GIVLLKN    LPL K+R SSLAVIGP A N  +L G+Y G 
Sbjct  396   DHVCTKEHQELALEAARNGIVLLKNSANLLPLSKSRTSSLAVIGPNADNGYALLGNYEGP  455

Query  1206  PCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQET  1027
             PC   ++L  L  Y+  T Y  GC  V+C S     +AV  AKRAD+V++V+GLD SQET
Sbjct  456   PCESVTILKALQGYMSNTLYHKGCDAVSCASA-AIEDAVQTAKRADHVVLVMGLDQSQET  514

Query  1026  EDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGYPG  847
             EDHDR  L LPG Q +LV  +   + +P+VLVL  GGP+D+SFA+ DP + S++W GYPG
Sbjct  515   EDHDRVELTLPGQQESLVRAVTAAAKRPIVLVLVCGGPVDVSFARDDPNVGSIIWAGYPG  574

Query  846   EEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFYTGEK  667
             E GG AL+EI+FGD+NP G+LP+TWYP+ F  VPM DM MR  P+ GYPGRTYRFY G K
Sbjct  575   EAGGIALAEIIFGDHNPGGKLPITWYPKDFINVPMTDMRMR--PASGYPGRTYRFYKGPK  632

Query  666   VYEFGHGlsyssfslell-SAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEVSNCNSL  490
             V+EFGHGLSY+++S E + S P  I L Q                   V    +  C+ L
Sbjct  633   VFEFGHGLSYTTYSYEFIPSTPNTIHLDQLTHALQATDESPHSSRCLSVSKIGMDTCDRL  692

Query  489   AFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSISIE  310
              FS  V + N G M G   V+LF R       G P KQL+GF  V ++     E    + 
Sbjct  693   KFSTHVGVENAGDMAGKHPVLLFVRHGRP-DDGRPVKQLVGFQSVSLNARERAEIEFVLN  751

Query  309   PCQHLSIVNVEGSRILPLG  253
             PC+HLS  N +G  ++  G
Sbjct  752   PCEHLSSANEDGVMVIEEG  770



>ref|XP_004150696.1| PREDICTED: probable beta-D-xylosidase 7-like [Cucumis sativus]
 gb|KGN62174.1| Periplasmic beta-glucosidase [Cucumis sativus]
Length=783

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/761 (50%), Positives = 487/761 (64%), Gaps = 30/761 (4%)
 Frame = -3

Query  2505  ATSYSKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRL  2332
             A S S+P   C    P   + PFC T LPI  R   LVS LT+DEK+ +L +    IPRL
Sbjct  30    AGSSSQPPYACDSSNPLTKTLPFCKTYLPIKLRARDLVSRLTLDEKVLQLVNTVPPIPRL  89

Query  2331  GIPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavea  2152
             GIPAYEWWSE+LHG+A  G GI  +G + +AT FPQVILTAA+F+  LW  I  A   EA
Sbjct  90    GIPAYEWWSEALHGVANVGYGIRLNGTITAATSFPQVILTAASFDENLWYQIGQAIGTEA  149

Query  2151  rAMFNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgk  1975
             RA++N+GQA G+TFW PN+N+F DPRWGRGQETPGEDP++   Y+V YVR          
Sbjct  150   RAVYNAGQAKGMTFWTPNINIFRDPRWGRGQETPGEDPLMTGKYSVAYVR----------  199

Query  1974  ngRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTY  1795
                   + G+ + E  +  ++L  SACCKH TAYDL+ W+  +RY F+A VT QDM DTY
Sbjct  200   -----GIQGDAI-EGGKLGNQLKASACCKHFTAYDLDRWNGMTRYVFDAKVTMQDMADTY  253

Query  1794  EPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLE-KARTDWGFEGYITSDCDAVATIF  1618
             +PPF+SCVE+G+AS +MCAYN VNG+P+CA+  LL   AR  W F GYITSDCDAV+ I 
Sbjct  254   QPPFESCVEEGKASGIMCAYNRVNGVPSCADHHLLTATARKQWKFNGYITSDCDAVSIIH  313

Query  1617  EYQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFR  1438
             + Q YAK PE+A    L+AG D+NCGTY+  + KSA+E K V    IDRAL NLFSV+ R
Sbjct  314   DAQGYAKIPEDAVADVLRAGMDVNCGTYLKEHTKSAVEMKKVPMLHIDRALRNLFSVRMR  373

Query  1437  LGLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAV  1258
             LGLF+G      F   G   VCS +H+ LAL+AAR+GIVLLKN  K LPL K+   SLAV
Sbjct  374   LGLFDGNPTKLPFGQIGRDQVCSQQHQNLALQAAREGIVLLKNSAKLLPLSKSNTHSLAV  433

Query  1257  IGPMANT-SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIA  1081
             IG   N   +L G+Y GIPC   +   GL  Y+  T Y  GC    C     + +AV IA
Sbjct  434   IGHNGNDPKTLRGNYAGIPCKSATPFQGLNNYVKNTVYHRGCNYANCTEATIY-QAVKIA  492

Query  1080  KRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDIS  901
             K  DYV++V+GLD +QE ED DR  L LPG Q  L+ E+A  + +P++LV+  GGP+DIS
Sbjct  493   KSVDYVVLVMGLDQTQEREDFDRTELGLPGKQDKLIAEVAKAAKRPVILVILSGGPVDIS  552

Query  900   FAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRA  721
              AK + +I S+LW GYPG+ GG A++EI+FGD+NP GRLPLTWYP  F K PM DM MRA
Sbjct  553   SAKYNEKIGSILWAGYPGQAGGTAIAEIIFGDHNPGGRLPLTWYPHDFIKFPMTDMRMRA  612

Query  720   DPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRG  541
             D S GYPGRTYRFY G KVYEFG+GLSYS+   E     T +S S+ + +  + S   + 
Sbjct  613   DSSTGYPGRTYRFYNGPKVYEFGYGLSYSNHIYEF----TSVSESKLLLSHPKASQPAKN  668

Query  540   GN-EPYVHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLI  370
              +   Y  V E+    C S   +V V +RN G M G   V+LF + P+    G+P KQL+
Sbjct  669   SDLVSYRLVSELDKKFCESKTVNVTVGVRNEGEMGGKHSVLLFIK-PSKPINGSPVKQLV  727

Query  369   GFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             GF +V ++     E    + PC H+S  + EG  I+  G +
Sbjct  728   GFKKVEINAGERREIEFLVSPCDHISKASEEGLMIIEEGSY  768



>ref|XP_007225247.1| hypothetical protein PRUPE_ppa001675mg [Prunus persica]
 gb|EMJ26446.1| hypothetical protein PRUPE_ppa001675mg [Prunus persica]
Length=781

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/768 (51%), Positives = 502/768 (65%), Gaps = 38/768 (5%)
 Frame = -3

Query  2502  TSYSKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLG  2329
             T  ++P   C    P+ SSYPFC T+LPI  R+  LVS LT+DEKI +L ++   IPRL 
Sbjct  26    TESTQPPYACDSSQPSTSSYPFCKTTLPINQRVQDLVSRLTLDEKISQLVNSAPPIPRLS  85

Query  2328  IPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavear  2149
             IP+YEWWSE+LHG+A  G GI   G + +AT FPQVILTAA+FN  LW  I      EAR
Sbjct  86    IPSYEWWSEALHGVADVGKGINLYGTISNATSFPQVILTAASFNEHLWYRIGQVIGTEAR  145

Query  2148  AMFNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkn  1972
             A++N+GQA G+TFWAPN+N+F DPRWGRGQETPGEDP+VV  YAV YVRG+QG       
Sbjct  146   ALYNAGQATGMTFWAPNINIFRDPRWGRGQETPGEDPLVVGKYAVSYVRGVQGD------  199

Query  1971  gRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYE  1792
                 S  G ++    +   RL  SACCKH TAYDL+ W + +R+ F+A V+ QD+ DTY+
Sbjct  200   ----SFEGGKL----KVGGRLQASACCKHFTAYDLDNWKSVTRFGFDARVSEQDLADTYQ  251

Query  1791  PPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFE  1615
             PPFKSCV++G+AS +MCAYN VNG+P+CA+ +LL K AR  W F GYITSDCDAV+ I +
Sbjct  252   PPFKSCVQQGQASGIMCAYNRVNGVPSCADYNLLTKVARGQWDFHGYITSDCDAVSIIRD  311

Query  1614  YQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRL  1435
              Q YAK+PE+A G  LKAG D+NCG+Y+  + KSA++ K +  S+IDRAL NLFS++ RL
Sbjct  312   VQGYAKTPEDAVGDVLKAGMDVNCGSYLKDHTKSAVQQKKLDVSEIDRALHNLFSIRMRL  371

Query  1434  GLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVI  1255
             GLF+G  + + + + GP   CS EH+ LALEAA+ GIVLLKN  + LPL K++  SLAVI
Sbjct  372   GLFDGSPLEQPYGNIGPDQACSKEHQALALEAAQDGIVLLKNSGRLLPLPKSKAISLAVI  431

Query  1254  GPMANTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAK  1078
             GP AN S +L G+Y G PC   + L  L  Y   T+Y +GC  V C       +AV  AK
Sbjct  432   GPNANASETLLGNYHGRPCKSITPLKALQGYAKYTNYEAGCDTVKCPQAT-IDKAVEAAK  490

Query  1077  RADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISF  898
              ADYV++++GLD SQE E HDR  L LPG Q  L++ +A  + KP++LV+  GGP+DI+ 
Sbjct  491   AADYVVLIMGLDQSQEREAHDRRHLGLPGKQQELISSVAKAAKKPVILVILSGGPVDITP  550

Query  897   AKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRAD  718
             AK D +I  +LW GYPGE GG AL+EI+FGD+NP GRLP+TWY + + KVPM DM MR D
Sbjct  551   AKYDKKIGGILWAGYPGEAGGIALAEIIFGDHNPGGRLPVTWYTQDYVKVPMTDMRMRPD  610

Query  717   PSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISL---SQSIKTKLRRSILN  547
                GYPGRTYRFY G  VY FG GLSYS++  E  SA  +  L     SI  ++  S   
Sbjct  611   TKTGYPGRTYRFYKGGNVYHFGFGLSYSNYIYEFASAIAQNKLYLNESSISPEVESS---  667

Query  546   RGGNEPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLF--SRAPTSYAGGAPQKQL  373
               G+   +       C    F VRV+++N+G M G   V+LF   + P +   G+P KQL
Sbjct  668   DSGHFRLIPDLSEEFCEKKKFPVRVAVKNHGEMVGKHPVLLFVGQKNPNN---GSPMKQL  724

Query  372   IGFDRVHVSGNGVTETSISIEPCQHLS-------IVNVEGSRILPLGD  250
             +GF  V +S     E    + PC+HLS       +V  EGS  L +GD
Sbjct  725   VGFQSVILSAGERAELEFILNPCEHLSHANEGGLMVVEEGSYFLQVGD  772



>ref|XP_003577615.1| PREDICTED: probable beta-D-xylosidase 7 [Brachypodium distachyon]
Length=767

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/752 (49%), Positives = 499/752 (66%), Gaps = 46/752 (6%)
 Frame = -3

Query  2457  SSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGIATN  2278
             SSY FCD +LP+  R   LVS LT  EK+ +L D  + +PRLG+P Y+WW+E+LHG+AT+
Sbjct  34    SSYAFCDAALPVAQRAADLVSRLTAAEKVAQLGDEAAGVPRLGVPGYKWWNEALHGLATS  93

Query  2277  GPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GLTFWAPN  2101
             G G+ FDGAV+SAT FPQV LTAAAF+  LW  I  A   EARA++N GQA GLT W+PN
Sbjct  94    GKGLHFDGAVRSATSFPQVCLTAAAFDDDLWFRIGQAIGREARALYNLGQAEGLTMWSPN  153

Query  2100  VNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEEED  1921
             VN++ DPRWGRGQETPGEDP   S YAV +VR                + GN        
Sbjct  154   VNIYRDPRWGRGQETPGEDPTTASRYAVAFVR---------------GMQGNST------  192

Query  1920  DDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCLMC  1741
                L  SACCKH TAYDLE W+  +RY+F+A VT QD+EDT+ PPF+SCV  G+ASC+MC
Sbjct  193   -SLLQASACCKHATAYDLEDWNGVARYNFDAKVTAQDLEDTFNPPFRSCVVDGKASCVMC  251

Query  1740  AYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIALK  1564
             AY  +NG+PACAN DLL K  R DWG +GY  SDCDAVA + + Q+YA+SPE+A  +ALK
Sbjct  252   AYTGINGVPACANADLLTKTVRGDWGLDGYTASDCDAVAIMRDAQRYAQSPEDAVALALK  311

Query  1563  AGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESFGP  1384
             AG DI+CGTYM ++  +A++   + E DID+AL NLF+++ RLG F+G      +   G 
Sbjct  312   AGLDIDCGTYMQQHAAAAIQQGKITEEDIDKALKNLFAIRMRLGHFDGDPRTNMYGGLGA  371

Query  1383  KDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANT-SSLGGDYTGI  1207
              D+C++EHR LAL+AA+ GIVLLKN+   LPLD+  V+S AVIGP AN   +L  +Y G 
Sbjct  372   ADICTAEHRSLALDAAQDGIVLLKNDAGILPLDRAAVASTAVIGPNANNPGALIANYFGP  431

Query  1206  PCALKSVLDGLGEYIHKTSYASGCLDVACN--STDGFAEAVSIAKRADYVIVVVGLDLSQ  1033
             PC   + L G+  Y+    + +GC   AC+  +TD   +A ++A  +DYV + +GL   Q
Sbjct  432   PCESTTPLKGIQGYVKDARFLAGCSSTACDVATTD---QAAALASTSDYVFLFMGLGQRQ  488

Query  1032  ETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGY  853
             E+E  DR SLLLPG Q +L+  +A  + +P++LVL  GGP+D++FA+ +P+I ++LW GY
Sbjct  489   ESEGRDRTSLLLPGKQQSLITAVADAAQRPVILVLLSGGPVDVTFAQTNPKIGAILWAGY  548

Query  852   PGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFYTG  673
             PG+ GG A++ ++FGD+NP+GRLP+TWYPE FT VPM DM MRADP+ GYPGR+YRFY G
Sbjct  549   PGQAGGLAIARVLFGDHNPSGRLPVTWYPEEFTNVPMTDMRMRADPANGYPGRSYRFYQG  608

Query  672   EKVYEFGHGlsyssfslellSAPTRI-----SLSQSIKTKL--RRSILNRGGNEPYVHVD  514
             + VY+FG+GLSYSS+S  LLS+ T        L  S+ T +    +IL         HV+
Sbjct  609   KTVYKFGYGLSYSSYSRRLLSSGTSTPAPNADLLASLTTTMPSAENILGS------YHVE  662

Query  513   EV--SNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGN  340
             ++    C  L F   V ++N+G MDG + V+++ R P + A G P++QLIGF + H+   
Sbjct  663   QIGAQGCEMLKFPAVVEVQNHGPMDGKQSVLMYLRWPNATA-GRPERQLIGFKKEHLKAG  721

Query  339   GVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
                     I PC+HLS V  +G++++  G H 
Sbjct  722   EKAHIKFEIRPCEHLSRVREDGNKVIDRGSHF  753



>ref|XP_006647908.1| PREDICTED: probable beta-D-xylosidase 7-like [Oryza brachyantha]
Length=780

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/758 (50%), Positives = 491/758 (65%), Gaps = 24/758 (3%)
 Frame = -3

Query  2502  TSYSKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIP  2323
             T  S P   C  P  SS  FC+  LPI  R   LVS LT++EKI +L D + AI RLG+P
Sbjct  28    TVASDPPFSCGAP--SSAAFCNPKLPIDQRADDLVSRLTLEEKISQLGDQSPAIDRLGVP  85

Query  2322  AYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAM  2143
             AY+WWSE+LHG++  G GI  DG +++AT FPQVILTAA+FN  LW  I      EARA+
Sbjct  86    AYKWWSEALHGVSNAGRGIHLDGPLRAATSFPQVILTAASFNPHLWYRIGQVIGTEARAV  145

Query  2142  FNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngR  1966
             +N+GQA GLTFWAPN+NVF DPRWGRGQETPGEDP V   YA  +VRG+QG         
Sbjct  146   YNNGQAEGLTFWAPNINVFRDPRWGRGQETPGEDPTVTGKYAAVFVRGVQG---------  196

Query  1965  KYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPP  1786
              Y L+G        +   L  SACCKH TAYDLE W   +RY F+A VT QD+ DTY PP
Sbjct  197   -YGLAG------AVNTTDLEASACCKHFTAYDLENWKGVTRYVFDAKVTAQDLADTYNPP  249

Query  1785  FKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQ  1609
             F+SCVE G AS +MC+YN VNG+P CA+ +LL K AR DW F GYITSDCDAV+ I + Q
Sbjct  250   FRSCVEDGGASGIMCSYNRVNGVPTCADYNLLSKTARGDWRFYGYITSDCDAVSIIHDAQ  309

Query  1608  QYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGL  1429
              YA++ E+A    LKAG D+NCG+Y+ ++  SA++   + E DI+RAL NLF+V+ RLGL
Sbjct  310   GYAQTAEDAVADVLKAGMDVNCGSYVQQHGLSAIQQGKITEQDINRALHNLFAVRMRLGL  369

Query  1428  FNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGP  1249
             FNG     ++ + GP  VC+ EH+ LALEAA+ GIVLLKN+   LPL K++VSS+AVIG 
Sbjct  370   FNGNPKYNRYGNIGPDQVCTQEHQNLALEAAQDGIVLLKNDANALPLSKSKVSSIAVIGH  429

Query  1248  MANTSS-LGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRA  1072
              AN ++ L G+Y G PC   + L  L  Y+  T + +GC   ACN +    EA  +A   
Sbjct  430   NANDATRLLGNYFGPPCISVTPLQVLQGYVKDTRFLAGCNSAACNVSS-IGEAAQLASSV  488

Query  1071  DYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAK  892
             DYV++ +GLD  QE E+ DR  L LPG Q  L+N +A  + KP++LVL  GGP+D++FAK
Sbjct  489   DYVVLFMGLDQDQEREEVDRLELSLPGMQENLINAVANAAKKPVILVLLCGGPVDVTFAK  548

Query  891   KDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPS  712
              +P+I ++LW GYPGE GG A+++++FG++NP GRLP+TWYP+ FT VPM DM MRADPS
Sbjct  549   YNPKIGAILWAGYPGEAGGIAIAQVLFGEHNPGGRLPVTWYPKEFTSVPMTDMRMRADPS  608

Query  711   RGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNE  532
              GYPGRTYRFY G  VY+FG+GLSYS +S   ++  T++    SI      +     G  
Sbjct  609   TGYPGRTYRFYRGNTVYKFGYGLSYSKYSHNFVANGTKVPSFGSINGLKAMATAAAAGGT  668

Query  531   PYVHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDR  358
                 V+E+ +  C+ L F   V ++NNG MDG   V+LF R P +  GG P  QLI F  
Sbjct  669   VSYDVEEIGSETCDKLRFPALVRVQNNGPMDGRHPVLLFLRWPNATDGGRPASQLIAFKS  728

Query  357   VHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             +H+           + PC+H S    EG +++  G H 
Sbjct  729   LHLKSMQTAHVEFEVSPCKHFSRATEEGKKVIDHGSHF  766



>ref|NP_001130324.1| putative O-Glycosyl hydrolase superfamily protein precursor [Zea 
mays]
 gb|ACF78508.1| unknown [Zea mays]
 gb|AFW73478.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=780

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/757 (50%), Positives = 482/757 (64%), Gaps = 28/757 (4%)
 Frame = -3

Query  2493  SKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             S+P   C      + PFCD  LPI  R+  LVS +TV EKI +L D + AIPRLG+PAY+
Sbjct  31    SEPPYTCGAGAPPNIPFCDAGLPIDRRVDDLVSRMTVAEKISQLGDQSPAIPRLGVPAYK  90

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSE+LHGI+  G GI  DG +++AT FPQVILTAA+FN  LW  I     VEARA++N+
Sbjct  91    WWSEALHGISNQGRGIHLDGPLRAATSFPQVILTAASFNPHLWYRIGQVIGVEARAVYNN  150

Query  2133  GQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYS  1957
             GQA GLTFWAPN+NVF DPRWGRGQETPGEDP +   YA  +VRG+Q           Y 
Sbjct  151   GQAEGLTFWAPNINVFRDPRWGRGQETPGEDPTMTGKYAAVFVRGVQ----------GYG  200

Query  1956  LSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKS  1777
             L+G        +   L  SACCKH TAYDLE W   +RY F+A VT QD+ DTY PPFKS
Sbjct  201   LAG------PVNSTGLEASACCKHFTAYDLENWKGVTRYVFDAKVTAQDLADTYNPPFKS  254

Query  1776  CVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYA  1600
             CVE G AS +MC+YN VNG+P CA+ +LL   AR DWGF GYITSDCDAVA I + Q YA
Sbjct  255   CVEDGHASGIMCSYNRVNGVPTCADYNLLSTTARQDWGFYGYITSDCDAVAIIHDAQGYA  314

Query  1599  KSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNG  1420
             K+ E+A    LKAG D+NCG+Y+  +  SAL+   + E DI+RAL NLF+V+ RLGLFNG
Sbjct  315   KTAEDAVADVLKAGMDVNCGSYVQDHGASALQQGKITEQDINRALHNLFAVRMRLGLFNG  374

Query  1419  KAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNE--QKFLPLDKTRVSSLAVIGPM  1246
                   +   GP  VC+ EH+ LALEAA+ GIVLLKN+     LPL K  V+SLAVIG  
Sbjct  375   DPRRNLYGDIGPDQVCTQEHQDLALEAAQDGIVLLKNDGGAGALPLSKPNVASLAVIGFN  434

Query  1245  ANTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             AN +  L G+Y G PC   + L  L  Y+  TS+ +GC   ACN T    EAV  A  AD
Sbjct  435   ANDAIRLRGNYFGPPCVTVTPLQVLQGYVKDTSFVAGCNSAACNVTT-IPEAVQAASSAD  493

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
              V++ +GLD  QE E+ DR  L LPG Q  L+  +A  + KP++LVL  GGP+D+SFAK 
Sbjct  494   SVVLFMGLDQDQEREEVDRLDLTLPGQQQTLIESVANAAKKPVILVLLCGGPVDVSFAKT  553

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSR  709
             +P+I ++LW GYPGE GG A+++++FG++NP GRLP+TWYP+ FT+VPM DM MRADP+ 
Sbjct  554   NPKIGAILWAGYPGEAGGIAIAQVLFGEHNPGGRLPVTWYPQDFTRVPMTDMRMRADPAT  613

Query  708   GYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEP  529
             GYPGRTYRFY G  V+ FG+GLSYS +S    + P   S    +K     +    GG   
Sbjct  614   GYPGRTYRFYRGPTVFNFGYGLSYSKYSHRFATKPPPTSNVAGLKAVEATA----GGMAS  669

Query  528   Y-VHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAG-GAPQKQLIGFDRV  355
             Y V       C+ L F   V ++N+G MDG   V++F R P +  G G P  QLIGF  +
Sbjct  670   YDVEAIGSETCDRLKFPAVVRVQNHGPMDGKHSVLVFMRWPNATDGSGRPASQLIGFQSL  729

Query  354   HVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             H+           + PC+H S    +G +++  G H 
Sbjct  730   HLRATQTAHVEFEVSPCKHFSRATEDGRKVIDQGSHF  766



>ref|XP_004163321.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-D-xylosidase 7-like 
[Cucumis sativus]
Length=783

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/761 (50%), Positives = 486/761 (64%), Gaps = 30/761 (4%)
 Frame = -3

Query  2505  ATSYSKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRL  2332
             A S S+P   C    P   + PFC T LPI  R   LVS LT+DEK+ +L +    IPRL
Sbjct  30    AGSSSQPPYACDSSNPLTKTLPFCKTYLPIKLRARDLVSRLTLDEKVLQLVNTVPPIPRL  89

Query  2331  GIPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavea  2152
             GIPAYEWWSE+LHG+A  G GI  +G + +AT FPQVILTAA+F+  LW  I  A   EA
Sbjct  90    GIPAYEWWSEALHGVANVGYGIRLNGTITAATSFPQVILTAASFDENLWYQIGQAIGTEA  149

Query  2151  rAMFNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgk  1975
             RA++N+GQA G+TFW PN+N+F DPRWGRGQETPGEDP++   Y+V YVR          
Sbjct  150   RAVYNAGQAKGMTFWTPNINIFRDPRWGRGQETPGEDPLMTGKYSVAYVR----------  199

Query  1974  ngRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTY  1795
                   + G+ + E  +  ++L  SACCKH TAYDL+ W+  +RY F+A VT QDM DTY
Sbjct  200   -----GIQGDAI-EGGKLGNQLKASACCKHFTAYDLDRWNGMTRYVFDAKVTMQDMADTY  253

Query  1794  EPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLE-KARTDWGFEGYITSDCDAVATIF  1618
             +PPF+SCVE+G+AS +MCAYN VNG+P+CA+  LL   AR  W F GYITSDCDAV+ I 
Sbjct  254   QPPFESCVEEGKASGIMCAYNRVNGVPSCADHHLLTATARKQWKFNGYITSDCDAVSIIH  313

Query  1617  EYQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFR  1438
             + Q YAK PE+A    L+AG D+NCGTY+  + KSA+E K V    IDRAL NLFSV+ R
Sbjct  314   DAQGYAKIPEDAVADVLRAGMDVNCGTYLKEHTKSAVEMKKVPMLHIDRALRNLFSVRMR  373

Query  1437  LGLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAV  1258
             LGLF+G      F   G   VCS +H+ LAL+AAR+GIVLLKN  K LPL K+   SLAV
Sbjct  374   LGLFDGNPTKLPFGQIGRDQVCSQQHQNLALQAAREGIVLLKNSAKLLPLSKSNTHSLAV  433

Query  1257  IGPMANT-SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIA  1081
             IG   N   +L G+Y GIPC   +   GL  Y+  T Y  GC    C     + +AV IA
Sbjct  434   IGHNGNDPKTLRGNYAGIPCKSATPFQGLNNYVKNTVYHRGCNYANCTEATIY-QAVKIA  492

Query  1080  KRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDIS  901
             K  DYV++V+GLD +QE ED DR  L LPG Q  L+ E+A  +  P++LV+  GGP+DIS
Sbjct  493   KSVDYVVLVMGLDQTQEREDFDRTELGLPGKQDKLIAEVAKAAKXPVILVILSGGPVDIS  552

Query  900   FAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRA  721
              AK + +I S+LW GYPG+ GG A++EI+FGD+NP GRLPLTWYP  F K PM DM MRA
Sbjct  553   SAKYNEKIGSILWAGYPGQAGGTAIAEIIFGDHNPGGRLPLTWYPHDFIKFPMTDMRMRA  612

Query  720   DPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRG  541
             D S GYPGRTYRFY G KVYEFG+GLSYS+   E     T +S S+ + +  + S   + 
Sbjct  613   DSSTGYPGRTYRFYNGPKVYEFGYGLSYSNHIYEF----TSVSESKLLLSHPKASQPAKN  668

Query  540   GN-EPYVHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLI  370
              +   Y  V E+    C S   +V V +RN G M G   V+LF + P+    G+P KQL+
Sbjct  669   SDLVSYRLVSELDKKFCESKTVNVTVGVRNEGEMGGKHSVLLFIK-PSKPINGSPVKQLV  727

Query  369   GFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             GF +V ++     E    + PC H+S  + EG  I+  G +
Sbjct  728   GFKKVEINAGERREIEFLVSPCDHISKASEEGLMIIEEGSY  768



>ref|XP_002302758.2| hypothetical protein POPTR_0002s19830g [Populus trichocarpa]
 gb|EEE82031.2| hypothetical protein POPTR_0002s19830g [Populus trichocarpa]
Length=770

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/757 (46%), Positives = 490/757 (65%), Gaps = 34/757 (4%)
 Frame = -3

Query  2502  TSYSKPQLPCQPP--THSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLG  2329
             TS +     C P   T  ++PFC   LPI +R+  L+  +T+ EK+  L ++ +A+PRLG
Sbjct  20    TSEALDPFACDPEDGTSRNFPFCQVKLPIQSRVSDLIGRMTLQEKVGLLVNDAAAVPRLG  79

Query  2328  IPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavear  2149
             I  YEWWSE+LHG++  GPG  F GA   AT FPQVI TAA+FN TLW +I    + EAR
Sbjct  80    IKGYEWWSEALHGVSNVGPGTQFGGAFPGATSFPQVITTAASFNATLWEAIGRVVSDEAR  139

Query  2148  AMFNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkng  1969
             AMFN G AGLT+W+PNVN+F DPRWGRGQETPGEDP+V   YA  YVR            
Sbjct  140   AMFNGGVAGLTYWSPNVNIFRDPRWGRGQETPGEDPVVAGKYAASYVR------------  187

Query  1968  RKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEP  1789
                 L GN       D DRL ++ACCKH TAYDL+ W+   R+ FNA V++QDMEDT++ 
Sbjct  188   ---GLQGN-------DGDRLKVAACCKHFTAYDLDNWNGVDRFHFNAQVSKQDMEDTFDV  237

Query  1788  PFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEY  1612
             PF+ CV++G+ + +MC+YN VNGIP CA+  LL+K  R  W  +GYI SDCD+V   +  
Sbjct  238   PFRMCVKEGKVASVMCSYNQVNGIPTCADPKLLKKTVRGQWKLDGYIVSDCDSVGVYYSQ  297

Query  1611  QQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLG  1432
             Q Y  +PEEAA  A+KAG D++CG ++ ++ + A+   ++ E++I+ ALLN  +VQ RLG
Sbjct  298   QHYTTTPEEAAADAIKAGLDLDCGPFLGQHTEDAVRKGLLTEAEINNALLNTLTVQMRLG  357

Query  1431  LFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIG  1252
             +F+G+  ++ + + GP DVC+  H+ LALEAARQGIVLLKN    LPL      S+A+IG
Sbjct  358   MFDGEPSSKPYGNLGPTDVCTPAHQELALEAARQGIVLLKNHGPPLPLSTRHHQSVAIIG  417

Query  1251  PMAN-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKR  1075
             P +N T ++ G+Y G+ C   + L G+G Y  KT Y  GC DVAC S   F  A+  A++
Sbjct  418   PNSNVTVTMIGNYAGVACGYTTPLQGIGRYA-KTIYQQGCADVACVSDQQFVAAMDAARQ  476

Query  1074  ADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFA  895
             AD  ++V+GLD S E E  DR  LLLPG Q  L++++A  S  P +LVL  GGP+D+SFA
Sbjct  477   ADATVLVMGLDQSIEAESRDRTELLLPGRQQELISKVAAASKGPTILVLMSGGPIDVSFA  536

Query  894   KKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESF-TKVPMNDMNMRAD  718
             + DP+I  ++W GYPG+ GG A+S+++FG  NP G+LP+TWYP+ + T +PM +M MR  
Sbjct  537   ENDPKIGGIVWAGYPGQAGGAAISDVLFGTTNPGGKLPMTWYPQDYVTNLPMTNMAMRPS  596

Query  717   PSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGG  538
              S GYPGRTYRFY G+ VY FGHG+SY++F   + SAPT +S+      +  R+    G 
Sbjct  597   KSNGYPGRTYRFYKGKVVYPFGHGISYTNFVHTIASAPTMVSVPLVGHRQASRNATISGK  656

Query  537   NEPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDR  358
                  H    + CN L+F V+V ++N G MDG+  ++++S+ P  +   AP KQL+ F++
Sbjct  657   AIRVTH----ARCNRLSFGVQVDVKNTGSMDGTHTLLVYSKPPAGHW--APLKQLVAFEK  710

Query  357   VHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             VHV+        I++  C+ LS+V+  G R +P+G H
Sbjct  711   VHVAAGTQQRVGINVHVCKFLSVVDRSGIRRIPMGAH  747



>gb|EEC74020.1| hypothetical protein OsI_08964 [Oryza sativa Indica Group]
Length=774

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/756 (50%), Positives = 492/756 (65%), Gaps = 27/756 (4%)
 Frame = -3

Query  2493  SKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             S P   C  P  SS  FC+  LPI  R   LVS LT++EKI +L D + A+ RLG+PAY+
Sbjct  26    SGPPFSCGAP--SSAAFCNPRLPIEQRADDLVSRLTLEEKISQLGDQSPAVDRLGVPAYK  83

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSE+LHG++  G GI  DG +++AT FPQVILTAA+FN  LW  I      EARA++N+
Sbjct  84    WWSEALHGVSNAGRGIHLDGPLRAATSFPQVILTAASFNPHLWYRIGQVIGTEARAVYNN  143

Query  2133  GQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYS  1957
             GQA GLTFWAPN+NVF DPRWGRGQETPGEDP V   YA  +VRG+Q           Y+
Sbjct  144   GQAEGLTFWAPNINVFRDPRWGRGQETPGEDPTVTGKYAAVFVRGVQ----------GYA  193

Query  1956  LSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKS  1777
             L+G        +   L  SACCKH TAYDLE W   +RY+F+A VT QD+ DTY PPF+S
Sbjct  194   LAG------AINSTDLEASACCKHFTAYDLENWKGVTRYAFDAKVTAQDLADTYNPPFRS  247

Query  1776  CVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYA  1600
             CVE G AS +MC+YN VNG+P CA+ +LL K AR DW F GYITSDCDAV+ I + Q YA
Sbjct  248   CVEDGGASGIMCSYNRVNGVPTCADYNLLSKTARGDWRFYGYITSDCDAVSIIHDVQGYA  307

Query  1599  KSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNG  1420
             K+ E+A    LKAG D+NCG+Y+  +  SA++   + E DI+RAL NLF+V+ RLGLFNG
Sbjct  308   KTAEDAVADVLKAGMDVNCGSYVQEHGLSAIQQGKITEQDINRALHNLFAVRMRLGLFNG  367

Query  1419  KAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN  1240
                  ++ + GP  VC+ EH+ LALEAA+ G+VLLKN+   LPL K++VSS+AVIG  AN
Sbjct  368   NPKYNRYGNIGPDQVCTQEHQNLALEAAQHGVVLLKNDANALPLSKSQVSSIAVIGHNAN  427

Query  1239  TSS-LGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYV  1063
              ++ L G+Y G PC   + L  L  Y+  T + +GC   ACN +    EA  +A   DYV
Sbjct  428   DATRLLGNYFGPPCISVTPLQVLQGYVKDTRFLAGCNSAACNVSS-IGEAAQLASSVDYV  486

Query  1062  IVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDP  883
             ++ +GLD  QE E+ DR  L LPG Q  L+N +A  + KP++LVL  GGP+D++FAK +P
Sbjct  487   VLFMGLDQDQEREEVDRLELSLPGMQENLINTVANAAKKPVILVLLCGGPVDVTFAKYNP  546

Query  882   RIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGY  703
             +I ++LW GYPGE GG A+++++FG++NP GRLP+TWYP+ FT VPM DM MRADPS GY
Sbjct  547   KIGAILWAGYPGEAGGIAIAQVLFGEHNPGGRLPVTWYPKEFTSVPMTDMRMRADPSTGY  606

Query  702   PGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYV  523
             PGRTYRFY G  VY+FG+GLSYS +S   ++  T++    SI   L+       G   Y 
Sbjct  607   PGRTYRFYRGNTVYKFGYGLSYSKYSHHFVANGTKLPSLSSID-GLKAMATAAAGTVSY-  664

Query  522   HVDEV--SNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYA-GGAPQKQLIGFDRVH  352
              V+E+    C+ L F   V ++N+G MDG   V+LF R P   A GG P  QLIGF  +H
Sbjct  665   DVEEIGTETCDKLKFPALVRVQNHGPMDGRHPVLLFLRWPNGAADGGRPASQLIGFQSLH  724

Query  351   VSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             +           + PC+H S    +G +++  G H 
Sbjct  725   LKSMQTVHVEFEVSPCKHFSRATEDGKKVIDHGSHF  760



>ref|XP_006390030.1| hypothetical protein EUTSA_v10018160mg [Eutrema salsugineum]
 gb|ESQ27316.1| hypothetical protein EUTSA_v10018160mg [Eutrema salsugineum]
Length=771

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/753 (51%), Positives = 482/753 (64%), Gaps = 39/753 (5%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P+   + FC T LPI  R   LVS LT+ EKI +L ++   IPRLG+PAYEWWSE+LHG+
Sbjct  35    PSTKLFQFCRTDLPISRRARDLVSRLTISEKISQLVNSAPGIPRLGVPAYEWWSEALHGV  94

Query  2286  ATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GLTFW  2110
             A  GPGI F+G VK+AT FPQVILTAA+F+   W  IA     EAR ++N+GQA G+TFW
Sbjct  95    AGAGPGIRFNGTVKAATSFPQVILTAASFDSYQWFRIAQVIGKEARGVYNAGQAKGMTFW  154

Query  2109  APNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEE  1930
             APN+N+F DPRWGRGQETPGEDP V   YAV YVR                L G+     
Sbjct  155   APNINIFRDPRWGRGQETPGEDPTVTGAYAVAYVR---------------GLQGDSFDGR  199

Query  1929  EEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASC  1750
             ++    L  SACCKH TAYDL+ W   +RY FNA V+  D+ +TY+PPFK C+E+GRAS 
Sbjct  200   KKLSGHLQASACCKHFTAYDLDRWKGITRYVFNAQVSLADLAETYQPPFKKCIEEGRASG  259

Query  1749  LMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGI  1573
             +MCAYN VNGIP+CA+ +LL + AR  W F+GYITSDCDAV+ I + Q YAKSPE+A   
Sbjct  260   IMCAYNRVNGIPSCADPNLLTRTARGLWHFQGYITSDCDAVSIIHDAQGYAKSPEDAVAD  319

Query  1572  ALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFES  1393
              LKAG D+NCG+Y+ ++ KSAL+ K V ESDIDRAL NLFSV+ RLGLFNG      + +
Sbjct  320   VLKAGMDVNCGSYLQKHTKSALQQKKVSESDIDRALTNLFSVRIRLGLFNGDPTKLTYGN  379

Query  1392  FGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTS-SLGGDY  1216
               P DVCS  H+ LALEAAR GIVLLKN  K LP  K  V SLAVIGP AN + +L G+Y
Sbjct  380   ISPNDVCSPAHQALALEAARNGIVLLKNTLKLLPFSKRSVPSLAVIGPNANAAETLLGNY  439

Query  1215  TGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLS  1036
              G PC   + L+ L  Y+    Y  GC  VAC S     +AV+IA+ AD V++++GLD +
Sbjct  440   AGPPCKNVTPLEALRGYVKTAVYHKGCDSVAC-SNAAVDQAVAIARNADRVVLIMGLDKT  498

Query  1035  QETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIG  856
             QE ED DR  L LPG Q  LV  +A  + KP+VLVL  GGP+DISFA  + +I S++W G
Sbjct  499   QEKEDMDRVDLSLPGKQQELVMTVAKAAKKPVVLVLICGGPVDISFATNNDKIGSIIWAG  558

Query  855   YPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFYT  676
             YPGE GG AL+EI+FGD+NP GRLP+TWYP+SF  V M DM MR+  S GYPGRTYRFY 
Sbjct  559   YPGEAGGIALAEIIFGDHNPGGRLPVTWYPQSFVNVKMTDMRMRS--SFGYPGRTYRFYK  616

Query  675   GEKVYEFGHGlsyssfsle-llSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEV--S  505
             G KV+EFGHGLSYSS+S      A + + L+QS       S+        Y  V E+   
Sbjct  617   GPKVFEFGHGLSYSSYSYLFKALAQSNLYLNQSKAQTNSESVR-------YALVSEMGRE  669

Query  504   NCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPT-SYAGGAPQKQLIGFDRVHVSGNGVTE  328
              CN     V V + N G M G   V++F+R       G   +KQL+GF  + +S     E
Sbjct  670   GCNIAKTKVSVVVENRGEMAGKHPVLVFARHERGGEEGKRAEKQLVGFKSIVLSKGEKAE  729

Query  327   TSISIEPCQHLS-------IVNVEGSRILPLGD  250
                 I  C+HLS       +V  EG   L +GD
Sbjct  730   IEFEIGLCEHLSRANDVGVMVVEEGKYFLTVGD  762



>ref|XP_009391117.1| PREDICTED: probable beta-D-xylosidase 7 [Musa acuminata subsp. 
malaccensis]
Length=774

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/762 (50%), Positives = 501/762 (66%), Gaps = 39/762 (5%)
 Frame = -3

Query  2493  SKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             + P   C P  P+  +Y FC T+LPI  R++ L+S LT++EKIQ+L D   AIPRLG+P 
Sbjct  26    ASPPFACDPASPSTRNYGFCQTTLPIDKRVNDLISRLTLEEKIQQLDDETPAIPRLGVPK  85

Query  2319  YEWWSESLHGIATNGPGITFDG-AVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAM  2143
             Y WWSE+LHG+++ G GI FD   +  AT FPQVILTAA+F++ LW  I  A AVEARA+
Sbjct  86    YYWWSEALHGVSSWGHGIHFDPLTIPGATSFPQVILTAASFDQYLWYRIGQAIAVEARAL  145

Query  2142  FNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngR  1966
             +N+G A GLTFW+PNVN+F DPRWGRGQETPGEDP   S YAV +VR             
Sbjct  146   YNAGHADGLTFWSPNVNIFRDPRWGRGQETPGEDPTTASKYAVAFVR-------------  192

Query  1965  KYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPP  1786
                L G+    E     +LM SACCKH TAYDL+ W+   RY+F+A VT QDMEDT++PP
Sbjct  193   --GLQGDSPTGERPG--QLMASACCKHFTAYDLDRWNGTLRYTFDARVTAQDMEDTFQPP  248

Query  1785  FKSCVEKGRASCLMCAYNAVNGIPACANKDLL-EKARTDWGFEGYITSDCDAVATIFEYQ  1609
             F+ CV++GR +C+MC+YN VNG+P CA+ +LL E+A+  WG +GYI SDC AV  I+   
Sbjct  249   FRGCVQEGRGTCVMCSYNRVNGVPTCADYNLLTEQAKNAWGLDGYIASDCAAVDFIYGAT  308

Query  1608  QYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGL  1429
              YAK+ EEA   ALKAG D+NCG  M +++  A++N  V ESD+DRAL N FS++ +LGL
Sbjct  309   HYAKTLEEAVSYALKAGVDVNCGKAMSQHVGDAIKNGNVSESDVDRALFNGFSLRMKLGL  368

Query  1428  FNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGP  1249
             FNG           P  VCS+EH+ LALEAA+ GIVLLKN    LPL ++ V+SL VIGP
Sbjct  369   FNGDPQKLPSGDIPPSQVCSTEHKNLALEAAQAGIVLLKNIGNTLPLARSNVTSLGVIGP  428

Query  1248  MANTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRA  1072
              +N   SL G+Y G PC + + LD L   I+ T +A GC +V  N +D   EAV +A   
Sbjct  429   NSNAPPSLLGNYNGPPCEVITPLDALQRSINNTRFAIGC-NVPGNVSD-IPEAVQLASSV  486

Query  1071  DYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAK  892
             DYVI+ +GLD  QE ED DR  L+LP  Q  L++++A  + KP++LVL  GGPLDI+FAK
Sbjct  487   DYVIMFMGLDQDQEREDLDRTDLVLPETQQTLISKVAEAAKKPIILVLISGGPLDITFAK  546

Query  891   KDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPS  712
              DPRI ++LW G+PGE GG A+S I+FGD+NP G+LP+TWYP+ FTKVPM DM MRADP+
Sbjct  547   DDPRIGAILWAGFPGEAGGSAISSIIFGDHNPGGKLPVTWYPQEFTKVPMTDMRMRADPA  606

Query  711   RGYPGRTYRFYTGEKVYEFGHGlsyssfslellSA-PTRISLSQSIKTKLRRSILNRGGN  535
              GYPGRTYRFY G+ VY+FG+GLSYSS S E  +   T I L+ S+  +          N
Sbjct  607   TGYPGRTYRFYNGKPVYQFGYGLSYSSHSYEFAAGTTTSIYLNNSLSPRAHP-------N  659

Query  534   EPYVHVDEVSN-----CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLI  370
             +P     ++++     C  L  S  V ++N+G M G   V+LFSR P++   G P KQL+
Sbjct  660   DPNTLSYDIASLGFNTCGELKISATVGVKNHGPMAGRHPVLLFSRWPST-EHGRPAKQLV  718

Query  369   GFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
              F  VH+     T+   S+  C+HLS V  +G R+L  G H 
Sbjct  719   DFQSVHLEAGESTKVEFSLSACEHLSRVTDDGRRVLDKGSHF  760



>ref|NP_001048140.1| Os02g0752200 [Oryza sativa Japonica Group]
 dbj|BAD15557.1| putative beta-D-xylosidase [Oryza sativa Japonica Group]
 dbj|BAD15656.1| putative beta-D-xylosidase [Oryza sativa Japonica Group]
 dbj|BAF10054.1| Os02g0752200 [Oryza sativa Japonica Group]
 gb|EAZ24641.1| hypothetical protein OsJ_08409 [Oryza sativa Japonica Group]
Length=780

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/756 (50%), Positives = 492/756 (65%), Gaps = 27/756 (4%)
 Frame = -3

Query  2493  SKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             S P   C  P  SS  FC+  LPI  R   LVS LT++EKI +L D + A+ RLG+PAY+
Sbjct  32    SGPPFSCGAP--SSAAFCNPRLPIEQRADDLVSRLTLEEKISQLGDQSPAVDRLGVPAYK  89

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSE+LHG++  G GI  DG +++AT FPQVILTAA+FN  LW  I      EARA++N+
Sbjct  90    WWSEALHGVSNAGRGIHLDGPLRAATSFPQVILTAASFNPHLWYRIGQVIGTEARAVYNN  149

Query  2133  GQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYS  1957
             GQA GLTFWAPN+NVF DPRWGRGQETPGEDP V   YA  +VRG+Q           Y+
Sbjct  150   GQAEGLTFWAPNINVFRDPRWGRGQETPGEDPTVTGKYAAVFVRGVQ----------GYA  199

Query  1956  LSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKS  1777
             L+G        +   L  SACCKH TAYDLE W   +RY+F+A VT QD+ DTY PPF+S
Sbjct  200   LAG------AINSTDLEASACCKHFTAYDLENWKGVTRYAFDAKVTAQDLADTYNPPFRS  253

Query  1776  CVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYA  1600
             CVE G AS +MC+YN VNG+P CA+ +LL K AR DW F GYITSDCDAV+ I + Q YA
Sbjct  254   CVEDGGASGIMCSYNRVNGVPTCADYNLLSKTARGDWRFYGYITSDCDAVSIIHDVQGYA  313

Query  1599  KSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNG  1420
             K+ E+A    LKAG D+NCG+Y+  +  SA++   + E DI+RAL NLF+V+ RLGLFNG
Sbjct  314   KTAEDAVADVLKAGMDVNCGSYVQEHGLSAIQQGKITEQDINRALHNLFAVRMRLGLFNG  373

Query  1419  KAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN  1240
                  ++ + GP  VC+ EH+ LALEAA+ G+VLLKN+   LPL K++VSS+AVIG  AN
Sbjct  374   NPKYNRYGNIGPDQVCTQEHQNLALEAAQHGVVLLKNDANALPLSKSQVSSIAVIGHNAN  433

Query  1239  TSS-LGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYV  1063
              ++ L G+Y G PC   + L  L  Y+  T + +GC   ACN +    EA  +A   DYV
Sbjct  434   DATRLLGNYFGPPCISVTPLQVLQGYVKDTRFLAGCNSAACNVSS-IGEAAQLASSVDYV  492

Query  1062  IVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDP  883
             ++ +GLD  QE E+ DR  L LPG Q  L+N +A  + KP++LVL  GGP+D++FAK +P
Sbjct  493   VLFMGLDQDQEREEVDRLELSLPGMQENLINTVANAAKKPVILVLLCGGPVDVTFAKYNP  552

Query  882   RIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGY  703
             +I ++LW GYPGE GG A+++++FG++NP GRLP+TWYP+ FT VPM DM MRADPS GY
Sbjct  553   KIGAILWAGYPGEAGGIAIAQVLFGEHNPGGRLPVTWYPKEFTSVPMTDMRMRADPSTGY  612

Query  702   PGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYV  523
             PGRTYRFY G  VY+FG+GLSYS +S   ++  T++    SI   L+       G   Y 
Sbjct  613   PGRTYRFYRGNTVYKFGYGLSYSKYSHHFVANGTKLPSLSSID-GLKAMATAAAGTVSY-  670

Query  522   HVDEVS--NCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYA-GGAPQKQLIGFDRVH  352
              V+E+    C+ L F   V ++N+G MDG   V+LF R P   A GG P  QLIGF  +H
Sbjct  671   DVEEIGPETCDKLKFPALVRVQNHGPMDGRHPVLLFLRWPNGAADGGRPASQLIGFQSLH  730

Query  351   VSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             +           + PC+H S    +G +++  G H 
Sbjct  731   LKSMQTVHVEFEVSPCKHFSRATEDGKKVIDHGSHF  766



>ref|XP_007140931.1| hypothetical protein PHAVU_008G153300g [Phaseolus vulgaris]
 gb|ESW12925.1| hypothetical protein PHAVU_008G153300g [Phaseolus vulgaris]
Length=777

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/760 (49%), Positives = 498/760 (66%), Gaps = 34/760 (4%)
 Frame = -3

Query  2493  SKPQLPCQPPTHSSY-PFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAY  2317
             ++P   C   ++S Y  FC+T LPIP R   LVS LT+DEK+ +L ++  AIPRLGIP Y
Sbjct  28    TQPPHSCDSSSNSPYYAFCNTKLPIPQRAKDLVSQLTLDEKLAQLVNSAPAIPRLGIPKY  87

Query  2316  EWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFN  2137
             +WWSE+LHG+A  G GI F+G +KSAT FPQVILTAA+F++ LW +I+ A   EARA++N
Sbjct  88    QWWSEALHGVADAGLGIRFNGTIKSATSFPQVILTAASFDQNLWYNISKAIGREARAVYN  147

Query  2136  SGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKY  1960
             +GQA G+TFWAPN+NVF DPRWGRGQET GEDP++ + Y+V YVR               
Sbjct  148   AGQALGMTFWAPNINVFRDPRWGRGQETVGEDPLMNAKYSVAYVR---------------  192

Query  1959  SLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFK  1780
              L G+   E  E  +RL  SACCKH TAYD++ W    R+ F+A V+ QD+ DTY+PPFK
Sbjct  193   GLQGDSF-EGGELGERLQASACCKHFTAYDVDQWKGLDRFVFDARVSMQDLADTYQPPFK  251

Query  1779  SCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQY  1603
             SC+++GRAS +MCAYN VNG+P CA+ +LL K AR  W F+GYITSDC AV+ I + Q Y
Sbjct  252   SCIQQGRASGIMCAYNRVNGVPNCADFNLLTKTARQQWKFDGYITSDCGAVSIIHDKQGY  311

Query  1602  AKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFN  1423
             AK+ E+A     +AG D+ CG Y+ ++ KSA+  K +  S IDRAL NLFS++ RLGLF+
Sbjct  312   AKTAEDAIADVFRAGMDVECGDYITQHAKSAVSQKKLSISQIDRALQNLFSIRMRLGLFD  371

Query  1422  GKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMA  1243
             G      + + GP +VCS EH +LALEAAR GIVLLKN    LPL KT +S +AVIGP A
Sbjct  372   GNPTKLPYGTIGPNEVCSKEHLQLALEAARDGIVLLKNTDSLLPLPKTGLS-VAVIGPNA  430

Query  1242  NTSSLG--GDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             N SSL   G+Y G PC L ++L G   Y   T+Y  GC D     +    EAV +AK+ D
Sbjct  431   NASSLVSLGNYYGRPCKLVTLLQGFEGYSKDTTYHPGCDDGPQCVSARIEEAVEVAKKMD  490

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
             YV++V+GLD SQE E HDR  L LPG Q  L+  +A  S +P+VLVL  GGP+DI+ AK 
Sbjct  491   YVVLVMGLDQSQERESHDREFLGLPGKQEELIKSVAKASKRPVVLVLLCGGPVDITSAKF  550

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSR  709
             + ++  +LW GYPGE GG AL++++FGD+NP G+LP+TWYP+ F ++PM DM MRADP+ 
Sbjct  551   NNKVGGILWAGYPGEVGGVALAQVIFGDHNPGGKLPITWYPKDFIRIPMTDMRMRADPAS  610

Query  708   GYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEP  529
             GYPGRTYRFYTG KVYEFG+GLSY+ +S         +SLS S     + S      N  
Sbjct  611   GYPGRTYRFYTGPKVYEFGYGLSYTKYSY------NLLSLSHSTLHINQSSTHLMTENSE  664

Query  528   YVHVDEVSN-----CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGF  364
              +    VS+     C S++ S+ + + N+G M G   V+LF +       G P KQL+GF
Sbjct  665   TIRYKLVSDLGEQTCQSMSLSITLGVTNHGNMAGKHPVLLFLKK-GQVRKGNPVKQLVGF  723

Query  363   DRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
               V+++     +    + PC HLS+ N  GS ++  G ++
Sbjct  724   QSVNLNAGETAQVGFELSPCDHLSMANEVGSLVIEEGSYL  763



>ref|XP_011041424.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/748 (47%), Positives = 494/748 (66%), Gaps = 34/748 (5%)
 Frame = -3

Query  2475  CQPP--THSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSE  2302
             C P   T  + PFC   LPI  R+  L+  +T+ EK+  L +N +A+PRLGI  YEWWSE
Sbjct  29    CDPKDGTKRNLPFCQVKLPIQTRVKDLIGRMTLQEKVGLLVNNAAAVPRLGIKRYEWWSE  88

Query  2301  SLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAG  2122
             +LHG++  GPG  F GA   AT FPQVI TAA+FN TLW +I    + EARAMFN G AG
Sbjct  89    ALHGVSNVGPGTKFGGAFPVATSFPQVITTAASFNATLWEAIGQVVSDEARAMFNGGVAG  148

Query  2121  LTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNR  1942
             LT+W+PNVN+F DPRWGRGQETPGEDP+VV  YA  YVR                L G+ 
Sbjct  149   LTYWSPNVNIFRDPRWGRGQETPGEDPVVVGKYAASYVR---------------GLQGS-  192

Query  1941  MPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKG  1762
                   D +RL ++ACCKH TAYDL+ W+   R+ FNA V++QDMEDT++ PF+ CV++G
Sbjct  193   ------DGNRLKVAACCKHFTAYDLDNWNGVDRFHFNAKVSKQDMEDTFDVPFRMCVKEG  246

Query  1761  RASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEE  1585
             + + +MC+YN VNGIP CA+ +LL+K  R  W  +GYI SDCD+V   +E Q Y  +PEE
Sbjct  247   KVASVMCSYNQVNGIPTCADPNLLKKTVRGQWRLDGYIVSDCDSVGVYYEQQHYTSTPEE  306

Query  1584  AAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNR  1405
             AA  A+KAG D++CG ++ ++ + A++  ++ E++I+ ALLN  +VQ RLG+F+G+  ++
Sbjct  307   AASDAIKAGLDLDCGPFLGQHTEDAVKKGLLNEAEINNALLNTLTVQMRLGMFDGEPSSQ  366

Query  1404  KFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSL  1228
              + + GP DVC+  H+ LALEAARQGIVLLKN    LPL   R  S+A++GP +N T+++
Sbjct  367   LYGNLGPNDVCTPAHQELALEAARQGIVLLKNHGPSLPLSTRRHLSVAIVGPNSNVTATM  426

Query  1227  GGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVG  1048
              G+Y G+ C   + L G+  Y  +T Y  GC DVAC S   F+ A+  A++AD  ++V+G
Sbjct  427   IGNYAGVACGYTTPLQGIQRYA-QTIYRQGCADVACVSDQQFSAAIDAARQADATVLVMG  485

Query  1047  LDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASV  868
             LD S E E  DR  LLLPG Q  LV+++A  S  P +LVL  GGP+D+SFA+ DP+I S+
Sbjct  486   LDQSIEAEFRDRAGLLLPGRQQELVSKVAAASKGPTILVLMSGGPIDVSFAENDPKIGSI  545

Query  867   LWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESF-TKVPMNDMNMRADPSRGYPGRT  691
             +W GYPG+ GG A+S+++FG  NP G+LP+TWYP+ + T +PM DM MR+  S+GYPGRT
Sbjct  546   VWAGYPGQAGGAAISDVLFGITNPGGKLPMTWYPQDYITNLPMTDMAMRSSKSKGYPGRT  605

Query  690   YRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDE  511
             YRFY G+ VY FGHG+SY++F   + SAPT +S+        R    N   +   + V  
Sbjct  606   YRFYKGKVVYPFGHGISYTNFVHTIASAPTMVSVPLD---GHRHGSGNATISRKAIRVTH  662

Query  510   VSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVT  331
              + CN L+  V+V ++N G MDG+  ++++SR P  +   AP KQL+ F++VHV+     
Sbjct  663   -ARCNKLSLGVQVDVKNIGSMDGTHTLLVYSRPPARHW--APHKQLVAFEKVHVAAGTQQ  719

Query  330   ETSISIEPCQHLSIVNVEGSRILPLGDH  247
                I+I  C+ LS+V+  G R +P+G+H
Sbjct  720   RVGINIHVCKSLSVVDASGIRRIPMGEH  747



>ref|XP_011015623.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/748 (47%), Positives = 495/748 (66%), Gaps = 34/748 (5%)
 Frame = -3

Query  2475  CQPP--THSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSE  2302
             C P   T  + PFC   LPI  R+  L+  +T+ EK+  L +N +A+PRLGI  YEWWSE
Sbjct  29    CDPKDGTKRNLPFCQVKLPIQTRVKDLIGRMTLQEKVGLLVNNAAAVPRLGIKRYEWWSE  88

Query  2301  SLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAG  2122
             +LHG++  GPG  F GA   AT FPQVI TAA+FN TLW +I    + EARAMFN G AG
Sbjct  89    ALHGVSNVGPGTKFGGAFPVATSFPQVITTAASFNATLWEAIGQVVSDEARAMFNGGVAG  148

Query  2121  LTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNR  1942
             LT+W+PNVN+F DPRWGRGQETPGEDP+VV  YA  YVR                L G+ 
Sbjct  149   LTYWSPNVNIFRDPRWGRGQETPGEDPVVVGKYAASYVR---------------GLQGS-  192

Query  1941  MPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKG  1762
                   D +RL ++ACCKH TAYDL+ W+   R+ FNA V++QDMEDT++ PF+ CV++G
Sbjct  193   ------DGNRLKVAACCKHFTAYDLDNWNGVDRFHFNAKVSKQDMEDTFDVPFRMCVKEG  246

Query  1761  RASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEE  1585
             + + +MC+YN VNGIP CA+ +LL+K  R  W  +GYI SDCD+V   +E Q Y  +PEE
Sbjct  247   KVASVMCSYNQVNGIPTCADPNLLKKTVRGQWRLDGYIVSDCDSVGVYYEQQHYTSTPEE  306

Query  1584  AAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNR  1405
             AA  A+KAG D++CG ++ ++ + A++  ++ E++I+ ALLN  +VQ RLG+F+G+  ++
Sbjct  307   AASDAIKAGLDLDCGPFLGQHTEDAVKKGLLNEAEINNALLNTLTVQMRLGMFDGEPSSQ  366

Query  1404  KFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSL  1228
              + + GP DVC+  H+ LALEAARQGIVLLKN    LPL   R  S+A++GP +N T+++
Sbjct  367   LYGNLGPNDVCTPAHQELALEAARQGIVLLKNHGPSLPLSTRRHLSVAIVGPNSNVTATM  426

Query  1227  GGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVG  1048
              G+Y G+ C   + L G+  Y  +T Y  GC DVAC S   F+ A+  A++AD  ++V+G
Sbjct  427   IGNYAGVACGYTTPLQGIQRYA-QTIYRQGCADVACVSDQQFSAAIDAARQADATVLVMG  485

Query  1047  LDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASV  868
             LD S E E  DR  LLLPG Q  LV+++A  S  P +LVL  GGP+D+SFA+ DP+I S+
Sbjct  486   LDQSIEAEFRDRAGLLLPGRQQELVSKVAAASKGPTILVLMSGGPIDVSFAENDPKIGSI  545

Query  867   LWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESF-TKVPMNDMNMRADPSRGYPGRT  691
             +W GYPG+ GG A+S+++FG  NP G+LP+TWYP+ + T +PM DM MR+  S+GYPGRT
Sbjct  546   VWAGYPGQAGGAAISDVLFGITNPGGKLPMTWYPQDYITNLPMTDMAMRSSKSKGYPGRT  605

Query  690   YRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDE  511
             YRFY G+ VY FGHG+SY++F   + SAPT +S+    +   R    N   +   + V  
Sbjct  606   YRFYKGKVVYPFGHGISYTNFVHTIASAPTMVSVPLDGR---RHGSGNATISRKAIRVTH  662

Query  510   VSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVT  331
              + CN L+  ++V ++N G MDG+  ++++SR P  +   AP KQL+ F++VHV+     
Sbjct  663   -ARCNKLSLGMQVDVKNIGSMDGTHTLLVYSRPPARHW--APHKQLVAFEKVHVAAGTQQ  719

Query  330   ETSISIEPCQHLSIVNVEGSRILPLGDH  247
                I+I  C+ LS+V+  G R +P+G+H
Sbjct  720   RVGINIHVCKSLSVVDASGIRRIPMGEH  747



>ref|XP_003526589.1| PREDICTED: probable beta-D-xylosidase 7-like isoform X1 [Glycine 
max]
Length=772

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/764 (51%), Positives = 495/764 (65%), Gaps = 39/764 (5%)
 Frame = -3

Query  2493  SKPQLP--CQ--PPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGI  2326
             SKP+ P  C    P+  SYPFC+  LPIP R   L+S LT+DEK+ +L +    IPRLGI
Sbjct  20    SKPEAPFACDFSNPSSRSYPFCNPKLPIPQRTKDLLSRLTLDEKLSQLVNTAPPIPRLGI  79

Query  2325  PAYEWWSESLHGIATNGPGITFDG--AVKSATGFPQVILTAAAFNRTLWRSIaaaaavea  2152
             PAY+WWSE+LHG++  GPGI FD    + SAT FPQVILTAA+F+  LW  I  A  +EA
Sbjct  80    PAYQWWSEALHGVSGVGPGILFDNNSTISSATSFPQVILTAASFDSRLWYRIGHAIGIEA  139

Query  2151  rAMFNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgk  1975
             RA+FN+GQA GLTFWAPN+N+F DPRWGRGQET GEDP++ S YAV +VR          
Sbjct  140   RAIFNAGQANGLTFWAPNINIFRDPRWGRGQETAGEDPLLTSRYAVSFVR----------  189

Query  1974  ngRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTY  1795
                   L G+           L+ SACCKH TAYDL+ W    R+ F+A V+ QD+ DTY
Sbjct  190   -----GLQGDSF-----KGAHLLASACCKHFTAYDLDNWKGVDRFVFDARVSLQDLADTY  239

Query  1794  EPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLL-EKARTDWGFEGYITSDCDAVATIF  1618
             +PPF+SCV++GRAS +MCAYN VNG+P CA+  LL + AR  W F GYITSDC AV  I 
Sbjct  240   QPPFQSCVQQGRASGIMCAYNRVNGVPNCADYGLLTQTARNQWDFNGYITSDCGAVGFIH  299

