BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8029_g1_i1 len=2755 path=[5639:0-199 2907:200-2754]

Length=2755
                                                                      Score     E

ref|XP_009804941.1|  PREDICTED: TMV resistance protein N-like           517   0.0      
ref|XP_010315476.1|  PREDICTED: uncharacterized protein LOC101251930    501   0.0      
ref|XP_009607719.1|  PREDICTED: TMV resistance protein N-like           503   0.0      
gb|KDP27361.1|  hypothetical protein JCGZ_20185                         343   6e-134   
ref|XP_007220769.1|  hypothetical protein PRUPE_ppa024626mg             341   9e-133   
ref|XP_002519358.1|  leucine-rich repeat-containing protein, puta...    335   2e-132   Ricinus communis
ref|XP_006358468.1|  PREDICTED: TMV resistance protein N-like iso...    410   7e-131   
ref|XP_006358467.1|  PREDICTED: TMV resistance protein N-like iso...    410   1e-130   
ref|XP_009348861.1|  PREDICTED: TMV resistance protein N-like           340   1e-130   
ref|XP_008232626.1|  PREDICTED: TMV resistance protein N-like           333   1e-128   
ref|XP_011022865.1|  PREDICTED: TMV resistance protein N-like           328   1e-127   
ref|XP_008232446.1|  PREDICTED: uncharacterized protein LOC103331589    332   1e-127   
ref|XP_002309943.2|  hypothetical protein POPTR_0007s04750g             324   2e-127   Populus trichocarpa [western balsam poplar]
ref|XP_008232434.1|  PREDICTED: TMV resistance protein N-like           325   3e-127   
ref|XP_008231867.1|  PREDICTED: TMV resistance protein N-like           325   6e-127   
ref|XP_008375678.1|  PREDICTED: TMV resistance protein N-like           332   1e-126   
ref|XP_002517696.1|  TMV resistance protein N, putative                 324   2e-125   Ricinus communis
ref|XP_007203940.1|  hypothetical protein PRUPE_ppa017433mg             320   3e-125   
ref|XP_008245847.1|  PREDICTED: TMV resistance protein N-like           323   6e-125   
ref|XP_008232624.1|  PREDICTED: TMV resistance protein N-like           327   8e-125   
ref|XP_007099591.1|  TMV resistance protein N                           314   9e-125   
ref|XP_008232447.1|  PREDICTED: TMV resistance protein N-like           317   1e-124   
ref|XP_008232442.1|  PREDICTED: TMV resistance protein N-like           323   1e-124   
ref|XP_008232415.1|  PREDICTED: TMV resistance protein N-like           318   2e-124   
ref|XP_008227885.1|  PREDICTED: TMV resistance protein N-like           320   2e-124   
ref|XP_008232430.1|  PREDICTED: TMV resistance protein N-like           313   3e-124   
ref|XP_008232445.1|  PREDICTED: TMV resistance protein N-like           327   1e-123   
ref|XP_007023235.1|  TMV resistance protein N                           308   1e-123   
ref|XP_008375654.1|  PREDICTED: TMV resistance protein N-like           317   2e-123   
ref|XP_007203971.1|  hypothetical protein PRUPE_ppa024258mg             317   2e-123   
ref|XP_009345565.1|  PREDICTED: TMV resistance protein N-like           310   8e-123   
ref|XP_008227883.1|  PREDICTED: TMV resistance protein N-like           314   1e-122   
ref|XP_007218903.1|  hypothetical protein PRUPE_ppa000524mg             316   2e-122   
ref|XP_007203067.1|  hypothetical protein PRUPE_ppa023459mg             315   3e-122   
ref|XP_007221574.1|  hypothetical protein PRUPE_ppa025931mg             318   3e-122   
ref|XP_008232444.1|  PREDICTED: TMV resistance protein N-like           312   3e-122   
ref|XP_008228036.1|  PREDICTED: TMV resistance protein N-like           313   4e-122   
ref|XP_004308481.1|  PREDICTED: TMV resistance protein N-like           307   3e-121   
ref|XP_008224240.1|  PREDICTED: TMV resistance protein N-like           322   6e-121   
ref|XP_008343165.1|  PREDICTED: TMV resistance protein N-like           310   6e-121   
ref|XP_007023241.1|  TMV resistance protein N, putative                 302   9e-121   
ref|XP_008362577.1|  PREDICTED: TMV resistance protein N-like           305   1e-120   
ref|XP_009373216.1|  PREDICTED: TMV resistance protein N-like iso...    304   1e-120   
ref|XP_009373229.1|  PREDICTED: TMV resistance protein N-like iso...    303   1e-120   
ref|XP_007220726.1|  hypothetical protein PRUPE_ppa023276mg             317   4e-120   
ref|XP_009361379.1|  PREDICTED: TMV resistance protein N-like           310   5e-120   
ref|XP_008235924.1|  PREDICTED: TMV resistance protein N-like           309   7e-120   
ref|XP_009355152.1|  PREDICTED: TMV resistance protein N-like           317   8e-120   
ref|XP_002512273.1|  leucine-rich repeat-containing protein, puta...    337   1e-119   Ricinus communis
ref|XP_009351003.1|  PREDICTED: TMV resistance protein N-like           318   2e-119   
ref|XP_008232158.1|  PREDICTED: TMV resistance protein N-like           312   2e-119   
ref|XP_009370599.1|  PREDICTED: TMV resistance protein N-like iso...    300   2e-119   
ref|XP_008351316.1|  PREDICTED: TMV resistance protein N-like           296   3e-119   
ref|XP_007203985.1|  hypothetical protein PRUPE_ppa000551mg             306   5e-119   
ref|XP_007206681.1|  hypothetical protein PRUPE_ppa023688mg             319   5e-119   
ref|XP_007201107.1|  hypothetical protein PRUPE_ppa024462mg             305   8e-119   
ref|XP_009343895.1|  PREDICTED: TMV resistance protein N-like           310   1e-118   
ref|XP_007221565.1|  hypothetical protein PRUPE_ppa015313mg             301   2e-118   
ref|XP_008368587.1|  PREDICTED: TMV resistance protein N-like           295   4e-118   
ref|XP_009370600.1|  PREDICTED: TMV resistance protein N-like iso...    300   6e-118   
ref|XP_008343276.1|  PREDICTED: TMV resistance protein N-like           303   8e-118   
ref|XP_004230402.1|  PREDICTED: TMV resistance protein N-like           302   9e-118   
ref|XP_007200327.1|  hypothetical protein PRUPE_ppa000525mg             302   2e-117   
gb|ADL36717.1|  HD domain class transcription factor                    310   3e-117   
ref|XP_009351002.1|  PREDICTED: TMV resistance protein N-like           315   3e-117   
ref|XP_008354870.1|  PREDICTED: TMV resistance protein N-like           311   3e-117   
ref|XP_008345648.1|  PREDICTED: TMV resistance protein N-like           311   5e-117   
ref|XP_009358933.1|  PREDICTED: TMV resistance protein N-like           295   9e-117   
ref|XP_008227882.1|  PREDICTED: TMV resistance protein N-like           309   2e-116   
ref|XP_007204538.1|  hypothetical protein PRUPE_ppa017291mg             291   6e-116   
ref|XP_007029528.1|  TMV resistance protein N, putative                 294   8e-116   
ref|XP_004292321.1|  PREDICTED: TMV resistance protein N-like           301   8e-116   
ref|XP_008384972.1|  PREDICTED: TMV resistance protein N-like           303   1e-115   
ref|XP_011000598.1|  PREDICTED: TMV resistance protein N-like           301   2e-115   
ref|XP_008228037.1|  PREDICTED: TMV resistance protein N-like           292   6e-115   
ref|XP_007029533.1|  TMV resistance protein N                           293   7e-115   
ref|XP_009354361.1|  PREDICTED: TMV resistance protein N-like           305   2e-114   
ref|XP_009370620.1|  PREDICTED: TMV resistance protein N-like           286   4e-114   
ref|XP_008375639.1|  PREDICTED: TMV resistance protein N-like           295   8e-114   
ref|XP_009337690.1|  PREDICTED: TMV resistance protein N-like           293   9e-114   
ref|XP_009344853.1|  PREDICTED: TMV resistance protein N-like           301   9e-114   
ref|XP_008369992.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...    300   9e-114   
ref|XP_008372869.1|  PREDICTED: TMV resistance protein N-like           297   1e-113   
ref|XP_009346661.1|  PREDICTED: TMV resistance protein N-like           301   1e-113   
ref|XP_008373781.1|  PREDICTED: TMV resistance protein N-like           305   2e-113   
ref|XP_006368624.1|  hypothetical protein POPTR_0001s06610g             300   3e-113   
ref|XP_009367284.1|  PREDICTED: TMV resistance protein N-like           289   6e-113   
ref|XP_009367206.1|  PREDICTED: TMV resistance protein N-like           289   6e-113   
ref|XP_007203381.1|  hypothetical protein PRUPE_ppa026003mg             277   2e-112   
ref|XP_008342527.1|  PREDICTED: TMV resistance protein N-like iso...    277   2e-112   
ref|XP_008342525.1|  PREDICTED: TMV resistance protein N-like iso...    277   2e-112   
ref|XP_008343279.1|  PREDICTED: TMV resistance protein N-like           291   3e-112   
ref|XP_004292249.1|  PREDICTED: TMV resistance protein N-like           287   4e-112   
ref|XP_009371023.1|  PREDICTED: TMV resistance protein N-like           281   4e-112   
ref|XP_008339325.1|  PREDICTED: TMV resistance protein N-like           291   4e-112   
ref|XP_009337692.1|  PREDICTED: TMV resistance protein N-like           294   6e-112   
ref|XP_011002582.1|  PREDICTED: TMV resistance protein N-like iso...    265   1e-111   
ref|XP_011002581.1|  PREDICTED: TMV resistance protein N-like iso...    265   1e-111   
ref|XP_008342629.1|  PREDICTED: TMV resistance protein N-like           289   2e-111   
ref|XP_011002580.1|  PREDICTED: TMV resistance protein N-like iso...    265   2e-111   
ref|XP_011002579.1|  PREDICTED: TMV resistance protein N-like iso...    265   2e-111   
ref|XP_007219232.1|  hypothetical protein PRUPE_ppa017814mg             282   2e-111   
ref|XP_009361477.1|  PREDICTED: TMV resistance protein N-like           294   3e-111   
ref|XP_002316552.2|  hypothetical protein POPTR_0011s01400g             263   6e-111   Populus trichocarpa [western balsam poplar]
ref|XP_007201127.1|  hypothetical protein PRUPE_ppa017276mg             282   1e-110   
ref|XP_002316558.2|  hypothetical protein POPTR_0011s00210g             265   1e-110   Populus trichocarpa [western balsam poplar]
ref|XP_004308512.1|  PREDICTED: TMV resistance protein N-like           284   2e-110   
ref|XP_009341509.1|  PREDICTED: TMV resistance protein N-like           276   3e-110   
ref|XP_008364363.1|  PREDICTED: TMV resistance protein N-like           286   4e-110   
ref|XP_008345646.1|  PREDICTED: TMV resistance protein N-like           288   1e-109   
ref|XP_009361478.1|  PREDICTED: TMV resistance protein N-like           284   2e-109   
ref|XP_009782738.1|  PREDICTED: TMV resistance protein N-like           318   1e-108   
ref|XP_008347442.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...    290   1e-108   
ref|XP_007207278.1|  hypothetical protein PRUPE_ppa024010m2g            298   2e-108   
ref|XP_008224252.1|  PREDICTED: TMV resistance protein N-like           306   4e-108   
ref|XP_008235925.1|  PREDICTED: TMV resistance protein N-like           276   6e-108   
ref|XP_009333811.1|  PREDICTED: TMV resistance protein N-like           273   6e-108   
ref|XP_008377461.1|  PREDICTED: TMV resistance protein N-like           286   1e-107   
ref|XP_008350436.1|  PREDICTED: TMV resistance protein N-like           274   3e-107   
gb|KDP37035.1|  hypothetical protein JCGZ_06091                         360   3e-107   
gb|ABF81452.1|  TIR-NBS type disease resistance protein                 270   4e-107   Populus trichocarpa [western balsam poplar]
ref|XP_009776630.1|  PREDICTED: TMV resistance protein N-like iso...    304   5e-107   
ref|XP_009776637.1|  PREDICTED: TMV resistance protein N-like iso...    304   5e-107   
ref|XP_011011346.1|  PREDICTED: TMV resistance protein N-like           269   6e-107   
ref|XP_007221572.1|  hypothetical protein PRUPE_ppa025473mg             287   7e-107   
ref|XP_002317136.2|  hypothetical protein POPTR_0011s01755g             254   5e-106   Populus trichocarpa [western balsam poplar]
ref|XP_011046323.1|  PREDICTED: TMV resistance protein N-like iso...    260   1e-105   
ref|XP_009350224.1|  PREDICTED: TMV resistance protein N-like           278   1e-105   
ref|XP_011046325.1|  PREDICTED: TMV resistance protein N-like iso...    260   1e-105   
ref|XP_002524855.1|  ATP binding protein, putative                      266   1e-105   Ricinus communis
ref|XP_009350229.1|  PREDICTED: TMV resistance protein N-like           277   2e-105   
ref|XP_007198927.1|  hypothetical protein PRUPE_ppa000477mg             283   1e-104   
ref|XP_009598203.1|  PREDICTED: TMV resistance protein N-like           308   1e-104   
ref|XP_006363488.1|  PREDICTED: TMV resistance protein N-like iso...    306   5e-104   
ref|XP_008353085.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...    259   5e-104   
ref|XP_006363487.1|  PREDICTED: TMV resistance protein N-like iso...    305   6e-104   
ref|XP_011041388.1|  PREDICTED: TMV resistance protein N-like iso...    251   7e-104   
ref|XP_011002554.1|  PREDICTED: TMV resistance protein N-like iso...    257   7e-104   
ref|XP_011041389.1|  PREDICTED: TMV resistance protein N-like iso...    251   8e-104   
ref|XP_011041390.1|  PREDICTED: TMV resistance protein N-like iso...    251   9e-104   
ref|XP_006388945.1|  hypothetical protein POPTR_0069s00220g             255   1e-103   
ref|XP_010242715.1|  PREDICTED: TMV resistance protein N-like iso...    256   1e-103   
ref|XP_006370902.1|  hypothetical protein POPTR_0019s01570g             261   1e-103   
ref|XP_010242716.1|  PREDICTED: TMV resistance protein N-like iso...    256   1e-103   
ref|XP_002316572.2|  hypothetical protein POPTR_0011s01695g             251   2e-103   Populus trichocarpa [western balsam poplar]
ref|XP_010315689.1|  PREDICTED: TMV resistance protein N-like iso...    272   3e-103   
ref|XP_010315688.1|  PREDICTED: TMV resistance protein N-like iso...    272   4e-103   
ref|XP_011002553.1|  PREDICTED: TMV resistance protein N-like           254   8e-103   
ref|XP_008244976.1|  PREDICTED: TMV resistance protein N-like           270   1e-102   
ref|XP_011012496.1|  PREDICTED: TMV resistance protein N-like iso...    246   1e-102   
ref|XP_011012495.1|  PREDICTED: TMV resistance protein N-like iso...    246   1e-102   
ref|XP_006377439.1|  hypothetical protein POPTR_0011s05930g             257   3e-102   
gb|KDP34368.1|  hypothetical protein JCGZ_11251                         255   3e-102   
ref|XP_006377253.1|  hypothetical protein POPTR_0011s03000g             248   4e-102   
ref|XP_010242717.1|  PREDICTED: TMV resistance protein N-like iso...    257   7e-102   
ref|XP_006388459.1|  hypothetical protein POPTR_0182s00240g             259   2e-101   
ref|XP_011026208.1|  PREDICTED: TMV resistance protein N-like           265   2e-100   
ref|XP_011016381.1|  PREDICTED: TMV resistance protein N-like           249   3e-100   
ref|XP_010263414.1|  PREDICTED: TMV resistance protein N-like           238   5e-100   
ref|XP_008347091.1|  PREDICTED: TMV resistance protein N-like           253   7e-100   
ref|XP_011032762.1|  PREDICTED: TMV resistance protein N-like iso...    271   8e-100   
ref|XP_010314215.1|  PREDICTED: TMV resistance protein N-like           283   9e-100   
ref|XP_011032759.1|  PREDICTED: TMV resistance protein N-like iso...    270   9e-100   
ref|XP_011032761.1|  PREDICTED: TMV resistance protein N-like iso...    270   1e-99    
ref|XP_006358466.1|  PREDICTED: TMV resistance protein N-like           298   1e-99    
ref|XP_011032756.1|  PREDICTED: TMV resistance protein N-like iso...    270   1e-99    
ref|XP_008375765.1|  PREDICTED: TMV resistance protein N-like           300   5e-99    
ref|XP_009779439.1|  PREDICTED: TMV resistance protein N-like           281   6e-99    
gb|KDP42474.1|  hypothetical protein JCGZ_00271                         278   2e-98    
gb|ABF81465.1|  TIR-NBS-LRR type disease resistance protein             246   2e-98    Populus trichocarpa [western balsam poplar]
ref|XP_006385577.1|  hypothetical protein POPTR_0003s08250g             246   2e-98    
ref|XP_009801307.1|  PREDICTED: TMV resistance protein N-like           278   3e-98    
ref|XP_010263209.1|  PREDICTED: TMV resistance protein N-like iso...    250   3e-98    
ref|XP_007203445.1|  hypothetical protein PRUPE_ppa022023mg             308   5e-98    
ref|XP_010263207.1|  PREDICTED: TMV resistance protein N-like iso...    250   5e-98    
ref|XP_010263318.1|  PREDICTED: TMV resistance protein N-like iso...    257   6e-98    
ref|XP_009804962.1|  PREDICTED: TMV resistance protein N-like iso...    292   7e-98    
ref|XP_009804951.1|  PREDICTED: TMV resistance protein N-like iso...    292   8e-98    
ref|XP_006344768.1|  PREDICTED: TMV resistance protein N-like           310   1e-97    
ref|XP_004231677.2|  PREDICTED: TMV resistance protein N-like           295   1e-97    
ref|XP_008368273.1|  PREDICTED: TMV resistance protein N-like           333   2e-97    
ref|XP_009594180.1|  PREDICTED: TMV resistance protein N-like           286   5e-97    
ref|XP_010263244.1|  PREDICTED: TMV resistance protein N-like           260   8e-97    
emb|CAN61853.1|  hypothetical protein VITISV_027841                     243   1e-96    Vitis vinifera
ref|XP_006349259.1|  PREDICTED: TMV resistance protein N-like iso...    277   1e-96    
ref|XP_010665235.1|  PREDICTED: TMV resistance protein N-like           243   2e-96    
ref|XP_010256441.1|  PREDICTED: TMV resistance protein N-like iso...    243   7e-96    
ref|XP_010256443.1|  PREDICTED: TMV resistance protein N-like iso...    243   8e-96    
ref|XP_008237268.1|  PREDICTED: TMV resistance protein N-like           243   9e-96    
ref|XP_008391553.1|  PREDICTED: uncharacterized protein LOC103453763    249   2e-95    
gb|ABM55687.1|  TIR-NBS-LRR class disease resistance protein            234   3e-95    (Populus tomentosa x Populus bolleana) x Populus tomentosa
ref|XP_010263317.1|  PREDICTED: TMV resistance protein N-like iso...    248   3e-95    
ref|XP_006370901.1|  hypothetical protein POPTR_0019s01560g             243   9e-95    
ref|XP_008238607.1|  PREDICTED: TMV resistance protein N-like           254   1e-94    
ref|XP_008364791.1|  PREDICTED: TMV resistance protein N-like           233   4e-94    
ref|XP_009771867.1|  PREDICTED: TMV resistance protein N-like           269   4e-94    
ref|XP_010263405.1|  PREDICTED: uncharacterized protein LOC104601664    254   4e-94    
ref|XP_011001241.1|  PREDICTED: TMV resistance protein N-like           225   7e-94    
ref|XP_008227563.1|  PREDICTED: TMV resistance protein N-like           243   1e-93    
ref|XP_008224273.1|  PREDICTED: TMV resistance protein N-like           255   3e-93    
gb|ABF81471.1|  TIR-NBS type disease resistance protein                 219   4e-93    Populus trichocarpa [western balsam poplar]
ref|XP_002310389.2|  hypothetical protein POPTR_0007s00600g             219   2e-92    Populus trichocarpa [western balsam poplar]
ref|XP_004515064.1|  PREDICTED: TMV resistance protein N-like           257   8e-92    
ref|XP_008346333.1|  PREDICTED: TMV resistance protein N-like           223   8e-92    
ref|XP_011005281.1|  PREDICTED: LOW QUALITY PROTEIN: TMV resistan...    218   9e-92    
ref|XP_008366926.1|  PREDICTED: TMV resistance protein N-like           231   1e-91    
ref|XP_006388454.1|  hypothetical protein POPTR_0182s00200g             222   1e-91    
ref|XP_004250576.1|  PREDICTED: TMV resistance protein N-like iso...    293   1e-91    
ref|XP_010263320.1|  PREDICTED: TMV resistance protein N-like           236   1e-91    
gb|AAZ07902.1|  NBS-LRR protein                                         299   2e-91    Ipomoea batatas [batate]
gb|ABE99701.1|  TIR-NBS-LRR disease resistance-like protein             228   2e-91    Populus balsamifera [balsam poplar]
ref|XP_010245559.1|  PREDICTED: uncharacterized protein LOC104589071    211   3e-91    
ref|XP_011047737.1|  PREDICTED: LOW QUALITY PROTEIN: TMV resistan...    216   3e-91    
ref|XP_008232560.1|  PREDICTED: TMV resistance protein N-like           323   4e-91    
ref|XP_006371054.1|  hypothetical protein POPTR_0019s03010g             223   5e-91    
gb|ABB82027.1|  TIR-NBS disease resistance-like protein                 223   6e-91    Populus trichocarpa [western balsam poplar]
gb|KEH25106.1|  disease resistance protein (TIR-NBS-LRR class), p...    241   1e-90    
ref|XP_008222872.1|  PREDICTED: TMV resistance protein N-like           239   1e-90    
ref|XP_009350789.1|  PREDICTED: TMV resistance protein N-like           243   1e-90    
ref|XP_006349418.1|  PREDICTED: TMV resistance protein N-like           277   2e-90    
ref|XP_006478252.1|  PREDICTED: TMV resistance protein N-like iso...    238   2e-90    
ref|XP_006370843.1|  hypothetical protein POPTR_0019s00720g             221   2e-90    
ref|XP_006371052.1|  hypothetical protein POPTR_0019s03000g             226   3e-90    
gb|ABD33460.1|  putative NBS-LRR resistance disease protein rsp-22      295   3e-90    Ipomoea batatas [batate]
ref|XP_009335301.1|  PREDICTED: TMV resistance protein N-like           244   3e-90    
ref|XP_006358559.1|  PREDICTED: TMV resistance protein N-like           255   4e-90    
gb|KEH25111.1|  disease resistance protein (TIR-NBS-LRR class)          240   5e-90    
ref|XP_007221584.1|  hypothetical protein PRUPE_ppa025848mg             233   6e-90    
gb|KDO51715.1|  hypothetical protein CISIN_1g001277mg                   236   8e-90    
ref|XP_011013098.1|  PREDICTED: TMV resistance protein N-like iso...    224   9e-90    
ref|XP_011013099.1|  PREDICTED: TMV resistance protein N-like iso...    224   1e-89    
ref|XP_009337704.1|  PREDICTED: TMV resistance protein N-like           219   1e-89    
ref|XP_006371227.1|  hypothetical protein POPTR_0019s06300g             217   2e-89    
gb|ABB82029.1|  TIR-NBS disease resistance-like protein                 219   2e-89    Populus trichocarpa [western balsam poplar]
ref|XP_002514805.1|  ATP binding protein, putative                      232   2e-89    Ricinus communis
ref|XP_006478256.1|  PREDICTED: TMV resistance protein N-like iso...    238   2e-89    
ref|XP_011001242.1|  PREDICTED: TMV resistance protein N-like           216   2e-89    
gb|ABM55688.1|  TIR-NBS class disease resistance protein                220   3e-89    (Populus tomentosa x Populus bolleana) x Populus tomentosa
ref|XP_010087987.1|  TMV resistance protein N                           233   4e-89    
ref|XP_007034212.1|  Disease resistance protein family, putative        214   4e-89    
ref|XP_011012884.1|  PREDICTED: TMV resistance protein N-like           213   4e-89    
ref|XP_006371041.1|  hypothetical protein POPTR_0019s02900g             217   4e-89    
ref|XP_007214464.1|  hypothetical protein PRUPE_ppa023828mg             317   6e-89    
ref|XP_007224218.1|  hypothetical protein PRUPE_ppa017550mg             225   9e-89    
ref|XP_006370864.1|  hypothetical protein POPTR_0019s01170g             214   1e-88    
ref|XP_006371058.1|  hypothetical protein POPTR_0019s03040g             211   1e-88    
gb|ABC55465.1|  TIR-NBS disease resistance-like protein                 217   1e-88    (Populus tomentosa x Populus bolleana) x Populus tomentosa var. truncata
ref|XP_008443388.1|  PREDICTED: TMV resistance protein N                234   2e-88    
ref|XP_006389335.1|  hypothetical protein POPTR_0030s00570g             201   3e-88    
ref|XP_007210009.1|  hypothetical protein PRUPE_ppa016162mg             231   4e-88    
ref|XP_006370866.1|  hypothetical protein POPTR_0019s01210g             210   4e-88    
gb|KDO40286.1|  hypothetical protein CISIN_1g000802mg                   236   8e-88    
ref|XP_006385250.1|  hypothetical protein POPTR_0003s02110g             209   9e-88    
gb|ABB82030.1|  TIR-NBS disease resistance-like protein                 222   1e-87    Populus trichocarpa [western balsam poplar]
ref|XP_006478464.1|  PREDICTED: TMV resistance protein N-like           231   1e-87    
ref|XP_008349526.1|  PREDICTED: TMV resistance protein N-like           216   2e-87    
ref|XP_006371047.1|  hypothetical protein POPTR_0019s02950g             211   2e-87    
ref|XP_007227234.1|  hypothetical protein PRUPE_ppa018286mg             228   2e-87    
gb|ABE99702.1|  TIR-NBS-LRR disease resistance-like protein             232   3e-87    Populus trichocarpa [western balsam poplar]
ref|XP_011011693.1|  PREDICTED: TMV resistance protein N-like           202   4e-87    
ref|XP_006377164.1|  hypothetical protein POPTR_0011s01315g             202   4e-87    
ref|XP_006370909.1|  hypothetical protein POPTR_0019s01640g             239   4e-87    
gb|AGF69193.1|  TMV resistance protein N-like protein 7                 218   4e-87    
ref|XP_010665419.1|  PREDICTED: TMV resistance protein N-like           218   5e-87    
ref|XP_007200952.1|  hypothetical protein PRUPE_ppa000577mg             234   7e-87    
ref|XP_010536050.1|  PREDICTED: TMV resistance protein N-like           233   7e-87    
ref|XP_011013492.1|  PREDICTED: TMV resistance protein N-like iso...    207   9e-87    
ref|XP_011013489.1|  PREDICTED: TMV resistance protein N-like iso...    207   9e-87    
ref|XP_011013487.1|  PREDICTED: TMV resistance protein N-like iso...    207   1e-86    
ref|XP_011013491.1|  PREDICTED: TMV resistance protein N-like iso...    207   1e-86    
ref|XP_011013488.1|  PREDICTED: TMV resistance protein N-like iso...    208   1e-86    
ref|XP_011014417.1|  PREDICTED: TMV resistance protein N-like           206   1e-86    
ref|XP_010263217.1|  PREDICTED: TMV resistance protein N-like iso...    235   1e-86    
ref|XP_007219398.1|  hypothetical protein PRUPE_ppa020421mg             236   1e-86    
ref|XP_011013490.1|  PREDICTED: TMV resistance protein N-like iso...    207   1e-86    
ref|XP_008218968.1|  PREDICTED: LOW QUALITY PROTEIN: TMV resistan...    222   2e-86    
ref|XP_010263218.1|  PREDICTED: TMV resistance protein N-like iso...    235   2e-86    
ref|XP_007226825.1|  hypothetical protein PRUPE_ppa017612mg             218   2e-86    
ref|XP_007226918.1|  hypothetical protein PRUPE_ppa015956mg             217   2e-86    
emb|CAD36200.1|  TIR-NBS disease resistance protein                     209   2e-86    
ref|XP_007224977.1|  hypothetical protein PRUPE_ppa020772mg             224   3e-86    
emb|CAC95124.1|  TIR/NBS/LRR protein                                    205   3e-86    
ref|XP_008357580.1|  PREDICTED: TMV resistance protein N-like           235   3e-86    
ref|XP_008236755.1|  PREDICTED: TMV resistance protein N-like           229   3e-86    
ref|XP_010263216.1|  PREDICTED: TMV resistance protein N-like iso...    233   4e-86    
gb|ABF81460.1|  TIR-NBS type disease resistance protein                 201   4e-86    
ref|XP_004489474.1|  PREDICTED: TMV resistance protein N-like iso...    227   5e-86    
ref|XP_004489473.1|  PREDICTED: TMV resistance protein N-like iso...    227   5e-86    
gb|KEH25109.1|  disease resistance protein (TIR-NBS-LRR class)          234   6e-86    
ref|XP_008218875.1|  PREDICTED: TMV resistance protein N-like iso...    214   8e-86    
ref|XP_009337696.1|  PREDICTED: TMV resistance protein N-like           296   1e-85    
ref|XP_007199382.1|  hypothetical protein PRUPE_ppa025692mg             233   1e-85    
ref|XP_008227722.1|  PREDICTED: TMV resistance protein N-like           212   1e-85    
ref|XP_003624006.1|  TMV resistance protein N                           229   1e-85    
ref|XP_008218838.1|  PREDICTED: LOW QUALITY PROTEIN: TMV resistan...    221   2e-85    
ref|XP_004489476.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...    230   2e-85    
ref|XP_008222878.1|  PREDICTED: TMV resistance protein N-like           221   2e-85    
ref|XP_006441684.1|  hypothetical protein CICLE_v10024297mg             227   2e-85    
ref|XP_007224521.1|  hypothetical protein PRUPE_ppa023909mg             214   3e-85    
gb|ABB82025.1|  TIR-NBS disease resistance-like protein                 205   4e-85    
ref|XP_008218878.1|  PREDICTED: TMV resistance protein N-like           216   4e-85    
gb|ABH07384.1|  CMR1                                                    233   5e-85    
ref|XP_010041284.1|  PREDICTED: uncharacterized protein LOC104430222    224   5e-85    
ref|XP_004489477.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...    229   6e-85    
ref|XP_008236758.1|  PREDICTED: TMV resistance protein N-like           232   9e-85    
ref|XP_006471199.1|  PREDICTED: TMV resistance protein N-like iso...    235   1e-84    
ref|XP_008350573.1|  PREDICTED: TMV resistance protein N-like           216   1e-84    
ref|XP_010263365.1|  PREDICTED: TMV resistance protein N-like           219   1e-84    
ref|XP_008218876.1|  PREDICTED: TMV resistance protein N-like iso...    213   1e-84    
ref|XP_008244985.1|  PREDICTED: TMV resistance protein N-like           219   2e-84    
ref|XP_004231293.2|  PREDICTED: TMV resistance protein N-like           306   2e-84    
ref|XP_009799389.1|  PREDICTED: TMV resistance protein N-like iso...    218   2e-84    
gb|KEH25115.1|  disease resistance protein (TIR-NBS-LRR class)          220   2e-84    
ref|XP_009354331.1|  PREDICTED: TMV resistance protein N-like           224   2e-84    
ref|XP_008218877.1|  PREDICTED: TMV resistance protein N-like iso...    213   2e-84    
gb|KEH25081.1|  disease resistance protein (TIR-NBS-LRR class)          219   3e-84    
ref|XP_009799386.1|  PREDICTED: TMV resistance protein N-like iso...    218   3e-84    
ref|XP_008219018.1|  PREDICTED: LOW QUALITY PROTEIN: TMV resistan...    209   3e-84    
ref|XP_008218845.1|  PREDICTED: TMV resistance protein N-like           217   3e-84    
emb|CAN68265.1|  hypothetical protein VITISV_020931                     197   4e-84    
ref|XP_002264399.1|  PREDICTED: TMV resistance protein N-like           210   4e-84    
ref|XP_007226831.1|  hypothetical protein PRUPE_ppa024963mg             215   5e-84    
ref|XP_006360923.1|  PREDICTED: TMV resistance protein N-like iso...    216   5e-84    
ref|XP_006360922.1|  PREDICTED: TMV resistance protein N-like iso...    216   6e-84    
ref|XP_007135105.1|  hypothetical protein PHAVU_010G101200g             229   7e-84    
emb|CAN61526.1|  hypothetical protein VITISV_036339                     210   7e-84    
ref|XP_006360969.1|  PREDICTED: TMV resistance protein N-like           209   8e-84    
ref|XP_002264704.2|  PREDICTED: TMV resistance protein N                211   8e-84    
ref|XP_009354333.1|  PREDICTED: TMV resistance protein N-like           224   8e-84    
ref|XP_009353023.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    210   1e-83    
emb|CAD36199.1|  NLS-TIR-NBS disease resistance protein                 199   1e-83    
ref|XP_010027055.1|  PREDICTED: TMV resistance protein N-like           211   1e-83    
ref|XP_009630491.1|  PREDICTED: uncharacterized protein LOC104120435    211   1e-83    
gb|KEH25073.1|  disease resistance protein (TIR-NBS-LRR class)          224   1e-83    
ref|XP_006471244.1|  PREDICTED: TMV resistance protein N-like           228   1e-83    
ref|XP_007198870.1|  hypothetical protein PRUPE_ppa019385mg             299   1e-83    
ref|XP_004289543.1|  PREDICTED: TMV resistance protein N-like           195   1e-83    
ref|XP_010263195.1|  PREDICTED: TMV resistance protein N-like iso...    224   2e-83    
ref|XP_010263198.1|  PREDICTED: TMV resistance protein N-like iso...    224   2e-83    
ref|XP_011046331.1|  PREDICTED: TMV resistance protein N-like iso...    239   2e-83    
gb|KEH25076.1|  disease resistance protein (TIR-NBS-LRR class)          219   2e-83    
ref|XP_003622506.1|  TMV resistance protein N                           213   2e-83    
ref|XP_002325276.2|  hypothetical protein POPTR_0019s01160g             202   2e-83    
ref|XP_008220542.1|  PREDICTED: TMV resistance protein N-like           216   2e-83    
ref|XP_004499788.1|  PREDICTED: TMV resistance protein N-like           226   2e-83    
ref|XP_010657779.1|  PREDICTED: TMV resistance protein N-like iso...    217   3e-83    
ref|XP_010657777.1|  PREDICTED: TMV resistance protein N-like iso...    217   3e-83    
ref|XP_006576565.1|  PREDICTED: TMV resistance protein N-like           213   3e-83    
ref|XP_004510758.1|  PREDICTED: TMV resistance protein N-like           221   3e-83    
gb|KEH25082.1|  disease resistance protein (TIR-NBS-LRR class)          217   3e-83    
ref|XP_004308487.1|  PREDICTED: uncharacterized protein LOC101311138    305   3e-83    
ref|XP_011012120.1|  PREDICTED: TMV resistance protein N-like           207   4e-83    
ref|XP_006471201.1|  PREDICTED: TMV resistance protein N-like iso...    230   4e-83    
ref|XP_008218977.1|  PREDICTED: TMV resistance protein N-like           209   4e-83    
ref|XP_009622118.1|  PREDICTED: TMV resistance protein N-like iso...    219   4e-83    
ref|XP_006471198.1|  PREDICTED: TMV resistance protein N-like iso...    230   4e-83    
ref|XP_006471200.1|  PREDICTED: TMV resistance protein N-like iso...    229   5e-83    
ref|XP_004489498.1|  PREDICTED: uncharacterized protein LOC101494533    221   5e-83    
ref|XP_010027038.1|  PREDICTED: TMV resistance protein N-like           213   6e-83    
ref|XP_006471197.1|  PREDICTED: TMV resistance protein N-like iso...    230   6e-83    
ref|XP_009622117.1|  PREDICTED: TMV resistance protein N-like iso...    218   6e-83    
ref|XP_002530627.1|  TMV resistance protein N, putative                 218   7e-83    
ref|XP_009622115.1|  PREDICTED: TMV resistance protein N-like iso...    218   7e-83    
ref|XP_010050809.1|  PREDICTED: uncharacterized protein LOC104439442    221   9e-83    
ref|XP_007224738.1|  hypothetical protein PRUPE_ppa024525mg             216   9e-83    
ref|XP_009595606.1|  PREDICTED: TMV resistance protein N-like iso...    300   1e-82    
ref|XP_004489475.1|  PREDICTED: TMV resistance protein N-like           218   1e-82    
ref|XP_003624057.1|  TMV resistance protein N                           213   1e-82    
ref|XP_003604611.1|  TIR-NBS-LRR RCT1-like resistance protein           229   2e-82    
ref|XP_010536163.1|  PREDICTED: TMV resistance protein N-like iso...    215   2e-82    
ref|XP_006364954.1|  PREDICTED: TMV resistance protein N-like           223   2e-82    
ref|XP_010657771.1|  PREDICTED: TMV resistance protein N-like iso...    213   2e-82    
ref|XP_006360963.1|  PREDICTED: TMV resistance protein N-like           212   2e-82    
ref|XP_010536165.1|  PREDICTED: TMV resistance protein N-like iso...    214   2e-82    
ref|XP_010657770.1|  PREDICTED: TMV resistance protein N-like iso...    213   2e-82    
ref|XP_008223836.1|  PREDICTED: TMV resistance protein N-like           215   2e-82    
ref|XP_009595605.1|  PREDICTED: TMV resistance protein N-like iso...    300   2e-82    
gb|KDP45045.1|  hypothetical protein JCGZ_01545                         219   2e-82    
ref|XP_010657780.1|  PREDICTED: TMV resistance protein N-like iso...    217   3e-82    
ref|XP_008364007.1|  PREDICTED: TMV resistance protein N-like           285   4e-82    
gb|AES86811.2|  disease resistance protein (TIR-NBS-LRR class)          220   4e-82    
ref|XP_003604614.1|  TIR-NBS-LRR RCT1-like resistance protein           220   4e-82    
gb|AGC24027.1|  TIR-NB-LRR type resistance protein RGA4                 203   4e-82    
ref|XP_010027054.1|  PREDICTED: TMV resistance protein N-like           229   5e-82    
ref|XP_010243472.1|  PREDICTED: TMV resistance protein N-like iso...    213   5e-82    
ref|XP_002273047.2|  PREDICTED: TMV resistance protein N-like           209   6e-82    
ref|XP_007199645.1|  hypothetical protein PRUPE_ppa022914mg             221   6e-82    
ref|XP_006573341.1|  PREDICTED: TMV resistance protein N-like iso...    221   6e-82    
ref|XP_004247886.1|  PREDICTED: TMV resistance protein N isoform X2     215   6e-82    
ref|XP_003516337.1|  PREDICTED: TMV resistance protein N-like iso...    220   7e-82    
ref|XP_010326869.1|  PREDICTED: TMV resistance protein N isoform X1     215   7e-82    
ref|XP_003624058.1|  TMV resistance protein N                           217   7e-82    
ref|XP_010243473.1|  PREDICTED: TMV resistance protein N-like iso...    212   8e-82    
ref|XP_010243470.1|  PREDICTED: TMV resistance protein N-like iso...    212   8e-82    
ref|XP_010243474.1|  PREDICTED: TMV resistance protein N-like iso...    212   8e-82    
gb|KEH23377.1|  disease resistance protein (TIR-NBS-LRR class)          217   9e-82    
gb|ACF19651.1|  TIR-NBS-LRR RCT1-like resistance protein                223   9e-82    
ref|XP_008343163.1|  PREDICTED: TMV resistance protein N-like iso...    296   1e-81    
ref|XP_009794564.1|  PREDICTED: TMV resistance protein N-like iso...    213   1e-81    
ref|XP_007200803.1|  hypothetical protein PRUPE_ppa025229mg             219   1e-81    
ref|XP_008343162.1|  PREDICTED: TMV resistance protein N-like iso...    295   1e-81    
ref|XP_007226259.1|  hypothetical protein PRUPE_ppa018622mg             204   1e-81    
ref|XP_004143832.1|  PREDICTED: TMV resistance protein N-like           215   1e-81    
ref|XP_009367970.1|  PREDICTED: TMV resistance protein N-like iso...    209   2e-81    
ref|XP_007199413.1|  hypothetical protein PRUPE_ppa026276mg             226   2e-81    
ref|XP_004157327.1|  PREDICTED: TMV resistance protein N-like           214   2e-81    
ref|XP_009367971.1|  PREDICTED: TMV resistance protein N-like iso...    209   2e-81    
ref|XP_006371055.1|  hypothetical protein POPTR_0019s03015g             186   2e-81    
gb|KEH25090.1|  disease resistance protein (TIR-NBS-LRR class)          217   2e-81    
gb|AFC90228.1|  nucleotide-binding site leucine-rich repeat protein     275   2e-81    
ref|XP_004492775.1|  PREDICTED: TMV resistance protein N-like iso...    213   2e-81    
gb|KEH25091.1|  disease resistance protein (TIR-NBS-LRR class)          216   2e-81    
ref|XP_008218985.1|  PREDICTED: TMV resistance protein N-like           207   2e-81    
ref|XP_007148814.1|  hypothetical protein PHAVU_005G016500g             217   2e-81    
ref|XP_008222869.1|  PREDICTED: TMV resistance protein N-like           206   3e-81    
ref|XP_004492774.1|  PREDICTED: TMV resistance protein N-like iso...    213   3e-81    
ref|XP_006427002.1|  hypothetical protein CICLE_v10024735mg             219   3e-81    
ref|XP_006427001.1|  hypothetical protein CICLE_v10024735mg             219   3e-81    
ref|XP_009597750.1|  PREDICTED: TMV resistance protein N-like           216   3e-81    
gb|AFC90241.1|  nucleotide-binding site leucine-rich repeat protein     275   4e-81    
ref|XP_004506792.1|  PREDICTED: TMV resistance protein N-like iso...    222   4e-81    
gb|KEH25078.1|  disease resistance protein (TIR-NBS-LRR class)          217   4e-81    
ref|XP_007226605.1|  hypothetical protein PRUPE_ppa023385mg             197   4e-81    
ref|XP_008372681.1|  PREDICTED: TMV resistance protein N-like           286   5e-81    
gb|AFC90338.1|  nucleotide-binding site leucine-rich repeat protein     275   5e-81    
ref|XP_004506794.1|  PREDICTED: TMV resistance protein N-like iso...    222   5e-81    
ref|XP_004288867.1|  PREDICTED: TMV resistance protein N-like           206   5e-81    
gb|KEH29031.1|  disease resistance protein (TIR-NBS-LRR class)          222   5e-81    
emb|CDK13053.1|  TIR-NBS-LRR disease resistance protein                 211   5e-81    
ref|XP_010024513.1|  PREDICTED: TMV resistance protein N-like           207   6e-81    
ref|XP_007029537.1|  TMV resistance protein N, putative                 295   6e-81    
ref|XP_010650310.1|  PREDICTED: TMV resistance protein N-like iso...    206   6e-81    
ref|XP_008232441.1|  PREDICTED: TMV resistance protein N-like           293   6e-81    
gb|KEH29032.1|  disease resistance protein (TIR-NBS-LRR class)          222   6e-81    
ref|XP_008219354.1|  PREDICTED: TMV resistance protein N-like           196   7e-81    
ref|XP_008383781.1|  PREDICTED: TMV resistance protein N-like           207   7e-81    
emb|CDP07826.1|  unnamed protein product                                212   7e-81    
gb|AFC90221.1|  nucleotide-binding site leucine-rich repeat protein     274   7e-81    
ref|XP_010050731.1|  PREDICTED: TMV resistance protein N-like           201   8e-81    
ref|XP_006478372.1|  PREDICTED: TMV resistance protein N-like           205   8e-81    
ref|XP_008219411.1|  PREDICTED: TMV resistance protein N-like           202   9e-81    
ref|XP_007199953.1|  hypothetical protein PRUPE_ppa1027167mg            209   1e-80    
ref|XP_009779815.1|  PREDICTED: TMV resistance protein N-like           210   1e-80    
ref|XP_010024533.1|  PREDICTED: TMV resistance protein N-like           208   1e-80    
ref|XP_008236730.1|  PREDICTED: TMV resistance protein N-like iso...    218   1e-80    
ref|XP_006441726.1|  hypothetical protein CICLE_v10023938mg             217   1e-80    
ref|XP_006598950.1|  PREDICTED: TMV resistance protein N-like iso...    218   1e-80    
ref|XP_006598946.1|  PREDICTED: TMV resistance protein N-like iso...    218   1e-80    
gb|KGN51220.1|  hypothetical protein Csa_5G494390                       214   2e-80    
gb|KEH29015.1|  disease resistance protein (TIR-NBS-LRR class), p...    219   2e-80    
gb|AGC24026.1|  TIR-NB-LRR type resistance protein RGA2                 198   2e-80    
ref|XP_008337420.1|  PREDICTED: TMV resistance protein N-like           216   2e-80    
gb|AFC90242.1|  nucleotide-binding site leucine-rich repeat protein     273   2e-80    
ref|XP_008337093.1|  PREDICTED: TMV resistance protein N-like           206   2e-80    
gb|KEH29013.1|  disease resistance protein (TIR-NBS-LRR class), p...    218   2e-80    
ref|XP_003604857.1|  NBS-LRR resistance protein                         218   2e-80    
gb|KEH25086.1|  disease resistance protein (TIR-NBS-LRR class)          213   3e-80    
gb|KEH29017.1|  disease resistance protein (TIR-NBS-LRR class), p...    218   3e-80    
ref|XP_007212365.1|  hypothetical protein PRUPE_ppa014763mg             276   3e-80    
gb|ACF19650.1|  TIR-NBS-LRR RCT1 resistance protein                     213   3e-80    
gb|AES86804.2|  disease resistance protein (TIR-NBS-LRR class)          213   3e-80    
gb|KEH29014.1|  disease resistance protein (TIR-NBS-LRR class), p...    218   3e-80    
ref|XP_009367964.1|  PREDICTED: TMV resistance protein N-like           209   3e-80    
ref|XP_003604607.1|  TIR-NBS-LRR RCT1 resistance protein                213   4e-80    
ref|XP_007023140.1|  Disease resistance protein                         200   4e-80    
ref|XP_008380645.1|  PREDICTED: TMV resistance protein N-like           210   4e-80    
ref|XP_007199998.1|  hypothetical protein PRUPE_ppa024831mg             214   4e-80    
ref|XP_002272667.2|  PREDICTED: TMV resistance protein N-like iso...    210   4e-80    
ref|XP_010657787.1|  PREDICTED: TMV resistance protein N-like iso...    210   4e-80    
ref|XP_010256316.1|  PREDICTED: TMV resistance protein N-like           213   4e-80    
ref|XP_009758994.1|  PREDICTED: TMV resistance protein N-like iso...    206   4e-80    
ref|XP_010657788.1|  PREDICTED: TMV resistance protein N-like iso...    210   4e-80    
ref|XP_009758995.1|  PREDICTED: TMV resistance protein N-like iso...    206   4e-80    
ref|XP_010027053.1|  PREDICTED: TMV resistance protein N-like           215   6e-80    
emb|CDK13057.1|  TIR-NBS-LRR disease resistance protein                 207   6e-80    
ref|XP_007201560.1|  hypothetical protein PRUPE_ppa017937mg             215   6e-80    
ref|XP_010027028.1|  PREDICTED: TMV resistance protein N-like           204   6e-80    
ref|XP_007226709.1|  hypothetical protein PRUPE_ppa020033mg             202   7e-80    
gb|KEH29016.1|  disease resistance protein (TIR-NBS-LRR class), p...    217   7e-80    
ref|XP_010645853.1|  PREDICTED: TMV resistance protein N-like           195   8e-80    
ref|XP_008236709.1|  PREDICTED: TMV resistance protein N-like           208   8e-80    
emb|CAN64759.1|  hypothetical protein VITISV_033530                     207   8e-80    
gb|AFC90231.1|  nucleotide-binding site leucine-rich repeat protein     271   8e-80    
ref|XP_011004891.1|  PREDICTED: LOW QUALITY PROTEIN: TMV resistan...    207   9e-80    
ref|XP_007134174.1|  hypothetical protein PHAVU_010G025700g             213   9e-80    
ref|XP_010658914.1|  PREDICTED: TMV resistance protein N-like           212   9e-80    
gb|KEH25117.1|  disease resistance protein (TIR-NBS-LRR class)          219   1e-79    
ref|XP_006358560.1|  PREDICTED: TMV resistance protein N-like           291   1e-79    
gb|AGC24030.1|  TIR-NB-LRR type resistance protein RUN1                 197   1e-79    
ref|XP_010661240.1|  PREDICTED: TMV resistance protein N-like iso...    207   1e-79    
ref|XP_009371428.1|  PREDICTED: TMV resistance protein N-like           211   1e-79    
ref|XP_010650202.1|  PREDICTED: TMV resistance protein N-like           196   1e-79    
ref|XP_010050147.1|  PREDICTED: TMV resistance protein N-like           201   1e-79    
ref|XP_007227381.1|  hypothetical protein PRUPE_ppb015618mg             197   1e-79    
ref|XP_009366896.1|  PREDICTED: TMV resistance protein N-like           204   2e-79    
ref|XP_010665208.1|  PREDICTED: TMV resistance protein N-like           199   2e-79    
gb|KGN60910.1|  hypothetical protein Csa_2G022790                       213   2e-79    
ref|XP_008232528.1|  PREDICTED: TMV resistance protein N-like           201   2e-79    
ref|XP_010027025.1|  PREDICTED: TMV resistance protein N-like           209   3e-79    
ref|XP_006466583.1|  PREDICTED: TMV resistance protein N-like           207   3e-79    