Query  1617  EYQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFR  1438
             + Q+YAKSPE+     L+AG D+ CG+Y+  + KSA+  K +  S+IDRAL NLFS++ R
Sbjct  300   DRQRYAKSPEDVVADVLRAGMDLECGSYLTYHAKSAVLQKKLGMSEIDRALQNLFSIRMR  359

Query  1437  LGLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVS-SLA  1261
             LGLF+G      F   G   VCS EH+ LALEAAR GIVLLKN    LPL KT  S SLA
Sbjct  360   LGLFDGNPTRLSFGLIGSNHVCSKEHQYLALEAARNGIVLLKNSPTLLPLPKTSPSISLA  419

Query  1260  VIGPMANTS--SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVS  1087
             VIGP AN+S  +L G+Y G PC   ++L G   Y+    Y  GC      S+    +AV 
Sbjct  420   VIGPNANSSPLTLLGNYAGPPCKYVTILQGFRHYVKNAFYHPGCDGGPKCSSAQIDQAVE  479

Query  1086  IAKRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLD  907
             +AK+ DYV++V+GLD S+E E+ DR  L LPG Q+ L+N +A  S KP++LVL  GGPLD
Sbjct  480   VAKKVDYVVLVMGLDQSEEREERDRVHLDLPGKQLELINGVAEASKKPVILVLLSGGPLD  539

Query  906   ISFAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNM  727
             I+ AK + +I  +LW GYPGE GG AL++I+FGD+NP GRLP TWYP+ + KVPM DM M
Sbjct  540   ITSAKYNHKIGGILWAGYPGELGGIALAQIIFGDHNPGGRLPTTWYPKDYIKVPMTDMRM  599

Query  726   RADPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAP-TRISLSQSIKTKLRRSIL  550
             RADPS GYPGRTYRFY G KVYEFG+GLSYS +S E +S    ++  +QS  T L   ++
Sbjct  600   RADPSTGYPGRTYRFYKGPKVYEFGYGLSYSKYSYEFVSVTHDKLHFNQS-STHL---MV  655

Query  549   NRGGNEPYVHVDEV--SNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQ  376
                    Y  V E+    C S++ SV V ++N+G M G   V+LF R P     G+P KQ
Sbjct  656   ENSETISYKLVSELDEQTCQSMSLSVTVRVQNHGSMVGKHPVLLFIR-PKRQKSGSPVKQ  714

Query  375   LIGFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             L+GF+ V +    +      + PC+HLS  N  G+ I+  G H+
Sbjct  715   LVGFESVMLDAGEMAHVEFEVSPCEHLSRANEAGAMIIEEGSHM  758



>gb|EYU23226.1| hypothetical protein MIMGU_mgv1a025071mg, partial [Erythranthe 
guttata]
Length=740

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/742 (49%), Positives = 484/742 (65%), Gaps = 38/742 (5%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P+  SYPFC+  LPI  R   LVS L++DEKI +L +  SA+PRLGIP Y+WWSE+LHG+
Sbjct  12    PSTKSYPFCNVDLPIEKRARDLVSRLSLDEKISQLVNEASAVPRLGIPYYQWWSEALHGV  71

Query  2286  ATNGP---GITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GL  2119
               + P   G++F+G + +AT FPQVILTAA F+  LW  +A     EARA++N GQ  G+
Sbjct  72    GGSTPAQSGVSFNGTINAATSFPQVILTAATFDANLWYRMAKVMGTEARALYNEGQVTGM  131

Query  2118  TFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRM  1939
             TF++PN+N+F DPRWGRGQETPGEDP + S YAV YVR                + G+  
Sbjct  132   TFFSPNINIFRDPRWGRGQETPGEDPFLTSKYAVSYVR---------------GIQGDSF  176

Query  1938  PEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGR  1759
                +  D RL  SACCKHLTAYDLE W+  SR++FNA VT+QDM DTY+ PFKSCV++G+
Sbjct  177   EGGDLKDGRLQASACCKHLTAYDLESWNGNSRFTFNARVTKQDMVDTYQLPFKSCVQEGQ  236

Query  1758  ASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEA  1582
             AS ++CAYN VNG+P C + DLL K  R +WGF+GYITSD  AV  ++E Q Y+K+ E+A
Sbjct  237   ASGILCAYNFVNGVPNCVDYDLLTKTVRGEWGFQGYITSDFHAVEHLYEKQNYSKTTEDA  296

Query  1581  AGIALKAGTDINCGTYMLRNMKSALENKIVVESD-IDRALLNLFSVQFRLGLFNGKAVNR  1405
                 LKAG D+ CG+Y+  + KSA+E   V ESD IDRAL NLF+V+ RLGLFNG     
Sbjct  297   VADVLKAGMDVECGSYLANHTKSAVEKGKVSESDDIDRALYNLFTVRMRLGLFNGNPSEL  356

Query  1404  KFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTS-SL  1228
              + +    DVCS EH+ LALE AR GIVLLKN    LPL K+ + SLAVIGP AN S +L
Sbjct  357   PYGNLSRNDVCSREHQDLALEVARDGIVLLKNSANLLPLSKSEIKSLAVIGPNANVSDTL  416

Query  1227  GGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVG  1048
              G+Y G PC   + L GL  Y+    Y  GC  + C S         ++K ADYV++V+G
Sbjct  417   LGNYAGPPCKTVTPLQGLMNYVKNIEYREGCETINCTSISSIKVVKELSKSADYVVLVMG  476

Query  1047  LDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASV  868
             L+  +E ED DR  L+LPG Q  L+  +A  +  P++LVL  GGP+DISFAK +P+I S+
Sbjct  477   LNQDREGEDLDREDLVLPGQQQRLITIVAKAAKNPVILVLLCGGPVDISFAKGNPKIGSI  536

Query  867   LWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTY  688
             LW GYPG  GGKA++EI+FGD+NP GRLP+TWYP+ F K+PM DM MR D S GYPGRTY
Sbjct  537   LWAGYPGGAGGKAIAEIIFGDHNPGGRLPVTWYPKDFIKIPMTDMRMRPDTSSGYPGRTY  596

Query  687   RFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEV  508
             +FY GEKVYEFG+GLSYS++S +       +S+S+S    L   +++  G+E        
Sbjct  597   KFYQGEKVYEFGYGLSYSTYSYKF------VSVSESKLKNLGNILVSNIGSEL-------  643

Query  507   SNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTE  328
               C    F V VS+ N+G M G   V+LF R   +   G+P KQL+GF  + ++ +    
Sbjct  644   --CERAKFLVIVSVENDGRMAGKHPVLLFLRRDKA-VKGSPVKQLVGFQTLKLNADEKAN  700

Query  327   TSISIEPCQHLSIVNVEGSRIL  262
                 I PC+H S  + +G+ ++
Sbjct  701   VEFEINPCEHFSTASEDGTMLI  722



>gb|AES97966.2| glycoside hydrolase family 3 protein [Medicago truncatula]
Length=782

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/747 (50%), Positives = 482/747 (65%), Gaps = 27/747 (4%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P   S PFC+ +L I  R   +VS LT+DEKI +L +   +IPRLGIP+Y+WW E+LHG+
Sbjct  43    PLTKSLPFCNLNLTITQRAKDIVSRLTLDEKISQLVNTAPSIPRLGIPSYQWWDEALHGV  102

Query  2286  ATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GLTFW  2110
             A  G GI  +G+V  AT FPQVILTAA+F+  LW  I+     EAR ++N+GQA G+TFW
Sbjct  103   ANAGKGIRLNGSVAGATSFPQVILTAASFDSKLWYQISKVIGTEARGVYNAGQAQGMTFW  162

Query  2109  APNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEE  1930
             APN+N+F DPRWGRGQET GEDP+V S Y V YVR                L G+     
Sbjct  163   APNINIFRDPRWGRGQETAGEDPLVNSKYGVSYVR---------------GLQGDSFEGG  207

Query  1929  EEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASC  1750
             +   DRL  SACCKH TAYDL+ W    R+ F+A VT QD+ DTY+PPF SC+ +GR+S 
Sbjct  208   KLIGDRLKASACCKHFTAYDLDNWKGLDRFDFDAKVTLQDLADTYQPPFHSCIVQGRSSG  267

Query  1749  LMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGI  1573
             +MCAYN VNG+P CA+ +LL K AR  W F GYITSDC+AV  I++ Q YAK+PE+A   
Sbjct  268   IMCAYNRVNGVPNCADYNLLTKTARQKWNFNGYITSDCEAVRIIYDNQGYAKTPEDAVAD  327

Query  1572  ALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFES  1393
              L+AG D+ CG Y+ ++ K+A+  K V  S IDRAL NLF+++ RLGLF+G     ++  
Sbjct  328   VLQAGMDVECGDYLTKHAKAAVLQKKVPISQIDRALHNLFTIRIRLGLFDGNPTKLQYGR  387

Query  1392  FGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTSS--LGGD  1219
              GP  VCS E+  LALEAAR GIVLLKN    LPL   RV++L VIGP AN SS  + G+
Sbjct  388   IGPNQVCSKENLDLALEAARSGIVLLKNTASILPL--PRVNTLGVIGPNANKSSKVVLGN  445

Query  1218  YTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDL  1039
             Y G PC L  +L G   Y  +T Y SGCLD    ++     AV +AK +DYVI+V+GLD 
Sbjct  446   YFGRPCRLVPILKGFYTYASQTHYRSGCLDGTKCASAEIDRAVEVAKISDYVILVMGLDQ  505

Query  1038  SQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWI  859
             SQE E  DR  L LPG Q  L+N +A  S KP++LVL  GGP+DI+FAK + +I  ++W 
Sbjct  506   SQERESRDRDDLELPGKQQELINSVAKASKKPVILVLLCGGPVDITFAKNNDKIGGIIWA  565

Query  858   GYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFY  679
             GYPGE GG+AL+++VFGDYNP GRLP+TWYP+ F K+PM DM MRADPS GYPGRTYRFY
Sbjct  566   GYPGELGGRALAQVVFGDYNPGGRLPMTWYPKDFIKIPMTDMRMRADPSSGYPGRTYRFY  625

Query  678   TGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEV--S  505
             TG KVYEFG+GLSYS++S   +S       +  I      SIL       Y  V E+   
Sbjct  626   TGPKVYEFGYGLSYSNYSYNFISVKNN---NLHINQSTTHSILENSETIYYKLVSELGEE  682

Query  504   NCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTET  325
              C +++ SV + + N G M G   V+LF + P     G P KQL+GF+ V V G G  E 
Sbjct  683   TCKTMSISVTLGITNTGSMAGKHPVLLFVK-PKKGRNGNPVKQLVGFESVTVEGGGKGEV  741

Query  324   SISIEPCQHLSIVNVEGSRILPLGDHI  244
                +  C+HLS  N  G +++  G H+
Sbjct  742   GFEVSVCEHLSRANESGVKVIEEGGHL  768



>gb|EMS60786.1| putative beta-D-xylosidase 6 [Triticum urartu]
Length=652

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/608 (56%), Positives = 436/608 (72%), Gaps = 22/608 (4%)
 Frame = -3

Query  2061  ETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEEEDDDRLMLSACCKHL  1882
             ETPGEDP +++ Y+VEYV                   G +    +  + R+MLSACCKH 
Sbjct  49    ETPGEDPAMIAAYSVEYV------------------KGFQGEYGDGREGRMMLSACCKHY  90

Query  1881  TAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCLMCAYNAVNGIPACAN  1702
              AYDLE W  F+RY+FNA V  QD EDTYEPPFKSC+++GRASCLMC+YN VNG+PACA 
Sbjct  91    IAYDLEKWGKFARYTFNAEVNAQDFEDTYEPPFKSCIQEGRASCLMCSYNQVNGVPACAR  150

Query  1701  KDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIALKAGTDINCGTYMLRN  1522
             KDLL+K R +WGF+GYI SDCDAVA I E Q Y  S E++  I LKAG D+NCG++++R+
Sbjct  151   KDLLQKIRDEWGFKGYIVSDCDAVAIIHENQTYTSSGEDSVAIVLKAGMDVNCGSFLIRH  210

Query  1521  MKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESFGPKDVCSSEHRRLALE  1342
              KSA+E   + E DI+ AL NLFSVQ RLGLF   + N+ F   GP +VC+ EHR LA E
Sbjct  211   TKSAIEKGKIQEEDINHALYNLFSVQLRLGLFEKTSENQWFTRLGPSNVCTKEHRELAAE  270

Query  1341  AARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTSS-LGGDYTGIPCALKSVLDGLGEY  1165
             A +QG VLLKN+  FLPL ++ VS +A+IG  AN +  +GGDYTG+PC   + L G+  +
Sbjct  271   AVKQGTVLLKNDNSFLPLKRSEVSHIAIIGAAANDAYIMGGDYTGVPCDPITFLKGMQAF  330

Query  1164  IHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQETEDHDRYSLLLPGHQ  985
             + +T+ A GC +V+C+STDGF EA+ +AKRAD V+V+ GL+L+QETED DR +LLLPG Q
Sbjct  331   VPQTTVAGGCKNVSCDSTDGFGEAIEVAKRADIVVVIAGLNLTQETEDLDRVTLLLPGKQ  390

Query  984   MALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGYPGEEGGKALSEIVFGD  805
               LVN +AGV+ KP+VLV+TGGGP+D+SFAK+DPRIASVLWIGYPGE GG+ L EI+FG+
Sbjct  391   QDLVNIIAGVTKKPIVLVITGGGPVDVSFAKQDPRIASVLWIGYPGEVGGQVLPEILFGE  450

Query  804   YNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFYTGEKVYEFGHGlsyssfs  625
             YNP G+L +TWYPESFT VPM DMNMRADPSRGYPGRTYRFYTG+ VY FGHGLSY+ +S
Sbjct  451   YNPGGKLTMTWYPESFTAVPMTDMNMRADPSRGYPGRTYRFYTGDVVYGFGHGLSYTKYS  510

Query  624   lellSAPTRISLSQSIKTKL--RRSILNRGGNEPYVHVDEVSNCNSLAFSVRVSLRNNGG  451
                L  P RISLSQS    L  R+    R     YV V+++++C SL FSV +S+ N G 
Sbjct  511   YNFLQGPNRISLSQSPVPGLISRKPAYTRRDGLDYVQVEDIASCESLVFSVHISVTNEGA  570

Query  450   MDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSISIEPCQHLSIVNVEGS  271
             MDGS  V+LF+R+      G P KQL+GF+RV+ +    T   I ++PC+H+S  N EG 
Sbjct  571   MDGSHAVLLFTRSKLRVP-GFPLKQLVGFERVYTAAGRSTNVEIKVDPCKHMSAANTEGR  629

Query  270   RILPLGDH  247
             R+L LG H
Sbjct  630   RVLLLGSH  637



>ref|XP_008344154.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Malus domestica]
Length=773

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/743 (49%), Positives = 485/743 (65%), Gaps = 33/743 (4%)
 Frame = -3

Query  2463  THSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGIA  2284
             T SS+ FCDTSL + AR+  LV  LT+ EKI  L ++  ++ RLGIP YEWWSE+LHG++
Sbjct  47    TLSSFAFCDTSLGVDARVADLVKRLTLPEKIGFLVNSAGSVSRLGIPKYEWWSEALHGVS  106

Query  2283  TNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWAP  2104
               GPG  F   V  AT FPQVILTAA+FN +L+ +I    + EARAM+N G AGLTFW+P
Sbjct  107   YVGPGTXFSSLVPGATSFPQVILTAASFNTSLFEAIGRVVSTEARAMYNVGLAGLTFWSP  166

Query  2103  NVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEEE  1924
             N+N+F DPRWGRGQETPGEDP++ S Y   YVR                        ++ 
Sbjct  167   NINIFRDPRWGRGQETPGEDPLLSSKYGSGYVR-------------------GLQQTDDG  207

Query  1923  DDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCLM  1744
             D ++L ++ACCKH TAYD++ W    RY FNAVVT+QD++DT++PPFKSCV  G  + +M
Sbjct  208   DKNKLKVAACCKHYTAYDVDNWKGVDRYHFNAVVTKQDLDDTFQPPFKSCVIDGNVASVM  267

Query  1743  CAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIAL  1567
             C+YN VNGIP CA+ DLL    R +W   GYI +DCD++   ++ Q Y K+PEEAA  A+
Sbjct  268   CSYNQVNGIPTCADPDLLAGVIRGEWKLNGYIVTDCDSIDVYYKQQHYTKTPEEAAAKAI  327

Query  1566  KAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESFG  1387
              AG D+NCG+++ +    A++  +V E+DIDRA+ N F+   RLG F+G   ++ +   G
Sbjct  328   LAGLDLNCGSFLGQYTPGAVQAGLVTEADIDRAISNNFATLMRLGFFDGDPSDKPYGKLG  387

Query  1386  PKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTS-SLGGDYTG  1210
             PKDVC+SE++ LA E ARQGIVLLKN    LPL  T + SLAVIGP AN   ++ G+Y G
Sbjct  388   PKDVCTSENQELARETARQGIVLLKNSPGSLPLSPTAIKSLAVIGPNANVQKTMIGNYEG  447

Query  1209  IPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQE  1030
              PC   ++L GL   +  TSY +GC +VAC +     +A  IA  AD  I+VVG D S E
Sbjct  448   TPCKYTTILQGLSASV-ATSYVAGCANVACGTAQ-VDDATKIAASADATILVVGADQSIE  505

Query  1029  TEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGYP  850
              E  DR  LLLPG Q  LV E+A  +  P++LV+  GG  DI+FAK D +I S+LW+GYP
Sbjct  506   RESLDRIDLLLPGQQTLLVTEVAKAAKGPVILVIMSGGGFDITFAKNDTKITSILWVGYP  565

Query  849   GEEGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRADPSRGYPGRTYRFYTG  673
             GE GG A++++VFG YNP+GRLP+TWYP+S+  KVPM +MNMR DPS GYPGRTYRF TG
Sbjct  566   GEAGGAAVADVVFGQYNPSGRLPMTWYPQSYVDKVPMTNMNMRPDPSNGYPGRTYRFXTG  625

Query  672   EKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEVSNCNS  493
             E VY FG GL YS+F+ +L+ AP  +S+       L    +    +   + V E   C +
Sbjct  626   ETVYSFGDGLGYSTFNHKLVRAPKLVSI------PLEEGHVCHSSSCKSLDVVE-ERCEN  678

Query  492   LAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSISI  313
             LAF + + ++N G M GS  VMLFS  P  +   +PQK L+GF++V VS   V     ++
Sbjct  679   LAFDIHLGVKNMGSMSGSHTVMLFSSPPAVHK--SPQKHLLGFEKVFVSAQRVALVKFNV  736

Query  312   EPCQHLSIVNVEGSRILPLGDHI  244
             + C+HLS+V+  G+R + LG+H+
Sbjct  737   DVCKHLSVVDELGNRKVALGEHV  759



>ref|XP_009391116.1| PREDICTED: probable beta-D-xylosidase 7 [Musa acuminata subsp. 
malaccensis]
Length=779

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/760 (49%), Positives = 492/760 (65%), Gaps = 36/760 (5%)
 Frame = -3

Query  2493  SKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             + P   C P  P+  +Y FC T+LPI  R   L+S LT++EKIQ+L     AIPRLG+P 
Sbjct  30    ATPPFACDPANPSTRNYGFCQTTLPIDKRAADLISRLTLEEKIQQLGHIAPAIPRLGLPN  89

Query  2319  YEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMF  2140
             Y+WWSE+LHG++  G GI F+G + SAT FPQVI++AA+FN  LW  I  A  VEARA++
Sbjct  90    YKWWSEALHGVSNWGRGIRFNGTITSATSFPQVIVSAASFNPDLWYRIGQAIGVEARAIY  149

Query  2139  NSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             N GQA GLTFW+PNVN+F DPRWGRGQETPGEDP+  S YAV +VR              
Sbjct  150   NVGQAEGLTFWSPNVNIFRDPRWGRGQETPGEDPVTASKYAVAFVR--------------  195

Query  1962  YSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
               L G+  P  E   ++LM SACCKH TAYDL+ W   SRY++NAVVT QDMEDTY+PPF
Sbjct  196   -GLQGDS-PTGERKSEQLMTSACCKHYTAYDLDNWKTHSRYTYNAVVTAQDMEDTYQPPF  253

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLE-KARTDWGFEGYITSDCDAVATIFEYQQ  1606
             KSCV++GR +C+MC+YN VNG+P CA+ +LL  +AR  WG +GYI SDC AV  I     
Sbjct  254   KSCVQEGRVTCVMCSYNRVNGVPTCADFNLLTLQARNSWGLDGYIASDCGAVDLISGAIH  313

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             YAKSPEEA    LK+G D++C  ++ ++  SA++  I+ + DIDRAL N+ S++ RLG F
Sbjct  314   YAKSPEEAVADVLKSGMDLDCSDFVQKHAGSAVQQGILSQGDIDRALFNILSLRIRLGHF  373

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPM  1246
             NG  +     +  P  VCS EH  LALEAA+ GIVLLKN    LPL +++V+SL VIGP 
Sbjct  374   NGNPLQLPAGNIPPSQVCSKEHHDLALEAAKAGIVLLKNAANLLPLARSKVTSLGVIGPS  433

Query  1245  ANTSSLG-GDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             AN   L  G+Y G PC   + L  L  Y++ T    GC  VAC++     E + +A+  D
Sbjct  434   ANNGYLLIGNYNGPPCTGSTPLGELRNYVNDTRSVQGCNKVACDAAT-INEVILLARSVD  492

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
              V++ +GLD   E E  DR  L+LPG Q +++ + A  + +P++LVL  GGP+DI+FAK 
Sbjct  493   QVVLFMGLDQDHEREGLDRIDLVLPGLQRSVITKAAKYAKRPVILVLLTGGPVDITFAKD  552

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSR  709
             DPRI ++LW GYPGE G  A+++++FG++NP G+LP+TWYP+ FT VPM DM MRADP+ 
Sbjct  553   DPRIGAILWAGYPGEAGALAIAQVLFGEHNPGGKLPVTWYPQEFTSVPMTDMRMRADPAT  612

Query  708   GYPGRTYRFYTGEKVYEFGHGlsyssfsl--ellSAPTRISLSQSIKTKLRRSILNRGGN  535
             GYPGR+YRFYTG+ VYEFG+G+S++S+S   E   A T I L+ S+  +          N
Sbjct  613   GYPGRSYRFYTGKPVYEFGYGISFTSYSYEFEAEEAVTSIYLNSSLTPRTT-------AN  665

Query  534   EPYVHVDEVS----NCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIG  367
                +  D  S     C +L FS  V ++N G M G   V+LFSR  +S   G P KQL+G
Sbjct  666   SHILSYDIASLGSDTCGNLKFSATVGVKNQGSMAGKHPVLLFSRWSSS-EHGRPIKQLVG  724

Query  366   FDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             F  VH+     T+    + PC+HLS    +G+R+L  G H
Sbjct  725   FQSVHLEAGESTKVVFPLSPCEHLSRATDDGTRVLDKGSH  764



>ref|XP_004953945.1| PREDICTED: probable beta-D-xylosidase 7-like [Setaria italica]
Length=788

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/756 (50%), Positives = 497/756 (66%), Gaps = 23/756 (3%)
 Frame = -3

Query  2493  SKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             S+P   C      + PFCD SLPI  R+  LV+ +TV+EKI +L D + A+PRLG+PAY+
Sbjct  36    SEPPYTCGAGAPPNIPFCDRSLPIERRVADLVARMTVEEKISQLGDESPAVPRLGVPAYK  95

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSE+LHG++ +G G+   G +++AT FPQVILTAA+FN  LW  I     VEARA++N+
Sbjct  96    WWSEALHGVSDHGRGVHLSGPLRAATSFPQVILTAASFNPHLWYRIGQVIGVEARAVYNN  155

Query  2133  GQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYS  1957
             GQA GLTFWAPN+NVF DPRWGRGQETPGEDP +   YA  +VRG+Q           Y+
Sbjct  156   GQAEGLTFWAPNINVFRDPRWGRGQETPGEDPTMTGKYAAVFVRGVQ----------GYA  205

Query  1956  LSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKS  1777
             ++G   P    D   L  SACCKH TAYDLE W   +RY F+A VT QD+EDTY PPFKS
Sbjct  206   IAG---PVNSTD---LEASACCKHFTAYDLENWKGVTRYVFDAQVTVQDLEDTYNPPFKS  259

Query  1776  CVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYA  1600
             CVE G AS +MC+YN VNG+P CA+ +LL K AR +WGF GYITSDCDAV+ I + Q YA
Sbjct  260   CVEDGHASGIMCSYNRVNGVPTCADYNLLSKTARQNWGFYGYITSDCDAVSIIHDAQGYA  319

Query  1599  KSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNG  1420
             K+ E+A    LKAG D+NCG+Y+ ++  SAL+   + E DIDRAL NLF+V+ RLGLFNG
Sbjct  320   KTAEDAVADVLKAGMDVNCGSYVQQHGASALQQGKITEQDIDRALHNLFAVRMRLGLFNG  379

Query  1419  KAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN  1240
                  ++   GP  VC+ EH+ LALEAA+ GIVLLKN+   LPL K++V+SL VIG  AN
Sbjct  380   DPRRNRYGDIGPDQVCTQEHQNLALEAAQDGIVLLKNDAGALPLSKSKVTSLGVIGFNAN  439

Query  1239  TSS-LGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYV  1063
              +  L G+Y G PC   + L  L  Y+  T +A+GC   ACN T    EAV +A   D V
Sbjct  440   NAERLLGNYFGPPCVTVTPLQVLQGYVKDTRFAAGCNAAACNVT-AIPEAVQVASSVDSV  498

Query  1062  IVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDP  883
             ++ +GLD  QE E+ DR  L LPG Q +L+  +A  +NKP++LVL  GGP+D+SFAK +P
Sbjct  499   VLFMGLDQDQEREEIDRLDLTLPGQQQSLIESVANAANKPVILVLLCGGPVDVSFAKTNP  558

Query  882   RIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGY  703
             +I ++LW GYPGE GG A+++++FG++NP GRLP+TWYP+ FTKVPM DM MRADP+ GY
Sbjct  559   KIGAILWAGYPGEAGGMAIAQVLFGEHNPGGRLPVTWYPQDFTKVPMTDMRMRADPATGY  618

Query  702   PGRTYRFYTGEKVYEFGHGlsyssfslellSAPTR-ISLSQSIKTKLRRSILNRGGNEPY  526
             PGRTYRFY G  V++FG+GLSYS +S   +++ T+  S+S     K   +    G     
Sbjct  619   PGRTYRFYRGPTVFDFGYGLSYSKYSHRFVASGTKPPSMSDIAGLKALETTSAAGAAMYD  678

Query  525   VHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAP--TSYAGGAPQKQLIGFDRVH  352
             V       C  L F   V ++N+G MDG   V++F R P  T    G P +QLIGF  +H
Sbjct  679   VEAMGSEACERLKFPAVVRVQNHGPMDGKHPVLVFLRWPNATDDGSGRPARQLIGFRTLH  738

Query  351   VSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             +           + PC+H S  + +G +++  G HI
Sbjct  739   LRAMQTAHVEFEVSPCKHFSRASEDGRKVIDQGSHI  774



>dbj|BAK00077.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=781

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/759 (48%), Positives = 491/759 (65%), Gaps = 34/759 (4%)
 Frame = -3

Query  2493  SKPQLPCQPPTHSS---YPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIP  2323
             + P   C P + ++   Y FCD +LP+  R   LV+ LT  EK+ +L D  + +PRLG+P
Sbjct  34    ADPPFSCGPSSTAATQGYAFCDATLPVAQRAADLVARLTTAEKVAQLGDEAAGVPRLGVP  93

Query  2322  AYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAM  2143
             AY+WW+E+LHG+AT+G G+ F+GAV+SAT FPQV LTAAAF+  LW  I  A   EARA+
Sbjct  94    AYKWWNEALHGLATSGKGLHFNGAVRSATSFPQVSLTAAAFDDDLWLRIGQAIGREARAL  153

Query  2142  FNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngR  1966
             +N GQA GLT W+PNVN++ DPRWGRGQETPGEDP   S Y V +V+             
Sbjct  154   YNVGQAEGLTMWSPNVNIYRDPRWGRGQETPGEDPTTASRYGVAFVK-------------  200

Query  1965  KYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPP  1786
                L GN              SACCKH TAYDLE W   +RY+F+A VT QD+EDTY PP
Sbjct  201   --GLQGNSTSSSLL-----QTSACCKHATAYDLEDWGGVARYNFDARVTAQDLEDTYNPP  253

Query  1785  FKSCVEKGRASCLMCAYNAVNGIPACANKDLL-EKARTDWGFEGYITSDCDAVATIFEYQ  1609
             F+SCV  G+ASC+MCAY A+NG+PACAN  LL    R DWG +GY+ SDCDAVA + + Q
Sbjct  254   FRSCVVDGKASCVMCAYTAINGVPACANSGLLTNTVRADWGLDGYVASDCDAVAIMRDAQ  313

Query  1608  QYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGL  1429
             +YA +PE+A  +ALKAG DI+CGTYM ++  +AL+   + E D+D+AL NLF+++ RLG 
Sbjct  314   RYAPTPEDAVALALKAGLDIDCGTYMQQHAPAALQQGKITEDDVDKALKNLFAIRMRLGH  373

Query  1428  FNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGP  1249
             F+G      +       +C+ EHR LALEAA+ GIVLLKN+   LPLD+  ++S AVIGP
Sbjct  374   FDGDPRANIYGGLNAAHICTPEHRSLALEAAQDGIVLLKNDAGILPLDRAAIASAAVIGP  433

Query  1248  MANTSSLG-GDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRA  1072
              AN   L  G+Y G PC   + L G+  Y+    + +GC   AC+  D   +A ++A  +
Sbjct  434   NANNPGLLIGNYFGPPCESVTPLKGVQGYVKDVRFMAGCGSAACDVAD-TDQAATLAGSS  492

Query  1071  DYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAK  892
             DYV++ +GL   QE+E  DR SLLLPG Q +L+  +A  + +P++LVL  GGP+D++FAK
Sbjct  493   DYVLLFMGLSQQQESEGRDRTSLLLPGQQQSLITAVADAAKRPVILVLLTGGPVDVTFAK  552

Query  891   KDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPS  712
              +P+I ++LW GYPG+ GG A++ ++FGD+NP GRLP+TWYPE FTKVPM DM MRADP+
Sbjct  553   NNPKIGAILWAGYPGQAGGLAIARVLFGDHNPGGRLPVTWYPEEFTKVPMTDMRMRADPA  612

Query  711   RGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPT-RISLSQSIKTKLRRSILNRGGN  535
              GYPGR+YRFY GE VY+FG+GLSYSS+S  LLS+ T    L   + T    +    GG 
Sbjct  613   TGYPGRSYRFYQGETVYKFGYGLSYSSYSRRLLSSGTPNTDLLAGLSTM--PTPAEEGGV  670

Query  534   EPYVHVDEVS--NCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFD  361
               Y HV+ +    C  L F   V + N+G MDG   V+++ R   + A G P KQLIGF 
Sbjct  671   ASY-HVEHIGARGCEQLKFPAVVEVENHGPMDGKHSVLMYLRWANATA-GRPAKQLIGFR  728

Query  360   RVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             R H+        +  I PC+H S V  +G++++  G H 
Sbjct  729   RQHLKAGEKASLTFDISPCEHFSRVRKDGNKVVDRGSHF  767



>emb|CBI19138.3| unnamed protein product [Vitis vinifera]
Length=1411

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/756 (51%), Positives = 489/756 (65%), Gaps = 58/756 (8%)
 Frame = -3

Query  2493  SKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             S P   C    P   SY FC+T+L I  R   L+S LT+DEKI +L  + ++IPRLGIPA
Sbjct  694   SSPPFACDSSDPLTKSYAFCNTTLRISQRASDLISRLTLDEKISQLISSAASIPRLGIPA  753

Query  2319  YEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMF  2140
             YEWWSE+LHGI  +  GI F+G ++SAT FPQVILTAA+F+  LW  I  A  +E RAM+
Sbjct  754   YEWWSEALHGI-RDRHGIRFNGTIRSATSFPQVILTAASFDAHLWYRIGQAIGIETRAMY  812

Query  2139  NSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             N+GQA G+TFWAPN+N+F DPRWGRGQETPGEDP+V   YAV YVR              
Sbjct  813   NAGQAMGMTFWAPNINIFRDPRWGRGQETPGEDPVVAGKYAVSYVR--------------  858

Query  1962  YSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
               L G+    E    D L  SACCKH TAYDL+ W +  RY+F+A VT QD+ DTY+PPF
Sbjct  859   -GLQGDTF--EGGKVDVLQASACCKHFTAYDLDNWTSIDRYTFDARVTMQDLADTYQPPF  915

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQ  1606
             +SC+E+GRAS LMCAYN VNG+P CA+ +LL K AR  WGF+GYI SDCDAV+ + + Q 
Sbjct  916   RSCIEEGRASGLMCAYNLVNGVPNCADFNLLSKTARGQWGFDGYIVSDCDAVSLVHDVQG  975

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             YAKSPE+A  I L AG D+ CG Y+ ++ KSA+  K + ES+IDRALLNLF+V+ RLGLF
Sbjct  976   YAKSPEDAVAIVLTAGMDVACGGYLQKHAKSAVSQKKLTESEIDRALLNLFTVRMRLGLF  1035

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPM  1246
             NG      F + GP  VCS+EH+ LALEAAR GIVLLKN  + LPL K    SLAVIGP 
Sbjct  1036  NGNPRKLPFGNIGPDQVCSTEHQTLALEAARSGIVLLKNSDRLLPLSKGETLSLAVIGPN  1095

Query  1245  AN-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             AN T +L G+Y G PC   S L GL  Y++ T Y +GC DVAC+S      AV +AK+AD
Sbjct  1096  ANATDTLLGNYAGPPCKFISPLQGLQSYVNNTMYHAGCNDVACSSAS-IENAVDVAKQAD  1154

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
             YV++V+GLD +QE E +DR  L+LPG Q  L+  +A  + KP+VLVL  GGP+DISFAK 
Sbjct  1155  YVVLVMGLDQTQEREKYDRLDLVLPGKQEQLITGVAKAAKKPVVLVLLCGGPVDISFAKG  1214

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSR  709
                I S+LW GYPGE GG A++E +FGD+NP GRLP+TWYP+ F K+PM DM MR +P  
Sbjct  1215  SSNIGSILWAGYPGEAGGAAIAETIFGDHNPGGRLPVTWYPKDFIKIPMTDMRMRPEPQS  1274

Query  708   GYPGRTYRFYTGEKVYEFGHGlsys-sfslellSAPTRISLSQSIKTKLRRSILNRGGNE  532
             GYPGRT+RFYTG+ V+EFG+GLSYS      L   P ++ L+Q   T             
Sbjct  1275  GYPGRTHRFYTGKTVFEFGNGLSYSPYSYEFLSVTPNKLYLNQPSTT-------------  1321

Query  531   PYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVH  352
                HV E                N+G M G   V+LF +   +   G+P KQL+GF  V 
Sbjct  1322  ---HVVE----------------NSGKMAGKHPVLLFVKQAKA-GNGSPMKQLVGFQNVF  1361

Query  351   VSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             +     +     + PC+HLS  N +G  ++  G H+
Sbjct  1362  LDAGESSNVEFILSPCEHLSRANKDGLMVMEQGIHL  1397


 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/714 (53%), Positives = 476/714 (67%), Gaps = 49/714 (7%)
 Frame = -3

Query  2499  SYSKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGI  2326
             S   P   C    P+  SY FC T+LPIP R+  LVS LT+DEKI +L ++  AIPRLGI
Sbjct  23    STQSPPFSCDSSNPSTKSYHFCKTTLPIPDRVRDLVSRLTLDEKISQLVNSAPAIPRLGI  82

Query  2325  PAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearA  2146
             PAYEWWSE+LHG+A  GPGI F+G ++SAT FPQVILTAA+F+  LW  I  A  VEARA
Sbjct  83    PAYEWWSEALHGVADAGPGIRFNGTIRSATSFPQVILTAASFDVHLWYRIGRAIGVEARA  142

Query  2145  MFNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkng  1969
             ++N+GQ  G+TFWAPN+N+F DPRWGRGQETPGEDP+V   YAV YVRG+QG        
Sbjct  143   VYNAGQTKGMTFWAPNINIFRDPRWGRGQETPGEDPLVTGSYAVSYVRGVQGD-------  195

Query  1968  RKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEP  1789
                 L G +   E      L  SACCKH TAYDL+ W    R+ F+A VT QD+ DTY+P
Sbjct  196   ---CLRGLKRCGE------LQASACCKHFTAYDLDDWKGIDRFKFDARVTMQDLADTYQP  246

Query  1788  PFKSCVEKGRASCLMCAYNAVNGIPACANKDLL-EKARTDWGFEGYITSDCDAVATIFEY  1612
             PF  C+E+GRAS +MCAYN VNG+P+CA+ +LL   AR  W F+GYITSDCDAV+ I + 
Sbjct  247   PFHRCIEEGRASGIMCAYNRVNGVPSCADFNLLTNTARKRWNFQGYITSDCDAVSLIHDS  306

Query  1611  QQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLG  1432
               +AK+PE+A    LKAG D+NCGTY+L + KSA+  K + ES++DRAL NLF+V+ RLG
Sbjct  307   YGFAKTPEDAVVDVLKAGMDVNCGTYLLNHTKSAVMQKKLPESELDRALENLFAVRMRLG  366

Query  1431  LFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIG  1252
             LFNG    + +   GP  VCS EH+ LAL+AAR GIVLLKN Q+ LPL K +  SLAVIG
Sbjct  367   LFNGNPKGQPYGDIGPNQVCSVEHQTLALDAARDGIVLLKNSQRLLPLPKGKTMSLAVIG  426

Query  1251  PMANT-SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKR  1075
             P AN+  +L G+Y G PC   + L  L  Y+  T Y  GC  VAC S+    +AV IA++
Sbjct  427   PNANSPKTLIGNYAGPPCKFITPLQALQSYVKSTMYHPGCDAVAC-SSPSIEKAVEIAQK  485

Query  1074  ADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFA  895
             ADYV++V+GLD +QE E HDR  L+LPG Q  L+  +A  + KP+VLVL  GGP+DISFA
Sbjct  486   ADYVVLVMGLDQTQEREAHDRLDLVLPGKQQQLIICVANAAKKPVVLVLLSGGPVDISFA  545

Query  894   KKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADP  715
             K    I S+LW GYPG  GG A++E +FGD+NP GRLP+TWYP+ FTK+PM DM MR + 
Sbjct  546   KYSNNIGSILWAGYPGGAGGAAIAETIFGDHNPGGRLPVTWYPQDFTKIPMTDMRMRPES  605

Query  714   SRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGN  535
             + GYPGRTYRFYTGEKV+EFG+GLSYS++S             ++I     +   N+   
Sbjct  606   NSGYPGRTYRFYTGEKVFEFGYGLSYSTYS------------CETIPVTRNKLYFNQSST  653

Query  534   EPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQL  373
                 HV E  N +S+ ++          M G   V+LF R   + A G+P KQL
Sbjct  654   ---AHVYE--NTDSIRYT---------SMAGKHSVLLFVRRLKASA-GSPIKQL  692



>ref|XP_010693351.1| PREDICTED: probable beta-D-xylosidase 7 [Beta vulgaris subsp. 
vulgaris]
Length=797

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/763 (50%), Positives = 499/763 (65%), Gaps = 45/763 (6%)
 Frame = -3

Query  2493  SKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             S+P   C    P   SY FC+  LPI  R+  LVS L++DEKI +L+++  AI RLGIPA
Sbjct  33    SRPLFACDSSNPLTKSYLFCNNKLPINQRVKDLVSRLSIDEKISQLTNSAPAIQRLGIPA  92

Query  2319  YEWWSESLHGIATNGPGITFDGA-------------VKSATGFPQVILTAAAFNRTLWRS  2179
             YEWWSESLHG++ +G G  F+G              +K+AT FPQ+ILTA++F+  LW  
Sbjct  93    YEWWSESLHGVSRHGRGYRFNGTFDENGTILNGTATIKAATMFPQIILTASSFDSQLWYR  152

Query  2178  IaaaaavearAMFNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrg  2002
             IA A A EARAM+N GQ  GLTFWAPN+N+F DPRWGRGQETPGEDP++ S Y V YVRG
Sbjct  153   IAQAIATEARAMYNVGQGKGLTFWAPNINIFRDPRWGRGQETPGEDPLLTSRYGVSYVRG  212

Query  2001  lqgqglkgkngRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVV  1822
             +QG          Y++ G +  +       L  SACCKH TA+DL+ WH  +RY+F+A V
Sbjct  213   IQG----------YTIQGKKTSQH------LQASACCKHFTAHDLDNWHGITRYTFDAKV  256

Query  1821  TRQDMEDTYEPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLL-EKARTDWGFEGYITS  1645
             ++QD+ DT++PPF+SCVE+G+AS +MCAYN VNGIP+CA+ D L + AR  W F+GYI S
Sbjct  257   SKQDLADTFQPPFQSCVEQGQASSIMCAYNRVNGIPSCAHYDFLTDTARGQWHFDGYIVS  316

Query  1644  DCDAVATIFEYQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRAL  1465
             DC+AV  I+E Q YAK+PE+A    L AG D+ CG+Y  R  +SALE K + E D+DRAL
Sbjct  317   DCNAVPIIYEQQGYAKTPEDAVAAVLSAGMDVECGSYTTRYSRSALEQKKITEEDLDRAL  376

Query  1464  LNLFSVQFRLGLFNGKAVNRKFESF---GPKDVCSSEHRRLALEAARQGIVLLKNEQKFL  1294
              NLFSV+ RLGLFNG    RK  SF   GP+ VCS EH+ LALEAA+  IVLLKN    L
Sbjct  377   YNLFSVRMRLGLFNGDP--RKIGSFRKIGPEQVCSEEHQNLALEAAKNSIVLLKNVNNLL  434

Query  1293  PLDKTRVSSLAVIGPMANTSS-LGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACN  1117
             PL K + SS AVIGP A++   L G+Y G PC   ++ + L  Y+    Y  GC  V C+
Sbjct  435   PLSKAKSSSFAVIGPNADSPQVLLGNYEGFPCKTTTIHEALQLYVEGIKYHPGCNAVECS  494

Query  1116  STDGFAEAVSIAKRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplv  937
             S +   + V IAK  DYV++V+GLD +QE E  DR  L+LPG Q +L+  +A  + KP+V
Sbjct  495   SAE-VEQVVEIAKAVDYVVLVMGLDQTQEREKLDRVDLVLPGKQQSLIKSVAEAAKKPVV  553

Query  936   lvltgggpLDISFAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESF  757
             LVL  GGP+DIS A+ D  + S+LW GYPGE GG AL+E++FGD+NP GRLP+TWYP+ F
Sbjct  554   LVLLCGGPVDISLARDDDEVGSILWAGYPGEAGGLALAEVIFGDHNPGGRLPVTWYPKDF  613

Query  756   TKVPMNDMNMRADPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSI  577
              +VPM DM MR D S GYPGRTYRFY G+KV+EFG+GLSYS++S E  S  TR +LS ++
Sbjct  614   AQVPMTDMRMRPDKSSGYPGRTYRFYEGKKVFEFGYGLSYSTYSYEFASV-TRNTLSLNL  672

Query  576   KTKLRRSILNRGGNEPYVHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTS  403
              +     +      +P + +  +S   C +      V ++NNG   G   V+LF +    
Sbjct  673   ASYANPFLKGSNITQPLL-ISHMSKQFCETGKLIAVVRVKNNGKTPGRHPVLLFVKTGVQ  731

Query  402   YAGGAPQKQLIGFDRVHVSGNGVTETSISIEPCQHLSIVNVEG  274
                G+P KQLIGF+ V+++     E    + PC+HLS  N +G
Sbjct  732   -IDGSPIKQLIGFESVNLNEGEFKEIEFPVSPCEHLSKANKDG  773



>ref|XP_002889174.1| glycosyl hydrolase family 3 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65433.1| glycosyl hydrolase family 3 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=766

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/760 (51%), Positives = 489/760 (64%), Gaps = 40/760 (5%)
 Frame = -3

Query  2487  PQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             P   C P  PT   Y FC T LPI  R   LVS L +DEKI +L +    IPRLG+PAYE
Sbjct  21    PPHSCDPSNPTTKLYQFCRTDLPISQRARDLVSRLNIDEKISQLGNTAPGIPRLGVPAYE  80

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSE+LHG+A  GPGI F+G VK+AT FPQVILTAA+F+   W  IA     EAR ++N+
Sbjct  81    WWSEALHGVAYAGPGIRFNGTVKAATSFPQVILTAASFDSYEWFRIAQVIGKEARGVYNA  140

Query  2133  GQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYS  1957
             GQA G+TFWAPN+N+F DPRWGRGQETPGEDP++   YAV YVR                
Sbjct  141   GQAQGMTFWAPNINIFRDPRWGRGQETPGEDPIMTGTYAVAYVR---------------G  185

Query  1956  LSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKS  1777
             L G+     +     L  SACCKH TAYDL+ W   +RY FNA V+  D+ +TY+PPFK 
Sbjct  186   LQGDSFDGRKTLSIHLQASACCKHFTAYDLDRWKGITRYVFNAQVSLADLAETYQPPFKK  245

Query  1776  CVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYA  1600
             C+E+GRAS +MCAYN VNGIP+CA+ +LL + AR  W F GYITSDCDAV+ I + Q YA
Sbjct  246   CIEEGRASGIMCAYNRVNGIPSCADPNLLTRTARGLWRFRGYITSDCDAVSIIHDAQGYA  305

Query  1599  KSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNG  1420
             K+PE+A    LKAG D+NCG+Y+ ++ KSAL+ K V E+DIDRALLNLFSV+ RLGLFNG
Sbjct  306   KTPEDAVADVLKAGMDVNCGSYLQKHTKSALQQKKVSETDIDRALLNLFSVRIRLGLFNG  365

Query  1419  KAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN  1240
                   + +  P DVCS  H+ LALEAAR GIVLLKN  K LP  K  VSSLAVIGP A+
Sbjct  366   DPTKLPYGNISPNDVCSPAHQALALEAARNGIVLLKNNLKLLPFSKRSVSSLAVIGPNAH  425

Query  1239  TS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYV  1063
              + +L G+Y G PC   + LD L  Y+    Y +GC  VAC S     +AV+IA+ AD+V
Sbjct  426   VAKTLLGNYAGPPCKTVTPLDALRSYVKNAVYHNGCDSVAC-SNAAIDQAVAIARNADHV  484

Query  1062  IVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDP  883
             ++++GLD +QE ED DR  L LPG Q  L+  +A  + KP+VLVL  GGP+DISFA  + 
Sbjct  485   VLIMGLDQTQEKEDMDRVDLSLPGKQQELITSVANAAKKPVVLVLICGGPVDISFATNND  544

Query  882   RIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGY  703
             +I S++W GYPGE GG AL+EI+FGD+NP GRLP+TWYP+SF  V M DM MR+  + GY
Sbjct  545   KIGSIMWAGYPGEAGGIALAEIIFGDHNPGGRLPVTWYPQSFVNVQMTDMRMRS--ATGY  602

Query  702   PGRTYRFYTGEKVYEFGHGlsyssfsle-llSAPTRISLSQSIKTKL-----RRSILNRG  541
             PGRTY+FY G KV+EFGHGLSYS++S        T + L+QS K +L     R ++++  
Sbjct  603   PGRTYKFYKGPKVFEFGHGLSYSTYSYRFKTLGATNLYLNQS-KAQLNSDSVRYTLVSEM  661

Query  540   GNEPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGA-PQKQLIGF  364
             G E          CN     V V++ N G M G   V++F+R       G   +KQL+GF
Sbjct  662   GEE---------GCNIAKTKVIVTVENQGEMAGKHPVLMFARHERGGENGKRAEKQLVGF  712

Query  363   DRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
               + +S     E    I  C+HLS  N  G  ++  G + 
Sbjct  713   KSIVLSNGEKAEMEFEIGLCEHLSRANEVGVMVVEEGKYF  752



>ref|XP_003544783.1| PREDICTED: probable beta-D-xylosidase 7-like [Glycine max]
Length=776

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/760 (50%), Positives = 494/760 (65%), Gaps = 33/760 (4%)
 Frame = -3

Query  2493  SKPQLPCQPPTHSSY-PFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAY  2317
             ++P   C   ++S Y PFC+T LPI  R   LVS LT+DEK+ +L +   AIPRLGIP+Y
Sbjct  26    TQPPYSCDSSSNSPYYPFCNTRLPISKRAQDLVSRLTLDEKLAQLVNTAPAIPRLGIPSY  85

Query  2316  EWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFN  2137
             +WWSE+LHG+A  G GI F+G +KSAT FPQVILTAA+F+  LW  I+     EARA++N
Sbjct  86    QWWSEALHGVADAGFGIRFNGTIKSATSFPQVILTAASFDPNLWYQISKTIGKEARAVYN  145

Query  2136  SGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKY  1960
             +GQA G+TFWAPN+NVF DPRWGRGQET GEDP++ + Y V YVRGLQG           
Sbjct  146   AGQATGMTFWAPNINVFRDPRWGRGQETAGEDPLMNAKYGVAYVRGLQGD----------  195

Query  1959  SLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFK  1780
             S  G ++ E      RL  SACCKH TAYDL+ W    R+ ++A VT QD+ DTY+PPF+
Sbjct  196   SFEGGKLGE------RLQASACCKHFTAYDLDHWKGLDRFVYDARVTSQDLADTYQPPFQ  249

Query  1779  SCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQY  1603
             SC+E+GRAS +MCAYN VNG+P CAN +LL K AR  W F+GYITSDC AV+ I + Q Y
Sbjct  250   SCIEQGRASGIMCAYNRVNGVPNCANFNLLTKTARQQWKFDGYITSDCGAVSIIHDEQGY  309

Query  1602  AKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFN  1423
             AK+ E+A     +AG D+ CG Y+ ++ KSA+  K +  S IDRAL NLFS++ RLGL +
Sbjct  310   AKTAEDAIADVFRAGMDVECGDYITKHGKSAVSQKKLPISQIDRALQNLFSIRIRLGLLD  369

Query  1422  GKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMA  1243
             G      F + GP  VCS +  +LALEAAR GIVLLKN    LPL KT   ++A+IGP A
Sbjct  370   GNPTKLPFGTIGPDQVCSKQSLQLALEAARDGIVLLKNTNSLLPLPKTN-PTIALIGPNA  428

Query  1242  NTSS--LGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             N SS    G+Y G PC L ++L G   Y   T Y  GC D    +      AV +AK+ D
Sbjct  429   NASSKVFLGNYYGRPCNLVTLLQGFEGYAKDTVYHPGCDDGPQCAYAQIEGAVEVAKKVD  488

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
             YV++V+GLD SQE E HDR  L LPG Q  L+  +A  S +P+VLVL  GGP+DI+ AK 
Sbjct  489   YVVLVMGLDQSQERESHDREYLGLPGKQEELIKSVARASKRPVVLVLLCGGPVDITSAKF  548

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSR  709
             D ++  +LW GYPGE GG AL+++VFGD+NP G+LP+TWYP+ F KVPM DM MRADP+ 
Sbjct  549   DDKVGGILWAGYPGELGGVALAQVVFGDHNPGGKLPITWYPKDFIKVPMTDMRMRADPAS  608

Query  708   GYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQ-SIKTKLRRSILNRGGNE  532
             GYPGRTYRFYTG KVYEFG+GLSY+ +S +L      +SLS  ++      + L    +E
Sbjct  609   GYPGRTYRFYTGPKVYEFGYGLSYTKYSYKL------LSLSHNTLHINQSSTHLTTQNSE  662

Query  531   P--YVHVDEVS--NCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGF  364
                Y  V E++   C ++  S+ + + N+G M G   V+LF R       G P KQL+GF
Sbjct  663   TIRYKLVSELAEETCQTMLLSIALGVTNHGNMAGKHPVLLFVRQGKVRNNGNPVKQLVGF  722

Query  363   DRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
               V ++     +    + PC+HLS+ N  GS ++  G ++
Sbjct  723   QSVKLNAGETVQVGFELSPCEHLSVANEAGSMVIEEGSYL  762



>ref|XP_010914548.1| PREDICTED: probable beta-D-xylosidase 2 [Elaeis guineensis]
Length=772

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/752 (48%), Positives = 491/752 (65%), Gaps = 27/752 (4%)
 Frame = -3

Query  2493  SKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             ++P   C     ++ PFC  +LPI AR+  L+  LT+DEKI+ L +N + +PRLGI  YE
Sbjct  25    TRPAFACGGGPAAALPFCRVALPIRARVADLIGRLTLDEKIRLLVNNAAGVPRLGIAGYE  84

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSE+LHG++  GPG+ F GA   AT FPQVI +AA+FN TLW  I  A + EARAM+N 
Sbjct  85    WWSEALHGVSDVGPGVHFGGAYPGATSFPQVISSAASFNATLWELIGKAVSDEARAMYNG  144

Query  2133  GQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSL  1954
             GQAGLTFW+PNVN+F DPRWGRGQETPGEDP V S YAV YVRGLQ              
Sbjct  145   GQAGLTFWSPNVNIFRDPRWGRGQETPGEDPGVASRYAVSYVRGLQQA------------  192

Query  1953  SGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSC  1774
             SG           RL L+ACCKH TAYDL+ W    R+ FNA V++QD+EDT++ PFK+C
Sbjct  193   SGG-----PHGHGRLKLAACCKHYTAYDLDNWRGVDRFHFNAKVSKQDLEDTFDVPFKAC  247

Query  1773  VEKGRASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQYAK  1597
             V +G+ + +MC+YN VNG+P CA+ +LL    R  W   GYI SDCD+V   +  Q Y  
Sbjct  248   VVEGKVASVMCSYNQVNGVPTCADPNLLRNTIRGQWALNGYIVSDCDSVGVFYNTQHYTS  307

Query  1596  SPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGK  1417
             +PEEAA  A+KAG D++CG ++ +   SA++  +V E+ ++ AL N  +VQ RLG+++G 
Sbjct  308   TPEEAAADAIKAGLDLDCGPFLAQYTVSAVKQGLVSEAQVNAALTNTITVQMRLGMYDGD  367

Query  1416  AVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-  1240
                + F + GP DVC+  H+ LALEAARQGIVLLKN    LPL  + +  +AVIGP ++ 
Sbjct  368   PSKQPFGNLGPGDVCTPAHQNLALEAARQGIVLLKNNGHALPLSPSHLRFVAVIGPNSDA  427

Query  1239  TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVI  1060
             T ++ G+Y G+PC   S L G+G Y  KT++  GC +VAC        A++ A+ +D  I
Sbjct  428   TVTMIGNYAGVPCGYTSPLQGIGRYA-KTNHQMGCTNVACTGNQPIDAAIAAARNSDATI  486

Query  1059  VVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPR  880
             +++GLD S E E  DR  LLLPG Q  LV+++A  S  P +LVL  GGP+D++FAK DPR
Sbjct  487   LIMGLDQSIEAEARDRDGLLLPGRQQELVSKVAKASRGPTILVLMCGGPVDVTFAKNDPR  546

Query  879   IASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRADPSRGY  703
             IA++LW+GYPG+ GG A+++++FG +NP G+LP+TWYP+ F  KVPM +M MRADP+RGY
Sbjct  547   IAAILWVGYPGQAGGAAIADVLFGKFNPGGKLPVTWYPQQFVDKVPMTNMAMRADPARGY  606

Query  702   PGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYV  523
             PGR+YRFYTG  V+ +GHGLSY+ F+  L  AP +IS+    +   R S  N       V
Sbjct  607   PGRSYRFYTGPVVFPYGHGLSYTKFTHSLAHAPAQISVQLDGR---RASAHNSTEPGRAV  663

Query  522   HVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSG  343
              V   + C+ LA  V V ++N G  DGS  V+++S  P +    APQKQL+ F++VHV+ 
Sbjct  664   RVSH-ARCDGLAIPVHVDVKNVGDQDGSHTVLVYSTPPGTRW--APQKQLVAFEKVHVAV  720

Query  342   NGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
              G       ++ C+ LS  +  G R +P+G+H
Sbjct  721   GGQVRVKFGVDVCRDLSFADEYGIRRIPIGEH  752



>ref|XP_003615003.1| Xylan 1 4-beta-xylosidase [Medicago truncatula]
 gb|AES97961.1| glycoside hydrolase family 3 amino-terminal domain protein [Medicago 
truncatula]
Length=780

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/749 (50%), Positives = 485/749 (65%), Gaps = 31/749 (4%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P   S+PFC+ +L I  R   +VS LT+DEKI +L +   AIPRLGIP+Y+WW+E+LHG+
Sbjct  41    PLTKSFPFCNLNLTITQRAKDIVSRLTLDEKISQLVNTAPAIPRLGIPSYQWWNEALHGV  100

Query  2286  ATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GLTFW  2110
             +  G GI  +G++ +AT FPQ+IL AA+F+  LW  I+     EAR ++N+GQA G+TFW
Sbjct  101   SYVGKGIRLNGSITAATSFPQIILIAASFDPKLWYRISKVIGTEARGVYNAGQAQGMTFW  160

Query  2109  APNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEE  1930
             APN+N+F DPRWGRGQET GEDP+V S Y V YVR                L G+     
Sbjct  161   APNINIFRDPRWGRGQETAGEDPLVNSKYGVSYVR---------------GLQGDSFEGG  205

Query  1929  EEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASC  1750
             +    RL  SACCKH TAYDLE W   +RY F+A VT QD+ DTY+P F SCV +GR+S 
Sbjct  206   KLIGGRLKASACCKHFTAYDLENWKGVNRYVFDAKVTLQDLADTYQPSFHSCVVQGRSSG  265

Query  1749  LMCAYNAVNGIPACANKDLL-EKARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGI  1573
             +MCAYN VNG+P CA+ +LL   AR  W F GYI SDCDAV  I+E Q YAK+PE+    
Sbjct  266   IMCAYNRVNGVPNCADYNLLTNTARKKWNFNGYIASDCDAVRFIYEKQGYAKTPEDVVAD  325

Query  1572  ALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFES  1393
              L+AG D+ CG YM ++ KSA+  K +  S IDRAL NLF+++ RLGLF+G     ++  
Sbjct  326   VLRAGMDVECGNYMTKHAKSAVLQKKIPISQIDRALHNLFTIRIRLGLFDGNPTKLQYGR  385

Query  1392  FGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTSS--LGGD  1219
              GP  VCS E+  LALEAAR GIVLLKN    LPL   RV++L VIGP AN SS  L G+
Sbjct  386   IGPNQVCSKENLDLALEAARSGIVLLKNTASILPL--PRVNTLGVIGPNANKSSIVLLGN  443

Query  1218  YTGIPCALKSVLDGLGEYIHKTSYASGCLD-VACNSTDGFAEAVSIAKRADYVIVVVGLD  1042
             Y G PC   S+L G   Y  +T Y SGC D V C S +    AV +AK +DYVI+V+GLD
Sbjct  444   YFGQPCKQVSILKGFYTYASQTHYRSGCTDGVKCASAE-IDRAVEVAKISDYVILVMGLD  502

Query  1041  LSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLW  862
              SQETE  DR  L LPG Q  L+N +A  S KP++LV+  GGP+DI+FAK + +I  ++W
Sbjct  503   QSQETETLDRDHLELPGKQQKLINSVAKASKKPVILVILCGGPVDITFAKNNDKIGGIIW  562

Query  861   IGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRF  682
              GYPGE GG+AL+++VFGDYNP GRLP+TWYP+ F K+PM DM MRADPS GYPGRTYRF
Sbjct  563   AGYPGELGGRALAQVVFGDYNPGGRLPMTWYPKDFIKIPMTDMRMRADPSSGYPGRTYRF  622

Query  681   YTGEKVYEFGHGlsyssfslellSAP-TRISLSQSIKTKLRRSILNRGGNEPYVHVDEVS  505
             YTG KVYEFG+GLSYS++S   +S     I ++QS       SIL       Y  V E+ 
Sbjct  623   YTGPKVYEFGYGLSYSNYSYNFISVKNNNIHINQSTT----HSILENSETIRYKLVSELG  678

Query  504   N--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVT  331
                C +++ SV + + N G M G   V+LF + P     G P KQL+GF+ V V G G  
Sbjct  679   KKACKTMSISVTLGITNTGSMAGKHPVLLFVK-PKKGRNGNPVKQLVGFESVTVEGGGKG  737

Query  330   ETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             E    +  C+HLS  N  G +++  G ++
Sbjct  738   EVGFEVSVCEHLSRANESGVKVIEEGGYL  766



>gb|KHG02566.1| putative beta-D-xylosidase 7 [Gossypium arboreum]
Length=799

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/762 (50%), Positives = 498/762 (65%), Gaps = 43/762 (6%)
 Frame = -3

Query  2493  SKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             S+P   C    P   SYPFC  +LPI  R+  L+S LT+DEKI +L ++   IPRLGIP 
Sbjct  55    SRPPFACDSSHPLTKSYPFCKPTLPINQRVQDLISRLTLDEKISQLVNSAPPIPRLGIPE  114

Query  2319  YEWWSESLHGIATN---GPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavear  2149
             YEWWSE+LHG+A       G++ +G ++SAT FPQVILTAA+F+             EAR
Sbjct  115   YEWWSEALHGVAYFPGLHTGMSLNGTIQSATSFPQVILTAASFDAV---------GREAR  165

Query  2148  AMFNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkn  1972
             A++N+GQA G+TFWAPN+N+F DPRWGRGQETPGEDP+V   YAV +VR           
Sbjct  166   AIYNAGQATGMTFWAPNINIFRDPRWGRGQETPGEDPVVTGKYAVSFVR-----------  214

Query  1971  gRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYE  1792
                  + G+   E  +    L  SACCKH TAYDL+ W   +R+ FNA V+ QD+ DTY 
Sbjct  215   ----GIQGDTF-EGGKLGHHLQASACCKHFTAYDLDNWKGVNRFVFNAKVSLQDLADTYM  269

Query  1791  PPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFE  1615
             PPF+SC+E+G+AS +MCAYN VNG+P CA+ +LL K AR  WGF+GYITSDCDAV+ I E
Sbjct  270   PPFRSCIEEGKASGIMCAYNRVNGVPNCADYNLLSKTARAQWGFDGYITSDCDAVSIIHE  329

Query  1614  YQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRL  1435
              Q YAK PE+A    LKAG D+NCG Y+    KSA+  + +  S+IDRAL NLFSV+ RL
Sbjct  330   EQGYAKLPEDAVADVLKAGMDVNCGNYLKNYTKSAVVKRKLPISEIDRALHNLFSVRMRL  389

Query  1434  GLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVI  1255
             GLF+G  + + F   GP  VCS EH+ LALEAAR  IVLLKN  + LP  K + +SLAVI
Sbjct  390   GLFDGNPLQQPFGKIGPDQVCSQEHQNLALEAARNSIVLLKNTYRVLPFSKAKTTSLAVI  449

Query  1254  GPMANTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNS--TDGFAEAVSI  1084
             GP AN++ +L G+Y GIPC   + L GL  Y+    Y  GC  V C+   TD   +AV +
Sbjct  450   GPNANSAKTLLGNYAGIPCKTVTPLQGLQRYVKDIRYHPGCNAVNCSYALTD---QAVKV  506

Query  1083  AKRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDI  904
             AK A+YV++V+GLD +QE E+ DR  L+L   Q  L++ LA  +  P+VLVL  GGP+DI
Sbjct  507   AKGAEYVVLVMGLDQTQEREELDRVDLVLSPKQQNLISTLARAAKNPVVLVLLSGGPVDI  566