>ref|XP_009804941.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
Length=609

 Score =   517 bits (1331),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 291/445 (65%), Positives = 350/445 (79%), Gaps = 18/445 (4%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL+EVA L+GM L +E DGHEA+FIQKII+EI+K+LNRTVLSVPSYTVGL SRV  IN
Sbjct  151   RAALKEVAKLEGMCLAKEVDGHEAKFIQKIIKEILKRLNRTVLSVPSYTVGLESRVKDIN  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEI-PNGQVG  1759
              WL DESS+VG+GVICGLGG+GKTTVAKVAYN NYDRF+GSCFLANVR  SE  PNGQV 
Sbjct  211   SWLLDESSEVGIGVICGLGGIGKTTVAKVAYNSNYDRFDGSCFLANVRDISEKHPNGQVY  270

Query  1758  LQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFS  1579
             LQKQIFE+ILKGR+E I+N DEGI+K+KDAIG+KKVF+VFDDVDQL++LD +IG RDWF 
Sbjct  271   LQKQIFESILKGRKEKIYNADEGIVKMKDAIGNKKVFVVFDDVDQLDVLDSLIGTRDWFY  330

Query  1578  RGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAI  1399
              GSKI+ITTRCE LLK HERH+ +KIKEL ++ESLKLF  YAF QD PLE     S +AI
Sbjct  331   PGSKILITTRCEKLLKAHERHMLFKIKELGEDESLKLFSWYAFSQDHPLEEFKVLSTEAI  390

Query  1398  RHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFV  1219
             +HCGGLPLAL DLGS+LSGR M++WRSKL+KLE I H K+Q+NLEIS N LDD+D+RLF+
Sbjct  391   QHCGGLPLALYDLGSFLSGRDMEIWRSKLQKLEAIPHSKVQKNLEISYNSLDDHDQRLFL  450

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
             LIA  FVGKD+D  I +LE CD HP VGIQNLID SL+++D++NK+MMPQLIQ+MGKEI+
Sbjct  451   LIAASFVGKDKDDVIKILENCDFHPTVGIQNLIDRSLISIDDENKVMMPQLIQDMGKEII  510

Query  1038  RQDSRDDLHTLSKLLDQ------LVSSTESTGNGVVNESASHV----------NSPKRPY  907
             R++S DD   L KLL+Q      L  + E+  NG    SA             N  KRPY
Sbjct  511   RRESPDDPERLCKLLNQWGLSNYLTENNETDANGGDLRSAHPSEDGLVPTLGPNVAKRPY  570

Query  906   SQEFEDNSIIPHQSN-WKRRFMGIF  835
              Q+F + +I+P+  N  KRRF+G+ 
Sbjct  571   YQDFPEIAILPYLGNSLKRRFVGLL  595


 Score =   187 bits (474),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 113/141 (80%), Gaps = 0/141 (0%)
 Frame = -1

Query  2551  SSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgir  2372
             S++ R+ +H FLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEI RGENI++EL++GIR
Sbjct  6     STLTRYSFHVFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIRRGENIESELQKGIR  65

Query  2371  esrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAF  2192
             ES IS+IV SKDYASSRWCLDEL+ I+ RRK EGH V P+FY+V   DVE Q+GSFAEAF
Sbjct  66    ESMISLIVLSKDYASSRWCLDELVNIVDRRKKEGHTVLPVFYTVSPEDVENQTGSFAEAF  125

Query  2191  ERHAKREKMEVEEGRVEWKGK  2129
               H KR   E  E R  W  K
Sbjct  126   VNHEKRGNAETGEKRKVWMEK  146



>ref|XP_010315476.1| PREDICTED: uncharacterized protein LOC101251930 [Solanum lycopersicum]
Length=1850

 Score =   501 bits (1291),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 285/446 (64%), Positives = 351/446 (79%), Gaps = 19/446 (4%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL+EVA L+GM L +E DGHEA+FIQKII+EI+K+LNRTVLSVPSYTVGL +RV  IN
Sbjct  148   RLALKEVAELEGMCLAKEVDGHEAKFIQKIIKEILKRLNRTVLSVPSYTVGLEARVKDIN  207

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEI-PNGQVG  1759
              WLQDESS+VG+G+ICGLGGVGKTTVAKVAYN NYDRF+GSCFLANVR  SE  PNGQV 
Sbjct  208   SWLQDESSEVGIGMICGLGGVGKTTVAKVAYNSNYDRFDGSCFLANVREISEKHPNGQVY  267

Query  1758  LQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFS  1579
             LQKQIFE+ILKGR+E I+N DEGI+K+KDAIG+KKVFIVFDDVDQL++LD +IG RDWF 
Sbjct  268   LQKQIFESILKGRKEKIYNADEGIVKMKDAIGNKKVFIVFDDVDQLDVLDSLIGTRDWFY  327

Query  1578  RGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAI  1399
              GSKI+ITTRCE LLK +ERH+ +KIKEL D+ESLKLF  YAF QD PLE     S +AI
Sbjct  328   PGSKILITTRCEKLLKSYERHMLFKIKELGDDESLKLFSWYAFAQDHPLEEFKMLSTEAI  387

Query  1398  RHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFV  1219
             +HC GLPLAL DLGS+LSGR  D+WRSKL+KLE I H ++Q+NLEIS   LDD+D+RLF+
Sbjct  388   QHCCGLPLALYDLGSFLSGRGTDIWRSKLQKLEAIPHSRVQKNLEISYKSLDDHDRRLFL  447

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
             LI+  FVGKD+D+ I  LE  DLHP VGIQNLID SL+++D++NK+MMP LIQ+MGKEI+
Sbjct  448   LISSLFVGKDKDYVIKFLENGDLHPTVGIQNLIDRSLISIDDENKVMMPPLIQDMGKEII  507

Query  1038  RQDSRDDLH-TLSKLLDQLVSS---TESTGNGV--VNESASHV-----------NSPKRP  910
             R++S+DD    L K L+Q   S   TE++G     V+   +H+           N+ KRP
Sbjct  508   RRESQDDPERLLCKWLNQCGLSHDLTENSGTDADGVDLQGTHLPEDGLVPALGPNAAKRP  567

Query  909   YSQEFEDNSIIPHQSN-WKRRFMGIF  835
             Y Q+F + +++P+  N  KRRF+G+ 
Sbjct  568   YYQDFPEIAVLPYLGNSLKRRFVGLL  593


 Score =   192 bits (489),  Expect(2) = 0.0, Method: Composition-based stats.
 Identities = 101/137 (74%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresri  2360
             R+ +H FLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEI RGENI++EL++GIRES+I
Sbjct  7     RYSFHVFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIRRGENIESELQKGIRESKI  66

Query  2359  siIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHA  2180
             S+IVFSKDYASSRWCLDEL+ IL RRK EGH V P+FY+V   DV+ QSGSFAEAF  H 
Sbjct  67    SLIVFSKDYASSRWCLDELVNILDRRKKEGHTVLPVFYTVSPEDVQNQSGSFAEAFVNHE  126

Query  2179  KREKMEVEEGRVEWKGK  2129
             KR   E  E R EW  K
Sbjct  127   KRGNAESGEKRKEWMEK  143


 Score =   289 bits (740),  Expect(2) = 9e-97, Method: Compositional matrix adjust.
 Identities = 175/366 (48%), Positives = 247/366 (67%), Gaps = 4/366 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             + +L EVA L GMVLQ + DG E+ FIQ+I++ +  +LNR VLSV  + VG+ SRV  IN
Sbjct  753   KTSLTEVADLGGMVLQNQSDGCESRFIQEIVKVVAGRLNRAVLSVALHPVGIDSRVKDIN  812

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+ + +  I G+GG+GK+T+AK AYNLN+D+F+G  FLA+V   SE  +G V L
Sbjct  813   LWLQDGSTSIDMMAIYGMGGLGKSTLAKTAYNLNFDKFDGCSFLADVNKTSERYDGLVSL  872

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  ++L  + E I+N DEG+IKI++AI  +++ +V DDVD  + L+ V+G R+WF  
Sbjct  873   QRQLLSDVLGRKVEKIYNVDEGVIKIQEAIHRRRILLVLDDVDDRDQLNAVLGMREWFYP  932

Query  1575  GSKIIITTRCENLLKGHE--RHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKA  1402
             GSKIIITTR ++L    E      YK+  L+ +ES++LF  +AFG++   E   + + K 
Sbjct  933   GSKIIITTRNQHLFDASEACSCKMYKVMPLNAQESIRLFSWHAFGKEKTPEDHEDLTEKV  992

Query  1401  IRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYD-KRL  1225
             I HC G PLALK LGS L  RS++VW S L KL+ I  +KI   L IS + LDD D +++
Sbjct  993   ILHCKGTPLALKVLGSSLCDRSVEVWESALRKLKAIPDNKILEKLRISYDLLDDDDVQKI  1052

Query  1224  FVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKE  1045
             F+ I C FVGKDRD+A+ +L+ C    VVGIQ L D  L+ +D D KL +  LIQ+MG+E
Sbjct  1053  FLDIVCFFVGKDRDYAVTILDGCGFFSVVGIQILSDRCLIEMDKD-KLKVHSLIQDMGRE  1111

Query  1044  ILRQDS  1027
             I+R +S
Sbjct  1112  IIRLES  1117


 Score = 94.7 bits (234),  Expect(2) = 9e-97, Method: Composition-based stats.
 Identities = 65/137 (47%), Positives = 84/137 (61%), Gaps = 2/137 (1%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresri  2360
             +F YHAFLS       K+F +HL++AL NAGIR F   DE+   E    EL++ I+ESRI
Sbjct  614   QFTYHAFLSL-ATKIGKSFGNHLHSALSNAGIRAF-SVDELDIDEKGCKELQKTIQESRI  671

Query  2359  siIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHA  2180
              I+V SKDY SS  CLDEL+ IL  +K  G  V P+FY V  ++V KQ G F + F  + 
Sbjct  672   LIVVLSKDYTSSERCLDELVFILESKKLFGRFVLPVFYDVDPSEVRKQKGCFEQDFLMYE  731

Query  2179  KREKMEVEEGRVEWKGK  2129
             +R K   EE R+EW  K
Sbjct  732   ERFKSGTEERRLEWLQK  748



>ref|XP_009607719.1| PREDICTED: TMV resistance protein N-like [Nicotiana tomentosiformis]
Length=1896

 Score =   503 bits (1295),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 288/447 (64%), Positives = 345/447 (77%), Gaps = 20/447 (4%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL+EVA L+GM L +E DGHEA+FIQKII+EI+K+L+R VL VPSYTVGL SRV  IN
Sbjct  154   RLALKEVAKLEGMCLAKEVDGHEAKFIQKIIKEILKRLDRMVLCVPSYTVGLESRVKDIN  213

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEI-PNGQVG  1759
              WLQDESS+VG+GVICGLGGVGKTTVAKVAYN NYDRFEGSCFLANVR  SE  PNGQV 
Sbjct  214   SWLQDESSEVGIGVICGLGGVGKTTVAKVAYNSNYDRFEGSCFLANVRDISEKHPNGQVY  273

Query  1758  LQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFS  1579
              QKQIFE+ILKGR+E I+N DEGI+K+KDAIG+KKVFIVFDDV++L++LD +IG RDWF 
Sbjct  274   FQKQIFESILKGRKEKIYNADEGIVKMKDAIGNKKVFIVFDDVEELDVLDSLIGTRDWFY  333

Query  1578  RGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAI  1399
              GSKI+ITTRCE LLK HERH+ +KIKEL D+ESLKLF  YAF QD PLE     S +AI
Sbjct  334   PGSKILITTRCEKLLKAHERHMLFKIKELGDDESLKLFSWYAFAQDHPLEEFKVLSTQAI  393

Query  1398  RHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFV  1219
             +HC GLPLAL DLGS+LSGR M++WRSKL+KLE I   K+Q+NLEIS   LDD+D+RLF+
Sbjct  394   QHCSGLPLALYDLGSFLSGRGMEIWRSKLQKLEAIPDSKVQKNLEISYKSLDDHDQRLFL  453

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
             LIA  FVGKD+D  I +LE CDLHP VGIQNLID SL+++D++NK+MMPQLIQ+MGKEI+
Sbjct  454   LIASFFVGKDKDDVIKILENCDLHPTVGIQNLIDRSLISIDDENKVMMPQLIQDMGKEII  513

Query  1038  RQDSRDDLHT--LSKLLDQ------LVSSTESTGNGVVNESASHV----------NSPKR  913
             R++S DD     L KLL+Q      L  + E   NG    SA             N  KR
Sbjct  514   RRESADDPEPERLCKLLNQWGLSNYLTENNEIAANGGDLPSAHTSEDGLVPALGPNVAKR  573

Query  912   PYSQEFEDNSIIPHQSN-WKRRFMGIF  835
             PY Q+F + +I+P+  N  KRRF+G+ 
Sbjct  574   PYYQDFPEIAILPYLGNSLKRRFVGLL  600


 Score =   185 bits (469),  Expect(2) = 0.0, Method: Composition-based stats.
 Identities = 97/137 (71%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresri  2360
             R+ +H FLSFRGEDTRKNFTDHLY+ALINAGIRTFRDDDEI RGENI++EL++GIRES+I
Sbjct  13    RYSFHVFLSFRGEDTRKNFTDHLYSALINAGIRTFRDDDEIRRGENIESELQKGIRESKI  72

Query  2359  siIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHA  2180
             S+IV SKDYASSRWCLDEL+ I+ RRK EGH V P+FY+V   DVE Q+GSFAEAF  H 
Sbjct  73    SLIVLSKDYASSRWCLDELVNIVVRRKKEGHTVLPVFYTVSPEDVENQTGSFAEAFVNHE  132

Query  2179  KREKMEVEEGRVEWKGK  2129
             KR   E  E R  W  K
Sbjct  133   KRGNAETGEKRKVWMEK  149


 Score =   294 bits (752),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 177/366 (48%), Positives = 248/366 (68%), Gaps = 4/366 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             + AL EVA L GMVLQ + DG E++FIQ+I++ +  KLNR VLSV  + VG+ SRV  IN
Sbjct  793   KAALTEVADLGGMVLQNKSDGCESKFIQEIVKVVAGKLNRAVLSVALHPVGIDSRVRDIN  852

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+ + +  I G+GG+GKTT+AK AYNLN+D+F+GS FLA+V   SE  +G V L
Sbjct  853   LWLQDGSTSIDIMAIYGMGGIGKTTLAKTAYNLNFDKFDGSSFLADVNKTSERHDGLVSL  912

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  N+L  + E I+N DEG+ KI++AI  +++ +V DDV+  + L+VV+G R+WF  
Sbjct  913   QRQLLSNVLGKKVEKIYNVDEGVSKIQEAIRCRRILLVLDDVEDRDQLNVVLGMREWFYP  972

Query  1575  GSKIIITTRCENLLKGHE--RHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKA  1402
             GSKIIITTR + L    E  R   YK+  L+ +ES+++F  YAFG++ P E   + S   
Sbjct  973   GSKIIITTRNQRLFDASEVYRCKMYKVTPLNAQESIRIFSWYAFGKEQPSEDHKDLSENV  1032

Query  1401  IRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLN-PLDDYDKRL  1225
             I HC G+PLALK LGS L  RS++VW+  L KL+ I  +KI   L IS +  LDD  + L
Sbjct  1033  ILHCKGIPLALKVLGSSLCDRSIEVWQCALRKLKAIPDNKILEKLRISYDLLLDDDVQNL  1092

Query  1224  FVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKE  1045
             F+ I C FVGKD+D+A+ +L+ C    VVG++ L D  L+ +D D KL +  LIQ+MG+E
Sbjct  1093  FLDIVCFFVGKDKDYAVTILDGCGFFSVVGLEILSDRCLIEMDKD-KLKVHSLIQDMGRE  1151

Query  1044  ILRQDS  1027
             I+R +S
Sbjct  1152  IIRLES  1157


 Score = 93.2 bits (230),  Expect(2) = 2e-97, Method: Composition-based stats.
 Identities = 64/140 (46%), Positives = 86/140 (61%), Gaps = 2/140 (1%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresri  2360
             +F YHAFLS        +F DHL +AL NAGIRTFR D E+   E    EL++ I+ESRI
Sbjct  654   QFAYHAFLSL-ATKIGMSFGDHLLSALSNAGIRTFRVD-ELEIDEKGCKELQKTIQESRI  711

Query  2359  siIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHA  2180
              ++VF+K+Y SS  CLDEL+ IL  +++    V P+FY V  ++V KQ GSF + F  + 
Sbjct  712   LVVVFTKEYTSSERCLDELVFILESKRAFRRFVLPVFYDVDPSEVRKQKGSFEQDFLMYE  771

Query  2179  KREKMEVEEGRVEWKGKGGE  2120
             +R K   E  R+EW  K  E
Sbjct  772   ERFKSGTEGRRLEWLQKVKE  791



>gb|KDP27361.1| hypothetical protein JCGZ_20185 [Jatropha curcas]
Length=1171

 Score =   343 bits (880),  Expect(2) = 6e-134, Method: Compositional matrix adjust.
 Identities = 211/442 (48%), Positives = 290/442 (66%), Gaps = 25/442 (6%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+ALREVA + G          + +FIQ I++E+  KLNR VL+V  Y VG+ SR+  IN
Sbjct  153   RKALREVADMGG----------KPQFIQNIVKEVGNKLNRIVLNVAPYLVGIDSRIADIN  202

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+DVG+  I G+GG+GKTT+AK+ YN NYD+F+G+ FLANVR  SE  NG V L
Sbjct  203   WWLQDVSNDVGIATIYGVGGIGKTTIAKIVYNQNYDKFDGASFLANVREISEKSNGLVRL  262

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  ++LKG+   I+N DEGIIKI+DAI  K++ +V DD+DQL+  + +IG  +WFS 
Sbjct  263   QRQLLSDLLKGKTNKIYNVDEGIIKIRDAICRKRILLVLDDLDQLDQFNAIIGMWEWFSP  322

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSK+IITTR E LL+  E    +++ ELDD+E+L+LF  +AFGQD P E   + S +A+ 
Sbjct  323   GSKLIITTRHERLLRVREVRNMFRVHELDDKEALQLFSWHAFGQDHPTEDFKKQSKRAVD  382

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HC GLPLAL+ LGS LSG+S DVW S L+KLE I   KIQ+ L++S + L DD+DK LF+
Sbjct  383   HCSGLPLALQVLGSSLSGKSTDVWESALQKLEAIADSKIQKILKVSFDSLQDDHDKNLFL  442

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              +AC F G D+D+  ++L+ C  + VVGI NLI   L+T++  NKLMM QL+++MG+EI+
Sbjct  443   DVACFFTGMDKDYVFSILDGCKFYTVVGINNLIGRCLLTINEANKLMMHQLVRDMGREIV  502

Query  1038  RQDSRDDLHTLSKLL---DQLVSSTESTGNGVVNESASHVNSPKRPYS-------QEFED  889
             RQ+S +D    S+L    D      E+TG   V     ++   K   S         FED
Sbjct  503   RQESPEDPGKRSRLWHNKDAFNVLRENTGTETVKGLILNLQMLKEDNSGDTNAEINHFED  562

Query  888   N---SIIPHQSN-WKRRFMGIF  835
             +   S +P Q N  KRR +G F
Sbjct  563   SGHESTLPDQENDSKRRHLGFF  584


 Score =   164 bits (416),  Expect(2) = 6e-134, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 109/151 (72%), Gaps = 5/151 (3%)
 Frame = -1

Query  2587  MEAEARTQESGISSVP---RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEI  2417
             M A  R QE   SS     R+ YH FLSFRG DTRKNFTDHLYTAL+ AGI TFRDDDEI
Sbjct  1     MAAAPRNQEPSTSSSKPSFRWTYHVFLSFRGGDTRKNFTDHLYTALVQAGIHTFRDDDEI  60

Query  2416  GRGENIDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVG  2237
              RGENI+ E+ + I+ESRIS+IV SKDYASSRWCLDEL+ I+ RR++ GH V P+FY V 
Sbjct  61    ERGENIEQEIEKAIQESRISVIVLSKDYASSRWCLDELVMIMERRRTVGHIVVPVFYDVD  120

Query  2236  RADVEKQSGSFAEAFERH--AKREKMEVEEG  2150
                V  Q GS+  AF RH  A +E+ME+ +G
Sbjct  121   PLQVGNQIGSYGAAFARHEIAFKEEMEMVDG  151



>ref|XP_007220769.1| hypothetical protein PRUPE_ppa024626mg [Prunus persica]
 gb|EMJ21968.1| hypothetical protein PRUPE_ppa024626mg [Prunus persica]
Length=1078

 Score =   341 bits (874),  Expect(2) = 9e-133, Method: Compositional matrix adjust.
 Identities = 198/366 (54%), Positives = 260/366 (71%), Gaps = 1/366 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL EVA L GMVLQ ECDGHEA+FI+KI++ I  KL+RT LSV  Y +G+ SRV +IN
Sbjct  149   RAALAEVADLAGMVLQNECDGHEAKFIKKIVKVIEGKLSRTPLSVAPYLIGMDSRVKEIN  208

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD SSDVG+ +I G+GG+GKTT+A+V YN  + RFEG  FL N+R  SE P+G V +
Sbjct  209   LWLQDGSSDVGIFLIYGIGGIGKTTIAQVVYNSKFSRFEGRSFLENIREISEGPDGLVQM  268

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +IL GR   I +  EGIIKIKD I  KKV +V DDVD    LDVV+  R WF  
Sbjct  269   QVQLLSDILGGRTVKIHSVSEGIIKIKDVISCKKVLLVLDDVDHTNQLDVVLRMRKWFYP  328

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTRC  LLK H+    + ++ L+  ESL+LF  +AFGQ+ P+E  ++ S K + 
Sbjct  329   GSKIIITTRCVGLLKAHQDVKVHNVETLNHVESLELFSCHAFGQNYPVEGYVKLSEKVVN  388

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             H GGLPLALK LGS LSG+S DVW S L+KLE I +  I   L IS + L DD+D++LF+
Sbjct  389   HSGGLPLALKILGSSLSGQSTDVWESALKKLEVIPNGDIVNKLRISYDSLQDDHDQQLFL  448

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F+G ++D  +N+L+ CD   +VGIQNL+D  L+T+D  NK+ M Q+I++MG+EI+
Sbjct  449   HIACFFIGNEKDVTVNILDGCDFFTIVGIQNLLDRCLLTIDEYNKVKMHQMIRDMGREIV  508

Query  1038  RQDSRD  1021
             RQ+S++
Sbjct  509   RQESKE  514


 Score =   163 bits (412),  Expect(2) = 9e-133, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 109/155 (70%), Gaps = 1/155 (1%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A  R QE+  S      YH FLSFRGEDTRK FTDH+YTA +NAG++TFRDDDE+ RGE+
Sbjct  2     ALVRAQEASSSDTCGCSYHVFLSFRGEDTRKTFTDHIYTAFVNAGLQTFRDDDELERGED  61

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVE  2222
             I  EL + I+ SR S+IVFSKDYASS+WCLDEL+ IL R+++  H V P+FY +  ++V 
Sbjct  62    IKPELEKAIQHSRSSVIVFSKDYASSKWCLDELVMILQRKRTSDHVVLPVFYDIDPSEVR  121

Query  2221  KQSGSFAEAFERHAKREKMEVEEGRVEWKGKGGEV  2117
             KQ+GSFA+AF  H K   +  ++ +  W+    EV
Sbjct  122   KQTGSFAKAFAGHQKNRSLNKDKVK-GWRAALAEV  155



>ref|XP_002519358.1| leucine-rich repeat-containing protein, putative [Ricinus communis]
 gb|EEF42975.1| leucine-rich repeat-containing protein, putative [Ricinus communis]
Length=1108

 Score =   335 bits (860),  Expect(2) = 2e-132, Method: Compositional matrix adjust.
 Identities = 186/367 (51%), Positives = 267/367 (73%), Gaps = 4/367 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R ALREVA + GMVL+     H+++FIQ I++E+  KLNR VL+V SY VG+ SR+  IN
Sbjct  152   RAALREVADMGGMVLENR---HQSQFIQNIVKEVGNKLNRVVLNVASYLVGIDSRIADIN  208

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD+S DVG+  I G+GG+GKTT+AK+ +N N+D+F+G+ FLANVR  SE  NG V L
Sbjct  209   SWLQDDSKDVGIATIYGVGGIGKTTLAKIIFNQNFDKFDGASFLANVRETSEQSNGLVRL  268

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+++  ++LKG+   I+N DEGIIKIKDAI  ++V ++ DD+DQL+  + +IG ++WF  
Sbjct  269   QRKVLSDLLKGKTSKIYNVDEGIIKIKDAICRRRVLLILDDLDQLDQFNSIIGMQEWFFP  328

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKII TTR E LL+ HE    +++ ELD  ESL+LF  ++FGQD P+E   + S +A+ 
Sbjct  329   GSKIIATTRHERLLRAHEVSKLFRVNELDSNESLQLFSWHSFGQDHPVEVFEQQSKRAVD  388

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
              C GLPLAL+ LGS LSG+S++VW S L+KLE +   KIQ+ L +S + L DD+DK LF+
Sbjct  389   LCSGLPLALQVLGSSLSGKSIEVWESALQKLEAVPDSKIQKILRVSYDSLEDDHDKNLFL  448

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F G ++++ I++L+ C  + VVGI NLI   L+T++  NKL++ QL+++MG+EI+
Sbjct  449   DIACFFTGMEKNYVISILQGCKFYAVVGINNLIGRCLLTINEGNKLIIHQLLRDMGREIV  508

Query  1038  RQDSRDD  1018
             RQ+S +D
Sbjct  509   RQESPED  515


 Score =   167 bits (424),  Expect(2) = 2e-132, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 108/140 (77%), Gaps = 5/140 (4%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             YH FLSFRG DTRKNFTDHLYTALI AGI TFRDDDEI RGENI++E++  IRES+IS++
Sbjct  22    YHVFLSFRGGDTRKNFTDHLYTALIQAGIHTFRDDDEIKRGENIESEIKNAIRESKISVL  81

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAK--  2177
             V SKDYASSRWCLDEL  I+ RR+++GH V P+FY     +V KQ GS+ EAFERH K  
Sbjct  82    VLSKDYASSRWCLDELAMIMERRRTDGHIVVPVFYDADPTEVGKQIGSYGEAFERHEKVF  141

Query  2176  REKMEVEEGRVEWKGKGGEV  2117
             +E+ME+ EG   W+    EV
Sbjct  142   KEEMEMVEG---WRAALREV  158



>ref|XP_006358468.1| PREDICTED: TMV resistance protein N-like isoform X2 [Solanum 
tuberosum]
Length=386

 Score =   410 bits (1055),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 223/364 (61%), Positives = 278/364 (76%), Gaps = 20/364 (5%)
 Frame = -2

Query  1869  KTTVAKVAYNLNYDRFEGSCFLANVRAASEI-PNGQVGLQKQIFENILKGREEIIFNTDE  1693
             KTTVAKVAYN NYDRF+GSCFLANVR  SE  PNGQV LQKQIFE+ILKGR++ I+N DE
Sbjct  10    KTTVAKVAYNSNYDRFDGSCFLANVREISEKHPNGQVYLQKQIFESILKGRKDKIYNADE  69

Query  1692  GIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSRGSKIIITTRCENLLKGHERHL  1513
             GI+K+KDAIG+KKVFIVFDDVDQL++LD +IG RDWF  GSKI+ITTRCE LLK +ERH+
Sbjct  70    GIVKMKDAIGNKKVFIVFDDVDQLDVLDSLIGTRDWFYPGSKILITTRCEKLLKSYERHM  129

Query  1512  QYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIRHCGGLPLALKDLGSYLSGRSM  1333
              +KIKEL  +ESLKLF  YAF QD PLE     S +AI+HCGGLPLAL DLGS+LSGR M
Sbjct  130   LFKIKELGVDESLKLFSWYAFAQDYPLEEFKMLSTEAIQHCGGLPLALYDLGSFLSGRDM  189

Query  1332  DVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFVLIACHFVGKDRDFAINVLEKCD  1153
             ++WRSKL+KLE I H ++Q+NLEIS   LDD+D+RLF+LIA  FVGKD+D+ I  LE  D
Sbjct  190   EIWRSKLQKLEAIPHSRVQKNLEISYKSLDDHDQRLFLLIASLFVGKDKDYVIKFLENSD  249

Query  1152  LHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEILRQDSRDDLHTLSKLLDQ-----  988
             LHP VGIQNLID SL+++D++NK+MMP LIQ+MGKEI+R++S DD   L KLL+Q     
Sbjct  250   LHPTVGIQNLIDRSLISIDDENKVMMPPLIQDMGKEIIRRESPDDPERLCKLLNQCGLSN  309

Query  987   -LVSSTESTGNGVVNESASHV-----------NSPKRPYSQEFEDNSIIPHQSN-WKRRF  847
              L  + E+  +G V+   +H+           N  KRPY Q+F + +++P+  N  KRRF
Sbjct  310   CLTENNETDADG-VDLPGTHLPEDGLVPALGPNGAKRPYYQDFPEIAVLPYLGNSLKRRF  368

Query  846   MGIF  835
             +G+ 
Sbjct  369   VGLL  372



>ref|XP_006358467.1| PREDICTED: TMV resistance protein N-like isoform X1 [Solanum 
tuberosum]
Length=387

 Score =   410 bits (1054),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 222/364 (61%), Positives = 276/364 (76%), Gaps = 19/364 (5%)
 Frame = -2

Query  1869  KTTVAKVAYNLNYDRFEGSCFLANVRAASEI-PNGQVGLQKQIFENILKGREEIIFNTDE  1693
             KTTVAKVAYN NYDRF+GSCFLANVR  SE  PNGQV LQKQIFE+ILKGR++ I+N DE
Sbjct  10    KTTVAKVAYNSNYDRFDGSCFLANVREISEKHPNGQVYLQKQIFESILKGRKDKIYNADE  69

Query  1692  GIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSRGSKIIITTRCENLLKGHERHL  1513
             GI+K+KDAIG+KKVFIVFDDVDQL++LD +IG RDWF  GSKI+ITTRCE LLK +ERH+
Sbjct  70    GIVKMKDAIGNKKVFIVFDDVDQLDVLDSLIGTRDWFYPGSKILITTRCEKLLKSYERHM  129

Query  1512  QYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIRHCGGLPLALKDLGSYLSGRSM  1333
              +KIKEL  +ESLKLF  YAF QD PLE     S +AI+HCGGLPLAL DLGS+LSGR M
Sbjct  130   LFKIKELGVDESLKLFSWYAFAQDYPLEEFKMLSTEAIQHCGGLPLALYDLGSFLSGRDM  189

Query  1332  DVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFVLIACHFVGKDRDFAINVLEKCD  1153
             ++WRSKL+KLE I H ++Q+NLEIS   LDD+D+RLF+LIA  FVGKD+D+ I  LE  D
Sbjct  190   EIWRSKLQKLEAIPHSRVQKNLEISYKSLDDHDQRLFLLIASLFVGKDKDYVIKFLENSD  249

Query  1152  LHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEILRQDSRDDLHTLSKLLDQ-----  988
             LHP VGIQNLID SL+++D++NK+MMP LIQ+MGKEI+R++S DD   L KLL+Q     
Sbjct  250   LHPTVGIQNLIDRSLISIDDENKVMMPPLIQDMGKEIIRRESPDDPERLCKLLNQCGLSN  309

Query  987   -LVSSTESTGNGVVNESASHV-----------NSPKRPYSQEFEDNSIIPHQSN-WKRRF  847
              L  + + T    V+   +H+           N  KRPY Q+F + +++P+  N  KRRF
Sbjct  310   CLTENNQETDADGVDLPGTHLPEDGLVPALGPNGAKRPYYQDFPEIAVLPYLGNSLKRRF  369

Query  846   MGIF  835
             +G+ 
Sbjct  370   VGLL  373



>ref|XP_009348861.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1171

 Score =   340 bits (871),  Expect(2) = 1e-130, Method: Compositional matrix adjust.
 Identities = 200/366 (55%), Positives = 260/366 (71%), Gaps = 1/366 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL EVA L GMVLQ E DGHEA+FI+KI++ I  KL+RT LSV  Y VG+ SRV +I+
Sbjct  147   RAALAEVADLAGMVLQNENDGHEAKFIKKIVKVIEAKLSRTPLSVAPYLVGINSRVKEIS  206