Query  903   SFAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMR  724
             SFAK D  I S+LW GYPGE GG AL+EI+FGD+NP GRLP+TWYP+SF KVPM DM MR
Sbjct  567   SFAKNDKHIGSILWAGYPGEAGGLALAEIIFGDHNPGGRLPVTWYPQSFVKVPMTDMRMR  626

Query  723   ADPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslell-SAPTRISLSQSIKTKLRRSILN  547
              +PS GYPGRTYRFY G+KV+EFG+GLSYS++S E L  A  ++ L+  IK+   ++ L 
Sbjct  627   PEPSSGYPGRTYRFYQGQKVFEFGYGLSYSNYSYEFLPVAQNKVYLNHQIKSP--KAELE  684

Query  546   RGGNEPYVHVDEV-SNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLI  370
                   +V V E+ +   S    V V  +N+G M G   ++LF R+  +   G P+KQL+
Sbjct  685   NSNALKHVPVSELGTELCSKRIPVTVRAQNHGDMAGRHPLLLFVRSAKA-GNGRPEKQLV  743

Query  369   GFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             GF  V ++     +    + PC+HLS VN +G  ++  G H+
Sbjct  744   GFQSVILNAGERADVEFELSPCEHLSTVNEDGLMVIEEGSHL  785



>ref|XP_004513829.1| PREDICTED: probable beta-D-xylosidase 7-like [Cicer arietinum]
Length=781

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/763 (50%), Positives = 491/763 (64%), Gaps = 29/763 (4%)
 Frame = -3

Query  2505  ATSYSKPQLPC--QPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRL  2332
             A S ++P   C    P   SY FC+  LPI  R   +VS LT+DEK+ +L +   +IPRL
Sbjct  25    AESPTQPPYSCDISNPLTKSYAFCNLKLPIIERAKDIVSRLTLDEKLAQLVNTAPSIPRL  84

Query  2331  GIPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavea  2152
             GIP+Y+WWSE+LHG+A  G GI  +G +K+AT FPQVILTAA+F+  LW  I+     EA
Sbjct  85    GIPSYQWWSEALHGVANAGKGIRLNGTIKAATSFPQVILTAASFDSKLWYQISKVIGTEA  144

Query  2151  rAMFNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgk  1975
             R ++N+GQA G+TFWAPN+N+F DPRWGRGQET GEDP+V + Y V YVRGLQG      
Sbjct  145   RGIYNAGQAEGMTFWAPNINIFRDPRWGRGQETAGEDPLVNAKYGVSYVRGLQGD-----  199

Query  1974  ngRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTY  1795
                  S +G ++   E    RL  SACCKH TAYDL+ W+   R+ F+A VT QD+ DTY
Sbjct  200   -----SFNGGKLIGGE----RLKASACCKHFTAYDLDNWNGVDRFDFDAHVTLQDLADTY  250

Query  1794  EPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLL-EKARTDWGFEGYITSDCDAVATIF  1618
             +PPF+SC+++GR+S +MCAYN VNG+P CA+  LL   AR  W F GYITSDC+AVA I 
Sbjct  251   QPPFQSCIQQGRSSGIMCAYNRVNGVPNCADFHLLTNTAREKWNFNGYITSDCEAVAIIH  310

Query  1617  EYQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFR  1438
             E Q YAK+ E+A    L+AG D+ CG Y+ ++ KSA+  K V  S I+RAL NLFS++ R
Sbjct  311   ERQGYAKTAEDAVADVLQAGMDVECGDYITKHAKSAVLQKKVPISQINRALHNLFSIRIR  370

Query  1437  LGLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAV  1258
             LGLF+G     K+ + GP  VCS ++ ++ALEAAR GIVLLKN  K LPL K+   S+A+
Sbjct  371   LGLFDGNPTKLKYGTIGPNQVCSKQNLQIALEAARSGIVLLKNTAKLLPLPKSN-PSIAL  429

Query  1257  IGPMANTSS--LGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLD-VACNSTDGFAEAVS  1087
             IGP AN SS    G+Y G PC L ++  G   Y     Y  GC D   C S +   +AV 
Sbjct  430   IGPNANASSQVFLGNYFGRPCNLVTLSQGFENYAKNIIYHPGCSDGTKCLSAE-IDQAVE  488

Query  1086  IAKRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLD  907
             +AK+ DYV++V+GLD SQE E HDR  L LPG Q  L+N +A  S +P+VLVL  GGP+D
Sbjct  489   VAKKVDYVVLVMGLDQSQERESHDRDHLELPGRQQELINSVAKASRRPVVLVLLCGGPVD  548

Query  906   ISFAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNM  727
             IS AK D +I  +LW GYPGE GG AL++I+FGDYNP GRLP+TWYP+ F K PM DM M
Sbjct  549   ISSAKFDDKIGGILWGGYPGELGGLALAQIIFGDYNPGGRLPMTWYPKDFIKTPMTDMRM  608

Query  726   RADPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILN  547
             RADPS GYPGRTYRFY G  VYEFG+GLSY+ +S   +S       +  I      SI+ 
Sbjct  609   RADPSSGYPGRTYRFYKGPTVYEFGYGLSYTKYSYHFISVTNN---NLHINQSSTHSIIE  665

Query  546   RGGNEPYVHVDEVS--NCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQL  373
                   Y  V E+S   C +++FSV + + NNG M G   V+LF +    Y  G P KQL
Sbjct  666   NSKTIRYKLVSELSEETCQTMSFSVTLEVTNNGSMVGKHPVLLFMKQ-KKYRTGNPMKQL  724

Query  372   IGFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             +GF+ V +      E    +  C+HLS  N  G +++  G ++
Sbjct  725   VGFESVKLGAGDKGEVGFEVRACKHLSRANESGVKVIEEGSYL  767



>ref|NP_001067726.1| Os11g0297800 [Oryza sativa Japonica Group]
 gb|AAX96805.1| beta-D-xylosidase [Oryza sativa Japonica Group]
 gb|ABA92796.1| Glycosyl hydrolase family 3 C terminal domain containing protein, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF28089.1| Os11g0297800 [Oryza sativa Japonica Group]
 gb|EAY80687.1| hypothetical protein OsI_35869 [Oryza sativa Indica Group]
 dbj|BAG98945.1| unnamed protein product [Oryza sativa Japonica Group]
Length=782

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/742 (49%), Positives = 486/742 (65%), Gaps = 35/742 (5%)
 Frame = -3

Query  2445  FCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGIATNGPGI  2266
             FCD +LP   R   LV+ LT  EK+ +L D  + +PRLG+PAY+WWSE+LHG+AT+G G+
Sbjct  52    FCDATLPAEQRAADLVARLTAAEKVAQLGDQAAGVPRLGVPAYKWWSEALHGLATSGRGL  111

Query  2265  TFDG---AVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GLTFWAPNV  2098
              FD    A ++AT FPQV+LTAAAF+  LW  I  A   EARA++N GQA GLT W+PNV
Sbjct  112   HFDAPGSAARAATSFPQVLLTAAAFDDDLWFRIGQAIGTEARALYNIGQAEGLTMWSPNV  171

Query  2097  NVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEEEDD  1918
             N+F DPRWGRGQETPGEDP + S YAV +V+                + GN         
Sbjct  172   NIFRDPRWGRGQETPGEDPTMASKYAVAFVK---------------GMQGN-------SS  209

Query  1917  DRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCLMCA  1738
               L  SACCKH+TAYDLE W+   RY+FNA VT QD+EDTY PPF+SCV   +A+C+MCA
Sbjct  210   AILQTSACCKHVTAYDLEDWNGVQRYNFNAKVTAQDLEDTYNPPFRSCVVDAKATCIMCA  269

Query  1737  YNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIALKA  1561
             Y  +NG+PACAN DLL K  R DWG +GYI SDCDAVA + + Q+Y ++PE+A  +ALKA
Sbjct  270   YTGINGVPACANADLLTKTVRGDWGLDGYIASDCDAVAIMRDAQRYTQTPEDAVAVALKA  329

Query  1560  GTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKA-VNRKFESFGP  1384
             G D+NCGTYM ++  +A++   + E DID+AL NLF+++ RLG F+G    N  +   G 
Sbjct  330   GLDMNCGTYMQQHATAAIQQGKLTEEDIDKALKNLFAIRMRLGHFDGDPRSNSVYGGLGA  389

Query  1383  KDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTS-SLGGDYTGI  1207
              D+C+ EHR LALEAA  GIVLLKN+   LPLD+T V+S AVIGP AN   +L G+Y G 
Sbjct  390   ADICTPEHRSLALEAAMDGIVLLKNDAGILPLDRTAVASAAVIGPNANDGLALIGNYFGP  449

Query  1206  PCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQET  1027
             PC   + L+G+  YI    + +GC   AC+       A   +  +DYV + +GL   QE+
Sbjct  450   PCESTTPLNGILGYIKNVRFLAGCNSAACDVAATDQAAAVASS-SDYVFLFMGLSQKQES  508

Query  1026  EDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGYPG  847
             E  DR SLLLPG Q +L+  +A  + +P++LVL  GGP+D++FA+ +P+I ++LW GYPG
Sbjct  509   EGRDRTSLLLPGEQQSLITAVADAAKRPVILVLLTGGPVDVTFAQTNPKIGAILWAGYPG  568

Query  846   EEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFYTGEK  667
             + GG A++ ++FGD+NP GRLP+TWYPE FTKVPM DM MRADP+ GYPGR+YRFY G+ 
Sbjct  569   QAGGLAIARVLFGDHNPGGRLPVTWYPEEFTKVPMTDMRMRADPATGYPGRSYRFYQGKT  628

Query  666   VYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEVSN--CNS  493
             VY+FG+GLSYSS+S +L+S         ++   LR +  +  G+E Y H++E+    C  
Sbjct  629   VYKFGYGLSYSSYSRQLVSGGKPAESYTNLLASLRTTTTSE-GDESY-HIEEIGTDGCEQ  686

Query  492   LAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSISI  313
             L F   V ++N+G MDG   V+++ R P +  GG P  QLIGF   H+           I
Sbjct  687   LKFPAVVEVQNHGPMDGKHSVLMYLRWPNA-KGGRPTTQLIGFRSQHLKVGEKANIRFDI  745

Query  312   EPCQHLSIVNVEGSRILPLGDH  247
              PC+H S V  +G +++  G H
Sbjct  746   SPCEHFSRVRKDGKKVIDRGSH  767



>ref|XP_003576084.1| PREDICTED: probable beta-D-xylosidase 7 isoform X1 [Brachypodium 
distachyon]
Length=779

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/761 (48%), Positives = 485/761 (64%), Gaps = 42/761 (6%)
 Frame = -3

Query  2487  PQLPCQPPTHSS-YPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEW  2311
             P   C P + +  Y FCD +LP+  R   LVS LT+ EK+ +L D   A+PRLG+PAY+W
Sbjct  34    PPFSCGPGSATQGYAFCDKALPVERRAADLVSRLTLAEKVSQLGDEADAVPRLGVPAYKW  93

Query  2310  WSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSG  2131
             WSE LHG++  G G+ FDGAV++ T FPQV+LTAA+F++ +W  I  A   EARA++N G
Sbjct  94    WSEGLHGLSFWGHGMHFDGAVRAITSFPQVLLTAASFDQDIWYRIGQAIGTEARALYNLG  153

Query  2130  QA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSL  1954
             QA GLT W+PNVN++ DPRWGRGQETPGEDP   S YAV +V+                L
Sbjct  154   QAQGLTIWSPNVNIYRDPRWGRGQETPGEDPTTASKYAVAFVK---------------GL  198

Query  1953  SGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSC  1774
              G            L  SACCKH TAYDLE W+   RY+FNA VT QD+ DT+ PPFKSC
Sbjct  199   QGTSATT-------LQTSACCKHATAYDLEDWNGVVRYNFNAKVTLQDLADTFNPPFKSC  251

Query  1773  VEKGRASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQYAK  1597
             VE+G+A+C+MCAY  +NG+PACA+ DL+ K  + DWG  GY++SDCDAVA + + Q+Y  
Sbjct  252   VEEGKATCVMCAYTNINGVPACASSDLITKTFKGDWGLNGYVSSDCDAVALLRDAQRYRA  311

Query  1596  SPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGK  1417
             +PE+   +ALKAG D+NCG Y   +  SAL+   + E D+D AL NLF+V+ RLG F+G 
Sbjct  312   TPEDTVAVALKAGLDLNCGNYTQVHGMSALQQGKMTEQDVDNALKNLFAVRMRLGHFDGD  371

Query  1416  A-VNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN  1240
                +  + S G  DVCS  H+ LALEAA+ GIVLLKN+   LPLD + V+S A IG  AN
Sbjct  372   PRTSALYGSLGAADVCSPAHKNLALEAAQSGIVLLKNDAGILPLDPSAVASAAAIGHNAN  431

Query  1239  T-SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFA---EAVSIAKRA  1072
               ++L G+Y G PC   + L GL  Y+    + +GC   AC    GFA   +AV++A  +
Sbjct  432   DPAALNGNYFGPPCETTTPLQGLQGYVKNVKFLAGCDSAAC----GFAATGQAVTLASSS  487

Query  1071  DYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAK  892
             DYVI+ +GL   +E E  DR SLLLPG Q  L+  +A  S +P++LVL  GG +DI+FAK
Sbjct  488   DYVILFMGLSQKEEQEGIDRTSLLLPGKQQNLITAVASASKRPVILVLLTGGSVDITFAK  547

Query  891   KDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPS  712
              +P+I ++LW GYPG+ GG A++ ++FGD+NP+GRLP+TWYPE FTKVPM DM MRADP+
Sbjct  548   SNPKIGAILWAGYPGQAGGLAIARVLFGDHNPSGRLPVTWYPEEFTKVPMTDMRMRADPA  607

Query  711   RGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNR---G  541
              GYPGR+YRFY G+ VY+FG GLSYS FS +L+   +  +  Q   T L   +  R    
Sbjct  608   TGYPGRSYRFYQGKTVYKFGDGLSYSKFSRQLV---SSTNTHQVPNTNLLTGLTARTATD  664

Query  540   GNEPYVHVDE--VSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIG  367
             G   Y HV+E  V  C+ L F   V ++N+G MDG   VM+F R P S   G P  QL+G
Sbjct  665   GGMSYYHVEEIGVEGCDKLKFPAVVEVQNHGPMDGKHSVMMFLRWPNSTGTGRPVSQLVG  724

Query  366   FDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             F   H+        +  + PC+H +    +G +++  G H 
Sbjct  725   FRSQHLKAGEKASLTFDVSPCEHFARAREDGKKVIDRGSHF  765



>ref|XP_003542472.1| PREDICTED: probable beta-D-xylosidase 7-like [Glycine max]
Length=778

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/762 (50%), Positives = 493/762 (65%), Gaps = 36/762 (5%)
 Frame = -3

Query  2493  SKPQLPCQPPTHSSY-PFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAY  2317
             ++P   C   ++S Y  FC+T LPI  R   LVS LT+DEK+ +L +   AIPRLGIP+Y
Sbjct  27    TRPPYSCDSSSNSPYYSFCNTKLPITKRAQDLVSRLTLDEKLAQLVNTAPAIPRLGIPSY  86

Query  2316  EWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFN  2137
             +WWSE+LHG+A  G GI F+G +KSAT FPQVILTAA+F+  LW  I+     EARA++N
Sbjct  87    QWWSEALHGVADAGFGIRFNGTIKSATSFPQVILTAASFDPNLWYQISKTIGREARAVYN  146

Query  2136  SGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKY  1960
             +GQA G+TFWAPN+NVF DPRWGRGQET GEDP++ + Y V YVRGLQG           
Sbjct  147   AGQATGMTFWAPNINVFRDPRWGRGQETAGEDPLMNAKYGVAYVRGLQGD----------  196

Query  1959  SLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFK  1780
             S  G ++ E      RL  SACCKH TAYDL+ W    R+ F+A VT QD+ DTY+PPF+
Sbjct  197   SFEGGKLAE------RLQASACCKHFTAYDLDQWKGLDRFVFDARVTSQDLADTYQPPFQ  250

Query  1779  SCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQY  1603
             SC+E+GRAS +MCAYN VNG+P CA+ +LL K AR  W F+GYITSDC AV+ I E Q Y
Sbjct  251   SCIEQGRASGIMCAYNRVNGVPNCADFNLLTKTARQQWKFDGYITSDCGAVSIIHEKQGY  310

Query  1602  AKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFN  1423
             AK+ E+A     +AG D+ CG Y+ ++ KSA+  K +  S IDRAL NLFS++ RLGLF+
Sbjct  311   AKTAEDAIADVFRAGMDVECGDYITKHAKSAVFQKKLPISQIDRALQNLFSIRIRLGLFD  370

Query  1422  GKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMA  1243
             G      F + GP +VCS +  +LALEAAR GIVLLKN    LPL KT   ++A+IGP A
Sbjct  371   GNPTKLPFGTIGPNEVCSKQSLQLALEAARDGIVLLKNTNSLLPLPKTN-PTIALIGPNA  429

Query  1242  NTSS--LGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             N SS    G+Y G PC L ++L G   Y  KT Y  GC D    +     EAV +AK+ D
Sbjct  430   NASSKVFLGNYYGRPCNLVTLLQGFEGYA-KTVYHPGCDDGPQCAYAQIEEAVEVAKKVD  488

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
             YV++V+GLD SQE E HDR  L LPG Q  L+  +A  + +P+V+VL  GGP+DI+ AK 
Sbjct  489   YVVLVMGLDQSQERESHDREYLGLPGKQEELIKSVARAAKRPVVVVLLCGGPVDITSAKF  548

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSR  709
             D ++  +LW GYPGE GG AL+++VFGD+NP G+LP+TWYP+ F KVPM DM MRADP+ 
Sbjct  549   DDKVGGILWAGYPGELGGVALAQVVFGDHNPGGKLPITWYPKDFIKVPMTDMRMRADPAS  608

Query  708   GYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEP  529
             GYPGRTYRFYTG KVYEFG+GLSY+ +S +L      +SLS S     + S      N  
Sbjct  609   GYPGRTYRFYTGPKVYEFGYGLSYTKYSYKL------LSLSHSTLHINQSSTHLMTQNSE  662

Query  528   YVHVDEVS-----NCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPT--SYAGGAPQKQLI  370
              +    VS      C ++  S+ + + N G + G   V+LF R     +   G P KQL+
Sbjct  663   TIRYKLVSELAEETCQTMLLSIALGVTNRGNLAGKHPVLLFVRQGKVRNINNGNPVKQLV  722

Query  369   GFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             GF  V V+     +    + PC+HLS+ N  GS ++  G ++
Sbjct  723   GFQSVKVNAGETVQVGFELSPCEHLSVANEAGSMVIEEGSYL  764



>ref|XP_009379698.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Pyrus x bretschneideri]
Length=773

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/743 (49%), Positives = 486/743 (65%), Gaps = 33/743 (4%)
 Frame = -3

Query  2463  THSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGIA  2284
             T SS+ FCDTSL + AR+  LV  LT+ EKI  L +N  ++ RLGIP YEWWSE+LHG++
Sbjct  47    TLSSFAFCDTSLGVDARVVDLVKRLTLPEKIGFLVNNAGSVSRLGIPKYEWWSEALHGVS  106

Query  2283  TNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWAP  2104
               GPG  F   V  AT FPQVILTAA+FN +L+ +I    + EARAM+N G AGLTFW+P
Sbjct  107   YVGPGTKFSSLVPGATSFPQVILTAASFNTSLFEAIGRVVSTEARAMYNVGLAGLTFWSP  166

Query  2103  NVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEEE  1924
             N+N+F DPRWGRGQETPGEDP++ S Y   YVRGLQ                     ++ 
Sbjct  167   NINIFRDPRWGRGQETPGEDPVLSSKYGSGYVRGLQQT-------------------DDG  207

Query  1923  DDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCLM  1744
             D ++L ++ACCKH TAYD++ W    RY FNAVVT+QD++DT++PPFKSCV  G  + +M
Sbjct  208   DKNKLKVAACCKHYTAYDVDNWKGVDRYHFNAVVTKQDLDDTFQPPFKSCVIDGNVASVM  267

Query  1743  CAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIAL  1567
             C+YN VNGIP CA+ DLL    R +W   GYI +DCD++   ++ Q Y K+PEEAA  A+
Sbjct  268   CSYNQVNGIPTCADPDLLAGVIRGEWKLNGYIVTDCDSIDVYYKQQHYTKTPEEAAAKAI  327

Query  1566  KAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESFG  1387
              AG D+NCG+++ +    A++  +V E+DIDRA+ N F+   RLG F+G   ++ +   G
Sbjct  328   LAGLDLNCGSFLGQYTPGAVQAGLVKEADIDRAISNNFATLMRLGFFDGDPSDKPYGKLG  387

Query  1386  PKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTS-SLGGDYTG  1210
             PKDVC+SE++ LA E ARQGIVLLKN    LPL  T + SLAVIGP AN   ++ G+Y G
Sbjct  388   PKDVCTSENQELARETARQGIVLLKNSPGSLPLSPTAIQSLAVIGPNANVQKTMIGNYEG  447

Query  1209  IPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQE  1030
              PC   ++L GL   +  T+Y  GC +VAC +     +A  IA  AD  I+V+G D S E
Sbjct  448   TPCKYTTILQGLSASV-TTNYVPGCANVACGTAQ-VDDATKIAASADATILVMGADQSIE  505

Query  1029  TEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGYP  850
              E  DR  LLLPG Q  LV E+A  +  P++LV+  GG  DI+FAK D +I S+LW+GYP
Sbjct  506   RESLDRIDLLLPGQQTLLVTEVAKAAKGPVILVIMSGGGFDITFAKNDTKITSILWVGYP  565

Query  849   GEEGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRADPSRGYPGRTYRFYTG  673
             GE GG A++++VFG YNP+GRLP+TWYP+S+  KVPM +MNMR DPS GYPGRTYRFYTG
Sbjct  566   GEAGGAAVADVVFGQYNPSGRLPMTWYPQSYVDKVPMTNMNMRPDPSNGYPGRTYRFYTG  625

Query  672   EKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEVSNCNS  493
             E VY FG GL YS+F+ +L+ AP  +S+       L    +    +   + V E   C +
Sbjct  626   ETVYSFGDGLGYSAFNHKLVRAPKLVSI------PLEEGHVCHSSSCKSLDVVE-ERCEN  678

Query  492   LAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSISI  313
             LAF + + ++N G M GS  VMLFS  P  +   +PQK L+GF++V VS         ++
Sbjct  679   LAFDIHLGVKNMGRMSGSHTVMLFSSPPAVHK--SPQKHLLGFEKVFVSAKREALVKFNV  736

Query  312   EPCQHLSIVNVEGSRILPLGDHI  244
             + C+HLS+V+  G+R + LG H+
Sbjct  737   DVCKHLSVVDELGNRKVALGKHV  759



>gb|KFK42187.1| hypothetical protein AALP_AA2G222800 [Arabis alpina]
Length=777

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/754 (51%), Positives = 488/754 (65%), Gaps = 35/754 (5%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             PT   + FC T + I  R   LVS LTVDEKI +L +    IPRLGIPAYEWWSE+LHG+
Sbjct  32    PTTKLFLFCRTDISINRRAKDLVSRLTVDEKISQLVNTAPGIPRLGIPAYEWWSEALHGV  91

Query  2286  ATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GLTFW  2110
             A  GPGI F+G V +AT FPQVILTAA+F+   W  IA     EAR ++N+GQA G+TFW
Sbjct  92    AGVGPGIRFNGTVHAATSFPQVILTAASFDPYEWFRIARVIGKEARGVYNAGQANGMTFW  151

Query  2109  APNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEE  1930
             APN+N+F DPRWGRGQETPGEDP +   YAV YVRGLQG    G    K  LSG      
Sbjct  152   APNINIFRDPRWGRGQETPGEDPTMTGTYAVAYVRGLQGDSFDG----KKILSGGH----  203

Query  1929  EEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASC  1750
                   L  SACCKH TAYDL+ W   +RY FNA V+  D+ +TY+PPFK C+++GRAS 
Sbjct  204   ------LQASACCKHFTAYDLDRWKGITRYVFNAQVSLADLAETYQPPFKKCIQEGRASG  257

Query  1749  LMCAYNAVNGIPACANKDLL-EKARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGI  1573
             +MCAYN VNG+PACAN +LL   AR  W F GYITSDCDAV+ I++ Q YAKSPE+A   
Sbjct  258   IMCAYNRVNGVPACANPNLLTHTARGLWQFNGYITSDCDAVSIIYDAQGYAKSPEDAVAD  317

Query  1572  ALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFES  1393
              LKAG D+NCG+Y+ ++ KSAL+ K V ESDI+RAL+NLFSV+ RLGL NG      + +
Sbjct  318   VLKAGMDVNCGSYLAKHTKSALQKKKVSESDINRALINLFSVRIRLGLLNGDPSKLTYGN  377

Query  1392  FGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTS-SLGGDY  1216
               PKDVCS  H+ LALEAAR GIVL+KN  K LP  K  + SLAVIGP A+ + +L G+Y
Sbjct  378   ISPKDVCSPGHQALALEAARNGIVLMKNTLKLLPFSKGSIGSLAVIGPNADIAKTLLGNY  437

Query  1215  TGIPCALKSVLDGLGEYIHK-----TSYASGCLDVACNSTDG-FAEAVSIAKRADYVIVV  1054
              G PC   + LD +  YI +     T Y  GC  VAC + D    +AV+IA+ AD V+++
Sbjct  438   AGPPCKSVTPLDAINVYIERGYIKSTIYHKGCDSVACANADAEIDQAVAIARDADRVVLI  497

Query  1053  VGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIA  874
             +GLDL+QE ED DR  L LPG Q  L+  +A V+ KP+VLVL  GGP+D+SFA  + +I 
Sbjct  498   MGLDLTQEKEDFDRVDLSLPGKQRELITSIAKVAKKPVVLVLICGGPVDVSFATNNAKIG  557

Query  873   SVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGR  694
             S++W GYPGE GG AL+EI+FGD+NP GRLP+TWYP+SF  V M DM MR+  + GYPGR
Sbjct  558   SIIWAGYPGEAGGIALAEILFGDHNPGGRLPVTWYPQSFVNVKMTDMRMRS--ATGYPGR  615

Query  693   TYRFYTGEKVYEFGHGlsyssfsle-llSAPTRISLSQSIKTKLRRSILNRGGNEPYVHV  517
             TYRFY G KV+EFGHGLSYS +S +    A T + L+QS+         N   +  Y  V
Sbjct  616   TYRFYKGPKVFEFGHGLSYSRYSYQFKTQAETNLYLNQSVAKP------NSVDSIRYTLV  669

Query  516   DEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGA-PQKQLIGFDRVHVS  346
              E+    C+     V V + N G M G   V++F+R       G   +KQL+GF  + +S
Sbjct  670   SEMGKHGCDIAKTKVSVMVENQGEMSGKHPVLMFARHERGGEDGKRAEKQLVGFKSIVLS  729

Query  345   GNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
                  E    I  C+HL+  N  G  ++  G + 
Sbjct  730   NGERAEIEFEISLCEHLTRANEVGVMVVEEGKYF  763



>ref|XP_002975008.1| hypothetical protein SELMODRAFT_103038 [Selaginella moellendorffii]
 gb|EFJ23793.1| hypothetical protein SELMODRAFT_103038 [Selaginella moellendorffii]
Length=772

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/749 (47%), Positives = 492/749 (66%), Gaps = 24/749 (3%)
 Frame = -3

Query  2475  CQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESL  2296
             C     SS+PFCD SLP+P R+  LV  + + EKI ++  N S IPRLGIP Y+WW E+L
Sbjct  25    CTDSRSSSFPFCDVSLPVPDRVADLVGRMNLSEKIAQIVSNASGIPRLGIPGYQWWEEAL  84

Query  2295  HGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLT  2116
             HG+A + PG+ F   V SAT FPQVILT A+FN +LW  IA A ++EA AM+N+G++GLT
Sbjct  85    HGVAES-PGVKFAAPVPSATSFPQVILTVASFNSSLWNKIAQAISIEAIAMYNAGRSGLT  143

Query  2115  FWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMP  1936
             FW+PN+N+F DPRWGRGQETPGEDP++ S YA  +VRGLQ               G  + 
Sbjct  144   FWSPNINIFRDPRWGRGQETPGEDPLLSSKYAAYFVRGLQEGDYD---------EGTAIS  194

Query  1935  EEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRA  1756
               +    RL +S+CCKH TAYD+E       + FNA VT QD++DT++PPF+SC+  G+A
Sbjct  195   TMQRRPTRLKVSSCCKHFTAYDMEKSEGTDCFHFNAQVTVQDLQDTFDPPFRSCIVDGQA  254

Query  1755  SCLMCAYNAVNGIPACANKDLL-EKARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAA  1579
             S LMC+YN VNG+P+CA+   L E  R  WGFEGYI SDCDAVA ++EY  Y  + E+A 
Sbjct  255   SGLMCSYNRVNGVPSCADYTFLTETVRNSWGFEGYIVSDCDAVALLYEYINYTTTAEDAV  314

Query  1578  GIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKF  1399
                L AG D+NCGT++LR+  +A+E   V E+ +DRAL N+ +V+ RLGLF+G +    +
Sbjct  315   ADVLSAGMDLNCGTFLLRHTAAAIEQGKVTEAAVDRALSNVMTVRMRLGLFDGNS-GETY  373

Query  1398  ESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSLGG  1222
              S GP  VC+ EHR+L+LEAA QGIVLLKN    LP  +  + ++AVIGP  N T ++ G
Sbjct  374   NSIGPDAVCTREHRQLSLEAAEQGIVLLKNSGNVLPFPRNDLMTIAVIGPSGNATETMLG  433

Query  1221  DYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLD  1042
             +Y G+PC   +   GL EY     +  GC D+ CN T  F  AV  A+ +D V++VVGLD
Sbjct  434   NYAGVPCQYITPFQGLQEYTKGVVFEPGCKDIMCNDTTLFLAAVRAAENSDAVVIVVGLD  493

Query  1041  LSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLW  862
               QE E  DR SLLLPG+Q  LV E++ V+  P++LV+  GGP+D++FAK + +I+SVLW
Sbjct  494   KDQEREGLDRTSLLLPGYQQDLVLEVSKVAKGPVILVVMSGGPIDVTFAKGNCKISSVLW  553

Query  861   IGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTK-VPMNDMNMRADPSRGYPGRTYR  685
             +GYPGE GGKA++ ++FGD+NPAGRLP+TWYP++F + V + +M++R + S G+PGRTYR
Sbjct  554   VGYPGEAGGKAIARVIFGDHNPAGRLPMTWYPQAFAEHVSILNMHLRPNTSTGFPGRTYR  613

Query  684   FYTGEKVYEFGHGlsyssfslellSAPTRISLSQS--IKTKLRRSILNRGGNEPYVHVDE  511
             FYTGE VYEFGHGLSY++F+    SAP+ I+   +  I+T LR           +  +D 
Sbjct  614   FYTGENVYEFGHGLSYTNFTYTNFSAPSNITARNTVAIRTPLRED------GARHFPID-  666

Query  510   VSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAG-GAPQKQLIGFDRVHVSGNGV  334
              + C +LAF V   + N G  D   + +L++  P + +    P+KQLI F R H+     
Sbjct  667   YTGCEALAFKVVAYISNTGTRDSDHISLLYAIPPAASSSLSPPRKQLISFKRQHLIAGRC  726

Query  333   TETSISIEPCQHLSIVNVEGSRILPLGDH  247
              +    ++ C+ L + N  G+++L  GD+
Sbjct  727   AKVEFDVDTCKDLGLTNEAGTKVLVHGDY  755



>ref|XP_006383491.1| hypothetical protein POPTR_0005s16650g, partial [Populus trichocarpa]
 gb|ERP61288.1| hypothetical protein POPTR_0005s16650g, partial [Populus trichocarpa]
Length=772

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/779 (49%), Positives = 494/779 (63%), Gaps = 51/779 (7%)
 Frame = -3

Query  2499  SYSKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGI  2326
             S S+P   C    P+  +Y FC T+LPI  R   LVS LT +EK  +L D + AIPRLGI
Sbjct  7     SASQPPYSCDSSDPSTKTYDFCKTTLPISRRAEDLVSRLTFEEKATQLVDTSPAIPRLGI  66

Query  2325  PAYEWWSESLHGIA---TNGPGITF-DGAVKSATGFPQVILTAAAFNRTLWRSIaaaaav  2158
             PAYEWWSE LHGI        GI+F +  ++ AT FPQVILTAA+F+  +W  I  A   
Sbjct  67    PAYEWWSEGLHGIGFLTRVQQGISFFNRTIQHATSFPQVILTAASFDAHIWYRIGQATGK  126

Query  2157  earAMFNSGQ-AGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglk  1981
             EARA++N+GQ  GL FWAPNVN+F DPRWGRGQETPGEDP+VV  Y   +VR        
Sbjct  127   EARALYNAGQVTGLGFWAPNVNIFRDPRWGRGQETPGEDPLVVGKYGASFVR--------  178

Query  1980  gkngRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMED  1801
                     + G+    E    D L  SACCKH TA+DL+ W+  +R+ FNA+VT QDM D
Sbjct  179   -------GVQGDSFEGESTLGDHLQASACCKHYTAHDLDNWNGVNRFRFNAIVTLQDMAD  231

Query  1800  TYEPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVAT  1624
             TY+PPF+SCV++G+AS +MC+YN +NGIP+CA+ DLL K  R +WGF GYITSDCDAV  
Sbjct  232   TYQPPFRSCVQEGKASGIMCSYNEINGIPSCAHYDLLTKTLRQEWGFYGYITSDCDAVNV  291

Query  1623  IFEYQQYAKSPEEAAGIALKAGTDINCGT----------YMLRNMKSALENKIVVESDID  1474
             +   Q+YAK+PE+A   ALK+G D+ C T          Y+    KSA+E K V  S+ID
Sbjct  292   LHVEQKYAKTPEDAVADALKSGMDVECSTSARSKDFPVSYLRNYTKSAVEKKKVTVSEID  351

Query  1473  RALLNLFSVQFRLGLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFL  1294
             RAL NLFS + RLGLFNG    + +   GP  VCS EH+ LALEAA  GIVLLKN  + L
Sbjct  352   RALHNLFSTRMRLGLFNGDPTKQLYSDIGPDQVCSQEHQALALEAALDGIVLLKNADRLL  411

Query  1293  PLDKTRVSSLAVIGPMA-NTSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACN  1117
             PL K+ +SSLAVIGP A N+++L G+Y G  C   ++L+GL  Y+   SY  GC +V+C 
Sbjct  412   PLSKSGISSLAVIGPNAHNSTNLLGNYFGPACKNVTILEGLRNYVSSASYEKGCNNVSCT  471

Query  1116  STDGFAEAVSIAKRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplv  937
             S     + V +A+  D VI+V+GLD SQE E  DR  L+LPG Q  L+  +A  + +P+V
Sbjct  472   SA-AKKKPVEMAQTEDQVILVMGLDQSQEKERLDRMDLVLPGKQPTLITAVAKAAKRPIV  530

Query  936   lvltgggpLDISFAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESF  757
             LVL GG P+D++FAK + +I S+LW GYPG+ G  AL++I+FG++NP GRLP+TWYP+ F
Sbjct  531   LVLLGGSPMDVTFAKNNRKIGSILWAGYPGQAGATALAQIIFGEHNPGGRLPMTWYPQDF  590

Query  756   TKVPMNDMNMRADPSRGYPGRTYRFYTGEKVYEFGHGlsyssfsle-llSAPTRISLSQS  580
             TKVPM DM MR  PS G PGRTYRFY GEKV+EFG+GLSYS +S      A  ++++  S
Sbjct  591   TKVPMTDMRMRPQPSTGNPGRTYRFYEGEKVFEFGYGLSYSDYSYTFASVAQNQLNVKDS  650

Query  579   IKTKLRRSILNRGGNEPYVHVDEV--SNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPT  406
                +   S         Y  V ++    C ++ F V VS++N G M G   V+LF+R   
Sbjct  651   SNQQPENS-----ETPGYKLVSDIGEEQCENIKFKVTVSVKNEGQMAGKHPVLLFARHAK  705

Query  405   SYAGGAPQKQLIGFDRVHVSGNGVTETSISIEPCQHLS-------IVNVEGSRILPLGD  250
                 G P K+L+GF  V +     TE    + PC+HLS       +V  EGS+IL +GD
Sbjct  706   P-GKGRPIKKLVGFQTVKLGAGEKTEIEYELSPCEHLSSANEDGVMVMEEGSQILLVGD  763



>ref|XP_010937520.1| PREDICTED: uncharacterized protein LOC105056876 [Elaeis guineensis]
Length=1555

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/745 (50%), Positives = 496/745 (67%), Gaps = 26/745 (3%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P+  S+ FC+T+L I  R+  L+S L+++EKI +L D+  +IPRLG+PAYEWWSESLHG+
Sbjct  35    PSTKSFAFCETTLAIDKRVDDLISRLSLEEKIAQLGDSAPSIPRLGVPAYEWWSESLHGV  94

Query  2286  ATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GLTFW  2110
             +  G G+ F G +++AT FPQVILTAA+FN  +W  I      EARA++N+GQA GLTFW
Sbjct  95    SNWGRGMHFTGPIRTATSFPQVILTAASFNPQIWYQIGQVIGTEARAIYNNGQAQGLTFW  154

Query  2109  APNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEE  1930
             APNVN+F DPRWGRGQETPGEDP+  S YA  +VRG+QG           S  G    E 
Sbjct  155   APNVNIFRDPRWGRGQETPGEDPVTASKYAASFVRGMQGD----------SFEGGSAAE-  203

Query  1929  EEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASC  1750
                   L  SACCKH TAYD++ W   SR++F+A+V+ QD+EDTY+PPFKSCVE+GRASC
Sbjct  204   ------LKASACCKHYTAYDMDNWGGKSRFTFDAIVSTQDLEDTYQPPFKSCVEEGRASC  257

Query  1749  LMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGI  1573
             +MC+YN+VNG+P CA+ +LL K AR  WG  GYI SDCDAVATI     YAK+PE+A G 
Sbjct  258   IMCSYNSVNGVPTCADSNLLSKTARDTWGLYGYIASDCDAVATIRGAHVYAKTPEDAVGD  317

Query  1572  ALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFES  1393
             ALKAG D++CG Y+     SA++   + E DI+RAL NLFS + RLGLFNG    + + +
Sbjct  318   ALKAGLDLDCGNYVQTYAMSAVQQGKLSEEDINRALRNLFSTRMRLGLFNGSPAYQLYSN  377

Query  1392  FGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANT-SSLGGDY  1216
               P  VC+ EH+ LALEAAR GIVLLKN    LPL +++V+SL VIGP AN+   L G+Y
Sbjct  378   IAPSQVCTQEHQDLALEAARDGIVLLKNSVNTLPLSRSQVTSLGVIGPNANSVMKLIGNY  437

Query  1215  TGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLS  1036
              G PC   + L  L  Y+  T Y SGC   ACN +    EAV +A   DYV++ +GLD  
Sbjct  438   AGPPCKYITPLQVLQSYVRDTRYLSGCDTAACNPSS-LNEAVQLASSVDYVVMFMGLDQD  496

Query  1035  QETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIG  856
             QE E  DR  L+LPG Q  L+  +A  + +P++LVL  GGP+DI+FAK + +I S+LW G
Sbjct  497   QEKEGLDRVDLVLPGMQQTLITSVARAAKRPVILVLLCGGPVDITFAKYEEKIGSILWAG  556

Query  855   YPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFYT  676
             YPGE GG A+++++FG++NP G+LP+TWYP+SFT V M DM MRADP+ GYPGRTYRFYT
Sbjct  557   YPGESGGLAIAQVIFGEHNPGGKLPVTWYPQSFTSVAMTDMRMRADPASGYPGRTYRFYT  616

Query  675   GEKVYEFGHGlsyssfsle-llSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEVSNC  499
             G+ V+EFG+GLSYS++S E    +   I +++SI      S      +   +       C
Sbjct  617   GKPVFEFGYGLSYSNYSYEFSAESENTIYMNKSISLD---SFKMSDSSSYDIKKMGSQAC  673

Query  498   NSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSI  319
               L FS  V ++N+G MDG   V+LF R P +   G P KQLIGF  VH+      +   
Sbjct  674   RKLKFSTVVGVKNHGPMDGKHPVLLFLRWP-NVLHGRPMKQLIGFQNVHLKAGERADVKF  732

Query  318   SIEPCQHLSIVNVEGSRILPLGDHI  244
              + PC+HLS  N++G+++L  G H 
Sbjct  733   VVSPCKHLSRTNIDGTKVLDQGSHF  757


 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/746 (50%), Positives = 499/746 (67%), Gaps = 44/746 (6%)
 Frame = -3

Query  2442  CDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGIATNGPGIT  2263
             C T+L +  R+  L+S LT++EKI +L D   +IPRLGIPAY+WWSESLHG++ +G GI 
Sbjct  827   CKTTLAVDKRVVDLISHLTLEEKIAQLGDIAPSIPRLGIPAYKWWSESLHGVSDSGRGIH  886

Query  2262  FDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GLTFWAPNVNVFV  2086
             F+G + SAT FPQVILTAA+FN  +W  I  A  +E RA++N+GQA GLTFW+PN+N+F 
Sbjct  887   FNGTIPSATSFPQVILTAASFNPRIWYQIGQAIGIEGRAIYNNGQAEGLTFWSPNINIFR  946

Query  2085  DPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEEEDDDRLM  1906
             DPRWGRGQETPGEDPM  S YA  YVR                L G+    E      L 
Sbjct  947   DPRWGRGQETPGEDPMTTSKYAALYVR---------------GLQGDSF--EGGSSAELK  989

Query  1905  LSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCLMCAYNAV  1726
              SACCKH TAYD++ W   +RY FNA+V+ QD+EDTY+PPFKSCVE+GRAS +MC+YN V
Sbjct  990   ASACCKHFTAYDMDNWDGITRYKFNAIVSAQDLEDTYQPPFKSCVEEGRASGIMCSYNRV  1049

Query  1725  NGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIALKAGTDI  1549
             NG+P CA+ +LL K AR  WGF GYITSDCDAV+ I + Q YAK+ E+A G  LKAG D+
Sbjct  1050  NGVPTCADDNLLSKTARGSWGFYGYITSDCDAVSIIHDAQGYAKTAEDAVGDVLKAGMDV  1109

Query  1548  NCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESFG---PKD  1378
             NCG Y+ +   SA++   + E DI+RAL NLFS++ RLGLFNG   N K+E++G   P  
Sbjct  1110  NCGGYVQKYAMSAVQQGKLSEGDINRALHNLFSIRMRLGLFNG---NPKYEAYGKIAPSQ  1166

Query  1377  VCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTSS-LGGDYTGIPC  1201
             VC+ +H+ LALEAA+ GIVLLKN    LPL +++V SL VIGP AN ++ L G+Y G PC
Sbjct  1167  VCTQKHQNLALEAAKDGIVLLKNSVDILPLSRSKVKSLGVIGPNANNATKLLGNYAGPPC  1226

Query  1200  ALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQETED  1021
                + L+ L  Y+  T Y +GC   ACNS+   +EAV +A   D+V++ +GLDL QE E+
Sbjct  1227  KHITPLEALQSYVKDTRYLAGCATAACNSSS-ISEAVQLATSVDFVVMFMGLDLEQEREE  1285

Query  1020  HDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGYPGEE  841
              DR  L+LPG Q +L+  +A  + +P++LVL  GGP+DI+FAK + +I  +LW GYPGE 
Sbjct  1286  LDRVDLVLPGMQQSLITSVARAAKRPVILVLLCGGPVDITFAKYEKKIGGILWAGYPGEA  1345

Query  840   GGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFYTGEKVY  661
             GG A+++++FG++NP G+LP+TWYP+SFT V M DM MRADP+ GYPGRTYRFYTG+ V+
Sbjct  1346  GGLAIAQVLFGEHNPGGKLPVTWYPQSFTSVAMTDMRMRADPASGYPGRTYRFYTGKPVF  1405

Query  660   EFGHGlsyssfsle-llSAPTRISLSQSIKT---KLRRSI---LNRGGNEPYVHVDEVSN  502
             EFG+GLSYS++S E    +   I +++S+     K+  S    + + G+E          
Sbjct  1406  EFGYGLSYSNYSYEFSAESENTIYMNKSVSLDAFKMSESFSYDIKKMGSEA---------  1456

Query  501   CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETS  322
             C  L F   V ++N+G MDG   V+LF R P     G P KQLIGF  VH+      +  
Sbjct  1457  CKKLKFLTVVGVKNHGPMDGKHPVLLFLRWP-DVLHGRPMKQLIGFQSVHLKAGEKADVK  1515

Query  321   ISIEPCQHLSIVNVEGSRILPLGDHI  244
               + PC+HLS  NV+G ++L  G H 
Sbjct  1516  FVVSPCKHLSRTNVDGMKVLDQGSHF  1541



>ref|XP_009354080.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Pyrus x bretschneideri]
Length=773

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/756 (48%), Positives = 485/756 (64%), Gaps = 36/756 (5%)
 Frame = -3

Query  2493  SKPQLPCQ---PPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIP  2323
             S P   C      T SS+ FCDT+L + AR+  LV  LT+ EKI  L ++  ++ RLGIP
Sbjct  34    SSPVFACNVASNATLSSFAFCDTTLGVDARVADLVKRLTLPEKIGFLVNSAGSVSRLGIP  93

Query  2322  AYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAM  2143
              YEWWSE+LHG++  GPG  F   V  AT FPQVILTAA+FN +L+++I    + EARAM
Sbjct  94    KYEWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNTSLFQAIGRVVSTEARAM  153

Query  2142  FNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             +N G AGLT+W+PN+N+F DPRWGRGQETPGEDP++ S Y   YVR              
Sbjct  154   YNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVR--------------  199

Query  1962  YSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
                       ++ D ++L ++ACCKH TAYD++ W    RY FNAVVT+QDMEDT++PPF
Sbjct  200   -----GLQQTDDGDKNKLKVAACCKHYTAYDVDNWKGVDRYHFNAVVTKQDMEDTFQPPF  254

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQ  1606
             KSCV  G  + +MC+YN VNGIP CA+ DLL    R +W   GYI +DCD++   ++ Q 
Sbjct  255   KSCVMDGNVASVMCSYNQVNGIPTCADPDLLAGVIRGEWKLNGYIVTDCDSIDVYYKNQH  314

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             Y K+PEEAA  A+ AG D+NCG+++ +  + A++  +V E+ IDRA+ N F+   RLG F
Sbjct  315   YTKTPEEAAAKAILAGLDLNCGSFLGKYTQGAVQAGLVNEAAIDRAISNNFATLMRLGFF  374

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPM  1246
             +G   N+ +   GPKDVC+SE++ LA E ARQGIVLLKN    LPL  T + SLAVIGP 
Sbjct  375   DGDPSNKPYGKLGPKDVCTSENQELARETARQGIVLLKNSPGSLPLSPTAIKSLAVIGPN  434

Query  1245  AN-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             AN T ++ G+Y G PC   ++L GL   +  TSY   C +VAC  T    +A  IA  AD
Sbjct  435   ANVTKTMIGNYEGTPCKYTTILQGLSASV-ATSYVPACANVACG-TAQVDDATKIAASAD  492

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
               I+VVG D S E E  DR  L LPG Q  LV E+A  S  P++LV+  GG  DI+FAK 
Sbjct  493   ATILVVGADQSIEAESRDRIDLYLPGQQTLLVTEVAKASKGPVILVIMSGGGFDITFAKN  552

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRADPS  712
             + +I S+LW+GYPGE GG A++++VFG YNP GRLP+TWYP+S+  KVPM +MNMR D S
Sbjct  553   NTKITSILWVGYPGEAGGAAVADVVFGHYNPCGRLPMTWYPQSYVDKVPMTNMNMRPDAS  612

Query  711   RGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNE  532
               YPGRTYRFYTGE VY FG GLSYS+F+ +L+ AP  +S+       L    +    + 
Sbjct  613   NSYPGRTYRFYTGETVYSFGDGLSYSTFNHKLVRAPKLVSI------PLEEGHVCHSSSC  666

Query  531   PYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVH  352
               + V E   C +LAF + + ++N G M GS  VMLFS  P  +   +PQK L+GF++V 
Sbjct  667   KSLDVVE-ERCENLAFDIHLGVKNAGSMSGSHTVMLFSSPPAVHK--SPQKHLLGFEKVF  723

Query  351   VSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             +S         +++ C+HLS+V+  G+R + LG+H+
Sbjct  724   LSAQREALVKFNVDVCKHLSVVDELGNRKVALGEHV  759



>ref|XP_008808663.1| PREDICTED: beta-D-xylosidase 1-like [Phoenix dactylifera]
Length=772

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/753 (48%), Positives = 483/753 (64%), Gaps = 29/753 (4%)
 Frame = -3

Query  2493  SKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             ++P   C        PFC  +LPI AR+  L+  LT+DEKI+ L +N + +PRLGI  YE
Sbjct  25    ARPAFACGGGPAVGLPFCRAALPIRARVADLIGRLTLDEKIRLLVNNAAGVPRLGIGGYE  84

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSE+LHG++  GPG+ F GA   AT FPQVI +AA+FN TLW  I  A + EARAM+N 
Sbjct  85    WWSEALHGVSNVGPGVHFGGAYPGATSFPQVISSAASFNATLWELIGKAVSDEARAMYNG  144

Query  2133  GQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSL  1954
             GQAGLTFW+PNVN+F DPRWGRGQETPGEDP V   YAV YV                  
Sbjct  145   GQAGLTFWSPNVNIFRDPRWGRGQETPGEDPGVAGRYAVSYV------------------  186

Query  1953  SGNRMP-EEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKS  1777
              G + P     D  RL L+ACCKH TAYDL+ W    RY FNA V++QD+EDT+  PFK+
Sbjct  187   RGLQQPYGGPHDHSRLKLAACCKHYTAYDLDNWRGVDRYHFNAKVSKQDLEDTFNVPFKA  246

Query  1776  CVEKGRASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQYA  1600
             CV +GR +C MC+YN VNG+P CA+ +LL    R +W   GYI SDCD+V   +  Q YA
Sbjct  247   CVMQGRVACAMCSYNQVNGVPTCADPNLLRSTIRGEWKLNGYIVSDCDSVGVFYNAQHYA  306

Query  1599  KSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNG  1420
              +PEEAA  A+KAG D++CG ++ +   SA++   V E+ I+ AL N  +VQ RLG+++G
Sbjct  307   STPEEAAADAIKAGLDLDCGPFLAQYTGSAVKQGKVSEAHINAALSNTITVQMRLGMYDG  366

Query  1419  KAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN  1240
                 + F + GP+DVCS  H+ LALEAARQGIVLLKN+   LPL  + + S+AVIGP ++
Sbjct  367   DLSKQPFGNLGPRDVCSPAHQNLALEAARQGIVLLKNDGHALPLSPSHLRSVAVIGPNSD  426

Query  1239  -TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYV  1063
              T ++ G+Y GI CA  S    +G Y+ KT++  GC +VACN       AV+ A+ +D  
Sbjct  427   ATVTMIGNYAGIACAYTSPHQAIGRYV-KTNHQMGCTNVACNGNQPIKAAVAAARNSDAT  485

Query  1062  IVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDP  883
             I+++GLD S E E  DR  LLLPG Q  LV+++A  S  P++LVL  GGP+D++FAK DP
Sbjct  486   ILIMGLDQSIEAEARDREGLLLPGRQPELVSKVARASKGPIILVLMCGGPVDVTFAKNDP  545

Query  882   RIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRADPSRG  706
             RIA++LW GYPG+ GG A+++++FG +NP G+LP+TWYP+ F  KV M +M MRAD  RG
Sbjct  546   RIAAILWAGYPGQAGGAAIADVLFGTFNPGGKLPVTWYPQEFVEKVSMANMAMRADGDRG  605

Query  705   YPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPY  526
             YPGR+YRFY G  VY +GHGLSY+ F+  L  AP +I++    +   R    N       
Sbjct  606   YPGRSYRFYNGPVVYPYGHGLSYTKFTHSLAHAPAQIAVQLDGR---RAPAYNSTEPARA  662

Query  525   VHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVS  346
             V V   + C+ L+  V V + N G  DGS  V+++S  P +    APQKQL+ F++VHV+
Sbjct  663   VRVSH-ARCDGLSIPVHVDVENVGDRDGSHTVLVYSTPPGTRW--APQKQLVAFEKVHVA  719

Query  345   GNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
               G     + ++ C  +S  +  G R +P+G+H
Sbjct  720   AGGQVRVELGVDVCGQMSFADEYGIRRIPIGEH  752



>ref|XP_004976326.1| PREDICTED: probable beta-D-xylosidase 6-like [Setaria italica]
Length=568

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/562 (59%), Positives = 418/562 (74%), Gaps = 26/562 (5%)
 Frame = -3

Query  2469  PPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHG  2290
             P + S+YPFCD SL IPAR  +LVSLLT+DEKI +LS+  + +PRLG+P Y+WWSESLHG
Sbjct  31    PYSASAYPFCDASLSIPARARALVSLLTLDEKIAQLSNTAAGVPRLGVPPYQWWSESLHG  90

Query  2289  IATNGPGITFD-GAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTF  2113
             +A NGPG+ F  G V++AT FPQVILT AAFNR+LWR++A A A EA  M  +GQAGLT+
Sbjct  91    LADNGPGVNFSSGPVRAATAFPQVILTTAAFNRSLWRAVAGAVATEALGMHGAGQAGLTY  150

Query  2112  WAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPE  1933
             WAPN+N+F DPRWGRGQET GEDP V + Y++EYV+G                       
Sbjct  151   WAPNINIFRDPRWGRGQETSGEDPAVAAAYSLEYVKG--------------------FQG  190

Query  1932  EEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRAS  1753
             E  D+ R+ LSACCKH TAYD+E W  FSRY+FNA V  QD+EDTY+PPFK+C+++ RAS
Sbjct  191   EYGDEGRIRLSACCKHYTAYDMEKWEGFSRYTFNAKVNAQDLEDTYQPPFKTCIQEARAS  250

Query  1752  CLMCAYNAVNGIPACANKDLLEKARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGI  1573
             CLMC+YN VNG+P CA KDLL+K R +WGF+GYITSDCDAVA I E Q Y  S E++  I
Sbjct  251   CLMCSYNQVNGVPICARKDLLQKTRDEWGFQGYITSDCDAVAIIHENQTYTNSDEDSVAI  310

Query  1572  ALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFES  1393
              LKAG D+NCG++++R+ KSA+E   + E DI+RAL NLFSVQ RLG+F+  + N+    
Sbjct  311   VLKAGMDLNCGSFLVRHTKSAIEKGKIQEQDINRALFNLFSVQLRLGIFDKSSGNQ----  366

Query  1392  FGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSLGGDY  1216
              GP +VC+ EHR LA EA RQG VLLKN   FLPL ++ V  +A+IGP  N   ++GGDY
Sbjct  367   LGPNNVCTKEHRELAAEAVRQGAVLLKNYNSFLPLKRSEVRHVAIIGPSVNDVYAMGGDY  426

Query  1215  TGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLS  1036
             TG+PC   + L G+  Y+ +T++A+GC DV+CNSTD F EA+  AKRAD V+VV GL+L+
Sbjct  427   TGVPCNPTTFLKGIQAYVTQTTFAAGCKDVSCNSTDLFGEAIEAAKRADIVVVVAGLNLT  486

Query  1035  QETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIG  856
             +E ED DR SLLLPG QM L++ +A V+ KPLVLVL GGGP+D+SFAK DPRIAS+LW+G
Sbjct  487   EEREDFDRVSLLLPGKQMDLIHAVASVTKKPLVLVLLGGGPVDVSFAKHDPRIASILWLG  546

Query  855   YPGEEGGKALSEIVFGDYNPAG  790
             YPGE GG+ L EI+FG+YNP G
Sbjct  547   YPGEVGGQVLPEILFGEYNPGG  568



>ref|XP_010937054.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Elaeis guineensis]
Length=772

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/749 (48%), Positives = 489/749 (65%), Gaps = 43/749 (6%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P+ +++ FC+TS    AR+  LV  LT+DEK+  L +  +A+ RLGIP+YEWWSE+LHG+
Sbjct  45    PSLANFGFCNTSWGTAARVDDLVERLTLDEKVGFLVNKATAVSRLGIPSYEWWSEALHGV  104

Query  2286  ATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWA  2107
             +  GPG  F   V  AT FPQVILTAA+FN TL+ +I    + EARAM N G AGLTFW+
Sbjct  105   SYVGPGTHFSSLVPGATSFPQVILTAASFNTTLFETIGKVVSTEARAMHNVGLAGLTFWS  164

Query  2106  PNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEE  1927
             PNVN+F DPRWGRGQETPGEDP++ S YA  YV                     +  ++ 
Sbjct  165   PNVNIFRDPRWGRGQETPGEDPLLASKYAAGYV---------------------KGLQKA  203

Query  1926  EDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCL  1747
              + DRL ++ACCKH TAYDL+ W    RY+F+AVVT+QD++DT++PPFKSCV  G  + +
Sbjct  204   SNPDRLKVAACCKHYTAYDLDNWKGIQRYTFDAVVTKQDLDDTFQPPFKSCVTDGNVASV  263

Query  1746  MCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIA  1570
             MC+YN VNG+P CA+ DLL    R DW   GYI SDCD+V  ++  Q Y K+PE+AA + 
Sbjct  264   MCSYNQVNGVPTCADADLLAGTIRGDWKLNGYIVSDCDSVDVLYNSQHYTKTPEDAAAVT  323

Query  1569  LKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESF  1390
             + AG D+NCG+++ ++ ++A++   + ESD+D+A+ N F V  RLG F+G    +++ S 
Sbjct  324   ILAGLDLNCGSFLGQHTQAAVKAGKLKESDVDKAITNNFVVLMRLGFFDGDPRKQEYGSL  383

Query  1389  GPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSLGGDYT  1213
             GPKDVC++ ++ LA EAARQGIVLLKN+   LPLD   ++ +AVIGP AN T ++ G+Y 
Sbjct  384   GPKDVCTAANQELAREAARQGIVLLKNDDDALPLDPKSITCMAVIGPNANVTKTMIGNYE  443

Query  1212  GIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTD-GFAEAVSIAKRADYVIVVVGLDLS  1036
             G PC   + L GL   +  T Y  GC +V C         A + A +AD  I+VVG D S
Sbjct  444   GTPCTYTTPLQGLTAVV-STVYQPGCTNVGCTGNSLQLDAAKAAAAKADVTILVVGTDQS  502

Query  1035  QETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIG  856
              E E  DR +LLLPG Q  LV E+A  +   ++LV+  GGP DISFAK D RI+S+LW+G
Sbjct  503   IEREGLDRVNLLLPGQQPTLVTEIAKAAKGKVILVIMSGGPFDISFAKSDDRISSILWVG  562

Query  855   YPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRADPSRGYPGRTYRFY  679
             YPGE GG AL++I+FG YNP+GRLP+TWYPESF  KVPM DM MR DPS GYPGRTYRFY
Sbjct  563   YPGEAGGAALADIIFGYYNPSGRLPVTWYPESFADKVPMTDMRMRPDPSTGYPGRTYRFY  622

Query  678   TGEKVYEFGHGlsyssfslellSAPTRISL----SQSIKTKLRRSILNRGGNEPYVHVDE  511
             TG+ VY FG GLSY+ ++  L+ AP  +S+      S  +K  +SI   G          
Sbjct  623   TGDVVYSFGDGLSYNDYAHHLVRAPKLVSIPLEEGHSCYSKRCKSIDVVG----------  672

Query  510   VSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVT  331
              S C ++AF + + ++N G M GS  V LFS  P+ +   +PQKQL+GF++V++   GV 
Sbjct  673   -SGCENVAFDIHLRVQNTGRMAGSHTVFLFSTPPSVH--NSPQKQLLGFEKVYLGPQGVG  729

Query  330   ETSISIEPCQHLSIVNVEGSRILPLGDHI  244
                  ++ C+ LS+V+  G+R + LG HI
Sbjct  730   NVVFKVDVCKDLSLVDELGNRKVALGSHI  758



>ref|XP_003615008.1| Xylan 1 4-beta-xylosidase [Medicago truncatula]
Length=798

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/763 (49%), Positives = 482/763 (63%), Gaps = 43/763 (6%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P   S PFC+ +L I  R   +VS LT+DEKI +L +   +IPRLGIP+Y+WW E+LHG+
Sbjct  43    PLTKSLPFCNLNLTITQRAKDIVSRLTLDEKISQLVNTAPSIPRLGIPSYQWWDEALHGV  102

Query  2286  ATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GLTFW  2110
             A  G GI  +G+V  AT FPQVILTAA+F+  LW  I+     EAR ++N+GQA G+TFW
Sbjct  103   ANAGKGIRLNGSVAGATSFPQVILTAASFDSKLWYQISKVIGTEARGVYNAGQAQGMTFW  162

Query  2109  APNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEE  1930
             APN+N+F DPRWGRGQET GEDP+V S Y V YVR                L G+     
Sbjct  163   APNINIFRDPRWGRGQETAGEDPLVNSKYGVSYVR---------------GLQGDSFEGG  207

Query  1929  EEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNA----------------VVTRQDMEDT  1798
             +   DRL  SACCKH TAYDL+ W    R+ F+A                 VT QD+ DT
Sbjct  208   KLIGDRLKASACCKHFTAYDLDNWKGLDRFDFDAKVSFLFSMAYSPWMINYVTLQDLADT  267

Query  1797  YEPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATI  1621
             Y+PPF SC+ +GR+S +MCAYN VNG+P CA+ +LL K AR  W F GYITSDC+AV  I
Sbjct  268   YQPPFHSCIVQGRSSGIMCAYNRVNGVPNCADYNLLTKTARQKWNFNGYITSDCEAVRII  327

Query  1620  FEYQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQF  1441
             ++ Q YAK+PE+A    L+AG D+ CG Y+ ++ K+A+  K V  S IDRAL NLF+++ 
Sbjct  328   YDNQGYAKTPEDAVADVLQAGMDVECGDYLTKHAKAAVLQKKVPISQIDRALHNLFTIRI  387

Query  1440  RLGLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLA  1261
             RLGLF+G     ++   GP  VCS E+  LALEAAR GIVLLKN    LPL   RV++L 
Sbjct  388   RLGLFDGNPTKLQYGRIGPNQVCSKENLDLALEAARSGIVLLKNTASILPL--PRVNTLG  445

Query  1260  VIGPMANTSS--LGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVS  1087
             VIGP AN SS  + G+Y G PC L  +L G   Y  +T Y SGCLD    ++     AV 
Sbjct  446   VIGPNANKSSKVVLGNYFGRPCRLVPILKGFYTYASQTHYRSGCLDGTKCASAEIDRAVE  505

Query  1086  IAKRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLD  907
             +AK +DYVI+V+GLD SQE E  DR  L LPG Q  L+N +A  S KP++LVL  GGP+D
Sbjct  506   VAKISDYVILVMGLDQSQERESRDRDDLELPGKQQELINSVAKASKKPVILVLLCGGPVD  565

Query  906   ISFAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNM  727
             I+FAK + +I  ++W GYPGE GG+AL+++VFGDYNP GRLP+TWYP+ F K+PM DM M
Sbjct  566   ITFAKNNDKIGGIIWAGYPGELGGRALAQVVFGDYNPGGRLPMTWYPKDFIKIPMTDMRM  625