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD SS+VG+ VICG+GG+GKTT+A+V YN N+ RFEG  FL N+R  SE PNG V +
Sbjct  207   LWLQDRSSNVGIFVICGIGGIGKTTIAQVVYNSNFSRFEGRSFLENIREISERPNGLVQV  266

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +IL GRE  I +  EGIIKIKD I  KKV +V DDVD    LD ++  RDWF  
Sbjct  267   QMQLLYDILGGREVKIHSISEGIIKIKDVISCKKVLLVLDDVDHTSQLDAILRMRDWFHP  326

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR   LLK  +    + ++ L+D ESL+LF  +AFGQD P++  +E S + +R
Sbjct  327   GSKIIITTRRAGLLKSQKAVKVHNVQTLNDVESLELFSWHAFGQDHPIDGYIELSERVVR  386

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             H GGLPLAL+  GS LSG+++DVW S L+KLE I +  I   L++S   L DD+DK LF+
Sbjct  387   HSGGLPLALQVFGSSLSGQNLDVWESALKKLEAIPNSDIMNKLKLSYESLQDDHDKNLFL  446

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F+GKD+D  + +L+ C    +VGIQNLID  LVTVD  NK+ M Q+I++MG+EI+
Sbjct  447   HIACFFIGKDKDVIVKILDGCGFFTIVGIQNLIDRCLVTVDEYNKVKMHQMIRDMGREIV  506

Query  1038  RQDSRD  1021
             RQ+S++
Sbjct  507   RQESKE  512


 Score =   157 bits (397),  Expect(2) = 1e-130, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 103/139 (74%), Gaps = 3/139 (2%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             YH FLSFRGEDTRK FTDHLY A ++AG+RTFRDDDE+ RGE+I +EL   I+ SR S+I
Sbjct  17    YHVFLSFRGEDTRKTFTDHLYEAFVSAGLRTFRDDDELERGEDIKSELPIAIQHSRSSVI  76

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKRE  2171
             VFSKDYASS+WCLDEL+ IL R+K+  + V P+FY +  ++V KQ+GSFA+AF RH K  
Sbjct  77    VFSKDYASSKWCLDELVMILERKKASKNIVIPVFYDIDPSEVRKQTGSFAKAFSRHQKNR  136

Query  2170  KMEVEEGRVE-WKGKGGEV  2117
              +   + RV  W+    EV
Sbjct  137   SL--SKDRVNGWRAALAEV  153



>ref|XP_008232626.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1177

 Score =   333 bits (855),  Expect(2) = 1e-128, Method: Compositional matrix adjust.
 Identities = 196/366 (54%), Positives = 257/366 (70%), Gaps = 1/366 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL EVA L GMVLQ ECDGHEA+FI+KI++ I  KL+RT LSV  Y +G+ SRV +IN
Sbjct  149   RAALAEVADLAGMVLQNECDGHEAKFIKKIVKVIEGKLSRTPLSVAPYLIGIDSRVKEIN  208

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD SSDVG+ VI G+GG+GKTT+A+V YN N+ RFEG  FL ++R  SE PNG V +
Sbjct  209   LWLQDGSSDVGIFVIYGIGGIGKTTIAQVVYNSNFSRFEGRSFLESIREISEGPNGLVQM  268

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +IL GR   I +  EGIIKIKD I  KKV +V DDVD    LD V+  R WF  
Sbjct  269   QVQLLSDILGGRTVKIRSVSEGIIKIKDVISCKKVLLVLDDVDHTNQLDAVLRMRKWFYP  328

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTRC  LLK H+    + ++ L+  ESL+LF  +AFGQ+ P+E  ++ S K + 
Sbjct  329   GSKIIITTRCVGLLKAHQDVKVHNVETLNHVESLELFSCHAFGQNYPVEGYVKLSEKVVN  388

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             H GGLPLALK LGS LSG+S+ VW S L+KLE I +  I   L IS + L DD+D++LF+
Sbjct  389   HSGGLPLALKILGSSLSGQSIHVWESALKKLEVIPNGDIVNKLRISYDSLQDDHDQQLFL  448

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F+G ++D  + +L+ CD   +V IQNLID  L+T+D  NK+ M Q+I++MG+EI+
Sbjct  449   HIACFFIGNEKDVTVKILDGCDFFTIVAIQNLIDRCLLTIDEHNKVKMHQMIRDMGREIV  508

Query  1038  RQDSRD  1021
             R +S++
Sbjct  509   RLESKE  514


 Score =   157 bits (396),  Expect(2) = 1e-128, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 109/156 (70%), Gaps = 3/156 (2%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A  R QE   +      YH FLSFRGEDTRK FTDH+YTA ++AG++TFRDDDE+ RGE+
Sbjct  2     ALVRAQEDSSADTFGCRYHVFLSFRGEDTRKTFTDHIYTAFVDAGLQTFRDDDELERGED  61

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVE  2222
             I  EL + I+ SR S+IVFSKDYASS+WCLDEL+ IL R+++  H V P+FY +  ++V 
Sbjct  62    IKPELEKAIQHSRSSVIVFSKDYASSKWCLDELVMILQRKRTSDHVVLPVFYDIDPSEVR  121

Query  2221  KQSGSFAEAFERHAKREKMEVEEGRVE-WKGKGGEV  2117
             KQ+GSFA+AF  H K     V + +V+ W+    EV
Sbjct  122   KQTGSFAKAFAGHQKNR--SVNKDKVKGWRAALAEV  155



>ref|XP_011022865.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=1105

 Score =   328 bits (842),  Expect(2) = 1e-127, Method: Compositional matrix adjust.
 Identities = 192/374 (51%), Positives = 262/374 (70%), Gaps = 4/374 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL+EVA L GMVLQ   DG+E++FIQ +++E+  +LNR +L+V  Y VG+ SRV  IN
Sbjct  149   RTALKEVADLGGMVLQ---DGYESKFIQNVVKEVGNRLNRKILNVEPYLVGIDSRVRLIN  205

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WL+D S DVG+  I G+GG+GKTT+AK  YN N   FEGS FLAN+R  SE PNG V L
Sbjct  206   LWLRDGSDDVGIATIYGIGGIGKTTIAKRVYNQNCHNFEGSSFLANIREISEQPNGLVRL  265

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  ++ K +     + DEGII IKDAI  K+V +V DDVDQL+ +  +IG R WF +
Sbjct  266   QRQLVSDVTKRKAGKFHSIDEGIITIKDAICCKRVLLVLDDVDQLDQVSAIIGMRQWFCQ  325

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR E+LL+  E  + +K+++L++ ESL+LF  +AFGQD PL     YS   + 
Sbjct  326   GSKIIITTRHEHLLRVDEVSVMFKVQQLNENESLQLFSWHAFGQDQPLHGYEMYSENVVN  385

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HCGG+PLAL+ LGS L G+ +++WR  L++ E I   KIQ+ L  S + L DD DK LF+
Sbjct  386   HCGGIPLALQVLGSSLHGQPVELWRRALQEPEAIDDGKIQKILRRSFDSLQDDRDKNLFL  445

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F+GKD+D+   ++E CD + V+GIQ L+D  L+T+D DN LMM Q +++MG+EI+
Sbjct  446   DIACFFIGKDKDYLDRIVEGCDFYRVLGIQKLVDRCLITIDKDNILMMHQSLRDMGREIV  505

Query  1038  RQDSRDDLHTLSKL  997
             RQ+S DDL   S+L
Sbjct  506   RQESPDDLGKRSRL  519


 Score =   158 bits (400),  Expect(2) = 1e-127, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 111/157 (71%), Gaps = 5/157 (3%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A A  Q+   SS  R  Y  FLSFRGEDTRK FTDHL+TAL+ AG  TFRDDDEI RGEN
Sbjct  2     ATAIPQDDASSSKYRCTYQVFLSFRGEDTRKKFTDHLHTALVQAGFHTFRDDDEIQRGEN  61

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEG-HAVFPIFYSVGRADV  2225
             I+ E+++ I+ESR+SIIVFSKDYASSRWCLDEL+ I+  +K  G H V PIFY +  + V
Sbjct  62    IEIEIQKAIKESRMSIIVFSKDYASSRWCLDELVMIMEHKKLGGWHVVLPIFYDLDPSHV  121

Query  2224  EKQSGSFAEAFERHAKREKMEVEEGRVE-WKGKGGEV  2117
               Q+GSFAEAF RH +R K    E RVE W+    EV
Sbjct  122   RNQTGSFAEAFVRHEERFK---NEDRVEGWRTALKEV  155



>ref|XP_008232446.1| PREDICTED: uncharacterized protein LOC103331589 [Prunus mume]
Length=1413

 Score =   332 bits (852),  Expect(2) = 1e-127, Method: Compositional matrix adjust.
 Identities = 193/368 (52%), Positives = 259/368 (70%), Gaps = 3/368 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASR--VGK  1942
             R+AL+EVA L GMVLQ + DGHE++FI KI++ I K L R  LSVP + +G  S   V K
Sbjct  148   RKALKEVADLGGMVLQNQADGHESKFINKIVQVIGKTLRRRPLSVPHFVIGKHSLDLVNK  207

Query  1941  INKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQV  1762
             +N WLQD S DVG+ VI G+ G+GKTT+AK  YN NY RFEG  FL N++  S+ PNG V
Sbjct  208   LNLWLQDGSDDVGILVIYGMSGIGKTTIAKRVYNSNYGRFEGRSFLENIKRVSQQPNGLV  267

Query  1761  GLQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWF  1582
              LQ Q+  ++LKGR+  I +  EG+ +I+DAI SKK  +V DDVD ++ LD V   +D F
Sbjct  268   QLQTQLLSDVLKGRKMKISSVSEGLTEIEDAISSKKALLVLDDVDHMDQLDAVFRMKDQF  327

Query  1581  SRGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKA  1402
               GSKIIITTR   LL+ H+    +K++ LDD+ESL+LF  +AFGQD P+E  +EYS K 
Sbjct  328   CPGSKIIITTRHARLLRAHQVTKMHKVETLDDKESLELFSWHAFGQDHPIEGYIEYSQKI  387

Query  1401  IRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRL  1225
             + HC GLPLALK LGS L G S+DVW+S LEKLE I + +I   L +S + L DD+D+ L
Sbjct  388   VGHCAGLPLALKVLGSSLLGESIDVWKSALEKLEAIPNGEIVNKLRVSYDSLQDDHDRNL  447

Query  1224  FVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKE  1045
             F+ IAC F+GKD+D+ +N+L+ CD + +VGIQNLID  LV +D  +K+ M  LI+ MG+E
Sbjct  448   FLHIACFFIGKDKDYIVNILDGCDFYTLVGIQNLIDRCLVIIDGWDKVQMHNLIRGMGRE  507

Query  1044  ILRQDSRD  1021
             I+R +S++
Sbjct  508   IVRLESKE  515


 Score =   154 bits (389),  Expect(2) = 1e-127, Method: Composition-based stats.
 Identities = 83/138 (60%), Positives = 99/138 (72%), Gaps = 4/138 (3%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             YH FLSFRG+DTRK FTDHLYTAL+NAG RTFRDDDE+ RGE I  EL++ I+ SR S+I
Sbjct  21    YHVFLSFRGQDTRKTFTDHLYTALVNAGFRTFRDDDEVERGEGIKPELQKAIKHSRTSVI  80

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKRE  2171
             VFSK+YASSRWCLDEL+ I   R S  H VFP+FY V  +DV  Q+GS A+AF RH   +
Sbjct  81    VFSKNYASSRWCLDELVMI-HERLSADHVVFPVFYDVDPSDVRNQTGSLAKAFARH---Q  136

Query  2170  KMEVEEGRVEWKGKGGEV  2117
             K +      EW+    EV
Sbjct  137   KTQSSNKVKEWRKALKEV  154


 Score =   328 bits (840),  Expect(2) = 2e-92, Method: Compositional matrix adjust.
 Identities = 194/367 (53%), Positives = 259/367 (71%), Gaps = 2/367 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL EVA L GMVLQ + DGHE++FI KI++ I +KL R  LSVP   +G+ SRV ++N
Sbjct  1011  REALAEVADLAGMVLQNQADGHESKFINKIVQVIGEKLRRRPLSVPHIMIGMHSRVNELN  1070

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S DVG+ VI G+ G+GKTT+AK  YN N+ RFEGS FL N+R  S++PNG V +
Sbjct  1071  LWLQDGSDDVGILVIYGMSGIGKTTIAKSVYNTNFRRFEGSSFLENIREISQLPNGLVQI  1130

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +IL GR+  I +  +G+ +I+DAI SKKVF+V DDVD +  LDVV+G +D F  
Sbjct  1131  QIQLLSDILYGRKVKIHSVSKGMTEIEDAISSKKVFLVLDDVDHISQLDVVLGMKDKFYP  1190

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR   LLK H+    + +  L  EESL+LF  +AFGQD P+E  +E+S K   
Sbjct  1191  GSKIIITTRRAGLLKAHQVTKVHAVGTLTREESLELFSWHAFGQDHPIEDYIEFSEKLAD  1250

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HCGGLPLAL+ LGS L G S+ VW+S LEKL+ I + +I   L +S + L DD+D++LF+
Sbjct  1251  HCGGLPLALQVLGSSLLGESIGVWKSALEKLKVIPNGEIVNKLRVSYDSLQDDHDRKLFL  1310

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVT-VDNDNKLMMPQLIQNMGKEI  1042
              IAC F+GKD+D+   +L+ CD + +VGIQNLID  LVT VD  +K+ M  LI+ MG+EI
Sbjct  1311  HIACFFIGKDKDYIAKILDGCDFYTIVGIQNLIDRCLVTIVDGWDKVQMHDLIRGMGREI  1370

Query  1041  LRQDSRD  1021
             +R +S +
Sbjct  1371  VRLESNE  1377


 Score = 42.0 bits (97),  Expect(2) = 2e-92, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = -1

Query  2278  SEGHAVFPIFYSVGRADVEKQSGSFAEAFERH  2183
             S  H + P+FY V  +DV KQ+GS A+AF RH
Sbjct  967   SADHVILPVFYDVDPSDVRKQTGSLAKAFVRH  998



>ref|XP_002309943.2| hypothetical protein POPTR_0007s04750g [Populus trichocarpa]
 gb|EEE90393.2| hypothetical protein POPTR_0007s04750g [Populus trichocarpa]
Length=1105

 Score =   324 bits (831),  Expect(2) = 2e-127, Method: Compositional matrix adjust.
 Identities = 190/374 (51%), Positives = 259/374 (69%), Gaps = 4/374 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL+EVA L GMVLQ   DG+E++FIQ +++E+  +LNR +L+V  Y VG+ SRV  IN
Sbjct  149   RMALKEVADLGGMVLQ---DGYESKFIQNVVKEVGNRLNRKILNVEPYLVGIDSRVRLIN  205

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WL+D S DVG+  I G+GG+GKTT+AK  YN N   FEGS FLAN+R  SE PNG V L
Sbjct  206   LWLRDGSDDVGIATIYGIGGIGKTTIAKRVYNQNCHNFEGSSFLANIREISEQPNGLVRL  265

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+  ++ K +     + DEGIIKIKDA   K+V ++ DDVDQL+ +  +IG R WF +
Sbjct  266   QKQLVSDVTKRKAGKFHSIDEGIIKIKDAFCCKRVLLILDDVDQLDQVSAIIGMRQWFYQ  325

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR E LL+  E  + +K+++L++ ESL+LF  +AFGQ+ PL     YS   + 
Sbjct  326   GSKIIITTRHERLLRADEVSVMFKVQQLNENESLQLFSWHAFGQNQPLHGYEMYSENVVN  385

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HCGG+PLAL+ LGS L G+ + +WR  L++ E I   KIQ+ L  S + L DD DK LF+
Sbjct  386   HCGGIPLALQVLGSSLHGQPVKLWRRALQEPEAIDDGKIQKILRRSFDSLQDDRDKNLFL  445

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F+GKD+D+   ++E CD + V+GIQ L+D  L+T+D D  LMM Q +++MG+EI+
Sbjct  446   DIACFFIGKDKDYLDRIVEGCDFYRVLGIQKLVDRCLITIDKDKILMMHQSLRDMGREIV  505

Query  1038  RQDSRDDLHTLSKL  997
             RQ+S DDL   S+L
Sbjct  506   RQESPDDLGKRSRL  519


 Score =   161 bits (408),  Expect(2) = 2e-127, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 113/157 (72%), Gaps = 5/157 (3%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A A  Q+   SS  R  Y  FLSFRGEDTRKNFTDHL+TAL+ AG  TFRDDDEI RGEN
Sbjct  2     ATAIPQDEASSSKSRCTYQVFLSFRGEDTRKNFTDHLHTALVQAGFHTFRDDDEIQRGEN  61

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEG-HAVFPIFYSVGRADV  2225
             I+ E+++ I+ESR+SIIVFSKDYASSRWCLDEL+ I+  +K  G H V PIFY +  + V
Sbjct  62    IEIEIQKAIKESRMSIIVFSKDYASSRWCLDELVMIMELKKLGGWHVVLPIFYDLDPSHV  121

Query  2224  EKQSGSFAEAFERHAKREKMEVEEGRVE-WKGKGGEV  2117
               Q+GSFAEAF RH +R K   +E RVE W+    EV
Sbjct  122   SNQTGSFAEAFVRHEERFK---KEDRVEGWRMALKEV  155



>ref|XP_008232434.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=863

 Score =   325 bits (832),  Expect(2) = 3e-127, Method: Compositional matrix adjust.
 Identities = 190/365 (52%), Positives = 257/365 (70%), Gaps = 2/365 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL EVA L GMVLQ + DGHE++FI KI+  I +KL R  LSVP   +G+ SRV ++N
Sbjct  150   REALAEVADLAGMVLQNQADGHESKFINKIVHVIGEKLRRRPLSVPHIMIGMHSRVNELN  209

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S DVG+ VI G+ G+GKTT+AK  YN N+ RFEGS FL N++  S+ PNG V L
Sbjct  210   LWLQDGSDDVGILVIYGMSGIGKTTIAKSVYNSNFGRFEGSSFLENIKEVSQQPNGLVQL  269

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  NIL GR+  I +  EG+ +I+DAI SK+V +V DDVD ++ LD V+  +D F  
Sbjct  270   QTQLLSNILNGRKMKISSVSEGLTEIEDAISSKRVLLVLDDVDHMDQLDAVLRMKDQFCP  329

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR   LLK H+    ++++ L  +ESL+LF  +AFGQD P+E  +EYS K + 
Sbjct  330   GSKIIITTRRVRLLKVHQVTKVHEVETLHYKESLELFSWHAFGQDHPIEGYIEYSQKIVH  389

Query  1395  HCGGLPLALKDLGSYL-SGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLF  1222
             HCGGLPLALK LGS + S  S+DVW+S L+KLE I + +I   L +S + L DD+D+ LF
Sbjct  390   HCGGLPLALKVLGSSMYSEDSIDVWKSALQKLEAIPNGEIVNKLRVSYDSLPDDHDRNLF  449

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
             + IAC F+GKD+D+ +N+L+ CD + +VG QNLID  LV++D   K+ M  +I  MG++I
Sbjct  450   LHIACFFIGKDKDYIVNILDACDFYTIVGFQNLIDRCLVSIDKWEKVQMHDMICGMGRQI  509

Query  1041  LRQDS  1027
             +RQ+S
Sbjct  510   VRQES  514


 Score =   160 bits (406),  Expect(2) = 3e-127, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 109/153 (71%), Gaps = 5/153 (3%)
 Frame = -1

Query  2569  TQESGISSVPRFF-YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDA  2393
             TQ++  S+  R   YH FLSFRGEDTRK FTDHL+TAL+NAG RTFRDDDE+ RGE+I  
Sbjct  7     TQQTSSSNTSRCCRYHVFLSFRGEDTRKTFTDHLFTALVNAGFRTFRDDDELARGEDIKP  66

Query  2392  ELrrgiresrisiIVFSKDYASSRWCLDELLTILGR-RKSEGHAVFPIFYSVGRADVEKQ  2216
             EL++ I++SR S+IVFSKDYASSRWCLDEL+ IL R R S  + V P+FY V  + V KQ
Sbjct  67    ELQKAIKQSRTSVIVFSKDYASSRWCLDELMMILERKRTSPDYVVLPVFYDVDPSHVRKQ  126

Query  2215  SGSFAEAFERHAKREKMEVEEGRVEWKGKGGEV  2117
             +GS A+AF RH   +K +      EW+    EV
Sbjct  127   TGSLAKAFARH---QKTQPSNKVKEWREALAEV  156



>ref|XP_008231867.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=755

 Score =   325 bits (833),  Expect(2) = 6e-127, Method: Compositional matrix adjust.
 Identities = 189/366 (52%), Positives = 257/366 (70%), Gaps = 1/366 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL EVA L GMVLQ +  G+E++FI+KI++ I  KL+RT LSV    VG+ S+V +IN
Sbjct  152   REALAEVADLAGMVLQNQAHGYESKFIKKIVKVIGDKLSRTPLSVAPNLVGMHSKVERIN  211

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQ  S+DVG+ VI G+ G+GKTT+AK  YN N+  FEGS FL N++  S+ PNG V +
Sbjct  212   FWLQRRSTDVGILVIYGMSGIGKTTIAKTVYNSNFRIFEGSSFLENIKEVSQQPNGLVQI  271

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +IL GR+  I N  EG+IKI+DA+ SK+  +V DDVD ++ LD V   +D F  
Sbjct  272   QTQLLSDILNGRKMKISNVSEGLIKIEDAMSSKRFLLVLDDVDHMDQLDAVFQMKDRFYP  331

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTRC  LLK H+    Y ++ L  +ESL+LF  +AFGQD P+E  +EYS K + 
Sbjct  332   GSKIIITTRCARLLKAHQVTEVYAVETLTQKESLELFSWHAFGQDHPVEDYVEYSKKLVD  391

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HC GLPLALK LGS L G S+ +W+S LEKLE I + +I   L +S + L DD+D+ LF+
Sbjct  392   HCEGLPLALKVLGSSLLGESICLWKSALEKLEAIPNGEIINKLRVSYDSLQDDHDRNLFL  451

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F+GKD+D+ +N+L+ CD + +VGIQNLID  LV +D  +K+ M  LI+ MG+EI+
Sbjct  452   HIACFFIGKDKDYIVNILDGCDFYTLVGIQNLIDRCLVIIDGWDKVQMHNLIRGMGREIV  511

Query  1038  RQDSRD  1021
             R +S++
Sbjct  512   RLESKE  517


 Score =   159 bits (403),  Expect(2) = 6e-127, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 102/142 (72%), Gaps = 4/142 (3%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A+ +T  S  S   R  YH FLSFRG DTRK FTDHLYTAL+N G RTFRDDDE+ RGE 
Sbjct  7     ADPQTSSSNASRYCR--YHVFLSFRGPDTRKTFTDHLYTALVNEGFRTFRDDDEVERGEG  64

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTIL--GRRKSEGHAVFPIFYSVGRAD  2228
             I  EL++ I+ SR S+IVFSKDYASSRWCLDEL+ IL   RR S+ H V P+FY V  + 
Sbjct  65    IKPELQKAIKHSRTSVIVFSKDYASSRWCLDELVMILERKRRTSDDHVVLPVFYDVDPSH  124

Query  2227  VEKQSGSFAEAFERHAKREKME  2162
             V KQ+GS A+AF RH K + ++
Sbjct  125   VRKQTGSLAKAFARHQKSQPLQ  146



>ref|XP_008375678.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=584

 Score =   332 bits (850),  Expect(2) = 1e-126, Method: Compositional matrix adjust.
 Identities = 192/368 (52%), Positives = 265/368 (72%), Gaps = 5/368 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R ALR+VA L GMVL+   D +E++FIQ I++EI  KL+   L+V  Y VG+  RV  IN
Sbjct  153   RRALRDVADLAGMVLE---DRYESQFIQDIVKEIGNKLDPKALNVAPYAVGIDDRVRGIN  209

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WL+D S+DVGV VI G+GG+GKTT+AK AYNLN+ RFE S FLA++R  SE PNG V L
Sbjct  210   MWLEDGSNDVGVAVIYGMGGIGKTTIAKAAYNLNHARFESSSFLADIRETSEQPNGFVRL  269

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+++  +I KG+   I++T+EGIIKIK A+  K+V IV DDV+ L+  + ++G R+WF  
Sbjct  270   QRKLLSDIQKGKANKIYSTNEGIIKIKHAVCYKRVLIVLDDVNNLDQFNAILGIREWFYP  329

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR ENLL+ HE H  +K++EL++ ESL+LF  +  GQ  P+E  +E S   ++
Sbjct  330   GSKIIITTRHENLLRAHEDHAMFKVEELNEYESLELFSWHTVGQSHPIEGYIELSRSVVK  389

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HCGGLPLAL+ LGS LSG+ +DVW+S L+KL  I + K+Q+ L IS + L DD+DK LF+
Sbjct  390   HCGGLPLALQVLGSSLSGKEVDVWQSALQKLYEIPNGKVQKVLXISYDSLQDDHDKNLFL  449

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDN-DNKLMMPQLIQNMGKEI  1042
              IAC  +GK+++FAI VL+  D +  +GIQNL D  LV +DN DN+L M  L+++MG+ I
Sbjct  450   HIACFIIGKEKNFAITVLDSLDFYTRIGIQNLXDRCLVKIDNEDNRLGMHHLLRDMGRGI  509

Query  1041  LRQDSRDD  1018
             +R++S  D
Sbjct  510   IREESPQD  517


 Score =   152 bits (383),  Expect(2) = 1e-126, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 107/142 (75%), Gaps = 2/142 (1%)
 Frame = -1

Query  2557  GISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrg  2378
             G S   R  YHAFLSFRGEDTRK F+DHLY AL  AGI TFRDDDEI RGENI AEL R 
Sbjct  13    GSSCFYRCSYHAFLSFRGEDTRKGFSDHLYRALELAGIHTFRDDDEIERGENIAAELHRA  72

Query  2377  iresrisiIVFSKDYASSRWCLDELLTILGRRKS-EGHAVFPIFYSVGRADVEKQSGSFA  2201
             I ES++SIIVFS++YA+SRWCLDEL  I+ RR+S +GH V P+FY V  + V KQ+GSF 
Sbjct  73    INESKVSIIVFSENYATSRWCLDELAKIMERRRSDDGHFVMPVFYDVDPSHVRKQTGSFG  132

Query  2200  EAFERHAKREKMEVEEGRVEWK  2135
             EAF RH +R K ++++   EW+
Sbjct  133   EAFCRHEERFKEDMDKVE-EWR  153



>ref|XP_002517696.1| TMV resistance protein N, putative [Ricinus communis]
 gb|EEF44860.1| TMV resistance protein N, putative [Ricinus communis]
Length=1186

 Score =   324 bits (830),  Expect(2) = 2e-125, Method: Compositional matrix adjust.
 Identities = 187/376 (50%), Positives = 259/376 (69%), Gaps = 4/376 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL+E A L GMVLQ   DG+E++FIQ I++E+  KL+RTVL V  Y VG  SR+ +I 
Sbjct  150   RAALKEAAELGGMVLQ---DGYESQFIQTIVKEVENKLSRTVLHVAPYLVGTESRMARIT  206

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
             +WL+D S DV +  I G+GG+GKTT+AK+ YN N+  F+G  FLANV+  SE PNG   L
Sbjct  207   RWLRDGSDDVEIATIYGIGGIGKTTIAKIVYNQNFRSFDGRSFLANVKEISEQPNGLARL  266

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  ++LK     I+N DEGI+KIKDA+  K+V ++ DDVD LE  + ++  R+W   
Sbjct  267   QRQLLSDLLKKNTSKIYNVDEGIMKIKDALFQKRVLLILDDVDDLEQFNAIVAMREWCHP  326

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR E+L        ++++++L+D+ESL+LFC +AF QD P +   ++S   + 
Sbjct  327   GSKIIITTRHEHLQGVDGICRRFEVEKLNDKESLQLFCWHAFRQDHPADGYEKHSKDVVH  386

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HCGGLPLAL+ LGS LSG+++ VW S LEKLE++   KIQ  L IS + L DD+DKRLF+
Sbjct  387   HCGGLPLALQVLGSSLSGKTVSVWESALEKLEKVADSKIQHILRISFDSLQDDHDKRLFL  446

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F G D  +   +L+ C  + V+GIQNLID  L+T+ +  KLMM QL+ +MG+EI+
Sbjct  447   DIACFFTGMDIGYVFRILDGCGFYAVIGIQNLIDRCLITISDKYKLMMHQLLGDMGREIV  506

Query  1038  RQDSRDDLHTLSKLLD  991
             RQ+S DD    S+L D
Sbjct  507   RQESPDDPGKRSRLWD  522


 Score =   155 bits (392),  Expect(2) = 2e-125, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 100/135 (74%), Gaps = 3/135 (2%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             YH FLSFRG DTRKNFTDHLYTAL+  GI TFRDDDEI RGE+I+ E++R I ES++S+I
Sbjct  20    YHVFLSFRGGDTRKNFTDHLYTALVQEGIHTFRDDDEIKRGEDIELEIQRAITESKLSVI  79

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAK--  2177
             V SKDYASSRWCLDEL+ I+ RRK  GH V P+FY V    V  Q+GS+ EAF +H K  
Sbjct  80    VLSKDYASSRWCLDELVLIMERRKLVGHVVVPVFYDVEPYQVRNQTGSYGEAFAKHEKDF  139

Query  2176  REKME-VEEGRVEWK  2135
             +E M  VEE R   K
Sbjct  140   KEDMSRVEEWRAALK  154



>ref|XP_007203940.1| hypothetical protein PRUPE_ppa017433mg [Prunus persica]
 gb|EMJ05139.1| hypothetical protein PRUPE_ppa017433mg [Prunus persica]
Length=1072

 Score =   320 bits (819),  Expect(2) = 3e-125, Method: Compositional matrix adjust.
 Identities = 188/366 (51%), Positives = 261/366 (71%), Gaps = 3/366 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL EVA L GMVLQ +  G+E++FI KI++ I +KL R  L+VP   +G+ SRV ++N
Sbjct  150   REALAEVADLAGMVLQNQ--GYESKFINKIVQVIGEKLRRRPLNVPHIMIGMHSRVHELN  207

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S DVG+ VI G+ G+GKTT+AK  YN N++RF GS F+ N+R  S+ PNG V +
Sbjct  208   LWLQDGSDDVGILVIYGMSGIGKTTIAKSVYNTNFERFGGSSFIENIREISQQPNGLVQI  267

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+  +IL GR+  I +  EG+ +I+DAI SK+VF+V DDVD +  LDVV+G +D F  
Sbjct  268   QKQLLYDILIGRKVKIQSVSEGMTEIQDAISSKRVFLVLDDVDHISQLDVVLGMKDQFYP  327

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR   LLK H+    + ++ LD++ESL+LF  +AFG+D P+E  +EYS K + 
Sbjct  328   GSKIIITTRRAGLLKAHQVTKVHAVQTLDNKESLELFSWHAFGRDHPIEDYIEYSKKLVD  387

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HCGGLPLAL+ LGS L G S+ VW+S LEKL+ I + +I   L +S + L DD+D++LF+
Sbjct  388   HCGGLPLALQVLGSSLLGESIGVWKSALEKLKAIPNGEIVNKLRVSYDSLQDDHDRKLFL  447

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F+GKD+D  + +L+ CD + +VGIQNLID  LVT+D  +K+ M  LI  MG+E++
Sbjct  448   HIACFFIGKDKDCIVKILDGCDFYTIVGIQNLIDRCLVTIDEFDKVHMHDLICGMGREVV  507

Query  1038  RQDSRD  1021
              Q+S +
Sbjct  508   HQESEE  513


 Score =   159 bits (402),  Expect(2) = 3e-125, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 102/139 (73%), Gaps = 4/139 (3%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             YH FLSFRG+DTRK FTDHLYTAL+NAG RTFRDDDE+ RGE I  EL++ I+ SR S+I
Sbjct  21    YHVFLSFRGQDTRKTFTDHLYTALVNAGFRTFRDDDEVERGEGIKPELQKAIKHSRTSVI  80

Query  2350  VFSKDYASSRWCLDELLTIL-GRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKR  2174
             VFSK+YASSRWCLDEL+ IL  +R S  H + P+FY V  +DV KQ+GS A+AF RH K 
Sbjct  81    VFSKNYASSRWCLDELVMILEHKRISADHVILPVFYDVDPSDVRKQTGSLAKAFARHQKT  140

Query  2173  EKMEVEEGRVEWKGKGGEV  2117
             +    E+   EW+    EV
Sbjct  141   QPSNKEK---EWREALAEV  156



>ref|XP_008245847.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=734

 Score =   323 bits (827),  Expect(2) = 6e-125, Method: Compositional matrix adjust.
 Identities = 186/366 (51%), Positives = 259/366 (71%), Gaps = 2/366 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             ++AL EVA L GMVLQ + DG+E++FI+KI+  I  KL+RT LS+    +G+ SRV  +N
Sbjct  149   KDALAEVADLAGMVLQNQADGYESKFIKKIVNVIGDKLSRTTLSIAPNMIGMHSRVKTVN  208

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+DVG+ +I G+ G+GKTT+AK AYN N+ RF+GS FL N++  S+ PNG V +
Sbjct  209   LWLQDGSTDVGILLIYGMSGIGKTTIAKFAYNSNFSRFQGSSFLENIKEISQQPNGLVQI  268

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +IL GR+  I N  EG+ KI+DAI SK+V +V DDVD ++ LD V+  +D F  
Sbjct  269   QTQLLSDILNGRKMKISNVSEGLTKIEDAISSKRVLLVLDDVDHMDQLDAVLRMKDRFCP  328

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR   LLK H+    ++++ L  +ESL+L   +AFGQD P+E  +EYS K + 
Sbjct  329   GSKIIITTRRARLLKAHQVTKVHEVETLHYQESLELLSWHAFGQDHPIEGYIEYSQKIVD  388

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HC GLPLALK LGS L G S+DVW+S LEKLE I + +I   L +S + L DD+D+ LF+
Sbjct  389   HCRGLPLALKVLGSSLLGESIDVWKSALEKLEAIPNGEIVNKLRVSYDSLQDDHDRNLFL  448

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F+GKD+D+ +N+L+ CD + +VGIQNLID  LV +D  +K+ M  LI+ MG+EI+
Sbjct  449   HIACFFIGKDKDYIVNILDACDFYTIVGIQNLIDRCLV-IDKYDKVQMHDLIRGMGREIV  507

Query  1038  RQDSRD  1021
               +S++
Sbjct  508   HLESKE  513


 Score =   155 bits (392),  Expect(2) = 6e-125, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 105/152 (69%), Gaps = 4/152 (3%)
 Frame = -1

Query  2569  TQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAE  2390
             TQ++  S+  R  +H FLSFRGEDTRK FTDHL+TAL+NAG RTFRDDDE+ RGE+I  E
Sbjct  7     TQQTSSSNTSRCCHHVFLSFRGEDTRKTFTDHLFTALVNAGFRTFRDDDELERGEDIKPE  66

Query  2389  LrrgiresrisiIVFSKDYASSRWCLDELLTILGR-RKSEGHAVFPIFYSVGRADVEKQS  2213
             L++ I+ SR S+IVFSKDY SSRWCLDEL+ IL R R S  + V P+FY +  + V KQ+
Sbjct  67    LQKAIKHSRTSVIVFSKDYTSSRWCLDELVMILERKRTSPDYVVLPVFYDMDPSHVRKQT  126

Query  2212  GSFAEAFERHAKREKMEVEEGRVEWKGKGGEV  2117
             GS A AF  H K +  +  +    WK    EV
Sbjct  127   GSLARAFATHQKSQPPKKVKA---WKDALAEV  155



>ref|XP_008232624.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1140

 Score =   327 bits (839),  Expect(2) = 8e-125, Method: Compositional matrix adjust.
 Identities = 192/365 (53%), Positives = 250/365 (68%), Gaps = 1/365 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL EVA L GMVLQ E DGHEA+FI+KI++ I  KL+RT LSV  Y +G+  RV  IN
Sbjct  151   RAALTEVADLAGMVLQNEADGHEAKFIKKIVKVIEGKLSRTPLSVSPYLIGIDHRVKDIN  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD SSDVG+ VI G+GG+GKTT+A+V YN N+ RFEG  FL N+R  SE PNG V +
Sbjct  211   SWLQDGSSDVGICVIYGIGGIGKTTIAQVVYNSNFSRFEGRSFLENIREISEQPNGLVQV  270

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +IL GR+  I N  EGI KIKD I  KKV ++ DDVD +  LD ++  +DWF  
Sbjct  271   QMQLLSDILNGRKVKIHNISEGITKIKDVISCKKVLLILDDVDHMRQLDAILRMKDWFCA  330

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR   LLK H+    + I+ L+  ESL+LF  +AF QD P+   +E S   ++
Sbjct  331   GSKIIITTRSVGLLKAHQDVKVHNIETLNHVESLELFSWHAFRQDHPIGGYVELSESIVK  390

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             H GGLPLAL+ LGS LSG+S+DVW S L+KLE I +  I   L IS + L DD+D+ LF+
Sbjct  391   HSGGLPLALQTLGSSLSGQSIDVWGSALKKLEVIPNSDIMSKLRISYDSLQDDHDQNLFL  450

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              I C F+G D D  + +L+ CD   +VG+QNLID  LVT+D   K+ M Q+I++MG+EI+
Sbjct  451   HITCFFIGNDMDVVVTILDGCDFFTIVGMQNLIDRCLVTIDEYKKVKMHQMIRDMGREIV  510

Query  1038  RQDSR  1024
             R +S+
Sbjct  511   RLESK  515


 Score =   150 bits (378),  Expect(2) = 8e-125, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 102/140 (73%), Gaps = 4/140 (3%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             YH FLSFRGEDTR+ FTDHLYTA +N+G++TFRDDDE+ RGE I  EL + I+ SR S+I
Sbjct  20    YHVFLSFRGEDTRRTFTDHLYTAFVNSGLQTFRDDDELERGEGIKTELEKAIQHSRSSVI  79

Query  2350  VFSKDYASSRWCLDELLTILGR-RKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKR  2174
             VFSK+YASS+WCLDEL+ IL R R S  H + P+FY +  ++V KQ+GS A+AF RH  R
Sbjct  80    VFSKNYASSKWCLDELVKILERKRASNEHVILPVFYDIDPSEVRKQTGSLAKAFARH--R  137

Query  2173  EKMEVEEGRVE-WKGKGGEV  2117
             +   + + R+  W+    EV
Sbjct  138   QNRSLNKDRISGWRAALTEV  157



>ref|XP_007099591.1| TMV resistance protein N [Theobroma cacao]
 gb|EOY20434.1| TMV resistance protein N [Theobroma cacao]
Length=1315

 Score =   314 bits (805),  Expect(2) = 9e-125, Method: Compositional matrix adjust.
 Identities = 191/381 (50%), Positives = 262/381 (69%), Gaps = 19/381 (5%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R ALREVA L GM+L+   D HE++FIQ II+++  KL+RT L VP Y VG+ + V +IN
Sbjct  148   RNALREVADLGGMLLE---DRHESQFIQDIIQQVQNKLHRTALYVPPYLVGIDALVARIN  204

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WL+D S+ VG+  ICG+GG+GKTT+AK+ YN N+ RFE   FLANVR  ++  NG V L
Sbjct  205   WWLRDGSNKVGIATICGIGGIGKTTIAKLVYNQNFQRFESYSFLANVRETTQELNGLVQL  264

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +ILKG+   I+N+D+GI KIK+ I  ++V +V DDVD  E +  +IG +  F  
Sbjct  265   QRQLISDILKGKANKIYNSDDGITKIKETICHRRVLLVLDDVDDSEKVTEIIGVQIPFHP  324

Query  1575  GSKIIITTRCENLLK--------GHERHLQY-------KIKELDDEESLKLFCRYAFGQD  1441
             GSKII+T+R   LL           E    Y       ++KEL   ESL+LF  YAFGQ+
Sbjct  325   GSKIIVTSRHRCLLSDLFIRQMFDLEESSNYGDLCKVIEVKELAFNESLQLFNWYAFGQN  384

Query  1440  DPLEHLMEYSVKAIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEI  1261
             +P+E  M+Y+   ++HCGGLPLAL+ LGS LSG+S++VWRS LEKL+ I H KIQ+ L I
Sbjct  385   NPIESYMDYARSIVKHCGGLPLALQVLGSSLSGKSINVWRSALEKLKAIPHSKIQKILRI  444

Query  1260  SLNPL-DDYDKRLFVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNK  1084
             S + L DD+DK LF+ IAC F+GKDRD+   +L+ CD + V+GI+NLI+ SL+ V   NK
Sbjct  445   SYDSLQDDHDKNLFLDIACVFIGKDRDYTTKILDGCDYYTVIGIENLINRSLLVVSERNK  504

Query  1083  LMMPQLIQNMGKEILRQDSRD  1021
             LMM Q+I++MG+ I+ Q+S D
Sbjct  505   LMMHQMIRDMGRNIICQESFD  525


 Score =   163 bits (413),  Expect(2) = 9e-125, Method: Composition-based stats.
 Identities = 85/142 (60%), Positives = 106/142 (75%), Gaps = 1/142 (1%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A +  QES  SS+ R+ YH FLSFRG DTRKNFTDHLY  L++AGI TFRDD+EI RGEN
Sbjct  2     AVSMVQES-FSSISRYTYHIFLSFRGADTRKNFTDHLYMVLMHAGIHTFRDDNEIERGEN  60

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVE  2222
             I  E+ R + ES++SII+FSK+YASS WCL+EL+ I+  RK   H V PIFY V  + V+
Sbjct  61    IRDEIERALHESKMSIIIFSKNYASSTWCLNELVKIMEHRKFSKHIVLPIFYDVNPSQVK  120

Query  2221  KQSGSFAEAFERHAKREKMEVE  2156
             KQ+GSFAEAF RH +  K E++
Sbjct  121   KQTGSFAEAFARHEESFKYEMD  142



>ref|XP_008232447.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=736

 Score =   317 bits (811),  Expect(2) = 1e-124, Method: Compositional matrix adjust.
 Identities = 188/367 (51%), Positives = 256/367 (70%), Gaps = 5/367 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASR--VGK  1942
             R+AL+EVA L GMVLQ + DGHE++FI KI++ I K L R  LSVP + +G  S   V K
Sbjct  149   RKALKEVADLGGMVLQNQADGHESKFINKIVQVIGKTLRRRPLSVPHFVIGKHSLDLVNK  208

Query  1941  INKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQV  1762
             +N WLQD S DVG+ VI G+ G+GKTT+AK  YN NY RFEG  FL N++  S+ PNG V
Sbjct  209   LNLWLQDGSDDVGILVIYGMSGIGKTTIAKRVYNSNYGRFEGRSFLENIKRVSQQPNGLV  268

Query  1761  GLQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWF  1582
              LQ Q+  ++LKGR+  I +  EG+ +I+DAI SKK  +V DDVD ++ LD V   +D F
Sbjct  269   QLQTQLLSDVLKGRKMKISSVSEGLTEIEDAISSKKALLVLDDVDHMDQLDAVFRMKDQF  328

Query  1581  SRGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKA  1402
               GSKIIITTR   LL+ H+    +K++ LDD+ESL+LF  +AFGQD P+E  +EYS K 
Sbjct  329   CPGSKIIITTRHARLLRAHQVTKMHKVETLDDKESLELFSWHAFGQDHPIEGYIEYSQKI  388

Query  1401  IRHCGGLPLALKDLGSYLS-GRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKR  1228
             + HC GLPLALK LGS +  G S+DVW+S LEKLE I + +I   L +S + L DD+D+ 
Sbjct  389   VGHCAGLPLALKVLGSSMYLGDSIDVWKSALEKLEAIPNGEIVNKLRVSYDSLQDDHDRN  448

Query  1227  LFVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGK  1048
             LF+ IAC F+GKD+D+ +N+L+ CD + +VGIQNLID  LV++ +  K+ M  +I+ MG+
Sbjct  449   LFLHIACFFIGKDKDYIVNILDGCDFYTIVGIQNLIDRCLVSI-HGKKVQMHDMIRGMGR  507

Query  1047  EILRQDS  1027
             +I+  +S
Sbjct  508   QIVHLES  514


 Score =   160 bits (406),  Expect(2) = 1e-124, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 99/135 (73%), Gaps = 1/135 (1%)
 Frame = -1

Query  2575  ARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENID  2396
             A +Q S +S      YH FLSFRG+DTRK FTDHLYTAL+NAG RTFRDDDE+ RGE I 
Sbjct  7     ADSQTSSVSGTRHCLYHVFLSFRGQDTRKTFTDHLYTALVNAGFRTFRDDDEVERGEGIK  66

Query  2395  AELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQ  2216
              EL++ I+ SR S+IVFSK+YASSRWCLDEL+ I   R S  H VFP+FY V  +DV  Q
Sbjct  67    PELQKAIKHSRTSVIVFSKNYASSRWCLDELVMI-HERLSADHVVFPVFYDVDPSDVRNQ  125

Query  2215  SGSFAEAFERHAKRE  2171
             +GS A+AF RH K +
Sbjct  126   TGSLAKAFARHQKTQ  140



>ref|XP_008232442.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=556

 Score =   323 bits (827),  Expect(2) = 1e-124, Method: Compositional matrix adjust.
 Identities = 192/369 (52%), Positives = 258/369 (70%), Gaps = 4/369 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASR--VGK  1942
             R+AL+EVA L GMVLQ + DGHE++FI KI++ I  KL R  LSVP   +G  S   V K
Sbjct  152   RKALKEVADLAGMVLQNQADGHESKFINKIVQVIGGKLRRRPLSVPRIMIGRHSLDLVNK  211

Query  1941  INKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQV  1762
             +N WLQD S DVG+ VI G+ G+GKTT+AK  YN N+ RFEGS FL N++  S+ PNG V
Sbjct  212   LNLWLQDGSDDVGILVIYGMSGIGKTTIAKSVYNSNFGRFEGSSFLENIKEVSQQPNGLV  271

Query  1761  GLQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWF  1582
              LQ Q+  +IL  R+  I +  EG+ +I+DAI SKKV +V DDVD ++ LD V   +D F
Sbjct  272   QLQTQLLSDILNRRKMKISSVSEGLTEIEDAISSKKVLLVLDDVDHMDQLDAVFRMKDQF  331

Query  1581  SRGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKA  1402
               GSKIIITTR   LL+ H+    +K++ LDD+ESL+LF  +AFGQD P+E  +EYS K 
Sbjct  332   YPGSKIIITTRHARLLRAHQVTKMHKVETLDDKESLELFSWHAFGQDHPIEGYVEYSQKI  391

Query  1401  IRHCGGLPLALKDLGSYLS-GRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKR  1228
             + HCGGLPLALK LGS +  G S+DVW+S LEKLE I + +I   L +S + L DD+D++
Sbjct  392   VDHCGGLPLALKVLGSSMYLGDSIDVWKSALEKLEAIPNREIINKLRLSYDSLQDDHDRK  451

Query  1227  LFVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGK  1048
             LF+ IAC F+G+D+D+ + +L+ CD + +VGIQNLID  LVT+D  +K+ M  LI  MG+
Sbjct  452   LFLHIACFFIGRDKDYIVKILDGCDFYTIVGIQNLIDRCLVTIDEFDKVHMHDLIHGMGR  511

Query  1047  EILRQDSRD  1021
             EI+ Q+S +
Sbjct  512   EIVCQESNE  520


 Score =   154 bits (389),  Expect(2) = 1e-124, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 101/139 (73%), Gaps = 4/139 (3%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             YH FLSFRG+DTRK FTDHLYTAL+NAG RTFRDDDE+ RGE I  EL++ I+ SR S+I
Sbjct  23    YHVFLSFRGQDTRKAFTDHLYTALVNAGFRTFRDDDEVERGEGIKPELQKAIKHSRTSVI  82

Query  2350  VFSKDYASSRWCLDELLTILGRRK-SEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKR  2174
             VFSK+YASSRWCLDEL+ IL R++ S  H V P+FY    +D+ KQ+GS A+AF RH   
Sbjct  83    VFSKNYASSRWCLDELVMILERKRISADHVVLPVFYDADPSDLRKQTGSLAKAFARH---  139

Query  2173  EKMEVEEGRVEWKGKGGEV  2117
             +K +      EW+    EV
Sbjct  140   QKTQPSNKVKEWRKALKEV  158



>ref|XP_008232415.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=764

 Score =   318 bits (816),  Expect(2) = 2e-124, Method: Compositional matrix adjust.
 Identities = 189/366 (52%), Positives = 252/366 (69%), Gaps = 1/366 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL EVA L GMVLQ +  G+E++FI+KI++ I  KL+RT LSV    VG+ SRV +IN
Sbjct  153   REALAEVADLAGMVLQNQAHGYESKFIKKIVKVIGDKLSRTPLSVSPNLVGMHSRVERIN  212

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQ  S+DVG+ VI G+ G+GKTT+AK  YN N+  FEGS FL N++  S+ PNG V +
Sbjct  213   FWLQRRSTDVGILVIYGMSGIGKTTIAKTVYNSNFRIFEGSSFLENIKEVSQQPNGLVQI  272

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q  +  +IL GR+  I N  EG+IKI+DAI SK+V +V DDVD  + LD V   +D F  
Sbjct  273   QTLLLSDILNGRKMKISNVSEGLIKIEDAISSKRVLLVLDDVDHTDQLDAVFQMKDQFYP  332

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR   LLK H+    Y ++ L  EESL+LF  + FGQD P+E  +EYS K + 
Sbjct  333   GSKIIITTRRARLLKAHQVTEVYAVETLTQEESLELFSWHTFGQDHPIEDYIEYSEKLVD  392

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HCGGLPLALK LGS L G S+ +W+S LEKLE I + +I   L +S + L DD+D++LF+
Sbjct  393   HCGGLPLALKVLGSSLLGESVCLWKSALEKLEVIPNGEIINKLRVSYDSLQDDHDQKLFL  452

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F+G D+D+   +L+ CD + +VGIQNLID  LV +D  +K+ M  LI  MG+EI+
Sbjct  453   HIACFFIGMDKDYIAKILDGCDFYTIVGIQNLIDRCLVIIDRWDKVRMHDLICGMGREIV  512

Query  1038  RQDSRD  1021
             R +S++
Sbjct  513   RLESKE  518


 Score =   157 bits (398),  Expect(2) = 2e-124, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 104/140 (74%), Gaps = 3/140 (2%)
 Frame = -1

Query  2575  ARTQESGISSVPRFF-YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENI  2399
             A  Q S +SS   +  YH FLSFRG+DTRK FTDHLYTAL+NAG RTFRD DE+ RGE I
Sbjct  7     ADPQTSFVSSTSGYCRYHVFLSFRGQDTRKTFTDHLYTALVNAGFRTFRDYDEVERGEGI  66

Query  2398  DAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRK--SEGHAVFPIFYSVGRADV  2225
               EL++ I+ SR S+IVFSKDYASSRWCLDEL+ IL R++  S+ H V P+FY V  + V
Sbjct  67    KPELQKAIKHSRTSVIVFSKDYASSRWCLDELVMILERKRKTSDAHVVLPVFYDVYPSHV  126

Query  2224  EKQSGSFAEAFERHAKREKM  2165
             +KQ+GS A+AF RH K + +
Sbjct  127   KKQTGSLAKAFARHQKTQPL  146



>ref|XP_008227885.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1193

 Score =   320 bits (819),  Expect(2) = 2e-124, Method: Compositional matrix adjust.
 Identities = 183/369 (50%), Positives = 262/369 (71%), Gaps = 6/369 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTV---LSVPSYTVGLASRVG  1945
             R+ALR+VA L GMVL    D +E++FIQ I+ +I  KL+ T    L V  Y VG+ +RV 
Sbjct  149   RKALRDVADLGGMVLG---DRYESQFIQDIVEDIGNKLDHTWNRRLVVDPYVVGIDNRVE  205

Query  1944  KINKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQ  1765
              +N WL+D SSDVGV V+ G+GG+GKTT+AK+AYN N+ +F+G  FLA++RA S++PNG 
Sbjct  206   GLNMWLEDGSSDVGVAVVYGMGGIGKTTIAKIAYNRNFYKFQGGSFLADIRATSKLPNGL  265

Query  1764  VGLQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDW  1585
             V LQ+++  ++ KG+ + I+N++EGI KIK AI  K+V +  DDVD LE  + ++G R+W
Sbjct  266   VHLQRKLLSDLQKGKAKKIYNSEEGIKKIKRAIRCKRVLVALDDVDNLEQFNAILGMREW  325

Query  1584  FSRGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVK  1405
                GSKIIITTR E+LLK HE    +K++ L + ESL+LF  +AF Q  P E  M+ S  
Sbjct  326   LHPGSKIIITTRHEHLLKAHENCAMFKVEGLLENESLELFSWHAFRQPHPSEGHMDLSRP  385

Query  1404  AIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRL  1225
              ++HCGG+PLAL+ LGS L G++ DVW++ L+ L+ I   KIQ+ L IS + L D+DKRL
Sbjct  386   VVQHCGGVPLALQVLGSSLFGKAADVWKNALQNLDVITEGKIQKILRISFDSLQDHDKRL  445

Query  1224  FVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKE  1045
             F+ IAC F+GKD+DF+  VL++C+    +GIQNL+D  L+ +D  NKL M QL+Q+MG+ 
Sbjct  446   FLHIACFFIGKDKDFSTTVLDECEFATNIGIQNLVDRCLLIIDGFNKLTMHQLLQDMGRG  505

Query  1044  ILRQDSRDD  1018
             I+R++S +D
Sbjct  506   IIREESPED  514


 Score =   156 bits (394),  Expect(2) = 2e-124, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 103/143 (72%), Gaps = 0/143 (0%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A   TQ+    S  R  Y AFLSFRG DTRK FTDHLY AL  AGI TFRDDDEI RG N
Sbjct  2     AATSTQQDASPSSHRCTYDAFLSFRGTDTRKGFTDHLYRALEVAGIHTFRDDDEIERGAN  61

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVE  2222
             I AEL++ I+ESR+SIIVFSKDYASSRWCLDEL+TI+ RR++  H V PIFY V  + V 
Sbjct  62    ISAELQKAIQESRVSIIVFSKDYASSRWCLDELVTIMDRRETNEHMVMPIFYDVDPSHVR  121

Query  2221  KQSGSFAEAFERHAKREKMEVEE  2153
              Q+G F EAF RH +R   E+++
Sbjct  122   NQTGIFEEAFARHQQRFNKEMDK  144



>ref|XP_008232430.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1075

 Score =   313 bits (802),  Expect(2) = 3e-124, Method: Compositional matrix adjust.
 Identities = 191/376 (51%), Positives = 257/376 (68%), Gaps = 11/376 (3%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL EVA L GMVLQ + DGHE+ FI KI++ I +KL R  LSVP   +G+ SRV ++N
Sbjct  150   REALAEVADLAGMVLQNQADGHESRFINKIVQVIGEKLRRRPLSVPHIMIGMHSRVNELN  209

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S DVG+ VI G+ G+GKTT+AK  YN N+  F+ S FL N+R  S++PNG V +
Sbjct  210   LWLQDGSYDVGILVIYGMSGIGKTTIAKSVYNTNFSTFDESSFLENIREISQLPNGLVQI  269

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +IL GR+  I +  +G+ +I+DAI SKKVF+V DDVD +  LDVV+G +D F  
Sbjct  270   QIQLLSDILYGRKVKIHSVSKGMTEIEDAISSKKVFLVLDDVDHISQLDVVLGMKDQFYP  329

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLE---------HL  1423
             GSKIIITTR   LLK H+    Y ++ L  EESL+LF  +AFGQD P+E         + 
Sbjct  330   GSKIIITTRRAGLLKAHQVSKVYAVETLTREESLELFSWHAFGQDHPVEDFYFKNFVGNY  389

Query  1422  MEYSVKAIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-  1246
             +E+S K   HCGGLPLAL+ LGS L G S+ VW+S LEKL+ I + +I   L +S + L 
Sbjct  390   IEFSEKLADHCGGLPLALQVLGSSLLGESIGVWKSALEKLKVIPNGEIINKLRVSYDSLQ  449

Query  1245  DDYDKRLFVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVT-VDNDNKLMMPQ  1069
             DD+D++LF+ IAC F+GKD+D+   +L+ CD + +VGIQNLID  LVT VD  + + M  
Sbjct  450   DDHDQKLFLHIACFFIGKDKDYIAKILDGCDFYTIVGIQNLIDRCLVTIVDGWDLVQMHD  509

Query  1068  LIQNMGKEILRQDSRD  1021
             LI+ MG+EI+R +S +
Sbjct  510   LIRGMGREIVRLESNE  525


 Score =   162 bits (411),  Expect(2) = 3e-124, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 108/151 (72%), Gaps = 4/151 (3%)
 Frame = -1

Query  2566  QESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAEL  2387
             Q S  ++ P   YH FLSFRGEDTRKNFTDHLYTAL+NAG RTFRDDDE+ RGE+I  EL
Sbjct  9     QTSSSNTSPYCRYHVFLSFRGEDTRKNFTDHLYTALVNAGFRTFRDDDELERGEDIKREL  68

Query  2386  rrgiresrisiIVFSKDYASSRWCLDELLTILGRRK-SEGHAVFPIFYSVGRADVEKQSG  2210
             ++ I+ +R S+IVFSK+YASSRWCLDEL+ IL R++ S  H V P+FY V  +DV KQ+G
Sbjct  69    QKAIKHARTSVIVFSKEYASSRWCLDELVMILERKRISADHVVLPVFYDVDPSDVRKQTG  128

Query  2209  SFAEAFERHAKREKMEVEEGRVEWKGKGGEV  2117
             S  +AF RH   +K +      EW+    EV
Sbjct  129   SLGKAFARH---QKTQPSNKVKEWREALAEV  156



>ref|XP_008232445.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1165

 Score =   327 bits (838),  Expect(2) = 1e-123, Method: Compositional matrix adjust.
 Identities = 189/365 (52%), Positives = 259/365 (71%), Gaps = 2/365 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             ++AL EVA L GMVLQ + DGHE++FI KI++ I +KL R  LSVP   +G+ SRV ++N
Sbjct  154   KDALAEVADLAGMVLQNQADGHESKFINKIVQVIGEKLRRRPLSVPHIMIGMHSRVNELN  213

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S DVG+ VI G+ G+GKTT+AK  YN N+ RF GS FL N++  S+ PNG V +
Sbjct  214   LWLQDGSDDVGILVIYGMSGIGKTTIAKSVYNSNFGRFGGSSFLENIKEVSQQPNGLVQI  273

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  NIL GR+  I N  EG+ +I+DAI SK+V +V DDVD ++ LD V+  +D F  
Sbjct  274   QTQLLSNILNGRKMRISNVSEGLTEIEDAISSKRVLLVLDDVDHMDQLDAVLRMKDQFCP  333

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTRC  LLK H+    +K++ L  +ESL+LF  +AFGQD P+E  +EYS K + 
Sbjct  334   GSKIIITTRCARLLKVHQVTKVHKVETLHYKESLELFSWHAFGQDHPIEGYIEYSQKIVH  393

Query  1395  HCGGLPLALKDLGSYL-SGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLF  1222
             HCGGLPLALK LGS + S  S+DVW+S L+KLE I + +I   L +S + L DD+D+ LF
Sbjct  394   HCGGLPLALKVLGSSMYSEDSIDVWKSALQKLEAIPNGEIVNKLRVSYDSLPDDHDRNLF  453

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
             + IAC F+GKD+D+ +N+L+ CD + +VGIQNLID  LV++D  + + M  +I+ MG+EI
Sbjct  454   LHIACFFIGKDKDYIVNILDACDFYTIVGIQNLIDRCLVSIDVFDNVHMHDMIRGMGREI  513

Query  1041  LRQDS  1027
             +R +S
Sbjct  514   VRLES  518


 Score =   147 bits (370),  Expect(2) = 1e-123, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 103/159 (65%), Gaps = 9/159 (6%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A+ +T  S  S   R  YH FLSFR +DTRK FTDHLYTAL+NAG RTFRDDDE+ RGE 
Sbjct  7     ADPQTSSSNASRYCR--YHVFLSFRSQDTRKTFTDHLYTALVNAGFRTFRDDDEVERGEG  64

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTIL----GRRKSEGHAVFPIFYSVGR  2234
             I  EL++ I+ SR S+IVFSKDYASSRWCL+EL+ ++     +R S  + V P+FY V  
Sbjct  65    IKPELQKAIKHSRTSVIVFSKDYASSRWCLNELVMLMMILECKRTSPDYVVLPVFYDVDP  124

Query  2233  ADVEKQSGSFAEAFERHAKREKMEVEEGRVEWKGKGGEV  2117
             + V  Q+GS A A  RH K +  E  +    WK    EV
Sbjct  125   SHVRNQTGSLARAIARHQKSQHPEKVKA---WKDALAEV  160



>ref|XP_007023235.1| TMV resistance protein N [Theobroma cacao]
 gb|EOY25857.1| TMV resistance protein N [Theobroma cacao]
Length=1320

 Score =   308 bits (788),  Expect(2) = 1e-123, Method: Compositional matrix adjust.
 Identities = 189/381 (50%), Positives = 263/381 (69%), Gaps = 19/381 (5%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R ALREVA L GM+L+   D HE++FIQ II+++  KL+RT L VP Y VG+ + V +IN
Sbjct  148   RTALREVADLGGMLLE---DRHESQFIQDIIKQVQSKLHRTALYVPPYLVGIDAFVARIN  204

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WL+D S+ VG+  ICG+GG+GKTT+AK+ YN N+ RFE   FLA+VR  ++  NG V L
Sbjct  205   WWLRDGSNKVGIATICGIGGIGKTTIAKLVYNQNFQRFESYSFLADVRETTQERNGLVQL  264

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +ILKG+   I+N+D+GI KIK+ I  ++V +V DDVD LE +  +IG +  F  
Sbjct  265   QRQLISDILKGKANKIYNSDDGITKIKETICHRRVLLVLDDVDDLEKVTEIIGVQIPFHP  324

Query  1575  GSKIIITTRCENLLKG-HERHL--------------QYKIKELDDEESLKLFCRYAFGQD  1441
             GSKII+T+R   LL     R +               +++KEL   ESL+LF  YAFGQ+
Sbjct  325   GSKIIVTSRHRCLLSDLFIRQMFDLEESSNYGDLCKVFEVKELAFNESLQLFNWYAFGQN  384

Query  1440  DPLEHLMEYSVKAIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEI  1261
             +P+E  M+ +   ++HCGGLPLAL+ LGS LSG+S++VWRS LEKL+ I H KIQ+ L I
Sbjct  385   NPIESYMDCARSIVQHCGGLPLALQVLGSSLSGKSINVWRSALEKLKAIPHSKIQKILRI  444

Query  1260  SLNPL-DDYDKRLFVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNK  1084
             S + L DD+DK LF+ IAC F+GKDRD+   +L+ CD + V+GI+NLI+ SL+ V   NK
Sbjct  445   SYDSLQDDHDKNLFLDIACVFIGKDRDYTTKILDGCDYYTVIGIENLINRSLLVVSERNK  504

Query  1083  LMMPQLIQNMGKEILRQDSRD  1021
             LMM Q+I++MG+ I+ Q+S D
Sbjct  505   LMMHQMIRDMGRNIVCQESFD  525


 Score =   166 bits (419),  Expect(2) = 1e-123, Method: Composition-based stats.
 Identities = 86/142 (61%), Positives = 106/142 (75%), Gaps = 1/142 (1%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A +  QES  SS+ R+ YH FLSFRG DTRKNFTDHLY AL++ GI TFRDDDEI RGEN
Sbjct  2     AVSMVQESS-SSISRYTYHVFLSFRGTDTRKNFTDHLYMALVHTGIHTFRDDDEIERGEN  60

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVE  2222
             I  E+ R + ES++SII+FSK+YASS WCL+EL+ I+  RK   H V PIFY V  + V+
Sbjct  61    IRDEIERALHESKMSIIIFSKNYASSTWCLNELVKIMEHRKFSKHIVLPIFYDVNPSQVK  120

Query  2221  KQSGSFAEAFERHAKREKMEVE  2156
             KQ+GSFAEAF RH +  K E++
Sbjct  121   KQTGSFAEAFARHEESFKYEMD  142



>ref|XP_008375654.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=1215

 Score =   317 bits (812),  Expect(2) = 2e-123, Method: Compositional matrix adjust.
 Identities = 183/368 (50%), Positives = 265/368 (72%), Gaps = 5/368 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL++VA L GMVL+     +E++FIQ I++EI  KL+   L+V  Y VG+  RV  IN
Sbjct  153   RRALKDVADLAGMVLENR---YESQFIQDIVKEIGSKLDPKALNVAPYAVGIDDRVRGIN  209

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+DVG+ VICG+GG+GKTT+A+ AYNLNY RF+GS FLA++RA SE P G V L
Sbjct  210   MWLQDGSNDVGIAVICGMGGIGKTTIARAAYNLNYARFQGSSFLADIRANSEQPYGLVRL  269

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+++  +I K + + I++ +EGI+KIK A+ +K+V IV DDV+ L+  + ++G R+WF  
Sbjct  270   QRKLLSDIQKXKADKIYDINEGIMKIKHAVCNKRVLIVLDDVNDLDQFNAILGMREWFYP  329

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKII+TTR E+LLK HE    ++++EL+++ESL+LF  +AFGQ  P+E  ME S  A++
Sbjct  330   GSKIIVTTRHEHLLKAHEDXAMFEVEELNEDESLELFSWHAFGQAHPIEGYMELSRPAVQ  389

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HC GLPLAL+ LGS LSG+++DVW+S L+KL  I   K+ + L +S + L DD DK +F+
Sbjct  390   HCEGLPLALQVLGSSLSGKAVDVWKSALQKLCEIPDDKVHKVLRVSYDSLQDDNDKNVFL  449

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDN-DNKLMMPQLIQNMGKEI  1042
               A  F+GK++DFAI VL+  D +  + IQNL+D  LV ++N DN+L M  L+++MG+ I
Sbjct  450   YXAGFFIGKEKDFAITVLDNLDFYTRIXIQNLVDRCLVKINNEDNRLAMHHLLRDMGRGI  509

Query  1041  LRQDSRDD  1018
             +R++S  D
Sbjct  510   IREESPQD  517


 Score =   156 bits (394),  Expect(2) = 2e-123, Method: Composition-based stats.
 Identities = 85/130 (65%), Positives = 101/130 (78%), Gaps = 1/130 (1%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresri  2360
             R  YHAFLSFRG DTRK+FTDHLY AL  AGI TFRDDDEI RGE+I AEL   I ES++
Sbjct  19    RCTYHAFLSFRGADTRKSFTDHLYRALELAGIHTFRDDDEIKRGEDIAAELHNAINESKV  78

Query  2359  siIVFSKDYASSRWCLDELLTILGRRKS-EGHAVFPIFYSVGRADVEKQSGSFAEAFERH  2183
             SIIVFSKDYASSRWCLDEL+ I+ RR+S +GH V P+FY V  + V KQ+ SF E+F RH
Sbjct  79    SIIVFSKDYASSRWCLDELVKIMERRRSDDGHFVLPVFYDVDPSHVRKQTASFEESFCRH  138

Query  2182  AKREKMEVEE  2153
              +R K E+++
Sbjct  139   EERFKEEMDK  148



>ref|XP_007203971.1| hypothetical protein PRUPE_ppa024258mg [Prunus persica]
 gb|EMJ05170.1| hypothetical protein PRUPE_ppa024258mg [Prunus persica]
Length=1076

 Score =   317 bits (813),  Expect(2) = 2e-123, Method: Compositional matrix adjust.
 Identities = 188/366 (51%), Positives = 252/366 (69%), Gaps = 1/366 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL EVA L GMVLQ +  G+E++FIQKI++ I  KL+RT LSV    VG+ S+V +IN
Sbjct  153   REALAEVADLAGMVLQNQAHGYESKFIQKIVKVIGDKLSRTPLSVAPNLVGMHSQVERIN  212

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQ  S+DVG+ VI G+ G+GKTT+AK  YN N+  FEGS FL N++  S+ PNG V +
Sbjct  213   FWLQRRSTDVGILVIYGMSGIGKTTIAKTVYNSNFRIFEGSSFLENIKEVSQQPNGLVQI  272

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q  +  +IL GR+  I N  EG+IKI+DAI SK+V +V DDVD  + LD V   +D    
Sbjct  273   QTLLLSDILNGRKMKISNVSEGLIKIEDAISSKRVLLVLDDVDHTDQLDAVFQMKDQIYP  332

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR   LLK H+    Y ++ L  EESL+LF  +AFGQD P+E  +EYS K + 
Sbjct  333   GSKIIITTRRARLLKAHQVTEVYAVETLTQEESLELFSWHAFGQDHPIEDYIEYSEKLVD  392

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HCGGLPLALK  GS L G S+ +W+S LEKLE I + +I   L +S + L DD+D++LF+
Sbjct  393   HCGGLPLALKVFGSSLLGESVCLWKSALEKLEVIPNGEIINKLRVSYDSLQDDHDQKLFL  452

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F+G D+D+   +L+ CD + +VGIQNLID  LV +D  +K+ M  LI+ MG+EI+
Sbjct  453   HIACFFIGMDKDYIAKILDGCDFYTIVGIQNLIDRCLVIIDGWDKVQMHDLIRGMGREIV  512

Query  1038  RQDSRD  1021
             R +S++
Sbjct  513   RLESKE  518


 Score =   155 bits (393),  Expect(2) = 2e-123, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 102/140 (73%), Gaps = 3/140 (2%)
 Frame = -1

Query  2575  ARTQESGISSVPRFF-YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENI  2399
             A  Q S +SS   +  YH FLSFRG+DTRK FTDHLYTAL+NAG RTFRD DE+ RGE I
Sbjct  7     ADPQTSSVSSTSGYCRYHVFLSFRGQDTRKTFTDHLYTALVNAGFRTFRDYDEVERGEGI  66

Query  2398  DAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRK--SEGHAVFPIFYSVGRADV  2225
               EL++ I+ SR S+IV SKDYASSRWCLDEL+ IL R++  S  H V P+FY V  + V
Sbjct  67    KPELQKAIKHSRTSVIVLSKDYASSRWCLDELVMILERKRKTSNDHVVLPVFYDVYPSHV  126

Query  2224  EKQSGSFAEAFERHAKREKM  2165
             +KQ+GS A+AF RH K + +
Sbjct  127   KKQTGSLAKAFARHQKTQPL  146



>ref|XP_009345565.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1210

 Score =   310 bits (794),  Expect(2) = 8e-123, Method: Compositional matrix adjust.
 Identities = 189/368 (51%), Positives = 264/368 (72%), Gaps = 5/368 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R ALREVA L GMVL      +E++FIQ I++E+  KL+   L+V  Y VG+  RV  IN
Sbjct  152   RRALREVADLAGMVLGNR---YESQFIQDIVKEVGNKLDPKALNVAPYPVGIEDRVRGIN  208

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+DVGV VICG+GG+GK+T+A+ AYNLN  RF+GS FLA++RA SE P G V L
Sbjct  209   MWLQDGSNDVGVAVICGMGGIGKSTIARAAYNLNCARFQGSSFLADIRANSEQPYGLVRL  268

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+++  +I KG+   I++ +EGI+KIK A+ +K+V IV DDV+ LE  + ++G R+WF  
Sbjct  269   QRKLLSDIQKGKANKIYDINEGIMKIKHAVCNKRVLIVLDDVNDLEQFNAILGMREWFYP  328

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR E+LLK HE +  ++++EL++ ESL+LF  +AFGQ  P+E  ME S  A +
Sbjct  329   GSKIIITTRHEHLLKAHEDYTMFEVEELNENESLELFSWHAFGQAQPVEGYMELSRPAAQ  388

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HC GLPLAL+ LGS LSG+ +DVW+S L+KL  I   K+ + L +S + L DD+DK +F+
Sbjct  389   HCEGLPLALQVLGSSLSGKLVDVWKSALQKLCEIPDDKVHKVLRVSFDSLQDDHDKNIFL  448

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDN-DNKLMMPQLIQNMGKEI  1042
              +AC F+GK++DFAI VL+  D    +GIQNL+D  LV +DN DN+L M  L+++MG+ I
Sbjct  449   YVACFFIGKEKDFAITVLDNLDFCTRIGIQNLVDRCLVKIDNEDNRLAMHHLLRDMGRGI  508

Query  1041  LRQDSRDD  1018
             +R++S  D
Sbjct  509   IREESPQD  516


 Score =   161 bits (407),  Expect(2) = 8e-123, Method: Composition-based stats.
 Identities = 88/134 (66%), Positives = 105/134 (78%), Gaps = 1/134 (1%)
 Frame = -1

Query  2551  SSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgir  2372
             SS  R  YHAFLSFRGEDTRK+FTDHLY AL  AGI TFRDDDEI RGE+I AEL + I 
Sbjct  14    SSSYRCTYHAFLSFRGEDTRKSFTDHLYRALELAGIHTFRDDDEIKRGEDIAAELHKAIN  73

Query  2371  esrisiIVFSKDYASSRWCLDELLTILGRRKSEG-HAVFPIFYSVGRADVEKQSGSFAEA  2195
             ES++SIIVFSK+YASSRWCLDEL+ I+ RR+S+  H V P+FY V  + V KQ+GSF E+
Sbjct  74    ESKVSIIVFSKNYASSRWCLDELVKIMERRRSDDEHFVLPVFYDVDPSHVRKQTGSFEES  133

Query  2194  FERHAKREKMEVEE  2153
             F RH +R K E+E+
Sbjct  134   FHRHKERFKEEMEK  147



>ref|XP_008227883.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1139

 Score =   314 bits (804),  Expect(2) = 1e-122, Method: Compositional matrix adjust.
 Identities = 182/369 (49%), Positives = 259/369 (70%), Gaps = 6/369 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTV---LSVPSYTVGLASRVG  1945
             R+ALR+VA L GMVL    D +E++FIQ I+  I  KL+ T    L V  Y VG+ +RV 
Sbjct  149   RKALRDVADLGGMVLG---DRYESQFIQDIVEIIGNKLDHTWNRRLIVDPYVVGIDNRVE  205

Query  1944  KINKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQ  1765
              +N WL+D SSDVGV V+ G+GG+GKTT+AK+AYN N+ +F+G  FLA++RA S++ NG 
Sbjct  206   GLNMWLEDGSSDVGVAVVYGMGGIGKTTIAKIAYNRNFYKFQGGSFLADIRATSKLRNGL  265

Query  1764  VGLQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDW  1585
             V LQ+ +  ++ KG+ + I+N++EGI KIK AI  K+V +  DD+D LE  + ++G R+W
Sbjct  266   VHLQRNLLSDLQKGKAKKIYNSEEGIKKIKRAIRCKRVLVALDDIDNLEQFNAILGMREW  325

Query  1584  FSRGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVK  1405
                GSKIIITTR E+LLK HE    +K++ L + ESL+LF  +AF Q  P E  M+ S  
Sbjct  326   LHPGSKIIITTRHEHLLKAHENCAMFKVEGLLENESLELFSWHAFRQPHPGEGYMDLSRP  385

Query  1404  AIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRL  1225
              ++HCGG+PLAL+ LGS L G++ DVW++ L+ L+ I   KIQ+ L IS + L D+DKRL
Sbjct  386   VVQHCGGVPLALQVLGSSLFGKAADVWKNALQNLDVITEGKIQKILRISFDSLQDHDKRL  445

Query  1224  FVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKE  1045
             F+ IAC F+GKD+DF+  VL++C+    +GIQNL+D  L+ +D  NKL M QL+Q+MGK 
Sbjct  446   FLHIACFFIGKDKDFSTTVLDECEFATNIGIQNLVDRCLLIIDGFNKLTMHQLLQDMGKG  505

Query  1044  ILRQDSRDD  1018
             I+R++S +D
Sbjct  506   IIREESPED  514


 Score =   156 bits (395),  Expect(2) = 1e-122, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 103/143 (72%), Gaps = 0/143 (0%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A   TQ+    S  R  Y AFLSFRG DTRK FTDHLY AL  AGI TFRDDDEI RG N
Sbjct  2     AATSTQQDASPSSHRCTYDAFLSFRGTDTRKGFTDHLYRALEVAGIHTFRDDDEIERGAN  61

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVE  2222
             I AEL++ I+ESR+SIIVFSKDYASSRWCLDEL+TI+ RR++  H V PIFY V  + V 
Sbjct  62    ISAELQKAIQESRVSIIVFSKDYASSRWCLDELVTIMDRRETNEHMVMPIFYDVDPSHVR  121

Query  2221  KQSGSFAEAFERHAKREKMEVEE  2153
              Q+G F EAF RH +R   E+++
Sbjct  122   NQTGIFEEAFARHQQRFNKEMDK  144



>ref|XP_007218903.1| hypothetical protein PRUPE_ppa000524mg [Prunus persica]
 gb|EMJ20102.1| hypothetical protein PRUPE_ppa000524mg [Prunus persica]
Length=1115

 Score =   316 bits (809),  Expect(2) = 2e-122, Method: Compositional matrix adjust.
 Identities = 188/366 (51%), Positives = 251/366 (69%), Gaps = 1/366 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL EVA L GMVLQ +  G+E++FIQKI++ I  KL+RT LSV    VG+ S+V +IN
Sbjct  153   REALAEVADLAGMVLQNQAHGYESKFIQKIVKVIGDKLSRTPLSVAPNLVGMHSQVERIN  212

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQ  S+DVG+ VI G+ G+GKTT+AK  YN N+  FEGS FL N++  S+ PNG V +
Sbjct  213   FWLQRRSTDVGILVIYGMSGIGKTTIAKTVYNSNFRIFEGSSFLENIKEVSQQPNGLVQI  272

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q  +  +IL GR+  I N  EG+IKI DAI S +V +V DDVD  + LD V   +D F  
Sbjct  273   QTLLLSDILNGRKMKISNVSEGLIKIADAIISTRVLLVLDDVDHTDQLDAVFQMKDQFYP  332

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR   LLK H+    Y ++ L  EESL+LF  +AFGQD P+E  +EYS K + 
Sbjct  333   GSKIIITTRRARLLKAHQVTEVYAVETLTKEESLELFSWHAFGQDHPIEDYIEYSEKLVN  392

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HCGGLPLALK LGS L G S+ +W+S L KLE I + +I   L +S + L DD+D++LF+
Sbjct  393   HCGGLPLALKVLGSSLLGESVCLWKSALAKLEVIPNGEIINKLRVSYDSLQDDHDQKLFL  452

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F+G D+D+   +L+ CD + +VGIQNLID  LV +D  +K+ M  LI+ MG+EI+
Sbjct  453   HIACFFIGMDKDYIAKILDGCDFYTIVGIQNLIDRCLVIIDGWDKVRMHDLIRGMGREIV  512

Query  1038  RQDSRD  1021
             R +S++
Sbjct  513   RLESKE  518


 Score =   154 bits (388),  Expect(2) = 2e-122, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 103/145 (71%), Gaps = 6/145 (4%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFF----YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIG  2414
             A  R  +   SSV   F    YH FLSFRG+DTRK FTDHLYTAL+NAG RTFRD DE+ 
Sbjct  2     ALVRAADPQTSSVSSTFGYCRYHVFLSFRGQDTRKTFTDHLYTALVNAGFRTFRDYDEVE  61

Query  2413  RGENIDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRK--SEGHAVFPIFYSV  2240
             RGE I  EL++ I+ SR S+IVFSKDYASSRWCLDEL+ IL R++  S+ H V P+FY V
Sbjct  62    RGEGIKPELQKAIKHSRTSVIVFSKDYASSRWCLDELVMILERKRKTSDDHVVLPVFYDV  121

Query  2239  GRADVEKQSGSFAEAFERHAKREKM  2165
               + V+KQ+GS A+AF  H K + +
Sbjct  122   YPSHVKKQTGSLAKAFAGHQKTQPL  146



>ref|XP_007203067.1| hypothetical protein PRUPE_ppa023459mg [Prunus persica]
 gb|EMJ04266.1| hypothetical protein PRUPE_ppa023459mg [Prunus persica]
Length=1040

 Score =   315 bits (806),  Expect(2) = 3e-122, Method: Compositional matrix adjust.
 Identities = 188/367 (51%), Positives = 257/367 (70%), Gaps = 2/367 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL EVA L GMVLQ + +G+E++FI+KI++ I  KL+RT LSV    VG+ S+V +IN
Sbjct  152   REALAEVADLAGMVLQNQANGYESKFIKKIVKVIGDKLSRTPLSVAPNLVGMHSKVERIN  211

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQ  S+DVG+ VI G+ G+GKTT+AK  YN N+  FEGS FL N++  S+ PNG V +
Sbjct  212   FWLQRRSTDVGILVIYGMSGIGKTTIAKTVYNSNFRIFEGSSFLENIKEVSQQPNGLVQI  271

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +IL G +  I N  EG+IK++DAI SK+V +V DDVD ++ LD V+  +D F  
Sbjct  272   QTQLLSDILNGTKMKISNVSEGLIKVEDAISSKRVLLVLDDVDHMDQLDAVLRMKDRFYP  331

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR   LL+ H+    Y ++ L  EESL+LF  +AFGQD P+E  +EYS K + 
Sbjct  332   GSKIIITTRHARLLRAHQVTEVYAVETLTQEESLELFSWHAFGQDHPIEDYIEYSEKLVD  391

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HCGGLPLALK LGS L G S+ +W+S LEKLE I + +I   L +S + L DD+D+ LF+
Sbjct  392   HCGGLPLALKVLGSSLLGGSICLWKSALEKLEAIPNGEIINKLRVSYDSLQDDHDRELFL  451

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVT-VDNDNKLMMPQLIQNMGKEI  1042
              IAC FVG D+D  + +L+ CD + +VGIQNL+D  LVT +D  +K+ M  LI+ MG+EI
Sbjct  452   HIACFFVGMDKDNIVKILDGCDFYTIVGIQNLVDRCLVTIIDGWDKVHMHDLIRGMGREI  511