Query  726   RADPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILN  547
             RADPS GYPGRTYRFYTG KVYEFG+GLSYS++S   +S       +  I      SIL 
Sbjct  626   RADPSSGYPGRTYRFYTGPKVYEFGYGLSYSNYSYNFISVKNN---NLHINQSTTHSILE  682

Query  546   RGGNEPYVHVDEV--SNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQL  373
                   Y  V E+    C +++ SV + + N G M G   V+LF + P     G P KQL
Sbjct  683   NSETIYYKLVSELGEETCKTMSISVTLGITNTGSMAGKHPVLLFVK-PKKGRNGNPVKQL  741

Query  372   IGFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             +GF+ V V G G  E    +  C+HLS  N  G +++  G H+
Sbjct  742   VGFESVTVEGGGKGEVGFEVSVCEHLSRANESGVKVIEEGGHL  784



>ref|XP_002977427.1| hypothetical protein SELMODRAFT_106899 [Selaginella moellendorffii]
 gb|EFJ21431.1| hypothetical protein SELMODRAFT_106899 [Selaginella moellendorffii]
Length=772

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/747 (47%), Positives = 492/747 (66%), Gaps = 20/747 (3%)
 Frame = -3

Query  2475  CQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESL  2296
             C     SS+PFCD SLP+P R+  LV  + + EKI ++  N S IPRLGIP Y+WW E+L
Sbjct  25    CTDSRSSSFPFCDVSLPVPDRVADLVGRMNLSEKIAQIVSNASGIPRLGIPGYQWWEEAL  84

Query  2295  HGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLT  2116
             HG+A + PG+ F   V SAT FPQVILT A+FN +LW  IA A ++EA AM+N+G++GLT
Sbjct  85    HGVAES-PGVKFAAPVPSATSFPQVILTVASFNSSLWNKIAQAISIEAIAMYNAGRSGLT  143

Query  2115  FWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMP  1936
             FW+PN+N+F DPRWGRGQETPGEDP++ S YA  +VRGLQ               G  + 
Sbjct  144   FWSPNINIFRDPRWGRGQETPGEDPLLSSKYAAYFVRGLQEGDYD---------EGTAIS  194

Query  1935  EEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRA  1756
               +    RL +S+CCKH TAYD+E       + FNA VT QD++DT++PPF+SC+  G+A
Sbjct  195   TMQGSPTRLKVSSCCKHFTAYDMEKSEGTDCFHFNAQVTVQDLQDTFDPPFRSCIVDGQA  254

Query  1755  SCLMCAYNAVNGIPACANKDLL-EKARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAA  1579
             S LMC+YN VNG+P+CA+   L E  R  WGFEGYI SDCDAVA ++EY  Y  + E+A 
Sbjct  255   SGLMCSYNRVNGVPSCADYTFLTETVRNSWGFEGYIVSDCDAVALLYEYINYTTTAEDAV  314

Query  1578  GIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKF  1399
                L AG D+NCGT++LR+  +A+E   V E+ +DRAL N+ +V+ RLGLF+G +    +
Sbjct  315   ADVLSAGMDLNCGTFLLRHTAAAIEQGKVTEAAVDRALSNVMTVRMRLGLFDGNS-GETY  373

Query  1398  ESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSLGG  1222
              S GP  VC+ EHR+L+LEAA QGIVLLKN    LP  +  + ++AVIGP  N T ++ G
Sbjct  374   NSIGPDAVCTPEHRQLSLEAAEQGIVLLKNSGNVLPFPRNDLMTIAVIGPSGNATETMLG  433

Query  1221  DYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLD  1042
             +Y G+PC   +   GL EY     +  GC D+ CN T  F  AV  A+ +D V++VVGLD
Sbjct  434   NYAGVPCQYITPFQGLQEYTKCVVFEPGCKDIMCNDTTLFLAAVRAAENSDAVVIVVGLD  493

Query  1041  LSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLW  862
               QE E  DR SLLLPG+Q  LV E++ V+  P++LV+  GGP+D++FAK++ +I++VLW
Sbjct  494   KDQEREGLDRTSLLLPGNQQGLVLEVSKVAKGPVILVVMSGGPIDVTFAKENCKISNVLW  553

Query  861   IGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTK-VPMNDMNMRADPSRGYPGRTYR  685
             +GYPGE GGKA++ ++FGD+NPAGRLP+TWYP++F + V + +M++R + S G+PGRTYR
Sbjct  554   VGYPGEAGGKAIARVIFGDHNPAGRLPMTWYPQAFAEHVSILNMHLRPNTSTGFPGRTYR  613

Query  684   FYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEVS  505
             FYTGE VYEFGHGLSY++F+     AP+ I+   ++   +R  +   G  +  +   + +
Sbjct  614   FYTGENVYEFGHGLSYTNFTYTNFCAPSNITARNTV--AIRTPLREDGARQFPI---DYT  668

Query  504   NCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAG-GAPQKQLIGFDRVHVSGNGVTE  328
              C +LAF V   + N G  D   + +L++  P + +    P+KQLI F R H+      +
Sbjct  669   GCEALAFKVVAYISNTGTRDSDHISLLYAIPPAASSSLSPPRKQLISFKRQHLIAGRCAK  728

Query  327   TSISIEPCQHLSIVNVEGSRILPLGDH  247
                 ++ C+ L + N  G+++L  GD+
Sbjct  729   VEFDVDTCKDLGLTNEAGTKVLVHGDY  755



>ref|XP_009347830.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Pyrus x bretschneideri]
Length=773

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/756 (48%), Positives = 485/756 (64%), Gaps = 36/756 (5%)
 Frame = -3

Query  2493  SKPQLPCQ---PPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIP  2323
             S P   C      T SS+ FCDT+L + AR+  LV  LT+ EKI  L ++  ++ RLGIP
Sbjct  34    SSPVFACNVASNATLSSFAFCDTTLGVDARVADLVKRLTLPEKIGFLVNSAGSVSRLGIP  93

Query  2322  AYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAM  2143
              YEWWSE+LHG++  GPG  F   V  AT FPQVILTAA+FN +L+ +I    + EARAM
Sbjct  94    KYEWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNTSLFEAIGRVVSTEARAM  153

Query  2142  FNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             +N G AGLT+W+PN+N+F DPRWGRGQETPGEDP++ S Y   YVR              
Sbjct  154   YNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVR--------------  199

Query  1962  YSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
                       ++ D ++L ++ACCKH TAYD++ W    RY FNAVVT+QDM+DT++PPF
Sbjct  200   -----GLQQTDDGDKNKLKVAACCKHYTAYDVDNWKGVDRYHFNAVVTKQDMDDTFQPPF  254

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQ  1606
             KSCV  G  + +MC+YN VNGIP CA+ DLL    R +W   GYI +DCD++   ++ Q 
Sbjct  255   KSCVMDGNVASVMCSYNQVNGIPTCADPDLLAGVIRGEWKLNGYIVTDCDSIDVYYKNQH  314

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             Y K+PEEAA  A+ AG D+NCG+++ +  + A++  +V E+ IDRA+ N F+   RLG F
Sbjct  315   YTKTPEEAAAKAILAGLDLNCGSFLGKYTQGAVQAGLVNEAAIDRAISNNFATLMRLGFF  374

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPM  1246
             +G   N+ +   GPKDVC+SE++ LA E ARQGIVLLKN    LPL  T + SLAVIGP 
Sbjct  375   DGDPSNKPYGKLGPKDVCTSENQELARETARQGIVLLKNSPGSLPLSPTAIKSLAVIGPN  434

Query  1245  AN-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             AN T ++ G+Y G PC   ++L GL   +  TSY   C +VAC  T    +A  IA  AD
Sbjct  435   ANVTKTMIGNYEGTPCKYTTILQGLSASV-ATSYVPACANVACG-TAQVDDATKIAASAD  492

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
               I++VG D S E E  DR  L LPG Q  LV E+A  S  P++LV+  GG  DI+FAK 
Sbjct  493   ATILIVGADQSIEAESRDRIDLYLPGQQTLLVTEVAKASKGPVILVIMSGGGFDITFAKI  552

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRADPS  712
             + +I S+LW+GYPGE GG A++++VFG YNP GRLP+TWYP+S+  KVPM +MNMR D S
Sbjct  553   NTKITSILWVGYPGEAGGAAVADVVFGHYNPCGRLPMTWYPQSYVDKVPMTNMNMRPDAS  612

Query  711   RGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNE  532
              GYPGRTYRFYTGE VY FG GLSYS+F+ +L+ AP  +S+       L    +    + 
Sbjct  613   NGYPGRTYRFYTGETVYSFGDGLSYSTFNHKLVQAPKLVSI------PLEEGHVCHSSSC  666

Query  531   PYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVH  352
               + V E   C +LAF + + ++N G M GS  VMLFS  P  +   +PQK L+GF++V 
Sbjct  667   KSLDVVE-ERCENLAFDIHLGVKNAGSMSGSHTVMLFSSPPAVHK--SPQKHLLGFEKVF  723

Query  351   VSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             +S         +++ C+HLS+V+  G+R + LG+H+
Sbjct  724   LSAQREALVKFNVDVCKHLSVVDELGNRKVALGEHV  759



>ref|XP_002515300.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF47284.1| Beta-glucosidase, putative [Ricinus communis]
Length=768

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/749 (46%), Positives = 483/749 (64%), Gaps = 49/749 (7%)
 Frame = -3

Query  2463  THSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGIA  2284
             T  + PFC   LPI  R+  L+  LT+ EK+  L +N  A+ RLGI  YEWWSE+LHG++
Sbjct  36    TTKNLPFCQVKLPIQDRVKDLIGRLTLAEKVGLLVNNAGAVSRLGIKGYEWWSEALHGVS  95

Query  2283  TNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWAP  2104
               GPG  F G+   AT FPQVI TAA+FN TLW +I    + EARAM+N G AGLT+W+P
Sbjct  96    NVGPGTKFGGSFPGATSFPQVITTAASFNSTLWEAIGRVVSDEARAMYNGGAAGLTYWSP  155

Query  2103  NVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEEE  1924
             NVN+  DPRWGRGQETPGEDP++V  YA  YV+                L GN       
Sbjct  156   NVNILRDPRWGRGQETPGEDPLLVGKYAASYVK---------------GLQGN-------  193

Query  1923  DDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCLM  1744
             D +RL ++ACCKH TAYDL+ W+   R+ FNA V++QDM+DT++ PF+ CV++G+ + +M
Sbjct  194   DGERLKVAACCKHFTAYDLDNWNGVDRFHFNAKVSKQDMKDTFDVPFRMCVKEGKVASVM  253

Query  1743  CAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIAL  1567
             C+YN VNGIP CA+ +LL K  RT WG  GYI SDCD+V   ++ Q Y  +PEEAA  A+
Sbjct  254   CSYNQVNGIPTCADPNLLRKTVRTQWGLNGYIVSDCDSVGVFYDKQHYTSTPEEAAADAI  313

Query  1566  KAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESFG  1387
             KAG D++CG ++  + + A++  ++ E+D++ AL N  +VQ RLG+F+G+   + + + G
Sbjct  314   KAGLDLDCGPFLAVHTQDAVKRGLISEADVNGALFNTLTVQMRLGMFDGEPSAQPYGNLG  373

Query  1386  PKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSLGGDYTG  1210
             PKDVC+  H+ LALEA RQGIVLLKN    LPL   R  ++A+IGP +N T ++ G+Y G
Sbjct  374   PKDVCTPAHQELALEAGRQGIVLLKNHGPSLPLSPRRHRTVAIIGPNSNVTVTMIGNYAG  433

Query  1209  IPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQE  1030
             + C   + L G+G Y  KT +  GC DV C +   F+ A+  A++AD  ++V+GLD S E
Sbjct  434   VACQYTTPLQGIGSYA-KTIHQQGCADVGCVTDQLFSGAIDAARQADATVLVMGLDQSIE  492

Query  1029  TEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGYP  850
              E  DR  LLLPG Q  LV+++A  S  P +LVL  GGP+D+SFAKKDP+IA++LW GYP
Sbjct  493   AEFRDRTGLLLPGRQQELVSKVAMASKGPTILVLMSGGPIDVSFAKKDPKIAAILWAGYP  552

Query  849   GEEGGKALSEIVFGDYNPAGRLPLTWYPESF-TKVPMNDMNMRADPSRGYPGRTYRFYTG  673
             G+ GG A+++++FG  NP G+LP+TWYP+ + T +PM +M MR+  S+GYPGRTYRFY G
Sbjct  553   GQAGGAAIADVLFGTINPGGKLPMTWYPQEYITNLPMTEMAMRSSQSKGYPGRTYRFYQG  612

Query  672   EKVYEFGHGlsyssfslellSAPTRISL-------SQSIKTKLRRSILNRGGNEPYVHVD  514
             + VY FGHG+SY+ F   + SAPT +S+       + SI  K  R    +          
Sbjct  613   KVVYPFGHGMSYTHFVHNIASAPTMVSVPLDGHRGNTSISGKAIRVTHTK----------  662

Query  513   EVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGV  334
                 CN L+  ++V ++N G  DG+  ++++S  P      +P KQL+ F+RVHVS    
Sbjct  663   ----CNKLSLGIQVDVKNVGSKDGTHTLLVYSAPPAGRW--SPHKQLVAFERVHVSAGTQ  716

Query  333   TETSISIEPCQHLSIVNVEGSRILPLGDH  247
                 ISI  C+ LS+V+  G R +P+G+H
Sbjct  717   ERVGISIHVCKLLSVVDRSGIRRIPIGEH  745



>ref|XP_002270249.1| PREDICTED: probable beta-D-xylosidase 2 isoform X1 [Vitis vinifera]
 emb|CBI36935.3| unnamed protein product [Vitis vinifera]
Length=768

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/748 (47%), Positives = 484/748 (65%), Gaps = 38/748 (5%)
 Frame = -3

Query  2475  CQPP--THSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSE  2302
             C P    ++ +PFC  S+ I  R+  L+  LT++EK++ L +N + +PRLGI  YEWWSE
Sbjct  31    CDPKDGANAGFPFCRKSIGIGERVKDLIGRLTLEEKVRLLVNNAAGVPRLGIKGYEWWSE  90

Query  2301  SLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAG  2122
             +LHG++  GPG  F G    AT FPQVI TAA+FN +LW +I    + EARAM+N G AG
Sbjct  91    ALHGVSNVGPGTKFSGDFPGATSFPQVITTAASFNSSLWEAIGQVVSDEARAMYNGGAAG  150

Query  2121  LTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNR  1942
             LTFW+PNVN+F DPRWGRGQETPGEDP++   YA  YVR                L GN 
Sbjct  151   LTFWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAARYVR---------------GLQGNA  195

Query  1941  MPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKG  1762
                     DRL ++ACCKH TAYDL+ W+   R+ F+A V++Q+MEDT++ PF+SCV +G
Sbjct  196   -------GDRLKVAACCKHFTAYDLDNWNGVDRFHFDARVSKQEMEDTFDVPFRSCVVEG  248

Query  1761  RASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEE  1585
             + + +MC+YN VNG+P CA+ +LL    R  W   GY+ SDCD+V   ++ Q Y  +PEE
Sbjct  249   KVASVMCSYNQVNGVPTCADPNLLRNTVRKQWHLNGYVVSDCDSVGVFYDNQHYTNTPEE  308

Query  1584  AAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNR  1405
             AA  A+KAG D++CG ++  + + A++  +V E+D+D AL+N  +VQ RLG+F+G+   +
Sbjct  309   AAADAIKAGLDLDCGPFLAVHTQDAIKKGLVSEADVDSALVNTVTVQMRLGMFDGEPSAQ  368

Query  1404  KFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTS-SL  1228
              F   GPKDVCS  H+ LA+EAARQGIVLLKN    LPL      S+AVIGP ++ + ++
Sbjct  369   PFGDLGPKDVCSPAHQELAIEAARQGIVLLKNHGHSLPLSTRSHRSIAVIGPNSDANVTM  428

Query  1227  GGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVG  1048
              G+Y GIPC   + L G+G Y  +T +  GC DVAC+    FA A+  A +AD  ++V+G
Sbjct  429   IGNYAGIPCEYTTPLQGIGRY-SRTIHQKGCADVACSEDQLFAGAIDAASQADATVLVMG  487

Query  1047  LDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASV  868
             LD S E E  DR  LLLPG Q  LV+++A  S  P VLVL  GGP+D+SFAKKDPRIA++
Sbjct  488   LDQSIEAEAKDRADLLLPGRQQELVSKVAMASRGPTVLVLMSGGPVDVSFAKKDPRIAAI  547

Query  867   LWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESF-TKVPMNDMNMRADPSRGYPGRT  691
             +W GYPG+ GG A+++I+FG  NP G+LP+TWYP+ + +KVPM  M MRA PS+ YPGRT
Sbjct  548   VWAGYPGQAGGAAIADILFGVANPGGKLPMTWYPQEYLSKVPMTTMAMRAIPSKAYPGRT  607

Query  690   YRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDE  511
             YRFY G  VY FGHGLSY++F   +  APT +    +I      +    G      H   
Sbjct  608   YRFYKGPVVYRFGHGLSYTNFVHTIAQAPTAV----AIPLHGHHNTTVSGKAIRVTH---  660

Query  510   VSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVT  331
              + CN L+ ++ + ++N G  DGS  +++FS+ P  +   AP KQL+ F++VHV+     
Sbjct  661   -AKCNRLSIALHLDVKNVGNKDGSHTLLVFSKPPAGH--WAPHKQLVAFEKVHVAARTQQ  717

Query  330   ETSISIEPCQHLSIVNVEGSRILPLGDH  247
                I+I  C++LS+V+  G R +P+G H
Sbjct  718   RVQINIHVCKYLSVVDRSGIRRIPMGQH  745



>ref|XP_009383731.1| PREDICTED: probable beta-D-xylosidase 2 [Musa acuminata subsp. 
malaccensis]
Length=781

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/741 (47%), Positives = 478/741 (65%), Gaps = 29/741 (4%)
 Frame = -3

Query  2457  SSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGIATN  2278
             +  PFC    PI AR   LV  LTV EK+  L +  + +PRLGIP Y+WWSE+LHG++ +
Sbjct  46    AGLPFCQRGQPIRARARDLVGRLTVAEKVALLVNTAAGVPRLGIPGYQWWSEALHGVSNS  105

Query  2277  GPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWAPNV  2098
             GPG+ F GA   AT FPQVI +AA+FN TLW  +    + EARAM+N GQAGLTFW+PNV
Sbjct  106   GPGVRFGGAFPGATSFPQVISSAASFNATLWELMGQVVSDEARAMYNGGQAGLTFWSPNV  165

Query  2097  NVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEEEDD  1918
             N++ DPRWGRGQETPGEDP V + YA  YV                   G +        
Sbjct  166   NIYRDPRWGRGQETPGEDPAVSARYAAAYV------------------RGLQQANGGTSH  207

Query  1917  DRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCLMCA  1738
              RL ++ACCKH TAYDL+ W    R+ FNA V++QD+EDTY+ PFK+CV +G+ + +MC+
Sbjct  208   ARLKVAACCKHYTAYDLDNWKGVDRFHFNAKVSKQDLEDTYDVPFKACVVEGKVASVMCS  267

Query  1737  YNAVNGIPACANKDLL-EKARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIALKA  1561
             YN VNG+P+CA+ +LL    R  W   GYI SDCD+V   +  Q Y  +PE+A   ALKA
Sbjct  268   YNQVNGVPSCADSNLLRHTVRGQWRLNGYIVSDCDSVGVFYSAQHYTSTPEDAVAYALKA  327

Query  1560  GTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESFGPK  1381
             G D++CG ++ ++ +SAL+   V E+D+D AL +  +VQ RLG+F+G+   + F + GP+
Sbjct  328   GLDLDCGQFLAQHTESALKQGKVSEADVDAALTHTVAVQMRLGMFDGEPSQQPFGNLGPQ  387

Query  1380  DVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSLGGDYTGIP  1204
              VC+  HR LALEAARQ +VLLKN+   LPL  +R+ ++AV+GP ++ T ++ G+Y G+P
Sbjct  388   HVCTQAHRNLALEAARQAMVLLKNDAGTLPLSPSRLRTVAVVGPNSDATVTMIGNYAGVP  447

Query  1203  CALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQETE  1024
             CA  S L G+G Y+  T +  GC +VAC+       AV  A+RAD  IVVVGLD S E+E
Sbjct  448   CAYTSPLKGIGGYV-DTVHQVGCNNVACSGEQPIGAAVEAARRADAAIVVVGLDQSIESE  506

Query  1023  DHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGYPGE  844
               DR  LLLPG Q  LV+E+A     P VLVL  GGP+D+SFAK DP IA++LW GYPG+
Sbjct  507   GRDRVGLLLPGRQQELVSEVAKACRGPTVLVLMCGGPVDVSFAKDDPNIAAILWAGYPGQ  566

Query  843   EGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRADPSRGYPGRTYRFYTGEK  667
              GG A++E++FG +NP G+LP+TWYP+ +  KV M +M MRADPS GYPGRTYRFY G  
Sbjct  567   AGGTAIAEVIFGAHNPGGKLPVTWYPQEYVEKVTMTNMAMRADPSTGYPGRTYRFYDGPV  626

Query  666   VYEFGHGlsyssfslellSAPTRISLS-QSIKTKLRRSILNRGGNEPYVHVDEVSNCNSL  490
             VY FGHGLSY+ F+  L   P ++S+    ++ +   +    G   P  H    + C+ L
Sbjct  627   VYSFGHGLSYTKFTHALADTPAQVSVPFDGLRAEPLFNASEPGRTVPVTH----ARCDGL  682

Query  489   AFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSISIE  310
             +  V V + N G  DGS  V+++ R P   A GAP KQL+ F++VH++        + ++
Sbjct  683   SVPVHVDVTNAGDRDGSHTVLVYWRPPA--ADGAPSKQLVAFEKVHLAAGEQVRVLLGVD  740

Query  309   PCQHLSIVNVEGSRILPLGDH  247
              C+ L++ + +G R +PLG+H
Sbjct  741   VCRDLTVADGDGIRRIPLGEH  761



>gb|KHG05051.1| putative beta-D-xylosidase 2 -like protein [Gossypium arboreum]
Length=776

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/740 (47%), Positives = 485/740 (66%), Gaps = 33/740 (4%)
 Frame = -3

Query  2457  SSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGIATN  2278
             SS PFC  S+PIP R+  L+  LT+ EK++ L +N +A+PRLGI  YEWWSE+LHG++  
Sbjct  44    SSLPFCKVSMPIPNRVTDLLGRLTMQEKVRLLVNNAAAVPRLGIKGYEWWSEALHGVSNV  103

Query  2277  GPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWAPNV  2098
             GPG  F GA   AT FPQVI TAA+FN TLW +I    + EARAM+N G AGLT+W+PNV
Sbjct  104   GPGTKFGGAFPGATSFPQVISTAASFNATLWEAIGRVVSDEARAMYNGGAAGLTYWSPNV  163

Query  2097  NVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEEEDD  1918
             N+F DPRWGRGQETPGEDP++   YA  YV+                L GN       + 
Sbjct  164   NIFRDPRWGRGQETPGEDPVLAGTYAASYVK---------------GLQGN-------NG  201

Query  1917  DRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCLMCA  1738
             DRL ++ACCKH TAYDL+ W+   R+ FNA V++QD+EDT++ PFK CV+ G  + +MC+
Sbjct  202   DRLKVAACCKHFTAYDLDNWNGVDRFHFNAKVSKQDIEDTFDVPFKMCVQDGNVASVMCS  261

Query  1737  YNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIALKA  1561
             YN VNG+P CA+ +LL++  R  W   GYI SDCD+V   +  Q Y  +PEEAA  A+KA
Sbjct  262   YNQVNGVPTCADPNLLKRTIRGQWNLNGYIVSDCDSVGVFYNTQHYTSTPEEAAADAIKA  321

Query  1560  GTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESFGPK  1381
             G D++CG ++ +  ++A+   ++ E+D++ AL N  +VQ RLG+F+G+   + F + GPK
Sbjct  322   GLDLDCGPFLAQYTENAVTRGLLKEADVNSALANTLTVQMRLGMFDGEPSAQPFGNLGPK  381

Query  1380  DVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSLGGDYTGIP  1204
             DVC+  H+ LALEAARQGIVLL N    LPL   R  ++AVIGP +N T ++ G+Y G+ 
Sbjct  382   DVCTPAHQELALEAARQGIVLLNNRGPSLPLSHLRHRTVAVIGPNSNATVTMIGNYAGVA  441

Query  1203  CALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQETE  1024
             CA  S L G+G Y  KT +  GC DVACN    F+ A++ A++A+  ++V+GLD S E E
Sbjct  442   CAYTSPLQGIGNYA-KTIHQMGCADVACNDDKLFSGAINAARQAEATVLVMGLDQSIEAE  500

Query  1023  DHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGYPGE  844
               DR  LLLPG Q  LV+++A  S  P +LVL  GGP+D+SFAK DPRI+++LW GYPG+
Sbjct  501   FRDRTGLLLPGRQQELVSKVAMASKGPTILVLMSGGPIDVSFAKNDPRISAILWAGYPGQ  560

Query  843   EGGKALSEIVFGDYNPAGRLPLTWYPESF-TKVPMNDMNMRADPSRGYPGRTYRFYTGEK  667
              GG A++++++G  NP G+LP+TWYP+ + + +PM DM MR+ P+R YPGRTY+FY G  
Sbjct  561   AGGAAIADVLYGTTNPEGKLPMTWYPQEYVSNLPMTDMAMRSSPNRNYPGRTYKFYKGPV  620

Query  666   VYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEVSNCNSLA  487
             VY FGHGLSY++F   + SAP  +    ++     R   N   +   + V+ V  CN L+
Sbjct  621   VYPFGHGLSYTNFVHTIASAPKVV----TVPLDGHRHSGNATISGKAIKVNHV-RCNKLS  675

Query  486   FSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSISIEP  307
               ++V ++N G  +G+  +++FS+ P  +   APQKQL+ F +VHV         I+I  
Sbjct  676   VGLQVDVKNTGSKEGTHTMLVFSKPPAGHW--APQKQLVAFAKVHVPARSQRRVGINIHV  733

Query  306   CQHLSIVNVEGSRILPLGDH  247
             C+ LS+V+  G R +P G H
Sbjct  734   CKFLSVVDRSGVRRIPTGVH  753



>ref|XP_008371868.1| PREDICTED: probable beta-D-xylosidase 7 [Malus domestica]
Length=784

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/742 (51%), Positives = 480/742 (65%), Gaps = 27/742 (4%)
 Frame = -3

Query  2445  FCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGIATNGPGI  2266
             FC T+LPI  R+  LVS LT+DEKI +L ++   IPRLGIP+YEWWSE+LHG+A  G GI
Sbjct  48    FCKTTLPIYKRVRDLVSRLTLDEKISQLVNSAPPIPRLGIPSYEWWSEALHGVADVGKGI  107

Query  2265  TFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GLTFWAPNVNVF  2089
                  + +AT FPQVILTAA+FN  LW  I      EARA++N+GQA G+TFWAPN+N+F
Sbjct  108   KLYPTINNATSFPQVILTAASFNDHLWYRIGQVIGTEARAVYNAGQATGMTFWAPNINIF  167

Query  2088  VDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEEEDDDRL  1909
              DPRWGRGQETPGEDP V   YAV YVRG+QG    G    K+ L             RL
Sbjct  168   RDPRWGRGQETPGEDPTVAGRYAVSYVRGVQGDSFFGG---KHKLGAG---------GRL  215

Query  1908  MLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCLMCAYNA  1729
               SACCKH TAYDL+ W+N +R+ F+A VT+QD+ DTY PPF+ CV++G+AS +MCAYN 
Sbjct  216   QASACCKHFTAYDLDSWNNVTRFRFDARVTQQDLADTYHPPFQKCVQEGQASGIMCAYNR  275

Query  1728  VNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIALKAGTD  1552
             VNG+P+CA+ +LL K AR  W F GYITSDCDAV+ I + Q YAK PE+A    LKAG D
Sbjct  276   VNGVPSCADYNLLTKVARGQWDFHGYITSDCDAVSIIHDMQGYAKKPEDAVAXVLKAGMD  335

Query  1551  INCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESFGPKDVC  1372
             +NCG+Y+  ++KSA+E K +  S IDRAL NLFSV+ RLGLF+G  + + + + GP  VC
Sbjct  336   VNCGSYLKDHIKSAVEQKKLNVSKIDRALHNLFSVRMRLGLFDGNPLKQPYGTIGPDQVC  395

Query  1371  SSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTSS-LGGDYTGIPCAL  1195
             S  H+ LALEAA+ GIVLLKN  + LPL K +  SLAVIGP+AN S  L G+Y G PC  
Sbjct  396   SKLHQALALEAAQDGIVLLKNSGRLLPLPKAKAISLAVIGPLANASXXLLGNYHGXPCKS  455

Query  1194  KSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQETEDHD  1015
              + L  L +Y        GC  V C     F EAV  AK ADY++++VGLD SQE E HD
Sbjct  456   VTPLXALQDYAKBMISNPGCDSVQCPQAS-FDEAVGXAKEADYLVLIVGLDQSQEREGHD  514

Query  1014  RYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGYPGEEGG  835
             R  L  PG Q  L+  +A V+ KP+VLV+  GGP DISFAK D ++ S+LW GYPGE GG
Sbjct  515   RLHLEXPGKQQQLITSVAKVAKKPVVLVILSGGPXDISFAKLDKKVGSILWAGYPGEAGG  574

Query  834   KALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFYTGEKVYEF  655
              AL+ I+FGD+NP GRLP+ WY + + K+PM DM +R DP  GY GRTYRFYTG K+++F
Sbjct  575   IALAXIIFGDHNPGGRLPMAWYTQDYVKMPMTDMRIRPDPKTGYVGRTYRFYTGRKLFDF  634

Query  654   GHGlsyssfslellSAPTRISL---SQSIKTKLRRSILNRGGNEPYVHVDEVSN--CNSL  490
             G+GLSYS++  E  SA ++  L     SI    + S   R     Y  V ++    C   
Sbjct  635   GYGLSYSNYVYEFASAESQNKLYLNESSISPTXKSSDXGR-----YQLVQDLGEEFCEKK  689

Query  489   AFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSISIE  310
                VRV ++N+G M G   V+LF     +   G P KQL+GF  V ++     E    + 
Sbjct  690   KLPVRVGVQNHGEMAGKHPVLLFX-GEKNPKNGRPMKQLVGFQSVILNAGERAEVEFVLS  748

Query  309   PCQHLSIVNVEGSRILPLGDHI  244
             PC+HLS  N EG  ++  G + 
Sbjct  749   PCEHLSHPNEEGLMVVEEGSYF  770



>ref|XP_010024778.1| PREDICTED: putative beta-D-xylosidase [Eucalyptus grandis]
 gb|KCW61273.1| hypothetical protein EUGRSUZ_H04033 [Eucalyptus grandis]
Length=788

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/737 (47%), Positives = 484/737 (66%), Gaps = 34/737 (5%)
 Frame = -3

Query  2445  FCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGIATNGPGI  2266
             FC  +LPI  R+  L+  LT+ EKI+ L +N +A+PRLGI  YEWWSE+LHG++  GPG 
Sbjct  64    FCRVALPIHVRVRDLIGQLTLQEKIRLLVNNAAAVPRLGIQGYEWWSEALHGVSNVGPGT  123

Query  2265  TFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWAPNVNVFV  2086
              F GA   AT FPQVI TAA+FN +LW  I    + EARAM+N G AGLT+W+PNVNVF 
Sbjct  124   RFGGAFPGATSFPQVITTAASFNSSLWEEIGRVVSDEARAMYNGGMAGLTYWSPNVNVFR  183

Query  2085  DPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEEEDDDRLM  1906
             DPRWGRGQETPGEDP++   YA  YVR                L GN         +RL 
Sbjct  184   DPRWGRGQETPGEDPVMAGKYAASYVR---------------GLQGNV-------GNRLK  221

Query  1905  LSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCLMCAYNAV  1726
             ++A CKH TAYDL+ W+   RY FNA V++QD+EDTY  PFK+CV  G+ + +MC+YN V
Sbjct  222   VAASCKHYTAYDLDNWNGVDRYHFNARVSKQDLEDTYNVPFKACVVDGKVASVMCSYNQV  281

Query  1725  NGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIALKAGTDI  1549
             NG+P CA+ +LL+   R  W   GYI SDCD+V  ++E Q Y  +PE+AA   ++AG D+
Sbjct  282   NGVPTCADPNLLKNTIRGQWRLNGYIVSDCDSVGVLYENQHYTTTPEDAAADTIRAGLDL  341

Query  1548  NCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESFGPKDVCS  1369
             +CG ++  + ++A+    + E+++D AL N  +VQ RLG+F+G+   + + + GP+DVC+
Sbjct  342   DCGPFLAVHTEAAIRGGKMAEAEVDLALANTITVQMRLGMFDGEPSAQPYGNLGPRDVCT  401

Query  1368  SEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSLGGDYTGIPCALK  1192
               H++LALEAARQGIVLLKN+ + LPL   R   +AVIGP ++ T ++ G+Y G+ C   
Sbjct  402   PAHQQLALEAARQGIVLLKNQGQALPLSARRHRLVAVIGPNSDVTVTMIGNYAGVACGYT  461

Query  1191  SVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQETEDHDR  1012
             S   G+G Y  +T +  GC+ VAC S   F  A   A+ AD  ++V+GLD S E E  DR
Sbjct  462   SPFQGIGRY-SRTVHQPGCVGVACTSNQLFGRAEVAARHADATVLVMGLDQSIEAEFRDR  520

Query  1011  YSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGYPGEEGGK  832
               LLLPGHQ  LV+ +A  S  P +LVL  GGP+D+SFAK DPR+A+++W GYPG+ GG+
Sbjct  521   TGLLLPGHQQELVSRVAMASRGPTILVLMSGGPIDVSFAKNDPRVAAIVWAGYPGQAGGQ  580

Query  831   ALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRADPSRGYPGRTYRFYTGEKVYEF  655
             A+++++FG  NP G+LP+TWYP+ +  KVPM +MNMRA+P++GYPGRTYRFY G  VY F
Sbjct  581   AIADVLFGTVNPGGKLPVTWYPQEYVAKVPMTNMNMRANPAKGYPGRTYRFYKGPVVYPF  640

Query  654   GHGlsyssfslellSAPTRISLS-QSIKTKLRRSILNRGGNEPYVHVDEVSNCNSLAFSV  478
             G+G+SY+S+   L+ APT++S+   S+    R S L   G     HV    NCN+ +  +
Sbjct  641   GYGMSYTSYRHSLVKAPTQVSVPVASLSAAYRNSSLLSAGIRA-AHV----NCNAASLGI  695

Query  477   RVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSISIEPCQH  298
              V++ N G MDG+  +++FS  P      +P +QLIGF++VHVS        I +  C+H
Sbjct  696   HVNIENTGSMDGTHTLLVFSAPPEGKW--SPARQLIGFEKVHVSAGSQRRVRIDVRVCEH  753

Query  297   LSIVNVEGSRILPLGDH  247
             LS+V+  G R +P+G+H
Sbjct  754   LSVVDEFGIRRIPIGEH  770



>ref|XP_006300771.1| hypothetical protein CARUB_v10019845mg [Capsella rubella]
 gb|EOA33669.1| hypothetical protein CARUB_v10019845mg [Capsella rubella]
Length=768

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/763 (52%), Positives = 495/763 (65%), Gaps = 34/763 (4%)
 Frame = -3

Query  2505  ATSYSKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRL  2332
             A   + P   C P  PT   Y FC T L I  R H LVS LT+DEKI +L +    IPRL
Sbjct  17    AVDSAPPPHACDPSNPTTKLYQFCRTDLRIRNRAHDLVSRLTIDEKISQLVNTAPGIPRL  76

Query  2331  GIPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavea  2152
             G+PAYEWWSE+LHG+A  GPGI F+G V++AT FPQVILTAA+F+   W  IA     EA
Sbjct  77    GVPAYEWWSEALHGVANVGPGIRFNGTVRAATSFPQVILTAASFDSYEWFRIAQVIGKEA  136

Query  2151  rAMFNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgk  1975
             R ++N+GQA G+TFWAPN+N+F DPRWGRGQETPGEDPM+   YAV YVRGLQG      
Sbjct  137   RGVYNAGQANGMTFWAPNINIFRDPRWGRGQETPGEDPMMTGSYAVAYVRGLQGD-----  191

Query  1974  ngRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTY  1795
                  S  G ++         L  SACCKH TAYDL+ W   +RY FNA V+  D+ +TY
Sbjct  192   -----SFDGRKVLSGAH----LQASACCKHFTAYDLDRWKGITRYVFNAQVSLADLAETY  242

Query  1794  EPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLL-EKARTDWGFEGYITSDCDAVATIF  1618
             +PPFK CVE+GRAS +MCAYN VNGIP+CA+ +LL   AR  W F GYITSDCDAV+ I+
Sbjct  243   QPPFKKCVEEGRASGIMCAYNRVNGIPSCADPNLLTHTARGLWRFRGYITSDCDAVSIIY  302

Query  1617  EYQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFR  1438
             + Q YAKSPE+A    LKAG D+NCG+Y+ ++ KSAL+ K V ESDIDRALLNLFSV+ R
Sbjct  303   DAQGYAKSPEDAVAGVLKAGMDVNCGSYLQKHTKSALQQKKVSESDIDRALLNLFSVRIR  362

Query  1437  LGLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAV  1258
             LGLFNG      + +  PKDVCS  H  LAL+AAR GIVLLKN  K L       SSLAV
Sbjct  363   LGLFNGDPTKLPYGNISPKDVCSPAHEALALDAARNGIVLLKNNLKLL-PLSKSSSSLAV  421

Query  1257  IGPMANTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIA  1081
             IGP AN + +L G+Y G PC   + LD L  Y+    Y  GC  V C++ D   +AV+IA
Sbjct  422   IGPNANAARTLLGNYAGPPCKTVTPLDALRGYVKNAVYHQGCDAVVCSNAD-INQAVAIA  480

Query  1080  KRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDIS  901
             + AD+V++++GLD +QE ED DR SL LPG Q  L+   A  + KP+VLVL  GGP+D+S
Sbjct  481   RNADHVVLIMGLDQTQEKEDLDRVSLTLPGKQQDLITSAANAAKKPVVLVLICGGPVDVS  540

Query  900   FAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRA  721
             FA  + +I S++W GYPGE GG AL+EI+FGD+NP GRLP+TWYP+SF  V M DM MR+
Sbjct  541   FATNNDKIGSIIWAGYPGEAGGIALAEIIFGDHNPGGRLPVTWYPQSFVNVKMTDMRMRS  600

Query  720   DPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAP-TRISLSQSIKTKLRRSILNR  544
               + GYPGRTY+FY G KV+EFGHGLSYS +S    + P T++ L+QS      +++LN 
Sbjct  601   --ATGYPGRTYKFYKGPKVFEFGHGLSYSKYSYRFKNLPETKLYLNQS------KALLNS  652

Query  543   GGNEPYVHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGA-PQKQL  373
                  Y  V E+    CN     V V++ N G M G   V++F+R       G   +KQL
Sbjct  653   DSVR-YALVSEMEKEACNVAKTKVTVTVENQGEMAGKHPVLMFARHERGGEDGKRAEKQL  711

Query  372   IGFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             +GF  + +S    TE    I  C+HLS  N  G  ++  G + 
Sbjct  712   VGFKSIVLSNGEKTEIEFEIGLCEHLSRANEVGVMVVEEGKYF  754



>gb|KDP27887.1| hypothetical protein JCGZ_18967 [Jatropha curcas]
Length=775

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/736 (48%), Positives = 488/736 (66%), Gaps = 33/736 (4%)
 Frame = -3

Query  2445  FCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGIATNGPGI  2266
             FC  ++PI  R+  L+  LT+ EKI+ L +N +A+PRLGI  YEWWSE+LHG++  GPG+
Sbjct  48    FCRVNVPIHVRVRDLLGRLTLQEKIRLLVNNAAAVPRLGIQGYEWWSEALHGVSNVGPGV  107

Query  2265  TFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWAPNVNVFV  2086
              F GA   AT FPQVI TAA+FN +LW  I    + EARAM+N G AGLT+W+PNVN+F 
Sbjct  108   KFGGAFPGATSFPQVITTAASFNESLWEQIGRVVSDEARAMYNGGLAGLTYWSPNVNIFR  167

Query  2085  DPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEEEDDDRLM  1906
             DPRWGRGQETPGEDP++   YA  YVRGLQ            S++GN          RL 
Sbjct  168   DPRWGRGQETPGEDPVLAGKYAASYVRGLQ------------SITGN----------RLK  205

Query  1905  LSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCLMCAYNAV  1726
             ++ACCKH TAYDL+ W+   R+ FNA V++QD+EDTY+ PFK+CV +G+ + +MC+YN V
Sbjct  206   VAACCKHYTAYDLDNWNGVDRFHFNAKVSKQDLEDTYDVPFKACVVEGKVASVMCSYNQV  265

Query  1725  NGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIALKAGTDI  1549
             NG P CA+ DLL+   R +W   GYI SDCD+V  +++ Q Y  +PEEAA   +KAG D+
Sbjct  266   NGKPTCADPDLLKNTIRGEWRLNGYIVSDCDSVGVLYDNQHYTSTPEEAAAATVKAGLDL  325

Query  1548  NCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESFGPKDVCS  1369
             +CG ++  + ++A+   ++ E D++ AL N  +VQ RLG+F+G+   + + + GP+DVC+
Sbjct  326   DCGPFLAIHTENAVRKGLLTEEDVNMALANTITVQMRLGMFDGEPSAQPYGNLGPRDVCT  385

Query  1368  SEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSLGGDYTGIPCALK  1192
               H+ LALEAARQGIVLL+N    LPL   R  ++AV+GP ++ T ++ G+Y GI C   
Sbjct  386   PAHQELALEAARQGIVLLENRGGALPLSGARHHTVAVVGPNSDVTVTMIGNYAGIACGYT  445

Query  1191  SVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQETEDHDR  1012
             S L G+G Y  KT +  GC +VAC     FA A   A+ AD  ++V+GLD S E E  DR
Sbjct  446   SPLQGIGRYA-KTIHQPGCENVACTGNQNFARAEVAARHADATVLVMGLDQSIEAEFRDR  504

Query  1011  YSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGYPGEEGGK  832
              SLLLPG+Q  LV+ +A  S  P +LVL  G P+D+SFAK DPRI ++LW+GYPG+ GG 
Sbjct  505   VSLLLPGNQQELVSRVAKASRGPTILVLMSGSPIDVSFAKNDPRIGAILWVGYPGQAGGA  564

Query  831   ALSEIVFGDYNPAGRLPLTWYPESF-TKVPMNDMNMRADPSRGYPGRTYRFYTGEKVYEF  655
             A+++++FG  NP G+LP+TWYP+S+  KVPM +M MRADPS GYPGRTYRFY G  V+ F
Sbjct  565   AIADVLFGTTNPGGKLPMTWYPQSYIAKVPMTNMGMRADPSTGYPGRTYRFYKGPVVFPF  624

Query  654   GHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEVSNCNSLAFSVR  475
             GHG+SY+SFS  L  AP ++SL  +  + L+    N  G    + V   +NC SL   + 
Sbjct  625   GHGMSYTSFSHSLSQAPKQLSLPITSLSALK----NTTGLNNAIRVSH-TNCESLLLGLD  679

Query  474   VSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSISIEPCQHL  295
             + ++N G +DG++ +++FS  P      +  KQLIGF+++H+      +  I+I  C+HL
Sbjct  680   LDVKNTGSVDGTQTLLVFSSPPEGKW--SSNKQLIGFEKIHLVAGSQKQVRINIHVCKHL  737

Query  294   SIVNVEGSRILPLGDH  247
             S+V+  G R +P+G H
Sbjct  738   SVVDRFGIRRIPIGKH  753



>ref|XP_009401393.1| PREDICTED: beta-D-xylosidase 4-like [Musa acuminata subsp. malaccensis]
Length=770

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/749 (48%), Positives = 487/749 (65%), Gaps = 43/749 (6%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P+  SY FC+TS     R+  LV  LT+ EK+  L +  +A+ RLGIP+YEWWSE+LHG+
Sbjct  43    PSLGSYGFCNTSYGTEQRVADLVKRLTLQEKVGFLVNKATAVSRLGIPSYEWWSEALHGV  102

Query  2286  ATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWA  2107
             +  GPG  F   V  AT FPQVILTAA+FN TL+++I    + EARAM N G AGLT+W+
Sbjct  103   SYVGPGTHFSTLVPGATSFPQVILTAASFNTTLFQAIGKVVSTEARAMHNVGLAGLTYWS  162

Query  2106  PNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEE  1927
             PNVN+F DPRWGRGQETPGEDP++ S YA  YV                     R  +E 
Sbjct  163   PNVNIFRDPRWGRGQETPGEDPLLASKYATGYV---------------------RGLQEA  201

Query  1926  EDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCL  1747
             ++ ++L ++ACCKH TAYD++ W    RY+FNAVV++QD++DT++PPFKSCV  G  + +
Sbjct  202   DEPEKLKVAACCKHYTAYDVDNWKGIERYTFNAVVSKQDLDDTFQPPFKSCVIDGNVASV  261

Query  1746  MCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIA  1570
             MC+YN VNG+P CA+ DLL    R DW   GYI SDCD+V  ++  Q Y K+PE+AA I+
Sbjct  262   MCSYNQVNGVPTCADPDLLSGTIRGDWKLNGYIVSDCDSVNELYNRQHYTKTPEDAAAIS  321

Query  1569  LKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESF  1390
             + AG D+NCG+++  +  +A++   + E D+++A+ N F+V  RLG F+G      +   
Sbjct  322   ILAGLDLNCGSFLRDHTLAAVQGGKLTEKDVEKAITNNFAVLMRLGFFDGDPRKLPYGGL  381

Query  1389  GPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSLGGDYT  1213
             GPKDVC+  ++ LA EAARQGIVLLKN+   LPLD TR+ SLAVIGP AN T ++ G+Y 
Sbjct  382   GPKDVCTPANQELAREAARQGIVLLKNDNGCLPLDSTRIKSLAVIGPNANVTFTMIGNYE  441

Query  1212  GIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTD-GFAEAVSIAKRADYVIVVVGLDLS  1036
             G PC   + L GL   + KT YA+GC +V C         A + A  AD+ ++VVG D S
Sbjct  442   GTPCKYTTPLQGLAANV-KTVYAAGCANVGCTGNSLQLDSAKAAAAAADFTVLVVGADQS  500

Query  1035  QETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIG  856
              E E  DR SLLLPG Q  L+ E+A V+  P++LV+  GGP DISFAK +  I+S+LW+G
Sbjct  501   IERESFDRVSLLLPGQQTTLITEVAKVAKGPVILVIMSGGPFDISFAKTNGNISSILWVG  560

Query  855   YPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRADPSRGYPGRTYRFY  679
             YPGE GG A+++++FG YNP+GRLP+TWYP+SF   VPM DM MRADPS GYPGRTYRFY
Sbjct  561   YPGEAGGAAIADVIFGYYNPSGRLPVTWYPQSFADSVPMTDMRMRADPSTGYPGRTYRFY  620

Query  678   TGEKVYEFGHGlsyssfslellSAPTRISL----SQSIKTKLRRSILNRGGNEPYVHVDE  511
             TG+ VYEFG GLSY+ ++  L+ AP  +S+      S  ++  +S+   G          
Sbjct  621   TGDIVYEFGDGLSYTDYTHHLVKAPRLVSIPLEEGHSCDSRQCKSVDLAG----------  670

Query  510   VSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVT  331
              + CN L F V + +RN+G   GS  V LFS  P  +  GAP+K L+GF++V +    V 
Sbjct  671   -TGCNDLGFDVHLRVRNSGNRAGSHTVFLFSTPPAVH--GAPRKHLVGFEKVFLGPKAVG  727

Query  330   ETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             +    ++ C+ LS+V+  G+R L LG H+
Sbjct  728   QVVFKVDVCKDLSVVDELGNRKLALGSHV  756



>ref|XP_008339210.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Malus domestica]
Length=773

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/756 (48%), Positives = 483/756 (64%), Gaps = 36/756 (5%)
 Frame = -3

Query  2493  SKPQLPCQ---PPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIP  2323
             S P   C      T SS+ FCDTSL + AR+  LV  LT+ EKI  L ++  ++ RLGIP
Sbjct  34    SSPVFACNVASNATLSSFAFCDTSLGVDARVADLVKRLTLPEKIGFLVNSAGSVSRLGIP  93

Query  2322  AYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAM  2143
              YEWWSE+LHG++  GPG  F   V  AT FPQVILTAA+FN +L+ +I    + EARAM
Sbjct  94    KYEWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNTSLFEAIGRVVSTEARAM  153

Query  2142  FNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             +N G AGLT+W+PN+N+F DPRWGRGQETPGEDP++ S Y   YVR              
Sbjct  154   YNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVR--------------  199

Query  1962  YSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
                       ++ D ++L ++ACCKH TAYD++ W    RY FNAVVT+QDM+DT++PPF
Sbjct  200   -----GLQQTDDGDKNKLKVAACCKHYTAYDIDNWKGVDRYHFNAVVTKQDMDDTFQPPF  254

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQ  1606
             KSCV  G  + +MC+YN VNGIP CA+ DLL    R +W   GYI +DCD++   +  Q 
Sbjct  255   KSCVIDGNVASVMCSYNQVNGIPTCADPDLLAGVIRGEWKLNGYIVTDCDSIDVYYNNQH  314

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             Y K+PEEAA  A+ AG D+NCG+++ +  + A++  +V E+ IDRA+ N F+   RLG F
Sbjct  315   YTKTPEEAAAKAILAGLDLNCGSFLGKYTQGAVQAGLVNEAAIDRAISNNFATLMRLGFF  374

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPM  1246
             +G   N+ +   GPKDVC+SE++ LA E ARQGIVLLKN    LPL  T + SLAVIGP 
Sbjct  375   DGDPSNKPYGKLGPKDVCTSENQELAXETARQGIVLLKNSPGSLPLSPTAIKSLAVIGPN  434

Query  1245  AN-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             +N T ++ G+Y G PC   ++L GL      TSY   C +VAC  T    +A  IA  AD
Sbjct  435   SNVTKTMIGNYEGTPCKYTTILQGLSAS-XATSYVPACANVACG-TAQVDDATKIAASAD  492

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
               I+VVG D S E E  DR  L LPG Q  LV E+A  S  P++LV+  GG  DI+FAK 
Sbjct  493   ATILVVGADQSIEAESRDRIDLYLPGQQTLLVTEVAKASKGPVILVIMSGGGFDITFAKN  552

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRADPS  712
             + +I S+LW+GYPGE GG A++++VFG YNP GRLP+TWYP+S+  KVPM +MNMR D S
Sbjct  553   NTKITSILWVGYPGEAGGAAVADVVFGHYNPCGRLPMTWYPQSYVDKVPMTNMNMRPDAS  612

Query  711   RGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNE  532
             +GYPGRTYRFYTGE VY FG GLSYS+F+ +L+ AP  +S+       L    +    + 
Sbjct  613   KGYPGRTYRFYTGETVYSFGDGLSYSTFNHKLVRAPKLVSI------PLEEGHVCHSSSC  666

Query  531   PYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVH  352
               + V E   C +L F + + ++N G M GS  VMLFS  P  +   +PQK L+GF++V 
Sbjct  667   KSLDVME-ERCKNLVFDIHLGVKNAGSMSGSHTVMLFSSPPAVHK--SPQKHLLGFEKVF  723

Query  351   VSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             +S         +++ C+HLS+V+  G+R + LG+H+
Sbjct  724   LSAQREALVKFNVDVCKHLSVVDELGNRKVALGEHV  759



>ref|XP_002316021.1| beta-D-xylosidase family protein [Populus trichocarpa]
 gb|EEF02192.1| beta-D-xylosidase family protein [Populus trichocarpa]
Length=768

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/756 (47%), Positives = 489/756 (65%), Gaps = 40/756 (5%)
 Frame = -3

Query  2493  SKPQLPCQPPT--HSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             S+    C P      S  FC  +LPI  R+  L+  LT+ EKI+ L +N +A+PRLGI  
Sbjct  24    SREPFACDPKLGLTRSLKFCRVNLPIHVRVRDLIGRLTLQEKIRLLVNNAAAVPRLGIQG  83

Query  2319  YEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMF  2140
             YEWWSE+LHG++  GPG  F GA   AT FPQVI TAA+FN +LW  I    + EARAM+
Sbjct  84    YEWWSEALHGVSNVGPGTKFGGAFPGATAFPQVITTAASFNESLWEEIGRVVSDEARAMY  143

Query  2139  NSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKY  1960
             N G AGLT+W+PNVNVF DPRWGRGQETPGEDP+V   YA  YVR               
Sbjct  144   NGGMAGLTYWSPNVNVFRDPRWGRGQETPGEDPVVAGKYAASYVR---------------  188

Query  1959  SLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFK  1780
              L GN       +  RL ++ACCKH TAYDL+ W+   RY FNA V++QD+EDTY  PFK
Sbjct  189   GLQGN-------NGLRLKVAACCKHYTAYDLDNWNGVDRYHFNARVSKQDLEDTYNVPFK  241

Query  1779  SCVEKGRASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQY  1603
             SCV  G+ + +MC+YN VNG P CA+  LL+   R +WG  GYI SDCD+V  +F+ Q Y
Sbjct  242   SCVVAGKVASVMCSYNQVNGKPTCADPYLLKNTIRGEWGLNGYIVSDCDSVGVLFDTQHY  301

Query  1602  AKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFN  1423
               +PEEAA   ++AG D++CG ++  + ++A++  ++ E D++ AL N  +VQ RLG+F+
Sbjct  302   TATPEEAAASTIRAGLDLDCGPFLAIHTENAVKGGLLKEEDVNMALANTITVQMRLGMFD  361

Query  1422  GKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMA  1243
             G+   + F + GP+DVC+  H++LAL+AARQGIVLL+N  + LPL +T + ++AVIGP +
Sbjct  362   GEPSAQPFGNLGPRDVCTPAHQQLALQAARQGIVLLQNRGRTLPLSRT-LQTVAVIGPNS  420

Query  1242  N-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADY  1066
             + T ++ G+Y G+ C   + L G+  Y  KT +  GC DV CN    F  A   A+ AD 
Sbjct  421   DVTVTMIGNYAGVACGYTTPLQGIRRYA-KTVHHPGCNDVFCNGNQQFNAAEVAARHADA  479

Query  1065  VIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKD  886
              I+V+GLD S E E  DR  LLLPG+Q  LV+ +A  S  P +LVL  GGP+D+SFAK D
Sbjct  480   TILVMGLDQSIEAEFRDRKGLLLPGYQQELVSIVARASRGPTILVLMSGGPIDVSFAKND  539

Query  885   PRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESF-TKVPMNDMNMRADPSR  709
             PRI ++LW+GYPG+ GG A+++++FG  NP G+LP+TWYP ++  KVPM +M MRADPSR
Sbjct  540   PRIGAILWVGYPGQAGGAAIADVLFGTANPGGKLPMTWYPHNYLAKVPMTNMGMRADPSR  599

Query  708   GYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEP  529
             GYPGRTYRFY G  V+ FGHG+SY++F+  L+ AP  +S+  +     R    N  G   
Sbjct  600   GYPGRTYRFYKGPVVFPFGHGMSYTTFAHSLVQAPREVSVPLASLHVSR----NTTGASN  655

Query  528   YVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGG--APQKQLIGFDRV  355
              + V   +NC +LA  V + ++N G MDG+  +++FS  P    GG  + QKQLIGF++V
Sbjct  656   AIRVSH-ANCEALALGVHIDVKNTGDMDGTHTLLVFSSPP----GGKWSTQKQLIGFEKV  710

Query  354   HVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             H+         I I  C+HLS+V+  G R +P+G+H
Sbjct  711   HLVTGSQKRVKIDIHVCKHLSVVDRFGIRRIPIGEH  746



>ref|XP_007042636.1| Glycosyl hydrolase family protein [Theobroma cacao]
 gb|EOX98467.1| Glycosyl hydrolase family protein [Theobroma cacao]
Length=852

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/758 (49%), Positives = 498/758 (66%), Gaps = 33/758 (4%)
 Frame = -3

Query  2484  QLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEW  2311
             Q  C    P  S +PFCD +L    R   LVS LT+ EK+Q+L +  S I RLG+PAYEW
Sbjct  84    QFACDKNDPNTSQFPFCDYALSYEDRAKDLVSHLTLQEKVQQLVNTASGISRLGVPAYEW  143

Query  2310  WSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSG  2131
             WSE+LHG++  GPG  F+  V  AT FP VIL+AA+FN TLW  +    + EARAM+N G
Sbjct  144   WSEALHGVSDLGPGTRFNATVPGATSFPAVILSAASFNATLWFKMGQVVSTEARAMYNVG  203

Query  2130  QAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLS  1951
              AGLT+W+PNVNVF DPRWGRGQETPGEDP+VVS YAV YVRGLQ  G            
Sbjct  204   LAGLTYWSPNVNVFRDPRWGRGQETPGEDPLVVSRYAVNYVRGLQEVGG-----------  252

Query  1950  GNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCV  1771
                  E     D+L +S+CCKH TAYDL+ W    R+ F+A VT+QD+EDTY+PPFKSCV
Sbjct  253   -----ESNSTHDKLKVSSCCKHYTAYDLDNWKGVDRFHFDAKVTKQDLEDTYQPPFKSCV  307

Query  1770  EKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKS  1594
             E+G  S +MC+YN VNGIP CA+ DLL+   R  WG +GYI SDCD+VA  +    Y  +
Sbjct  308   EEGHVSSVMCSYNRVNGIPTCADPDLLKGIVRGQWGLDGYIVSDCDSVAVFYNSIHYTAT  367

Query  1593  PEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKA  1414
             PE+A  +ALKAG ++NCG Y+ +   +A+  K V ES +D+AL+  + V  RLG F+G  
Sbjct  368   PEDAVAVALKAGLNMNCGDYLGKYTVNAVNLKKVEESIVDQALIYNYIVLMRLGFFDGNP  427

Query  1413  VNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-T  1237
                 F   GP DVC+ +H+ LA +AA+QGIVLL N    LPL +    +LAVIGP AN T
Sbjct  428   KLLLFGDLGPSDVCADDHQLLAHDAAKQGIVLLDNNGA-LPLSQNITKNLAVIGPNANAT  486

Query  1236  SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIV  1057
             + +  +Y G+PC   S L GL +Y+   +Y +GC DV C++      AV  A +AD ++V
Sbjct  487   TVMISNYAGVPCHYTSPLQGLQKYVSVVTYEAGCSDVKCSNETLIEAAVQAAAKADALVV  546

Query  1056  VVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRI  877
             VVGLD S E E  DR +L LPG+Q  LV ++A  +N  ++LV+   GP+DISFAK   +I
Sbjct  547   VVGLDQSIEAEGLDRVNLTLPGYQEKLVTDVANAANGTVILVIMAAGPIDISFAKNVSQI  606

Query  876   ASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRADPSRGYP  700
               +LW+GYPG+ GG+A+++++FGDYNPAGR P TWYP+ +  +VPM DMNMRA+ S  +P
Sbjct  607   GGILWVGYPGQAGGEAIAQVIFGDYNPAGRSPFTWYPQEYADQVPMTDMNMRANTSENFP  666

Query  699   GRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVH  520
             GRTYRFYTG+ +YEFGHGLSY+SFS  +LSAP+ I L QSI   +  S   +   EPY +
Sbjct  667   GRTYRFYTGKCIYEFGHGLSYTSFSKFILSAPSTI-LIQSIPNNILSS---KSIREPYAY  722

Query  519   VD----EVS--NCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTS-YAGGAPQKQLIGFD  361
              +    +VS  NCN L F++ + ++NNG M+G+ VV+LF + P+S    GAP  QL+GF+
Sbjct  723   SNGEAIDVSNINCNDLQFNLVIGVKNNGPMNGAHVVLLFWKPPSSRVVTGAPNVQLVGFE  782

Query  360   RVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             R+ V        ++S+  C+  ++V+ EG+R L  G H
Sbjct  783   RLEVKRGKTQNVTMSLGVCKEFTLVDAEGNRKLITGQH  820



>ref|XP_008784548.1| PREDICTED: LOW QUALITY PROTEIN: beta-xylosidase/alpha-L-arabinofuranosidase 
2-like [Phoenix dactylifera]
Length=773

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/746 (48%), Positives = 489/746 (66%), Gaps = 43/746 (6%)
 Frame = -3

Query  2457  SSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGIATN  2278
             +S+ FC+TS  I AR+  LV  LT++EK+  L +  +A+ RLGIP+YEWWSE+LHG++  
Sbjct  49    ASFGFCNTSWGIEARVGDLVKRLTLEEKVGFLVNKAAAVSRLGIPSYEWWSEALHGVSFV  108

Query  2277  GPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWAPNV  2098
             GPG  F   V  AT FPQVILTAA+FN TL+ +I    + EARAM N G AGLTFW+PNV
Sbjct  109   GPGTHFSSLVPGATSFPQVILTAASFNTTLFETIGKVVSTEARAMHNVGLAGLTFWSPNV  168

Query  2097  NVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEEEDD  1918
             N+F DPRWGRGQETPGEDP++ S YA  YV                     +  ++ +D 
Sbjct  169   NIFRDPRWGRGQETPGEDPVLASKYAAGYV---------------------KGLQQAKDP  207

Query  1917  DRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCLMCA  1738
             DRL ++ACCKH TAYDL+ W    RY+FNAVVT+QD++DT++PPFKSCV +G  + +MC+
Sbjct  208   DRLKVAACCKHYTAYDLDNWKGIQRYTFNAVVTKQDLDDTFQPPFKSCVTEGNVASVMCS  267

Query  1737  YNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIALKA  1561
             YN VNG+P CA+ DLL    R DW   GYI SDCD+V  ++  Q Y K+PE+AA + + A
Sbjct  268   YNQVNGVPTCADPDLLAGTIRGDWKLNGYIVSDCDSVDVLYNQQHYTKTPEDAAAVTILA  327

Query  1560  GTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESFGPK  1381
             G D+NCG+++ ++ ++A++   + ESD+D+A+ + F V  RLG F+G     +F   GPK
Sbjct  328   GLDLNCGSFLGQHTQAAVKAGKLKESDVDKAITSNFVVLMRLGFFDGDPRKLEFGKLGPK  387

Query  1380  DVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSLGGDYTGIP  1204
             DVC++EH+ LA EAARQGIVLLKN+   LPLD   V+ +AVIGP AN T ++ G+Y G P
Sbjct  388   DVCTAEHQELAREAARQGIVLLKNDDDALPLDPKSVAFMAVIGPNANVTKTMIGNYEGTP  447

Query  1203  CALKSVLDGLGEYIHKTSYASGCLDVAC-NSTDGFAEAVSIAKRADYVIVVVGLDLSQET  1027
             C   + L GL   +  T Y  GC +V C  ++     A + A +AD  ++VVG D S E 
Sbjct  448   CKYTTPLQGLTAVV-STVYQPGCTNVGCAGNSLQLDAAKAAAAKADVTVLVVGADQSIER  506

Query  1026  EDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGYPG  847
             E  DR SLLLPG Q  LV E+A  +   ++LV+  GGP DISFAK D RI+S+LW+GYPG
Sbjct  507   EGFDRVSLLLPGQQTTLVTEIAKAAKGKVILVIMSGGPFDISFAKSDDRISSILWVGYPG  566