Query  1041  LRQDSRD  1021
             +R +S++
Sbjct  512   VRLESKE  518


 Score =   154 bits (390),  Expect(2) = 3e-122, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 102/142 (72%), Gaps = 4/142 (3%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A+ +T  S  S   R  YH FLSFRG+DTRK FTDHLYTAL++AG  TFRDDDE+ RGE 
Sbjct  7     ADPQTSSSNASRYCR--YHVFLSFRGQDTRKTFTDHLYTALVSAGFHTFRDDDEVERGEG  64

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTIL--GRRKSEGHAVFPIFYSVGRAD  2228
             I  EL++ I+ SR S+IVFSKDY SS+WCLDEL+ IL   RR S+ H V P+FY V  + 
Sbjct  65    IKPELQKAIKHSRTSVIVFSKDYVSSQWCLDELVMILERKRRTSDDHVVLPVFYDVDPSH  124

Query  2227  VEKQSGSFAEAFERHAKREKME  2162
             V KQ+GS A+AF RH K + ++
Sbjct  125   VRKQTGSLAKAFARHQKSQPLQ  146



>ref|XP_007221574.1| hypothetical protein PRUPE_ppa025931mg [Prunus persica]
 gb|EMJ22773.1| hypothetical protein PRUPE_ppa025931mg [Prunus persica]
Length=1188

 Score =   318 bits (814),  Expect(2) = 3e-122, Method: Compositional matrix adjust.
 Identities = 185/370 (50%), Positives = 260/370 (70%), Gaps = 7/370 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTV---LSVPSYTVGLASRVG  1945
             R+ALR+VA L GMVL    D +E++F+Q I+  I  KL+ T    L V  Y VG+  RV 
Sbjct  147   RKALRDVADLGGMVLG---DRYESQFVQDIVEIIGNKLDHTWNRRLRVDPYVVGMDYRVR  203

Query  1944  KINKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQ  1765
              +N WL+D SSDVGV V+ G+GG+GKTT+AK AYN NY++F+GS FLA++RA S++PNG 
Sbjct  204   GLNMWLEDGSSDVGVAVVYGMGGIGKTTIAKTAYNQNYNKFQGSSFLADIRATSKLPNGF  263

Query  1764  VGLQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDW  1585
             V LQ+ +  ++ KG+ + I++ DEGI KIK AI  K+V I  DDVD LE  + ++G R+W
Sbjct  264   VHLQRNLLSDLQKGKAKKIYSLDEGITKIKRAIRCKRVLIALDDVDNLEQFNAILGMREW  323

Query  1584  FSRGSKIIITTRCENLLKGHERH-LQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSV  1408
                GSKIIITTR E+LLK HE + + +K++ L + ESL+LF  +AF Q  P E  M+ S 
Sbjct  324   LHPGSKIIITTRHEHLLKAHENYAILFKVEGLHEYESLELFSWHAFRQPHPSEGYMDLSR  383

Query  1407  KAIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKR  1228
               ++HCGG+PLAL+ LGS L G++ DVW++ L+ L+ I   KIQ+ L IS + L D+DKR
Sbjct  384   PVVQHCGGVPLALQVLGSSLFGKAADVWKNALQNLDVITEGKIQKILRISFDSLQDHDKR  443

Query  1227  LFVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGK  1048
             LF+ IAC FVGKD DF+  VL++C+    +G+QNL+D  L+ +D  NKL M QL+Q+MG+
Sbjct  444   LFLHIACFFVGKDNDFSTTVLDECEFATNIGMQNLVDRCLLIIDGFNKLTMHQLLQDMGR  503

Query  1047  EILRQDSRDD  1018
              I+R++S +D
Sbjct  504   GIIREESPED  513


 Score =   151 bits (382),  Expect(2) = 3e-122, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 103/143 (72%), Gaps = 2/143 (1%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A   TQ+    S  R  Y AFLSFRG DTRK FTDHLY AL  AGI TFRDDDEI RG N
Sbjct  2     AATSTQQD--PSSHRCTYDAFLSFRGTDTRKGFTDHLYRALEVAGIHTFRDDDEIERGAN  59

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVE  2222
             I AEL++ I+ESR+SIIVFSKDYASSRWCLDEL+TI+ RR++  H V PIFY V  + V 
Sbjct  60    ISAELQKAIQESRVSIIVFSKDYASSRWCLDELVTIMDRRETNEHMVMPIFYDVDPSHVR  119

Query  2221  KQSGSFAEAFERHAKREKMEVEE  2153
              Q+G F +AF RH +R   E+++
Sbjct  120   NQTGIFEQAFARHQQRFNKEMDK  142



>ref|XP_008232444.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1140

 Score =   312 bits (800),  Expect(2) = 3e-122, Method: Compositional matrix adjust.
 Identities = 186/367 (51%), Positives = 254/367 (69%), Gaps = 2/367 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL EVA L GMVLQ + +G+E++FI+KI++ I  KL+RT LSV    VG+ SRV +IN
Sbjct  141   REALAEVADLAGMVLQNQANGYESKFIKKIVKVIGDKLSRTPLSVAPNLVGMHSRVERIN  200

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQ  S+DVG+ VI G+ G+GKTT+AK  YN N+  F+GS FL N++  S+ PNG V +
Sbjct  201   FWLQRRSTDVGILVIYGMSGIGKTTIAKTVYNSNFRIFKGSSFLENIKEVSQQPNGLVQI  260

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +IL G +  I N  EG++KI +AI S+++ +V DDVD ++ LD V+  +D F  
Sbjct  261   QTQLLSDILNGTKMKISNVSEGLVKIANAISSRRILLVLDDVDHMDQLDAVLQMKDQFYP  320

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR   LLK H+    Y ++ L  EESL+LF  + FGQD P+E  +EYS K + 
Sbjct  321   GSKIIITTRRARLLKAHQVTEVYAVETLTQEESLELFSWHTFGQDHPIEDYIEYSEKLVD  380

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HCGGLPLALK LGS L G S+ +W+S LEKLE I +  I   L +S + L DD+D+ LF+
Sbjct  381   HCGGLPLALKVLGSSLLGESICLWKSALEKLEAIPNGDIINKLRVSYDSLQDDHDRELFL  440

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVT-VDNDNKLMMPQLIQNMGKEI  1042
              IAC FVG D+D  + +L+ CD + +VGIQNLID  LVT +D  +K+ M  LI+ MG+EI
Sbjct  441   HIACFFVGMDKDNIVKILDGCDFYTIVGIQNLIDRCLVTIIDGRDKVQMHDLIRGMGREI  500

Query  1041  LRQDSRD  1021
             +R +S++
Sbjct  501   VRLESKE  507


 Score =   156 bits (395),  Expect(2) = 3e-122, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 96/125 (77%), Gaps = 2/125 (2%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             YH FLSFRG+DTRK FTDHLYTAL+NAG RTFRD DE+ RGE I  EL++ I+ SR S+I
Sbjct  11    YHVFLSFRGQDTRKTFTDHLYTALVNAGFRTFRDYDEVERGEGIKPELQKAIKHSRTSVI  70

Query  2350  VFSKDYASSRWCLDELLTILGR--RKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAK  2177
             VFSKDYASSRWCLDEL+ IL R  R S+ H V P+FY V  + V KQ+GS A+AF RH K
Sbjct  71    VFSKDYASSRWCLDELVMILERKSRTSDDHVVLPVFYDVDPSHVRKQTGSLAKAFARHQK  130

Query  2176  REKME  2162
              + ++
Sbjct  131   SQPLQ  135



>ref|XP_008228036.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=822

 Score =   313 bits (801),  Expect(2) = 4e-122, Method: Compositional matrix adjust.
 Identities = 183/370 (49%), Positives = 256/370 (69%), Gaps = 7/370 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKL----NRTVLSVPSYTVGLASRV  1948
             ++ALR+VA L GMVL    D +E++FIQ I+  I  KL    NR +     Y VG+ +RV
Sbjct  149   KKALRDVADLGGMVLG---DRYESQFIQDIVEVIGNKLDHTWNRRLRVDDPYVVGIDNRV  205

Query  1947  GKINKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNG  1768
               +N WL+D SSDVGV V+ G+GG+GKTT+AK AYN N+ +F+GS FLA++RA S++PNG
Sbjct  206   EGLNMWLEDGSSDVGVAVVYGMGGIGKTTIAKTAYNQNFYKFQGSSFLADIRATSKLPNG  265

Query  1767  QVGLQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARD  1588
              V LQ+ +   + KG+ + I++ DEGI KIK AI  K+V I  DDVD LE  + ++G R+
Sbjct  266   LVHLQRNLLSGLQKGKAKKIYSLDEGITKIKRAIRCKRVLIALDDVDNLEQFNAILGMRE  325

Query  1587  WFSRGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSV  1408
             W   GSKIIITTR E+LLK HE    +K+K L++ ESL+LF  +AF Q  P E  M+ S 
Sbjct  326   WLHPGSKIIITTRHEHLLKAHENCAMFKVKGLNENESLELFSWHAFRQPHPSEGHMDLSR  385

Query  1407  KAIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKR  1228
               ++HCGG+PLAL+ LGS L G++ DVW++ L+ L+ I   KIQ+ L IS + L D+ KR
Sbjct  386   PVVQHCGGVPLALQVLGSSLFGKAADVWKNALQNLDVITEGKIQKILRISFDSLQDHVKR  445

Query  1227  LFVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGK  1048
             LF+ IAC F+GKD+DF+  VL++C+    +GIQNL+D  L+ +D  NKL M QL+Q+MG 
Sbjct  446   LFLHIACFFIGKDKDFSTTVLDECEFATNIGIQNLVDRCLLIIDGFNKLTMHQLLQDMGG  505

Query  1047  EILRQDSRDD  1018
              I+R++S +D
Sbjct  506   GIIREESPED  515


 Score =   156 bits (394),  Expect(2) = 4e-122, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 108/150 (72%), Gaps = 3/150 (2%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A   TQ++   S  R  Y AFLSFRG DTRK FTDHLY AL  AGI TFRDDDEI RG N
Sbjct  2     AATSTQQNASPSSHRCTYDAFLSFRGTDTRKGFTDHLYRALEVAGIHTFRDDDEIERGAN  61

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVE  2222
             I AEL++ I+ESR+SIIVFSKDYASSRWCLDEL+TI+ RR++  H V PIFY V  + V 
Sbjct  62    ILAELQKAIQESRVSIIVFSKDYASSRWCLDELVTIMDRRETNEHMVMPIFYDVDPSHVR  121

Query  2221  KQSGSFAEAFERHAKREKMEVEEGRVE-WK  2135
              Q+G F EAF RH +R   E++  +VE WK
Sbjct  122   NQTGIFEEAFARHQQRFNKEMD--KVEKWK  149



>ref|XP_004308481.1| PREDICTED: TMV resistance protein N-like [Fragaria vesca subsp. 
vesca]
Length=1268

 Score =   307 bits (787),  Expect(2) = 3e-121, Method: Compositional matrix adjust.
 Identities = 183/374 (49%), Positives = 254/374 (68%), Gaps = 1/374 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL+EVA L GMVLQ + DGHE++FI+KI+  +V+KL R  L V  + VG+   V  IN
Sbjct  149   RKALKEVADLAGMVLQNQNDGHESKFIKKIVDMLVEKLCRIPLGVDPHLVGIQYWVESIN  208

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD SSDVG+  I G+GG+GKTT+A+V YN ++ +FEGS FL N+R  SE  NG V +
Sbjct  209   SWLQDGSSDVGILGIYGIGGIGKTTIARVVYNSSFKKFEGSSFLENIRETSEQYNGLVRI  268

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+  ++   RE  I    EGI +IKD IGSKKV +V DDVD  + L  +   R+ F  
Sbjct  269   QKQLLYDLSNRREVKIHMVAEGINRIKDVIGSKKVLLVLDDVDHRDQLQAIFSMRNCFFP  328

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             G KIIITTR   LLK ++   +  I+ LD   S +LFC +AFGQ+ P+E   E S + ++
Sbjct  329   GRKIIITTRRPGLLKLYKDVKECCIQTLDSGGSFELFCWHAFGQNHPIEGYFELSKRIVQ  388

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             H GGLPLALK LGS L+G+S+ VW S+L+KL+     +I + L IS + L DD+DK +F+
Sbjct  389   HIGGLPLALKILGSSLTGQSLAVWVSQLQKLDTTPDTEILKKLRISYDALQDDHDKDIFL  448

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F+GKD+D  I +L+ C  + +VGIQNLID  L+T+D  NK+ MPQ+I++MG++I+
Sbjct  449   HIACFFIGKDKDVIIKILDGCGFYSLVGIQNLIDRCLITIDTSNKVKMPQMIRDMGRDIV  508

Query  1038  RQDSRDDLHTLSKL  997
             RQ++  +    S+L
Sbjct  509   RQENAKNPDKRSRL  522


 Score =   158 bits (400),  Expect(2) = 3e-121, Method: Composition-based stats.
 Identities = 80/142 (56%), Positives = 101/142 (71%), Gaps = 2/142 (1%)
 Frame = -1

Query  2581  AEARTQESGISSVPRF--FYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRG  2408
             A  + QE G S   R    YH FLS+RG+DTRK FTDHLYTAL+NAGIRTFRDD+E+ RG
Sbjct  2     APVKIQEPGSSIASRLPCSYHVFLSYRGQDTRKTFTDHLYTALVNAGIRTFRDDNELERG  61

Query  2407  ENIDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRAD  2228
              +I  EL + I+ SR S+IVFSKDYASS WCLDEL+ IL ++++  H V P+FY +    
Sbjct  62    HDIKPELEKAIQLSRGSVIVFSKDYASSGWCLDELVMILEQKRTSDHVVLPVFYDIDPTH  121

Query  2227  VEKQSGSFAEAFERHAKREKME  2162
             V KQ+GS A+A  RH K++  E
Sbjct  122   VRKQTGSVAKALARHGKKQSPE  143



>ref|XP_008224240.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=974

 Score =   322 bits (824),  Expect(2) = 6e-121, Method: Compositional matrix adjust.
 Identities = 184/368 (50%), Positives = 257/368 (70%), Gaps = 4/368 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R ALREVA L GMVLQ   DG+E++FI +I++ I  KL+RT  ++  Y +G+ SRV  IN
Sbjct  150   RAALREVADLSGMVLQNHADGYESKFIMQIVKVIDNKLSRTPFAIAPYPIGIDSRVETIN  209

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+DVG+ +I G+GG+GKTT+AK AYN+N+ RFE SCFL +VR  S  PNG V L
Sbjct  210   SWLQDGSTDVGILLINGVGGIGKTTLAKFAYNVNFRRFERSCFLEDVREISNQPNGLVHL  269

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q   +I+ GRE  I +  EG+ KI+DAI SK V +V DDVD ++ +D +   +DWF  
Sbjct  270   QIQFLHHIMSGREVKIHSVSEGVKKIRDAIISKTVLLVLDDVDHMDQIDAIFFMQDWFCP  329

Query  1575  GSKIIITTRCENLLKGHE--RHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKA  1402
             GSKI+ITTRC  LL+GH+  +   Y ++ LD +ESL+LF  +AFGQD P+E  +  S + 
Sbjct  330   GSKIMITTRCAGLLRGHQVAKSKVYDVETLDVDESLQLFSWHAFGQDHPIEGYISLSKRV  389

Query  1401  IRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDY--DKR  1228
                CGGLPLAL+ LGS LSGR +DVW S LEKL+ I  ++I + L IS + L D   D+ 
Sbjct  390   EDQCGGLPLALQVLGSSLSGRRIDVWESTLEKLKTIPDNQIIKKLRISYDGLQDNPDDQN  449

Query  1227  LFVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGK  1048
             LF+ IAC FVG+ +D+ + +L+ C+   +VGI+NL++  LVT+D++N + M Q+I +MG+
Sbjct  450   LFLHIACFFVGQGKDYVVRILDGCNFFTIVGIENLVNRCLVTIDDENNVKMHQMIWDMGR  509

Query  1047  EILRQDSR  1024
             EI+R +S+
Sbjct  510   EIVRLESK  517


 Score =   143 bits (361),  Expect(2) = 6e-121, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 99/139 (71%), Gaps = 4/139 (3%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGEDTRKNFTDHLYTA +  G  TFRDD+E+ RG +I  EL++ I++SR S+I
Sbjct  21    YDVFLSFRGEDTRKNFTDHLYTACVEKGFNTFRDDEELERGVDIKPELKKAIQQSRSSVI  80

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKRE  2171
             VFSKDY+SSRWCLDEL+ ILG+++   H V P+FY V  + V  Q+G  AEAF RH   E
Sbjct  81    VFSKDYSSSRWCLDELVFILGQKRISEHVVLPVFYDVDPSHVRNQTGCVAEAFARH---E  137

Query  2170  KMEVEEGRV-EWKGKGGEV  2117
             + ++   +V +W+    EV
Sbjct  138   ENQLSTNKVKQWRAALREV  156



>ref|XP_008343165.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=1192

 Score =   310 bits (795),  Expect(2) = 6e-121, Method: Compositional matrix adjust.
 Identities = 184/391 (47%), Positives = 268/391 (69%), Gaps = 4/391 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL +VA L GMVL    D +E +FIQ+I+ EI  K++   L V  ++VG+  RV ++N
Sbjct  147   RRALADVASLGGMVLG---DRYEGQFIQEIVEEIRNKVDHAALDVAPFSVGMDYRVERLN  203

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+DVGV VICG+GG+GK+T+AK AYN N+DRF+GS FLA++R +SE PNG   L
Sbjct  204   MWLQDGSNDVGVAVICGMGGIGKSTIAKAAYNRNFDRFQGSSFLADIRESSEQPNGFARL  263

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+++  +I KG+ + ++N DEG I+IK A+G KKV IV DDV   + L+ ++G ++W   
Sbjct  264   QRKLLSDIQKGKAKKVYNMDEGTIRIKQAVGYKKVLIVLDDVSNRDQLNAILGMQEWLHP  323

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR E+LL  +E   ++ ++ELD++ESL+LF  +AF Q  P+E  ME S   ++
Sbjct  324   GSKIIITTRHEHLLNAYEVFEKFMVQELDEDESLELFSWHAFRQSHPVEGYMELSRHVVQ  383

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HCGGLPLAL+ LGS LSG+S++VW+S L+KL+ I + KI + L IS + L DD+DK LF+
Sbjct  384   HCGGLPLALQVLGSSLSGKSVEVWQSALKKLDVIPNDKIFKVLRISFDSLQDDHDKNLFL  443

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IA  F GK  D+   +L+  +    +GI+NL+D  LV +   N+L+M QL++NM  EI+
Sbjct  444   HIASFFTGKTMDYTSTMLDSLEFCTRIGIENLVDRCLVKISCPNRLVMHQLVRNMAMEII  503

Query  1038  RQDSRDDLHTLSKLLDQLVSSTESTGNGVVN  946
             R+++ DD    S++L +  S+     +G  N
Sbjct  504   REEAPDDPGKRSRVLQKDASNILRKLSGTEN  534


 Score =   154 bits (389),  Expect(2) = 6e-121, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 100/135 (74%), Gaps = 4/135 (3%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresri  2360
             R  YHAFLSFRG DTRK FTDHLY AL  AGI TFRDDDEI RGENI+ EL + I+ES++
Sbjct  13    RCSYHAFLSFRGPDTRKGFTDHLYIALEQAGIHTFRDDDEIERGENIELELDKAIQESQV  72

Query  2359  siIVFSKDYASSRWCLDELLTILGRRKSEG-HAVFPIFYSVGRADVEKQSGSFAEAFERH  2183
             SI VFSK YASSRWCL+EL  I+ RR +   H V P+FY V  +DV KQSG FAEAF RH
Sbjct  73    SIXVFSKXYASSRWCLNELXKIVERRNTNPRHVVLPVFYDVDPSDVRKQSGPFAEAFARH  132

Query  2182  AKR---EKMEVEEGR  2147
              +R   EK +VE+ R
Sbjct  133   EERFSTEKDKVEQWR  147



>ref|XP_007023241.1| TMV resistance protein N, putative [Theobroma cacao]
 gb|EOY25863.1| TMV resistance protein N, putative [Theobroma cacao]
Length=1098

 Score =   302 bits (773),  Expect(2) = 9e-121, Method: Compositional matrix adjust.
 Identities = 182/381 (48%), Positives = 256/381 (67%), Gaps = 19/381 (5%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R ALREVA L GM+L+   DG+E++FIQ II+++  KL+RT L V  Y VG+ +    IN
Sbjct  148   RTALREVADLCGMLLE---DGYESQFIQDIIKQVQNKLHRTTLYVFPYLVGIDALAAHIN  204

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WL+D S+ VG+  ICG+GG+GKTT+AK+ YN N+ RFE   FLA+VR  ++  NG V L
Sbjct  205   WWLRDGSNKVGMATICGIGGIGKTTIAKLVYNQNFQRFESYSFLADVRETTQESNGLVQL  264

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +ILKG+   I+N D+GI KIK+ I  +++  V DDVD  + +  ++G +  F  
Sbjct  265   QRQLISDILKGKANKIYNLDDGITKIKETICHRRMLFVLDDVDDSKKVTEIVGVQIPFHP  324

Query  1575  GSKIIITTRCENLLK--------GHERHLQY-------KIKELDDEESLKLFCRYAFGQD  1441
             GSKII+T+R   LL           E    Y       ++KEL   ESL+LF  YAF Q+
Sbjct  325   GSKIIVTSRHRCLLSDLFIKQMFDLEASSNYGDLCKVFEVKELAFNESLQLFNWYAFRQN  384

Query  1440  DPLEHLMEYSVKAIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEI  1261
             DP+E  M+Y+   ++HCGGLPLAL+ LGS LS +S++VWRS LEK + I H KIQ+ L I
Sbjct  385   DPIESYMDYAKSIVKHCGGLPLALQVLGSSLSSKSINVWRSALEKFKAIPHSKIQKILRI  444

Query  1260  SLNPL-DDYDKRLFVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNK  1084
             S + L DD+DK LF+ IAC F+ +DRD+ I +L  CD + V+GI+NLI+ SL+ ++  NK
Sbjct  445   SYDSLQDDHDKNLFLDIACVFIEEDRDYTIKILYGCDYYTVIGIENLINRSLLVINERNK  504

Query  1083  LMMPQLIQNMGKEILRQDSRD  1021
             LMM Q+I++MG+ I+RQ+S D
Sbjct  505   LMMHQMIRDMGRHIIRQESFD  525


 Score =   162 bits (410),  Expect(2) = 9e-121, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 112/155 (72%), Gaps = 2/155 (1%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A +  QES  SS+ ++ YH FLSFRG DTRKNFT+HLY AL++AGI TFRDDDEI RGEN
Sbjct  2     AVSMVQESS-SSISQYTYHVFLSFRGADTRKNFTNHLYMALVHAGIHTFRDDDEIERGEN  60

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVE  2222
             I  E+ R + +S++SIIVFSK+YASS WCL+EL+ I+  RK   H V PIFY V  + V+
Sbjct  61    IKDEIERALHDSKMSIIVFSKNYASSTWCLNELVKIMEHRKFSKHIVLPIFYDVNPSQVK  120

Query  2221  KQSGSFAEAFERHAKREKMEVEEGRVEWKGKGGEV  2117
             KQ+GSFAEAF RH +  K E++  +  W+    EV
Sbjct  121   KQTGSFAEAFARHEESFKYEMDMVQ-RWRTALREV  154



>ref|XP_008362577.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=871

 Score =   305 bits (780),  Expect(2) = 1e-120, Method: Compositional matrix adjust.
 Identities = 192/438 (44%), Positives = 286/438 (65%), Gaps = 22/438 (5%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL +VA L GMVL    D +E +FIQ ++ EI  KL+   L V  + VG+ +RV  +N
Sbjct  147   RRALGDVASLGGMVLG---DRYEGQFIQDVVEEISNKLDPAALDVAPFAVGIDNRVQDLN  203

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+DVGV VICG+GG+GK+T+ K AYN N+DRF+GS FLA++R +SE PNG   L
Sbjct  204   MWLQDGSNDVGVAVICGMGGIGKSTIVKAAYNQNFDRFQGSSFLADIRESSEQPNGFARL  263

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+++  +I KG  + ++N  EGI +IK A+G K+V IV DDV+  + L+ ++G R+W   
Sbjct  264   QRKLLLDIQKGNAKKVYNVAEGISRIKRAVGYKRVLIVLDDVNSRDQLNAILGMREWLHP  323

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR E+LL  HE   ++ ++ELD++ESL+LF  +AFGQ  P+E  ME S   ++
Sbjct  324   GSKIIITTRHEHLLNAHEVCEKFMVRELDEDESLELFSWHAFGQSHPVEGYMELSRHVVQ  383

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HCGGLPLA++ LGS LSG+S++VW+S L+KL+ I + KIQ+ L IS + L +D+D+ LF+
Sbjct  384   HCGGLPLAIQVLGSSLSGKSVEVWQSALQKLDVIPNDKIQKVLRISFDSLHEDHDQNLFL  443

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IA  F GK  D+ I +L+  +    VGI+NL+D  LVT+    KL+M QL++NM   I+
Sbjct  444   HIASFFTGKTMDYIITILDNLEFCTRVGIENLVDRCLVTIQG-XKLVMHQLLRNMAMAII  502

Query  1038  RQDSRDDLHTLSKLLD-------QLVSSTESTGNGVVNESASHV---NSPKRPYSQEFED  889
             R++S  D    S++L        + +S TE+    ++N ++      +  KR ++++++ 
Sbjct  503   RKESPHDPGKRSRVLQNDASNILRKLSGTENIKGLMLNLASKRTFVGSDNKRCHAEDYDG  562

Query  888   NSIIPHQSNWKRRFMGIF  835
             N         +RR +G F
Sbjct  563   NCS-------RRRRLGFF  573


 Score =   159 bits (402),  Expect(2) = 1e-120, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 110/142 (77%), Gaps = 2/142 (1%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresri  2360
             R  YHAFLSFRG+DTR+ FTDHLY AL  AGI TFRDDDEI RGENI++EL + I+ES++
Sbjct  13    RCSYHAFLSFRGQDTRRGFTDHLYRALELAGIHTFRDDDEIKRGENIESELDKAIQESQV  72

Query  2359  siIVFSKDYASSRWCLDELLTILGRRKSEG-HAVFPIFYSVGRADVEKQSGSFAEAFERH  2183
             SIIVFSKDYASSRWCL+ELL I+ RR ++  H V P+FY V  +DV KQSG+FA+AF RH
Sbjct  73    SIIVFSKDYASSRWCLNELLKIVERRNTDHRHVVLPVFYDVDPSDVRKQSGTFAKAFARH  132

Query  2182  AKREKMEVEEGRVEWKGKGGEV  2117
              +R   E+++   +W+   G+V
Sbjct  133   EERFSTEMDKVE-QWRRALGDV  153



>ref|XP_009373216.1| PREDICTED: TMV resistance protein N-like isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009373224.1| PREDICTED: TMV resistance protein N-like isoform X1 [Pyrus x 
bretschneideri]
Length=1104

 Score =   304 bits (778),  Expect(2) = 1e-120, Method: Compositional matrix adjust.
 Identities = 180/369 (49%), Positives = 253/369 (69%), Gaps = 7/369 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTV---LSVPSYTVGLASRVG  1945
             R ALR+VA L GMVL+E    +E +FIQ I++ I  KL+      L V  Y +G  + V 
Sbjct  148   RRALRDVADLGGMVLRER---YEWQFIQDIVKAIGNKLDYMTNRRLRVDPYVIGSGNYVE  204

Query  1944  KINKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQ  1765
              +N WL+  S+DVGV VI G+GG+GKTT+AK+AYN N+ +F+ S FL+++R  S+  NG 
Sbjct  205   SLNTWLEYGSNDVGVAVIHGMGGIGKTTIAKIAYNQNFQKFQASSFLSDIRETSKQANGF  264

Query  1764  VGLQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDW  1585
             V LQ+ +  +I KG+ E I+N +EGI+KIK  +  K+V IV DDV+  E  + +IG RDW
Sbjct  265   VHLQRNLLSDIQKGKMEEIYNPNEGIVKIKRVVRCKRVLIVLDDVENSEQFNAIIGMRDW  324

Query  1584  FSRGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVK  1405
             F  GSKIIITTR E+LLK HE  +++K++ L ++ESL+LF  +AF Q  P E  ME S  
Sbjct  325   FHPGSKIIITTRHEHLLKAHEV-VRFKVEGLHEDESLELFNWHAFRQPHPQEGYMELSRP  383

Query  1404  AIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRL  1225
              + HCGG+PLAL+ LGS L G++ DVW++ L  L+ I   KIQ+ L IS + L D++KRL
Sbjct  384   VVEHCGGVPLALQVLGSSLFGKTADVWKNALHNLDVISEGKIQKILGISFDSLQDHEKRL  443

Query  1224  FVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKE  1045
             F+ IAC FVGKD+DF   +L++CD    VG+Q+L+D  LV ++  NKLMM QL+Q+MG+ 
Sbjct  444   FLHIACFFVGKDKDFTTTILDECDFSTEVGLQHLVDRCLVEINVHNKLMMHQLLQDMGRA  503

Query  1044  ILRQDSRDD  1018
             I R++S +D
Sbjct  504   ISREESPED  512


 Score =   159 bits (403),  Expect(2) = 1e-120, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 112/144 (78%), Gaps = 1/144 (1%)
 Frame = -1

Query  2566  QESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAEL  2387
             Q++  SS  R  Y AFLSF+G DTRK+FTDHLY AL +AGI TFRDDDEI RG NI+ EL
Sbjct  6     QKNASSSSYRCTYDAFLSFKGADTRKSFTDHLYNALESAGIHTFRDDDEIERGANIEQEL  65

Query  2386  rrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGS  2207
             +  I+ESR+S+IVFSKDYASSRWCL+EL  I+ R++++GH V P+FY+V  +DV KQ+GS
Sbjct  66    QTAIQESRVSVIVFSKDYASSRWCLNELALIMERKRTDGHMVMPVFYAVEPSDVRKQTGS  125

Query  2206  FAEAFERHAKREKMEVEEGRVEWK  2135
             F E+F RH +R K E+++   EW+
Sbjct  126   FEESFTRHEERFKDEIDKVE-EWR  148



>ref|XP_009373229.1| PREDICTED: TMV resistance protein N-like isoform X2 [Pyrus x 
bretschneideri]
Length=893

 Score =   303 bits (777),  Expect(2) = 1e-120, Method: Compositional matrix adjust.
 Identities = 180/369 (49%), Positives = 253/369 (69%), Gaps = 7/369 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTV---LSVPSYTVGLASRVG  1945
             R ALR+VA L GMVL+E    +E +FIQ I++ I  KL+      L V  Y +G  + V 
Sbjct  148   RRALRDVADLGGMVLRER---YEWQFIQDIVKAIGNKLDYMTNRRLRVDPYVIGSGNYVE  204

Query  1944  KINKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQ  1765
              +N WL+  S+DVGV VI G+GG+GKTT+AK+AYN N+ +F+ S FL+++R  S+  NG 
Sbjct  205   SLNTWLEYGSNDVGVAVIHGMGGIGKTTIAKIAYNQNFQKFQASSFLSDIRETSKQANGF  264

Query  1764  VGLQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDW  1585
             V LQ+ +  +I KG+ E I+N +EGI+KIK  +  K+V IV DDV+  E  + +IG RDW
Sbjct  265   VHLQRNLLSDIQKGKMEEIYNPNEGIVKIKRVVRCKRVLIVLDDVENSEQFNAIIGMRDW  324

Query  1584  FSRGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVK  1405
             F  GSKIIITTR E+LLK HE  +++K++ L ++ESL+LF  +AF Q  P E  ME S  
Sbjct  325   FHPGSKIIITTRHEHLLKAHEV-VRFKVEGLHEDESLELFNWHAFRQPHPQEGYMELSRP  383

Query  1404  AIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRL  1225
              + HCGG+PLAL+ LGS L G++ DVW++ L  L+ I   KIQ+ L IS + L D++KRL
Sbjct  384   VVEHCGGVPLALQVLGSSLFGKTADVWKNALHNLDVISEGKIQKILGISFDSLQDHEKRL  443

Query  1224  FVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKE  1045
             F+ IAC FVGKD+DF   +L++CD    VG+Q+L+D  LV ++  NKLMM QL+Q+MG+ 
Sbjct  444   FLHIACFFVGKDKDFTTTILDECDFSTEVGLQHLVDRCLVEINVHNKLMMHQLLQDMGRA  503

Query  1044  ILRQDSRDD  1018
             I R++S +D
Sbjct  504   ISREESPED  512


 Score =   160 bits (404),  Expect(2) = 1e-120, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 112/144 (78%), Gaps = 1/144 (1%)
 Frame = -1

Query  2566  QESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAEL  2387
             Q++  SS  R  Y AFLSF+G DTRK+FTDHLY AL +AGI TFRDDDEI RG NI+ EL
Sbjct  6     QKNASSSSYRCTYDAFLSFKGADTRKSFTDHLYNALESAGIHTFRDDDEIERGANIEQEL  65

Query  2386  rrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGS  2207
             +  I+ESR+S+IVFSKDYASSRWCL+EL  I+ R++++GH V P+FY+V  +DV KQ+GS
Sbjct  66    QTAIQESRVSVIVFSKDYASSRWCLNELALIMERKRTDGHMVMPVFYAVEPSDVRKQTGS  125

Query  2206  FAEAFERHAKREKMEVEEGRVEWK  2135
             F E+F RH +R K E+++   EW+
Sbjct  126   FEESFTRHEERFKDEIDKVE-EWR  148



>ref|XP_007220726.1| hypothetical protein PRUPE_ppa023276mg [Prunus persica]
 gb|EMJ21925.1| hypothetical protein PRUPE_ppa023276mg [Prunus persica]
Length=1201

 Score =   317 bits (813),  Expect(2) = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/368 (50%), Positives = 264/368 (72%), Gaps = 5/368 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL++ A L GM L+   D +E++FIQ I++EI  KL+  VL+V  Y VG+  RV  IN
Sbjct  153   RRALKDAADLAGMALK---DSYESQFIQDIVKEIGNKLDPKVLNVAPYAVGIDDRVQGIN  209

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WL+D S+ VGV VI G+GG+GKTT+AK AYN N+ RF+GS FLA++R A+E P G V L
Sbjct  210   MWLEDGSNAVGVAVIYGMGGIGKTTIAKAAYNRNFGRFQGSSFLADIREAAEQPYGFVRL  269

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+++  +I KG+ + I N DEGIIKIK A+ +K++ IV DDV+ ++  + ++G R+WF  
Sbjct  270   QRKLLSDIQKGKAKKIDNIDEGIIKIKHAVCNKRLLIVLDDVNDMDQFNAILGMREWFYP  329

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR E+LLK HE    ++++EL++ ESL+LF  +AFGQ  P+E  ME S  A+ 
Sbjct  330   GSKIIITTRHEHLLKAHEGCTMFEVEELNEYESLELFSWHAFGQPQPIEGYMELSRPAVE  389

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HCGG+PLAL+ LGS LSG+ +DVWRS L+KL  I + KIQ+ L IS + L DD+D+ +F+
Sbjct  390   HCGGIPLALQVLGSSLSGKEVDVWRSALQKLCEIPNVKIQKILRISYDSLQDDHDQNIFL  449

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDN-DNKLMMPQLIQNMGKEI  1042
              IA  F+GK++DF I +L+  + +  +GIQNL+D  LV ++N DN+L M  L+++MG+ I
Sbjct  450   HIAYFFIGKEKDFTIAILDNLNFYTRIGIQNLVDRCLVKINNEDNRLNMHHLLRDMGRGI  509

Query  1041  LRQDSRDD  1018
             +R++S  D
Sbjct  510   VREESPQD  517


 Score =   144 bits (364),  Expect(2) = 4e-120, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 98/130 (75%), Gaps = 2/130 (2%)
 Frame = -1

Query  2521  FLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiIVFS  2342
             FLSFRGEDTRK FTDHLY AL  AGI TFRDDDEI RG +I AEL + I ES++SIIVFS
Sbjct  25    FLSFRGEDTRKGFTDHLYRALELAGIHTFRDDDEIERGADIAAELNKAINESKVSIIVFS  84

Query  2341  KDYASSRWCLDELLTILGRRK-SEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKREKM  2165
             ++YASSRWCLDEL+ I+ RRK  +GH V P+FY V  + V  Q GSFAEAF RH +R K 
Sbjct  85    QNYASSRWCLDELVKIMERRKHDDGHIVMPVFYHVDPSHVRNQRGSFAEAFSRHEERFKE  144

Query  2164  EVEEGRVEWK  2135
             E+ +   EW+
Sbjct  145   EMNKVE-EWR  153



>ref|XP_009361379.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=651

 Score =   310 bits (795),  Expect(2) = 5e-120, Method: Compositional matrix adjust.
 Identities = 189/368 (51%), Positives = 264/368 (72%), Gaps = 5/368 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R ALREVA L GMVL      +E++FIQ I++E+  KL+   L+V  Y VG+  RV  IN
Sbjct  152   RRALREVADLAGMVLGNR---YESQFIQDIVKEVGNKLDPKALNVAPYPVGIEDRVRGIN  208

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+DVGV VICG+GG+GK+T+A+ AYNLN  RF+GS FLA++RA SE P G V L
Sbjct  209   MWLQDGSNDVGVAVICGMGGIGKSTIARAAYNLNCARFQGSSFLADIRANSEQPYGLVRL  268

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+++  +I KG+   I++ +EGI+KIK A+ +K+V IV DDV+ L+  + ++G R+WF  
Sbjct  269   QRKLLSDIQKGKANKIYDINEGIMKIKHAVCNKRVLIVLDDVNDLDQFNAILGMREWFYP  328

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR E+LLK HE +  ++++EL++ ESL+LF  +AFGQ  P+E  ME S  A +
Sbjct  329   GSKIIITTRHEHLLKAHEDYTMFEVEELNENESLELFSWHAFGQAQPVEGYMEVSRPAAQ  388

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HC GLPLAL+ LGS LSG+ +DVW+S L+KL  I   K+ + L +S + L DD+DK +F+
Sbjct  389   HCEGLPLALQVLGSSLSGKLVDVWKSALQKLCEIPDDKVHKVLRVSFDSLQDDHDKNIFL  448

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDN-DNKLMMPQLIQNMGKEI  1042
              IAC F+GK++DFAI VL+  D    +GIQNL+D  LV +DN DN+L M  L+++MG+ I
Sbjct  449   YIACFFIGKEKDFAITVLDNLDFRTRIGIQNLVDRCLVKIDNEDNRLAMHHLLRDMGRGI  508

Query  1041  LRQDSRDD  1018
             +R++S  D
Sbjct  509   IREESPQD  516


 Score =   151 bits (381),  Expect(2) = 5e-120, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 106/144 (74%), Gaps = 1/144 (1%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A +  Q    SS  R  YHAFLSFRGEDTRK+FTDHLY AL  AGI TFRDDDEI RGE+
Sbjct  4     AISSMQLLDTSSSYRCTYHAFLSFRGEDTRKSFTDHLYRALELAGIHTFRDDDEIKRGED  63

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEG-HAVFPIFYSVGRADV  2225
             I  EL + I ES++SIIVFSK+YASSRWCLDEL+ I+ RR+ +  H V P+FY V  + V
Sbjct  64    IAEELHKAINESKVSIIVFSKNYASSRWCLDELVKIMERRRRDDEHFVLPVFYDVDPSHV  123

Query  2224  EKQSGSFAEAFERHAKREKMEVEE  2153
              KQ+GSF E+F RH +R K E+E+
Sbjct  124   RKQTGSFEESFHRHKERFKEEMEK  147



>ref|XP_008235924.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1323

 Score =   309 bits (792),  Expect(2) = 7e-120, Method: Compositional matrix adjust.
 Identities = 178/367 (49%), Positives = 246/367 (67%), Gaps = 4/367 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL EVA + GMVLQ E DGHEA+FIQKI++ I  +L+RT LS   + +G+  RV  IN
Sbjct  328   RAALTEVADVAGMVLQNEADGHEAKFIQKIVKVIEDRLSRTPLSAAPHLIGIDYRVKNIN  387

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
             +WLQD+S+DVG+  I G+ G GKTTVAK  YN N+ RFE S FL N++ +SE PNG V +
Sbjct  388   QWLQDQSTDVGILAIYGMRGTGKTTVAKFVYNSNFRRFEASSFLENIKGSSEQPNGLVQV  447

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKV-FIvfddvdqlelldvVIGARDWFS  1579
             QKQ+  +IL GR+  + +  EGI K++DAI SK++  ++ D     +LLD+++G +D  S
Sbjct  448   QKQLLTDILDGRKVKVNSVSEGITKVEDAISSKRILLVLDDVDHMDKLLDLLLGMKDRSS  507

Query  1578  RGSKIIITTRCENLLKGHERHL--QYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVK  1405
             RGSKIIITT    LL+     +   + I    D ESL+LF R+AFG+D P+E   E S K
Sbjct  508   RGSKIIITTSIVGLLRSDRYQIIKVHDIGTFRDSESLELFSRHAFGKDHPIEGYKEISKK  567

Query  1404  AIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKR  1228
              + HCGGLPLALK LGS LSG+SM VW+S LEKLE I   +I + L +S + L DD+D+ 
Sbjct  568   VVNHCGGLPLALKTLGSSLSGQSMVVWKSALEKLEAIRKDEIMKKLRVSYDSLQDDHDRD  627