Query  846   EEGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRADPSRGYPGRTYRFYTGE  670
             E GG AL++I+FG YNP GRLP+TWYP+SF  KVPM DM MR DPS GYPGRTYRFYTG+
Sbjct  567   EAGGAALADIIFGYYNPCGRLPVTWYPQSFADKVPMTDMRMRPDPSTGYPGRTYRFYTGD  626

Query  669   KVYEFGHGlsyssfslellSAPTRISL----SQSIKTKLRRSILNRGGNEPYVHVDEVSN  502
              +Y FG GLSY+ F+  L+ AP  +S+      S  +K  +S+   G           S 
Sbjct  627   VIYSFGDGLSYNDFTHHLVQAPKLVSIPLEEGHSCYSKRCKSVDLVG-----------SR  675

Query  501   CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETS  322
             C + AF + + ++N G M GS  V LFS  P+ +   +PQK L+GF+++++    V    
Sbjct  676   CQNAAFDIHLRVQNPGRMAGSHTVFLFSTPPSVH--NSPQKHLLGFEKIYLGPKXVGYVV  733

Query  321   ISIEPCQHLSIVNVEGSRILPLGDHI  244
              +++ C+ LS+V+  G+R++ LG H+
Sbjct  734   FNVDVCKDLSLVDELGNRMVALGSHV  759



>ref|XP_002963750.1| hypothetical protein SELMODRAFT_80102 [Selaginella moellendorffii]
 gb|EFJ35621.1| hypothetical protein SELMODRAFT_80102 [Selaginella moellendorffii]
Length=785

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/761 (49%), Positives = 487/761 (64%), Gaps = 30/761 (4%)
 Frame = -3

Query  2502  TSYSKPQLPCQPPTHSS---YPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRL  2332
              S ++P+  C   +++S   +PFCDT L +  R+  LVS LT+DEK+  + +    IPRL
Sbjct  30    VSTAQPRYACDVSSNASLGSFPFCDTKLGVDVRVQDLVSRLTLDEKVDEMVNAAQGIPRL  89

Query  2331  GIPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavea  2152
             G+P+Y+WW E+LHG+A++ PG+ F G   +AT FP  I  AA+FN TL+ SI  A + EA
Sbjct  90    GVPSYQWWQEALHGVASS-PGVQFGGLAPAATSFPMPIAMAASFNSTLFYSIGEAVSSEA  148

Query  2151  rAMFNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkn  1972
             RA+ N G+AGLTFW+PNVN+F DPRWGRGQETPGEDP++ S +A  YVR           
Sbjct  149   RALHNLGRAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLASKFASLYVR-----------  197

Query  1971  gRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYE  1792
                  L G         D  L +SACCKHLTAYD++ W    RY FNA V+ QD+ DTY 
Sbjct  198   ----GLQGGAY-GGSASDGFLKVSACCKHLTAYDMDNWKGMDRYHFNAEVSEQDLVDTYN  252

Query  1791  PPFKSCVEKGRASCLMCAYNAVNGIPACANKDLL-EKARTDWGFEGYITSDCDAVATIFE  1615
             PPF+SC+E GR S +MC+YN VNG+P CA++ LL E  R  WGF GYI SDCDA+  +FE
Sbjct  253   PPFQSCIEDGRVSSVMCSYNRVNGVPTCADRSLLTETVRNSWGFNGYIVSDCDALQVLFE  312

Query  1614  YQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRL  1435
                YA S E+A   ++ AG D+NCGT++ ++ KSAL+   V E+D+D A+ NL   + RL
Sbjct  313   DTTYAPSAEDAVADSILAGLDLNCGTFLGKHAKSALQAGKVTEADLDHAISNLMRTRMRL  372

Query  1434  GLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVI  1255
             GLF+G    R + S G  D+CS++H++LAL+AA QG+VLLKN+   LPL  T + ++A+I
Sbjct  373   GLFDGDLNTRPYSSLGATDICSNDHQQLALDAALQGVVLLKNDGS-LPL-STALKTVALI  430

Query  1254  GPMAN-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAK  1078
             GP AN T ++ G+Y GIPC   S L G+  Y +   Y+ GC DVAC+  D  A AV +A 
Sbjct  431   GPNANATYTMLGNYEGIPCKYVSPLQGMQIYNNNILYSPGCRDVACSEGDLVASAVEVAT  490

Query  1077  RADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISF  898
             +AD V++VVGLD SQE E  DR SLLLPG Q  LV+ +A     P+VLV+   GP+DIS 
Sbjct  491   KADAVVLVVGLDQSQERETFDRTSLLLPGMQSQLVSNIANAVTCPIVLVIMSAGPVDIST  550

Query  897   AKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRAD  718
              K + RI+SV+WIGYPG+ GG AL+ +VFG YNP GRLP TWY E FT V M DM MR +
Sbjct  551   FKDNSRISSVIWIGYPGQSGGAALAHVVFGAYNPGGRLPNTWYHEEFTNVSMLDMRMRPN  610

Query  717   PSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRS-ILNRG  541
             P  GYPGR+YRFYTG  +Y FG GLSYS++  + L APTR+S  +S     R    +NR 
Sbjct  611   PPSGYPGRSYRFYTGTPLYNFGDGLSYSTYLYKFLLAPTRLSFFKSNTRNSRDCPTVNRS  670

Query  540   GNE---PYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLI  370
               E    ++  D++  CNS+ F V V + N G   GS  V++FS  P     GAP KQLI
Sbjct  671   EAEFGCFHLPADDLETCNSILFQVSVEVSNLGPRSGSHSVLIFSAPPP--VEGAPLKQLI  728

Query  369   GFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
              F +VH+  +        I+PC+HLS V   G R L  G H
Sbjct  729   AFQKVHLESDTTQRLIFGIDPCKHLSSVRRNGKRFLHSGRH  769



>ref|XP_003592512.1| Xylosidase [Medicago truncatula]
 gb|AES62763.1| beta-D-xylosidase-like protein [Medicago truncatula]
Length=781

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/745 (50%), Positives = 499/745 (67%), Gaps = 26/745 (3%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P  S++PFC+TSL    R   LVS LT+ EK Q+L + ++ I RLG+PAYEWWSE+LHG+
Sbjct  31    PKTSNFPFCNTSLSYETRAKDLVSRLTLQEKAQQLVNPSTGISRLGVPAYEWWSEALHGV  90

Query  2286  ATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWA  2107
             +  GPG  FD  V  AT FP VIL+AA+FN TLW ++    + EARAM+N   AGLTFW+
Sbjct  91    SNVGPGTRFDSRVPGATSFPAVILSAASFNETLWYTMGQVVSNEARAMYNVDLAGLTFWS  150

Query  2106  PNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEE  1927
             PNVNVF DPRWGRGQETPGEDP+VVS YAV YVRGLQ  G                 E  
Sbjct  151   PNVNVFRDPRWGRGQETPGEDPLVVSRYAVNYVRGLQEVGD----------------EAS  194

Query  1926  EDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCL  1747
                DRL +S+CCKH TAYD++ W    R+ F+A VT+QD+EDTY+PPFKSCV +G  S +
Sbjct  195   AKGDRLKVSSCCKHYTAYDVDNWKGVDRFHFDAKVTKQDLEDTYQPPFKSCVLEGHVSSV  254

Query  1746  MCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIA  1570
             MC+YN VNGIP CA+ DLL+   R  WG +GYI SDCD+V   +    Y K+PE+A  +A
Sbjct  255   MCSYNRVNGIPTCADPDLLQGVIRGQWGLDGYIVSDCDSVEVYYNSIHYTKTPEDAVALA  314

Query  1569  LKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF-NGKAVNRKFES  1393
             LKAG ++NCG ++ +   +A+  K V  S +D+AL+  + V  RLG F N K++   F +
Sbjct  315   LKAGLNMNCGDFLKKYTANAVNLKKVDVSIVDQALVYNYIVLMRLGFFENPKSL--PFAN  372

Query  1392  FGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSLGGDY  1216
              GP DVC+ E+++LALEAA+QGIVLL+N +  LPL KT++ +LAVIGP AN T+ +  +Y
Sbjct  373   LGPSDVCTKENQQLALEAAKQGIVLLENNKGALPLSKTKIKNLAVIGPNANATTVMISNY  432

Query  1215  TGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLS  1036
              GIPC   S L GL +YI   +YA GC DV C++ + FA AV  A  AD V++VVGLD S
Sbjct  433   AGIPCRYSSPLQGLQKYISSVTYARGCSDVKCSNQNLFAAAVKAAASADAVVLVVGLDQS  492

Query  1035  QETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIG  856
              E E  DR +L LPG Q  LV ++A  +   L+LV+   GP+DISF K    I  +LW+G
Sbjct  493   IEAEGLDRVNLTLPGFQEKLVKDVAAATKGTLILVIMAAGPIDISFTKSVSNIGGILWVG  552

Query  855   YPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRADPSRGYPGRTYRFY  679
             YPG++GG A+++++FGDYNP GR P TWYP+S+  +VPM DMNMRA+ SR +PGRTYRFY
Sbjct  553   YPGQDGGNAIAQVIFGDYNPGGRSPFTWYPQSYVDQVPMTDMNMRANSSRNFPGRTYRFY  612

Query  678   TGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEVSNC  499
              G+ +YEFG+GLSYS+FS  + SAP+ I L ++  T + + + N   ++  + +  +S C
Sbjct  613   NGKSLYEFGYGLSYSTFSTHIASAPSTIMLQKN--TSISKPLNNIFLDDQVIDISTIS-C  669

Query  498   NSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYA-GGAPQKQLIGFDRVHVSGNGVTETS  322
              +L FS+ + ++NNG  DGS VV++F   P+S A  G P KQLIGF+R  V        +
Sbjct  670   FNLTFSLVIGVKNNGPFDGSHVVLVFLEPPSSEAVSGVPLKQLIGFERAQVKVGKTEFVT  729

Query  321   ISIEPCQHLSIVNVEGSRILPLGDH  247
             + I+ C+ LS V+ +G R L +G H
Sbjct  730   VKIDICKMLSNVDSDGKRKLVIGQH  754



>ref|XP_002302284.2| glycosyl hydrolase family 3 family protein [Populus trichocarpa]
 gb|EEE81557.2| glycosyl hydrolase family 3 family protein [Populus trichocarpa]
Length=742

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/757 (50%), Positives = 477/757 (63%), Gaps = 80/757 (11%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P+   YPFC T LPI  R+  LVS LT+DEK+ +L D   AIPRLGIPAYEWWSE+LHG+
Sbjct  39    PSTKLYPFCQTKLPISQRVEDLVSRLTLDEKVSQLVDTAPAIPRLGIPAYEWWSEALHGV  98

Query  2286  A---TNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GL  2119
             A   T   GI F+G ++ AT FPQVILTAA+F+  LW  I      EAR ++N+GQA G+
Sbjct  99    ALQTTVRQGIRFNGTIRFATSFPQVILTAASFDAHLWYRIGQVIGKEARGIYNAGQATGM  158

Query  2118  TFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRM  1939
             TFWAPN+N+F DPRWGRGQETPGEDP+V   YAV YVRG+QG           S  G  +
Sbjct  159   TFWAPNINIFRDPRWGRGQETPGEDPLVAGKYAVSYVRGVQGD----------SFGGGTL  208

Query  1938  PEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGR  1759
              E+      L  SACCKH TAYDL+ W   +R+ F+A    QD+ DTY+PPF+SC+++G+
Sbjct  209   GEQ------LQASACCKHFTAYDLDKWKGMNRFVFDA----QDLADTYQPPFQSCIQEGK  258

Query  1758  ASCLMCAYNAVNGIPACANKDLL-EKARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEA  1582
             AS +MCAYN VNG+P CA+ +LL +KAR  WGF GYITSDCDAVA I + Q YAKSPE+A
Sbjct  259   ASGIMCAYNRVNGVPNCADYNLLSKKARGQWGFYGYITSDCDAVAIIHDDQGYAKSPEDA  318

Query  1581  AGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRK  1402
                 LKAG D+NCG Y+    KSA++ K + ES+IDRAL NLFS++ RLGLFNG    + 
Sbjct  319   VADVLKAGMDVNCGDYLKNYTKSAVKKKKLPESEIDRALHNLFSIRMRLGLFNGNPTKQP  378

Query  1401  FESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTSS-LG  1225
             + +  P  VCS EH+ LAL+AA+ GIVLLKN  K LPL K    SLAVIGP AN S+ L 
Sbjct  379   YGNIAPDQVCSQEHQALALKAAQDGIVLLKNPDKLLPLSKLETKSLAVIGPNANNSTKLL  438

Query  1224  GDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGL  1045
             G+Y G PC   + L GL  YI  T Y  GC  VAC+S     +AV IAK AD VI+V+GL
Sbjct  439   GNYFGPPCKTVTPLQGLQNYIKNTRYHPGCSRVACSSAS-INQAVKIAKGADQVILVMGL  497

Query  1044  DLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVL  865
             D +QE E+ DR  L+LPG Q  L+  +A  + KP+VLVL  GGP+D+SFAK D  I S++
Sbjct  498   DQTQEKEEQDRVDLVLPGKQRELITAVAKAAKKPVVLVLFCGGPVDVSFAKYDQNIGSII  557

Query  864   WIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYR  685
             W GYPGE GG AL++I+FGD+NP GRLP+TWYP+ FTKVPM DM MR   S GYPGRTYR
Sbjct  558   WAGYPGEAGGTALAQIIFGDHNPGGRLPMTWYPQDFTKVPMTDMRMRPQLSSGYPGRTYR  617

Query  684   FYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEVS  505
             FY G+KV+EFG+GLSYS++S         ++     K  LR S      N   +    +S
Sbjct  618   FYNGKKVFEFGYGLSYSNYSY-------ELASDAQNKLYLRASSNQITKNSNTIRHKLIS  670

Query  504   N-----CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGN  340
             N     C    F+V V ++N+G M G                                  
Sbjct  671   NIGKELCEKTKFTVTVRVKNHGEMAGENA-------------------------------  699

Query  339   GVTETSISIEPCQHLS-------IVNVEGSRILPLGD  250
                E    + PC+HLS       +V  EGS+ L +GD
Sbjct  700   ---EIQYELSPCEHLSSPDDRGMMVMEEGSQFLLIGD  733



>gb|AES97964.2| glycoside hydrolase family 3 amino-terminal domain protein [Medicago 
truncatula]
Length=791

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/747 (50%), Positives = 478/747 (64%), Gaps = 27/747 (4%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P    +PFC+ +L I  R   +VS LT+DEK+ +L +   AIPRL IP+Y+WW+E+LHG+
Sbjct  43    PRTKLFPFCNLNLTITQRAKDIVSRLTLDEKVSQLVNTAPAIPRLDIPSYQWWNEALHGV  102

Query  2286  ATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GLTFW  2110
             +  G GI  +G++ +AT FPQVILTAA+F+  LW  I+     EAR ++N+GQA G+ FW
Sbjct  103   SYVGMGIILNGSIPAATSFPQVILTAASFDPKLWYQISKVIGTEARGVYNAGQAQGMNFW  162

Query  2109  APNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEE  1930
             APN+N+F DPRWGRGQET GEDP+V S Y V YVR                L G+     
Sbjct  163   APNINIFRDPRWGRGQETAGEDPLVNSKYGVSYVR---------------GLQGDSFEGG  207

Query  1929  EEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASC  1750
             +    RL  SACCKH TAYDLE W   +RY F+A VT QD+ DTY+P F SCV +GR+S 
Sbjct  208   KLIGGRLKASACCKHFTAYDLENWKGVNRYVFDAKVTLQDLADTYQPSFHSCVVQGRSSG  267

Query  1749  LMCAYNAVNGIPACANKDLL-EKARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGI  1573
             +MCAYN VNG+P CA+ +LL   AR  W F GYI SDCDAV  I+E Q YAK+PE+    
Sbjct  268   IMCAYNRVNGVPNCADYNLLTNTARKKWNFNGYIASDCDAVRFIYEKQGYAKTPEDVVAD  327

Query  1572  ALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFES  1393
              L+AG D+ CG YM ++ KSA+  K +  S IDRAL NLF+++ RLGLF+G     ++  
Sbjct  328   VLRAGMDLECGNYMTKHAKSAVLQKKIPISQIDRALHNLFTIRIRLGLFDGNPTKLQYGR  387

Query  1392  FGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTSS--LGGD  1219
              GP  VCS E+  LALEAAR GIVLLKN    LPL   RV++L VIGP AN SS  L G+
Sbjct  388   IGPNQVCSKENLDLALEAARSGIVLLKNTASILPL--PRVNTLGVIGPNANKSSIVLLGN  445

Query  1218  YTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDL  1039
             Y G PC   S+L G   Y  +T Y SGC D    ++     AV +AK +DYVI+V+GLD 
Sbjct  446   YIGPPCKNVSILKGFYTYASQTHYHSGCTDGTKCASAEIDRAVEVAKISDYVILVMGLDQ  505

Query  1038  SQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWI  859
             SQETE  DR  L LPG Q  L+N +A  S KP++LVL  GGP+DI+FAK + +I  ++W 
Sbjct  506   SQETETLDRDHLELPGKQQKLINSVAKASKKPVILVLLCGGPVDITFAKNNDKIGGIIWA  565

Query  858   GYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFY  679
             GYPGE GG+AL+++VFGDYNP GRLP+TWYP+ F K+PM DM MRADPS GYPGRTYRFY
Sbjct  566   GYPGELGGRALAQVVFGDYNPGGRLPMTWYPKDFIKIPMTDMRMRADPSSGYPGRTYRFY  625

Query  678   TGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEV--S  505
             TG KVYEFG+GLSYS++S   +S       +  I      SIL       Y  V E+   
Sbjct  626   TGPKVYEFGYGLSYSNYSYNFISVKNN---NLHINQSTTYSILENSETINYKLVSELGEE  682

Query  504   NCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTET  325
              C +++ SV + + N G M G   V+LF + P     G P KQL+GF+ V V G G  E 
Sbjct  683   TCKTMSISVTLGITNTGSMAGKHPVLLFVK-PKKGRNGNPVKQLVGFESVTVEGGGKGEV  741

Query  324   SISIEPCQHLSIVNVEGSRILPLGDHI  244
                +  C+HLS  N  G +++  G ++
Sbjct  742   GFEVSVCEHLSRANESGVKVIEEGGYL  768



>ref|XP_009373165.1| PREDICTED: probable beta-D-xylosidase 7 [Pyrus x bretschneideri]
Length=784

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/744 (50%), Positives = 482/744 (65%), Gaps = 31/744 (4%)
 Frame = -3

Query  2445  FCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGIATNGPGI  2266
             FC T+LPI  R+  LVS LT DEKI +L ++   IPRLGIP+YEWWSE+LHG+A  G GI
Sbjct  48    FCKTTLPIYKRVRDLVSRLTFDEKISQLVNSAPPIPRLGIPSYEWWSEALHGVADVGKGI  107

Query  2265  TFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GLTFWAPNVNVF  2089
                  + +AT FPQVILT A+FN  LW  I      EARA++N+GQA G+TFWAPN+N+F
Sbjct  108   KLYPTINNATSFPQVILTVASFNDHLWYRIGQVIGTEARAVYNAGQATGMTFWAPNINIF  167

Query  2088  VDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEEEDDDRL  1909
              DPRWGRGQETPGEDP V   YAV YVRG+QG         K+ L             RL
Sbjct  168   RDPRWGRGQETPGEDPTVAGRYAVSYVRGVQGYSFFEG---KHKLGAG---------GRL  215

Query  1908  MLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCLMCAYNA  1729
               SACCKH TAYDL+ W+N +R+ F+A VT+QD+ DTY PPF+ CV++G+AS +MCAYN 
Sbjct  216   QASACCKHFTAYDLDNWNNVTRFRFDARVTQQDLADTYHPPFQKCVQEGQASGIMCAYNR  275

Query  1728  VNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIALKAGTD  1552
             VNG+P+CA+ +LL K AR  W F GYITSDCDAV+ I + Q YAK PE+A    LKAG D
Sbjct  276   VNGVPSCADYNLLTKVARGQWDFHGYITSDCDAVSIIHDMQGYAKKPEDAVADVLKAGMD  335

Query  1551  INCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESFGPKDVC  1372
             +NCG+Y+  ++KSA+E K +  S IDRAL N+FSV+ RLGLF+G  + + + + GP  VC
Sbjct  336   VNCGSYLKDHIKSAVEQKKLNVSKIDRALHNVFSVRMRLGLFDGNPLKQPYGTIGPDQVC  395

Query  1371  SSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTS-SLGGDYTGIPCAL  1195
             S  H+ LALEAAR GIVLLKN  + LPL K +  SLAVIGP+AN S +L G+Y G PC  
Sbjct  396   SKLHQALALEAARDGIVLLKNSGRLLPLPKAKAISLAVIGPLANASEALLGNYHGPPCKS  455

Query  1194  KSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQETEDHD  1015
              + L+ L +Y        GC  V C     F EAV  AK ADY++++VGLD SQE E HD
Sbjct  456   VTPLEALEDYAKDIISHPGCDSVQCPQA-AFDEAVGTAKEADYLVLIVGLDQSQEREGHD  514

Query  1014  RYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGYPGEEGG  835
             R  L LPG Q  L+  +A V+ KP+VLV+  GGP+DISFAK D ++ S+LW GYPGE GG
Sbjct  515   RLHLELPGKQQQLITSVAKVAKKPVVLVILSGGPVDISFAKFDKKVGSILWAGYPGEAGG  574

Query  834   KALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFYTGEKVYEF  655
              AL+EI+FGD+NP GRLP+ WY + + K+PM DM +R  P  GY GRTYRFY G K+++F
Sbjct  575   IALAEIIFGDHNPGGRLPMAWYTQDYVKMPMTDMRIRPHPKTGYLGRTYRFYAGRKLFDF  634

Query  654   GHGlsyssfslellSAPTRISL---SQSIKTKLRRSILNRGGNEPYVHVDEVSN--CNSL  490
             G+GLSYS++  E  SA ++  L     SI    + S   R     Y  V ++    C   
Sbjct  635   GYGLSYSNYVHEFASAESQNKLYLNESSISPTAKSSDSGR-----YQLVQDLGEEFCEKK  689

Query  489   AFSVRVSLRNNGGMDGSRVVMLF--SRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSIS  316
                VRV ++N+G M G   V+LF   + P +   G P KQL+GF  V ++     E    
Sbjct  690   KLPVRVGVQNHGEMAGKHPVLLFVGEKNPKN---GRPMKQLVGFQSVILNAGERAEVEFV  746

Query  315   IEPCQHLSIVNVEGSRILPLGDHI  244
             + PC+HLS  N EG  ++  G + 
Sbjct  747   LSPCEHLSHPNEEGLMVVEEGSYF  770



>ref|XP_010094323.1| Beta-D-xylosidase 1 [Morus notabilis]
 gb|EXB55743.1| Beta-D-xylosidase 1 [Morus notabilis]
Length=783

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/739 (47%), Positives = 488/739 (66%), Gaps = 31/739 (4%)
 Frame = -3

Query  2454  SYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGIATNG  2275
             S  FC T+LP+  R+  L+  LT+ EKI+ L +N   +PRLGI  YEWWSE+LHG++  G
Sbjct  50    SLRFCRTTLPVHVRVSDLIGRLTLQEKIRLLVNNAIEVPRLGIQGYEWWSEALHGVSNVG  109

Query  2274  PGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWAPNVN  2095
             PG  F GA   AT FPQVI TAA+FN +LW  I    + EARAM+N G AGLTFW+PNVN
Sbjct  110   PGTKFGGAFPGATSFPQVITTAASFNESLWEEIGRVVSDEARAMYNGGLAGLTFWSPNVN  169

Query  2094  VFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEEEDDD  1915
             +F DPRWGRGQETPGEDP++   YA  YVR                L GN         +
Sbjct  170   IFRDPRWGRGQETPGEDPVLAGKYAASYVR---------------GLQGNGA------GN  208

Query  1914  RLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCLMCAY  1735
             +L ++ACCKH TAYDL+ W+   RY FNA V+RQD+EDTY+ PFK+CV +G+ + +MC+Y
Sbjct  209   KLKVAACCKHYTAYDLDNWNGVDRYHFNARVSRQDLEDTYDVPFKACVVEGKVASVMCSY  268

Query  1734  NAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIALKAG  1558
             N VNG P CA+ DLL+   R  W   GYI SDCD+V  +++ Q Y K+PEEAA   +KAG
Sbjct  269   NQVNGKPTCADPDLLKNTIRGQWHLNGYIVSDCDSVGVLYDSQHYTKTPEEAAADTIKAG  328

Query  1557  TDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESFGPKD  1378
              D++CG ++    ++A+   ++ E D++ AL NL +VQ RLG+F+G+   + F + GP D
Sbjct  329   LDLDCGPFLAIYTEAAVRRGLLSEIDVNNALANLITVQMRLGMFDGEPSAQPFGNLGPND  388

Query  1377  VCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSLGGDYTGIPC  1201
             VC+  H++LALEAARQGIVLLKN +  LPL   R  ++AVIGP ++ T ++ G+Y G+ C
Sbjct  389   VCTPAHKQLALEAARQGIVLLKNREPTLPLSTRRHRTVAVIGPNSDVTVTMIGNYAGVAC  448

Query  1200  ALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQETED  1021
                + L G+G Y  KT + +GC  VAC++   F  A + A++AD  ++V+GLD S E E 
Sbjct  449   GYTTSLQGIGRYA-KTIHQAGCTGVACDNNQQFGAAEAAARQADATVLVMGLDQSIEAEF  507

Query  1020  HDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGYPGEE  841
              DR  LLLPGHQ  LV+ +A  S  P +LVL  GGP+D+SFA++DPRI ++LW+GYPG+ 
Sbjct  508   RDRSGLLLPGHQQELVSRVAKASRGPTILVLMSGGPIDVSFAQRDPRIGAILWVGYPGQA  567

Query  840   GGKALSEIVFGDYNPAGRLPLTWYPESF-TKVPMNDMNMRADPSRGYPGRTYRFYTGEKV  664
             GG A+++++FG  NP G+LP+TWYP+S+   VPM  M+MRA+P+RGYPGRTYRFY G  V
Sbjct  568   GGAAIADVLFGTTNPGGKLPMTWYPQSYLANVPMTSMDMRANPTRGYPGRTYRFYKGPVV  627

Query  663   YEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEVSNCNSLAF  484
             + FG+GLSY++F  +L  APT++S+  +   +L  S  N       V V   ++CNSL+ 
Sbjct  628   FPFGYGLSYTTFVHKLAQAPTQVSIPIA---RLHASSANSTSLSKAVRVTH-TDCNSLSL  683

Query  483   SVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSISIEPC  304
              + + + NNG  DG+  +++FS  PT     A  KQL+GF +VH++        + +  C
Sbjct  684   RIHIDVENNGPTDGTHTLLIFSTPPTHKW--AAHKQLVGFQKVHLAAGSRQRVILGVHVC  741

Query  303   QHLSIVNVEGSRILPLGDH  247
             +HLSIV+  G R +P+G+H
Sbjct  742   KHLSIVDQFGIRRIPMGEH  760



>ref|XP_002974833.1| hypothetical protein SELMODRAFT_101733 [Selaginella moellendorffii]
 gb|EFJ24353.1| hypothetical protein SELMODRAFT_101733 [Selaginella moellendorffii]
Length=784

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/742 (49%), Positives = 481/742 (65%), Gaps = 27/742 (4%)
 Frame = -3

Query  2454  SYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGIATNG  2275
             S+PFCDT L I  R+  LVS LT+DEK+  + +    IPRLG+P+Y+WW E+LHG+A++ 
Sbjct  48    SFPFCDTKLGIDVRVQDLVSRLTLDEKVDEMVNAAQGIPRLGVPSYQWWQEALHGVASS-  106

Query  2274  PGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWAPNVN  2095
             PG+ F G   +AT FP  I TAA+FN TL+ SI  A + EARA+ N G+AGLTFW+PNVN
Sbjct  107   PGVQFGGLAPAATSFPMPIATAASFNSTLFYSIGEAVSSEARALHNLGRAGLTFWSPNVN  166

Query  2094  VFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEEEDDD  1915
             +F DPRWGRGQETPGEDP++ S +A  YVR                L G    E    D 
Sbjct  167   IFRDPRWGRGQETPGEDPLLASKFASLYVR---------------GLQGGAY-EGSASDG  210

Query  1914  RLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCLMCAY  1735
              L +SACCKHLTAYD++ W    RY FNA V+ QD+ DTY PPF+SC+E GR S +MC+Y
Sbjct  211   FLKVSACCKHLTAYDVDNWKGMDRYHFNAEVSEQDLVDTYNPPFQSCIEDGRVSSVMCSY  270

Query  1734  NAVNGIPACANKDLL-EKARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIALKAG  1558
             N VNG+P CA+++LL E  R  WGF GYI SDCDA+  +FE   YA S E+A   ++ AG
Sbjct  271   NRVNGVPTCADRNLLTETVRNSWGFNGYIVSDCDALQVLFEDTTYAPSAEDAVADSILAG  330

Query  1557  TDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESFGPKD  1378
              D+NCGT++ ++ KSAL+   + E+D+D A+ NL   + RLGLF+G   ++ + S G  D
Sbjct  331   LDLNCGTFLGKHAKSALQAGKITEADLDHAVSNLMRTRMRLGLFDGDPNSQPYSSLGATD  390

Query  1377  VCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSLGGDYTGIPC  1201
             +CS++H++LAL+AA QG+VLLKN+   LPL  T + ++A+IGP AN T ++ G+Y GIPC
Sbjct  391   ICSNDHQQLALDAALQGVVLLKNDGS-LPL-STALKTVALIGPNANATYTMLGNYEGIPC  448

Query  1200  ALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQETED  1021
                S L G+  Y     Y+ GC +VACN  D  A AV +A +AD V++VVGLD SQE E 
Sbjct  449   KYISPLQGMQIYSSNILYSPGCRNVACNEGDLVASAVEVATKADAVVLVVGLDQSQERET  508

Query  1020  HDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGYPGEE  841
              DR SLLLPG Q  LV+ +A     P+VLV+   GP+DIS  K + RI+SV+W+GYPG+ 
Sbjct  509   FDRTSLLLPGMQSQLVSNIANAVTSPIVLVIMSAGPVDISTFKDNSRISSVIWLGYPGQS  568

Query  840   GGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFYTGEKVY  661
             GG AL+ +VFG YNP GRLP TWY E FT V M DM MR +P  GYPGR+YRFYTG  +Y
Sbjct  569   GGAALAHVVFGAYNPGGRLPNTWYHEEFTNVSMLDMQMRPNPLSGYPGRSYRFYTGTPLY  628

Query  660   EFGHGlsyssfslellSAPTRISLSQSIKTKLRRS-ILNRGGNEP---YVHVDEVSNCNS  493
              FG GLSYS++  + L APT++S  +S     R    +NR   +    ++  D++  CNS
Sbjct  629   NFGDGLSYSTYFYKFLLAPTKLSFFKSNTGNSRGCPAVNRSKAKSGCFHLPADDLETCNS  688

Query  492   LAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSISI  313
             + F V V + N G   GS  V++FS  P     GAP KQLI F +VH+  +        I
Sbjct  689   ILFQVSVEVSNLGPRSGSHSVLIFSAPPP--VEGAPLKQLIAFQKVHLESDTTQRLIFGI  746

Query  312   EPCQHLSIVNVEGSRILPLGDH  247
             +PC+HLS V   G R L  G H
Sbjct  747   DPCKHLSSVRRNGKRFLHSGRH  768



>ref|XP_003638778.1| Xylan 1 4-beta-xylosidase [Medicago truncatula]
 gb|KEH34893.1| glycoside hydrolase family 3 amino-terminal domain protein [Medicago 
truncatula]
Length=776

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/749 (50%), Positives = 489/749 (65%), Gaps = 31/749 (4%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P+  SYPFC+  LPI  R   LVS LT+DEK+ +L ++   IPRLGIPAYEWWSE+LHGI
Sbjct  37    PSTRSYPFCNPKLPITQRTKDLVSRLTLDEKLAQLVNSAPPIPRLGIPAYEWWSEALHGI  96

Query  2286  ATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GLTFW  2110
                G GI F+G++ SAT FPQVILTAA+F+  LW  I  A  VEARA++N GQA G+TFW
Sbjct  97    GNVGRGIFFNGSITSATSFPQVILTAASFDSHLWYRIGQAIGVEARAIYNGGQAMGMTFW  156

Query  2109  APNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEE  1930
             APN+N+F DPRWGRGQET GEDPM+ S+YAV YVRGLQG           S  G ++   
Sbjct  157   APNINIFRDPRWGRGQETAGEDPMMTSNYAVSYVRGLQGD----------SFQGGKL---  203

Query  1929  EEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASC  1750
                   L  SACCKH TAYDL+ W   +R+ F+A V+ QD+ DTY+PPF+SC+E+GRAS 
Sbjct  204   ---RGHLQASACCKHFTAYDLDNWKGVNRFHFDARVSLQDLADTYQPPFRSCIEQGRASG  260

Query  1749  LMCAYNAVNGIPACANKDLL-EKARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGI  1573
             +MCAYN VNGIP+CA+ +LL    R  W F GYI SDC AV  I + Q YAKS E+A   
Sbjct  261   IMCAYNRVNGIPSCADFNLLTNTVRKQWEFHGYIVSDCGAVGIIHDEQGYAKSAEDAVAD  320

Query  1572  ALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFES  1393
              L AG D+ CG+Y+  + KSA++ K +    IDRAL NLFS++ RLG F+G      F  
Sbjct  321   VLHAGMDLECGSYLTDHAKSAVQQKKLPIVRIDRALHNLFSIRIRLGQFDGNPAKLPFGM  380

Query  1392  FGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTS--SLGGD  1219
              GP  VCS  H  LALEAAR GIVLLKN    LPL KT +S LAVIGP AN S  +L G+
Sbjct  381   IGPNHVCSENHLYLALEAARNGIVLLKNTASLLPLPKTSIS-LAVIGPNANASPLTLLGN  439

Query  1218  YTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDL  1039
             Y G PC   ++L G   Y+    +  GC      ++    +AV +AK ADYV++V+GLD 
Sbjct  440   YAGPPCKSITILQGFQHYVKNAVFHPGCDGGPKCASAPIDKAVKVAKNADYVVLVMGLDQ  499

Query  1038  SQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWI  859
             S E E+ DR  L LPG Q+ L+N +A  S +P++LVL  GGP+DIS AK + +I  ++W 
Sbjct  500   SVEREERDRVHLDLPGKQLELINSVAKASKRPVILVLLCGGPIDISSAKNNDKIGGIIWA  559

Query  858   GYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFY  679
             GYPGE GG AL++I+FGD+NP GRLP+TWYP+ + KVPM DM MRADP+ GYPGRTYRFY
Sbjct  560   GYPGELGGIALAQIIFGDHNPGGRLPITWYPKDYIKVPMTDMRMRADPTTGYPGRTYRFY  619

Query  678   TGEKVYEFGHGlsyssfslellSAP-TRISLSQS---IKTKLRRSILNRGGNEPYVHVDE  511
              G  VYEFGHGLSY+ +S E +S    ++  +QS   + T+   +I  +  +E    +DE
Sbjct  620   KGPTVYEFGHGLSYTKYSYEFVSVTHDKLHFNQSSTHLMTENSETIRYKLVSE----LDE  675

Query  510   VSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVT  331
                C S++ SV V ++N+G + G   ++LF R P  +   +P KQL+GF  + +    ++
Sbjct  676   -ETCKSMSVSVTVGVKNHGNIVGRHPILLFMR-PQKHRTRSPMKQLVGFHSLLLDAGEMS  733

Query  330   ETSISIEPCQHLSIVNVEGSRILPLGDHI  244
                  + PC+HLS  N  G +I+  G H+
Sbjct  734   HVGFELSPCEHLSRANEAGLKIIEEGSHL  762



>ref|XP_006301942.1| hypothetical protein CARUB_v10022420mg [Capsella rubella]
 gb|EOA34840.1| hypothetical protein CARUB_v10022420mg [Capsella rubella]
Length=767

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/757 (52%), Positives = 488/757 (64%), Gaps = 34/757 (4%)
 Frame = -3

Query  2487  PQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             P   C P  P    Y FC T L I  R H LVS LTVDEKI +L +    IPRLG+PAYE
Sbjct  22    PPHACDPSNPATKLYQFCRTDLQISNRAHDLVSRLTVDEKISQLVNTAPGIPRLGVPAYE  81

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSE+LHGIA  GPG  F+G VK+AT FPQVILTAA+F+   W  I  A   EAR M+N+
Sbjct  82    WWSEALHGIAYTGPGTWFNGTVKAATSFPQVILTAASFDSYEWFRIGQAIGEEARGMYNA  141

Query  2133  GQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYS  1957
             GQA G+TFWAPN+N+F DPRWGRGQETPGEDP +   YAV YVRGLQG           S
Sbjct  142   GQANGMTFWAPNINIFRDPRWGRGQETPGEDPTMTGSYAVAYVRGLQGD----------S  191

Query  1956  LSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKS  1777
               G ++         L  SACCKH TAYDL+ W   +RY FNA V+  DM +TY+PPFK 
Sbjct  192   FDGRKV----LSGAHLQASACCKHFTAYDLDRWKGVTRYVFNAQVSLADMAETYQPPFKK  247

Query  1776  CVEKGRASCLMCAYNAVNGIPACANKDLL-EKARTDWGFEGYITSDCDAVATIFEYQQYA  1600
             CVE+GRA+C+MCAY  VNGIP+CA+ +LL    R  WGF GYI SDCDAV+ I+E Q YA
Sbjct  248   CVEEGRATCIMCAYTRVNGIPSCADPNLLTHTVRGLWGFRGYIASDCDAVSLIYEAQGYA  307

Query  1599  KSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNG  1420
             KS E+A G  LKAG D+NCG+Y+ ++ KSAL+ K V ESDIDRALLNLFSV+ RLGLFNG
Sbjct  308   KSHEDAVGDVLKAGMDVNCGSYLQKHTKSALQQKKVSESDIDRALLNLFSVRIRLGLFNG  367

Query  1419  KAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN  1240
                   + +  PKDVCS  H  LAL+AAR GIVLLKN  K L       SSLAVIGP AN
Sbjct  368   DPTKLPYGNISPKDVCSPAHEALALDAARNGIVLLKNNLKLL-PLSKSSSSLAVIGPNAN  426

Query  1239  TS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYV  1063
              + +L G+Y G PC   + LD L  Y+    Y  GC  V C++ D   +AV+IA+ AD+V
Sbjct  427   AARTLLGNYAGPPCKTVTPLDALRGYVKNAVYHQGCDAVVCSNAD-INQAVAIARNADHV  485

Query  1062  IVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDP  883
             ++++GLD +QE ED DR SL LPG Q  L+   A  + KP+VLVL  GGP+D+SFA  + 
Sbjct  486   VLIMGLDQTQEKEDLDRVSLTLPGKQQDLITSAANAAKKPVVLVLICGGPVDVSFATNND  545

Query  882   RIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGY  703
             +I S++W GYPGE GG AL+EI+FGD+NP GRLP+TWYP+SF  V M DM MR+  + GY
Sbjct  546   KIGSIIWAGYPGEAGGIALAEIIFGDHNPGGRLPVTWYPQSFVNVKMTDMRMRS--ATGY  603

Query  702   PGRTYRFYTGEKVYEFGHGlsyssfslellSAP-TRISLSQSIKTKLRRSILNRGGNEPY  526
             PGRTY+FY G KV+EFGHGLSYS +S    + P T++ L+QS      +++LN      Y
Sbjct  604   PGRTYKFYKGPKVFEFGHGLSYSKYSYRFKNLPETKLYLNQS------KALLNSDSVR-Y  656

Query  525   VHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGA-PQKQLIGFDRV  355
               V E+    CN     V V++ N G M G   V++F+R       G   +KQL+GF  +
Sbjct  657   ALVSEMEKEACNVAKTKVTVTVENQGEMAGKHPVLMFARHERGGEDGKRAEKQLVGFKSI  716

Query  354   HVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
              +S     E    I  C+HLS  N  G  ++  G + 
Sbjct  717   VLSYGEKAEMEFEIGLCEHLSRANEVGVMVVEEGKYF  753



>ref|XP_004494414.1| PREDICTED: probable beta-D-xylosidase 2-like [Cicer arietinum]
Length=771

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/757 (46%), Positives = 481/757 (64%), Gaps = 34/757 (4%)
 Frame = -3

Query  2502  TSYSKPQLPCQPP--THSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLG  2329
             T  S+    C P   T    PFC   L IP R+  ++  LT+ EK+  L +N +A+PR G
Sbjct  20    TCESRDTFACDPKDGTTKKLPFCSVKLAIPERVKDIIGRLTLQEKVNLLVNNAAAVPRFG  79

Query  2328  IPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavear  2149
             I  YEWWSE+LHG++  GPG  F      AT FPQVI TAA+FN +LW +I    + EAR
Sbjct  80    IKGYEWWSEALHGVSNVGPGTKFGALFPGATSFPQVITTAASFNASLWEAIGRVVSDEAR  139

Query  2148  AMFNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkng  1969
             AM+N G AGLT+W+PNVN+F DPRWGRGQETPGEDP++   YA  YV+            
Sbjct  140   AMYNGGAAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGSYAASYVK------------  187

Query  1968  RKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEP  1789
                 L G        D +RL ++ACCKH TAYD++ W+   R+ FNA V++QD+EDT++ 
Sbjct  188   ---GLQGT-------DGNRLKVAACCKHFTAYDIDNWNGVDRFHFNAQVSKQDIEDTFDV  237

Query  1788  PFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEY  1612
             PF+ CV++G+ + +MC+YN VNG+P CA+ +LL+K  R  WG +GYI SDCD+V   +  
Sbjct  238   PFRMCVKEGKVASVMCSYNQVNGVPTCADPNLLKKTVRGQWGLDGYIVSDCDSVGVFYNS  297

Query  1611  QQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLG  1432
             Q Y  +PEEAA  A+KAG D++CG ++  + + A++  +V ESD++ AL+N  +VQ RLG
Sbjct  298   QHYTSTPEEAAADAIKAGLDLDCGPFLGIHTQDAVKKGLVTESDVNGALVNTLTVQMRLG  357

Query  1431  LFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIG  1252
             +F+G+   + +   GPKDVC   H+ LALEAARQGIVLLKN    LPL      ++A+IG
Sbjct  358   MFDGEPSAQAYGKLGPKDVCKPAHQELALEAARQGIVLLKNTGPTLPLSTQHHRTVAIIG  417

Query  1251  PMAN-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKR  1075
             P +N T ++ G+Y GI C   S L+G+G Y  +T +  GC++VAC     F  A+  A++
Sbjct  418   PNSNVTVTMIGNYAGIACGYTSPLEGIGRYA-RTIHQPGCVNVACKDDKNFGPALDAARQ  476

Query  1074  ADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFA  895
             AD  ++V+GLD S E E  DR  LLLPGHQ  LV+++A  S  P +LVL  GGP+DI+FA
Sbjct  477   ADATVLVIGLDQSIEAETIDRTGLLLPGHQQDLVSKVAAASKGPTILVLMSGGPIDITFA  536

Query  894   KKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTK-VPMNDMNMRAD  718
             K DPRIA +LW GYPG+ GG A+++I+FG  NP G+LP+TWYP+ + K + M +M MRA 
Sbjct  537   KNDPRIAGILWAGYPGQAGGAAIADILFGTANPGGKLPVTWYPQEYLKNLAMTNMAMRAS  596

Query  717   PSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGG  538
              S GYPGRTYRFY G  VY FGHGL+Y+ F   L SAPT +    S+     R   N   
Sbjct  597   -SIGYPGRTYRFYKGPVVYPFGHGLTYTHFVQTLSSAPTLV----SVPVHGHRHGNNTNI  651

Query  537   NEPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDR  358
             +   + V   + C  L+ ++ V ++N G  DG+  +++FS  P   A   PQKQL+ F++
Sbjct  652   SNKAIRVTH-AKCGKLSITLHVDVKNVGSRDGTHTLLVFSAPPNGGAHWVPQKQLVAFEK  710

Query  357   VHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             VHV+ N       +I  C+ LS+V+  G R +P+G+H
Sbjct  711   VHVAANTKQRVRFNIHVCKFLSVVDRSGIRRIPMGEH  747



>gb|EPS70883.1| hypothetical protein M569_03875, partial [Genlisea aurea]
Length=716

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/722 (51%), Positives = 475/722 (66%), Gaps = 31/722 (4%)
 Frame = -3

Query  2445  FCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGIATNGPGI  2266
             FC TSLPI  R+  LVS LT++EKI +L ++ +AIPRLGIPAYEWWSE+LHG++  G G+
Sbjct  17    FCRTSLPIRRRVEDLVSRLTLEEKISQLVNSAAAIPRLGIPAYEWWSEALHGVSNYGLGV  76

Query  2265  TFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GLTFWAPNVNVF  2089
             +F G +  AT FPQVIL+AA F+  LW  I  AA  EARA+FN GQ  G+TFWAPN+N+F
Sbjct  77    SFSGKITGATSFPQVILSAATFDSRLWYRIGKAAGTEARAVFNEGQGKGMTFWAPNINIF  136

Query  2088  VDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEEEDDDRL  1909
              DPRWGRGQETPGEDP+V S YAV +V G QG   K       S SG+R+  +   +D L
Sbjct  137   RDPRWGRGQETPGEDPLVASKYAVAFVTGFQGGTPK-------SRSGDRL--DAATNDHL  187

Query  1908  MLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCLMCAYNA  1729
             + SACCKH TAYDLE W+  +R  F+A VT+QD+ DT++PPFKSCV +G+AS +MCAYN 
Sbjct  188   LASACCKHFTAYDLERWNGVTRLDFDAKVTKQDLADTFQPPFKSCVVEGKASGIMCAYNR  247

Query  1728  VNGIPACANKDLL-EKARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIALKAGTD  1552
             VNGIP CA+ +LL   AR  WGF GYITSDC+AV+ I + Q YAK PE+A    LKAG D
Sbjct  248   VNGIPNCADHNLLTSTARHLWGFHGYITSDCNAVSIIHDIQNYAKLPEDAVADVLKAGMD  307

Query  1551  INCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESFGPKDVC  1372
             + CG+Y+    KSA++   +  S+IDRAL NLFSV+ RLGLF+G   ++ +   G   VC
Sbjct  308   VECGSYLQSYTKSAVDQNKLPVSEIDRALHNLFSVRMRLGLFDGDPRSQVYGKLGADHVC  367

Query  1371  SSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTS-SLGGDYTGIPCAL  1195
             +  H+ LALE AR GIVLLKN    LPL ++ VSSLAVIGP AN++  L GDY G PC  
Sbjct  368   TQAHQDLALETARNGIVLLKNSGNLLPLSESHVSSLAVIGPNANSAYVLLGDYEGPPCKS  427

Query  1194  KSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQETEDHD  1015
               +L  L +Y+ KTS+  GC  V C S +    AV  A+ A++V++V+GL+  QE EDHD
Sbjct  428   VEILKALRKYVEKTSFLPGCDFVNCTSAN-VEAAVGTAREAEHVVMVMGLNQDQEREDHD  486

Query  1014  RYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGYPGEEGG  835
             R  L LPG Q  L+  +A  S  P++LVL  GGP+D+SFA+ DP+I S+LW GYPGE GG
Sbjct  487   RVDLKLPGQQETLITAVASASKNPVILVLLSGGPVDVSFARDDPKIGSILWAGYPGEAGG  546

Query  834   KALSEIVFGDYNPAGRLPLTWYPESF-TKVPMNDMNMRADPSRGYPGRTYRFYTGEKVYE  658
              AL+EI+FG++NP G+LP+TWYP  F  K PM DM MR+DPS GYPGRTYRFY G KV+E
Sbjct  547   IALAEIIFGEHNPGGKLPVTWYPNDFIIKTPMTDMRMRSDPSSGYPGRTYRFYNGPKVFE  606

Query  657   FGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEVSN-----CNS  493
             FGHGLSY+++S     A T  ++            LNR   + Y     VS+     C  
Sbjct  607   FGHGLSYTTYSYRFNPAKTPNAIH-----------LNRHSADNYSDYLSVSDIGTDTCAM  655

Query  492   LAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSISI  313
               FS  V + N G + G   V+LF+R+        P K+L+GF  V +      E    +
Sbjct  656   SNFSAHVGVENTGEVAGKHPVLLFARSEEE-GSNHPVKKLVGFRSVVLRPKERIEVEFVL  714

Query  312   EP  307
              P
Sbjct  715   NP  716



>ref|XP_010428909.1| PREDICTED: probable beta-D-xylosidase 7 isoform X1 [Camelina 
sativa]
 ref|XP_010428911.1| PREDICTED: probable beta-D-xylosidase 7 isoform X3 [Camelina 
sativa]
Length=766

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/761 (51%), Positives = 488/761 (64%), Gaps = 40/761 (5%)
 Frame = -3

Query  2487  PQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             P   C P  PT   Y FC T LP+  R   LVS LTVDEKI +L +    IPRLG+PAYE
Sbjct  22    PPHACDPSNPTTKLYQFCRTELPVNKRARDLVSRLTVDEKISQLVNTAPGIPRLGVPAYE  81

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSE+LHG+A  GPGI F+G VK+AT FPQVILTAA+F+   W  IA     EAR ++N+
Sbjct  82    WWSEALHGVAGVGPGIRFNGTVKAATSFPQVILTAASFDSYEWFRIAQVIGREARGVYNA  141

Query  2133  GQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYS  1957
             GQA G+TFWAPN+N+F DPRWGRGQETPGEDPM+   YAV YVR                
Sbjct  142   GQAKGMTFWAPNINIFRDPRWGRGQETPGEDPMMTGSYAVAYVR---------------G  186

Query  1956  LSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKS  1777
             L G+     +     L  SACCKH TAYDL+ W+  +RY FNA V+  D+ +TY+PPFK 
Sbjct  187   LQGDSFDGRKSLAGHLQASACCKHFTAYDLDRWNGITRYVFNAQVSLADLAETYQPPFKK  246

Query  1776  CVEKGRASCLMCAYNAVNGIPACANKDLL-EKARTDWGFEGYITSDCDAVATIFEYQQYA  1600
             CVE+GRAS +MC+YN VNGIP CA+ +LL + AR  W F+GYITSDCDAV+ I + Q YA
Sbjct  247   CVEEGRASGVMCSYNRVNGIPTCADPNLLTQTARGLWRFQGYITSDCDAVSIIHDAQGYA  306

Query  1599  KSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNG  1420
             K+PE+A    LKAG D+NCG+Y+ ++ KSAL+ K V E DIDRALLNL SV+ RLGLFNG
Sbjct  307   KTPEDAVADVLKAGMDVNCGSYLQKHTKSALQQKKVSEYDIDRALLNLISVRIRLGLFNG  366

Query  1419  KAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN  1240
                   + +  P +VC+  H+ LALEAAR GIVLLKN  K LPL K    SLAVIGP A 
Sbjct  367   DPTKLPYGNISPNEVCAPAHQALALEAARNGIVLLKNNLKLLPLSKAS-PSLAVIGPNAY  425

Query  1239  TS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYV  1063
              + +L G+Y G PC   + LD L  Y+    Y  GC  VAC S     +AV++A+ AD+V
Sbjct  426   AAKTLQGNYAGPPCKTVTPLDALRGYVKNAVYHQGCDSVAC-SNAAINQAVAVARNADHV  484

Query  1062  IVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDP  883
             ++++GLDL+QE ED DR SL LPG Q  L+  +A  + KP+VLVL  GGP+D+SFA  + 
Sbjct  485   VMIMGLDLTQEKEDLDRVSLSLPGKQQELITSVANAAKKPVVLVLICGGPVDVSFATNNN  544

Query  882   RIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGY  703
             +I S++W GYPGE GG AL+EI+FGD+NP GRLP+TWYP+SF  V M DM MR+  + GY
Sbjct  545   KIGSIIWAGYPGEAGGTALAEIIFGDHNPGGRLPVTWYPQSFVNVKMTDMRMRS--ATGY  602

Query  702   PGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYV  523
             PGRTY+FY G KV+EFGHGLSYS +S +    P  +SL  + +TK++        +  Y 
Sbjct  603   PGRTYKFYKGPKVFEFGHGLSYSKYSYQFKH-PAEMSLYLN-QTKVQ----TNSDSVRYA  656

Query  522   HVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGA-PQKQLIGFDRVH  352
              V E+    CN     V V++ N G M G   V++F+R       G   +KQL+GF  + 
Sbjct  657   LVSEMEKQGCNVAKTKVTVTVENQGEMAGKHPVLMFARHERGGEDGKRAEKQLVGFKSIV  716

Query  351   VSGNGVTETSISIEPCQHLSIVN-------VEGSRILPLGD  250
             +S     E    I  C+HLS  N        EG   L +GD
Sbjct  717   LSNGEKAEMEFEIGLCEHLSRANEVGLMVVEEGKYFLTVGD  757



>ref|XP_010472005.1| PREDICTED: probable beta-D-xylosidase 7 [Camelina sativa]
Length=764

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/758 (51%), Positives = 488/758 (64%), Gaps = 34/758 (4%)
 Frame = -3

Query  2493  SKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             + P   C P  P    Y FC T LP+  R   LVS LTVDEKI +L +    IPRLGIPA
Sbjct  19    ATPPHACDPSNPATKLYQFCRTDLPVNKRARDLVSRLTVDEKISQLVNTAPGIPRLGIPA  78

Query  2319  YEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMF  2140
             YEWWSE+LHG+A  GPGI F+G VK+AT FPQVILTAA+F+   W  IA     EAR ++
Sbjct  79    YEWWSEALHGVAGVGPGIRFNGTVKAATSFPQVILTAASFDSYEWFRIAQVIGREARGVY  138

Query  2139  NSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             N+GQA G+TFWAPN+NVF DPRWGRGQETPGEDPM+   YAV YVR              
Sbjct  139   NAGQARGMTFWAPNINVFRDPRWGRGQETPGEDPMMTGSYAVAYVR--------------  184

Query  1962  YSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
               L G+     +     L  SACCKH TAYDL+ W+  +RY FNA V+  D+ +TY+PPF
Sbjct  185   -GLQGDSFDGRKSLAGHLQASACCKHFTAYDLDRWNGITRYVFNAQVSLADLAETYQPPF  243

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLL-EKARTDWGFEGYITSDCDAVATIFEYQQ  1606
             K CVE+GRAS +MC+YN VNGIP CA+ +LL + AR  W F+GYITSDCDAV+ I + Q 
Sbjct  244   KKCVEEGRASGVMCSYNRVNGIPTCADPNLLTQTARGLWRFQGYITSDCDAVSIIHDAQG  303

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             YAK+PE+A    LKAG D+NCG+Y+ ++ KSAL+ K V E DIDRAL+NL SV+ RLGLF
Sbjct  304   YAKTPEDAVADVLKAGMDVNCGSYLQKHTKSALQQKKVSEYDIDRALINLVSVRIRLGLF  363

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPM  1246
             NG      + +  P +VC+  H+ LALEAAR GIVLLKN  K LPL K    SLAVIGP 
Sbjct  364   NGDPTKLPYGNISPNEVCAPAHQALALEAARNGIVLLKNNLKLLPLSKAS-PSLAVIGPN  422

Query  1245  ANTS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             A  + +L G+Y G PC   + LD L  Y+    Y  GC  VAC S    ++AV+IA+ AD
Sbjct  423   AYAAKTLLGNYAGPPCKTVTPLDALRGYVKNAVYHQGCDSVAC-SNAAISQAVAIARNAD  481

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
             +V++++GLDL+QE ED DR SL LPG Q  L+  +A  + KP+VLVL  GGP+D+SFA  
Sbjct  482   HVVLIMGLDLTQEKEDLDRVSLNLPGKQQELITSVANAAKKPVVLVLICGGPVDVSFATN  541

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSR  709
             + +I S++W GYPGE GG AL+EI+FGD+NP GRLP+TWYP+SF  V M DM MR+  + 
Sbjct  542   NNKIGSIIWAGYPGEAGGTALAEIIFGDHNPGGRLPVTWYPQSFVNVKMTDMRMRS--AT  599

Query  708   GYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEP  529
             GYPGRTY+FY G KV+EFGHGLSYS +S +  + P  +SL  +    L  S   R     
Sbjct  600   GYPGRTYKFYKGPKVFEFGHGLSYSKYSYQFKN-PAEMSLYLNQTKALTNSDSVR-----  653

Query  528   YVHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGA-PQKQLIGFDR  358
             Y  V E+    CN +A  V VS+ N G M G   V++F+R       G   +KQL+GF  
Sbjct  654   YALVSEMEKQGCN-VAKKVTVSVENQGEMAGKHPVLMFARHERGGEDGKRAEKQLVGFKS  712

Query  357   VHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             + +S     E    I  C+HLS  N  G  ++  G + 
Sbjct  713   IVLSNGEKAEMEFEIGLCEHLSRANEVGVMVVEEGKYF  750



>gb|KDP28242.1| hypothetical protein JCGZ_14013 [Jatropha curcas]
Length=772

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/759 (46%), Positives = 488/759 (64%), Gaps = 39/759 (5%)
 Frame = -3

Query  2502  TSYSKPQLPCQPP--THSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLG  2329
             TS +     C P   T  + PFC   LPI  R+  L+  LT+ EK+  L +N +++ RLG
Sbjct  23    TSKAIEPFACDPKEETTRNLPFCQVKLPIQDRVKDLIGRLTLQEKVVLLVNNAASVSRLG  82

Query  2328  IPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavear  2149
             I  YEWWSE+LHG++  GPG  F GA   AT FPQVI TAA+FN TLW +I    + EAR
Sbjct  83    IKGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNATLWEAIGRVVSDEAR  142

Query  2148  AMFNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkng  1969
             AM+N G  GLT+W+PNVN+F DPRWGRGQETPGEDP+VV  YA  YV+            
Sbjct  143   AMYNGGMGGLTYWSPNVNIFRDPRWGRGQETPGEDPLVVGKYAASYVK------------  190

Query  1968  RKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEP  1789
                 L GN       + DRL ++ACCKH TAYDL+ W+   R+ FNA V++QD+ DT++ 
Sbjct  191   ---GLQGN-------EGDRLKVAACCKHFTAYDLDNWNGVDRFHFNAKVSKQDIVDTFDV  240

Query  1788  PFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEY  1612
             PF+ CV++G+ + +MC+YN VNGIP CA+ +LL+K  RT WG  GYI SDCD+V   +  
Sbjct  241   PFRMCVKEGKVASVMCSYNQVNGIPTCADPNLLQKTVRTQWGLNGYIVSDCDSVGVYYNQ  300

Query  1611  QQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLG  1432
             Q Y  +PEEAA  A+KAG D++CG ++ ++ + A++  ++ E+ ++ AL+N  +VQ RLG
Sbjct  301   QHYTSTPEEAAADAIKAGLDLDCGPFLAKHTQDAVKRGLINEAHVNGALVNTLTVQMRLG  360

Query  1431  LFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQK--FLPLDKTRVSSLAV  1258
             +F+G+  +  + + GP+DVC+  H+ LALEAARQGIVLLKN      LPL   R  ++AV
Sbjct  361   MFDGEPSSHPYGNLGPEDVCTQAHQELALEAARQGIVLLKNNNHGPSLPLFTHRHRTIAV  420

Query  1257  IGPMAN-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIA  1081
             IGP +N T ++ G+Y G+ C   + L G+G Y  +T Y  GC DV C S   F EA+  A
Sbjct  421   IGPNSNVTVTMIGNYAGVACGYTTPLQGIGSYA-RTIYKQGCPDVGCASDQLFGEAIGAA  479

Query  1080  KRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDIS  901
              +AD  ++V+GLD S E E  DR  LLLPG Q   V+++A  S  P +LVL  GGP+D+S
Sbjct  480   SQADATVLVMGLDQSIEAEFRDRTGLLLPGRQQEFVSKVASASKGPTILVLMSGGPIDVS  539

Query  900   FAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESF-TKVPMNDMNMR  724
             FAK DP+I+++LW GYPG+ GG A+++++FG  NP G+LP+TWYP+ + T +PM +M MR
Sbjct  540   FAKNDPKISAILWTGYPGQAGGAAIADVLFGTTNPGGKLPMTWYPQDYITNLPMTEMGMR  599

Query  723   ADPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNR  544
             +  S+GYPGRTYRFY GE VY FGHG+SY++F   + SAPT +S+  +     R +    
Sbjct  600   SSQSKGYPGRTYRFYKGEVVYPFGHGMSYTNFVHNIASAPTMVSVPLA---GHRGNTTIS  656

Query  543   GGNEPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGF  364
             G      H    + CN L+  ++V ++N G  DG+  ++++S  P      AP KQL+ F
Sbjct  657   GKAIRVTH----TKCNRLSLGLQVDVKNVGSKDGTYTLLVYSTPPAGLW--APHKQLVAF  710

Query  363   DRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             ++VHV+        I+I  C++LS+V+  G R +P+G H
Sbjct  711   EKVHVAAGSQQRVGINIHVCKYLSVVDKYGIRRIPIGLH  749



>ref|XP_010416771.1| PREDICTED: probable beta-D-xylosidase 7 [Camelina sativa]
Length=765

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/755 (50%), Positives = 487/755 (65%), Gaps = 33/755 (4%)
 Frame = -3

Query  2487  PQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             P   C P  P+   Y FC T LP+  R   LVS LTVDEKI +L +    IPRLG+PAYE
Sbjct  21    PPHACDPSNPSTKLYQFCRTDLPVNKRARDLVSRLTVDEKISQLVNTAPGIPRLGVPAYE  80

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSE+LHG+A  GPGI F+G VK+AT FPQVILTAA+F+   W  IA     EAR ++N+
Sbjct  81    WWSEALHGVAGVGPGIRFNGTVKAATSFPQVILTAASFDSYEWFRIAQVIGREARGVYNA  140

Query  2133  GQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYS  1957
             GQA G+TFWAPN+N+F DPRWGRGQETPGEDPM+   YAV YVR                
Sbjct  141   GQARGMTFWAPNINIFRDPRWGRGQETPGEDPMMTGSYAVAYVR---------------G  185

Query  1956  LSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKS  1777
             L G+     +     L  SACCKH TAYDL+ W+  +RY FNA V+  D+ +TY+PPFK 
Sbjct  186   LQGDSFDGRKSLAGHLQASACCKHFTAYDLDRWNGITRYVFNAQVSLADLAETYQPPFKK  245

Query  1776  CVEKGRASCLMCAYNAVNGIPACANKDLL-EKARTDWGFEGYITSDCDAVATIFEYQQYA  1600
             CVE+GRAS +MC+YN VNGIP CA+ +LL + AR  W F+GYITSDCDAV+ I + Q YA
Sbjct  246   CVEEGRASGVMCSYNRVNGIPTCADPNLLTQTARGLWRFQGYITSDCDAVSIIHDAQGYA  305

Query  1599  KSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNG  1420
             K+PE+A    LKAG D+NCG+Y+ ++ KSAL+ K V E DIDRALLNL SV+ RLGLFNG
Sbjct  306   KTPEDAVADVLKAGMDVNCGSYLQKHTKSALQQKKVSEYDIDRALLNLISVRIRLGLFNG  365

Query  1419  KAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN  1240
              +    + +  P +VC+  H+ LALEAAR GIVLLKN  K LPL K    SLAVIGP A 
Sbjct  366   DSTKLPYGNISPNEVCAPAHQALALEAARNGIVLLKNNLKLLPLPKAS-PSLAVIGPNAY  424

Query  1239  TS-SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYV  1063
              + +L G+Y G PC   + LD L  Y+    Y  GC  VAC S    ++AV+IA+ AD+V
Sbjct  425   AAKTLLGNYAGPPCKTVTPLDALRGYVKNAVYHQGCDSVAC-SNAAISQAVAIARNADHV  483

Query  1062  IVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDP  883
             ++++GLDL+QE ED DR SL LPG Q  L+  +A  + KP+VLVL  GGP+D+SFA  + 
Sbjct  484   VLIMGLDLTQEKEDLDRVSLNLPGKQQELITSVANAAKKPVVLVLICGGPVDVSFATNNN  543

Query  882   RIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGY  703
             +I S++W GYPGE GG AL+EI+FGD+NP GRLP+TWYP+SF  V M DM MR+  + GY
Sbjct  544   KIGSIIWAGYPGEAGGTALAEIIFGDHNPGGRLPVTWYPQSFVNVKMTDMRMRS--ATGY  601

Query  702   PGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYV  523
             PGRTY+FY G KV+EFGHGLSYS ++ +  + P  +SL  +     +  +     +  Y 
Sbjct  602   PGRTYKFYKGPKVFEFGHGLSYSKYAYQFKN-PAEMSLYLN-----QSKVQTNSDSVRYA  655

Query  522   HVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGA-PQKQLIGFDRVH  352
              V E+    CN     V VS+ N G M G   V++F+R       G   +KQL+GF  + 
Sbjct  656   LVSEMEKEGCNVAKTKVTVSVENKGEMAGKHPVLMFARHERGGEDGKRAEKQLVGFKSIV  715

Query  351   VSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             +S     E    I  CQHLS  N  G  ++  G +
Sbjct  716   LSNGEKAEMEFEIGLCQHLSRANEVGVMVVEEGKY  750



>ref|XP_003520749.2| PREDICTED: probable beta-D-xylosidase 2-like [Glycine max]
Length=802

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/757 (45%), Positives = 487/757 (64%), Gaps = 33/757 (4%)
 Frame = -3

Query  2502  TSYSKPQLPCQPPTHSS--YPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLG  2329
             T  ++    C P   ++   PFC  SL IP R+  LV  LT+ EK++ L +N +A+PRLG
Sbjct  51    TCEARDPFACDPKNGATENMPFCKASLAIPERVKDLVGRLTLQEKVRLLVNNAAAVPRLG  110

Query  2328  IPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavear  2149
             +  YEWWSE+LHG++  GPG+ F+     AT FPQVI TAA+FN +LW +I    + EAR
Sbjct  111   MKGYEWWSEALHGVSNVGPGVKFNAQFPGATSFPQVITTAASFNASLWEAIGQVVSDEAR  170

Query  2148  AMFNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkng  1969
             AM+N G AGLT+W+PNVN+F DPRWGRGQETPGEDP++   YA  YVR            
Sbjct  171   AMYNGGTAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGTYAASYVR------------  218

Query  1968  RKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEP  1789
                 L G        D +RL ++ACCKH TAYDL+ W+   R+ FNA V++QD+E+T++ 
Sbjct  219   ---GLQGT-------DGNRLKVAACCKHFTAYDLDNWNGMDRFHFNAQVSKQDIEETFDV  268

Query  1788  PFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEY  1612
             PF+ CV +G+ + +MC+YN VNG+P CA+ +LL+K  R  W  +GYI SDCD+V   ++ 
Sbjct  269   PFRMCVSEGKVASVMCSYNQVNGVPTCADPNLLKKTVRGLWQLDGYIVSDCDSVGVFYDN  328

Query  1611  QQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLG  1432
             Q Y  +PEEAA  A+KAG D++CG ++  + ++A+E  ++ E+D++ AL+N  +VQ RLG
Sbjct  329   QHYTPTPEEAAADAIKAGLDLDCGPFLAVHTQNAVEKGLLSEADVNGALVNTLTVQMRLG  388

Query  1431  LFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIG  1252
             +F+G+     +   GPKDVC   H+ LALEAARQGIVLLKN    LPL   R  ++AVIG
Sbjct  389   MFDGEPSAHAYGKLGPKDVCKPAHQELALEAARQGIVLLKNTGPVLPLSPQRHHTVAVIG  448

Query  1251  PMAN-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKR  1075
             P +  T ++ G+Y G+ C   + L G+G Y  KT +  GC +VAC +   F  A++ A++
Sbjct  449   PNSKATVTMIGNYAGVACGYTNPLQGIGRYA-KTIHQLGCENVACKNDKLFGSAINAARQ  507

Query  1074  ADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFA  895
             AD  ++V+GLD S E E  DR  LLLPG Q  LV+++A  S  P +LV+  GG +DI+FA
Sbjct  508   ADATVLVMGLDQSIEAETVDRTGLLLPGRQQDLVSKVAAASKGPTILVIMSGGSVDITFA  567

Query  894   KKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESF-TKVPMNDMNMRAD  718
             K +PRI  +LW GYPG+ GG A+++I+FG  NP G+LP+TWYP+ + TK+PM +M MR  
Sbjct  568   KNNPRIVGILWAGYPGQAGGAAIADILFGTTNPGGKLPVTWYPQEYLTKLPMTNMAMRGS  627

Query  717   PSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGG  538
              S GYPGRTYRFY G  VY FGHGL+Y+ F   L SAPT +S+   +    R ++ N   
Sbjct  628   KSAGYPGRTYRFYNGPVVYPFGHGLTYTHFVHTLASAPTVVSV--PLNGHRRANVTNISN  685

Query  537   NEPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDR  358
                 V     + C+ L+ S+ V ++N G  DG+  +++FS  P  +   A +KQL+ F++
Sbjct  686   RAIRV---THARCDKLSISLEVDIKNVGSRDGTHTLLVFSAPPAGFGHWALEKQLVAFEK  742

Query  357   VHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             +HV   G+    ++I  C+ LS+V+  G R +PLG+H
Sbjct  743   IHVPAKGLQRVGVNIHVCKLLSVVDKSGIRRIPLGEH  779



>ref|XP_003519750.1| PREDICTED: probable beta-D-xylosidase 2-like [Glycine max]
Length=772

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/752 (46%), Positives = 482/752 (64%), Gaps = 41/752 (5%)
 Frame = -3

Query  2475  CQPPTHSS--YPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSE  2302
             C P   ++   PFC  SL   AR+  L+  LT+ EK+  L +N +A+PRLGI  YEWWSE
Sbjct  30    CDPKNTATKNLPFCKASLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEWWSE  89

Query  2301  SLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAG  2122
             +LHG++  GPG  F G   +AT FPQVI TAA+FN +LW +I   A+ EARAM+N G AG
Sbjct  90    ALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGRVASDEARAMYNGGTAG  149

Query  2121  LTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNR  1942
             LT+W+PNVN+F DPRWGRGQETPGEDP++   YA  YVR                L G  
Sbjct  150   LTYWSPNVNIFRDPRWGRGQETPGEDPILAGKYAASYVR---------------GLQGT-  193

Query  1941  MPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKG  1762
                   D +RL ++A CKH TAYDL+ W+   R+ FNA V++QD+EDT+  PF+ CV++G
Sbjct  194   ------DGNRLKVAASCKHFTAYDLDNWNGVDRFHFNAQVSKQDIEDTFNVPFRMCVKEG  247

Query  1761  RASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEE  1585
             + + +MC+YN VNG+P CA+  LL++  R  WG  GYI SDCD+V   +  Q Y  +PEE
Sbjct  248   KVASVMCSYNQVNGVPTCADPILLKRTVRGQWGLNGYIVSDCDSVGVFYNSQHYTSTPEE  307

Query  1584  AAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNR  1405
             AA  A+KAG D++CG ++ ++ ++A++  ++ E+D++ ALLN  +VQ RLG+++G+  + 
Sbjct  308   AAADAIKAGLDLDCGPFLGQHTQNAVKKGLISEADVNGALLNTLTVQMRLGMYDGEPSSH  367

Query  1404  KFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSL  1228
              + + GP+DVC+  H+ LALEAARQGIVLLKN+   LPL   R  ++AVIGP +N T ++
Sbjct  368   PYNNLGPRDVCTQSHQELALEAARQGIVLLKNKGPSLPLSTRRGRTVAVIGPNSNVTFTM  427

Query  1227  GGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVG  1048
              G+Y GI C   S L G+G Y  KT Y  GC +VAC     F  A++ A++AD  ++V+G
Sbjct  428   IGNYAGIACGYTSPLQGIGTYT-KTIYEHGCANVACTDDKQFGRAINAAQQADATVLVMG  486

Query  1047  LDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASV  868
             LD S E E  DR SLLLPGHQ  LV+++A  S  P +LV+  GGP+DI+FAK DPRI  +
Sbjct  487   LDQSIEAETVDRASLLLPGHQQDLVSKVAAASKGPTILVIMSGGPVDITFAKNDPRIQGI  546

Query  867   LWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTK-VPMNDMNMRADPSRGYPGRT  691
             LW GYPG+ GG A+++I+FG  NP G+LP+TWYP+ + K +PM +M MRA  S+GYPGRT
Sbjct  547   LWAGYPGQAGGAAIADILFGTSNPGGKLPMTWYPQGYIKNLPMTNMAMRASRSKGYPGRT  606

Query  690   YRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDE  511
             YRFY G  VY FG+GLSY+ F   L SAP  +S+             +R GN   +    
Sbjct  607   YRFYNGPVVYPFGYGLSYTHFVHTLTSAPKLVSIPVD---------GHRHGNSSNIANKA  657

Query  510   V----SNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSG  343
             +    + C  L+ ++ V ++N G  DG   +++FS  P      AP KQL+ F++VH+  
Sbjct  658   IKVTHARCGKLSINLHVDVKNVGSKDGIHTLLVFSAPPAGNGHWAPHKQLVAFEKVHIPA  717

Query  342   NGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
                    + I  C+ LS+V+  G+R +P+G H
Sbjct  718   KAQQRVRVKIHVCKLLSVVDRSGTRRIPMGLH  749



>ref|XP_009593976.1| PREDICTED: probable beta-D-xylosidase 2 [Nicotiana tomentosiformis]
Length=773

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/759 (45%), Positives = 489/759 (64%), Gaps = 44/759 (6%)
 Frame = -3

Query  2493  SKPQLPCQPPTHSS--YPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             ++P   C P   ++  +PFC T+L I  R+  LV  LT+ EK++ L +  +A+PRLGI  
Sbjct  26    ARPPFACDPRDRATKNFPFCQTNLAIGDRVRDLVGRLTLQEKVKLLGNTAAAVPRLGIKG  85

Query  2319  YEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMF  2140
             YEWWSE+LHG++  GPG  F G    AT FPQVI TAA+FN +LW  I    + EARAM+
Sbjct  86    YEWWSEALHGVSNVGPGTKFGGDFPGATSFPQVITTAASFNASLWEEIGRVVSDEARAMY  145

Query  2139  NSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKY  1960
             N    GLT+W+PNVN+F DPRWGRGQETPGEDP+V   YA  YV+               
Sbjct  146   NGDMGGLTYWSPNVNIFRDPRWGRGQETPGEDPVVAGIYAERYVK---------------  190

Query  1959  SLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFK  1780
              L GN      E+DDRL ++ACCKH TAYDL+ W    R+ FNA V++QDMEDT++ PF+
Sbjct  191   GLQGN------EEDDRLKVAACCKHYTAYDLDNWSGVDRFHFNAKVSKQDMEDTFDVPFR  244

Query  1779  SCVEKGRASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQY  1603
             SCV +G+ + +MC+YN VNGIP CA+ +LL K  R  WG  GYI SDCD+V   +E Q Y
Sbjct  245   SCVREGKVASVMCSYNQVNGIPTCADPELLRKTIRGGWGLNGYIVSDCDSVGVFYENQHY  304

Query  1602  AKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFN  1423
               +PEEAA  A+KAG D++CG ++ ++ ++A+++ I+ E+ ID  L N  +VQ RLG+F+
Sbjct  305   TSTPEEAAADAIKAGLDLDCGPFLAQHTETAVQSGILKEASIDTNLANTVAVQMRLGMFD  364

Query  1422  GKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMA  1243
             G+   + + + GP+DVCS  H+ LALEAARQGIVLLKN    LPL      ++AVIGP +
Sbjct  365   GETSAQPYGNLGPRDVCSPAHQELALEAARQGIVLLKNHGPALPLSPRHHPTVAVIGPNS  424

Query  1242  N-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADY  1066
             + T ++ G+Y G+ C   S L G+ +Y  K  +  GC DVAC+    F  AV  A++AD 
Sbjct  425   DVTVTMIGNYAGVACGYTSPLQGIAKYA-KIIHQQGCGDVACSDDRLFPGAVDAARQADA  483

Query  1065  VIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKD  886
              ++V+GLD S E E  DR  LLLPG Q  L+++++  S  P++LVL  GGP+D++FA+KD
Sbjct  484   TVLVMGLDQSIEAEFRDRTGLLLPGFQQDLISQVSKASRGPVILVLMSGGPVDVTFAEKD  543

Query  885   PRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESF-TKVPMNDMNMRADPSR  709
             PRI+ ++W+GYPG+ GG A+++++FG +NP G+LP+TWYP+ +   +PM  M+MRA+ ++
Sbjct  544   PRISGIVWVGYPGQAGGAAIADVLFGAHNPGGKLPMTWYPQEYLNNLPMTTMDMRANLAK  603

Query  708   GYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEP  529
             GYPGRTYRFY G  VY FGHGLSY+ F   +  AP  +++           I  R  +  
Sbjct  604   GYPGRTYRFYKGPLVYPFGHGLSYTKFINTIAEAPNMLAI----------PIFGRHASNT  653

Query  528   YVHVDEV-----SNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGF  364
              +   +      + C+ L+  V + ++N G  DG++ +++FS+ P      AP KQL+ F
Sbjct  654   TITTSKAIRVTHAKCSKLSIQVHIDVKNVGSKDGTQTLLVFSKPPIGLW--APHKQLVAF  711

Query  363   DRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
              +VHV    +   +I+I  C++LS+V+  G R +P+G+H
Sbjct  712   QKVHVPAGSLQRVAINIHVCKYLSVVDKAGVRRIPIGEH  750



>ref|XP_004500608.1| PREDICTED: probable beta-D-xylosidase 7-like [Cicer arietinum]
Length=1028

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/734 (51%), Positives = 478/734 (65%), Gaps = 28/734 (4%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P+  SYPFC+  LPI  R   LVS LT++EK+ +L ++   IPRLGIPAYEWWSE+LHG+
Sbjct  40    PSTRSYPFCNPKLPITQRTKDLVSRLTLNEKLAQLVNSAPPIPRLGIPAYEWWSEALHGV  99

Query  2286  ATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GLTFW  2110
                G GI F+G + SAT FPQVILTAA F+  LW  IA A  +EARA++N GQA G+TFW
Sbjct  100   GNVGRGIFFNGTISSATSFPQVILTAATFDSHLWYRIAQAIGIEARAIYNGGQAMGMTFW  159

Query  2109  APNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEE  1930
             APN+N+F DPRWGRGQET GEDPMV S+YAV YVR                L G+     
Sbjct  160   APNINIFRDPRWGRGQETAGEDPMVTSNYAVSYVR---------------GLQGDSFKGG  204

Query  1929  EEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASC  1750
                   L  SACCKH TAYDL+ W   +R+ F+A V+ QD+ DTY+PPF SCVEKGRAS 
Sbjct  205   GTFRGHLQASACCKHFTAYDLDNWKGVNRFHFDAQVSLQDLADTYQPPFHSCVEKGRASG  264

Query  1749  LMCAYNAVNGIPACANKDLL-EKARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGI  1573
             +MCAYN VNG+P CA+ +LL   AR  WGF GYI SDC AV  I + Q YAKSPE+A   
Sbjct  265   IMCAYNRVNGVPTCADFNLLTNTARKQWGFRGYIASDCGAVGIIHDQQGYAKSPEDAVAD  324

Query  1572  ALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFES  1393
              LKAG D+ CG+Y+  + KSA+  K +  S IDRAL NLFS++ RLGLF G      F  
Sbjct  325   VLKAGMDLECGSYLTDHAKSAVLQKKLPISLIDRALHNLFSIRIRLGLFEGNPTKLPFGM  384

Query  1392  FGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTS--SLGGD  1219
              GP  VCS +H  L+LEAAR GIVLLKN    LPL KT +S LAVIGP AN S  +L G+
Sbjct  385   IGPNHVCSKDHLYLSLEAARNGIVLLKNTASLLPLPKTSIS-LAVIGPNANASPLTLLGN  443

Query  1218  YTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDL  1039
             Y G PC   ++L G   Y+  T +  GC      ++    +AV +AK+ DYV++V+GLD 
Sbjct  444   YAGPPCKYITILQGFQHYVKNTVFHPGCDGGPKCASAQIDQAVEVAKKVDYVVLVMGLDQ  503

Query  1038  SQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWI  859
             S E E+ DR  L LPG Q+ L+N +A  S +P++LVL  GGP+DIS AK D +I S++W 
Sbjct  504   SVEREERDRVHLDLPGKQLELINSVAEASKRPIILVLLCGGPVDISSAKYDNKIGSIVWA  563

Query  858   GYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFY  679
             GYPGE GG AL++++FGD+NP GRLP+TWYP+ + KVPM DM MRADPS  YPGRTYRFY
Sbjct  564   GYPGELGGIALAQVIFGDHNPGGRLPITWYPKDYIKVPMTDMRMRADPSTDYPGRTYRFY  623

Query  678   TGEKVYEFGHGlsyssfslellSAP-TRISLSQSIKTKLRRSILNRGGNEPYVHVDEVS-  505
              G  VY+FGHGLSY+ +S + +S    ++  +QS  T L   ++       Y  V E+S 
Sbjct  624   KGPTVYDFGHGLSYTKYSYQFVSVTRDKLHFNQS-STHL---MVENSETIRYKLVSELSE  679

Query  504   -NCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTE  328
               C S+  SV + ++NNG + G   ++LF R P     G+P KQL+GF+ V +    ++ 
Sbjct  680   ETCQSMLVSVTIGVKNNGNIVGRHPILLFMR-PRKPRIGSPIKQLVGFESVLLDAGEMSH  738

Query  327   TSISIEPCQHLSIV  286
                 + PC+HLS +
Sbjct  739   VGFELSPCEHLSRI  752



>ref|XP_003615019.1| hypothetical protein MTR_5g062650 [Medicago truncatula]
 gb|AES97977.1| glycoside hydrolase family 3 amino-terminal domain protein [Medicago 
truncatula]
Length=785

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/750 (50%), Positives = 480/750 (64%), Gaps = 30/750 (4%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P   SY FC+ +L    R   +VS LT+DEK+ +L +   AIPRLGI +Y+WWSE+LHG+
Sbjct  43    PLTKSYTFCNLNLTTIQRAKDIVSRLTLDEKLAQLVNTAPAIPRLGIHSYQWWSEALHGV  102

Query  2286  ATNGPGITFDG--AVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQA-GLT  2116
             A  G GI  +G   +K+AT FPQVILTAA+F+  LW  I+     EARA++N+GQA G+T
Sbjct  103   ADYGKGIRLNGNVTIKAATIFPQVILTAASFDSKLWYRISKVIGTEARAVYNAGQAEGMT  162

Query  2115  FWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMP  1936
             FWAPN+N+F DPRWGRGQET GEDP+V + YAV +VR                L G+   
Sbjct  163   FWAPNINIFRDPRWGRGQETAGEDPLVSAKYAVSFVR---------------GLQGDSFE  207

Query  1935  EEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRA  1756
               + ++DRL  SACCKH TAYDL+ W    R+ F+A VT QD+ DTY+PPF SC+ +GR+
Sbjct  208   GGKLNEDRLKASACCKHFTAYDLDNWKGVDRFDFDANVTLQDLADTYQPPFHSCIVQGRS  267

Query  1755  SCLMCAYNAVNGIPACANKDLL-EKARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAA  1579
             S +MCAYN VNGIP CA+ +LL   AR  W F GYITSDC AV  I + Q YAK+PE+A 
Sbjct  268   SGIMCAYNRVNGIPNCADYNLLTNTARKKWNFNGYITSDCSAVDIIHDRQGYAKAPEDAV  327

Query  1578  GIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKF  1399
                L+AG D+ CG Y   + KSA+  K V  S IDRAL NLFS++ RLGLF+G     K+
Sbjct  328   ADVLQAGMDVECGDYFTSHSKSAVLQKKVPISQIDRALHNLFSIRIRLGLFDGHPTKLKY  387

Query  1398  ESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTSS--LG  1225
                GP  VCS ++  +ALEAAR GIVLLKN    LPL K+   S+ VIGP AN+SS  + 
Sbjct  388   GKIGPNRVCSKQNLNIALEAARSGIVLLKNAASILPLPKS-TDSIVVIGPNANSSSQVVL  446

Query  1224  GDYTGIPCALKSVLDGLGEYIHKTSYASGCLD-VACNSTDGFAEAVSIAKRADYVIVVVG  1048
             G+Y G PC L ++L G   Y     Y  GC D   C S +    AV +AK  DYV++V+G
Sbjct  447   GNYFGRPCNLVTILQGFENYSDNLLYHPGCSDGTKCVSAE-IDRAVEVAKVVDYVVLVMG  505

Query  1047  LDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASV  868
             LD SQE+E HDR  L LPG Q  L+N +A  S +P++LVL  GGP+DISFAK D +I  +
Sbjct  506   LDQSQESEGHDRDDLELPGKQQELINSVAKASKRPVILVLFCGGPVDISFAKVDDKIGGI  565

Query  867   LWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTY  688
             LW GYPGE GG AL+++VFGDYNP GRLP+TWYP+ F K+PM DM MRADPS GYPGRTY
Sbjct  566   LWAGYPGELGGMALAQVVFGDYNPGGRLPMTWYPKDFIKIPMTDMRMRADPSSGYPGRTY  625

Query  687   RFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEV  508
             RFYTG KVYEFG+GLSYS++S   +S       +  I      SIL +     Y  V E+
Sbjct  626   RFYTGPKVYEFGYGLSYSNYSYNFISVKNN---NLHINQSTTYSILEKSQTIHYKLVSEL  682

Query  507   SN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGV  334
                 C +++ SV + + N G M G   V+LF + P     G P KQL+GF+ V V G G 
Sbjct  683   GKKACKTMSISVTLGITNTGSMAGKHPVLLFVK-PKKGRNGNPVKQLVGFESVTVEGGGK  741

Query  333   TETSISIEPCQHLSIVNVEGSRILPLGDHI  244
              E    +  C+HLS  N  G +++  G ++
Sbjct  742   GEVGFEVSVCEHLSRANESGVKVIEEGGYL  771



>ref|XP_010268028.1| PREDICTED: probable beta-D-xylosidase 2 [Nelumbo nucifera]
Length=767

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/755 (46%), Positives = 482/755 (64%), Gaps = 36/755 (5%)
 Frame = -3

Query  2493  SKPQLPCQPPT--HSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             ++P   C P      + PFC  SLPIP R+  L+  LT+ EKI+ L +N +A+PRL I  
Sbjct  29    ARPAFACDPRNGLTRNLPFCQVSLPIPDRVRDLIGQLTLQEKIRLLVNNAAAVPRLDIGG  88

Query  2319  YEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMF  2140
             YEWWSE+LHG++  GPG  F GA   AT FPQVI TAA+FN +LW  I    + EARAM+
Sbjct  89    YEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNVSLWEQIGQVVSDEARAMY  148

Query  2139  NSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKY  1960
             N G AGLT+W+PNVN+  DPRWGRGQETPGEDP+V  +YA+ YVR               
Sbjct  149   NGGMAGLTYWSPNVNILRDPRWGRGQETPGEDPIVAGEYAIRYVR---------------  193

Query  1959  SLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFK  1780
              L GN       D +RL ++ACCKH TAYDL+ W+   R+ FNA V++QD+EDTY  PFK
Sbjct  194   GLQGN-------DGNRLKVAACCKHYTAYDLDDWNGVDRFHFNAKVSKQDLEDTYNVPFK  246

Query  1779  SCVEKGRASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQY  1603
             +CV +G  + +MC+YN VNGIP CA+ +LL    R  W   GYI SDCD+V   F+ Q Y
Sbjct  247   ACVLEGNVASVMCSYNQVNGIPTCADPNLLRNTIRGQWRLNGYIVSDCDSVGVFFDQQHY  306

Query  1602  AKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFN  1423
               +PEEAA  A+KAG D++CG ++  + ++A+   ++ E  ++ AL N  +VQ RLG+F+
Sbjct  307   TSTPEEAAADAIKAGLDLDCGPFLAIHTEAAIRKGMLTEGAVNDALTNTLTVQMRLGMFD  366

Query  1422  GKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMA  1243
             G+     F   GP DVC+  H+ LALEAARQGIVLLKN+   LPL + R  ++AVIG  +
Sbjct  367   GEPSAEPFGHLGPMDVCTPAHQELALEAARQGIVLLKNQGPSLPLSRIRHRTVAVIGSNS  426

Query  1242  N-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADY  1066
             + T+++ G+Y G+PC   + L G+  Y  +  + +GC+DVACNS   F  A+  A++AD 
Sbjct  427   DVTATMIGNYAGVPCGYTTPLQGIARYA-RPIHQAGCIDVACNSDQLFGAALDAARQADA  485

Query  1065  VIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKD  886
              ++V+GLD S E E  DR  LLLPG Q  L++++A  S  P VLVL  GGP+D+SFA+  
Sbjct  486   TVLVMGLDQSIEAEARDRVGLLLPGRQQELISKVAMASRGPTVLVLMSGGPIDVSFARDA  545

Query  885   PRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRADPSR  709
             PRI ++LW GYPG+ GG A+++++FG  NP G+LP+TWYP+ +  ++PM  M+MR+DP R
Sbjct  546   PRIPAILWAGYPGQAGGAAIADVLFGTTNPGGKLPMTWYPQDYVARLPMTTMDMRSDPWR  605

Query  708   GYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEP  529
             GYPGRTYRFY G  VY FGHG+SY++F   +  AP  +++       LR    N   +  
Sbjct  606   GYPGRTYRFYKGPVVYPFGHGMSYTNFVYTIADAPAMVTV------PLRGHQGNSSTSGK  659

Query  528   YVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHV  349
              + V   + C+ L+  + V ++N G  DGS  +++FS  P +     PQKQL+ F++VH+
Sbjct  660   AIKVTH-AKCDGLSVVLHVDVKNAGSKDGSHSLLVFSSPPPA-EHWVPQKQLVAFEKVHL  717

Query  348   SGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
                      I+I  C+ LS+V+  G R +PLG H+
Sbjct  718   PAGSQQRVQITIHLCKFLSVVDKLGIRRIPLGQHV  752



>ref|XP_004504774.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cicer arietinum]
Length=774

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/758 (47%), Positives = 496/758 (65%), Gaps = 36/758 (5%)
 Frame = -3

Query  2499  SYSKPQLPC---QPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLG  2329
             S + P   C   + P  S+Y FC+ SL + AR+  LVS LT+ EKI  L ++   + RLG
Sbjct  33    SQTSPVFACDVGKNPALSNYRFCNKSLGVNARVSDLVSRLTLQEKIGNLVNSAVDVSRLG  92

Query  2328  IPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavear  2149
             IP YEWWSE+LHG++  GPG  F   V  +T FP  IL AA+FN +L+++I    + EAR
Sbjct  93    IPRYEWWSEALHGVSNVGPGTRFSNVVPGSTSFPMPILIAASFNASLFQTIGKVVSTEAR  152

Query  2148  AMFNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkng  1969
             AM N G AGLT+W+PN+N+F DPRWGRGQETPGEDP++ S YA  YV+GLQ         
Sbjct  153   AMHNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLASKYAAGYVKGLQQT-------  205

Query  1968  RKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEP  1789
                         ++ D ++L ++ACCKH TAYD++ W    RY+FNAVVT+QD++DTY+P
Sbjct  206   ------------DDGDSNKLKVAACCKHYTAYDVDSWKGVQRYTFNAVVTQQDLDDTYQP  253

Query  1788  PFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEY  1612
             PFKSCV  G  + +MC+YN VNG P CA+ DLL+   R  W   GYI SDCD+V  +F+ 
Sbjct  254   PFKSCVIDGNVASVMCSYNKVNGKPTCADPDLLKGVIRGKWKLNGYIVSDCDSVDVLFKS  313

Query  1611  QQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLG  1432
             Q Y K+PEEAA I++ AG D+NCG+++ ++ + A++  ++ E+ I+ A+ N F+   RLG
Sbjct  314   QHYTKTPEEAAAISILAGLDLNCGSFLGQHTEGAVKQGLIDEASINNAVSNNFATLMRLG  373

Query  1431  LFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIG  1252
              F+G    + + + GPKDVC+S ++ LA EAARQGIVLLKN    LPL+   + SLAVIG
Sbjct  374   FFDGDPSKQHYGNLGPKDVCTSANQELAREAARQGIVLLKNSPGSLPLNAKAIKSLAVIG  433

Query  1251  PMAN-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKR  1075
             P AN T ++ G+Y GIPC   S L GL   +  TSY +GC DV C S     +A  +A  
Sbjct  434   PNANATRTMIGNYEGIPCKYTSPLQGLTALV-PTSYIAGCSDVQC-SNAALDDAKKVASS  491

Query  1074  ADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFA  895
             AD  ++VVG +L+ E E  DR ++LLPG Q  LV E+A  +  P++LV+  GG +D+SFA
Sbjct  492   ADATVIVVGANLAIEAESLDRVNILLPGQQQQLVTEVANAAKGPVILVIMSGGGMDVSFA  551

Query  894   KKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRAD  718
             K + +I S+LW+GYPGE GG A+++++FG +NP+GRLP+TWYP+S+  KVPM +MNMR D
Sbjct  552   KTNDKITSILWVGYPGEAGGAAIADVIFGFHNPSGRLPMTWYPQSYVDKVPMTNMNMRPD  611

Query  717   PSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGG  538
             P+ GYPGRTYRFY GE V+ FG G+SYS+   +L+ AP  +S+  S +  + RS+  +  
Sbjct  612   PATGYPGRTYRFYKGETVFSFGDGISYSTCEHKLVKAPQLVSVPLS-EDHVCRSLECKSL  670

Query  537   NEPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDR  358
             +    H      C +LAF +++S++NNG M  S+ V LFS  P  +   APQK L+ F++
Sbjct  671   DVAGQH------CQNLAFDIQLSIKNNGKMSISQTVFLFSTPPAVH--NAPQKHLLAFEK  722

Query  357   VHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             VH+ G      S  ++ C+ LS+V+  G+R + LG H+
Sbjct  723   VHLMGKSEAVVSFKVDVCKDLSVVDEVGNRKVALGQHM  760



>ref|XP_003547598.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Glycine max]
Length=776

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/745 (47%), Positives = 488/745 (66%), Gaps = 35/745 (5%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P  + Y FCD SL +  R+  LV  LT+ EKI  L ++ +++ RLGIP YEWWSE+LHG+
Sbjct  49    PALAGYGFCDKSLSVEDRVADLVKRLTLQEKIGSLVNSATSVSRLGIPKYEWWSEALHGV  108

Query  2286  ATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWA  2107
             +  GPG  F   V  AT FP  ILTAA+FN +L+ +I    + EARAM+N G AGLT+W+
Sbjct  109   SNVGPGTHFSSLVPGATSFPMPILTAASFNASLFEAIGRVVSTEARAMYNVGLAGLTYWS  168

Query  2106  PNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEE  1927
             PN+N+F DPRWGRGQETPGEDP++ S YA  YV+GLQ                     ++
Sbjct  169   PNINIFRDPRWGRGQETPGEDPLLSSKYATGYVKGLQQT-------------------DD  209

Query  1926  EDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCL  1747
              D ++L ++ACCKH TAYDL+ W    RY+FNAVVT+QDM+DT++PPFKSCV  G  + +
Sbjct  210   GDSNKLKVAACCKHYTAYDLDNWKGIQRYTFNAVVTQQDMDDTFQPPFKSCVIDGNVASV  269

Query  1746  MCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIA  1570
             MC+YN VNG P CA+ DLL+   R +W   GYI SDCD+V  +F+ Q Y K+PEEAA   
Sbjct  270   MCSYNQVNGKPTCADPDLLKGIIRGEWKLNGYIVSDCDSVEVLFKDQHYTKTPEEAAAQT  329

Query  1569  LKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESF  1390
             + AG D+NCG Y+ +  + A++  ++ E+ I+ A+ N F+   RLG F+G    + + + 
Sbjct  330   ILAGLDLNCGNYLGQYTEGAVKQGLLDEASINNAVSNNFATLMRLGFFDGDPSKQPYGNL  389

Query  1389  GPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSLGGDYT  1213
             GPKDVC+SE+R LA EAARQGIVLLKN    LPL+   + SLAVIGP AN T  + G+Y 
Sbjct  390   GPKDVCTSENRELAREAARQGIVLLKNSPGSLPLNAKTIKSLAVIGPNANATRVMIGNYE  449

Query  1212  GIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQ  1033
             GIPC   S L  L   +  TSYA+GC +V C + +   +A  IA  AD  +++VG  L+ 
Sbjct  450   GIPCNYISPLQTLTALV-PTSYAAGCPNVQCANAE-LDDATQIAASADATVIIVGASLAI  507

Query  1032  ETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGY  853
             E E  DR ++LLPG Q  LV+E+A  S  P++LV+  GG +D+SFAK + +I S+LW+GY
Sbjct  508   EAESLDRINILLPGQQQLLVSEVANASKGPVILVIMSGGGMDVSFAKSNDKITSILWVGY  567

Query  852   PGEEGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRADPSRGYPGRTYRFYT  676
             PGE GG A+++++FG YNP+GRLP+TWYP+++  KVPM +MNMRADP+ GYPGRTYRFY 
Sbjct  568   PGEAGGAAIADVIFGFYNPSGRLPMTWYPQAYVNKVPMTNMNMRADPATGYPGRTYRFYK  627

Query  675   GEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEV-SNC  499
             GE V+ FG G+S+SS   +++ AP  +S+  +   + R S          + +D    +C
Sbjct  628   GETVFSFGDGISFSSIEHKIVKAPQLVSVPLAEDHECRSS--------ECMSLDIADEHC  679

Query  498   NSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSI  319
              +LAF + + ++N G M  S VV+LF   P  +   APQK L+GF++VH+ G    +   
Sbjct  680   QNLAFDIHLGVKNTGKMSTSHVVLLFFTPPDVH--NAPQKHLLGFEKVHLPGKSEAQVRF  737

Query  318   SIEPCQHLSIVNVEGSRILPLGDHI  244
              ++ C+ LS+V+  G+R +PLG H+
Sbjct  738   KVDVCKDLSVVDELGNRKVPLGQHL  762



>ref|XP_011079568.1| PREDICTED: probable beta-D-xylosidase 2 [Sesamum indicum]
Length=771

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/748 (46%), Positives = 481/748 (64%), Gaps = 34/748 (5%)
 Frame = -3

Query  2475  CQPPTHSSY--PFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSE  2302
             C P   +++  PFC T L I  R+  L+  LT+ EK++ L++N +A+PRLGI  YEWWSE
Sbjct  30    CDPRDSATHTLPFCTTGLRIEERVKDLIGRLTLQEKVKLLANNAAAVPRLGIKEYEWWSE  89

Query  2301  SLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAG  2122
             +LHG++  GPG  F G    AT FPQVI TAA+FN +LW  I    + EARAM+N G  G
Sbjct  90    ALHGVSNVGPGTKFGGEFPGATSFPQVITTAASFNVSLWEKIGEVVSDEARAMYNGGMGG  149

Query  2121  LTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNR  1942
             LT+W+PNVN+F DPRWGRGQETPGEDP+V + YA  YV                     R
Sbjct  150   LTYWSPNVNIFRDPRWGRGQETPGEDPVVAAKYAASYV---------------------R  188

Query  1941  MPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKG  1762
               +  +   RL ++ACCKH TAYDL+ W    R+ FNA V++QD++DT++ PF+SCV +G
Sbjct  189   GLQGTDAGGRLKVAACCKHYTAYDLDNWAGVDRFHFNAKVSQQDIKDTFDIPFRSCVMEG  248

Query  1761  RASCLMCAYNAVNGIPACANKDLLE-KARTDWGFEGYITSDCDAVATIFEYQQYAKSPEE  1585
             + + +MC+YN VNG+P CA+  LL    R  W  +GYI SDCD+V   ++ Q YA +PEE
Sbjct  249   KVASVMCSYNQVNGVPTCADPKLLRGTVRGSWRLDGYIVSDCDSVGVFYDNQHYASTPEE  308

Query  1584  AAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNR  1405
             A   A+KAG D++CG ++  + ++A++  ++ E+DI+ AL N  +VQ RLG+F+G+   +
Sbjct  309   AVADAIKAGLDLDCGPFLSVHTENAVQRGLLNEADINLALYNTITVQMRLGMFDGEPSAQ  368

Query  1404  KFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSL  1228
              + + GPKDVC+  H+ LALEAARQGIVLLKNE   LPL   R    AVIGP ++ T ++
Sbjct  369   PYGNLGPKDVCTPAHQELALEAARQGIVLLKNEGSVLPLSPRRHHPYAVIGPNSDVTVTM  428

Query  1227  GGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVG  1048
              G+Y G+ C   + L G+  Y  +T +  GC +VAC     F  A+  A+RAD  I+V+G
Sbjct  429   IGNYAGVACGYTTPLQGISAY-SRTIHQPGCAEVACADDALFGGAIQAARRADATIMVMG  487

Query  1047  LDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASV  868
             LD S E E  DR  L+LPG Q  L+++++  S  P +LVL  GGP+DISFAK DPRIA++
Sbjct  488   LDQSIEAEFRDRAGLMLPGRQQELISKVSAASKGPTILVLMSGGPIDISFAKNDPRIAAI  547

Query  867   LWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESF-TKVPMNDMNMRADPSRGYPGRT  691
             LW+GYPG+ GG A+++++FG +NP G+LP+TWYP+ +   +PM  M+MRADPSR YPGRT
Sbjct  548   LWVGYPGQAGGAAIADVLFGTHNPGGKLPMTWYPQEYLNNLPMTTMDMRADPSRNYPGRT  607

Query  690   YRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDE  511
             YRFY G  VY FGHG+SY+SF   +  AP  +S+    +     +++    +   + V  
Sbjct  608   YRFYKGPVVYPFGHGMSYTSFVHTIADAPKVVSVPVDGRHHSNTTVV----SSKSIRVTH  663

Query  510   VSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVT  331
              + CN L+  V V +RN G  DGS  +++FS  P     GAP KQLI F++V V+  G  
Sbjct  664   -ARCNRLSLVVSVDVRNTGSKDGSHTLLVFSTPPRGL--GAPHKQLITFEKVKVAAGGQE  720

Query  330   ETSISIEPCQHLSIVNVEGSRILPLGDH  247
                I I  C++LS+V+  G R +P+G+H
Sbjct  721   RVPIKIHVCKYLSVVDGAGVRRIPMGEH  748



>ref|XP_003531557.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Glycine max]
Length=776

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/745 (47%), Positives = 487/745 (65%), Gaps = 35/745 (5%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P  + Y FCD SL +  R+  LV  LT+ EKI  L ++ +++ RLGIP YEWWSE+LHG+
Sbjct  49    PALAGYGFCDKSLSLEDRVADLVKRLTLQEKIGSLVNSATSVSRLGIPKYEWWSEALHGV  108

Query  2286  ATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWA  2107
             +  GPG  F   V  AT FP  ILTAA+FN +L+ +I    + EARAM+N G AGLT+W+
Sbjct  109   SNVGPGTHFSSLVPGATSFPMPILTAASFNASLFEAIGRVVSTEARAMYNVGLAGLTYWS  168

Query  2106  PNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEE  1927
             PN+N+F DPRWGRGQETPGEDP++ S YA  YV+GLQ                     ++
Sbjct  169   PNINIFRDPRWGRGQETPGEDPLLSSKYATGYVKGLQQT-------------------DD  209

Query  1926  EDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCL  1747
              D ++L ++ACCKH TAYDL+ W    RY+FNAVVT+QDM+DT++PPFKSCV  G  + +
Sbjct  210   GDSNKLKVAACCKHYTAYDLDNWKGIQRYTFNAVVTQQDMDDTFQPPFKSCVIDGNVASV  269

Query  1746  MCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIA  1570
             MC+YN VNG P CA+ DLL+   R +W   GYI SDCD+V  +F+ Q Y K+PEEAA   
Sbjct  270   MCSYNQVNGKPTCADPDLLKGVIRGEWKLNGYIVSDCDSVEVLFKDQHYTKTPEEAAAET  329

Query  1569  LKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESF  1390
             + AG D+NCG Y+ +  + A++  ++ E+ I+ A+ N F+   RLG F+G    + + + 
Sbjct  330   ILAGLDLNCGNYLGQYTEGAVKQGLLDEASINNAVSNNFATLMRLGFFDGDPSKQTYGNL  389

Query  1389  GPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSLGGDYT  1213
             GP DVC+SE+R LA EAARQGIVLLKN    LPL+   + SLAVIGP AN T  + G+Y 
Sbjct  390   GPNDVCTSENRELAREAARQGIVLLKNSLGSLPLNAKAIKSLAVIGPNANATRVMIGNYE  449

Query  1212  GIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQ  1033
             GIPC   S L  L   +  TSYA+GC +V C + +   +A  IA  AD  ++VVG  L+ 
Sbjct  450   GIPCNYISPLQALTALV-PTSYAAGCPNVQCANAE-LDDATQIAASADATVIVVGASLAI  507

Query  1032  ETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGY  853
             E E  DR ++LLPG Q  LV+E+A  S  P++LV+  GG +D+SFAK + +I S+LW+GY
Sbjct  508   EAESLDRINILLPGQQQLLVSEVANASKGPVILVIMSGGGMDVSFAKSNDKITSILWVGY  567

Query  852   PGEEGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRADPSRGYPGRTYRFYT  676
             PGE GG A+++++FG YNP+GRLP+TWYP+S+  KVPM +MNMRADP+ GYPGRTYRFY 
Sbjct  568   PGEAGGAAIADVIFGFYNPSGRLPMTWYPQSYVNKVPMTNMNMRADPATGYPGRTYRFYK  627

Query  675   GEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEV-SNC  499
             GE V+ FG G+S+S+   +++ AP  +S+  +   + R S          + +D    +C
Sbjct  628   GETVFSFGDGISFSNIEHKIVKAPQLVSVPLAEDHECRSS--------ECMSLDVADEHC  679

Query  498   NSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSI  319
              +LAF + + ++N G M  S VV+LF   P  +   APQK L+GF++VH+ G    +   
Sbjct  680   QNLAFDIHLGVKNMGKMSSSHVVLLFFTPPDVH--NAPQKHLLGFEKVHLPGKSEAQVRF  737

Query  318   SIEPCQHLSIVNVEGSRILPLGDHI  244
              ++ C+ LS+V+  G+R +PLG H+
Sbjct  738   KVDICKDLSVVDELGNRKVPLGQHL  762



>gb|KHG10349.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Gossypium arboreum]
Length=779

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/756 (48%), Positives = 487/756 (64%), Gaps = 36/756 (5%)
 Frame = -3

Query  2493  SKPQLPC---QPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIP  2323
             + P   C   + P  +SY FCDT L   AR+  LV  LT+ EKI  + ++  ++ RLGIP
Sbjct  40    TSPVFACDATKDPKVASYGFCDTKLGTDARVADLVHRLTLQEKILFIVNSAGSVSRLGIP  99

Query  2322  AYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAM  2143
              YEWWSE+LHG++  GPG  F   V  AT FPQVILTAA+FN +L+ +I    + EARAM
Sbjct  100   KYEWWSEALHGVSNVGPGTKFTSLVPGATSFPQVILTAASFNTSLYEAIGKVVSTEARAM  159

Query  2142  FNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             +N G AGLT+W+PN+N+F DPRWGRGQETPGEDP++ S Y   YV+GLQ           
Sbjct  160   YNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLASKYGSSYVKGLQQT---------  210

Query  1962  YSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
                       +  D  RL ++ACCKH TAYD++ W    RY+F+AVVT+QD++DT++PPF
Sbjct  211   ----------DGGDPSRLKVAACCKHYTAYDVDNWKGIERYTFDAVVTKQDLDDTFQPPF  260

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQ  1606
             KSCV  G  + +MC+YN VNG+P CA+ DLL    R  W   GYI SDCD+V  +F+ Q 
Sbjct  261   KSCVIDGNVASVMCSYNKVNGMPTCADPDLLAGVIRGQWKLNGYIVSDCDSVDVLFKNQH  320

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             Y K+PEEAA   + AG D+NCG+++ ++ ++A++  ++ ES ID+A+ N F+   RLG F
Sbjct  321   YTKTPEEAAAKVILAGLDLNCGSFLGQHTEAAVKAGLLNESAIDKAVTNNFATLMRLGFF  380

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPM  1246
             +G    + +   GPKDVC+ EH+ LA EAAR+GIVLLKN    LPL  T + +LAVIGP 
Sbjct  381   DGDPSKQPYGKLGPKDVCTPEHQELAREAAREGIVLLKNSPGSLPLSPTAIKTLAVIGPN  440

Query  1245  AN-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             AN T ++ G+Y GIPC   + L GL   +  T+Y  GC +VAC  T    +A   A  AD
Sbjct  441   ANVTKTMIGNYEGIPCKYTTPLQGLTTSV-ATNYVPGCTNVACG-TAQVDDAKKAAASAD  498

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
               ++V+G+D SQE E  DR SLLLPG Q  L+ E+A  +  P++LV+  GG  DISFAK 
Sbjct  499   ATVLVMGIDQSQERESFDRVSLLLPGEQPLLITEVAKAAKGPVILVIMSGGGFDISFAKN  558

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRADPS  712
             D +I S+LW+GYPGE GG A+++++FG YNP+GRLP+TWYP+S+  KVPM +MNMR DPS
Sbjct  559   DDKITSILWVGYPGEAGGAAIADVIFGYYNPSGRLPMTWYPQSYVDKVPMTNMNMRPDPS  618

Query  711   RGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNE  532
              GYPGRTYRFYTGE +Y FG GLSYS  + EL  AP  +S+       L    + R    
Sbjct  619   NGYPGRTYRFYTGETIYTFGDGLSYSKITHELAKAPRLVSI------PLEEDHVCRSSEC  672

Query  531   PYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVH  352
               V   E S C +LAF + V ++N G   GS  V LFS  P+ +   +PQK L+GF++V 
Sbjct  673   KSVEAVEQS-CKNLAFDIHVRVQNRGKYGGSHTVFLFSSPPSVH--NSPQKHLLGFEKVS  729

Query  351   VSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             ++G   T     ++ C+ LS+V+  GSR + LG H+
Sbjct  730   LTGKSETLVRFKVDVCKDLSVVDELGSRKVALGQHL  765



>ref|XP_010687471.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Beta vulgaris subsp. vulgaris]
Length=777

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/757 (46%), Positives = 488/757 (64%), Gaps = 44/757 (6%)
 Frame = -3

Query  2487  PQLPCQPPTH---SSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAY  2317
             P   C   ++   SS  FCDTS  + AR+  L+  LT+ EKI  L    +++ RLGIP Y
Sbjct  40    PAFACDTTSNASLSSLGFCDTSKSVEARVADLIGRLTLTEKIGYLISGAASVNRLGIPKY  99

Query  2316  EWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFN  2137
             EWWSE+LHG++  GPG  F   V  AT FPQVI TAA+FN TL+++I    + EARAM+N
Sbjct  100   EWWSEALHGVSNVGPGTRFTSVVPGATSFPQVITTAASFNTTLFQAIGKVVSNEARAMYN  159

Query  2136  SGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYS  1957
             +G AGLT+W+PNVN+F DPRWGRGQETPGEDP++ S Y   YVRGLQ             
Sbjct  160   TGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYGSAYVRGLQQT-----------  208

Query  1956  LSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKS  1777
                     ++ D ++L ++ACCKH TAYD++ W +  RY FNA+V++QD++DTY+PPFKS
Sbjct  209   --------DDADPNKLKVAACCKHYTAYDVDNWKSVDRYHFNALVSQQDLDDTYQPPFKS  260

Query  1776  CVEKGRASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQYA  1600
             CV  G  + +MC+YN VNG P CA+ DLL    R +W   GYI +DCD++  ++  Q Y 
Sbjct  261   CVVDGNVASVMCSYNQVNGKPTCADTDLLSGVIRGEWKLNGYIVTDCDSIDVLYNNQHYT  320

Query  1599  KSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNG  1420
             K+PEEAA  ++ AG D+NCG ++ ++ + A++  +V E+DI++A+ N      RLG F+G
Sbjct  321   KTPEEAAAQSILAGVDLNCGYFLSKHTQGAVDKGLVKETDINKAISNNLITLMRLGFFDG  380

Query  1419  KAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN  1240
                 + + + G KDVC+SE++ LAL+AARQG+VLLKN    LP   T++ SLAVIGP AN
Sbjct  381   NPSKKPYGNLGAKDVCTSENQELALDAARQGLVLLKNNAGCLPFSATKIKSLAVIGPNAN  440

Query  1239  -TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYV  1063
              T ++ G+Y GIPC   + L GL  Y   T+Y  GC +VAC +     EA  IA  AD  
Sbjct  441   VTKTMIGNYEGIPCKYTTPLQGLSAYT-STTYQPGCSNVACAAAQ-VDEAKQIASTADAT  498

Query  1062  IVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDP  883
             ++++G D S E E  DR  L LPG Q  LV  +A VS  P++LV+  GG +DI+FAK + 
Sbjct  499   VLIMGADQSIEAESRDRVDLYLPGQQSLLVAAVANVSRGPVILVIMSGGGMDITFAKDND  558

Query  882   RIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRADPSRG  706
             +I+S++W+GYPG+ GG AL++++FG YNP+GRLP+TWYP+S+  KVPM +MNMR +P+ G
Sbjct  559   KISSIVWVGYPGQAGGAALADLIFGAYNPSGRLPMTWYPQSYAEKVPMTNMNMRPNPTTG  618

Query  705   YPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISL----SQSIKTKLRRSILNRGG  538
             YPGR+YRFYTGE VY FG GLSYS F+  L+ APT +S+         T   +SI   G 
Sbjct  619   YPGRSYRFYTGETVYNFGDGLSYSDFTHHLVKAPTEVSVPLQEEHVCHTSTCKSIDALG-  677

Query  537   NEPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDR  358
                        +C +L F V + +RNNG M+G   V LFS  P+ +   +P+K LI F++
Sbjct  678   ----------EHCKNLGFDVHLKVRNNGAMEGRHTVFLFSSPPSVH--NSPKKNLIAFEK  725

Query  357   VHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             V + G     T   ++ C+HLS+V+ EG+R + LG H
Sbjct  726   VFLHGKTEGMTVFKVDACEHLSVVDEEGNRKVALGVH  762



>gb|KDP30704.1| hypothetical protein JCGZ_16402 [Jatropha curcas]
Length=770

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/752 (47%), Positives = 485/752 (64%), Gaps = 49/752 (7%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P+ +S+ FC+ SL I  R+  LV  LT+ EKI  L ++  ++ RLGIP YEWWSE+LHG+
Sbjct  43    PSVASFGFCNVSLGINERVVDLVERLTLQEKISFLVNSAGSVSRLGIPKYEWWSEALHGV  102

Query  2286  ATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWA  2107
             +  GPG  F   V  AT FPQVILTAA+FN +L+ +I    + EARAM+N G AGLTFW+
Sbjct  103   SYVGPGTHFSSLVPGATSFPQVILTAASFNTSLFEAIGKVVSTEARAMYNVGLAGLTFWS  162

Query  2106  PNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEE  1927
             PNVN+F DPRWGRGQETPGEDP++ S Y   YVRGLQ                     ++
Sbjct  163   PNVNIFRDPRWGRGQETPGEDPLLSSKYGSGYVRGLQQ-------------------RDD  203

Query  1926  EDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCL  1747
              D D+L ++ACCKH TAYDL+ W    RY FNAVVT+QD++DT++PPFKSCV  G  + +
Sbjct  204   GDSDKLKVAACCKHYTAYDLDNWKGTDRYHFNAVVTKQDLDDTFQPPFKSCVIDGNVASV  263

Query  1746  MCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIA  1570
             MC+YN VNG P CA+ DLL    R  W   GYI SDCD+V  ++  Q Y K+PEEAA ++
Sbjct  264   MCSYNKVNGKPTCADPDLLSGVIRGQWKLNGYIVSDCDSVDVLYNSQHYTKTPEEAAAVS  323

Query  1569  LKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESF  1390
             + AG D+NCG+++ ++ ++A++  +V E+ ID+A+ N F+   RLG F+G    + +   
Sbjct  324   ILAGLDLNCGSFLGQHTEAAVKGGLVNETAIDKAVSNNFATLMRLGFFDGDPSKQLYGKL  383

Query  1389  GPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSLGGDYT  1213
             GPKDVC+ EH+ LA EAARQGIVLLKN    LPL  T + +LAVIGP AN T ++ G+Y 
Sbjct  384   GPKDVCTPEHQELAREAARQGIVLLKNTPGSLPLSPTAIKNLAVIGPNANVTKTMIGNYE  443

Query  1212  GIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQ  1033
             G PC   + L GL   +  T+Y  GC +VAC  T    +A  IA  AD  ++V+G D S 
Sbjct  444   GTPCKYTTPLQGLTASV-ATTYQPGCNNVAC-GTAQVEDAKKIAASADATVLVMGADQSI  501

Query  1032  ETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGY  853
             E E  DR  +LLPG Q  L+ ++A  S  P++LV+  GG +D+SFAK + +I S+LW+GY
Sbjct  502   EAESRDRVDILLPGQQQLLITQVANASKGPVILVIMSGGGMDVSFAKSNDKITSILWVGY  561

Query  852   PGEEGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRADPSRGYPGRTYRFYT  676
             PGE GG A+++I+FG YNP+GRLP+TWYP+S+  KVPM +MNMR DPS GYPGR+YRFYT
Sbjct  562   PGEAGGAAIADIIFGYYNPSGRLPMTWYPQSYVDKVPMTNMNMRPDPSSGYPGRSYRFYT  621

Query  675   GEKVYEFGHGlsyssfslellSAPTRISL-------SQSIKTKLRRSILNRGGNEPYVHV  517
             GE VY FG GLSYS F  +L+ AP  +++        QS K                + V
Sbjct  622   GETVYSFGDGLSYSKFEQQLVQAPKLVTVPLEEGHACQSTKC---------------ISV  666

Query  516   DEVS-NCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGN  340
             D V   C +LAF + + ++N G + GS  V LFS  P+ +   +PQK L+ F++V +   
Sbjct  667   DAVDRTCQNLAFDIHLKVKNMGRIRGSHTVFLFSTPPSVH--NSPQKHLVDFEKVSLDAQ  724

Query  339   GVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
               +     ++ C+HLS+V+  G+R + LG+HI
Sbjct  725   THSTVQFKVDICKHLSVVDEFGNRKIALGEHI  756



>ref|XP_010111676.1| putative beta-D-xylosidase 5 [Morus notabilis]
 gb|EXC31467.1| putative beta-D-xylosidase 5 [Morus notabilis]
Length=802

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/756 (48%), Positives = 497/756 (66%), Gaps = 37/756 (5%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P  S +PFCDTSL    R   ++S LT+ EK+Q+L   ++ I RLG+P+YEWWSE+LHG+
Sbjct  36    PQASQFPFCDTSLSYDIRAKDIISRLTLQEKVQQLVSGSAGISRLGVPSYEWWSEALHGV  95

Query  2286  ATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWA  2107
             +  GPG TF+  V  AT FP VIL+AAAFN +LW  +  A + EARAM+N+G AGLT+W+
Sbjct  96    SNVGPGTTFNATVPGATSFPAVILSAAAFNASLWYKMGQAVSTEARAMYNAGLAGLTYWS  155

Query  2106  PNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEE  1927
             PNVNVF DPRWGRGQETPGEDP+VVS YAV YV+GL                   M  EE
Sbjct  156   PNVNVFRDPRWGRGQETPGEDPLVVSKYAVNYVKGL-----------------QEMSNEE  198

Query  1926  ----EDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGR  1759
                    DRL +S+CCKH TAYD++ W    R+ F+A VT+QD+EDTY+PPFKSCVEKG 
Sbjct  199   GSGGNQGDRLKVSSCCKHYTAYDVDNWKGVDRFHFDAKVTKQDLEDTYQPPFKSCVEKGH  258

Query  1758  ASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQYAKSPEEA  1582
              S +MC+YN VNGIP CA+ DLL+   R  WG +GYI SDCD++   +    Y  +PE+A
Sbjct  259   VSSVMCSYNRVNGIPTCADPDLLKGVIRGQWGLDGYIASDCDSIEVYYNSIHYTATPEDA  318

Query  1581  AGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRK  1402
               +ALKAG ++NCG Y+ +   +A++ K V ES +D+AL+  +    RLG F+G   +  
Sbjct  319   VALALKAGLNMNCGDYLGKYTANAVQLKKVDESVVDQALIYNYVTLMRLGFFDGNPKSGP  378

Query  1401  FESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSLG  1225
             + + GP DVC+ EH+ LAL+AA+QGIVLL+ +   LPL   +V +LAV+GP AN T+++ 
Sbjct  379   YGNLGPADVCTDEHKSLALDAAKQGIVLLE-DNGILPLSPDKVKNLAVVGPNANATNAMI  437

Query  1224  GDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGL  1045
              +Y GIPC   S   GL +Y+    Y  GC +V C S      A   A  AD V+ V+GL
Sbjct  438   SNYAGIPCGYTSPFQGLKKYVQAAIYEPGCSNVKCGSESLIEAAAKAAATADVVVAVMGL  497

Query  1044  DLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVL  865
             D S E E  DR +L LPG Q  LV ++A  +N  ++LV+   GP+D+SFAK   ++  +L
Sbjct  498   DQSIEAEGLDRENLTLPGFQEKLVKQVANSTNGTVILVVMSAGPIDVSFAKNLSKVGGIL  557

Query  864   WIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRADPSRGYPGRTY  688
             W+GYPG++GG A+++++FGDYNP GR P TWYP+ +T +VPM +MNMR + S  +PGRTY
Sbjct  558   WVGYPGQDGGDAIAQVIFGDYNPGGRSPFTWYPQEYTDQVPMTEMNMRENTSNNFPGRTY  617

Query  687   RFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPY------  526
             RFYTG+ +YEFGHGLSYS FS   +SAPT + +  +  +K   +IL+    +P       
Sbjct  618   RFYTGKTIYEFGHGLSYSVFSKFFISAPTTVVIKPTSTSK-PLNILSSKSIQPKHFLAGQ  676

Query  525   -VHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSY-AGGAPQKQLIGFDRVH  352
              + +  + NC +L F + V +RN+G  DGS VV++F + P+S    GAP  QL+GF+RV 
Sbjct  677   AIDISAI-NCQNLTFDISVGVRNSGPRDGSHVVLVFWKPPSSKDLSGAPNVQLVGFERVV  735

Query  351   VSGNGVTET-SISIEPCQHLSIVNVEGSRILPLGDH  247
             V  NG TE+ ++ ++ C+ L++V+ EG+R L +G H
Sbjct  736   VM-NGKTESMTVKLDLCEGLNLVDSEGNRKLVIGQH  770



>ref|XP_009348894.1| PREDICTED: putative beta-D-xylosidase [Pyrus x bretschneideri]
Length=776

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/760 (45%), Positives = 487/760 (64%), Gaps = 37/760 (5%)
 Frame = -3

Query  2505  ATSYSKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRL  2332
             A  +++    C P  P   +  FC  ++ I  R+  L+  LT+ EKI+ L +N   +PRL
Sbjct  25    AVVHARLPFACDPRNPITRTLKFCRVTMSIHVRVQDLIGRLTLQEKIRLLVNNAIDVPRL  84

Query  2331  GIPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavea  2152
             GI  YEWWSE+LHG++  GPG  F GA   AT FPQVI TAA+FN +LW  I    + EA
Sbjct  85    GIQGYEWWSEALHGVSNVGPGTKFGGAFLGATSFPQVITTAASFNESLWEEIGRVVSDEA  144

Query  2151  rAMFNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkn  1972
             RAM+N G AGLTFW+PNVN+F DPRWGRGQETPGEDP++ + Y   YV+           
Sbjct  145   RAMYNGGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPVLAAKYGARYVK-----------  193

Query  1971  gRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYE  1792
                  L G      +   +RL ++ACCKH TAYDL+ W+   R+ FNA V++QD+EDTY+
Sbjct  194   ----GLQG------DGAGNRLKVAACCKHYTAYDLDNWNGVDRFHFNARVSKQDLEDTYD  243

Query  1791  PPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFE  1615
              PF++CV  G+ + +MC+YN VNG P CA+  LL+   R+ W   GYI SDCD+V   ++
Sbjct  244   VPFRACVVDGKVASVMCSYNQVNGKPTCADPSLLKGTIRSQWRLNGYIVSDCDSVGVYYD  303

Query  1614  YQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRL  1435
              Q Y K+PEEAA  A+KAG D++CG ++  + ++A++  +V E DI+ AL N  +VQ RL
Sbjct  304   DQHYTKTPEEAAADAIKAGLDLDCGPFLAIHTEAAVKTGLVNEIDINYALANTITVQMRL  363

Query  1434  GLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVI  1255
             G+F+G+   +++ + GP DVC      LALEAARQGIVLL+N    LPL  TR  ++AVI
Sbjct  364   GMFDGEPSTQRYGNLGPADVCKMSSNELALEAARQGIVLLENRGNSLPLSTTRHRTVAVI  423

Query  1254  GPMAN-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAK  1078
             GP ++ T ++ G+Y G+ C   + L G+  Y  +T + +GCL+V CN       A + A+
Sbjct  424   GPNSDVTETMIGNYAGVACGYTTPLQGIARYT-RTIHQAGCLNVHCNGNQLIGAAEAAAR  482

Query  1077  RADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISF  898
               D  I+V+GLD S E E  DR +LLLPGHQ  LV+ +A  S  P +LV+  G P+D++F
Sbjct  483   HVDATILVIGLDQSIEAEFRDRTNLLLPGHQQELVSRVARASRGPTILVIMSGSPIDVTF  542

Query  897   AKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRA  721
             AK DPRI +++W+GYPG+ GG A+++++FG  NP+G+LP+TWYP+++  K+PM DM MRA
Sbjct  543   AKNDPRIGAIIWVGYPGQAGGTAIADVLFGTTNPSGKLPMTWYPQNYVAKLPMTDMAMRA  602

Query  720   DPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRIS--LSQSIKTKLRRSILN  547
             +P+RGYPGRTYRFY G  V+ FG GLSY+ FS  L   PT +S  L+  I TK   ++LN
Sbjct  603   NPARGYPGRTYRFYKGPVVFPFGLGLSYTRFSHTLAQGPTLVSVPLTSLIATK-NTTMLN  661

Query  546   RGGNEPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIG  367
               G    V V   +NC+SL+  + V ++N G MDG+  +++F+  P      AP KQL+G
Sbjct  662   NNG----VRVSH-TNCDSLSLDIHVDVKNTGTMDGTHTLLVFATPPAEKW--APNKQLVG  714

Query  366   FDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             F +VH+         + +  C+HLS+V+  G R +PLG+H
Sbjct  715   FHKVHIVAGSERRVRVGVHVCKHLSVVDKFGIRRIPLGEH  754



>ref|NP_001233910.1| beta-D-xylosidase 1 precursor [Solanum lycopersicum]
 dbj|BAC98298.1| LEXYL1 [Solanum lycopersicum]
Length=770