Query  1227  LFVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGK  1048
             LF+ IAC F+G + D  + +L+ C    +VGIQNL+D  L+ +D   K+ M  +I++MG+
Sbjct  628   LFLHIACFFIGMENDVMVRILDGCGFQTIVGIQNLLDRCLIRIDRCKKVQMNHMIRDMGR  687

Query  1047  EILRQDS  1027
              I+  +S
Sbjct  688   GIVGLES  694


 Score =   152 bits (383),  Expect(2) = 7e-120, Method: Composition-based stats.
 Identities = 79/140 (56%), Positives = 98/140 (70%), Gaps = 5/140 (4%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGEDTRK F+DHLYTA + AG+RTFRDDDE+ RGE+I  E+ R I+ES+  +I
Sbjct  198   YQVFLSFRGEDTRKTFSDHLYTAFVKAGLRTFRDDDELKRGEHIQPEVLRAIKESKCFVI  257

Query  2350  VFSKDYASSRWCLDELLTILGRRKS--EGHAVFPIFYSVGRADVEKQSGSFAEAFERHAK  2177
             VFSK+YASS WCLDEL+ IL R++S    H V P+FY V  + V KQ+GSFA AF RH  
Sbjct  258   VFSKEYASSLWCLDELVMILDRKRSSNSSHVVLPVFYDVDPSQVRKQTGSFATAFARHEM  317

Query  2176  REKMEVEEGRVEWKGKGGEV  2117
             R  +E  +    W+    EV
Sbjct  318   RHSLETTK---RWRAALTEV  334



>ref|XP_009355152.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1198

 Score =   317 bits (813),  Expect(2) = 8e-120, Method: Compositional matrix adjust.
 Identities = 200/420 (48%), Positives = 268/420 (64%), Gaps = 8/420 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL E+A L GMVL  + DG+E++FI KI++ I  KL RT L+V S  +G+ SRV  IN
Sbjct  151   REALAELADLAGMVLSNQADGYESKFITKIVKVIGDKLIRTPLAVESNLIGIQSRVKHIN  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+DVG+  + G+ G+GKTT+AK  YN N+  FEGS F+ N+R  +  PNG V +
Sbjct  211   LWLQDGSTDVGIVAVQGISGIGKTTIAKYVYNSNFTSFEGSSFVENIRETASQPNGLVQM  270

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +ILKG+EE + +  EGI KI  AI S++V +V DDVD +  LD V+  +D F  
Sbjct  271   QMQLLYDILKGKEEKVHSVSEGISKIVRAISSRRVLLVLDDVDHMNQLDAVLRMKDRFYP  330

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR E LLK H+    + ++ LD +ESL+L   +AFGQD P E  MEYS K ++
Sbjct  331   GSKIIITTRRERLLKAHQVTKVHGVETLDYDESLELLSWHAFGQDHPPEGYMEYSKKLVQ  390

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             H GGLPLAL+ LGS L G SM VW S LEKL+ I + +I   L IS + L DDYD++LF+
Sbjct  391   HAGGLPLALQVLGSSLLGESMGVWESALEKLKVIPNGEIMNKLRISYDSLQDDYDRKLFL  450

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC  +G+D+ + + +L+ CD +  VGIQNLID  LV VD  NK+ M  LI++MG+EI+
Sbjct  451   HIACFLIGRDKKYIVRILDGCDFYTTVGIQNLIDRCLVKVDKHNKVNMHDLIRDMGREIV  510

Query  1038  RQDSRDD--LHTLSKLLDQLVSSTESTGN----GVVNESASH-VNSPKRPYSQEFEDNSI  880
             R +S +      L +  D      E TG     G+V +   H  NSP       FE N+ 
Sbjct  511   RLESEEPEKRSRLWRHWDSFQVLREKTGTQTIQGLVLDMHWHPANSPINTNETVFETNAF  570


 Score =   144 bits (362),  Expect(2) = 8e-120, Method: Composition-based stats.
 Identities = 75/123 (61%), Positives = 91/123 (74%), Gaps = 1/123 (1%)
 Frame = -1

Query  2536  FFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresris  2357
             + Y  FLSFRGEDTR+ FTDHLYTAL NAG  TFRDDDE+ RGE+I   L++ IR+SR S
Sbjct  20    YRYDVFLSFRGEDTRRTFTDHLYTALNNAGFLTFRDDDELERGEDIKPGLQKAIRQSRAS  79

Query  2356  iIVFSKDYASSRWCLDELLTILGR-RKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHA  2180
             ++VFSKDYASSRWCLDEL+ IL R R +  H V P+FY V  +   KQ+GS  +AF RH 
Sbjct  80    VVVFSKDYASSRWCLDELVMILERKRTTSDHVVLPVFYDVDPSHARKQTGSIGKAFARHE  139

Query  2179  KRE  2171
             K +
Sbjct  140   KTQ  142



>ref|XP_002512273.1| leucine-rich repeat-containing protein, putative [Ricinus communis]
 gb|EEF49725.1| leucine-rich repeat-containing protein, putative [Ricinus communis]
Length=1166

 Score =   337 bits (863),  Expect(2) = 1e-119, Method: Compositional matrix adjust.
 Identities = 208/428 (49%), Positives = 282/428 (66%), Gaps = 25/428 (6%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTV-LSVPSYTVGLASRVGKI  1939
             R  LRE+  L GM LQ+    HEAEFIQ I++ +  +LN +V + VPS+ VG+ SRV  I
Sbjct  139   RAVLREITDLSGMDLQQR---HEAEFIQDIVKLVENRLNESVSMHVPSFLVGIDSRVKDI  195

Query  1938  NKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVG  1759
             N WLQD S+D G+ +I G+GGVGKTT+AK  YNLN DRF+GSCFLANVR AS+ PNG + 
Sbjct  196   NLWLQDGSTDPGIAIIYGIGGVGKTTIAKTVYNLNLDRFKGSCFLANVRKASKEPNGLIF  255

Query  1758  LQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFS  1579
             LQKQ+ E    G+E  I + DEG IK+ D I  K+V IV DDVD+L+ L+  IG  +   
Sbjct  256   LQKQLVEKFRNGKENKIDSVDEGSIKVIDVISCKRVLIVLDDVDELDQLNAFIGTWNSLF  315

Query  1578  RGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAI  1399
             +GSKII+TTR E LL  H+   ++++KELDD +SL+LF  +AF Q+ P+E   E+S   +
Sbjct  316   QGSKIIVTTRHERLLNPHDTQKKFRVKELDDNDSLQLFSWHAFRQNHPIEGYKEHSESVV  375

Query  1398  RHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLF  1222
             +HC G+PLAL+ LGSYLS +  D W S+LEKL+ I H KIQ++L+IS + L DD  K LF
Sbjct  376   KHCCGVPLALEVLGSYLSDKMADEWESELEKLKAIPHPKIQKSLQISYDSLQDDKYKNLF  435

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
             + IAC F G+D+D+ + VL+ C+L+  VGIQNLID  LVT++ DNKLMM  L+++MG+EI
Sbjct  436   LHIACFFTGRDKDYVVKVLDGCELYAKVGIQNLIDRHLVTINKDNKLMMHPLLRDMGREI  495

Query  1041  LRQDSRDDLHTLSKLL---DQLVSSTESTGNGVV--------------NESASHVNSPKR  913
             +RQ+S +   + S+L    D L    E+ G   +                S S +N  KR
Sbjct  496   VRQESPEHPGSRSRLWHHEDTLTVLRENIGTEAIRGLTLDLQIIMQEQQHSISCINCAKR  555

Query  912   PYSQEFED  889
                Q +ED
Sbjct  556   ---QHYED  560


 Score =   124 bits (310),  Expect(2) = 1e-119, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = -1

Query  2536  FFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresris  2357
             + Y  FLSF G+DT KNF+DHLY AL ++GI TFR D  + RGE +DAE ++ +++S++ 
Sbjct  9     YTYRVFLSFSGDDTGKNFSDHLYAALEHSGIHTFRGDYGVERGEIVDAEFQKAMQQSKLC  68

Query  2356  iIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAK  2177
             ++VFSKDYASS WCL+EL+ I+  RK+ G  V P+FY      V +QSGS+A+AF  H +
Sbjct  69    LVVFSKDYASSIWCLEELVKIMEVRKNGGLIVMPVFYDADPNQVWEQSGSYAKAFAIHEE  128

Query  2176  REKME  2162
              E+ME
Sbjct  129   MEEME  133



>ref|XP_009351003.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=559

 Score =   318 bits (816),  Expect(2) = 2e-119, Method: Compositional matrix adjust.
 Identities = 188/366 (51%), Positives = 252/366 (69%), Gaps = 1/366 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL E+A L GMVL  + DG+E++FI KI++ I  KL RT L+V S  +G+ SRV  IN
Sbjct  151   REALAELADLAGMVLSNQADGYESKFITKIVKVIGDKLLRTPLAVESNLIGIQSRVKHIN  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+DVG+ V+ G+ G+GKTT+AK  YN N+  FEGS F+ N+R  +  PNG V +
Sbjct  211   LWLQDGSTDVGIVVVHGMSGIGKTTIAKYVYNSNFTSFEGSSFVENIRETASQPNGLVQI  270

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +ILKG+EE + N  EGIIKI  AI S++V +V DDVD  E LD V+  +D F  
Sbjct  271   QMQLLYDILKGKEEKVHNVSEGIIKIVRAISSRRVLLVLDDVDHKEQLDAVLLMKDRFYP  330

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR E LLK H+    + ++ LD +ESL+L   +AFGQD P E  MEYS K ++
Sbjct  331   GSKIIITTRRERLLKAHQVTKVHGVETLDYDESLELLSWHAFGQDHPPEGYMEYSKKLVQ  390

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             H GGLPLAL+ LGS L G SM VW S LEKLE I + +I   L IS + L DD+D++LF+
Sbjct  391   HTGGLPLALQVLGSSLLGESMGVWESALEKLEVIPNGEIMNKLRISYDSLQDDHDRKLFL  450

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC  +G+D+ + + +L+ CD +  VGIQNLID  LV +D  +K+ M  LI++MG+EI+
Sbjct  451   HIACFLIGRDKKYIVRILDGCDFYTTVGIQNLIDRCLVKIDKHDKVTMHDLIRDMGREIV  510

Query  1038  RQDSRD  1021
             R +S +
Sbjct  511   RLESEE  516


 Score =   141 bits (355),  Expect(2) = 2e-119, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 90/121 (74%), Gaps = 1/121 (1%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGEDTR+ FTDHLYTAL NAG  TFRDDDE+ RGE+I   L++ IR+SR S++
Sbjct  22    YDVFLSFRGEDTRRTFTDHLYTALNNAGFLTFRDDDELERGEDIKPGLQKAIRQSRASVV  81

Query  2350  VFSKDYASSRWCLDELLTILGR-RKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKR  2174
             VFSKDYASSRWCLDEL+ IL R R +  H V P+FY V  +   KQ+GS  +AF RH K 
Sbjct  82    VFSKDYASSRWCLDELVMILERKRTTSDHVVLPVFYDVDPSHARKQTGSIGKAFARHEKN  141

Query  2173  E  2171
             +
Sbjct  142   Q  142



>ref|XP_008232158.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=679

 Score =   312 bits (799),  Expect(2) = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/368 (50%), Positives = 262/368 (71%), Gaps = 5/368 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL++ A L GM L+   D +E++FIQ I++EI  KL+  VL+V  Y VG+  RV  IN
Sbjct  146   RRALKDAADLAGMALK---DRYESQFIQDIVKEIGNKLDPKVLNVAPYAVGIDDRVQGIN  202

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WL+D S+ VGV VI G+GG+GKTT+AK AYN N+ RF+GS FLA++R A+E P G V L
Sbjct  203   MWLEDGSNAVGVAVIYGMGGIGKTTIAKAAYNRNFGRFQGSSFLADIREAAEQPYGFVRL  262

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+++  +I KG+ + I N DEGIIKIK A+ +K++ IV DDV+ L+  + ++G R+WF  
Sbjct  263   QRKLLSDIQKGKAKKIDNIDEGIIKIKHAVSNKRLLIVLDDVNDLDQFNAILGMREWFYS  322

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR E+LLK HE    ++++EL++ ESL+LF  +AFGQ  P+E  +E S  A+ 
Sbjct  323   GSKIIITTRHEHLLKAHEGCTMFEVEELNEYESLELFSWHAFGQPQPIEGYIELSRPAVE  382

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HCGG+PLAL+ LGS LSG+ + VWRS L+KL  I   KIQ+ L IS + L DD+D+ +F+
Sbjct  383   HCGGIPLALQVLGSSLSGKEVAVWRSALQKLCEIPDVKIQKILRISYDSLQDDHDQNIFL  442

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDN-DNKLMMPQLIQNMGKEI  1042
              IA  F+GK++DF I +L+  + +  +GIQNL+D  LV ++N DN+L M  L+++MG+ I
Sbjct  443   HIAYFFIGKEKDFTITILDNLNFYTRIGIQNLVDRCLVKINNEDNRLNMHHLLRDMGRGI  502

Query  1041  LRQDSRDD  1018
             +R++S  D
Sbjct  503   VREESPQD  510


 Score =   147 bits (372),  Expect(2) = 2e-119, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresri  2360
             R  YHAFLSFRGEDTRK FTDHLY AL  AGI TFRDDDEI RG +I AEL + I ES++
Sbjct  12    RCSYHAFLSFRGEDTRKGFTDHLYRALELAGIHTFRDDDEIERGADIAAELNKAINESKV  71

Query  2359  siIVFSKDYASSRWCLDELLTILGRRK-SEGHAVFPIFYSVGRADVEKQSGSFAEAFERH  2183
             SIIVFS++YASSRWCLDEL+ I+ RRK  +GH V P+FY V  + V  Q  SFAEAF RH
Sbjct  72    SIIVFSQNYASSRWCLDELVKIMERRKHDDGHIVMPVFYHVDPSHVRNQRESFAEAFSRH  131

Query  2182  AKREKMEVEE  2153
              +R K E+ +
Sbjct  132   EERFKEEMNK  141



>ref|XP_009370599.1| PREDICTED: TMV resistance protein N-like isoform X1 [Pyrus x 
bretschneideri]
Length=1226

 Score =   300 bits (768),  Expect(2) = 2e-119, Method: Compositional matrix adjust.
 Identities = 189/439 (43%), Positives = 283/439 (64%), Gaps = 22/439 (5%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R ALR+VA L GMVL    D +E +FIQ I+ EI  +++   L V  + VG+ +RV ++N
Sbjct  150   RRALRDVASLGGMVLG---DRYEGQFIQDIVGEIRNRVDHAALDVAPFAVGMDNRVRRLN  206

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+DVG+ VICG+GG+GK+T+AK AYN NYDRF+G  FLA++R +SE PNG   L
Sbjct  207   MWLQDGSNDVGLAVICGMGGIGKSTIAKAAYNRNYDRFQGGSFLADIRESSEQPNGFALL  266

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+++  +I KG+ + ++N DEG I IK A+G KKV IV DDV   + L+ ++G R+W   
Sbjct  267   QRKLLSDIQKGKAKKVYNMDEGTIMIKQAVGYKKVLIVLDDVSNRDQLNAILGMREWLHP  326

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKII+TTR E+LL  H+   ++ ++EL++ ESL+LF  +AF Q  P E   E S   ++
Sbjct  327   GSKIIVTTRHEHLLNAHDVFEKFMVRELNEYESLELFSWHAFRQSHPEEGYKELSRHVVQ  386

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HCGGLPLAL+ LGS LSG+S++VW+S L+KL+ I + KIQ+ L IS + L DD+DK LF+
Sbjct  387   HCGGLPLALQVLGSSLSGKSVEVWQSALQKLDVIPNDKIQKVLRISFDSLQDDHDKNLFL  446

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVD-NDNKLMMPQLIQNMGKEI  1042
              IA  F GK  D+ I +L+  +    +GI+NL+D  L+ ++   N+L+M Q ++NM   I
Sbjct  447   HIASFFTGKTMDYTITILDNLEFCTRIGIENLVDRCLLKMEWGWNRLVMHQSVRNMAMAI  506

Query  1041  LRQDSRDDLHTLSKLLDQ-------LVSSTESTGNGVVNESASHV---NSPKRPYSQEFE  892
             +R++S  D    S++L +        +S TE+    ++N ++      +  KR + +++E
Sbjct  507   IREESPHDPGKRSRVLQKDASNILRKLSGTENIKGLMLNLASKTTFVGSDEKRCHVEDYE  566

Query  891   DNSIIPHQSNWKRRFMGIF  835
              N         +RR +G F
Sbjct  567   GNCS-------RRRRLGFF  578


 Score =   160 bits (404),  Expect(2) = 2e-119, Method: Composition-based stats.
 Identities = 89/137 (65%), Positives = 105/137 (77%), Gaps = 3/137 (2%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresri  2360
             R  YHAFLSFRG+DTRK FTDHL  AL  AGI TFRDDDEI RGENI++EL + I+ES++
Sbjct  15    RCSYHAFLSFRGQDTRKGFTDHLCRALELAGIHTFRDDDEIKRGENIESELEKAIQESQV  74

Query  2359  siIVFSKDYASSRWCLDELLTILGRRKSE-GHAVFPIFYSVGRADVEKQSGSFAEAFERH  2183
             SIIVFSKDYASSRWCL+ELL I+ RR ++  H V P+FY V  +DV KQSGSF EAF RH
Sbjct  75    SIIVFSKDYASSRWCLNELLKIVERRNTDRRHVVLPVFYDVDPSDVRKQSGSFVEAFARH  134

Query  2182  AKREKMEVEEGRVE-WK  2135
              +R   E E  +VE W+
Sbjct  135   EERFSTE-EMDKVELWR  150



>ref|XP_008351316.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=1163

 Score =   296 bits (759),  Expect(2) = 3e-119, Method: Compositional matrix adjust.
 Identities = 177/369 (48%), Positives = 249/369 (67%), Gaps = 7/369 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTV---LSVPSYTVGLASRVG  1945
             R ALR+VA L GMVL+E    +E++FIQ I+  I  KL+      L V  Y +G    V 
Sbjct  148   RRALRDVADLGGMVLRER---YESQFIQDIVEAIGNKLDYMTNRRLRVEPYVIGRDYHVK  204

Query  1944  KINKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQ  1765
             ++N WL+D S+DVGV VI G+GG+GKTT+AK+AYN N  +F+ S FL+++R  S+  NG 
Sbjct  205   RLNMWLEDGSNDVGVAVIHGMGGIGKTTIAKIAYNQNLYKFQASSFLSDIRETSKQANGF  264

Query  1764  VGLQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDW  1585
             V LQ+ +  +I K +   I++ DEGI+KI+ A+  K+V IV DDV+  E    +IG RDW
Sbjct  265   VHLQRNLLSDIQKRKLNKIYSIDEGIVKIERAVRCKRVLIVLDDVENSEQFSAIIGMRDW  324

Query  1584  FSRGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVK  1405
             F  G KIIITTR E+LLK HE  +++K++ L ++ESL+LF  +AF Q  P E  ME S  
Sbjct  325   FHPGCKIIITTRHEHLLKAHEV-VRFKVEGLHEDESLELFSWHAFRQPHPQEGYMELSRP  383

Query  1404  AIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRL  1225
              + HCGG+PLAL+ LGS L G+++DVW + L  L+ I   KIQ+ L IS + L D+DKRL
Sbjct  384   VVEHCGGVPLALQVLGSSLYGKTIDVWXNALHNLDVISEGKIQKILXISFDSLQDHDKRL  443

Query  1224  FVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKE  1045
             F+ IAC FVGKD+DF   +L++CD    VG+Q+L+D  LV ++   KL M QL+Q+MG+ 
Sbjct  444   FLHIACFFVGKDKDFTTTILDECDFXTEVGLQHLVDRCLVEINVXXKLXMHQLLQDMGRA  503

Query  1044  ILRQDSRDD  1018
             I+R++S +D
Sbjct  504   IIREESPED  512


 Score =   162 bits (410),  Expect(2) = 3e-119, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 112/144 (78%), Gaps = 1/144 (1%)
 Frame = -1

Query  2566  QESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAEL  2387
             Q++  SS  R  Y AFLSFRG DTRK FTDHLY+AL +AGI TFRDDDEI RG NI+ EL
Sbjct  6     QKNASSSSYRCTYDAFLSFRGTDTRKGFTDHLYSALESAGIHTFRDDDEIERGANIEQEL  65

Query  2386  rrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGS  2207
             +  I+ESR+S+IVFSKDYASSRWCL+EL  I+ R++++GH V P+FY V  +DV KQ+GS
Sbjct  66    QTAIQESRVSVIVFSKDYASSRWCLNELAVIMERKRTDGHMVIPVFYDVEPSDVRKQTGS  125

Query  2206  FAEAFERHAKREKMEVEEGRVEWK  2135
             FAE+F RH +R K E+++   EW+
Sbjct  126   FAESFTRHEERFKDEIDKVE-EWR  148



>ref|XP_007203985.1| hypothetical protein PRUPE_ppa000551mg [Prunus persica]
 gb|EMJ05184.1| hypothetical protein PRUPE_ppa000551mg [Prunus persica]
Length=1100

 Score =   306 bits (783),  Expect(2) = 5e-119, Method: Compositional matrix adjust.
 Identities = 183/366 (50%), Positives = 253/366 (69%), Gaps = 2/366 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL EVA L GMVLQ + DG+E++FI+KII+ I  KL+RT LSV    +G+ SRV  IN
Sbjct  147   REALAEVACLAGMVLQNQADGYESKFIEKIIKVIGDKLSRTPLSVGPNMIGMQSRVENIN  206

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQ  S+DVG+ VI G+ G+GKTT+AK  YN N+ RF+GS FL N++  S+ PNG V +
Sbjct  207   LWLQQGSTDVGILVIYGISGIGKTTIAKYVYNSNFRRFKGSSFLENIKEISQQPNGLVQI  266

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +IL GR+  I +  +G+ +I+DAI SK+V +V DDVD  + LD ++  +D F  
Sbjct  267   QTQLLYDILNGRKVKIHSVSQGVTEIEDAISSKRVLLVLDDVDHEDQLDALLRMKDQFCP  326

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR    LK H     + ++ LD  ESL+LF  +AFGQ+ P+E  +EYS K + 
Sbjct  327   GSKIIITTR-RARLKTHLVTEVHAVESLDQNESLELFSWHAFGQNHPVEDHIEYSKKIVD  385

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HCGGLPLALK LGS L G S+DVW+S  EKLE I + +I   L +S + L DD D+ +F+
Sbjct  386   HCGGLPLALKVLGSSLLGESIDVWKSAFEKLEAIPNGEIINKLRVSYDSLQDDNDQNVFL  445

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              I+C F+GKD+D+ + +L+ C+    V IQNLID  LVT+D+ +K+ M  LI+ MG+EI+
Sbjct  446   HISCFFIGKDKDYIVKILDGCEFFTNVAIQNLIDRCLVTIDSCDKVQMHDLIRGMGREIV  505

Query  1038  RQDSRD  1021
             R +S++
Sbjct  506   RLESKE  511


 Score =   152 bits (385),  Expect(2) = 5e-119, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 105/142 (74%), Gaps = 4/142 (3%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFF-YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGE  2405
             A  R Q++  SS  R+  YH FLSFRGEDTRKNFTDHL  A +NAG RTFRD+DE+ RGE
Sbjct  2     ALVRAQQT--SSNSRYSRYHVFLSFRGEDTRKNFTDHLCRAFVNAGFRTFRDNDELERGE  59

Query  2404  NIDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRK-SEGHAVFPIFYSVGRAD  2228
             +I  ELR+ I++SR S+IVFSKDYASS WCLDELL IL R++ S  H + P+FY V  + 
Sbjct  60    DIKPELRKAIKQSRTSVIVFSKDYASSPWCLDELLMILERKRISADHVILPVFYDVDPSH  119

Query  2227  VEKQSGSFAEAFERHAKREKME  2162
             V KQ+GS A+AF RH K + ++
Sbjct  120   VRKQTGSLAKAFARHQKTQPLQ  141



>ref|XP_007206681.1| hypothetical protein PRUPE_ppa023688mg, partial [Prunus persica]
 gb|EMJ07880.1| hypothetical protein PRUPE_ppa023688mg, partial [Prunus persica]
Length=1072

 Score =   319 bits (818),  Expect(2) = 5e-119, Method: Compositional matrix adjust.
 Identities = 183/368 (50%), Positives = 255/368 (69%), Gaps = 4/368 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R ALREVA L GMVLQ   DG+E++FI +I++ I  KL+RT  ++  Y +G+ SRV  IN
Sbjct  150   RAALREVADLSGMVLQNHADGYESKFIMQIVKVIDNKLSRTPFAIAPYPIGIDSRVENIN  209

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+DVG+ ++ G+GG+GKTT+AK AYN+N+ RFE SCFL +VR  S  PNG V L
Sbjct  210   SWLQDGSTDVGILLVNGVGGIGKTTLAKFAYNINFRRFERSCFLEDVREISNQPNGLVHL  269

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q   +I+ GRE  I    EGI KI+DAI SK + +V DDVD ++ +D +   +DWF  
Sbjct  270   QIQFLHHIMSGREVKIQCVSEGIKKIRDAIISKTILLVLDDVDHMDQIDAIFFMQDWFCP  329

Query  1575  GSKIIITTRCENLLKGHE--RHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKA  1402
             GSKI+ITTRC  LL+GH+  +   Y  + LD +ESL+LF  +AFGQD P+E  +  S + 
Sbjct  330   GSKIMITTRCAGLLRGHQVAKSKVYDAETLDVDESLQLFSWHAFGQDHPIEGYISLSKRV  389

Query  1401  IRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDY--DKR  1228
                CGGLPLAL+ LGS LSGR +DVW S LEKL+ I  ++I + L IS + L D   D+ 
Sbjct  390   KDRCGGLPLALQVLGSSLSGRHIDVWESTLEKLKTIPDNQIIKKLRISYDALQDNPDDQN  449

Query  1227  LFVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGK  1048
             LF+ IAC FVG+ +D+ + +L+ C+   +VGI+NL++  LVT+D++N + M Q+I +MG+
Sbjct  450   LFLHIACFFVGQGKDYVVRILDGCNFFTIVGIENLVNRCLVTIDDENNVKMHQMIWDMGR  509

Query  1047  EILRQDSR  1024
             EI+R +S+
Sbjct  510   EIVRLESK  517


 Score =   139 bits (349),  Expect(2) = 5e-119, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 98/139 (71%), Gaps = 4/139 (3%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGEDTRKNF+DHLYTA +  G  TFRDD+E+ RG +I  EL++ I++SR S+I
Sbjct  21    YDVFLSFRGEDTRKNFSDHLYTACVEKGFNTFRDDEELERGVDIKPELKKAIQQSRSSVI  80

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKRE  2171
             VFSKDY+SSRWCLDEL+ IL +++   H V P+FY V  + V  Q+G  AEAF RH   E
Sbjct  81    VFSKDYSSSRWCLDELVFILEQKRISEHVVLPVFYDVDPSHVRNQTGCVAEAFSRH---E  137

Query  2170  KMEVEEGRV-EWKGKGGEV  2117
             + ++   +V +W+    EV
Sbjct  138   ENQLSTNKVKQWRAALREV  156



>ref|XP_007201107.1| hypothetical protein PRUPE_ppa024462mg, partial [Prunus persica]
 gb|EMJ02306.1| hypothetical protein PRUPE_ppa024462mg, partial [Prunus persica]
Length=1082

 Score =   305 bits (780),  Expect(2) = 8e-119, Method: Compositional matrix adjust.
 Identities = 177/369 (48%), Positives = 251/369 (68%), Gaps = 6/369 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL EVA + GMVLQ E DGHEA+FIQKI++ I  +L+RT LS   + +G+  RV  IN
Sbjct  135   RAALTEVANVAGMVLQNEADGHEAKFIQKIVKVIEDRLSRTPLSAAPHLIGIDYRVKNIN  194

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
             +WLQD+S+DVG+  I G+ G GKTTVAK  YN N+ RFE S FL N++ +SE PNG V +
Sbjct  195   QWLQDQSTDVGILAIYGMRGTGKTTVAKFVYNSNFRRFEASSFLENIKGSSEQPNGLVQV  254

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKV-FIvfddvdqlelldvVIGARDWFS  1579
             QKQ+  +IL GR+  + +  EGI +++DAI SK++  ++ D     +LLD+++G +D  S
Sbjct  255   QKQLLTDILDGRKVRVNSVSEGITEVEDAISSKRILLVLDDVDHMDKLLDLLLGMKDRSS  314

Query  1578  RGSKIIITTRCENLLKGHERHLQYKIKELD---DEESLKLFCRYAFGQDDPLEHLMEYSV  1408
             RGSKIIITT    LL+  +R+   K+ ++    D ESL+LF  +AFG+D P+E   E S 
Sbjct  315   RGSKIIITTSNVGLLRS-DRYQVIKVHDIGTFRDSESLELFSWHAFGKDHPIEGYKEISK  373

Query  1407  KAIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDK  1231
             K + HCGGLP+ALK LGS LSG+SM VW+S LEKLE I   +I + L +S + L DD+D+
Sbjct  374   KVVNHCGGLPVALKTLGSSLSGQSMVVWKSALEKLEAIPKDEIIKKLRVSYDSLQDDHDR  433

Query  1230  RLFVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMG  1051
              LF+ IAC F+G + D  + +L+ C    +VGIQNL+D  L+ +D  NK+ M  +I++MG
Sbjct  434   DLFLHIACFFIGMENDIMVRILDGCGFQTIVGIQNLLDRCLIRIDRCNKVQMNHMIRDMG  493

Query  1050  KEILRQDSR  1024
             + I+  +S+
Sbjct  494   RGIVGLESK  502


 Score =   153 bits (386),  Expect(2) = 8e-119, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 99/140 (71%), Gaps = 5/140 (4%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             YH FLSFRGEDTRK F+DHLYTA + AG+RTFRDDDE+ RGE+I  E+ R I+ES+  +I
Sbjct  5     YHVFLSFRGEDTRKTFSDHLYTAFVKAGLRTFRDDDELKRGEHIQQEVLRAIKESKCFLI  64

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEG--HAVFPIFYSVGRADVEKQSGSFAEAFERHAK  2177
             VFSK+YASS WCLDEL+ IL R++S    H V P+FY V  + V KQ+GSFA AF RH  
Sbjct  65    VFSKEYASSLWCLDELVMILDRKRSSNSSHVVLPVFYDVDPSQVRKQTGSFATAFARHEM  124

Query  2176  REKMEVEEGRVEWKGKGGEV  2117
             R  +E  +    W+    EV
Sbjct  125   RHSLETTK---RWRAALTEV  141



>ref|XP_009343895.1| PREDICTED: TMV resistance protein N-like, partial [Pyrus x bretschneideri]
Length=887

 Score =   310 bits (795),  Expect(2) = 1e-118, Method: Compositional matrix adjust.
 Identities = 180/366 (49%), Positives = 255/366 (70%), Gaps = 1/366 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL +VA L GMVLQ + DG+E++FI+KI++ I  KL+ T LS+    +G+ S+V +IN
Sbjct  151   REALAKVADLAGMVLQNQADGYESKFIEKIVKVIGDKLSHTPLSIEPKVIGIKSQVERIN  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+DVG+ ++ G+ G+GKTT+AK  YN N+  FEGS F+ N++  +  PNG V +
Sbjct  211   LWLQDGSNDVGIFIVYGMSGIGKTTIAKHVYNSNFRSFEGSSFIENIKEIANRPNGLVQI  270

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  NIL GRE  I +  EGIIKI+ AI S+KV +V DDVD ++ LD V+  +D F  
Sbjct  271   QMQLLSNILNGREVKIHSVSEGIIKIEGAISSRKVLLVLDDVDHMDQLDAVLKMKDRFYP  330

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKI+ITTR E LLK H+    ++++ LD  ESL+LF  +AFGQD P E  ME+S   ++
Sbjct  331   GSKILITTRRERLLKAHQVTKVHRVETLDYNESLELFSWHAFGQDHPTEEYMEHSKMVVQ  390

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             H GGLPLAL+ LGS LSG S+DVW S LEKL+ I + +I   L IS + L DD+D++LF+
Sbjct  391   HSGGLPLALRVLGSTLSGESIDVWESALEKLKVIPNGEILNKLRISYDSLQDDHDQKLFL  450

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC  +G+D+++ + +L  CD    +GI NLID  LVT+D  +K+ M  +I++MG+EI+
Sbjct  451   HIACFLIGRDKNYIVRILNGCDFFTTIGIHNLIDRCLVTIDKYDKVNMHDMIRDMGREIV  510

Query  1038  RQDSRD  1021
             R +S +
Sbjct  511   RLESEE  516


 Score =   146 bits (369),  Expect(2) = 1e-118, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 94/128 (73%), Gaps = 1/128 (1%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGEDTRK FTDHLYTAL NAG  TFRDDDE+ RGE+I   L++ I+ SR S++
Sbjct  22    YDVFLSFRGEDTRKTFTDHLYTALNNAGFLTFRDDDELERGEDIKPGLQKAIQLSRASVV  81

Query  2350  VFSKDYASSRWCLDELLTILGR-RKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKR  2174
             VFSKDYASSRWCLDEL+ IL R R +  H V P+FY V  + V KQ+GS  +AF RH K 
Sbjct  82    VFSKDYASSRWCLDELVLILERKRTTSDHVVLPVFYDVDPSHVRKQTGSIGKAFARHQKN  141

Query  2173  EKMEVEEG  2150
             + ++  +G
Sbjct  142   QSLKKVKG  149



>ref|XP_007221565.1| hypothetical protein PRUPE_ppa015313mg, partial [Prunus persica]
 gb|EMJ22764.1| hypothetical protein PRUPE_ppa015313mg, partial [Prunus persica]
Length=1118

 Score =   301 bits (770),  Expect(2) = 2e-118, Method: Compositional matrix adjust.
 Identities = 190/424 (45%), Positives = 272/424 (64%), Gaps = 9/424 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTV---LSVPSYTVGLASRVG  1945
             R+ALR+VA L GMVL    D +E++FIQ I+  I  KL+ T    L V  Y VG+ +RV 
Sbjct  149   RKALRDVADLGGMVLG---DRYESQFIQDIVEVIGNKLDHTWNRRLRVDPYLVGIDNRVE  205

Query  1944  KINKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQ  1765
              +N WL+D SSDVGV V+ G+GG+GKTT+AK AYN N ++F+GS FLA++RA S++PNG 
Sbjct  206   GLNMWLEDGSSDVGVAVVYGMGGIGKTTIAKTAYNQNCNKFQGSSFLADIRATSKLPNGF  265

Query  1764  VGLQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDW  1585
             V LQ+ +  ++ KG+ + I++ DEGI KIK AI  K+V I  DDVD LE  + ++G R+W
Sbjct  266   VHLQRNLLSDLQKGKAKKIYSLDEGITKIKRAIRCKRVLIALDDVDNLEQFNAILGMREW  325

Query  1584  FSRGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVK  1405
                GSKIIITTR E+LLK HE    + ++ L + ESL+LF  +AF Q  P E  M+ S  
Sbjct  326   LHPGSKIIITTRHEHLLKAHENCAMFNVEGLLENESLELFSWHAFRQPHPGEGYMDLSRP  385

Query  1404  AIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRL  1225
              ++HCGG+PLALK LGS L G+     ++ L+ L+ I   KI++ L +S + L D+DKRL
Sbjct  386   VVQHCGGVPLALKVLGSALFGKLQMYGKNALQNLDVITEGKIEKILRVSFDSLQDHDKRL  445

Query  1224  FVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKE  1045
             F+ IAC F+G+ +DF+I VL++C     +GIQNL+D  L+ +D  NKL M QL+Q+MG+ 
Sbjct  446   FLHIACFFIGRHKDFSITVLDECGFATNIGIQNLVDRCLLIIDGFNKLTMHQLLQDMGRG  505

Query  1044  ILRQDSRDDLHTLSKLLDQLVSSTESTGNGVVNESASHVNSPKRPYSQEFEDNSIIPHQS  865
             I+R++S +D    +++ ++  S+      G        +N P        E + II   S
Sbjct  506   IIREESPEDPGKRTRVWNKDASNVLRKLTGTATIKGLMLNIPMLIKD---ESSKIISSGS  562

Query  864   NWKR  853
             N KR
Sbjct  563   NRKR  566


 Score =   155 bits (392),  Expect(2) = 2e-118, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 103/143 (72%), Gaps = 0/143 (0%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A   TQ++   S  R  Y AFLSFRG DTRK F DHLY AL  AGI TFRDDDEI RG N
Sbjct  2     AATSTQQNASPSSHRCTYDAFLSFRGRDTRKGFADHLYRALEVAGIHTFRDDDEIERGAN  61

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVE  2222
             I AEL++ I+ESR+SIIVFSKDYASSRWCLDEL+ I+ RR++ GH V PIFY V  + V 
Sbjct  62    ILAELQKAIQESRVSIIVFSKDYASSRWCLDELVMIMDRRETNGHMVMPIFYDVDPSHVR  121

Query  2221  KQSGSFAEAFERHAKREKMEVEE  2153
              Q+G F EAF RH +R   E+++
Sbjct  122   NQTGIFEEAFSRHQQRFNKEMDK  144



>ref|XP_008368587.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=1152

 Score =   295 bits (756),  Expect(2) = 4e-118, Method: Compositional matrix adjust.
 Identities = 175/369 (47%), Positives = 251/369 (68%), Gaps = 8/369 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTV---LSVPSYTVGLASRVG  1945
             R ALR+VA L GMVL+   D +E++FIQ+I+  + KKL+      L V  Y +G    V 
Sbjct  212   RRALRDVADLGGMVLK---DRYESQFIQEIVEAVGKKLDYMTNWRLRVEPYVIGRDYHVK  268

Query  1944  KINKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQ  1765
             ++N WL+D S+DVGV VI  +GG+GKTT+AK+AYN N+++FE S FL+++R  S   NG 
Sbjct  269   RLNMWLEDGSNDVGVAVIHAMGGIGKTTIAKIAYNQNFNKFEASSFLSDIRETSGQANGF  328

Query  1764  VGLQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDW  1585
             V LQ+++  +I K + E I +  EG++KIK  +  K+V IV DDV+  E  + ++G RDW
Sbjct  329   VRLQRRLLSDIQKRKMEKI-DGPEGLVKIKRVVRCKRVLIVLDDVENSEQFNAILGMRDW  387

Query  1584  FSRGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVK  1405
             F  GSKIIITTR E+LLK HE  +++K++ L ++ESLKLF  +AFGQ  P E  ME S  
Sbjct  388   FYPGSKIIITTRHEHLLKAHEV-VRFKVEGLHEDESLKLFSWHAFGQPRPQEGYMELSRP  446

Query  1404  AIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRL  1225
              + HCGG+PLALK LGS L G++ D+W + +  L+     KI++ L IS + L D+DKRL
Sbjct  447   IVEHCGGVPLALKVLGSSLFGKTADIWENAIHNLDEFTEGKIRKILCISFDSLQDHDKRL  506

Query  1224  FVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKE  1045
             F+ IAC FVGK++DF   +L++CD    VG+Q L+D  LV ++  NKL M QL+Q+MG+ 
Sbjct  507   FLNIACFFVGKNKDFTTTILDECDFATKVGLQRLVDRCLVEINVYNKLTMHQLLQDMGRA  566

Query  1044  ILRQDSRDD  1018
             I+R++S +D
Sbjct  567   IIREESPED  575


 Score =   160 bits (404),  Expect(2) = 4e-118, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 112/151 (74%), Gaps = 1/151 (1%)
 Frame = -1

Query  2587  MEAEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRG  2408
             + A +  Q++  SS  R  Y AFLSFRG DTRK FTDHLY AL  AGI TFRDDDEI RG
Sbjct  63    IAAMSNEQQNPSSSSNRCTYDAFLSFRGADTRKGFTDHLYNALKLAGIHTFRDDDEIERG  122

Query  2407  ENIDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRAD  2228
             ENI  EL+  I+ES++SIIVFSKDYASS WCL+EL  I+ R++++GH V P+FY V  +D
Sbjct  123   ENIAQELQTAIQESQVSIIVFSKDYASSTWCLNELAIIMERKRTDGHMVIPVFYYVEPSD  182

Query  2227  VEKQSGSFAEAFERHAKREKMEVEEGRVEWK  2135
             V KQ+GSFAE+F RH ++ K E+++   EW+
Sbjct  183   VRKQTGSFAESFTRHQEQFKDEIDKVE-EWR  212



>ref|XP_009370600.1| PREDICTED: TMV resistance protein N-like isoform X2 [Pyrus x 
bretschneideri]
Length=1159

 Score =   300 bits (768),  Expect(2) = 6e-118, Method: Compositional matrix adjust.
 Identities = 189/439 (43%), Positives = 283/439 (64%), Gaps = 22/439 (5%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R ALR+VA L GMVL    D +E +FIQ I+ EI  +++   L V  + VG+ +RV ++N
Sbjct  150   RRALRDVASLGGMVLG---DRYEGQFIQDIVGEIRNRVDHAALDVAPFAVGMDNRVRRLN  206

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+DVG+ VICG+GG+GK+T+AK AYN NYDRF+G  FLA++R +SE PNG   L
Sbjct  207   MWLQDGSNDVGLAVICGMGGIGKSTIAKAAYNRNYDRFQGGSFLADIRESSEQPNGFALL  266

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+++  +I KG+ + ++N DEG I IK A+G KKV IV DDV   + L+ ++G R+W   
Sbjct  267   QRKLLSDIQKGKAKKVYNMDEGTIMIKQAVGYKKVLIVLDDVSNRDQLNAILGMREWLHP  326

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKII+TTR E+LL  H+   ++ ++EL++ ESL+LF  +AF Q  P E   E S   ++
Sbjct  327   GSKIIVTTRHEHLLNAHDVFEKFMVRELNEYESLELFSWHAFRQSHPEEGYKELSRHVVQ  386

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HCGGLPLAL+ LGS LSG+S++VW+S L+KL+ I + KIQ+ L IS + L DD+DK LF+
Sbjct  387   HCGGLPLALQVLGSSLSGKSVEVWQSALQKLDVIPNDKIQKVLRISFDSLQDDHDKNLFL  446

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVD-NDNKLMMPQLIQNMGKEI  1042
              IA  F GK  D+ I +L+  +    +GI+NL+D  L+ ++   N+L+M Q ++NM   I
Sbjct  447   HIASFFTGKTMDYTITILDNLEFCTRIGIENLVDRCLLKMEWGWNRLVMHQSVRNMAMAI  506

Query  1041  LRQDSRDDLHTLSKLLDQ-------LVSSTESTGNGVVNESASHV---NSPKRPYSQEFE  892
             +R++S  D    S++L +        +S TE+    ++N ++      +  KR + +++E
Sbjct  507   IREESPHDPGKRSRVLQKDASNILRKLSGTENIKGLMLNLASKTTFVGSDEKRCHVEDYE  566

Query  891   DNSIIPHQSNWKRRFMGIF  835
              N         +RR +G F
Sbjct  567   GNCS-------RRRRLGFF  578


 Score =   154 bits (390),  Expect(2) = 6e-118, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 105/137 (77%), Gaps = 3/137 (2%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresri  2360
             R  YHAFLSFRG+DTRK FTDHL  AL  AGI TFRDDDEI RGENI++EL + I+ES++
Sbjct  15    RCSYHAFLSFRGQDTRKGFTDHLCRALELAGIHTFRDDDEIKRGENIESELEKAIQESQV  74

Query  2359  siIVFSKDYASSRWCLDELLTILGRRKSE-GHAVFPIFYSVGRADVEKQSGSFAEAFERH  2183
             SIIVFSKDYASSRWCL+ELL I+ RR ++  H V P+FY V  +DV KQSGSF EAF RH
Sbjct  75    SIIVFSKDYASSRWCLNELLKIVERRNTDRRHVVLPVFYDVDPSDVRKQSGSFVEAFARH  134

Query  2182  AKREKMEVEEGRVE-WK  2135
              +R   E E  +VE W+
Sbjct  135   EERFSTE-EMDKVELWR  150



>ref|XP_008343276.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=1163

 Score =   303 bits (777),  Expect(2) = 8e-118, Method: Compositional matrix adjust.
 Identities = 192/438 (44%), Positives = 282/438 (64%), Gaps = 22/438 (5%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL +VA L GMVL    D +E +FI+ I+ EI  K+    L V  + VG+ +RV ++N
Sbjct  147   RRALGDVASLGGMVLG---DRYEGQFIZDIVEEIRNKVGHAALDVAPFAVGMDNRVRRLN  203

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+DVG+ VICG+GG+GK+T+AK AYN N+DRFEGS FLA++R +SE PNG   L
Sbjct  204   MWLQDGSNDVGLAVICGMGGIGKSTIAKAAYNQNFDRFEGSSFLADIRESSEQPNGFACL  263

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+++  +I KG  + ++N  EGI +IK A+G KKV IV DDV+  + L+ ++G R+W  +
Sbjct  264   QRKLLSDIQKGNTKKVYNVAEGISRIKRAVGYKKVLIVLDDVNSRDQLNAILGMREWLHQ  323

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR E+LL  HE   ++ ++ELD+ ESL+LF  +AF Q  P+E  ME S   +R
Sbjct  324   GSKIIITTRHEHLLNAHEVCEKFMVRELDEYESLELFSWHAFRQSHPVEGYMELSRHVVR  383

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HCGGLPLAL+ +GS LSG+S +VW+S L+KL+ I + KIQ+ L IS + L DD+DK LF+
Sbjct  384   HCGGLPLALQVVGSSLSGKSEEVWQSALQKLDVIPNDKIQKVLRISFDSLPDDHDKNLFL  443

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IA  F GK  D+ I +L+  +    +GI+NL+D  LV +   +KL M QL++NM   I+
Sbjct  444   HIASFFTGKTMDYTITILDNLEFCTRIGIENLVDRCLVKIQG-SKLAMHQLVRNMAMXII  502

Query  1038  RQDSRDDLHTLSKLLD-------QLVSSTESTGNGVVNESASHV---NSPKRPYSQEFED  889
              ++S  D    S++L        + +S TE+    ++N ++      +  KR + ++++ 
Sbjct  503   XEESPHDPGKRSRVLQNDASNILRKLSGTENIKGLMLNLASKRTFVGSDNKRCHVEDYDG  562

Query  888   NSIIPHQSNWKRRFMGIF  835
             N         +RR +G F
Sbjct  563   NCS-------RRRGLGFF  573


 Score =   150 bits (380),  Expect(2) = 8e-118, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 105/137 (77%), Gaps = 2/137 (1%)
 Frame = -1

Query  2524  AFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiIVF  2345
             AFLSFRG+DTRK FTDHLY AL  AGI TFRDDDEI RGENI++EL + I ES++SIIVF
Sbjct  18    AFLSFRGKDTRKGFTDHLYRALELAGIHTFRDDDEIKRGENIESELEKAIXESQVSIIVF  77

Query  2344  SKDYASSRWCLDELLTILGRRKSE-GHAVFPIFYSVGRADVEKQSGSFAEAFERHAKREK  2168
             SKDYASSRWCL+ELL  + RR ++  H V P+FY V  +DV KQSGSFAEAF RH +R  
Sbjct  78    SKDYASSRWCLNELLKXVERRNTDRRHXVLPVFYDVDPSDVRKQSGSFAEAFARHEERFS  137

Query  2167  MEVEEGRVEWKGKGGEV  2117
              E+++  + W+   G+V
Sbjct  138   TEMDKVEL-WRRALGDV  153



>ref|XP_004230402.1| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
Length=1161

 Score =   302 bits (773),  Expect(2) = 9e-118, Method: Compositional matrix adjust.
 Identities = 178/364 (49%), Positives = 257/364 (71%), Gaps = 3/364 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL EVA L G+++  + D  E+EFI++I++ I  KLNRT+ SV  Y VG++SRV  I 
Sbjct  156   RAALGEVADLGGVLVNNQEDRKESEFIEEILQLIEDKLNRTISSVAPYLVGISSRVKNIV  215

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S D  +  ICG+ G+GKTTVAK  +  N+ RFEGS FLAN++  S+  +G + L
Sbjct  216   SWLQDGSHDDNLIAICGMSGIGKTTVAKYVFTTNFRRFEGSSFLANIQDISQQNDGLIRL  275

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+  + L G++  I +TDEGIIKI+DAI  K+V ++ DD+DQ+E +  +IG ++WF  
Sbjct  276   QKQLLYD-LTGKKSKIQDTDEGIIKIRDAICFKRVLVILDDIDQIEQIHAIIGMKNWFCP  334

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITT+   LLK  E    +K++E+ ++ESL+LF  ++FG+D P +  ME S + ++
Sbjct  335   GSKIIITTKNSCLLKVEEIQKVHKVREMGNDESLELFSWHSFGEDHPADDYMELSKRVVK  394

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HCGGLPLAL+ LGS L GRS+DVW+S L+KLE I   ++ + L+   + L DD+DK LF+
Sbjct  395   HCGGLPLALQVLGSSLCGRSIDVWKSALDKLEAIPASQVIKKLKFGYDSLKDDHDKNLFL  454

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F  KD+D+ I VL++  ++  VGIQNL D  L+T++  NKL+M Q+I++MG+EI+
Sbjct  455   DIACFFTRKDKDYVIAVLDESYIYTRVGIQNLTDRFLLTIEG-NKLIMHQMIRDMGREIV  513

Query  1038  RQDS  1027
             RQ+S
Sbjct  514   RQES  517


 Score =   152 bits (383),  Expect(2) = 9e-118, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 100/135 (74%), Gaps = 0/135 (0%)
 Frame = -1

Query  2533  FYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisi  2354
              YHAFLSFRGEDTRK FTD LY AL+ AG RTF+DD+EI RGENI  EL   IR SR SI
Sbjct  17    IYHAFLSFRGEDTRKTFTDTLYAALVGAGWRTFKDDNEIERGENIKTELENAIRNSRSSI  76

Query  2353  IVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKR  2174
             I+ SK+YA+S WCLDEL+ IL  ++++GHA+ P+FY V  ++V  Q+ SFAEAF  + ++
Sbjct  77    IILSKNYATSTWCLDELVKILEHKRTKGHAILPVFYHVDPSEVRDQTKSFAEAFSTYERQ  136

Query  2173  EKMEVEEGRVEWKGK  2129
              + E +EG+ EW  K
Sbjct  137   IEAESDEGKREWMDK  151



>ref|XP_007200327.1| hypothetical protein PRUPE_ppa000525mg [Prunus persica]
 gb|EMJ01526.1| hypothetical protein PRUPE_ppa000525mg [Prunus persica]
Length=1114

 Score =   302 bits (774),  Expect(2) = 2e-117, Method: Compositional matrix adjust.
 Identities = 176/367 (48%), Positives = 252/367 (69%), Gaps = 2/367 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL E+A + GMVLQ + DGHE++FI+K+++ I ++L+RT +SV  + +G+ S+V KIN
Sbjct  151   RAALTEIADVAGMVLQNQADGHESKFIKKVVKVIEERLSRTPISVARHLIGIHSQVKKIN  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WL+D S+DVG+ +I G+ G+GKTT+AK  YN ++ RFEGS FL N+R  SE  NG V +
Sbjct  211   LWLRDGSTDVGILMIYGMRGIGKTTIAKYVYNSDFKRFEGSSFLENIREVSEQSNGLVKI  270

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +IL GR+  I +  EGIIKI+D I SK+V +V DDVD L+ LD ++  +D F  
Sbjct  271   QRQLLSDILHGRKVNIHSVSEGIIKIQDTISSKRVLLVLDDVDHLDQLDAILRMQDLFYP  330

Query  1575  GSKIIITTRCENLLKGHERHLQ-YKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAI  1399
             GSKII+TT C  LL+ H + ++ + +  L   ESL+LF  +AFGQD P+E  M +S + +
Sbjct  331   GSKIIVTTCCAGLLQAHHKVIKVHNVATLGYTESLELFSWHAFGQDHPIEAYMAHSHRVV  390

Query  1398  RHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLF  1222
                GGLPLALK LGS LSG+S+ VW S L KLE I + +I + + IS + L DD+D+ LF
Sbjct  391   SQSGGLPLALKVLGSSLSGKSIAVWESALNKLEAIPNSEILKKIRISFDSLQDDHDRSLF  450

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
             + IAC F+G D      +L+ C  +  V IQNLID  LVT+D +NK+ M  +I++MG+ I
Sbjct  451   LHIACFFIGMDTYVISRILDDCGFYTTVAIQNLIDRCLVTIDENNKVEMHNMIRDMGRGI  510

Query  1041  LRQDSRD  1021
             +R +S D
Sbjct  511   VRLESED  517


 Score =   150 bits (380),  Expect(2) = 2e-117, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 99/145 (68%), Gaps = 3/145 (2%)
 Frame = -1

Query  2587  MEAEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRG  2408
             M  EA +  +   +   + YH FLSFRG+DTRK FTDHLYTA +NAG +TFRDDDE+ RG
Sbjct  1     MAQEASSSNTCPPASSGYSYHVFLSFRGKDTRKTFTDHLYTAFVNAGFQTFRDDDELERG  60

Query  2407  ENIDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRK---SEGHAVFPIFYSVG  2237
             + I  EL + I++S+  +IVFSKDYA S WCLDEL+ IL R+K   S+ H V PIFY V 
Sbjct  61    KGIKPELEKAIQQSQSCVIVFSKDYAFSEWCLDELVMILERKKRSSSQEHVVLPIFYDVD  120

Query  2236  RADVEKQSGSFAEAFERHAKREKME  2162
              + V +Q+GS AEAF  H K + + 
Sbjct  121   PSQVRRQTGSLAEAFATHQKNQSLN  145



>gb|ADL36717.1| HD domain class transcription factor [Malus domestica]
Length=561

 Score =   310 bits (794),  Expect(2) = 3e-117, Method: Compositional matrix adjust.
 Identities = 181/366 (49%), Positives = 251/366 (69%), Gaps = 1/366 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL ++A L GMVL  + D ++++FI KI++ I  KL RT L V S  +G+ SRV +IN
Sbjct  151   REALAQLADLAGMVLSNQADRYKSKFITKIVKVIGDKLIRTPLGVESNLIGIQSRVKRIN  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+DVG+  + G+ G+GKTT+AK  YN N+  FEGS F+ N+R  +  PNG V +
Sbjct  211   LWLQDGSTDVGIVAVHGMSGIGKTTIAKYVYNSNFTSFEGSSFVENIRETASQPNGLVQM  270

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +ILKG+EE + N  EGI KI  AI S++V +V DD+D ++ LD V+  +D F  
Sbjct  271   QMQLLYDILKGKEEKVHNVSEGISKIVRAISSRRVLLVLDDIDHMDQLDAVLRMKDRFYP  330

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR E LLK H+    + ++ LD +ESL+L   +AFGQD P E  MEYS K ++
Sbjct  331   GSKIIITTRHERLLKVHQVTKVHGVETLDYDESLELLSWHAFGQDHPPEGYMEYSKKLVQ  390

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             H GGLPLAL+ LGS L G SM VW S LEKL+ I + +I   L IS + L DD+D++LF+
Sbjct  391   HTGGLPLALQVLGSSLLGESMGVWESALEKLKVIPNGEIMNKLRISYDSLQDDHDRKLFL  450

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC  +G+D+++ + +L+ CD +  VGIQNLID  LV +D D K+ M  LI++MG+EI+
Sbjct  451   HIACFLIGRDKNYIVRILDGCDFYTTVGIQNLIDRCLVKIDEDKKVNMHDLIRDMGREIV  510

Query  1038  RQDSRD  1021
             R +S +
Sbjct  511   RLESEE  516


 Score =   142 bits (359),  Expect(2) = 3e-117, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 94/131 (72%), Gaps = 1/131 (1%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGEDTR+ FTDHLYTAL NAG  TFRDDDE+ RGE+I   L++ IR+SR+S++
Sbjct  22    YDVFLSFRGEDTRRTFTDHLYTALNNAGFLTFRDDDELERGEDIKPGLQKAIRQSRMSVV  81

Query  2350  VFSKDYASSRWCLDELLTILGR-RKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKR  2174
             VFSKDYASSRWCLDEL+ IL R R +  H V P+FY V  +   KQ+GS  +AF RH K 
Sbjct  82    VFSKDYASSRWCLDELVMILERKRTTSDHVVLPVFYDVDPSHARKQTGSIGKAFARHEKT  141

Query  2173  EKMEVEEGRVE  2141
             +      GR E
Sbjct  142   QSPSKVRGRRE  152



>ref|XP_009351002.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=559

 Score =   315 bits (806),  Expect(2) = 3e-117, Method: Compositional matrix adjust.
 Identities = 184/366 (50%), Positives = 251/366 (69%), Gaps = 1/366 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL E+A   GMVL  + DG+E++FI KII+ I  KL RT L V S  +G+ SRV  IN
Sbjct  151   REALAELADRAGMVLSNQADGYESKFITKIIKVIGDKLIRTPLGVESNLIGIQSRVKHIN  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+DVG+  + G+ G+GKTT+AK  YN N+  FEGS F+ N+R  +  PNG V +
Sbjct  211   LWLQDGSTDVGIVAVHGMSGIGKTTIAKYVYNSNFTSFEGSSFVENIRETASQPNGLVQM  270

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +ILKG+EE + +  EGI KI  AI S++V +V DDVD ++ LD V+  +D F  
Sbjct  271   QMQLLYDILKGKEEKVHSVSEGISKIVRAISSRRVLLVLDDVDHMDQLDAVLRMKDRFYP  330

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR E LLK H+    ++++ LD +ESL+L   +AFGQD P E  MEYS K +R
Sbjct  331   GSKIIITTRRERLLKAHQVTKVHRVETLDYDESLELLSWHAFGQDHPPEGYMEYSKKLVR  390

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             H GGLPLAL+ LGS L G SM VW S LEKLE I + +I   L IS + L D++D++LF+
Sbjct  391   HTGGLPLALRVLGSSLLGESMGVWESALEKLEVIPNGEIMNKLRISYDSLQDEHDRKLFL  450

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC  +G+ +++ + +L+ CD +  VGIQNLID  LV +D D+K+ M  LI++MG+EI+
Sbjct  451   HIACFLIGRHKNYIVRILDGCDFYTTVGIQNLIDRCLVKIDTDDKVNMHDLIRDMGREIV  510

Query  1038  RQDSRD  1021
             R +S +
Sbjct  511   RLESEE  516


 Score =   137 bits (346),  Expect(2) = 3e-117, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 89/121 (74%), Gaps = 1/121 (1%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGEDTR+ FTDHLYTAL NAG  TFRDDDE+ RGE+I   L++ IR+SR S++
Sbjct  22    YDVFLSFRGEDTRRTFTDHLYTALNNAGFLTFRDDDELERGEDIKPGLQKAIRQSRASVV  81

Query  2350  VFSKDYASSRWCLDELLTILGR-RKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKR  2174
             VFSKDYASSRWCLDEL+ IL R R +  H V P+FY V  +   KQ+ S  +AF RH K 
Sbjct  82    VFSKDYASSRWCLDELVMILERKRTTSDHVVLPVFYDVDPSHARKQTESIGKAFARHEKT  141

Query  2173  E  2171
             +
Sbjct  142   Q  142



>ref|XP_008354870.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=934

 Score =   311 bits (796),  Expect(2) = 3e-117, Method: Compositional matrix adjust.
 Identities = 195/420 (46%), Positives = 266/420 (63%), Gaps = 8/420 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL E+A L G VL  + DG+E++FI KI++ I  KL RT L V S  +G+ SRV  IN
Sbjct  151   REALAELADLAGTVLSNQADGYESKFITKIVKVIGDKLXRTPLGVESNLIGIQSRVKHIN  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+DVG+  + G+ G+GKTT+AK  YN N+  FEGS F+ N+R  +  PNG V +
Sbjct  211   LWLQDGSTDVGIVAVHGMSGIGKTTIAKYVYNSNFTSFEGSSFVENIRETASQPNGLVQM  270

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +ILKG+EE + N  EGI KI  A  S++V +V DDVD ++ LD V+  +D F  
Sbjct  271   QMQLLYDILKGKEEKVHNVSEGISKIVRAXSSRRVLLVLDDVDHMDQLDAVLRMKDRFYP  330

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR E LLK H+    + ++ LD +ESL+L   +AFGQD P E  MEYS K ++
Sbjct  331   GSKIIITTRRERLLKAHQVTKVHXVETLDYDESLELLSWHAFGQDHPPEGYMEYSKKLVQ  390

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             H GGLPLAL+ LGS L G S  VW S LEKL+ I + +I   L IS + L DD+D++LF+
Sbjct  391   HTGGLPLALQVLGSSLLGESXGVWESALEKLKVIPNGEIMNKLXISYDSLQDDHDRKLFL  450

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC  +G+D+++ + +L+ CD +  VGIQNLID  LV +D  NK+ M  LI++MG+EI+
Sbjct  451   HIACFLIGRDKNYIVRILDGCDFYTTVGIQNLIDRCLVKIDKXNKVNMHDLIRDMGREIV  510

Query  1038  RQDSRDD--LHTLSKLLDQLVSSTESTGN----GVVNESASH-VNSPKRPYSQEFEDNSI  880
             R +S++      L +  D      E TG     G+V +   H  N P       FE N+ 
Sbjct  511   RLESKEPEKRSRLWRRKDSFQVLREXTGTETIQGIVLDMHXHPANGPINTNETVFETNAF  570


 Score =   141 bits (356),  Expect(2) = 3e-117, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 91/121 (75%), Gaps = 1/121 (1%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGEDTR+ FTDHLYTAL NAG  TFRDDDE+ RGE+I   L++ IR+SR+S++
Sbjct  22    YDVFLSFRGEDTRRTFTDHLYTALNNAGFLTFRDDDELERGEDIKPGLQKAIRQSRMSVV  81

Query  2350  VFSKDYASSRWCLDELLTILGR-RKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKR  2174
             VFSKDYASSRWCLDEL+ IL R R +  H V P+FY V  +   KQ+GS  +AF RH K 
Sbjct  82    VFSKDYASSRWCLDELVMILERKRTTSDHVVLPVFYDVDPSHARKQTGSIGKAFARHEKT  141

Query  2173  E  2171
             +
Sbjct  142   Q  142



>ref|XP_008345648.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=779

 Score =   311 bits (798),  Expect(2) = 5e-117, Method: Compositional matrix adjust.
 Identities = 180/366 (49%), Positives = 252/366 (69%), Gaps = 1/366 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL E+A L GMVLQ + DG+E+ FI+ II+ I  KL+RT LSV    +G+ S+   IN
Sbjct  151   RKALAEIADLAGMVLQNQADGYESTFIKNIIKVIGDKLSRTPLSVEPKLIGIQSQAEXIN  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              W QD SSDVG+ V+ G+ G+GKTT+AK  YN N+  F+GS F+ N++  ++ PNG V +
Sbjct  211   LWFQDGSSDVGIFVVYGMSGIGKTTIAKHVYNSNFGSFQGSSFIENIKETADRPNGLVQI  270

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +IL GRE  I +  EGIIKI+ AI SK+V +V DDVD ++ LD ++  +D F  
Sbjct  271   QMQLLCDILNGREVKIHSVSEGIIKIERAISSKRVLLVLDDVDHMDQLDAILXMKDQFYP  330

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKI+ITTRCE LLK  +    ++++ LDD ESLKLF  +AFGQD P+E  ME+S + ++
Sbjct  331   GSKILITTRCERLLKADQVTEVHRVQTLDDNESLKLFSWHAFGQDHPIEEYMEHSKQLVQ  390

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             H GGLPLALK LGS LSG  + VW S LEKL+ I   +I   L IS   L DD+D++LF+
Sbjct  391   HSGGLPLALKVLGSSLSGGRIGVWESALEKLKVIPDGEIMSKLRISYESLKDDHDRKLFL  450

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC  +G+++ + + + + CD + ++GIQNLID  LVT+D   K+ M  LI+ MG+EI+
Sbjct  451   HIACFLIGRNKSYIVRIFDGCDFYTIIGIQNLIDRCLVTLDEYGKVNMHDLIRAMGREIV  510

Query  1038  RQDSRD  1021
             RQ+S +
Sbjct  511   RQESEE  516


 Score =   140 bits (352),  Expect(2) = 5e-117, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 95/139 (68%), Gaps = 4/139 (3%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGE+TRK FTDHLYTAL NAG  TFRDDDE+ RGE I   L++ I++SR S++
Sbjct  22    YDVFLSFRGEETRKTFTDHLYTALNNAGFLTFRDDDELERGEXIKPGLQKAIQQSRTSVV  81

Query  2350  VFSKDYASSRWCLDELLTILGR-RKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKR  2174
             VFSKDYASS WCLDEL+ IL R R +  H V P+FY V  + V KQ+GS  +AF R  K 
Sbjct  82    VFSKDYASSSWCLDELVLILERKRTTSDHVVLPVFYDVDPSHVRKQTGSVGKAFARSQKN  141

Query  2173  EKMEVEEGRVEWKGKGGEV  2117
             +  E  +G   W+    E+
Sbjct  142   QSPEKVQG---WRKALAEI  157



>ref|XP_009358933.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1225

 Score =   295 bits (755),  Expect(2) = 9e-117, Method: Compositional matrix adjust.
 Identities = 175/367 (48%), Positives = 246/367 (67%), Gaps = 2/367 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL EVA L GMVLQ + DGHE++FI+KI++ I  KL+RT +SV  + +G+ SRV  IN
Sbjct  153   RAALTEVADLAGMVLQHQADGHESKFIKKIVKVIEGKLSRTPISVAPHLIGIHSRVQNIN  212

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+D  + +I G+ G+GKTT+AK  YN NY RF+G+ FL N+R  S  PNG V +
Sbjct  213   LWLQDGSTDPDILIIYGMRGMGKTTIAKCVYNSNYKRFQGTSFLENIREISGQPNGLVQI  272

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+  ++L G++  I +  EG+IKI+DAI S+KV +V DDVD ++ LD V+  +     
Sbjct  273   QKQLLYDVLNGKKVKIHSISEGVIKIEDAISSRKVLLVLDDVDHMDQLDAVLRMQGQLYP  332

Query  1575  GSKIIITTRCENLLKGHERHLQ-YKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAI  1399
             GSKIIITT    LLK     ++ + ++  D  ESL+LF  +AFGQD P+E  +E S + +
Sbjct  333   GSKIIITTSNAGLLKARHHAIKVHNVQSFDRSESLELFSWHAFGQDYPIEDYLELSERVV  392

Query  1398  RHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLF  1222
                GGLPLALK LGS L G+S  VW S L KL+ I + +I   L IS + L DD+DK LF
Sbjct  393   HLSGGLPLALKILGSSLFGQSTLVWESALNKLKAIPNGEILNKLRISYDSLQDDHDKNLF  452

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
             + IAC F+G ++D  + +L+ CD + VVGIQNL+D  LVT+D  NK+ M  +++ MG+ I
Sbjct  453   LHIACFFIGMEKDVIVRILDSCDFYTVVGIQNLMDRCLVTIDEYNKVKMHHMVREMGRGI  512

Query  1041  LRQDSRD  1021
             +  +S++
Sbjct  513   VGFESKE  519


 Score =   155 bits (393),  Expect(2) = 9e-117, Method: Composition-based stats.
 Identities = 75/123 (61%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             YH FLSFRGEDTRK FTDHLYTA +NAG  TFRDDDE+ RG +I  EL++ I++SR S+I
Sbjct  24    YHVFLSFRGEDTRKTFTDHLYTAFVNAGFLTFRDDDELERGTDIKQELQKIIQQSRSSVI  83

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKRE  2171
             V SKDYASSRWCLDEL+ IL R ++  H V P+FY +    V KQ GSFA++F RH K  
Sbjct  84    VLSKDYASSRWCLDELVMILERNRTSDHVVLPVFYDIDPPQVRKQEGSFAKSFARHEKDR  143

Query  2170  KME  2162
              ++
Sbjct  144   SLK  146



>ref|XP_008227882.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1211

 Score =   309 bits (792),  Expect(2) = 2e-116, Method: Compositional matrix adjust.
 Identities = 180/367 (49%), Positives = 253/367 (69%), Gaps = 4/367 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R ALR+VA L GMVL    D +E++FIQ I+ EI  KLN T  ++  + VG+ +RV  IN
Sbjct  150   RRALRDVADLGGMVLG---DRYESQFIQNIVEEIENKLNHTTPNIAPHLVGIDNRVRGIN  206

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WL+D S+DVGV VI G+GGVGKTT+AK AY  N+D+F+GS FL +VRAASE PNG V L
Sbjct  207   MWLKDRSNDVGVAVIYGMGGVGKTTIAKAAYKQNFDKFQGSSFLPDVRAASEQPNGLVCL  266

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+++  +I KG+ + I++ DEG+ KIK  +  K+V IV DDV+  E  + ++G R+WF  
Sbjct  267   QRKLLSDIQKGKTKKIYSIDEGMSKIKLVVRCKRVLIVLDDVNHSEQFNAILGMREWFHP  326

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKII+TTR ENL   H  H  +K+KEL + ESL+LF  +AF Q  P++  M  S   ++
Sbjct  327   GSKIIVTTRHENLFNDHAVHAMFKVKELGEGESLELFNWHAFKQAHPIKGYMNLSRSVVQ  386

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HC GLPLAL+ LGS L G+S+D+W+S L+KL  I    IQ+ L IS + L DD+D+ LF+
Sbjct  387   HCEGLPLALQVLGSSLFGKSVDLWQSALQKLHVIPDDNIQKILRISFDSLKDDHDRNLFL  446

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              I C F+ K   + I VL+  + +  +GIQNL+D  LV +D DN+L+M QL+++MG+ I+
Sbjct  447   HIVCFFIEKKMSYTITVLDNLNFYTRIGIQNLVDRCLVEIDVDNRLIMHQLLRDMGRAII  506

Query  1038  RQDSRDD  1018
             R++S +D
Sbjct  507   REESSED  513


 Score =   140 bits (354),  Expect(2) = 2e-116, Method: Composition-based stats.
 Identities = 82/139 (59%), Positives = 100/139 (72%), Gaps = 4/139 (3%)
 Frame = -1

Query  2551  SSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgir  2372
             S+  R  Y  FLS+RGEDTRK FTDHLY AL  AG  TFRDDDEI RG NI AE++R I+
Sbjct  12    STFYRCTYDVFLSYRGEDTRKGFTDHLYRALEQAGFHTFRDDDEIKRGANIAAEIQRAIQ  71

Query  2371  esrisiIVFSKDYASSRWCLDELLTILGRRKS-EGHAVFPIFYSVGRADVEKQSGSFAEA  2195
             ES++SIIVFSK+YASS WCLDEL+ I+ RRK+ +G  V P+FY V  + + K +GSFA A
Sbjct  72    ESQVSIIVFSKNYASSTWCLDELVKIMERRKADDGLMVMPVFYDVDPSHIRKLTGSFANA  131

Query  2194  F---ERHAKREKMEVEEGR  2147
             F   E H K +  +VEE R
Sbjct  132   FSGHEEHFKEDIHKVEEWR  150



>ref|XP_007204538.1| hypothetical protein PRUPE_ppa017291mg [Prunus persica]
 gb|EMJ05737.1| hypothetical protein PRUPE_ppa017291mg [Prunus persica]
Length=1126

 Score =   291 bits (746),  Expect(2) = 6e-116, Method: Compositional matrix adjust.
 Identities = 172/366 (47%), Positives = 242/366 (66%), Gaps = 3/366 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL +VA L GMVLQ +  G+EA+FI+KI++ I +KL+RT L+V    +G+  RV  IN
Sbjct  150   RDALAKVADLAGMVLQNQAHGYEAKFIKKIVKVIGEKLSRTPLNVDRNMIGMQYRVQNIN  209

Query  1935  KWLQDESSDvgvgvicglggvG-KTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVG  1759
              WLQ  S+D    ++        KTT+AK  YN N+ +FEGS FL N++  S+ PNG V 
Sbjct  210   LWLQHGSTDDVGILVIYGISGIGKTTIAKHVYNSNFQKFEGSSFLENIKEISQQPNGLVQ  269

Query  1758  LQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFS  1579
             +Q Q+  +IL G E  I    +GI +I+ AI SK+V +V DDVD ++ L+ V   +D F 
Sbjct  270   IQTQLLYDILNGTEVKIHGVSQGITEIEKAISSKRVLLVLDDVDHVDQLNAVHLMKDRFC  329

Query  1578  RGSKIIITTRCENLLKGHERHLQ-YKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKA  1402
              GSKII+TTR   LL+ H+   + + +K LD  ESL+L   +AFGQD PLE   EYS K 
Sbjct  330   PGSKIIVTTRHRGLLEAHQFITEVHAVKTLDHIESLELLSWHAFGQDHPLEDYTEYSKKL  389

Query  1401  IRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRL  1225
             + HCGGLPLALK LGS L G+S+ +W+S L+KLE I + +I R L +S + L DD+D++L
Sbjct  390   VDHCGGLPLALKVLGSSLFGKSIYIWKSALKKLEDIPNGEIIRKLRVSYDSLQDDHDQKL  449

Query  1224  FVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKE  1045
             F+ IAC F+GKD+D  + +L+ CD H +V I+ LI   LVT+D  +K+ M  LI+ MG+E
Sbjct  450   FLHIACFFIGKDKDCIVTILDGCDFHTLVTIEYLIHRCLVTIDEHDKVQMHDLIRGMGRE  509

Query  1044  ILRQDS  1027
             I+R +S
Sbjct  510   IVRLES  515


 Score =   156 bits (395),  Expect(2) = 6e-116, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 99/139 (71%), Gaps = 1/139 (1%)
 Frame = -1

Query  2575  ARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENID  2396
             A  Q S  ++     YH FLSFRGEDTRK FTDHLYTAL+NA   TFRDDDE+ RGE I 
Sbjct  6     AAQQTSSSNARRHCLYHVFLSFRGEDTRKTFTDHLYTALVNARFHTFRDDDELERGEEIK  65

Query  2395  AELrrgiresrisiIVFSKDYASSRWCLDELLTIL-GRRKSEGHAVFPIFYSVGRADVEK  2219
              EL + I+ SR S+IVFSKDYASSRWCLDEL+ IL  +R S+ H V P+FY V  + V K
Sbjct  66    PELEKAIKNSRSSVIVFSKDYASSRWCLDELVVILEHKRTSDDHVVLPVFYDVDPSHVRK  125

Query  2218  QSGSFAEAFERHAKREKME  2162
             Q+GS A+AF RH K + +E
Sbjct  126   QTGSLAKAFARHEKTQPLE  144



>ref|XP_007029528.1| TMV resistance protein N, putative [Theobroma cacao]
 gb|EOY10030.1| TMV resistance protein N, putative [Theobroma cacao]
Length=1238

 Score =   294 bits (752),  Expect(2) = 8e-116, Method: Compositional matrix adjust.
 Identities = 187/381 (49%), Positives = 256/381 (67%), Gaps = 19/381 (5%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R ALREVA L GM L+   D +E +FIQ II+++  KL+   L VP   VG+ S V  IN
Sbjct  147   RAALREVAVLGGMFLE---DRYEWQFIQDIIKQVQNKLHHPTLYVPPCVVGIDSLVTCIN  203

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WL D S+ VG+  ICG+GG+GKTT+AKV YNLN  RFE   FLA+VR  ++  NG V L
Sbjct  204   SWLGDGSNKVGIATICGIGGIGKTTIAKVVYNLNIQRFERYSFLADVREVTQERNGLVRL  263

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +ILKG+   I N+D+GI KIK+AI  ++V +V DDVD  E +  +IGA+  F  
Sbjct  264   QRQLISDILKGKVNKIHNSDDGITKIKEAICRRRVLLVLDDVDDSEKITELIGAQIPFHP  323

Query  1575  GSKIIITTRCENLLKGH--------ERHLQY-------KIKELDDEESLKLFCRYAFGQD  1441
             GSKIIIT+R + LL           E    Y       ++KEL   ES +LF  YAFGQ+
Sbjct  324   GSKIIITSRHQCLLSDPFIIQMFDLEASSSYGDLCKVFEVKELAFNESFQLFNWYAFGQN  383

Query  1440  DPLEHLMEYSVKAIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEI  1261
             DP+++ M+Y+   ++HCGGLPLAL+ LGS LSG+S++VW+S LEKL+ I   KIQ+ L I
Sbjct  384   DPIDNYMKYARSVVKHCGGLPLALQILGSSLSGKSINVWKSALEKLKAIPDSKIQKILRI  443

Query  1260  SLNPL-DDYDKRLFVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNK  1084
             S + L DD+DK LF+ IAC F+GKD+D+   +L+ CD +  +GI+NLI+ SL+ V+  NK
Sbjct  444   SYDSLQDDHDKNLFLDIACVFIGKDKDYTTTILDGCDYYTAIGIENLINRSLLVVNEKNK  503

Query  1083  LMMPQLIQNMGKEILRQDSRD  1021
             LMM Q+I++MG+ I+ Q+S D
Sbjct  504   LMMHQMIRDMGRNIICQESPD  524


 Score =   154 bits (388),  Expect(2) = 8e-116, Method: Composition-based stats.
 Identities = 84/137 (61%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = -1

Query  2566  QESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAEL  2387
             QES  SS+ R  Y  FLSFRG DTRKNFTDHLY  L+N GI TFRDDDEI RGE I  E+
Sbjct  7     QES--SSISRCGYDVFLSFRGVDTRKNFTDHLYMTLVNVGIHTFRDDDEIERGEKIRDEI  64

Query  2386  rrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGS  2207
              R I ES+ISII+FSK+YASS WCL+EL+ I+  RK   H V PIFY V  + V++Q+GS
Sbjct  65    ERAIYESKISIIIFSKNYASSTWCLNELVKIMEHRKFSKHIVLPIFYDVNPSQVKEQTGS  124

Query  2206  FAEAFERHAKREKMEVE  2156
             FAEAF RH +  K E++
Sbjct  125   FAEAFARHEESFKSEMD  141



>ref|XP_004292321.1| PREDICTED: TMV resistance protein N-like [Fragaria vesca subsp. 
vesca]
Length=638

 Score =   301 bits (772),  Expect(2) = 8e-116, Method: Compositional matrix adjust.
 Identities = 173/368 (47%), Positives = 254/368 (69%), Gaps = 3/368 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL EVA L GMVLQ E DGHE++FI+KI+R +  KL R  LSV  + +G+ S+   IN
Sbjct  147   REALAEVADLAGMVLQNEADGHESKFIEKIVRVMEDKLRRIPLSVEPHLIGIDSQTRDIN  206

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WL+D S+DV + ++ G+ G+GK+T+AK  YN N+ RFE   +L N+R A+E PNG + L
Sbjct  207   LWLRDGSADVDILLLHGMRGIGKSTIAKFVYNSNFQRFERCSYLENIREAAEQPNGLLRL  266

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+  +IL G +  I N  EGI KI+DAI S++VF+V DDVD ++ L  ++  ++ F  
Sbjct  267   QKQLLNDILSGSKVKIHNISEGIAKIEDAISSRRVFLVLDDVDHVDQLAALLRMKNRFHP  326

Query  1575  GSKIIITTRCENLLKGHERHLQ-YKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAI  1399
             GSKIIIT+ C  LL+ H +  + + ++ LD++E+L LF  +AFGQD P+E   ++S + I
Sbjct  327   GSKIIITSSCAGLLEAHCQFAKVHMVRILDEDEALALFSWHAFGQDHPIEGYTDHSKRVI  386

Query  1398  RHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLF  1222
              HCG LPLALK LG+ LSG+++ VW S L KLE I + +I + L+IS   + DD+DK LF
Sbjct  387   DHCGRLPLALKVLGASLSGKNLVVWESALNKLEVIPNGEIMKKLKISYESIQDDHDKALF  446

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNK-LMMPQLIQNMGKE  1045
             + IAC F+G ++   + +L+ CD    VGI+N+ID  LVT+D D+K + M  +I++MG+E
Sbjct  447   LHIACFFIGMEKAVVLTILDACDFFTEVGIENIIDRCLVTIDKDSKSVQMHDMIRDMGRE  506

Query  1044  ILRQDSRD  1021
             I+R +S++
Sbjct  507   IVRLESKE  514


 Score =   146 bits (368),  Expect(2) = 8e-116, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 100/138 (72%), Gaps = 2/138 (1%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             YH FLSFRGE+TRK FTDHLYTA I++G RTFRD+DE+ +G++I  E+R+ I  SR S+I
Sbjct  18    YHVFLSFRGEETRKTFTDHLYTAFISSGFRTFRDEDELPKGQDIKPEIRKAIELSRSSVI  77

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKRE  2171
             VFSKDYASS+WCLDEL+ I+ R+++  H V P+FY V  + V KQ+G  A+A  RH + +
Sbjct  78    VFSKDYASSQWCLDELVMIMERKRTADHIVLPVFYDVDPSQVRKQTGDLAKALARHERIQ  137

Query  2170  KMEVEEGRVEWKGKGGEV  2117
              ++ +  R  W+    EV
Sbjct  138   SLKSKVKR--WREALAEV  153



>ref|XP_008384972.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=537

 Score =   303 bits (777),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 175/366 (48%), Positives = 253/366 (69%), Gaps = 1/366 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REA+ EVA L G+VLQ + DG+E++FI KI++ +  KL+ +  SV    +G+ S+V  IN
Sbjct  151   REAVAEVADLAGIVLQNQADGYESKFITKIVKVVGDKLSCSPFSVEPKLIGIESQVEDIN  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S++VG+ V+ G+ G+GKTT+AK  YN N+  FEGS F+ N+R  ++ PNG V +
Sbjct  211   LWLQDGSTNVGILVVYGMSGIGKTTIAKXVYNSNFRSFEGSSFIENIRETADQPNGLVQI  270

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+  +IL  RE  I    EG+ KI+  I S++V +V DDVD ++ LD V+  +D F  
Sbjct  271   QKQLLADILNDREVKIHGVSEGLRKIERGISSRRVLLVLDDVDHMDQLDAVLKIKDQFYP  330