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/748 (47%), Positives = 482/748 (64%), Gaps = 41/748 (5%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P   +  FCD SL +  R++ LV+ LT+ EKI  L      + RLGIP YEWWSE+LHG+
Sbjct  43    PALGNLTFCDASLAVENRVNDLVNRLTLGEKIGFLVSGAGGVSRLGIPKYEWWSEALHGV  102

Query  2286  ATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWA  2107
             A  GPG+ F   V  AT FPQVILTAA+FN TL+++I    + EARAM+N G AGLT+W+
Sbjct  103   AYTGPGVHFTSLVPGATSFPQVILTAASFNVTLFQTIGKVVSTEARAMYNVGLAGLTYWS  162

Query  2106  PNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEE  1927
             PNVN+F DPRWGRGQETPGEDP + S Y V YV GL                      ++
Sbjct  163   PNVNIFRDPRWGRGQETPGEDPTLTSKYGVAYVEGL----------------------QQ  200

Query  1926  EDD---DRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRA  1756
              DD   ++L ++ACCKH TAYD++ W    RYSFNAVV +QD++DT++PPF+SCV +G  
Sbjct  201   TDDGSTNKLKVAACCKHYTAYDVDNWKGIERYSFNAVVRQQDLDDTFQPPFRSCVLEGAV  260

Query  1755  SCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAA  1579
             + +MC+YN VNG P C + +LL    R +W   GYI +DCD++  IF+ Q Y K+PEEAA
Sbjct  261   ASVMCSYNQVNGKPTCGDPNLLAGIVRGEWKLNGYIVTDCDSLQVIFKSQNYTKTPEEAA  320

Query  1578  GIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKF  1399
              + L +G D+NCG+++    + A+  K+V ES IDRA+ N F+   RLG F+G   +R +
Sbjct  321   ALGLNSGVDLNCGSWLSTYTQGAVNQKLVNESVIDRAISNNFATLMRLGFFDGNPKSRIY  380

Query  1398  ESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSLGG  1222
              + GPKDVC+ E++ LA EAARQGIVLLKN    LPL  T + SLAVIGP AN T ++ G
Sbjct  381   GNLGPKDVCTPENQELAREAARQGIVLLKNTAGSLPLTPTAIKSLAVIGPNANVTKTMIG  440

Query  1221  DYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLD  1042
             +Y GIPC   + L GL   +  T Y  GC DV+CN+     +A  IA  AD V++V+G D
Sbjct  441   NYEGIPCKYTTPLQGLTASV-ATIYKPGCADVSCNTAQ-IDDAKQIATTADAVVLVMGSD  498

Query  1041  LSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLW  862
              S E E  DR S+ LPG Q  LV E+A V+  P++LV+  GG +D+ FA  +P+I S+LW
Sbjct  499   QSIEKESLDRTSITLPGQQSILVAEVAKVAKGPVILVIMSGGGMDVQFAVDNPKITSILW  558

Query  861   IGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTK-VPMNDMNMRADPSRGYPGRTYR  685
             +G+PGE GG AL++++FG YNP+GRLP+TWYP+S+   VPM DMNMR +P+  YPGRTYR
Sbjct  559   VGFPGEAGGAALADVIFGYYNPSGRLPMTWYPQSYADVVPMTDMNMRPNPATNYPGRTYR  618

Query  684   FYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEV-  508
             FYTG  V+ FGHGLSYS F   L  AP  +SL    K   R S            VD V 
Sbjct  619   FYTGPTVFTFGHGLSYSQFKHHLDKAPQFVSLPLGEKHTCRLSKCKT--------VDAVG  670

Query  507   SNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTE  328
              +C+++ F + + ++N G + GS ++ LF+  P+ +   AP+K L+GF++VH++  G   
Sbjct  671   QSCSNMGFDIHLRVKNVGKISGSHIIFLFTSPPSVH--NAPKKHLLGFEKVHLTPQGEGV  728

Query  327   TSISIEPCQHLSIVNVEGSRILPLGDHI  244
                ++  C+HLS+ +  G+R + LG H+
Sbjct  729   VKFNVNVCKHLSVHDELGNRKVALGPHV  756



>ref|XP_010030625.1| PREDICTED: probable beta-D-xylosidase 5 [Eucalyptus grandis]
Length=810

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/754 (48%), Positives = 497/754 (66%), Gaps = 33/754 (4%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P  S +PFC+TSL    R   LVSLLT+ EK+Q+L  + + I RLG+P Y WWSE+LHG+
Sbjct  50    PETSQFPFCNTSLSYQDRAKHLVSLLTLHEKVQQLVHHATGISRLGVPPYNWWSEALHGV  109

Query  2286  AT-NGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFW  2110
             A+  G  + F+G V  AT FP VIL+AA+FN TLW  +    + EARAM N GQAGLT+W
Sbjct  110   ASGRGEAVIFNGTVPGATSFPAVILSAASFNATLWYKMGQVVSTEARAMHNVGQAGLTYW  169

Query  2109  APNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEE  1930
             +PNVNVF DPRWGRGQETPGEDP+VVS YA  YVRGLQ               GN     
Sbjct  170   SPNVNVFRDPRWGRGQETPGEDPLVVSRYAANYVRGLQEVVE----------GGNYT---  216

Query  1929  EEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASC  1750
                D RL +S+CCKH TAYD++ W    R+ F+A VT+QDMEDTY+PPF+SC+E+GR S 
Sbjct  217   ---DSRLKVSSCCKHYTAYDVDSWKAVDRFHFDARVTKQDMEDTYQPPFRSCIEEGRVSS  273

Query  1749  LMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGI  1573
             +MC+YN VNG+P CA+ +LL+   R  WG +GYI SDCD++    +   Y  +PE+A  +
Sbjct  274   VMCSYNRVNGVPTCADPNLLKGIVRDQWGLDGYIVSDCDSIEVYHDRIHYTPTPEDAVAL  333

Query  1572  ALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFES  1393
             ALKAG ++NCG ++ +  ++A++ K V ES +D+AL+  ++V  RLG F+G   +  F +
Sbjct  334   ALKAGLNMNCGDFLSKYTQNAVKQKKVDESVVDQALVYNYAVLMRLGFFDGDPNSLPFGN  393

Query  1392  FGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSLGGDY  1216
              GP+DVC++E++ LAL+AA+QGIVLL NE   LPL ++ + ++AVIGP AN T+ +  +Y
Sbjct  394   LGPQDVCTNENQHLALDAAKQGIVLLANEGA-LPLSESTIKNMAVIGPNANATTVMISNY  452

Query  1215  TGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLS  1036
              G PC   S L GL +++   SY  GC DV C++   F  AV+IA  AD V+VVVGL LS
Sbjct  453   AGTPCQYTSPLQGLQKFVSTVSYEPGCADVKCSNKSLFEAAVNIATPADVVVVVVGLSLS  512

Query  1035  QETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIG  856
              E E  DR +L LPG Q  LV E++  +N  ++LV+   GP+D+SFAK   +I  +LW+G
Sbjct  513   IEKEGLDRVNLTLPGLQENLVMEVSEATNGTVILVIMSAGPVDVSFAKHVSKIKGILWVG  572

Query  855   YPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRADPSRGYPGRTYRFY  679
             YPG++GG A+++++FG+YNP GR P TWYP+ +  +VPM DMNMRA+ S  YPGRTYRFY
Sbjct  573   YPGQDGGDAIAQVIFGNYNPGGRSPFTWYPQEYADQVPMTDMNMRANASTNYPGRTYRFY  632

Query  678   TGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRG--------GNEPYV  523
             TG+ VY+FGHGLSYS +S  ++SAP+ I L Q   T  +  IL            N   +
Sbjct  633   TGKSVYQFGHGLSYSYYSKFIISAPSTI-LVQLAPTPDQHDILCSSSKVQILSDSNAQAI  691

Query  522   HVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYA--GGAPQKQLIGFDRVHV  349
              +  +  C  L F++ V + N+G MDG+ VV++F + P S     G P +QL+GF+R  V
Sbjct  692   DISAI-KCTDLGFNIVVGVTNDGKMDGTHVVLVFWKPPRSRGLITGVPIQQLVGFERAEV  750

Query  348   SGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
                   + ++ ++ C+HLS+ + EG+R+L  G H
Sbjct  751   KVGKTEKVTVRVDVCKHLSLADKEGNRLLVTGRH  784



>ref|XP_006444470.1| hypothetical protein CICLE_v10018959mg [Citrus clementina]
 ref|XP_006492318.1| PREDICTED: probable beta-D-xylosidase 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006492319.1| PREDICTED: probable beta-D-xylosidase 2-like isoform X2 [Citrus 
sinensis]
 gb|ESR57710.1| hypothetical protein CICLE_v10018959mg [Citrus clementina]
Length=770

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/748 (45%), Positives = 488/748 (65%), Gaps = 35/748 (5%)
 Frame = -3

Query  2475  CQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSE  2302
             C P   T  + PFC  SLPIP R++ L+  L++ EK++ L    +A+PRLGI  YEWWSE
Sbjct  30    CDPKDATTRTLPFCQVSLPIPQRVNDLIGRLSLQEKVKLLISGAAAVPRLGIKGYEWWSE  89

Query  2301  SLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAG  2122
             +LHG++  GPG  F G    AT FPQVI TA++FN TLW +I    + EARAM+N G AG
Sbjct  90    ALHGVSNVGPGTKFGGDFPGATSFPQVITTASSFNATLWEAIGRVVSDEARAMYNGGTAG  149

Query  2121  LTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNR  1942
             LT+W+PNVN+F DPRWGRGQETPGEDP++   YA  YVR                L G+ 
Sbjct  150   LTYWSPNVNIFRDPRWGRGQETPGEDPVLSGKYAASYVR---------------GLQGS-  193

Query  1941  MPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKG  1762
                   D DRL ++A CKH TAYDL+ W+   R+ FNA V++QD+EDT++ PF+ CV +G
Sbjct  194   ------DGDRLKVAASCKHFTAYDLDNWNGVDRFHFNAKVSKQDIEDTFDVPFRMCVMEG  247

Query  1761  RASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQYAKSPEE  1585
             + + +MC+YN VNG+P CA+ ++L++  R +W   GYI SDCD+V   ++ Q +  +PEE
Sbjct  248   KVASVMCSYNQVNGVPTCADPNILKRTIRGEWRLNGYIVSDCDSVGVYYDTQHFTSTPEE  307

Query  1584  AAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNR  1405
             AA  A++AG D++CG ++  + +SA++  ++ E DI+ AL+N  +VQ RLG+F+G+  ++
Sbjct  308   AAADAIRAGLDLDCGPFLGLHTESAVQRGLLSEIDINNALVNTLTVQMRLGMFDGEPSSQ  367

Query  1404  KFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSL  1228
              +   GPKDVC+ +H+ LALEAARQGIVLLKN+   LPL   R  ++AVIGP ++ T ++
Sbjct  368   PYGHLGPKDVCTPDHQELALEAARQGIVLLKNQGPSLPLSHIRHRTVAVIGPNSDVTVTM  427

Query  1227  GGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVG  1048
              G+Y GI C   + L G+G Y  +T +  GC DVAC     F  A+  +++AD  I+V+G
Sbjct  428   IGNYAGIACGYTTPLQGIGRYA-RTIHQQGCKDVACADDQLFGAAIDASRQADATILVMG  486

Query  1047  LDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASV  868
             LD S E E  DR  LLLPG Q  LV++++  S  P +LVL  GGP+D++FAK DPRIA++
Sbjct  487   LDQSIEAEALDRAGLLLPGRQQELVSKVSMASKGPTILVLMSGGPIDVAFAKNDPRIAAI  546

Query  867   LWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESF-TKVPMNDMNMRADPSRGYPGRT  691
             +W GYPG+ GG A+++I+FG  NP G+LP+TWYP+ + T +PM +M MR   S+ YPGRT
Sbjct  547   IWAGYPGQAGGTAIADILFGTSNPGGKLPMTWYPQEYITNLPMTEMAMRPSQSKRYPGRT  606

Query  690   YRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDE  511
             YRFY G  VY FGHG+SY++F   + +APT +    ++    R   +N   +   + V  
Sbjct  607   YRFYKGPVVYPFGHGMSYTNFVHTVANAPTVV----AVPLDGRHGSINATISGKAIKVTH  662

Query  510   VSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVT  331
              + CN L   V+V ++N G  DG+  +++FS  P  +   AP KQL+ F++VHV      
Sbjct  663   -AKCNRLTLGVQVDVKNVGSKDGAHTLLVFSTPPAGHW--APHKQLVAFEKVHVPAGAQQ  719

Query  330   ETSISIEPCQHLSIVNVEGSRILPLGDH  247
                I+I  C++LS+V+  G+R +PLG+H
Sbjct  720   RVGINIHVCKYLSVVDRSGTRRIPLGEH  747



>ref|XP_004301992.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Fragaria vesca subsp. vesca]
Length=774

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/741 (48%), Positives = 485/741 (65%), Gaps = 34/741 (5%)
 Frame = -3

Query  2454  SYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGIATNG  2275
             S+PFCD SL + AR+  LV  LT+ EKI  L D    + RLGIP Y+WWSE+LHG++  G
Sbjct  50    SFPFCDKSLAVDARVADLVQRLTLQEKITFLVDAAGNVSRLGIPTYQWWSEALHGVSKVG  109

Query  2274  PGIT-FDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWAPNV  2098
              G T F   V  AT FPQ ILTAA+FN +L+ +I    + EARAM+N G AGLT+WAPN+
Sbjct  110   RGGTKFTELVPGATSFPQPILTAASFNNSLFEAIGRVVSTEARAMYNVGLAGLTYWAPNI  169

Query  2097  NVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEEEDD  1918
             N+F DPRWGRGQETPGEDP++ S+Y   YVRGLQ                     + +D 
Sbjct  170   NIFRDPRWGRGQETPGEDPLLTSNYGAGYVRGLQQT-------------------DSQDK  210

Query  1917  DRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCLMCA  1738
             +RL ++ACCKH TAYDL+ W  + RY+FNAVVT+QDMEDT++PP KSCV +G A+ +MC+
Sbjct  211   NRLKVAACCKHYTAYDLDHWKGYDRYTFNAVVTQQDMEDTFQPPLKSCVLEGNAASVMCS  270

Query  1737  YNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIALKA  1561
             Y  VNG P CA+ DLL    R +W   GYI +DCD++   + YQ Y K+PEEAA + + A
Sbjct  271   YQQVNGKPTCADPDLLSGVIRGEWNLNGYIVTDCDSIDVYYNYQHYTKTPEEAAAMGILA  330

Query  1560  GTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESFGPK  1381
             G D++CG Y     + A++  +V E+ ID+A+ N F    RLG F+G    + +   GPK
Sbjct  331   GVDLDCGPYFGMYTEGAVKGGLVTEAAIDKAITNNFGTLMRLGFFDGDPSKQPYGDLGPK  390

Query  1380  DVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSLGGDYTGIP  1204
             DVC+ E++ LA E ARQGIVLLKN    LPL  T + SLAVIGP  N T ++ GDY GIP
Sbjct  391   DVCTPENQELARETARQGIVLLKNSAGSLPLSPTAIKSLAVIGPNGNATDTMIGDYFGIP  450

Query  1203  CALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQETE  1024
             C   S L GL   +  T + +GC DVAC +     +A  +A  AD  +V+VG +   ETE
Sbjct  451   CKYTSPLQGLTAVVPAT-FVAGCPDVACGTAQ-VDDATKLAAAADATVVIVGENQLIETE  508

Query  1023  DHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGYPGE  844
              HDR  L LPG Q  L++E+A  S  P++LV+  GG  DI+FAK D +I S+LW+GYPGE
Sbjct  509   SHDRTDLYLPGQQTLLISEVAKASKGPVILVIMSGGGYDITFAKNDDKITSILWVGYPGE  568

Query  843   EGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRADPSRGYPGRTYRFYTGEK  667
              GG A+++++FG YNP+GRLP+TWYP+++  KVPMN+MNMR DP+ GYPGRTYRFYTG+ 
Sbjct  569   AGGAAIADVIFGFYNPSGRLPMTWYPQAYVDKVPMNNMNMRPDPASGYPGRTYRFYTGDT  628

Query  666   VYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEVSNCNSLA  487
             VYEFGHGLSYS+FS  L+ AP ++S+        +  + +    +    V+E   C +LA
Sbjct  629   VYEFGHGLSYSNFSHRLVQAPKQVSIPLE-----QDHVCHSSSCQSLDVVEE--RCQNLA  681

Query  486   FSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSISIEP  307
             F + V ++N G M GS  V+L+S  P+ +   AP+K L+GF++V +S         +++ 
Sbjct  682   FDIHVGVKNMGKMSGSHTVILYSSPPSVH--NAPKKHLLGFEKVFLSSQKEALVKFNVDV  739

Query  306   CQHLSIVNVEGSRILPLGDHI  244
             C+HLS+V+  G+R + LGDH+
Sbjct  740   CKHLSVVDELGNRKVALGDHV  760



>ref|XP_006341844.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Solanum tuberosum]
Length=806

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/748 (47%), Positives = 484/748 (65%), Gaps = 41/748 (5%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P   +  FCD SL +  R++ LV  LT+ EKI  L    S + RLGIP YEWWSE+LHG+
Sbjct  79    PALGNLTFCDASLTVENRVNDLVKRLTLGEKIGFLVSGASGVSRLGIPKYEWWSEALHGV  138

Query  2286  ATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWA  2107
             A  GPG+ F   V  AT FPQVILTAA+FN +L+++I    + EARAM+N G AGLT+W+
Sbjct  139   AYTGPGVHFSSLVPGATSFPQVILTAASFNVSLFQTIGKVVSTEARAMYNVGLAGLTYWS  198

Query  2106  PNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEE  1927
             PNVN+F DPRWGRGQETPGEDP + S Y V YV+GL                      ++
Sbjct  199   PNVNIFRDPRWGRGQETPGEDPTLTSTYGVAYVKGL----------------------QQ  236

Query  1926  EDD---DRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRA  1756
              DD   ++L ++ACCKH TAYD++ W    RYSFNAVVT+QD++DT++PPFKSCV +G  
Sbjct  237   TDDGSTNKLKVAACCKHYTAYDVDNWKGIERYSFNAVVTQQDLDDTFQPPFKSCVLEGDV  296

Query  1755  SCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAA  1579
             + +MC+YN VNG P C + +LL    R +W   GYI +DCD++  IF+ Q Y K+PEEAA
Sbjct  297   ASVMCSYNQVNGKPTCGDPNLLAGIIRGEWKLNGYIVTDCDSLQVIFKSQNYTKTPEEAA  356

Query  1578  GIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKF  1399
              + L +G D+NCG+++    + A+  K+V ES IDRA+ N F+   RLG F+G   NR +
Sbjct  357   ALGLNSGVDLNCGSWLSTYTQGAVNQKLVNESVIDRAISNNFATLMRLGFFDGNPKNRIY  416

Query  1398  ESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSLGG  1222
              + GPKDVC+ E++ LA EAARQGIVLLKN    LPL  T + SLAVIGP AN T ++ G
Sbjct  417   GNLGPKDVCTLENQELAREAARQGIVLLKNTAGSLPLTPTVIKSLAVIGPNANVTKTMIG  476

Query  1221  DYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLD  1042
             +Y GIPC   + L GL   +  T Y  GC DV+CN+     +A  IA  AD V++V+G D
Sbjct  477   NYEGIPCKYTTPLQGLTASV-ATIYKPGCADVSCNTAQ-IDDAKQIASTADAVVLVMGSD  534

Query  1041  LSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLW  862
              S E E  DR ++ LPG Q  LV E+A V+  P++LV+  GG +D+ FA  +P+I S+LW
Sbjct  535   QSIEKESLDRTNITLPGQQSVLVAEVAKVAKGPVILVIMSGGGMDVQFAVDNPKITSILW  594

Query  861   IGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTK-VPMNDMNMRADPSRGYPGRTYR  685
             +G+PGE GG AL++++FG YNP+GRLP+TWYP+S+   VPM +MNMR +P+  YPGRTYR
Sbjct  595   VGFPGEAGGAALADVIFGYYNPSGRLPMTWYPQSYADVVPMTNMNMRPNPATNYPGRTYR  654

Query  684   FYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEV-  508
             FYTG  V+ FGHGLSYS F   L  AP  +SL    K   R S            VD V 
Sbjct  655   FYTGPTVFTFGHGLSYSQFKHHLDKAPQFVSLPLGEKHTCRLSKCKT--------VDAVG  706

Query  507   SNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTE  328
              +C+++ F + + ++N G + GS  + LF+  P+ +   AP+K L+GF++VH++  G   
Sbjct  707   QSCSNMGFDIHLRVKNVGKISGSHTIFLFTSPPSVH--NAPKKHLLGFEKVHLTPQGEGV  764

Query  327   TSISIEPCQHLSIVNVEGSRILPLGDHI  244
                +++ C+HLS+ +  G+R + LG H+
Sbjct  765   VKFNVDVCKHLSVHDELGNRKVALGPHV  792



>ref|XP_002264183.2| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Vitis vinifera]
Length=774

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/759 (48%), Positives = 485/759 (64%), Gaps = 42/759 (6%)
 Frame = -3

Query  2493  SKPQLPC---QPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIP  2323
             S P   C     PT   + FC+TSL   AR+  LV  LT++EKI  L ++ +++ RLGIP
Sbjct  35    SSPVFACDVENNPTLGQFGFCNTSLETAARVADLVKRLTLEEKIGFLVNSAASVSRLGIP  94

Query  2322  AYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAM  2143
              YEWWSE+LHG++  GPG  F+  V  AT FPQVILTAA+FN +L+ +I  A + EARAM
Sbjct  95    KYEWWSEALHGVSYVGPGTHFNSVVPGATSFPQVILTAASFNASLFEAIGKAVSTEARAM  154

Query  2142  FNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             +N G AGLTFW+PNVN+F DPRWGRGQETPGEDP++ S YA  YV               
Sbjct  155   YNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYV---------------  199

Query  1962  YSLSGNRMPEEEEDD--DRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEP  1789
                   R  ++ +D   DRL ++ACCKH TAYDL+ W    R+ FNAVVT+QDM+DT++P
Sbjct  200   ------RGLQQSDDGSPDRLKVAACCKHYTAYDLDNWKGVDRFHFNAVVTKQDMDDTFQP  253

Query  1788  PFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEY  1612
             PFKSCV  G  + +MC+YN VNG PACA+ DLL    R +W   GYI SDCD+V   +  
Sbjct  254   PFKSCVIDGNVASVMCSYNQVNGKPACADPDLLSGIVRGEWKLNGYIVSDCDSVDVFYNS  313

Query  1611  QQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLG  1432
             Q Y K+PEEAA  A+ AG D+NCG+++ ++ ++A++  +V ES +D+A+ N F+   RLG
Sbjct  314   QHYTKTPEEAAAKAILAGLDLNCGSFLGQHTEAAVKGGLVDESAVDKAVSNNFATLMRLG  373

Query  1431  LFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIG  1252
              F+G      +   GPKDVC+SEH+ LA EAARQGIVLLKN +  LPL  T + +LAVIG
Sbjct  374   FFDGNPSKAIYGKLGPKDVCTSEHQELAREAARQGIVLLKNSKGSLPLSPTAIKTLAVIG  433

Query  1251  PMAN-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKR  1075
             P AN T ++ G+Y G PC   + L GL   +  T+Y  GC +VAC  T    EA  IA  
Sbjct  434   PNANVTKTMIGNYEGTPCKYTTPLQGLTALV-ATTYLPGCSNVAC-GTAQIDEAKKIAAA  491

Query  1074  ADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFA  895
             AD  +++VG+D S E E  DR ++ LPG Q  L+ E+A  S   ++LV+  GG  DISFA
Sbjct  492   ADATVLIVGIDQSIEAEGRDRVNIQLPGQQPLLITEVAKASKGNVILVVMSGGGFDISFA  551

Query  894   KKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRAD  718
             K D +I S+LW+GYPGE GG A+++++FG YNP+GRLP+TWYP+S+  KVPM +MNMR D
Sbjct  552   KNDDKITSILWVGYPGEAGGAAIADVIFGFYNPSGRLPMTWYPQSYVDKVPMTNMNMRPD  611

Query  717   PSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGG  538
             P+ GYPGRTYRFYTGE +Y FG GLSY+ F+  L+ AP  +S+          S      
Sbjct  612   PASGYPGRTYRFYTGETIYTFGDGLSYTQFNHHLVQAPKSVSIPIEEGHSCHSSKCKS--  669

Query  537   NEPYVHVDEVS-NCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFD  361
                   VD V  +C +L F + + + N G + GS  V LFS  P+ +   +PQK L+GF+
Sbjct  670   ------VDAVQESCQNLVFDIHLRVNNAGNISGSHTVFLFSSPPSVH--NSPQKHLLGFE  721

Query  360   RVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             +V V+          ++ C+ LSIV+  G+R + LG H+
Sbjct  722   KVFVTAKAKALVRFKVDVCKDLSIVDELGTRKVALGLHV  760



>ref|XP_008390557.1| PREDICTED: putative beta-D-xylosidase [Malus domestica]
Length=776

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/759 (45%), Positives = 483/759 (64%), Gaps = 35/759 (5%)
 Frame = -3

Query  2505  ATSYSKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRL  2332
             A  +++P   C P  P      FC   +PI  R+H L+  LT+ EKI+ L +N   +PRL
Sbjct  25    AVVHARPPFACDPRNPITRXLKFCRVRVPIXDRVHDLIGRLTLQEKIRLLVNNAIDVPRL  84

Query  2331  GIPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavea  2152
             GI  YEWWSE+LHG++  GPG  F G    AT FPQVI TAA+FN +LW  I    + EA
Sbjct  85    GIQGYEWWSEALHGVSNVGPGTKFGGTFLGATSFPQVITTAASFNESLWEEIGRVVSDEA  144

Query  2151  rAMFNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkn  1972
             RAM+N G AGLTFW+PNVN+F DPRWGRGQETPGEDP++ + Y   YV+           
Sbjct  145   RAMYNGGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPVLAAKYGARYVK-----------  193

Query  1971  gRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYE  1792
                  L G      +   +RL ++ACCKH TAYDL+ W+   R+ FNA V++QD+EDTY+
Sbjct  194   ----GLQG------DGXGNRLKVAACCKHYTAYDLDNWNGVDRFHFNARVSKQDLEDTYD  243

Query  1791  PPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFE  1615
              PF++CV  G  + +MC+YN VNG P CA+ +LL+   R  W   GYI SDCD+V   ++
Sbjct  244   VPFRACVVDGNVASVMCSYNQVNGKPTCADPNLLKGTIRGQWRLNGYIVSDCDSVGVYYD  303

Query  1614  YQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRL  1435
              Q Y K+PEEAA  A+KAG D++CG ++  + ++A+   +V E DI+ AL N  +VQ RL
Sbjct  304   DQHYTKTPEEAAADAIKAGLDLDCGPFLAIHTEAAVRTGLVNEIDINYALANTITVQMRL  363

Query  1434  GLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVI  1255
             G+F+G+   +++ + GP DVC      LALEAARQGIVLL+N    LPL  TR  ++AVI
Sbjct  364   GMFDGEPSTQRYGNLGPADVCKMSSNELALEAARQGIVLLENRGNSLPLSTTRHRTVAVI  423

Query  1254  GPMAN-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAK  1078
             GP ++ T ++ G+Y G+ C   + L G+  Y  +T + +GC +V CN       A + A+
Sbjct  424   GPNSDVTETMIGNYAGVACGYTTPLQGIARYT-RTIHQAGCSNVHCNGNQLIGAAEAXAR  482

Query  1077  RADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISF  898
             +AD  ++V+GLD S E E  DR +LLLPGHQ  LV+ +A  S  P +LV+  G P+D++F
Sbjct  483   QADATVLVIGLDQSIEAEFRDRTNLLLPGHQQELVSMVARASRGPTILVIMSGSPIDVTF  542

Query  897   AKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRA  721
             AK DPRI +++W+GYPG+ GG A+++++FG  NP+G+LP+TWYP+++  K+PM DM MRA
Sbjct  543   AKNDPRIGAIIWVGYPGQAGGTAIADVLFGTTNPSGKLPMTWYPQNYVAKLPMTDMAMRA  602

Query  720   DPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLS-QSIKTKLRRSILNR  544
             +P+RGYPGRTYRFY G  V+ FG GLSY+ FS  L   PT +S+   S+      ++LN 
Sbjct  603   NPARGYPGRTYRFYKGPVVFPFGLGLSYTRFSYTLAQGPTLVSVPLTSLVAAKNTTMLNN  662

Query  543   GGNEPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGF  364
              G    V V  + NC+SL+  + V ++N G MDG+  +++F   P      AP KQL+GF
Sbjct  663   NG----VRVSHI-NCDSLSLDIHVDVKNTGTMDGTHTLLVFVTPPAEKW--APNKQLVGF  715

Query  363   DRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
              +VH+         + +  C+HLS+V+  G R +PLG+H
Sbjct  716   HKVHIVAGSERRVRVGVHVCKHLSVVDKFGIRRIPLGEH  754



>gb|AFU54452.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Prunus salicina]
Length=775

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/757 (46%), Positives = 497/757 (66%), Gaps = 37/757 (5%)
 Frame = -3

Query  2496  YSKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIP  2323
             +++P   C P  P      FC  ++PI  R+  L+  LT+ EKI+ L +N  A+PRLGI 
Sbjct  27    HARPPFACDPHNPITRGLKFCRVTVPIHVRVQDLIGRLTLQEKIRLLVNNAIAVPRLGIQ  86

Query  2322  AYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAM  2143
              YEWWSE+LHG++  GPG  F GA   AT FPQVI TAA+FN +LW+ I      EARAM
Sbjct  87    GYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWQEIGRVVPDEARAM  146

Query  2142  FNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             +N G AGLT+W+PNVN+F DPRWGRGQETPGEDP++ S YA  YV+              
Sbjct  147   YNGGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLASKYAARYVK--------------  192

Query  1962  YSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
               L G      +   +RL ++ACCKH TAYDL+ W+  +R+ FNA V++QD+ DTY  PF
Sbjct  193   -GLQG------DGAGNRLKVAACCKHYTAYDLDNWNGVNRFHFNARVSKQDLADTYNVPF  245

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQ  1606
             K+CV +G  + +MC+YN VNG P CA+ DLL+   R  W   GYI SDCD+V  ++E Q 
Sbjct  246   KACVVEGHVASVMCSYNQVNGKPTCADPDLLKGTIRGQWRLNGYIVSDCDSVGVLYEEQH  305

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             Y ++PEEAA  A+KAG D++CG ++  + ++A+   +V + +I+ AL N  +VQ RLG+F
Sbjct  306   YTRTPEEAAADAIKAGLDLDCGPFLAIHTEAAVRRGLVSQLEINWALANTMTVQMRLGMF  365

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPM  1246
             +G+    ++ + GP+DVC+  H++LALEAARQGIVLL+N  + LPL   R  ++AVIGP 
Sbjct  366   DGEPSAHQYGNLGPRDVCTPAHQQLALEAARQGIVLLENRGRSLPLSIRRHRTVAVIGPN  425

Query  1245  AN-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             ++ T ++ G+Y G+ C   + L G+G Y  +T + +GC DV CN    F  A + A++AD
Sbjct  426   SDVTVTMIGNYAGVACGYTTPLQGIGRYT-RTIHQAGCTDVHCNGNQLFGAAEAAARQAD  484

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
               ++V+GLD S E E  DR  LLLPGHQ  LV+ +A  S  P +LVL  GGP+D++FAK 
Sbjct  485   ATVLVMGLDQSIEAEFVDRVGLLLPGHQQELVSRVARASRGPTILVLMSGGPIDVTFAKN  544

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESF-TKVPMNDMNMRADPS  712
             DPRI++++W+GYPG+ GG A+++++FG  NP G+LP+TWYP+++ T +PM DM MRADP+
Sbjct  545   DPRISAIIWVGYPGQAGGTAIADVLFGTTNPGGKLPMTWYPQNYVTHLPMTDMAMRADPA  604

Query  711   RGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLS-QSIKTKLRRSILNRGGN  535
             RGYPGRTYRFY G  V+ FG GLSY++F+  L   PT +S+   S+K     ++L++   
Sbjct  605   RGYPGRTYRFYRGPVVFPFGLGLSYTTFAHNLAHGPTSVSVPLTSLKATANSTMLSKA--  662

Query  534   EPYVHVDEVSNCNSLA-FSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDR  358
                V V   ++CN+L+   V V ++N G MDG+  +++F+  P      A  KQL+GF +
Sbjct  663   ---VRVSH-ADCNALSPLDVHVDVKNTGSMDGTHTLLVFTSPPDGKW--AASKQLVGFHK  716

Query  357   VHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             +H++    T   I++  C+HLS+V+  G R +PLG+H
Sbjct  717   IHIAAGSETRVRIAVHVCKHLSVVDRFGIRRIPLGEH  753



>gb|AAP83934.1| auxin-induced beta-glucosidase [Oxybasis rubra]
Length=767

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/756 (46%), Positives = 487/756 (64%), Gaps = 45/756 (6%)
 Frame = -3

Query  2481  LPCQPPT--HSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWW  2308
             L C P +    +  FC  +LPI AR+  L+  L + EK++ L +N + +PRLGI  YEWW
Sbjct  26    LACDPKSGLTRALRFCRVNLPIRARVQDLIGRLNLQEKVKLLVNNAAPVPRLGISGYEWW  85

Query  2307  SESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQ  2128
             SE+LHG++  GPG  F GA  +AT FPQVI TAA+FN +LW +I    + EARAM+N G 
Sbjct  86    SEALHGVSNVGPGTKFRGAFPAATSFPQVITTAASFNASLWEAIGQVVSDEARAMYNGGT  145

Query  2127  AGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSG  1948
             AGLT+W+PNVN+F DPRWGRGQETPGEDP + S YA  YV                    
Sbjct  146   AGLTYWSPNVNIFRDPRWGRGQETPGEDPTLASQYAASYV--------------------  185

Query  1947  NRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVE  1768
              R  +   + +RL ++ACCKH TAYDL+ W+   R+ FNA V++QD+EDTY  PFK CV+
Sbjct  186   -RGLQGIYNKNRLKVAACCKHYTAYDLDNWNAVDRFHFNAKVSKQDLEDTYNVPFKGCVQ  244

Query  1767  KGRASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQYAKSP  1591
             +GR + +MC+YN VNG P CA+ DLL    R  W   GYI SDCD+V  +++ Q Y ++P
Sbjct  245   EGRVASVMCSYNQVNGKPTCADPDLLRNTIRGQWRLNGYIVSDCDSVGVLYDDQHYTRTP  304

Query  1590  EEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAV  1411
             EEAA   +KAG D++CG ++  + ++A++  ++ E+D+++AL N F+VQ RLG+F+G+A 
Sbjct  305   EEAAADTIKAGLDLDCGPFLAVHTEAAVKRGLLTEADVNQALTNTFTVQMRLGMFDGEAA  364

Query  1410  NRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TS  1234
              + F   GPKDVCS  H+ LAL+AARQGIVLL+N  + LPL   R  ++AVIGP A+ T 
Sbjct  365   AQPFGHLGPKDVCSPAHQDLALQAARQGIVLLQNRGRSLPLSTARHRNIAVIGPNADATV  424

Query  1233  SLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVV  1054
             ++ G+Y G+ C   S L G+  Y  KT + +GC+ VAC S   F  A + A  AD  ++V
Sbjct  425   TMIGNYAGVACGYTSPLQGIARYA-KTVHQAGCIGVACTSNQQFGAATAAAAHADATVLV  483

Query  1053  VGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIA  874
             +GLD S E E  DR S+LLPGHQ  LV+++A  S  P +LVL  GGP+D++FAK DP+I+
Sbjct  484   MGLDQSIEAEFRDRASVLLPGHQQELVSKVALASRGPTILVLMCGGPVDVTFAKNDPKIS  543

Query  873   SVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRADPSRGYPG  697
             ++LW+GYPG+ GG A+++++FG  NP G+LP TWYP+S+  KVPM D+ MRA+PS GYPG
Sbjct  544   AILWVGYPGQAGGTAIADVLFGTTNPGGKLPNTWYPQSYVAKVPMTDLAMRANPSNGYPG  603

Query  696   RTYRFYTGEKVYEFGHGlsyssfslellSAPTRI------SLSQSIKTKLRRSILNRGGN  535
             RTYRFY G  V+ FG GLSY+ F+  L  APT++        + S  T   +  L     
Sbjct  604   RTYRFYKGPVVFPFGFGLSYTRFTQSLAHAPTKVMVPLANQFTNSNITSFNKDALK----  659

Query  534   EPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRV  355
                +H    +NC+++  S+ + ++N G +DGS  +++FS  P      + +KQLIGF RV
Sbjct  660   --VLH----TNCDNIPLSLHIDVKNKGKVDGSHTILVFSTPPKGTK--SSEKQLIGFKRV  711

Query  354   HVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             HV         ++I  C HLS  +  G R +P+G+H
Sbjct  712   HVFAGSKQRVRMNIHVCNHLSRADEFGVRRIPIGEH  747



>ref|XP_007043027.1| Beta-D-xylosidase 4 [Theobroma cacao]
 gb|EOX98858.1| Beta-D-xylosidase 4 [Theobroma cacao]
Length=787

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/744 (48%), Positives = 479/744 (64%), Gaps = 33/744 (4%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P  +SY FC+ SL I +R+  LV  LT+ EKI  +     ++ RLGIP YEWWSE+LHG+
Sbjct  60    PEVTSYDFCNASLGIESRVADLVQRLTLQEKILFIVSGAGSVSRLGIPKYEWWSEALHGV  119

Query  2286  ATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWA  2107
             +  GPG  F   V  AT FPQVILTAA+FN TL+ +I    + EARAM+N G AGLT+W+
Sbjct  120   SNVGPGTKFSSLVPGATSFPQVILTAASFNTTLFEAIGRVVSTEARAMYNVGLAGLTYWS  179

Query  2106  PNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEE  1927
             PN+N+F DPRWGRGQETPGEDP++ S Y   YV+GLQ                     + 
Sbjct  180   PNINIFRDPRWGRGQETPGEDPLLTSKYGSSYVKGLQQ-------------------SDG  220

Query  1926  EDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCL  1747
              D  RL ++ACCKH TAYDL+ W    RY FNAVVT+QDM+DT++PPFKSCV  G  + +
Sbjct  221   GDPSRLKVAACCKHYTAYDLDNWKGVDRYHFNAVVTQQDMDDTFQPPFKSCVIDGNVASV  280

Query  1746  MCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIA  1570
             MC+YN VNG P CA+ DLL    R  W   GYI SDCD+V   ++ Q Y K+PEEAA  A
Sbjct  281   MCSYNQVNGKPTCADPDLLAGVVRGQWKLNGYIVSDCDSVEVFYKSQHYTKTPEEAAAKA  340

Query  1569  LKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESF  1390
             + AG D+NCG+++ ++ ++A++  ++ ES ID A+ N F+   RLG FNG    + +   
Sbjct  341   ILAGLDLNCGSFLGQHTEAAVKAGLLNESAIDNAVTNNFATLMRLGFFNGDPSKQLYGKL  400

Query  1389  GPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSLGGDYT  1213
             GPKDVC+ EH+ LA EAARQGIVLLKN    LPL  T + +LAVIGP AN T ++ G+Y 
Sbjct  401   GPKDVCTPEHQELAREAARQGIVLLKNSAGSLPLSPTAIQTLAVIGPNANVTKTMIGNYE  460

Query  1212  GIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQ  1033
             GIPC   + L GL      T+Y  GC +VAC  T    +A  +A  AD  ++V+G+D S 
Sbjct  461   GIPCKYTTPLQGLTASA-ATTYLPGCSNVACG-TAQVDDAKKLAASADATVLVMGIDQSL  518

Query  1032  ETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGY  853
             E E  DR  L+LPG Q  L+ E+A  +  P++LV+  GG  DISFAK + +I S+LW+GY
Sbjct  519   ERESFDRVDLVLPGQQPLLITEVAKAAKGPVILVIMSGGGFDISFAKNNDKITSILWVGY  578

Query  852   PGEEGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRADPSRGYPGRTYRFYT  676
             PGE GG A+++++FG YNP+GRLP+TWYP+S+  KVPM +MNMR DPS GYPGRTYRFYT
Sbjct  579   PGEAGGAAIADVIFGYYNPSGRLPMTWYPQSYVDKVPMTNMNMRPDPSSGYPGRTYRFYT  638

Query  675   GEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEVSNCN  496
             GE +Y FG GLSYS FS +L+ AP  +S+       L    + R      V   E S C 
Sbjct  639   GETIYTFGDGLSYSKFSHQLVKAPQLVSI------PLEEVHVCRSSECKSVDAIEQS-CK  691

Query  495   SLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSIS  316
             +LAF + + ++N G   GS  V LFS  P+ +   +P+K L+GF++V ++G   +     
Sbjct  692   NLAFDIHLRVQNKGRNSGSHTVFLFSTPPSVH--NSPRKHLLGFEKVLLTGKSESLVRFK  749

Query  315   IEPCQHLSIVNVEGSRILPLGDHI  244
             ++ C+ LS+V+  GSR + LG H+
Sbjct  750   VDVCKDLSVVDERGSRKVSLGQHV  773



>ref|XP_004300463.1| PREDICTED: probable beta-D-xylosidase 2-like [Fragaria vesca 
subsp. vesca]
Length=790

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/764 (46%), Positives = 483/764 (63%), Gaps = 45/764 (6%)
 Frame = -3

Query  2472  QPPTHSSY------------PFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLG  2329
             Q PT SS+            PFC   LPI  R+  L+  LT+ EK++ L ++  A+PRLG
Sbjct  28    QSPTSSSFACNPNDASTKDLPFCRVKLPIHVRVRDLIGRLTLQEKVKLLVNSAKAVPRLG  87

Query  2328  IPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavear  2149
             I  YEWWSE+LHG++  GPG  F G    AT FPQVI TAA+FN +LW +I  A + EAR
Sbjct  88    IKDYEWWSEALHGVSNVGPGTKFGGEFPGATSFPQVITTAASFNASLWEAIGQAVSDEAR  147

Query  2148  AMFNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkng  1969
             AM+N G  GLT+W+PNVNV  DPRWGRGQETPGEDP+VV  YA  YVR            
Sbjct  148   AMYNGGMGGLTYWSPNVNVLRDPRWGRGQETPGEDPVVVGAYAASYVR------------  195

Query  1968  RKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEP  1789
                 L GN          +L ++ACCKH TAYDL+ WH   R+ FNA V++QDMEDT++ 
Sbjct  196   ---GLQGN-----AGGGHQLKVAACCKHFTAYDLDNWHGVDRFHFNARVSKQDMEDTFDV  247

Query  1788  PFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEY  1612
             PF+ CV++G+ + +MC+YN VNG+P CA+ +LL+K  R  WG +GYI SDCD+V   ++ 
Sbjct  248   PFRMCVKEGKVASVMCSYNQVNGVPTCADPNLLKKTVRAQWGLDGYIVSDCDSVGVFYDN  307

Query  1611  QQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESD-IDRALLNLFSVQFRL  1435
             Q Y  +PEEAA +ALKAG D++CG ++  + + A++  ++ E D ID AL N  +VQ RL
Sbjct  308   QHYTSTPEEAAAVALKAGLDLDCGPFLGLHTEDAVKKGLLSEVDHIDLALANTLTVQMRL  367

Query  1434  GLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVI  1255
             G+F+G A    + + GP+DVCS  H++LAL+AA QGIVLLKN    LPL   R  ++AVI
Sbjct  368   GMFDGSA--HPYANLGPRDVCSPAHQQLALDAATQGIVLLKNHGTSLPLSTRRHRTVAVI  425

Query  1254  GPMAN-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAK  1078
             GP ++ T ++ G+Y G+ C   + L G+G+Y  +T +  GC +VAC     F  A+  A+
Sbjct  426   GPNSDVTVTMIGNYAGVACGYTTPLQGIGKY-SRTVHQQGCSNVACKEDTLFGAAIDAAR  484

Query  1077  RADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISF  898
             +AD  I+V+GLD S E E  DR  LLLPG Q  L++++A  S  P +LVL  GGP+D++F
Sbjct  485   QADATILVMGLDQSIEAEFRDRVGLLLPGRQQELISKVAASSKGPTILVLMSGGPVDVTF  544

Query  897   AKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTK-VPMNDMNMRA  721
             AK DP IA ++W GYPG+ GG+A+++IVFG  NP G+LP+TWYPE + + + M DM MR+
Sbjct  545   AKNDPHIAGIVWAGYPGQAGGQAIADIVFGISNPGGKLPMTWYPEEYLRNLEMTDMGMRS  604

Query  720   DPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLS-QSIKTKLRRSILNR  544
              PS+GYPGRTYRFY G  VY FGHGL Y+ F   + SAPT +++      T+   S  N 
Sbjct  605   RPSKGYPGRTYRFYKGPIVYPFGHGLGYTKFVQTVASAPTVVAVPLDGHHTETSTSAGNG  664

Query  543   GGNEPYVHVDEV-----SNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQK  379
              G  P+    +      + C+ L+  V V +RN G  DGS  ++++S  P +     P K
Sbjct  665   TGTRPFAADGKAIRVTHAKCSKLSLVVDVDVRNVGNRDGSHTLLVYSSPPAAAGHWVPHK  724

Query  378   QLIGFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             QL+ F++V+V          +I  C+HLS+V+  G R +P+G H
Sbjct  725   QLVAFEKVYVPARTQRRVRFNIHVCKHLSVVDRSGIRRIPMGRH  768



>gb|EAY80685.1| hypothetical protein OsI_35867 [Oryza sativa Indica Group]
Length=779

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/759 (47%), Positives = 482/759 (64%), Gaps = 39/759 (5%)
 Frame = -3

Query  2487  PQLPCQPPT-HSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEW  2311
             P   C P +    + FC+ +LP   R   LV+ LT  EK+ +L D    +PRLGIP Y+W
Sbjct  35    PGFTCGPASAQKGFAFCNAALPAEQRAADLVARLTTAEKVGQLGDQAPGVPRLGIPVYKW  94

Query  2310  WSESLHGIATNGPGITF-DGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WSE+LHG+A +G GI F +G  ++AT FPQVI TAAAF+  LW  I  A   E RA +N 
Sbjct  95    WSEALHGLAISGKGIHFGNGPARTATSFPQVIHTAAAFDDGLWFRIGQAIGKEGRAFYNL  154

Query  2133  GQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYS  1957
             GQA GL  W+PNVN+F DPRWGRGQETPGEDP   S Y   +V+                
Sbjct  155   GQAEGLAMWSPNVNIFRDPRWGRGQETPGEDPATASKYGAAFVK---------------G  199

Query  1956  LSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKS  1777
             L G+ +         L  SACCKH+TAYD+E W   SRY+FNA VT QD+ DTY PPF+S
Sbjct  200   LQGSSLTN-------LQTSACCKHITAYDIEEWKGVSRYNFNAKVTPQDLADTYNPPFRS  252

Query  1776  CVEKGRASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQYA  1600
             CV  G+ASC+MCAY  +NG+PACA+ DLL K  R +W  +GY  SDCDAVA + + + + 
Sbjct  253   CVVDGKASCIMCAYTLINGVPACASSDLLTKTVRGEWKLDGYTASDCDAVAILHKSEHFT  312

Query  1599  KSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNG  1420
             ++ EEA  +ALKAG DINCG YM +N  SAL+   + E D+D+AL NLF+++ RLG F+G
Sbjct  313   RTAEEAVAVALKAGLDINCGVYMQQNAASALQQGKMTEKDVDKALKNLFAIRMRLGHFDG  372

Query  1419  KAV-NRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMA  1243
                 N+ +   G  DVC+  H+ LALEAAR+G+VLLKN+ + LPL    VSS AVIG  A
Sbjct  373   DPRGNKLYGRLGAADVCTPVHKALALEAARRGVVLLKNDARLLPLRAPTVSSAAVIGHNA  432

Query  1242  N-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACN--STDGFAEAVSIAKRA  1072
             N   +L G+Y G+PC   +   G+ +Y+    +  GC   AC+  +TD   +A ++AK +
Sbjct  433   NDILALLGNYYGLPCETTTPFGGIQKYVKSAKFLPGCSSAACDVAATD---QATALAKSS  489

Query  1071  DYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAK  892
             DYV +V+GL   QE E  DR SLLLPG Q AL+  +A  S +P++L+L  GGP+DI+FA+
Sbjct  490   DYVFLVMGLSQKQEQEGLDRTSLLLPGKQQALITAVATASKRPVILILLTGGPVDITFAQ  549

Query  891   KDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPS  712
              +P+I ++LW GYPG+ GG+A+++++FG++NP+G+LP+TWYPE FTK  M DM MR DP+
Sbjct  550   TNPKIGAILWAGYPGQAGGQAIADVLFGEFNPSGKLPVTWYPEEFTKFTMTDMRMRPDPA  609

Query  711   RGYPGRTYRFYTGEKVYEFGHGlsyssfs-lellSAPTRISLSQSIKTKLRRSILNRGGN  535
              GYPGR+YRFY G+ VY+FG+GLSYS F+   +  A    S  ++    LR +    G  
Sbjct  610   TGYPGRSYRFYKGKTVYKFGYGLSYSKFACRIVSGAGNSSSYGKAALAGLRAATTPEG--  667

Query  534   EPYVHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFD  361
             +    VDE+ +  C  L F V V ++N+G MDG   V++F R  +S  GG P +QLIGF 
Sbjct  668   DAVYRVDEIGDDRCERLRFPVMVEVQNHGPMDGKHTVLMFVRW-SSTDGGRPVRQLIGFR  726

Query  360   RVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
               H+      +  + I PC+HLS   V+G +++  G H 
Sbjct  727   NQHLKVGEKKKLKMEISPCEHLSRARVDGEKVIDRGSHF  765



>gb|AFU54451.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Prunus salicina]
Length=775

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/757 (46%), Positives = 497/757 (66%), Gaps = 37/757 (5%)
 Frame = -3

Query  2496  YSKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIP  2323
             +++P   C P  P      FC  ++PI  R+  L+  LT+ EKI+ L +N  A+PRLGI 
Sbjct  27    HARPPFACDPHNPITRGLKFCRVTVPIHVRVQDLIGRLTLQEKIRLLVNNAIAVPRLGIQ  86

Query  2322  AYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAM  2143
              YEWWSE+LHG++  GPG  F GA   AT FPQVI TAA+FN +LW+ I      EARAM
Sbjct  87    GYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWQEIGRGVPDEARAM  146

Query  2142  FNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             +N G AGLT+W+PNVN+F DPRWGRGQETPGEDP++ S YA  YV+              
Sbjct  147   YNGGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLASKYAARYVK--------------  192

Query  1962  YSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
               L G      +   +RL ++ACCKH TAYDL+ W+  +R+ FNA V++QD+ DTY  PF
Sbjct  193   -GLQG------DGAGNRLKVAACCKHYTAYDLDNWNGVNRFHFNARVSKQDLADTYNVPF  245

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQ  1606
             K+CV +G  + +MC+YN VNG P CA+ DLL+   R  W   GYI SDCD+V  ++E Q 
Sbjct  246   KACVVEGHVASVMCSYNQVNGKPTCADPDLLKGTIRGQWRLNGYIVSDCDSVGVLYEEQH  305

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             Y ++PEEAA  A+KAG D++CG ++  + ++A+   +V + +I+ AL N  +VQ RLG+F
Sbjct  306   YTRTPEEAAADAIKAGLDLDCGPFLAIHTEAAVRRGLVSQLEINWALANTMTVQMRLGMF  365

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPM  1246
             +G+    ++ + GP+DVC+  H++LALEAARQGIVLL+N  + LPL   R  ++AVIGP 
Sbjct  366   DGEPSAHQYGNLGPRDVCTPAHQQLALEAARQGIVLLENRGRSLPLSIRRHRTVAVIGPN  425

Query  1245  AN-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             ++ T ++ G+Y G+ C   + L G+G Y  +T + +GC DV CN    F  A + A++AD
Sbjct  426   SDVTVTMIGNYAGVACGYTTPLQGIGRYT-RTIHQAGCTDVHCNGNQLFGAAEAAARQAD  484

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
               ++V+GLD S E E  DR  LLLPGHQ  LV+ +A  S  P +LVL  GGP+D++FAK 
Sbjct  485   ATVLVMGLDQSIEAEFVDRVGLLLPGHQQELVSRVARASRGPTILVLMSGGPIDVTFAKN  544

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESF-TKVPMNDMNMRADPS  712
             DPRI++++W+GYPG+ GG A+++++FG  NP G+LP+TWYP+++ T +PM DM MRADP+
Sbjct  545   DPRISAIIWVGYPGQAGGTAIADVLFGTTNPGGKLPMTWYPQNYVTHLPMTDMAMRADPA  604

Query  711   RGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLS-QSIKTKLRRSILNRGGN  535
             RGYPGRTYRFY G  V+ FG GLSY++F+  L   PT +S+   S+K     ++L++   
Sbjct  605   RGYPGRTYRFYRGPVVFPFGLGLSYTTFAHNLAHGPTSVSVPLTSLKATANSTMLSKA--  662

Query  534   EPYVHVDEVSNCNSLA-FSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDR  358
                V V   ++CN+L+   V V ++N G MDG+  +++F+  P      A  KQL+GF +
Sbjct  663   ---VRVSH-ADCNALSPLDVHVDVKNTGSMDGTHTLLVFTSPPDGKW--AASKQLVGFHK  716

Query  357   VHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             +H++    T   I++  C+HLS+V+  G R +PLG+H
Sbjct  717   IHIAAGSETRVRIAVHVCKHLSVVDRFGIRRIPLGEH  753



>ref|XP_010236106.1| PREDICTED: probable beta-D-xylosidase 7 [Brachypodium distachyon]
Length=786

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/772 (49%), Positives = 488/772 (63%), Gaps = 39/772 (5%)
 Frame = -3

Query  2505  ATSYSKPQLPCQPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGI  2326
             AT  + P   C  P  SSYPFCD  LPI  R   L S LTV+EK+  L D +  +PRLG+
Sbjct  20    ATMATDPPFSCGSP--SSYPFCDRKLPIGQRAADLASRLTVEEKVSLLGDVSPGVPRLGV  77

Query  2325  PAYEWWSESLHGIATNGP----GITFD-GAVKSATGFPQVILTAAAFNRTLWRSIaaaaa  2161
             PAY+WWSE+LHG+A N P    G+ FD G V++AT FPQV++TAA+FN  LW  I     
Sbjct  78    PAYKWWSEALHGVA-NAPADRAGVRFDDGPVRAATSFPQVLVTAASFNPHLWYRIGQVIG  136

Query  2160  vearAMFNSGQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqgl  1984
              EAR ++NSGQA GLTFWAPN+NVF DPRWGRGQETPGEDP +   YA  +VRG+QG   
Sbjct  137   REARGIYNSGQAEGLTFWAPNINVFRDPRWGRGQETPGEDPTMTGKYAAVFVRGVQG---  193

Query  1983  kgkngRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDME  1804
                    Y  SG        +   L  SACCKH TAYDLE W+  +R++FNA V+ QD+ 
Sbjct  194   -------YGASG------AVNSSGLEASACCKHFTAYDLENWNGVTRFAFNAKVSEQDLA  240

Query  1803  DTYEPPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVA  1627
             DTY PPF+SCVE G AS +MC+YN VNG+P CA+ +LL K AR DW F GYITSDCDAVA
Sbjct  241   DTYNPPFRSCVEDGGASGIMCSYNRVNGVPTCADHNLLSKTARGDWRFNGYITSDCDAVA  300

Query  1626  TIFEYQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSV  1447
              I + Q YAK PE+A    LKAG D+NCG Y+ ++  SA     + E DIDRAL NLF++
Sbjct  301   IIHDVQGYAKEPEDAVADVLKAGMDVNCGDYVQKHGVSAFHQGKITEQDIDRALQNLFAI  360

Query  1446  QFRLGLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSS  1267
             + RLGLF+G     ++ + G   VC  EH+ LALEAA+ GIVLLKN+   LPL K ++SS
Sbjct  361   RMRLGLFDGNPKYNRYGNIGADQVCKKEHQDLALEAAQDGIVLLKNDAGTLPLPKQKISS  420

Query  1266  LAVIGPMANTSS-LGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAV  1090
             LAVIG  AN +  L G+Y G PC   S L  L  Y+ +T + +GC    CN +D  A A 
Sbjct  421   LAVIGHNANDAQRLQGNYFGPPCISVSPLQALQGYVRETKFVAGCNAAVCNVSD-IAGAA  479

Query  1089  SIAKRADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpL  910
               A  A+YV++ +GLD  QE ED DR  L LPG Q +LVN +A  + KP+VLVL  GGP+
Sbjct  480   KAASEAEYVVLFMGLDQDQEREDLDRIELGLPGMQESLVNAVADAAKKPVVLVLLCGGPV  539

Query  909   DISFAKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESF-TKVPMNDM  733
             D++FAK +P+I +++W GYPG+ GG A+++++FG++NP GRLP+TWYP+ + T V M DM
Sbjct  540   DVTFAKGNPKIGAIIWAGYPGQAGGIAIAQVLFGEHNPGGRLPVTWYPKEYATAVAMTDM  599

Query  732   NMRADPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLS---QSIKTKLR  562
              MRAD S GYPGRTYRFY G+ VY FG+GLSYS +S   +S P    ++     +K K  
Sbjct  600   RMRADASTGYPGRTYRFYKGKTVYNFGYGLSYSKYSHSFVSKPPASMMASKLDGLKLKAM  659

Query  561   RSILNRGGNEPYVHVDEVSN--CNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGA  388
              S  + G       V+E+    C  L F   V ++N+G MDG   V+LF R P +   G 
Sbjct  660   ESSAS-GATISSYDVEEMGEEACERLKFPATVRVQNHGAMDGKHPVLLFLRWPETKGNGG  718

Query  387   ----PQKQLIGFDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
                 P +QLIGF  V +           + PC+H S   V+G +++  G H 
Sbjct  719   SSGRPARQLIGFRSVKLRAAEAKHVEFEVSPCKHFSRAAVDGKKVIDKGSHF  770



>ref|XP_008223305.1| PREDICTED: putative beta-D-xylosidase [Prunus mume]
Length=775

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/757 (46%), Positives = 496/757 (66%), Gaps = 37/757 (5%)
 Frame = -3

Query  2496  YSKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIP  2323
             +++P   C P  P      FC  ++PI  R+  L+  LT+ EKI+ L +N  A+PRLGI 
Sbjct  27    HARPPFACDPHNPITRGLKFCRVTVPIHVRVQDLIGRLTLQEKIRLLVNNAIAVPRLGIQ  86

Query  2322  AYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAM  2143
              YEWWSE+LHG++  GPG  F GA   AT FPQVI TAA+FN +LW+ I    + EARAM
Sbjct  87    GYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWQEIGRVVSDEARAM  146

Query  2142  FNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             +N G AGLT+W+PNVN+F DPRWGRGQETPGEDP++ + YA  YV+              
Sbjct  147   YNGGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAAKYAARYVK--------------  192

Query  1962  YSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
               L G      +    RL ++ACCKH TAYDL+ W+  +R+ FNA V++QD+ DTY  PF
Sbjct  193   -GLQG------DGAGSRLKVAACCKHYTAYDLDNWNGVNRFHFNARVSKQDLADTYNVPF  245

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQ  1606
             K+CV +G  + +MC+YN VNG P CA+ DLL+   R  W   GYI SDCD+V  ++E Q 
Sbjct  246   KACVVEGNVASVMCSYNQVNGKPTCADPDLLKGTIRGQWRLNGYIVSDCDSVGVLYEEQH  305

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             Y ++PEEAA  A+KAG D++CG ++  + ++AL   +V + +I+ AL N  +VQ RLG+F
Sbjct  306   YTRTPEEAAADAIKAGLDLDCGPFLAIHTEAALRRGLVSQLEINWALANTMTVQMRLGMF  365

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPM  1246
             +G+    ++ + GP+DVC+  H++LALEAARQGIVLL+N  + LPL   R  ++AVIGP 
Sbjct  366   DGEPSAHQYGNLGPRDVCTPAHQQLALEAARQGIVLLENRGRSLPLSTRRHRTVAVIGPN  425

Query  1245  AN-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             ++ T ++ G+Y G+ C   + L G+G Y  +T + +GC DV CN    F  A + A++AD
Sbjct  426   SDVTVTMIGNYAGVACGYTTPLQGIGRYT-RTIHQAGCTDVHCNGNQLFGAAEAAARQAD  484

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
               ++V+GLD S E E  DR  LLLPGHQ  LV+ +A  S  P +LVL  GGP+D++FAK 
Sbjct  485   ATVLVMGLDQSIEAEFVDRAGLLLPGHQQELVSRVARASRGPTILVLMSGGPIDVTFAKN  544

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESF-TKVPMNDMNMRADPS  712
             DPRI++++W+GYPG+ GG A+++++FG  NP G+LP+TWYP+++ T +PM DM MRADP+
Sbjct  545   DPRISAIIWVGYPGQAGGTAIADVLFGTTNPGGKLPMTWYPQNYVTHLPMTDMAMRADPA  604

Query  711   RGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLS-QSIKTKLRRSILNRGGN  535
             RGYPGRTYRFY G  V+ FG GLSY++F+  L   PT +S+   S+K     ++L++   
Sbjct  605   RGYPGRTYRFYRGPVVFPFGLGLSYTAFAHNLAHGPTSVSVPLTSLKATANSTMLSKA--  662

Query  534   EPYVHVDEVSNCNSLA-FSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDR  358
                V V   ++CN+L+   V V ++N G MDG+  +++F+  P      A  KQL+GF +
Sbjct  663   ---VRVSH-ADCNALSPLDVHVDVKNTGSMDGTHTLLVFTSPPDGKW--AASKQLVGFHK  716

Query  357   VHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             +H++        I++  C+HLS+V+  G R +PLG+H
Sbjct  717   IHIAAGSEKRVRIAVHACKHLSVVDRFGIRRIPLGEH  753



>ref|XP_008341125.1| PREDICTED: putative beta-D-xylosidase [Malus domestica]
Length=776

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/759 (45%), Positives = 482/759 (64%), Gaps = 35/759 (5%)
 Frame = -3

Query  2505  ATSYSKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRL  2332
             A  +++P   C P  P      FC   +PI  R+H L+  LT+ EKI+ L +N   +PRL
Sbjct  25    AVVHARPPFACDPRNPITRXLKFCRVRVPIXDRVHDLIGRLTLQEKIRLLVNNAIDVPRL  84

Query  2331  GIPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavea  2152
             GI  YEWWSE+LHG++  GPG  F G    AT FPQVI TAA+FN +LW  I    + EA
Sbjct  85    GIQGYEWWSEALHGVSNVGPGTKFGGTFLGATSFPQVITTAASFNESLWEEIGRVVSDEA  144

Query  2151  rAMFNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkn  1972
             RAM+N G AGLTFW+PNVN+F DPRWGRGQETPGEDP++ + Y   YV+           
Sbjct  145   RAMYNGGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPVLAAKYGARYVK-----------  193

Query  1971  gRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYE  1792
                  L G      +   +RL ++ACCKH TAYDL+ W+   R+ FNA V++QD+EDTY+
Sbjct  194   ----GLQG------DGXGNRLKVAACCKHYTAYDLDNWNGVDRFHFNARVSKQDLEDTYD  243

Query  1791  PPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFE  1615
              PF++CV  G  + +MC+YN VNG P CA+ +LL+   R  W   GYI SDCD+V   ++
Sbjct  244   VPFRACVVDGNVASVMCSYNQVNGKPTCADPNLLKGTIRGQWRLNGYIVSDCDSVGVYYD  303

Query  1614  YQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRL  1435
              Q Y K+PEEAA  A+KAG D++CG ++  + ++A+   +V E DI+ AL N  +VQ RL
Sbjct  304   DQHYTKTPEEAAADAIKAGLDLDCGPFLAIHTEAAVRTGLVNEIDINYALANTITVQMRL  363

Query  1434  GLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVI  1255
             G+F+G+   +++ + GP DVC      LALEAARQGIVLL+N    LPL  TR  ++AVI
Sbjct  364   GMFDGEPSTQRYGNLGPADVCKMSSNELALEAARQGIVLLENRGNSLPLSTTRHRTVAVI  423

Query  1254  GPMAN-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAK  1078
             GP ++ T ++ G+Y G+ C   + L G+  Y  +T + +GC +V CN       A + A+
Sbjct  424   GPNSDVTETMIGNYAGVACGYTTPLQGIARYT-RTIHQAGCSNVHCNGNQLIGAAEAXAR  482

Query  1077  RADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISF  898
             +AD  ++V+GLD S E E  DR +LLLPGHQ  LV+ +A  S  P +LV+  G P+D++F
Sbjct  483   QADATVLVIGLDQSIEAEFRDRTNLLLPGHQQELVSMVARASRGPTILVIMSGSPIDVTF  542

Query  897   AKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRA  721
             AK DPRI +++W+GYPG+ GG A+++++FG  NP+G+LP+TWYP+++  K+PM DM MRA
Sbjct  543   AKNDPRIGAIIWVGYPGQAGGTAIADVLFGTTNPSGKLPMTWYPQNYVAKLPMTDMAMRA  602

Query  720   DPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLS-QSIKTKLRRSILNR  544
             +P+RGYPGRTYRFY G  V+ FG GLSY+ FS  L   PT +S+   S+      ++LN 
Sbjct  603   NPARGYPGRTYRFYKGPVVFPFGLGLSYTRFSYTLAQGPTLVSVPLTSLVAAKNTTMLNN  662

Query  543   GGNEPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGF  364
              G     H+    NC+SL+  + V ++N G MDG+  +++F   P      AP KQL+GF
Sbjct  663   NGXR-VSHI----NCDSLSLDIHVDVKNTGTMDGTHTLLVFVTPPAEKW--APNKQLVGF  715

Query  363   DRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
              +VH+         + +  C+HLS+V+  G R +PLG+H
Sbjct  716   HKVHIVAGSERRVRVGVHVCKHLSVVDKFGIRRIPLGEH  754



>ref|XP_010546362.1| PREDICTED: beta-D-xylosidase 4 [Tarenaya hassleriana]
Length=781

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/761 (47%), Positives = 491/761 (65%), Gaps = 32/761 (4%)
 Frame = -3

Query  2493  SKPQLPCQ---PPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIP  2323
             S P   C     P+ + + FCD SL +  R+  LV  LT+ EKI  L +  + + RLGIP
Sbjct  28    SSPVFACDVSGNPSLAGFGFCDKSLEVNDRVADLVGRLTLQEKIGFLVNRANGVSRLGIP  87

Query  2322  AYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAM  2143
              YEWWSE+LHG++  GPG  F G V  AT FPQVILTAA+FN TL+++I    + EARAM
Sbjct  88    TYEWWSEALHGVSYVGPGTRFSGQVPGATSFPQVILTAASFNVTLFQTIGKVVSTEARAM  147

Query  2142  FNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             +N G AGLT+W+PNVN+F DPRWGRGQETPGEDP++ S YA  YV+GLQ           
Sbjct  148   YNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYAAAYVKGLQEI---------  198

Query  1962  YSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPF  1783
                       E  + + L ++ACCKH TAYDL+ W    RYSFNAVV +QD++DTY+PPF
Sbjct  199   ----------EGGNPNSLKVAACCKHYTAYDLDNWKGIERYSFNAVVNKQDLDDTYQPPF  248

Query  1782  KSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQ  1606
             KSCV  G  + +MC+YN VNGIP CA+ DLL    R  W   GYI SDCD+V  +++ Q 
Sbjct  249   KSCVIDGNVASVMCSYNQVNGIPTCADPDLLSGVVRGQWKLNGYIVSDCDSVDVLYKNQH  308

Query  1605  YAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLF  1426
             Y K+PEEAA  ++ AG D+NCG+++ ++   A++  +V E+ I+RA+ N F+   RLG F
Sbjct  309   YTKTPEEAAAKSILAGLDLNCGSFLAQHTGDAVKAGLVDETAINRAISNNFATLMRLGFF  368

Query  1425  NGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPM  1246
             +G    + F + GPKDVC++EH+ LA+EAARQGIVLLKN    LPL  + + +LAVIGP 
Sbjct  369   DGDPKKQMFGALGPKDVCTAEHQELAVEAARQGIVLLKNAAGSLPLSPSAIKTLAVIGPN  428

Query  1245  AN-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRAD  1069
             AN T ++ G+Y G PC   + L GL   +  T+Y  GC +VAC +T    EA  +A  AD
Sbjct  429   ANVTKTMIGNYEGTPCKYTTPLQGLAATV-STTYLPGCSNVAC-ATAQVDEAAKLAGSAD  486

Query  1068  YVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKK  889
               ++V+G D S E E  DR  L LPG Q  LV ++A  +  P++LV+  GG  DI+FAK 
Sbjct  487   ATVLVMGADQSIEAESRDRLDLNLPGQQRELVTQVAKSAKGPVILVIMSGGGFDITFAKN  546

Query  888   DPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRADPS  712
             D ++ S+LW+GYPGE GG A+++++FG YNP+GRLP+TWYP+S+  KVPM +MNMR D S
Sbjct  547   DDKVTSILWVGYPGEAGGAAIADVIFGRYNPSGRLPMTWYPQSYVEKVPMTNMNMRPDTS  606

Query  711   RGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISL----SQSIKTKLRRSILNR  544
              GYPGRTYRFYTGE VY FG GLS+S F+ +L+ AP  +SL    +   ++   +S+   
Sbjct  607   NGYPGRTYRFYTGETVYAFGDGLSFSHFAHQLVKAPRLVSLPLDQTHVCRSSDCQSLDAV  666

Query  543   GGNEPYVHVDEVSNCN-SLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIG  367
             G +      D  +N + S AF V + ++N+G  +G+  V LF+  P S   G+P+K L+G
Sbjct  667   GPHCSNAVADPNANASGSAAFEVHMKVKNSGEAEGTHTVFLFTTPPQSSVRGSPRKHLLG  726

Query  366   FDRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             F++V +           IE C+ LS+V+  G+R + LG+H+
Sbjct  727   FEKVRLGKEEEKVVRFRIEVCKDLSLVDEFGTRKVVLGEHV  767



>ref|XP_010261102.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nelumbo nucifera]
Length=773

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/741 (48%), Positives = 484/741 (65%), Gaps = 33/741 (4%)
 Frame = -3

Query  2457  SSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGIATN  2278
             +++ FC++S  I AR+  LV  LT+ EKI  L +   A+ RLGIP+YEWWSE+LHG++  
Sbjct  49    AAFGFCNSSWGIAARVDDLVKRLTLQEKIIFLVNKAGAVTRLGIPSYEWWSEALHGVSYV  108

Query  2277  GPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWAPNV  2098
             GPG  F   V  AT FPQVILTAA+FN +L+++I    + EARAM+N G AGLT+W+PNV
Sbjct  109   GPGTHFSSVVPGATSFPQVILTAASFNTSLFQAIGKVVSTEARAMYNVGLAGLTYWSPNV  168

Query  2097  NVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEEEDD  1918
             N+F DPRWGRGQETPGEDP++ S YA  YV+GLQ                     ++ + 
Sbjct  169   NIFRDPRWGRGQETPGEDPILASKYAAGYVQGLQQ-------------------SDDGNP  209

Query  1917  DRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCLMCA  1738
             +RL ++ACCKH TAYD++ W    RY FNA V++QD++DTY+PPFKSCV  G  + +MC+
Sbjct  210   NRLKVAACCKHYTAYDVDAWKGVDRYHFNAQVSKQDLDDTYQPPFKSCVVDGNVASVMCS  269

Query  1737  YNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIALKA  1561
             YN VNG P CA+ DLL    R +W   GYI SDCD+V  ++  Q Y K+PEEAA  ++ A
Sbjct  270   YNQVNGKPTCADPDLLAGVIRGEWQLNGYIVSDCDSVQVLYNDQHYTKTPEEAAAKSILA  329

Query  1560  GTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESFGPK  1381
             G D+NCG+++ ++ ++A++  ++ ES ID+A++N F+   RLG F+G    + +   GPK
Sbjct  330   GLDLNCGSFLGQHTEAAVKAGLLNESAIDKAIINNFATLMRLGFFDGDPSKQLYGKLGPK  389

Query  1380  DVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSLGGDYTGIP  1204
             DVC+  H+ LA EAARQGIVLLKN    LPL  T + SLAVIGP AN T ++ G+Y G P
Sbjct  390   DVCTPGHQELAREAARQGIVLLKNSAGSLPLSPTAIKSLAVIGPNANVTKTMIGNYEGTP  449

Query  1203  CALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQETE  1024
             C   + L GL   +  T Y  GC +VAC+S     +A  IA +AD  ++VVG D S E E
Sbjct  450   CKYTTPLQGLTASV-PTLYQPGCPNVACDSVQ-LDDAKRIAAQADATVLVVGADQSIEAE  507

Query  1023  DHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGYPGE  844
               DR  L LPG Q  LV E+A VS  P++LV+  GG +DISFAK + +I S+LW+GYPGE
Sbjct  508   SRDRVDLHLPGQQALLVTEVANVSKGPVILVIMSGGGMDISFAKANNKITSILWVGYPGE  567

Query  843   EGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRADPSRGYPGRTYRFYTGEK  667
              GG AL++++FG YNP+GRLP+TWYP++F  KVPM +MNMR +P+ GYPGRTYRFY GE 
Sbjct  568   AGGAALADVIFGYYNPSGRLPMTWYPQAFADKVPMTNMNMRPNPATGYPGRTYRFYRGET  627

Query  666   VYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEVSNCNSLA  487
             +Y FG G+SYS FS  L+ AP  +S+       L    + R      +H++E   C +LA
Sbjct  628   IYSFGDGMSYSQFSHHLVRAPKLVSV------PLEEGHICRSQKCKSIHLEE-EGCRNLA  680

Query  486   FSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSISIEP  307
             F + + +RN G M GS  V LFS  P+ +   AP K L+GF++V ++         +++ 
Sbjct  681   FEIHLRVRNMGRMSGSHTVFLFSTPPSVH--NAPNKHLLGFEKVFLTSQNEALVKFNVDV  738

Query  306   CQHLSIVNVEGSRILPLGDHI  244
             C+ LS+V+  G R + LG H+
Sbjct  739   CKDLSVVDELGRRKVALGSHV  759



>ref|XP_003535953.1| PREDICTED: probable beta-D-xylosidase 2 [Glycine max]
Length=771

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/749 (46%), Positives = 488/749 (65%), Gaps = 35/749 (5%)
 Frame = -3

Query  2475  CQPPTHSS--YPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSE  2302
             C P   ++   PFC   L   AR+  L+  LT+ EK+  L +N +A+PRLGI  YEWWSE
Sbjct  29    CDPKNTATKNLPFCKAWLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEWWSE  88

Query  2301  SLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAG  2122
             +LHG++  GPG  F G   +AT FPQVI TAA+FN +LW +I   A+ EARAM+N G AG
Sbjct  89    ALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGRVASDEARAMYNGGTAG  148

Query  2121  LTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNR  1942
             LT+W+PNVN+F DPRWGRGQETPGEDP++   YA  YVRGL                   
Sbjct  149   LTYWSPNVNIFRDPRWGRGQETPGEDPILAGKYAASYVRGL-------------------  189

Query  1941  MPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKG  1762
                +E D +RL ++A CKH TAYDL+ W+   R+ FNA V++QD+EDT+  PF+ CV++G
Sbjct  190   ---QETDGNRLKVAASCKHFTAYDLDNWNGVDRFHFNAQVSKQDIEDTFNVPFRMCVKEG  246

Query  1761  RASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEE  1585
             + + +MC+YN VNG+P CA+  LL++  R  WG  GYI SDCD+V   +  Q Y  +PEE
Sbjct  247   KVASVMCSYNQVNGVPTCADPILLKRTVRGQWGLNGYIVSDCDSVGVFYNSQHYTSTPEE  306

Query  1584  AAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNR  1405
             AA  A+KAG D++CG ++ ++ ++A++  ++ E+D++ ALLN  +VQ RLG+++G+  + 
Sbjct  307   AAADAIKAGLDLDCGPFLGQHTQNAVKKGLISETDVNGALLNTLTVQMRLGMYDGEPSSH  366

Query  1404  KFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSL  1228
              +   GP+DVC+  H+ LALEAARQGIVLLKN+   LPL   R  ++AVIGP +N T ++
Sbjct  367   PYGKLGPRDVCTPSHQELALEAARQGIVLLKNKGPSLPLSTRRHPTVAVIGPNSNVTVTM  426

Query  1227  GGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVG  1048
              G+Y GI C   S L+G+G Y  KT +  GC +VAC +   F  A+++A++AD  ++V+G
Sbjct  427   IGNYAGIACGYTSPLEGIGRYT-KTIHELGCANVACTNDKQFGRAINVAQQADATVLVMG  485

Query  1047  LDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASV  868
             LD S E E  DR  LLLPG Q  LV+++A  S  P +LV+  GGP+DI+FAK +PRI ++
Sbjct  486   LDQSIEAETVDRAGLLLPGRQQDLVSKVAAASKGPTILVIMSGGPVDITFAKNNPRIQAI  545

Query  867   LWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTK-VPMNDMNMRADPSRGYPGRT  691
             LW GYPG+ GG A+++I+FG  NP G+LP+TWYP+ + K +PM +M MRA  S+GYPGRT
Sbjct  546   LWAGYPGQAGGAAIADILFGTSNPGGKLPMTWYPQGYIKNLPMTNMAMRASRSKGYPGRT  605

Query  690   YRFYTGEKVYEFGHGlsyssfslellSAPTRISLS-QSIKTKLRRSILNRGGNEPYVHVD  514
             YRFY G  VY FG+GLSY+ F   L SAP  +S+     +     SI N+      + V 
Sbjct  606   YRFYNGPVVYPFGYGLSYTHFVHTLASAPKLVSIPVDGHRHGNSSSIANKA-----IKVT  660

Query  513   EVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGV  334
               + C  L+ S++V ++N G  DG+  +++FS  P      AP KQL+ F ++H+     
Sbjct  661   H-ARCGKLSISLQVDVKNVGSKDGTHTLLVFSAPPAGNGHWAPHKQLVAFQKLHIPSKAQ  719

Query  333   TETSISIEPCQHLSIVNVEGSRILPLGDH  247
                +++I  C+ LS+V+  G+R +P+G H
Sbjct  720   QRVNVNIHVCKLLSVVDRSGTRRVPMGLH  748



>ref|XP_011009934.1| PREDICTED: putative beta-D-xylosidase [Populus euphratica]
Length=767

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/756 (47%), Positives = 491/756 (65%), Gaps = 41/756 (5%)
 Frame = -3

Query  2493  SKPQLPCQPPT--HSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPA  2320
             S+    C P      S+ FC  +LPI  R+  L+  LT+ EKI+ L +N +A+PRLGI  
Sbjct  24    SREPFACDPKLGLTRSFKFCRVNLPIHVRVRDLIGRLTLQEKIRLLVNNAAAVPRLGIQG  83

Query  2319  YEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMF  2140
             YEWWSE+LHG++  GPG  F GA   ATGFPQVI TAA+FN +LW  I    + EARAM+
Sbjct  84    YEWWSEALHGVSNVGPGTKFGGAFPGATGFPQVITTAASFNESLWEEIGRVVSDEARAMY  143

Query  2139  NSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKY  1960
             N G AGLT+W+PNVNVF DPRWGRGQETPGEDP+V   YA  YVR               
Sbjct  144   NGGMAGLTYWSPNVNVFRDPRWGRGQETPGEDPVVAGKYAASYVR---------------  188

Query  1959  SLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFK  1780
              L GN       +  RL ++ACCKH TAYDL+ W+   RY FNA V++QD+EDTY  PFK
Sbjct  189   GLQGN-------NGIRLKVAACCKHYTAYDLDNWNGVDRYHFNARVSKQDLEDTYNVPFK  241

Query  1779  SCVEKGRASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQY  1603
             SCV +G+ + +MC+YN VNG P CA+  LL+   R +WG  GYI SDCD+V  +F+ Q Y
Sbjct  242   SCVVEGKVASVMCSYNQVNGKPTCADPYLLKNTIRGEWGLNGYIVSDCDSVGVLFDTQHY  301

Query  1602  AKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFN  1423
               +PEEAA   ++AG D++CG ++  + ++A++  ++ E D++ AL N  +VQ RLG+F+
Sbjct  302   TATPEEAAAATIRAGLDLDCGPFLAIHTENAVKGGLLKEEDVNMALANTITVQMRLGMFD  361

Query  1422  GKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMA  1243
             G +  + F + GP+DVC+  H++LAL AARQGIVLL+N  + LPL +T + ++AVIGP +
Sbjct  362   GPSA-QPFGNLGPRDVCTPAHQQLALHAARQGIVLLQNRGRTLPLSRT-LQTVAVIGPNS  419

Query  1242  N-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADY  1066
             + T ++ G+Y G+ C   + L G+  Y  KT + SGC DV CN    F  A   A+ AD 
Sbjct  420   DVTVTMIGNYAGVACGYTTPLQGIRRYA-KTVHHSGCNDVFCNGNQLFNAAEIAARHADA  478

Query  1065  VIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKD  886
              I+V+GLD S E E  DR  LLLPG+Q  LV+ +A  S  P +LVL  GGP+D+SFAK D
Sbjct  479   TILVMGLDQSIEAEFRDRKGLLLPGYQQELVSRVARASRGPTILVLMSGGPIDVSFAKND  538

Query  885   PRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESF-TKVPMNDMNMRADPSR  709
             PRI ++LW+GYPG+ GG A+++++FG  NP G+LP+TWYP  +  KVPM +M +RADPSR
Sbjct  539   PRIGAILWVGYPGQAGGAAIADVLFGTANPGGKLPMTWYPHDYLAKVPMTNMGLRADPSR  598

Query  708   GYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEP  529
             GYPGRTYRFY G  V+ FGHG+SY++F+  L+ AP  +S+  +     R    N  G   
Sbjct  599   GYPGRTYRFYKGPVVFPFGHGMSYTTFAHSLVQAPREVSVPLASLHVSR----NTTGASN  654

Query  528   YVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGG--APQKQLIGFDRV  355
              + V   +NC +LA  V + ++N G MDG+  +++FS  P    GG  + QKQLIGF++V
Sbjct  655   AIRVSH-ANCEALALGVHIDVKNTGDMDGTHTLLVFSSPP----GGKWSTQKQLIGFEKV  709

Query  354   HVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             H+         I I  C+HLS+V+  G R +P+G+H
Sbjct  710   HLVTGSQKRVKIDIHVCKHLSVVDRFGIRRIPIGEH  745



>ref|XP_011100796.1| PREDICTED: beta-D-xylosidase 1 [Sesamum indicum]
Length=770

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/758 (47%), Positives = 487/758 (64%), Gaps = 36/758 (5%)
 Frame = -3

Query  2502  TSYSKPQLPCQPPTH--SSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLG  2329
             T  S+    C P  H  ++ PFC  SL I  R+  L+  LT+ EKI+ L +N + + RLG
Sbjct  21    TCESRTPFACDPTNHITTTLPFCSVSLHIRDRVKDLIGRLTLQEKIRLLVNNAAPVDRLG  80

Query  2328  IPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavear  2149
             I  YEWWSE+LHG++  GPG+ F G    AT FPQVI TAA+FN +LW +I    + EAR
Sbjct  81    IRGYEWWSEALHGVSNTGPGVKFGGQFPGATSFPQVITTAASFNSSLWEAIGQVVSDEAR  140

Query  2148  AMFNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkng  1969
             AM+N G AGLT+W+PNVN+F DPRWGRGQETPGEDP V + YA  YVR            
Sbjct  141   AMYNGGVAGLTYWSPNVNIFRDPRWGRGQETPGEDPTVAAKYAASYVR------------  188

Query  1968  RKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEP  1789
                 L GN         +RL ++ACCKH TAYDL+ W+   R+ FNA V++QD+E+TY  
Sbjct  189   ---GLQGN------AAGNRLKVAACCKHYTAYDLDFWNGMDRFHFNARVSKQDLEETYNV  239

Query  1788  PFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEY  1612
             PFK+CV +GR + +MC+YN VNG P CA+ +LL    R  W   GYI SDCD+V  +F  
Sbjct  240   PFKACVVEGRVASVMCSYNQVNGKPTCADPNLLRNTIRGQWRLNGYIVSDCDSVGVLFND  299

Query  1611  QQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLG  1432
             Q Y  +PE+AA  ++KAG D++CG ++    + A+ +  + E+D+DR+L NL +VQ RLG
Sbjct  300   QHYTATPEDAAAASIKAGLDLDCGPFLAIYTEGAIRSGKLSEADVDRSLANLLAVQMRLG  359

Query  1431  LFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIG  1252
             +F+G    + + + GP+DVC+  H++LALEAARQGIVLL+N  + LPL  TR  ++AVIG
Sbjct  360   MFDGP--RQPYLNLGPRDVCTPAHQQLALEAARQGIVLLQNRNRALPLSTTRHRTVAVIG  417

Query  1251  PMAN-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKR  1075
             P ++ T ++ G+Y G PC   + L G+  Y  KT + +GC  V+C S D F  A   A+R
Sbjct  418   PNSDATDTMIGNYAGTPCGYTTPLQGISRYA-KTIHETGCTLVSCASNDQFGGAEEAARR  476

Query  1074  ADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFA  895
             AD  I+VVGL    E E  DR  LLLPGHQ  LV+ +A  S  P+VLVL  GGP+D++FA
Sbjct  477   ADATILVVGLSQVIEREALDRNGLLLPGHQQELVSRVAKASRGPVVLVLMSGGPIDVTFA  536

Query  894   KKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESF-TKVPMNDMNMRAD  718
             K DP+IA++LW GYPG+ GG A+++++FG  NP G+LP+TWYP+ +  KVPM DM M AD
Sbjct  537   KNDPQIAAILWAGYPGQSGGTAIADVLFGTINPGGKLPMTWYPQDYLAKVPMTDMAMHAD  596

Query  717   PSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLS-QSIKTKLRRSILNRG  541
             PSRGYPGRTYRFY G  V+ FG+GLSY+SF   L + P++IS+   S+K     ++L++ 
Sbjct  597   PSRGYPGRTYRFYKGPVVFPFGYGLSYTSFRHTLANGPSKISIPFTSLKASKNTTLLSKA  656

Query  540   GNEPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFD  361
                  + V   S C +L   + + + N G MDG+  +M+F+   +S     P+KQLI F+
Sbjct  657   -----IRVSHTS-CETLNLGMHIDVENIGEMDGTHTIMVFASTTSSVGEVGPEKQLIAFE  710

Query  360   RVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             +V V+        + I  C HLSIV+  G R +P+G+H
Sbjct  711   KVDVAAKSKQRVRVHINACNHLSIVDQFGIRRIPIGEH  748



>ref|XP_007051080.1| Beta-xylosidase 2 [Theobroma cacao]
 gb|EOX95237.1| Beta-xylosidase 2 [Theobroma cacao]
Length=818

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/748 (46%), Positives = 480/748 (64%), Gaps = 35/748 (5%)
 Frame = -3

Query  2475  CQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSE  2302
             C P   T  + PFC  S+PI  R+  L+  LT+ EK++ L +N +A+PRLGI  YEWWSE
Sbjct  78    CDPKDATTPNLPFCKVSMPISIRVKDLLGRLTLQEKVRLLVNNAAAVPRLGIKGYEWWSE  137

Query  2301  SLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAG  2122
             +LHG++  GPG  F  A  +AT FPQVI TAA+FN TLW +I    + EARAM+N G AG
Sbjct  138   ALHGVSNVGPGTKFGRAFPAATSFPQVITTAASFNATLWEAIGRVVSDEARAMYNGGMAG  197

Query  2121  LTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNR  1942
             LT+W+PNVN+F DPRWGRGQETPGEDP++   YA  YV+                L GN 
Sbjct  198   LTYWSPNVNIFRDPRWGRGQETPGEDPVLAGTYAASYVK---------------GLQGN-  241

Query  1941  MPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKG  1762
                   + DRL ++ACCKH TAYDL+ W+   R+ FNA V++QD+EDT++ PFK CV+ G
Sbjct  242   ------NGDRLKVAACCKHFTAYDLDNWNGVDRFHFNAKVSKQDIEDTFDVPFKMCVKDG  295

Query  1761  RASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEE  1585
               + +MC+YN VNG+P CA+ +LL+K  R  W   GYI SDCD+V   +  Q Y  +PE+
Sbjct  296   NVASVMCSYNQVNGVPTCADPNLLKKTVRGQWKLNGYIVSDCDSVGVFYNTQHYTSTPEQ  355

Query  1584  AAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNR  1405
             AA  A+KAG D++CG ++ ++ + A++  ++ ++D++ AL N  +VQ RLG+F+G+   +
Sbjct  356   AAADAIKAGLDLDCGPFLAQHSEDAVKRGLLNDADVNTALSNTLAVQMRLGMFDGEPSAQ  415

Query  1404  KFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSL  1228
              F + GPKDVC+  H+ LALEAARQGIVLLKN    LPL   R  ++AVIGP +N T ++
Sbjct  416   TFGNLGPKDVCTPAHQELALEAARQGIVLLKNHGPSLPLSHLRHRTVAVIGPNSNATVTM  475

Query  1227  GGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVG  1048
              G+Y G+ C   S L G+G Y  KT +  GC DVAC     F+ A+  A++AD  ++V+G
Sbjct  476   IGNYAGVACRYTSPLQGIGNYA-KTIHQLGCADVACADDKLFSGAIDAARKADATVLVMG  534

Query  1047  LDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASV  868
             LD S E E  DR  LLLPG Q  LV+++A  S    +LVL  GGP+D+SFAK DPRI ++
Sbjct  535   LDQSIEAESRDRTGLLLPGRQQDLVSKVAMASRGSTILVLMSGGPIDVSFAKNDPRIGAI  594

Query  867   LWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESF-TKVPMNDMNMRADPSRGYPGRT  691
             LW GYPG+ GG A++++++G  NP G+LP+TWYP+ + + +PM DM MR+ P + YPGRT
Sbjct  595   LWAGYPGQAGGAAIADVLYGTTNPEGKLPMTWYPQEYVSNLPMTDMAMRSRPLKNYPGRT  654

Query  690   YRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDE  511
             YRFY G  VY FGHGLSY++F   + SAP  +    ++    R    N   +   + V+ 
Sbjct  655   YRFYKGPLVYPFGHGLSYTNFVHTIASAPKVV----TVPLDGRHHSGNTTVSGKAIKVNH  710

Query  510   VSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVT  331
              + CN L   ++V ++N G  DG+  +++FS  P  +   APQKQL+ F +V V      
Sbjct  711   -AKCNKLTIGLQVDVKNTGSKDGTHTMLVFSTTPAGHW--APQKQLVAFAKVRVPAGAQQ  767

Query  330   ETSISIEPCQHLSIVNVEGSRILPLGDH  247
                I+I  C+ LS+V+  G R +P+G H
Sbjct  768   RIGINIHVCKFLSVVDGSGVRRIPIGVH  795



>ref|XP_010679361.1| PREDICTED: probable beta-D-xylosidase 2 [Beta vulgaris subsp. 
vulgaris]
Length=765

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/746 (47%), Positives = 476/746 (64%), Gaps = 39/746 (5%)
 Frame = -3

Query  2466  PTHS---SYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESL  2296
             P H+   ++PFC T+LP+  R+  L+  LT+ EK++ L DN +A+PRLGI  YEWWSE+L
Sbjct  30    PKHAGFRAFPFCKTTLPVGDRVRDLIGRLTLQEKVKLLVDNAAAVPRLGIQDYEWWSEAL  89

Query  2295  HGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLT  2116
             HG++  GPG  F G   +AT FPQVI TAA+FN +LW  I    + EARAM+N G AGLT
Sbjct  90    HGVSNVGPGTKFGGKFPTATSFPQVITTAASFNASLWEEIGRVVSDEARAMYNGGMAGLT  149

Query  2115  FWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMP  1936
             +W+PNVN+  DPRWGRGQETPGEDP++   YA  YVR                L G    
Sbjct  150   YWSPNVNILRDPRWGRGQETPGEDPVLAGKYAASYVR---------------GLQGT---  191

Query  1935  EEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRA  1756
                 D DRL ++ACCKH TAYDL+ W    R+ FNA V++QD+ DT++ PF+ CV +G+ 
Sbjct  192   ----DGDRLKVAACCKHYTAYDLDNWGGVDRFHFNAQVSKQDIVDTFDVPFRECVMEGKV  247

Query  1755  SCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAA  1579
             + +MC+YN VNGIP CA+  LL    R DW   GYI SDCD+V   ++ Q Y  +PEEAA
Sbjct  248   ASVMCSYNQVNGIPTCADPKLLRNTIRGDWRLNGYIVSDCDSVGVFYKNQHYTSTPEEAA  307

Query  1578  GIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKF  1399
               A+KAG D++CG ++  + + A++  ++ E D++ AL N  +VQ RLG+F+G    + +
Sbjct  308   ADAIKAGLDLDCGPFLGTHTEDAIKKGLLSEIDVNNALTNTLTVQMRLGMFDGPPSAQPY  367

Query  1398  ESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSLGG  1222
                GP DVCS  H+ LALEAARQGIVLLKN    LPL   R  S+AVIGP ++ T ++ G
Sbjct  368   GHLGPADVCSPAHQELALEAARQGIVLLKNHGPTLPLSHIRHRSVAVIGPNSDVTVTMIG  427

Query  1221  DYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLD  1042
             +Y GI C   + L G+G+Y  KT +  GC DV C     F  A+S A +AD  ++++GLD
Sbjct  428   NYAGIACGYTTPLQGIGKYA-KTIHQQGCADVGCIDDRLFGPAISAATQADATVLIMGLD  486

Query  1041  LSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLW  862
              S E E  DR  LLLPG Q  LV+++A  S  P+VLVL  GGP+D++FAK DP+I+++LW
Sbjct  487   QSIEAEFRDRAGLLLPGRQQELVSKVAAASRGPIVLVLMSGGPVDVTFAKNDPKISAILW  546

Query  861   IGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESF-TKVPMNDMNMRADPSRGYPGRTYR  685
              GYPG+ GG+A+++++FG  NP G+LP+TWYP+ +  K+PM +M MR+ P  GYPGRTYR
Sbjct  547   AGYPGQAGGQAIADVLFGTTNPGGKLPMTWYPQEYLNKLPMTNMGMRSGP--GYPGRTYR  604

Query  684   FYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEVS  505
             FY G  VY FGHGLSY+ F+  +  AP  +++        RRS  +  G    V     +
Sbjct  605   FYQGPVVYPFGHGLSYTHFTHTIADAPMEVTVPLD---GHRRSNASASGKAIRV---THA  658

Query  504   NCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTET  325
              C  L+  V V ++N G  DG+  +++FSR P      APQKQL+ F+RVH+        
Sbjct  659   RCGQLSLMVHVDVKNEGSKDGAHTLLVFSRPPAGKW--APQKQLVAFERVHLPAGSQQRV  716

Query  324   SISIEPCQHLSIVNVEGSRILPLGDH  247
              + I  C++LS+V+  G R +PLGDH
Sbjct  717   RVHIHVCKYLSVVDKSGIRRIPLGDH  742



>gb|AAX92971.1| beta-D-xylosidase [Oryza sativa Japonica Group]
 gb|AAX96035.1| beta-D-xylosidase [Oryza sativa Japonica Group]
 gb|ABA92842.1| Glycosyl hydrolase family 3 C terminal domain containing protein, 
expressed [Oryza sativa Japonica Group]
 gb|EAZ18122.1| hypothetical protein OsJ_33667 [Oryza sativa Japonica Group]
Length=771

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/760 (48%), Positives = 484/760 (64%), Gaps = 39/760 (5%)
 Frame = -3

Query  2490  KPQLPCQPPTHSS-YPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYE  2314
             +P   C P + SS Y FCD  LP   R   LVS LT  EK+ +L D    +PRLG+P Y+
Sbjct  24    EPPYSCGPRSPSSGYAFCDARLPPARRAADLVSRLTAAEKVAQLGDEAGGVPRLGVPPYK  83

Query  2313  WWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNS  2134
             WWSE LHG++  G G+ F+GAV + T FPQV+LTAAAF+  LW  I  A   EARA++N 
Sbjct  84    WWSEGLHGLSYWGHGMHFNGAVTAITSFPQVLLTAAAFDDRLWFRIGQAIGTEARALYNL  143

Query  2133  GQA-GLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYS  1957
             GQA GLT W+PNVN++ DPRWGRGQETPGEDP   S YAV +V+                
Sbjct  144   GQAEGLTIWSPNVNIYRDPRWGRGQETPGEDPTTASKYAVAFVK---------------G  188

Query  1956  LSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKS  1777
             L G+           L  SACCKH TAYDLE W+  +RY+FNA VT QD+ DT+ PPFKS
Sbjct  189   LQGS-------TPGTLQTSACCKHATAYDLEEWNGVARYNFNAKVTAQDLADTFNPPFKS  241

Query  1776  CVEKGRASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEYQQYA  1600
             CV   +ASC+MCAY  +NG+PACA+ DLL K  R  WG +GY++SDCDAVA + + Q+YA
Sbjct  242   CVVDAKASCVMCAYTDINGVPACASSDLLSKTFRGQWGLDGYVSSDCDAVALLRDAQRYA  301

Query  1599  KSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNG  1420
              +PE+   +A+KAG D+NCG Y   +  +AL+   + ESD+DRAL NLF+V+ RLG F+G
Sbjct  302   PTPEDTVAVAIKAGLDLNCGNYTQVHGMAALQQGKMRESDVDRALTNLFAVRMRLGHFDG  361

Query  1419  KA-VNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMA  1243
                 N  +   G  DVC+  HR LALEAA+ GIVLLKN+   LPLD+  V S AVIGP A
Sbjct  362   DPRSNAAYGHLGAADVCTQAHRDLALEAAQDGIVLLKNDAGALPLDRATVRSAAVIGPNA  421

Query  1242  NT-SSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIA---KR  1075
             N  ++L G+Y G PC   + L G+  YI    + +GC   AC    GFA     A     
Sbjct  422   NDPAALNGNYFGPPCETTTPLQGVQRYISSVRFLAGCDSPAC----GFAATGQAAALASS  477

Query  1074  ADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFA  895
             +D VI+ +GL   QE E  DR SLLLPG Q +L+  +A  + +P++LVL  GGP+D++FA
Sbjct  478   SDQVIMFMGLSQDQEKEGLDRTSLLLPGKQQSLITAVASAARRPVILVLLTGGPVDVTFA  537

Query  894   KKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADP  715
             K +P+I ++LW GYPG+ GG A+++++FGD+NP+GRLP+TWYPE FT++PM DM MRADP
Sbjct  538   KNNPKIGAILWAGYPGQAGGLAIAKVLFGDHNPSGRLPVTWYPEEFTRIPMTDMRMRADP  597

Query  714   SRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGN  535
             + GYPGR+YRFY G  VY+FG+GLSYS FS  L++A      ++++   +       GG 
Sbjct  598   ATGYPGRSYRFYQGNPVYKFGYGLSYSKFSRRLVAAAKPRRPNRNLLAGVIPKPAGDGG-  656

Query  534   EPYVHVDEVS--NCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGA-PQKQLIGF  364
             E Y HV+E+    C  L F   V + N+G MDG   V++F R P + AG + P +QL+GF
Sbjct  657   ESY-HVEEIGEEGCERLKFPATVEVHNHGPMDGKHSVLVFVRWPNATAGASRPARQLVGF  715

Query  363   DRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
                HV        ++ I PC+HLS    +G++++  G H 
Sbjct  716   SSQHVRAGEKARLTMEINPCEHLSRAREDGTKVIDRGSHF  755



>ref|XP_006354073.1| PREDICTED: probable beta-D-xylosidase 7-like [Solanum tuberosum]
Length=772

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/742 (47%), Positives = 470/742 (63%), Gaps = 33/742 (4%)
 Frame = -3

Query  2445  FCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGIATNGPGI  2266
             FC++SLP+  R+  L+  L +DEKI +L +   AIPRL IPAYEWWSE+LHG++  G G+
Sbjct  40    FCNSSLPVDQRVDDLILRLNLDEKISQLGNTAPAIPRLNIPAYEWWSEALHGLSMEGLGV  99

Query  2265  TFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQ-AGLTFWAPNVNVF  2089
              F+G++K+AT FPQ+I+TA+ F+  LW  IA A + EARA++N+G+  G+TFWAPNVN+ 
Sbjct  100   KFNGSIKAATQFPQIIITASTFDEHLWYRIAQAISREARAVYNAGELKGMTFWAPNVNIL  159

Query  2088  VDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEEEDDDRL  1909
              DPRWGR QET GEDPM+V  YAV YVR                L G+     +  D  L
Sbjct  160   RDPRWGRAQETAGEDPMMVGKYAVAYVR---------------GLQGDSFEGGKLKDGHL  204

Query  1908  MLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRASCLMCAYNA  1729
               SACCKH  A DL+ W+   R++F+A VT QDM D+++PPFK+CVE+G+A+ LMCAY+ 
Sbjct  205   QASACCKHFAAQDLDYWNGHHRFTFDAQVTPQDMADSFQPPFKTCVEEGKATSLMCAYSR  264

Query  1728  VNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAGIALKAGTD  1552
             +NG+  CAN DLL K AR  WGF GYI SDCDA+  + +   Y  + E+A   +LKAG D
Sbjct  265   LNGVSNCANYDLLTKTARGQWGFNGYIVSDCDAIRVMRDSHGY--TAEDAVAASLKAGMD  322

Query  1551  INCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFESFGPKDVC  1372
             +NCG+++    + ALE + + ESDIDRAL N+FS++ RLGLFNG     ++    P ++C
Sbjct  323   VNCGSFVANYTRLALEKQKLQESDIDRALRNIFSIRMRLGLFNGDPKKLEYGDIAPAEIC  382

Query  1371  SSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMANTSSLG-GDYTGIPCAL  1195
             S EH+ L+LEAA+ GIVLLKN  K LPL K + +SLA+IGP AN S L  G+Y GIPC  
Sbjct  383   SQEHQDLSLEAAKNGIVLLKNSAKLLPLSKIKTTSLAIIGPKANNSELLLGNYAGIPCKN  442

Query  1194  KSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDLSQETEDHD  1015
              S+L G    +    Y  GC  V C S     EAV +AK+A YV++++GLD   E E+ D
Sbjct  443   VSLLQGFQGVVKNIGYHPGCNFVNCTSA-AIDEAVDVAKKAQYVVLIMGLDQQVERENWD  501

Query  1014  RYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWIGYPGEEGG  835
             R  L LPG Q  L+N +A  + +P++LVL  GGP+DISFAK  P+I  +LWIGYPGE G 
Sbjct  502   RVDLGLPGQQEILINAVAEAAVEPVILVLVSGGPIDISFAKNHPKIGGILWIGYPGEGGA  561

Query  834   KALSEIVFGDYNPAGRLPLTWYPESFTKVPMNDMNMRADPSRGYPGRTYRFYTGEKVYEF  655
              AL++I+FG++NP GRLP+TWYP+ F KVPM DMNMR + S GYPGRTY+FY G KVYEF
Sbjct  562   AALTQILFGEHNPGGRLPVTWYPKDFIKVPMTDMNMRPNSSTGYPGRTYKFYKGPKVYEF  621

Query  654   GHGls-yssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEVSN-----CNS  493
             G+GLS  +        +  ++       +  RR       +  ++H   VS      CN 
Sbjct  622   GYGLSYTNYSYNITSVSHDKLYFINQTSSDKRRK------HGSHIHNIAVSKFGSEVCNK  675

Query  492   LAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTETSISI  313
                SV+V +RN G + G   V+LF R         P+KQLIGF  VH+     ++    +
Sbjct  676   AKISVKVVVRNKGKLGGKHPVLLFVRHSKVKNDEIPRKQLIGFKSVHLGAREKSKIKFIV  735

Query  312   EPCQHLSIVNVEGSRILPLGDH  247
              PC+H S  N  G  ++  G +
Sbjct  736   SPCEHFSRANKHGISVIDEGKY  757



>ref|XP_009369955.1| PREDICTED: putative beta-D-xylosidase [Pyrus x bretschneideri]
Length=776

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/759 (45%), Positives = 484/759 (64%), Gaps = 35/759 (5%)
 Frame = -3

Query  2505  ATSYSKPQLPCQP--PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRL  2332
             A  +++    C P  P   +  FC     I  R+  L+  LT+ EKI+ L +N   +PRL
Sbjct  25    AVVHARLPFACDPRNPITRTLKFCRVRASIHVRVQDLIGRLTLQEKIRLLVNNAIDVPRL  84

Query  2331  GIPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavea  2152
             GI  YEWWSE+LHG++  GPG  F GA   AT FPQVI TAA+FN +LW  I    + EA
Sbjct  85    GIQGYEWWSEALHGVSNVGPGTKFGGAFLGATSFPQVITTAASFNESLWEEIGRVVSDEA  144

Query  2151  rAMFNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkn  1972
             RAM+N G AGLTFW+PNVN+F DPRWGRGQETPGEDP++ + Y   YV+           
Sbjct  145   RAMYNGGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPVLAAKYGARYVK-----------  193

Query  1971  gRKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYE  1792
                  L G      +   +RL ++ACCKH TAYDL+ W+   R+ FNA V++QD+EDTY+
Sbjct  194   ----GLQG------DGAGNRLKVAACCKHYTAYDLDNWNGVDRFHFNARVSKQDLEDTYD  243

Query  1791  PPFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFE  1615
              PFK+CV  G+ + +MC+YN VNG P CA+ +LL+   R+ W   GYI SDCD+V   ++
Sbjct  244   VPFKACVVDGKVASVMCSYNQVNGKPTCADPNLLKGTIRSQWRLNGYIVSDCDSVGVYYD  303

Query  1614  YQQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRL  1435
              Q Y K+PEEAA  A+KAG D++CG ++  + ++A++  +V E DI+ AL N  +VQ RL
Sbjct  304   DQHYTKTPEEAAADAIKAGLDLDCGPFLAIHTEAAVKTGLVNEIDINYALANTITVQMRL  363

Query  1434  GLFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVI  1255
             G+F+G+   +++ + GP DVC      LALEAARQGIVLL+N    LPL  TR  ++AVI
Sbjct  364   GMFDGEPSTQRYGNLGPADVCKMSSNELALEAARQGIVLLENHGNSLPLSTTRHRTVAVI  423

Query  1254  GPMAN-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAK  1078
             GP ++ T ++ G+Y G+ C   + L G+  Y  +T + +GCL+V CN       A + A+
Sbjct  424   GPNSDVTETMIGNYAGVACGYTTPLQGIARYT-RTIHQAGCLNVHCNGNQLIGAAEAAAR  482

Query  1077  RADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISF  898
               D  I+V+GLD S E E  DR +LLLPGHQ  LV+ +A  S  P +LV+  G P+D++F
Sbjct  483   HVDATILVIGLDQSIEAEFRDRTNLLLPGHQQELVSRVARASRGPTILVIMSGSPIDVTF  542

Query  897   AKKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRA  721
             AK DPRI +++W+GYPG+ GG A+++++FG  NP+G+LP+TWYP+++  K+PM DM MRA
Sbjct  543   AKNDPRIGAIIWVGYPGQAGGTAIADVLFGTTNPSGKLPMTWYPQNYVAKLPMTDMAMRA  602

Query  720   DPSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLS-QSIKTKLRRSILNR  544
             +P+RGYPGRTYRFY G  V+ FG GLSY+ FS  L   PT +S+   S+      ++LN 
Sbjct  603   NPARGYPGRTYRFYKGPVVFPFGLGLSYTRFSHTLAQGPTLVSVPLTSLVAAKNTTMLNN  662

Query  543   GGNEPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGF  364
              G    V V   +NC+SL+  + V ++N G MDG+  +++F+  P      AP KQL+GF
Sbjct  663   NG----VRV-SYTNCDSLSLDIHVDIKNTGTMDGTHTLLVFATPPAEKW--APNKQLVGF  715

Query  363   DRVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
              +VH+         + +  C+HLS+V+  G R +PLG+H
Sbjct  716   HKVHIVAGLERRVRVGVHVCKHLSVVDKFGIRRIPLGEH  754



>ref|XP_003591420.1| Beta xylosidase [Medicago truncatula]
 gb|AES61671.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Medicago truncatula]
Length=765

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/757 (45%), Positives = 485/757 (64%), Gaps = 35/757 (5%)
 Frame = -3

Query  2502  TSYSKPQLPCQPPTHSS--YPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLG  2329
             +S ++    C P   S+  +PFC  SLPIP R++ L+  LT+ EK+  L +N +A+PR+G
Sbjct  16    SSEARDPFACDPKNTSTNNFPFCKASLPIPTRVNDLIGRLTLQEKVSMLVNNAAAVPRVG  75

Query  2328  IPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavear  2149
             I  YEWWSE+LHG++  GPG  F G   +AT FPQVI T A+FN +LW +I   A+ EAR
Sbjct  76    IKGYEWWSEALHGVSNVGPGTKFAGQFPAATSFPQVITTVASFNASLWEAIGRVASDEAR  135

Query  2148  AMFNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkng  1969
             AM+N G AGLT+W+PNVN+F DPRWGRGQETPGEDP++   YA  YVR            
Sbjct  136   AMYNGGTAGLTYWSPNVNIFRDPRWGRGQETPGEDPILAGKYAASYVR------------  183

Query  1968  RKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEP  1789
                 L G        D  RL ++A CKH TAYDL+ W+   R+ FNA V++QDMEDT+  
Sbjct  184   ---GLQGT-------DSSRLKVAASCKHFTAYDLDNWNGVDRFHFNAKVSKQDMEDTFNV  233

Query  1788  PFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEY  1612
             PF+ CV++G  + +MC+YN VNG+P CA+ +LL++  R  W  +GYI SDCD+V   +  
Sbjct  234   PFRMCVKEGNVASVMCSYNQVNGVPTCADPNLLKRTIRGQWHLDGYIVSDCDSVGVFYTN  293

Query  1611  QQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLG  1432
             Q Y  +PEEAA  A+KAG D++CG ++ ++ ++A++  ++ E+D++ AL N  +VQ RLG
Sbjct  294   QHYTSTPEEAAADAIKAGLDLDCGPFLAQHTQNAVKKGLLTETDVNGALANTLTVQMRLG  353

Query  1431  LFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIG  1252
             +F+G+   + + + GP DVC+  H+ LAL+AARQGIVLLKN    LPL      ++AVIG
Sbjct  354   MFDGEPSAQPYGNLGPTDVCTPTHQELALDAARQGIVLLKNTGPSLPLSTKNHQTVAVIG  413

Query  1251  PMAN-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKR  1075
             P +N T ++ G+Y GI C   S L G+G+Y  +T +  GC +VACN    F  A++ A++
Sbjct  414   PNSNATVTMIGNYAGIACGYTSPLQGIGKYA-RTIHEPGCANVACNDDKQFGSALNAARQ  472

Query  1074  ADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFA  895
             AD  ++V+GLD S E E  DR  LLLPGHQ  LV+++A  S  P +LVL  GGP+DI+FA
Sbjct  473   ADATVLVMGLDQSIEAEMVDRTGLLLPGHQQDLVSKVAAASRGPTILVLMSGGPIDITFA  532

Query  894   KKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTK-VPMNDMNMRAD  718
             K DPRI  +LW GYPG+ GG A+++I+FG  NP  +LP+TWYP+ + K + M +M MR  
Sbjct  533   KNDPRIMGILWAGYPGQAGGAAIADILFGTTNPGAKLPMTWYPQGYLKNLAMTNMAMRPS  592

Query  717   PSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGG  538
              S GYPGRTYRFY G  VY FG+GLSY++F   L SAP  +S+      +   S      
Sbjct  593   SSTGYPGRTYRFYNGPVVYPFGYGLSYTNFVHTLASAPKVVSVPVDGHRRGNSS------  646

Query  537   NEPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDR  358
             N+  + V   + C  L+  + + ++N G  DG+  +++FS  PT     APQKQL+ F++
Sbjct  647   NKAAIRVTH-ARCGKLSIRLDIDVKNVGSKDGTNTLLVFSVPPTGNGHWAPQKQLVAFEK  705

Query  357   VHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             V+V         I+I  C+ LS+V+  G+R +P+G H
Sbjct  706   VYVPAKAQQRVRINIHVCKLLSVVDKSGTRRIPMGAH  742



>ref|XP_002268626.2| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Vitis 
vinifera]
 emb|CBI39114.3| unnamed protein product [Vitis vinifera]
Length=774

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/759 (47%), Positives = 484/759 (64%), Gaps = 42/759 (6%)
 Frame = -3

Query  2493  SKPQLPC---QPPTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIP  2323
             S P   C     PT   + FC+TSL   AR+  LV  LT++EKI  L ++ +++ RLGIP
Sbjct  35    SSPVFACDVENNPTLGQFGFCNTSLETAARVADLVKRLTLEEKIGFLVNSAASVSRLGIP  94

Query  2322  AYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAM  2143
              YEWWSE+LHG++  GPG  F+  V  AT FPQVILTAA+FN +L+ +I    + EARAM
Sbjct  95    KYEWWSEALHGVSYVGPGTHFNSIVPGATSFPQVILTAASFNASLFEAIGKVVSTEARAM  154

Query  2142  FNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRK  1963
             +N G AGLTFW+PNVN+F DPRWGRGQETPGEDP++ S YA  YV               
Sbjct  155   YNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASAYV---------------  199

Query  1962  YSLSGNRMPEEEEDD--DRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEP  1789
                   R  ++ +D   DRL ++ACCKH TAYDL+ W    R  FNAVVT+QDM+DT++P
Sbjct  200   ------RGLQQGDDGSPDRLKVAACCKHYTAYDLDNWKGVDRLHFNAVVTKQDMDDTFQP  253

Query  1788  PFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEY  1612
             PFKSCV  G  + +MC++N VNG P CA+ DLL    R +W   GYI SDCD+V   +  
Sbjct  254   PFKSCVIDGNVASVMCSFNQVNGKPTCADPDLLSGIVRGEWKLNGYIVSDCDSVDVFYNS  313

Query  1611  QQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLG  1432
             Q Y K+PEEAA  A+ AG D+NCG+++ ++ ++A++  +V ES +D+A+ N F+   RLG
Sbjct  314   QHYTKTPEEAAAKAILAGLDLNCGSFLGQHTEAAVKGGLVDESAVDKAVSNNFATLMRLG  373

Query  1431  LFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIG  1252
              F+G      +   GPKDVC+SEH+ +A EAARQGIVLLKN +  LPL  T + +LA+IG
Sbjct  374   FFDGNPSKAIYGKLGPKDVCTSEHQEMAREAARQGIVLLKNSKGSLPLSPTAIKTLAIIG  433

Query  1251  PMAN-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKR  1075
             P AN T ++ G+Y G PC   + L GL   +  T+Y  GC +VAC  T    EA  IA  
Sbjct  434   PNANVTKTMIGNYEGTPCKYTTPLQGLTALV-ATTYLPGCSNVACG-TAQIDEAKKIAAA  491

Query  1074  ADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFA  895
             AD  +++VG+D S E E  DR S+ LPG Q  L+ E+A  S   ++LV+  GG  DISFA
Sbjct  492   ADATVLIVGIDQSIEAEGRDRVSIQLPGQQPLLITEVAKASKGNVILVVMSGGGFDISFA  551

Query  894   KKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFT-KVPMNDMNMRAD  718
             K D +IAS+LW+GYPGE GG A+++++FG YNP+GRLP+TWYP+S+  KVPM +MNMR D
Sbjct  552   KNDDKIASILWVGYPGEAGGAAIADVIFGFYNPSGRLPMTWYPQSYVDKVPMTNMNMRPD  611

Query  717   PSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGG  538
             P+ GYPGRTYRFYTGE +Y FG GLSY+ F+  L+ AP  +S+          S      
Sbjct  612   PASGYPGRTYRFYTGETIYTFGDGLSYTQFNHHLVQAPKSVSIPIEEGHSCHSSKCKS--  669

Query  537   NEPYVHVDEVS-NCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFD  361
                   VD V  +C +LAF + + + N G + GS  V LFS  P+ +   +PQK L+GF+
Sbjct  670   ------VDAVQESCQNLAFDIHLRVNNAGNISGSHTVFLFSSPPSVH--NSPQKHLLGFE  721

Query  360   RVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDHI  244
             +V V+          ++ C+ LSIV+  G++ + LG H+
Sbjct  722   KVFVTAKAEALVRFKVDVCKDLSIVDELGTQKVALGLHV  760



>ref|XP_007138975.1| hypothetical protein PHAVU_009G254300g [Phaseolus vulgaris]
 gb|ESW10969.1| hypothetical protein PHAVU_009G254300g [Phaseolus vulgaris]
Length=772

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/758 (45%), Positives = 488/758 (64%), Gaps = 37/758 (5%)
 Frame = -3

Query  2502  TSYSKPQLPCQPPT--HSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLG  2329
             TS  +    C P       + FC T +PI  R+  L++ LT+ EKI+ + +N  A+PRLG
Sbjct  25    TSQGRVPFACDPANGLTRGFKFCRTRVPIHVRVQDLIARLTLPEKIRLVVNNAIALPRLG  84

Query  2328  IPAYEWWSESLHGIATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavear  2149
             I  YEWWSE+LHG++  GPG  F GA   AT FPQVI TAA+FN++LWR I    + EAR
Sbjct  85    IQGYEWWSEALHGVSNVGPGTKFGGAFPGATMFPQVITTAASFNQSLWRQIGRVVSDEAR  144

Query  2148  AMFNSGQAGLTFWAPNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkng  1969
             AM+N GQ GLT+W+PNVN+F DPRWGRGQETPGEDP + + YA  YV+            
Sbjct  145   AMYNGGQGGLTYWSPNVNIFRDPRWGRGQETPGEDPTLAAKYAASYVQ------------  192

Query  1968  RKYSLSGNRMPEEEEDDDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEP  1789
                 L G      +   +RL ++ACCKH TAYDL+ W+   R+ FNA V++QD+EDTY+ 
Sbjct  193   ---GLQG------DGAGNRLKVAACCKHYTAYDLDNWNGVDRFHFNAKVSKQDLEDTYDV  243

Query  1788  PFKSCVEKGRASCLMCAYNAVNGIPACANKDLLEKA-RTDWGFEGYITSDCDAVATIFEY  1612
             PFK+CV +G+ + +MC+YN VNG P CA+ DLL    R  WG  GYI SDCD+V   ++ 
Sbjct  244   PFKACVLEGQVASVMCSYNQVNGKPTCADPDLLRNTIRGQWGLNGYIVSDCDSVGVFYDS  303

Query  1611  QQYAKSPEEAAGIALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLG  1432
             Q Y ++PEEAA  A+KAG D++CG ++  +  +A++  ++ E+D++ AL NL +VQ RLG
Sbjct  304   QHYTRTPEEAAADAIKAGLDLDCGPFLAIHTDAAIKKGLISENDLNLALANLITVQMRLG  363

Query  1431  LFNGKAVNRKFESFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIG  1252
             +F+G+   + + + GP+DVC+  H+ LALEAAR+ IVLL+N++  LPL   R+ ++ VIG
Sbjct  364   MFDGEPSAQPYGNLGPRDVCTPAHQELALEAARESIVLLQNKRNSLPLSPARIRTVGVIG  423

Query  1251  PMAN-TSSLGGDYTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKR  1075
             P ++ T ++ G+Y G+ C   S L G+  Y+ KTS+  GC  VAC   + F  A ++AK 
Sbjct  424   PNSDATVTMIGNYAGVACGYTSPLQGIARYV-KTSHQIGCRGVACRGNELFGAAETVAKV  482

Query  1074  ADYVIVVVGLDLSQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFA  895
              D  ++V+GLD S E E  DR  LLLPG Q  LV  +A  S  P++LV+  GGP+DISFA
Sbjct  483   VDATVLVMGLDQSVEAETRDRVGLLLPGLQQELVARVARASKGPVILVIMSGGPVDISFA  542

Query  894   KKDPRIASVLWIGYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESF-TKVPMNDMNMRAD  718
               DP+I+++LW+GYPG+ GG A+++++FG  NP GRLP+TWYPE + +KVPM +M+MR +
Sbjct  543   VNDPKISAILWVGYPGQAGGTAIADVIFGHTNPGGRLPMTWYPEGYLSKVPMTNMDMRPN  602

Query  717   PSRGYPGRTYRFYTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGG  538
             P  GYPGRTYRFY G  V+ FGHGLSYS+F+  L  AP  +SL   + T    ++  +  
Sbjct  603   PGTGYPGRTYRFYKGPVVFPFGHGLSYSTFTHALAIAPKHLSL--PLTTFTNSTLSTQAP  660

Query  537   NEPYVHVDEVSNCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQ-KQLIGFD  361
                + + D     ++L     V ++N+G MDG+  +++FS+ P    G   Q KQL+ F 
Sbjct  661   RLSHANCDH----DTLDMEFHVDVKNDGSMDGTHTLLVFSKPP---PGKWSQIKQLVNFQ  713

Query  360   RVHVSGNGVTETSISIEPCQHLSIVNVEGSRILPLGDH  247
             ++HV        ++ +  C+HLS+V+  G R +P G+H
Sbjct  714   KIHVPAGSTQRVTVGVHVCKHLSVVDQFGIRRIPSGEH  751



>ref|XP_009628814.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 {ECO:0000303|PubMed:17615411, 
ECO:0000312|EMBL:ABQ45228.1}-like 
[Nicotiana tomentosiformis]
Length=781

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/747 (46%), Positives = 477/747 (64%), Gaps = 39/747 (5%)
 Frame = -3

Query  2466  PTHSSYPFCDTSLPIPARLHSLVSLLTVDEKIQRLSDNNSAIPRLGIPAYEWWSESLHGI  2287
             P  ++  FCD SL +  R++ LV  LT+ EKI  L      + RLGIP YEWWSE+LHG+
Sbjct  54    PGLANLTFCDASLTVETRVNDLVQRLTLSEKIGFLVSGAGGVSRLGIPRYEWWSEALHGV  113

Query  2286  ATNGPGITFDGAVKSATGFPQVILTAAAFNRTLWRSIaaaaavearAMFNSGQAGLTFWA  2107
             +  GPG+ F G + +AT FPQVILTAA+FN TL+ +I    + EARAM+N G AGLT+W+
Sbjct  114   SYTGPGVHFSGLIPAATSFPQVILTAASFNVTLFETIGKVVSTEARAMYNVGLAGLTYWS  173

Query  2106  PNVNVFVDPRWGRGQETPGEDPMVVSDYAVEYVrglqgqglkgkngRKYSLSGNRMPEEE  1927
             PN+N+F DPRWGRGQETPGEDP + S Y   YV                     R  ++ 
Sbjct  174   PNINIFRDPRWGRGQETPGEDPTLTSKYGAAYV---------------------RGLQQT  212

Query  1926  ED--DDRLMLSACCKHLTAYDLELWHNFSRYSFNAVVTRQDMEDTYEPPFKSCVEKGRAS  1753
             +D   D+L ++ACCKH TAYD++ W    RY+FNAVVT+QDM+DT++PPFKSCV +G  +
Sbjct  213   DDGSKDKLKVAACCKHYTAYDVDNWKGIQRYNFNAVVTQQDMDDTFQPPFKSCVLEGNVA  272

Query  1752  CLMCAYNAVNGIPACANKDLLEK-ARTDWGFEGYITSDCDAVATIFEYQQYAKSPEEAAG  1576
              +MC+YN VNG P C + DLL    R +W   GYI +DCD++  IF  Q Y K+PEE A 
Sbjct  273   SVMCSYNQVNGKPTCGDPDLLAGIIRGEWNLNGYIVTDCDSLNEIFNSQHYTKTPEETAA  332

Query  1575  IALKAGTDINCGTYMLRNMKSALENKIVVESDIDRALLNLFSVQFRLGLFNGKAVNRKFE  1396
             + L +G D+NCG+++ +  + A   K+V ES IDRA+ N F+   RLG F+G   N  + 
Sbjct  333   LGLNSGVDLNCGSWLSKYTQGAFNQKLVNESVIDRAISNNFATLMRLGFFDGNPRNHIYG  392

Query  1395  SFGPKDVCSSEHRRLALEAARQGIVLLKNEQKFLPLDKTRVSSLAVIGPMAN-TSSLGGD  1219
             + GPKDVC+ E++ LA EAARQGIVLLKN    LPL  T + SLAVIGP AN T ++ G+
Sbjct  393   NLGPKDVCTPENQELAREAARQGIVLLKNTAGSLPLTPTAIKSLAVIGPNANVTKTMIGN  452

Query  1218  YTGIPCALKSVLDGLGEYIHKTSYASGCLDVACNSTDGFAEAVSIAKRADYVIVVVGLDL  1039
             Y G PC   + L GL   +  T Y  GC DV+CN+     +A  IA  AD V++V+G D 
Sbjct  453   YEGTPCKYTTPLQGLTASV-ATIYKPGCSDVSCNTAQ-LDDAKKIASTADAVVMVMGSDQ  510

Query  1038  SQETEDHDRYSLLLPGHQMALVNELAGVSNKplvlvltgggpLDISFAKKDPRIASVLWI  859
             S E E  DR ++ LPG Q  L+ E+A V+  P++LV+  GG +D+ FA  +P+I S+LW+
Sbjct  511   SIERESLDRVNITLPGQQSVLIAEVAKVAKGPVILVIMSGGGMDVQFAVDNPKITSILWV  570

Query  858   GYPGEEGGKALSEIVFGDYNPAGRLPLTWYPESFTK-VPMNDMNMRADPSRGYPGRTYRF  682
             G+PGE GG AL++++FG YNP+GRLP+TWYP+S+   VPM  MNMR DP+  YPGRTYRF
Sbjct  571   GFPGEAGGAALADVIFGYYNPSGRLPMTWYPQSYADAVPMTIMNMRPDPATNYPGRTYRF  630

Query  681   YTGEKVYEFGHGlsyssfslellSAPTRISLSQSIKTKLRRSILNRGGNEPYVHVDEV-S  505
             YTG  V+ FGHGLSYS F   L  APT +S+    K   R +            +D V  
Sbjct  631   YTGPTVFTFGHGLSYSQFKHRLDQAPTFVSIPLEEKHTCRSTKCKS--------IDTVEQ  682

Query  504   NCNSLAFSVRVSLRNNGGMDGSRVVMLFSRAPTSYAGGAPQKQLIGFDRVHVSGNGVTET  325
             +C++L F+V + ++N G + GS  + LF+  P+ +   APQK L+GF++VH++       
Sbjct  683   SCSNLGFNVHLRVKNMGKISGSHTIFLFNSPPSVH--NAPQKHLLGFEKVHLTPQEEGVV  740

Query  324   SISIEPCQHLSIVNVEGSRILPLGDHI  244
               +++ C+HLS  +  G++ + LG H+
Sbjct  741   KFNVDVCKHLSGHDELGNKKVALGQHV  767



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8224074983056