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKI+ITTR E LLK HE    ++++ LD  +SL+LF R+AFGQD PLE  +EYS + + 
Sbjct  331   GSKILITTRRERLLKAHEVIKVHEVETLDYNKSLELFSRHAFGQDQPLEGYIEYSKRVVS  390

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HCGGLPLAL+ LGS LSG S+DVW   LEKL+ I + +I     IS + L DD+D++LF+
Sbjct  391   HCGGLPLALRVLGSSLSGESIDVWERALEKLKVIPNGEIMSKQRISYDSLQDDHDRKLFL  450

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC  +G+++ + + +L+ CD + +VGIQNLID  LVT+D   K+ M  +I++MG+EI+
Sbjct  451   HIACFLIGRNKSYIVRILDGCDFYTIVGIQNLIDRCLVTLDEYGKVKMHDMIRDMGREIV  510

Query  1038  RQDSRD  1021
             R +S +
Sbjct  511   RLESEE  516


 Score =   144 bits (362),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 98/139 (71%), Gaps = 4/139 (3%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGEDTRK FTDHLYTAL NAG  T RDDDE+ RGE+I   L++ I+ SR S++
Sbjct  22    YDVFLSFRGEDTRKTFTDHLYTALNNAGFLTVRDDDELERGEDIKPGLQKAIQLSRASVV  81

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEG-HAVFPIFYSVGRADVEKQSGSFAEAFERHAKR  2174
             VFSKDYASSRWCLDEL+ IL RR++   H V P+FY V  + + KQ+GS  +AF RH K 
Sbjct  82    VFSKDYASSRWCLDELVLILERRRTTSDHVVLPVFYDVDPSHLRKQTGSVGKAFARHEKT  141

Query  2173  EKMEVEEGRVEWKGKGGEV  2117
             + ++  +G   W+    EV
Sbjct  142   QSLKKVKG---WREAVAEV  157



>ref|XP_011000598.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=1107

 Score =   301 bits (771),  Expect(2) = 2e-115, Method: Compositional matrix adjust.
 Identities = 187/375 (50%), Positives = 258/375 (69%), Gaps = 5/375 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REALR+VA L+G VL+   D +EA+FIQ I++E+ KKLNR +L VP Y VG+ S V +I+
Sbjct  147   REALRKVAVLKGPVLR---DRYEAQFIQDIVKEVAKKLNRMILHVPPYLVGIESHVKEIS  203

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S  VG+ V+ G GGVGKTT+AK  +N N+  F+   FL +VR  S  PNG V L
Sbjct  204   SWLQDGSDKVGIAVLHGFGGVGKTTIAKTVFNQNFHEFDSWSFLGDVRETSNQPNGLVRL  263

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+++  +ILKG  + I+N DEG IKI++A+ +K+V +V DDVD L+ LD VIG R+   +
Sbjct  264   QRRLLSDILKGEPQKIYNVDEGNIKIQNALVNKRVLVVLDDVDHLDQLDKVIGDRNQLYQ  323

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKII+T R  +LLK HE   ++ +  L  +ESL+LF  +AFGQ  P E   E+S K + 
Sbjct  324   GSKIIVTARHGSLLKSHEACEKFGVDALCYDESLQLFSWHAFGQALPNEGYEEFSQKIVH  383

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERI-LHHKIQRNLEISLNPL-DDYDKRLF  1222
             HC G+PL L+ LGS LSG+S+D W+S  +  E I    KIQ+ L+IS + L D+ DK LF
Sbjct  384   HCAGIPLVLEVLGSSLSGKSIDFWKSASQDPEAIDGDGKIQKILKISYDSLRDERDKNLF  443

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
             + IAC F+G D+D+   +LE C  +  +GIQ LID  LVTVD DNKLMM QL+++MG+EI
Sbjct  444   LDIACFFIGNDKDYVRRILECCGFYRTLGIQKLIDSCLVTVDKDNKLMMHQLLRDMGREI  503

Query  1041  LRQDSRDDLHTLSKL  997
             +R++S +DL   ++L
Sbjct  504   VRRESPEDLGKRTRL  518


 Score =   145 bits (366),  Expect(2) = 2e-115, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 102/139 (73%), Gaps = 2/139 (1%)
 Frame = -1

Query  2557  GISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrg  2378
               SSV +  Y  FLSFRG D+RKNFTDHLYTAL  AGIRTFRDDDEI  GE+I  ++R+ 
Sbjct  9     ACSSVHQHAYDVFLSFRGADSRKNFTDHLYTALKWAGIRTFRDDDEIKGGEHIGFKIRKA  68

Query  2377  iresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAE  2198
             I+ES++S++VFS+DYASS+WCL+ELL I+ RR+  GH V P+FY V   DV  Q+G FAE
Sbjct  69    IQESKMSLVVFSRDYASSKWCLEELLMIMKRREIIGHIVLPVFYEVDPDDVSTQTGFFAE  128

Query  2197  AFERHAKR--EKMEVEEGR  2147
             AF  H K   E  ++EE R
Sbjct  129   AFASHEKNLMENRDMEEWR  147



>ref|XP_008228037.1| PREDICTED: TMV resistance protein N-like, partial [Prunus mume]
Length=490

 Score =   292 bits (748),  Expect(2) = 6e-115, Method: Compositional matrix adjust.
 Identities = 170/347 (49%), Positives = 241/347 (69%), Gaps = 6/347 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTV---LSVPSYTVGLASRVG  1945
             ++ALR+VA L GMVL    D +E++FIQ I+  I  KL+ T    L V  Y VG+ +RV 
Sbjct  147   KKALRDVADLGGMVLG---DRYESQFIQDIVEVIGNKLDHTWNRRLIVDPYVVGIDNRVE  203

Query  1944  KINKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQ  1765
              +N WL+D SSDVGV V+ G+GG+GKTT+AK+AYN N+ +F+G  FLA++RA SE+PNG+
Sbjct  204   GLNMWLEDGSSDVGVAVVYGMGGIGKTTIAKIAYNRNFYKFQGGSFLADIRATSELPNGE  263

Query  1764  VGLQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDW  1585
             V LQ+++  ++ KG+ + I++ DEGI KIK AI  K+V +  DD+D LE  + ++G R+W
Sbjct  264   VHLQRKLLSDLQKGKAKKIYSLDEGITKIKRAIRCKRVLVALDDIDNLEQFNAILGMREW  323

Query  1584  FSRGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVK  1405
                GSKIIITTR E+LLK HE    +K++ L + ESL+LF  +AF Q  P E  M+ S  
Sbjct  324   LHPGSKIIITTRHEHLLKAHENCAMFKVEGLHEHESLELFSWHAFRQPHPSEGYMDLSRP  383

Query  1404  AIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRL  1225
              ++HCGG+PLALK LGS L G++ DVW++ L+ L+ I   KIQ+ L IS + L D+ KRL
Sbjct  384   VVQHCGGVPLALKVLGSSLFGKAADVWKNALQNLDVITEGKIQKILRISFDSLQDHVKRL  443

Query  1224  FVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNK  1084
             F+ IAC F+GK +DF+  VL++C+    +GIQNL+D  L+ +D  NK
Sbjct  444   FLHIACFFIGKHKDFSTTVLDECEFATNIGIQNLVDRCLLIIDGFNK  490


 Score =   152 bits (384),  Expect(2) = 6e-115, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 106/149 (71%), Gaps = 3/149 (2%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A   TQ+    S  R  Y AFLSFRG DTRK FTDHLY AL  AGI TFRDDDEI RG N
Sbjct  2     AATSTQQD--PSSHRCTYDAFLSFRGTDTRKGFTDHLYRALEVAGIHTFRDDDEIERGAN  59

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVE  2222
             I AEL++ I+ESR+SIIVFSKDYASSRWCLDEL+TI+ RR++  H V PIFY V  + V 
Sbjct  60    ISAELQKAIQESRVSIIVFSKDYASSRWCLDELVTIMDRRETNEHMVMPIFYDVDPSHVR  119

Query  2221  KQSGSFAEAFERHAKREKMEVEEGRVEWK  2135
              Q+G F EAF RH +R   E+++   +WK
Sbjct  120   NQTGIFEEAFARHQQRFNKEMDKVE-KWK  147



>ref|XP_007029533.1| TMV resistance protein N [Theobroma cacao]
 gb|EOY10035.1| TMV resistance protein N [Theobroma cacao]
Length=1322

 Score =   293 bits (751),  Expect(2) = 7e-115, Method: Compositional matrix adjust.
 Identities = 187/379 (49%), Positives = 252/379 (66%), Gaps = 19/379 (5%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL EVA L GM+L+   DGHE +FIQ II+++  KL+ T L VP   VG+ S V  IN
Sbjct  150   RAALTEVADLGGMLLE---DGHEWQFIQDIIKQVQNKLHHTALYVPPIVVGIDSLVTCIN  206

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WL D S+ VG+  ICG+GG+GKTT+AK+ YNLN  RFE   FLA+VR  ++   G V L
Sbjct  207   WWLGDGSNKVGIATICGIGGIGKTTIAKIVYNLNIQRFESYSFLADVREITQERKGLVHL  266

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +ILKG+   I N+D+GI KIK+AI  ++V +V DDVD  E +  +IGA+  F  
Sbjct  267   QRQLIADILKGKVNKIHNSDDGITKIKEAIYRRRVLLVLDDVDDSEKITKIIGAQIPFHP  326

Query  1575  GSKIIITTRCENLLKGH---------------ERHLQYKIKELDDEESLKLFCRYAFGQD  1441
             GSKIIIT+R   LL                  E    +++KEL   +SL+LF  YAFGQ 
Sbjct  327   GSKIIITSRHRCLLSDPFIRQMFDLEASSSYGELCKVFEVKELAFNDSLQLFKWYAFGQC  386

Query  1440  DPLEHLMEYSVKAIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEI  1261
              P++  MEY    + HCGGLPLAL+ LGS LSG+S++VWRS LEKL+ I   KIQ+ L I
Sbjct  387   HPIDSYMEYVKSVVEHCGGLPLALQVLGSSLSGKSINVWRSALEKLKAIPDSKIQKILRI  446

Query  1260  SLNPL-DDYDKRLFVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNK  1084
             S + L DD+DK LF+ IAC FVGKD+D+   +L++CD +  +GI+NLI+ SL+ V+  NK
Sbjct  447   SYDSLQDDHDKNLFLDIACVFVGKDKDYTTTILDECDYYTAIGIENLINRSLLVVNEKNK  506

Query  1083  LMMPQLIQNMGKEILRQDS  1027
             LMM Q+I+ +G+ I+RQ+S
Sbjct  507   LMMHQMIREIGRNIIRQES  525


 Score =   151 bits (381),  Expect(2) = 7e-115, Method: Composition-based stats.
 Identities = 85/150 (57%), Positives = 104/150 (69%), Gaps = 2/150 (1%)
 Frame = -1

Query  2566  QESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAEL  2387
             QES +S   ++ Y   LSFRG DTRKNFTDHLY AL+ AGI TFRDDDEIG+GENI  E+
Sbjct  9     QESSLSD-SQYTYDVLLSFRGADTRKNFTDHLYMALVQAGIHTFRDDDEIGKGENIKNEI  67

Query  2386  rrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGS  2207
              R I ES+ISIIVFSK+YASS WCL+EL+ I+   K   H V PIFY V  + V+KQ+GS
Sbjct  68    ERAIYESKISIIVFSKNYASSTWCLNELVKIMEHSKFSKHIVLPIFYDVNPSQVKKQTGS  127

Query  2206  FAEAFERHAKREKMEVEEGRVEWKGKGGEV  2117
             FA AF  H +  K E++  +  W+    EV
Sbjct  128   FAAAFAGHEESFKSEMDMVQ-RWRAALTEV  156



>ref|XP_009354361.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1187

 Score =   305 bits (780),  Expect(2) = 2e-114, Method: Compositional matrix adjust.
 Identities = 181/366 (49%), Positives = 252/366 (69%), Gaps = 3/366 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REA+ EVA L GMVLQ   DG+E++FI+KI++ +  KL+RT LSV    +G+ S+V  IN
Sbjct  150   REAVAEVADLAGMVLQ--ADGYESKFIEKIVKVVGDKLSRTPLSVEPKLIGIESQVEDIN  207

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+DVG+ V+ G+ G+GKTT+AK  YN N+  FEGS F+ N+R  ++ PNG V +
Sbjct  208   LWLQDGSTDVGILVVYGMSGIGKTTIAKHVYNSNFRSFEGSSFIENIRETADRPNGLVKI  267

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+  +IL GRE  I    +G+IKI+ AI S++V +V DDVD ++ LD V+  +D F  
Sbjct  268   QKQLLSDILNGREVKIHGVSDGLIKIERAISSRRVLLVLDDVDHMDQLDAVLKMKDRFYP  327

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKI+ITTR E LLK H+    +K+  L   ESL+LF  +AF QD PL   MEYS K ++
Sbjct  328   GSKILITTRRERLLKAHQVTKVHKVGTLYYNESLELFSWHAFCQDHPLRGYMEYSEKVVQ  387

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             +C GLPLALK LGS LSG S+DVW S LEKL+ I + +I   L IS + L DD+D++LF+
Sbjct  388   YCNGLPLALKVLGSSLSGESIDVWESALEKLKAIPNGEIMNKLRISYDSLQDDHDRKLFL  447

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC  +G+++   + +L  CD + +VGIQNL+D  LVT+D  N + M  LI++MG+EI+
Sbjct  448   HIACFLIGRNKSHIVRILNGCDFYTIVGIQNLLDRCLVTIDGCNNVQMHDLIRDMGREIV  507

Query  1038  RQDSRD  1021
               +S +
Sbjct  508   NHESEE  513


 Score =   138 bits (348),  Expect(2) = 2e-114, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 95/137 (69%), Gaps = 5/137 (4%)
 Frame = -1

Query  2524  AFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiIVF  2345
              FLSFRG DTRK FTDHLYTAL NAG  TFRDDDE+ RGE+I   L++ I  SR S++VF
Sbjct  24    VFLSFRG-DTRKTFTDHLYTALNNAGFNTFRDDDELVRGEDIKPGLQKAIWLSRTSVVVF  82

Query  2344  SKDYASSRWCLDELLTILGR-RKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKREK  2168
             SKDYASSRWCLDEL+ IL R R +  H V P+FY V  +D+ KQ+GS  +AF RH K + 
Sbjct  83    SKDYASSRWCLDELVLILERKRTTSDHVVIPVFYDVDPSDMRKQTGSIGKAFARHQKTQS  142

Query  2167  MEVEEGRVEWKGKGGEV  2117
              +  +G   W+    EV
Sbjct  143   PKKVKG---WREAVAEV  156



>ref|XP_009370620.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1192

 Score =   286 bits (731),  Expect(2) = 4e-114, Method: Compositional matrix adjust.
 Identities = 177/390 (45%), Positives = 251/390 (64%), Gaps = 22/390 (6%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL +VA L GMVL    D +E +FIQ I+ EI  KL+   L V  + VG+  RV ++N
Sbjct  147   RRALGDVASLAGMVLG---DRYEGQFIQDIVEEIRNKLDHAALDVAPFLVGMDHRVQRLN  203

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+DVGV VICG+GG+GK+T+AK AYN N+DRF+GS FLA++R +SE P+G VGL
Sbjct  204   MWLQDGSNDVGVAVICGMGGIGKSTIAKAAYNCNFDRFQGSSFLADIRESSEQPSGFVGL  263

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+++  +I KG+ + ++N DEG  +IK A+G KKV IV DDV   + L+ ++G R+W   
Sbjct  264   QRKLLSDIQKGKAKKVYNMDEGRSRIKQAVGYKKVLIVLDDVSNRDQLNAILGMREWLHP  323

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIIT R E+LL  HE   ++ ++ELD+++SL+LF  +AF Q  P E  ME S   ++
Sbjct  324   GSKIIITARHEHLLNAHEVFEKFMVQELDEDKSLELFSWHAFRQSHPEEGYMELSRHVVQ  383

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFVL  1216
              CGGLPLAL+ LGS LSG+S++VW+S  + L+                  DD+DK LF+ 
Sbjct  384   RCGGLPLALEVLGSSLSGKSVEVWQS-FDSLQ------------------DDHDKNLFLH  424

Query  1215  IACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEILR  1036
             IA  F GK  D+   VL+  + +  +GI+NL+D  LV     N+L M QL++NM  EI+R
Sbjct  425   IASFFTGKKMDYTSTVLDSLEFYTRIGIENLVDRCLVKNQWMNRLFMHQLVRNMAMEIIR  484

Query  1035  QDSRDDLHTLSKLLDQLVSSTESTGNGVVN  946
             ++S DD    S++L +  S+     +G  N
Sbjct  485   EESPDDPGNRSRVLQKDASNILRKLSGTEN  514


 Score =   156 bits (394),  Expect(2) = 4e-114, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 108/142 (76%), Gaps = 2/142 (1%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresri  2360
             R  YHAFLSFRG+DTRK FTDHLY AL  AGI TFRDDDEI RGENI++EL + I+ES++
Sbjct  13    RCSYHAFLSFRGQDTRKGFTDHLYRALELAGIHTFRDDDEIKRGENIESELDKAIQESQV  72

Query  2359  siIVFSKDYASSRWCLDELLTILGRRKSE-GHAVFPIFYSVGRADVEKQSGSFAEAFERH  2183
             SIIVFSKDYASSRWCL+ELL I+ RR ++  H V P+FY V  +D+ KQ GSFAEAF  H
Sbjct  73    SIIVFSKDYASSRWCLNELLKIVERRNTDRRHVVLPVFYDVDPSDIRKQRGSFAEAFATH  132

Query  2182  AKREKMEVEEGRVEWKGKGGEV  2117
              +R   E+++   +W+   G+V
Sbjct  133   EERFSTEMDKVE-QWRRALGDV  153



>ref|XP_008375639.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=1188

 Score =   295 bits (754),  Expect(2) = 8e-114, Method: Compositional matrix adjust.
 Identities = 178/364 (49%), Positives = 243/364 (67%), Gaps = 1/364 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL EVA L G VLQ +  G+E++FI+ I++ I  KL+RT LSV S  VG+ S V  IN
Sbjct  151   RKALAEVADLAGKVLQNQAYGYESKFIKDIVKVIRDKLSRTHLSVESKLVGIHSXVDHIN  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S D G+ V+ GL G+GKTT+AK  YN N   F GS ++ ++R  +  P+G V +
Sbjct  211   LWLQDPSHDXGILVVYGLPGIGKTTIAKCVYNXNXXSFXGSSYVESIRETASHPDGLVQI  270

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQI  +IL G++E I N  EGIIKI  AI  ++V +V DDVD  + LD V+  +D F  
Sbjct  271   QKQILYDILNGKKEKIHNXSEGIIKIGRAISFRRVLLVLDDVDHXDQLDAVLRMKDQFYP  330

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKII TTR + LLK HE    +++  L  +ESL+L  ++AFGQD PLE   +YS + ++
Sbjct  331   GSKIIXTTRRKRLLKAHEGITVHEVGXLGFBESLELLSQHAFGQDHPLEGYEKYSXEVVQ  390

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             H G LPLALK LGS L G    VW+S LEKLE I + +I   L IS +   DD+D++LF+
Sbjct  391   HSGRLPLALKVLGSSLFGEPKXVWKSTLEKLEXIPNGEIMXKLRISYDSJQDDHDQKLFL  450

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F+GKD D+ + +L+ CD   + GIQNL D  LVT+D DNKL M  +I++MG+E++
Sbjct  451   HIACFFIGKDEDYIVRILDGCDFKTICGIQNLXDRCLVTIDRDNKLSMHDVIRDMGREVV  510

Query  1038  RQDS  1027
             R++S
Sbjct  511   RRES  514


 Score =   146 bits (369),  Expect(2) = 8e-114, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 100/141 (71%), Gaps = 4/141 (3%)
 Frame = -1

Query  2536  FFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresris  2357
             + Y  FLSFRGEDTRK FTDHLYTALI+AG RTFRDDDE+  GE+I + L++ I+ SR S
Sbjct  20    YHYDVFLSFRGEDTRKTFTDHLYTALISAGYRTFRDDDELKTGEDIKSGLKQAIQMSRTS  79

Query  2356  iIVFSKDYASSRWCLDELLTILG-RRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHA  2180
             +IVFSKDYASSRWCL+EL+ I+  +R S  H V P+FY V  + V KQ+GS AEAF  H 
Sbjct  80    VIVFSKDYASSRWCLNELVEIVDHKRASSDHVVIPVFYDVDPSHVRKQTGSIAEAFAGHR  139

Query  2179  KREKMEVEEGRVEWKGKGGEV  2117
             K E  ++ E    W+    EV
Sbjct  140   KTEPPDMME---RWRKALAEV  157



>ref|XP_009337690.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1213

 Score =   293 bits (751),  Expect(2) = 9e-114, Method: Compositional matrix adjust.
 Identities = 173/366 (47%), Positives = 251/366 (69%), Gaps = 1/366 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL ++A L GMVLQ + DG+E++FI+KI++ I  KL+RT LSV    +G+ S+  +IN
Sbjct  180   RKALAKIADLAGMVLQNQADGYESKFIKKIVKVIGDKLSRTPLSVEPKLIGIQSQEERIN  239

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD SSDVG+ V+ G+ G+GKT +AK  YN N+  F+GS F+ N++  ++ PNG V +
Sbjct  240   LWLQDGSSDVGIFVVYGMSGIGKTIIAKHVYNSNFRSFQGSSFIENIKETADRPNGLVQI  299

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +IL  +E  I +  EGIIKI+ AI  +KV +V DDVDQ++ LD  +  +D F  
Sbjct  300   QMQLLCDILNDKEVKIHSVSEGIIKIERAISFRKVLLVLDDVDQMDQLDATLRMKDQFYP  359

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKI+ITTRCE LLK  +    ++++ L   +SLKL   +AFGQD P+E  ME+S + ++
Sbjct  360   GSKILITTRCERLLKADQVTELHRVQTLYYNDSLKLLSWHAFGQDPPIEEYMEHSKQLVQ  419

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             + GGLPLALK LGS LSG+S  VW S LEKL+ I   +I   L IS   L DD+D++LF+
Sbjct  420   YTGGLPLALKLLGSSLSGQSRGVWESALEKLKVIPDGEIMNKLRISYESLKDDHDRKLFL  479

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC  +G+++ + + +L+ CD +  +GIQNLID  LVT+D   K+ M  +I+ MG+EI+
Sbjct  480   HIACFLIGRNKSYIVRILDGCDFYTTIGIQNLIDRCLVTLDKHGKVKMHDMIRAMGREIV  539

Query  1038  RQDSRD  1021
             RQ+S +
Sbjct  540   RQESEE  545


 Score =   147 bits (371),  Expect(2) = 9e-114, Method: Composition-based stats.
 Identities = 88/164 (54%), Positives = 105/164 (64%), Gaps = 6/164 (4%)
 Frame = -1

Query  2626  QPNPYFTFHLV**MEAEARTQESGISSVPRFF----YHAFLSFRGEDTRKNFTDHLYTAL  2459
             Q  P F F       A  RT   G SS    F    Y  FLSFRGE+TRK FTDHLYTAL
Sbjct  16    QQTPVFLFEHRSTSMALVRTS-PGTSSDSNTFRGYRYDVFLSFRGEETRKTFTDHLYTAL  74

Query  2458  INAGIRTFRDDDEIGRGENIDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGR-R  2282
              NAG  TFRDDDE+ RGE+I   L++ I++SR S++VFSKDYASSRWCLDEL+ IL R R
Sbjct  75    NNAGFLTFRDDDELERGEDIKPGLQKAIQQSRTSVVVFSKDYASSRWCLDELVLILERKR  134

Query  2281  KSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKREKMEVEEG  2150
              +  H V P+FY V  + V KQ+GS  +AF R  K + +E  EG
Sbjct  135   TTSDHVVLPVFYDVDPSHVRKQTGSVGKAFARSQKNQSLEKVEG  178



>ref|XP_009344853.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=608

 Score =   301 bits (772),  Expect(2) = 9e-114, Method: Compositional matrix adjust.
 Identities = 179/347 (52%), Positives = 234/347 (67%), Gaps = 0/347 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL E+A L GMVL  + DG+E++FI KI++ I  KL R  L V S  +G+ SRV  IN
Sbjct  151   REALAELADLSGMVLSNQADGYESKFITKIVKVIGDKLIRRPLGVESNLIGIQSRVKNIN  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+DVG+  + G+ G+GKTT+AK  YN N+  FEGS F+ N+R  +  PNG V +
Sbjct  211   LWLQDGSTDVGIVAVHGMSGIGKTTIAKYVYNSNFTSFEGSSFVENIRETASQPNGLVQM  270

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +ILKG+EE + N  EGI KI+ AI S++V +V DDVD  E LD V+  +D F  
Sbjct  271   QMQLLYDILKGKEEKVHNVSEGISKIERAISSRRVLLVLDDVDHKEQLDAVLLRKDRFYP  330

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR E LLK H+    + ++ LD +ESL+L   +AFGQD P E  MEYS K +R
Sbjct  331   GSKIIITTRRERLLKAHQVTKVHGVETLDYDESLELLSWHAFGQDHPPEGYMEYSKKLVR  390

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFVL  1216
             H GGLPLAL+ LGS L G SM VW S LEKLE I + +I   + IS + L D D++LF+ 
Sbjct  391   HTGGLPLALQVLGSSLLGESMGVWESALEKLEVIPNGEIMNKIRISYDSLQDDDQKLFLH  450

Query  1215  IACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMM  1075
             IAC  +G+D+ + + +L+ CD +  VGIQNLID  LV VD DNK+ M
Sbjct  451   IACFLIGRDKKYIVKMLDGCDFYTTVGIQNLIDRCLVKVDKDNKVNM  497


 Score =   139 bits (350),  Expect(2) = 9e-114, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 90/121 (74%), Gaps = 1/121 (1%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGEDTR+ FTDHLYTAL NAG  TFRDDDE+ RGE+I   L++ IR+SR S++
Sbjct  22    YDVFLSFRGEDTRRTFTDHLYTALNNAGFLTFRDDDELERGEDIKPGLQKAIRQSRTSVV  81

Query  2350  VFSKDYASSRWCLDELLTIL-GRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKR  2174
             VFSKDYASSRWCLDEL+ +L  +R +  H V P+FY V  +   KQ+GS  +AF RH K 
Sbjct  82    VFSKDYASSRWCLDELVMVLEHKRTTSDHVVLPVFYRVDPSHARKQTGSVGKAFTRHEKT  141

Query  2173  E  2171
             +
Sbjct  142   Q  142



>ref|XP_008369992.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
[Malus domestica]
Length=1175

 Score =   300 bits (768),  Expect(2) = 9e-114, Method: Compositional matrix adjust.
 Identities = 180/366 (49%), Positives = 248/366 (68%), Gaps = 1/366 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REA+ EVA L GMVLQ + DG+E++FI+KI++ I  KL RT LSV    +G+ S+V  IN
Sbjct  150   REAVAEVADLAGMVLQNQADGYESKFIEKIVKVIGGKLGRTPLSVEPKLIGVKSQVKDIN  209

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+DVG+ V+ G+ G+GKTT+AK  YN N+  FE S F+ N+R  +  PNG V +
Sbjct  210   LWLQDGSTDVGILVVYGMSGIGKTTIAKHVYNSNFRSFERSSFIENIRETANQPNGLVQI  269

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+  +IL   E  I    EG+ KI+ AI S++V +V DDVD ++ LD V+  +D F  
Sbjct  270   QKQLLFDILNDIEVKIHGVSEGLRKIERAISSRRVLLVLDDVDHMDQLDAVLEMKDRFYS  329

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKI+ITTR E LLK H+    +K+  L   ESL+LF  +AF QD PL   MEYS K + 
Sbjct  330   GSKILITTRRERLLKAHQVTKVHKVGTLYYSESLELFSWHAFRQDHPLRGYMEYSEKVVH  389

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             +C GLPLALK LGS LSG S+DVW+S LEKL+ I + +I   L IS + L DD+D+ LF+
Sbjct  390   YCDGLPLALKVLGSSLSGESIDVWKSALEKLKVIPNGEIMNKLRISYDSLQDDHDRELFL  449

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC  +G+++   + + + CD + +VGIQNLID  LVT+D  N + M  +I++MG+EI+
Sbjct  450   HIACFLIGRNKSHIVRIFDGCDFYTIVGIQNLIDRCLVTIDGCNNVQMHDMIRDMGREIV  509

Query  1038  RQDSRD  1021
             R++S D
Sbjct  510   RRESED  515


 Score =   140 bits (354),  Expect(2) = 9e-114, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 97/139 (70%), Gaps = 5/139 (4%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             +  FLSFRG DTRK FTDHLYTAL NAG  TFRDDDE+ RGE+I   L++ I+ SR S++
Sbjct  22    HDVFLSFRG-DTRKTFTDHLYTALNNAGFNTFRDDDELERGEDIKPGLQKAIQLSRASVV  80

Query  2350  VFSKDYASSRWCLDELLTILGR-RKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKR  2174
             VFSKDYASSRWCLDEL+ IL R R +  H V P+FY V  +DV KQ+GS  +AF RH K 
Sbjct  81    VFSKDYASSRWCLDELVLILERKRTTSNHVVLPVFYDVDPSDVRKQTGSIGKAFARHEKT  140

Query  2173  EKMEVEEGRVEWKGKGGEV  2117
             +  +  +G   W+    EV
Sbjct  141   QSPKKVKG---WREAVAEV  156



>ref|XP_008372869.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=515

 Score =   297 bits (760),  Expect(2) = 1e-113, Method: Compositional matrix adjust.
 Identities = 172/345 (50%), Positives = 240/345 (70%), Gaps = 1/345 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL EVA L GMVLQ + DG+E++FI+KI++ I  KL+RT LS+    +G+ S+V  IN
Sbjct  151   REALAEVADLAGMVLQNQADGYESKFIKKIVKVIXDKLSRTPLSIEPKXIGIQSQVEHIN  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+DVG+ ++ G+ G+GKTT+AK  YN N+  FEGS F+ N+R  ++  NG V +
Sbjct  211   LWLQDGSNDVGIFIVYGMSGIGKTTIAKHVYNSNFRSFEGSSFIENIREIADRXNGLVQI  270

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  NIL GRE  I +  EGIIKI+ AI S+KV +V DDVD ++ LD V+  +D F  
Sbjct  271   QMQLLSNILNGREVKIHSVSEGIIKIEGAISSRKVLLVLDDVDHMDQLDAVLKMKDRFYX  330

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKI+ITTR E LLK H+    ++++ LD  ES +LF  +AFGQD P+E  ME+S   ++
Sbjct  331   GSKILITTRRERLLKAHQVTKVHRVETLDYNESXELFSWHAFGQDHPIEEYMEHSKMVVQ  390

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             H GGLPLAL+ LGS LSG S+DVW S LEKL+ I + +I   L IS + L DD+D++LF+
Sbjct  391   HSGGLPLALRVLGSTLSGESIDVWESALEKLKVIPNGEILNKLRISYDSLQDDHDQKLFL  450

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNK  1084
              IAC  +G+D+++ + +L+ CD    +GI NLID  +VT+D  +K
Sbjct  451   HIACFLIGRDKNYIVRILDGCDFFTTIGIHNLIDRCMVTIDKYDK  495


 Score =   143 bits (361),  Expect(2) = 1e-113, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 96/139 (69%), Gaps = 4/139 (3%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGEDTRK FTDHLYTAL NAG  TFRDDDE+ RGE+I   L++ I+ SR S++
Sbjct  22    YDVFLSFRGEDTRKTFTDHLYTALNNAGFLTFRDDDELERGEDIKPGLQKAIQLSRASVV  81

Query  2350  VFSKDYASSRWCLDELLTILGR-RKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKR  2174
             VFSKDYASSRWCLDEL  IL R R +  H V P+FY V  + + KQ+GS  +AF RH K 
Sbjct  82    VFSKDYASSRWCLDELXLILERKRTTSDHVVLPVFYDVDPSHLRKQTGSIGKAFARHQKT  141

Query  2173  EKMEVEEGRVEWKGKGGEV  2117
             +  +  +G   W+    EV
Sbjct  142   QSQKKVKG---WREALAEV  157



>ref|XP_009346661.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=608

 Score =   301 bits (772),  Expect(2) = 1e-113, Method: Compositional matrix adjust.
 Identities = 179/347 (52%), Positives = 234/347 (67%), Gaps = 0/347 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL E+A L GMVL  + DG+E++FI KI++ I  KL R  L V S  +G+ SRV  IN
Sbjct  151   REALAELADLSGMVLSNQADGYESKFITKIVKVIGDKLIRRPLGVESNLIGIQSRVKNIN  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+DVG+  + G+ G+GKTT+AK  YN N+  FEGS F+ N+R  +  PNG V +
Sbjct  211   LWLQDGSTDVGIVAVHGMSGIGKTTIAKYVYNSNFTSFEGSSFVENIRETASQPNGLVQM  270

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +ILKG+EE + N  EGI KI+ AI S++V +V DDVD  E LD V+  +D F  
Sbjct  271   QMQLLYDILKGKEEKVHNVSEGISKIERAISSRRVLLVLDDVDHKEQLDAVLLRKDRFYP  330

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR E LLK H+    + ++ LD +ESL+L   +AFGQD P E  MEYS K +R
Sbjct  331   GSKIIITTRRERLLKAHQVTKVHGVETLDYDESLELLSWHAFGQDHPPEGYMEYSKKLVR  390

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFVL  1216
             H GGLPLAL+ LGS L G SM VW S LEKLE I + +I   + IS + L D D++LF+ 
Sbjct  391   HTGGLPLALQVLGSSLLGESMGVWESALEKLEVIPNGEIMNKIRISYDSLQDDDQKLFLH  450

Query  1215  IACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMM  1075
             IAC  +G+D+ + + +L+ CD +  VGIQNLID  LV VD DNK+ M
Sbjct  451   IACFLIGRDKKYIVKMLDGCDFYTTVGIQNLIDRCLVKVDKDNKVNM  497


 Score =   139 bits (350),  Expect(2) = 1e-113, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 90/121 (74%), Gaps = 1/121 (1%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGEDTR+ FTDHLYTAL NAG  TFRDDDE+ RGE+I   L++ IR+SR S++
Sbjct  22    YDVFLSFRGEDTRRTFTDHLYTALNNAGFLTFRDDDELERGEDIKPGLQKAIRQSRTSVV  81

Query  2350  VFSKDYASSRWCLDELLTIL-GRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKR  2174
             VFSKDYASSRWCLDEL+ +L  +R +  H V P+FY V  +   KQ+GS  +AF RH K 
Sbjct  82    VFSKDYASSRWCLDELVMVLEHKRTTSDHVVLPVFYRVDPSHARKQTGSVGKAFTRHEKT  141

Query  2173  E  2171
             +
Sbjct  142   Q  142



>ref|XP_008373781.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=561

 Score =   305 bits (782),  Expect(2) = 2e-113, Method: Compositional matrix adjust.
 Identities = 183/366 (50%), Positives = 251/366 (69%), Gaps = 1/366 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL ++A L GMVL  + DG+E++FI KI++ I  KL RT L V S  +G+ SRV  IN
Sbjct  151   REALAZLADLAGMVLSNQADGYESKFITKIVKVIGDKLIRTPLGVESNLIGIQSRVKHIN  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+DVG+  + G+ G+GKTT+AK  YN N+  FEGS F+ N+R  +  PNG V +
Sbjct  211   LWLQDGSTDVGIVAVHGMSGIGKTTIAKYVYNSNFTSFEGSSFVENIRETASQPNGLVQM  270

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +ILKG++E + N  EGI KI  AI S++V +V DDVD  + LD V+  +D F  
Sbjct  271   QMQLLYDILKGKKEKVHNVSEGISKIVRAISSRRVLLVLDDVDHKDQLDAVLRMKDRFYP  330

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR E LLK H+    ++++ LD +ESL+L   +AFGQD P E  MEYS K ++
Sbjct  331   GSKIIITTRHERLLKAHQVTKVHEVETLDYDESLELLSWHAFGQDHPPEGYMEYSXKLVQ  390

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             H GGLPLAL+ LGS L G SM VW S LEKL+ I + +I   L IS + L DD+D++LF+
Sbjct  391   HTGGLPLALQVLGSSLLGESMGVWESALEKLKVIPNGEIMNKLRISYDSLQDDHDRKLFL  450

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC  +G+D+++ + +L+ CD +  VGIQNLID  LV +D D K+ M  LI++MG+EI+
Sbjct  451   HIACFLIGRDKNYIVRILDGCDFYTTVGIQNLIDRCLVKIDEDKKVNMHDLIRDMGREIV  510

Query  1038  RQDSRD  1021
             R +S +
Sbjct  511   RLESEE  516


 Score =   134 bits (337),  Expect(2) = 2e-113, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 86/121 (71%), Gaps = 1/121 (1%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGEDTR+ FTDHLYTAL N G  TFRDDDE+ RGE+I   L++ IR+S  S++
Sbjct  22    YDVFLSFRGEDTRRTFTDHLYTALNNKGFLTFRDDDELERGEDIKPGLQKAIRQSXXSVV  81

Query  2350  VFSKDYASSRWCLDELLTILGR-RKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKR  2174
             VFSKDYASS WCLDEL+ IL R R +  H V P+FY V  +   KQ+GS  +AF  H K 
Sbjct  82    VFSKDYASSXWCLDELVMILERKRTTSDHVVLPVFYDVDPSHARKQTGSIGKAFAXHEKT  141

Query  2173  E  2171
             +
Sbjct  142   Q  142



>ref|XP_006368624.1| hypothetical protein POPTR_0001s06610g [Populus trichocarpa]
 gb|ERP65193.1| hypothetical protein POPTR_0001s06610g [Populus trichocarpa]
Length=1109

 Score =   300 bits (767),  Expect(2) = 3e-113, Method: Compositional matrix adjust.
 Identities = 185/375 (49%), Positives = 256/375 (68%), Gaps = 5/375 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REALR+VA L+G VL+   D +EA+FIQ I++E+ KKLNR +L VP Y VG+ SRV +I 
Sbjct  147   REALRKVADLKGPVLR---DRYEAQFIQDIVKEVGKKLNRMILHVPPYLVGIESRVKEIR  203

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WL D S  VG+ ++ G GGVGKTT+AK  +N N+  F+   FL +VR  S  PNG V L
Sbjct  204   SWLHDGSDKVGIAILHGFGGVGKTTIAKTVFNQNFHEFDSWSFLRDVRETSNQPNGLVKL  263

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+++  +ILKG  + I N DEG IKI++A+  K+V +V DDVD L+ LD VIG R+   +
Sbjct  264   QRRLLSDILKGEPQKINNVDEGNIKIQNALAYKRVLVVLDDVDHLDQLDKVIGDRNQLYQ  323

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKII+T R  +LLK HE   ++ +  L  +ESL+LF  +AFGQ+ P E   E+S K + 
Sbjct  324   GSKIIVTARHGSLLKSHEACEKFGVDALCYDESLQLFSWHAFGQELPNEGYEEFSQKIVH  383

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERI-LHHKIQRNLEISLNPL-DDYDKRLF  1222
             HC G+PL L+ LGS LSG+S D W+   ++ E I    KIQ+ L+IS + L D+ DK LF
Sbjct  384   HCAGIPLVLEVLGSSLSGQSTDFWKRASQEPEAIDGDGKIQKILKISYDSLRDERDKNLF  443

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
             + IAC F+G D+D+   +LE CD +  +GIQ LID  L+T+D DNKLMM QL+++MG+EI
Sbjct  444   LDIACFFIGNDKDYVRRILECCDFYRTLGIQKLIDRCLITIDKDNKLMMHQLLRDMGREI  503

Query  1041  LRQDSRDDLHTLSKL  997
             +RQ+S +DL   ++L
Sbjct  504   VRQESPEDLGKRTRL  518


 Score =   139 bits (351),  Expect(2) = 3e-113, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 99/139 (71%), Gaps = 2/139 (1%)
 Frame = -1

Query  2557  GISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrg  2378
               SS+    Y  FLSFRG DTRKNFT HLY AL  AGIRTFRD+DEI  GE+I  ++ + 
Sbjct  9     ACSSIRPHAYDVFLSFRGADTRKNFTGHLYMALQGAGIRTFRDEDEIEGGEHIGFKITKA  68

Query  2377  iresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAE  2198
             I+ES++S++VFS+DYASS+WCL+ELL I+ RR++ GH V P+FY V   DV  Q+G FAE
Sbjct  69    IQESKMSLVVFSRDYASSKWCLEELLMIMKRRETIGHIVLPVFYEVDPDDVSMQTGFFAE  128

Query  2197  AFERHAKR--EKMEVEEGR  2147
             AF  H K   +  ++EE R
Sbjct  129   AFASHEKNFMDNRDMEEWR  147



>ref|XP_009367284.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=821

 Score =   289 bits (739),  Expect(2) = 6e-113, Method: Compositional matrix adjust.
 Identities = 176/376 (47%), Positives = 252/376 (67%), Gaps = 5/376 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLN-RTVLSVPSYTVGLASRVGKI  1939
             R ALR+VA + GMVL    D +E++FIQ I+ EI  KL+ R    +  Y VG+  RV  I
Sbjct  150   RRALRDVADVGGMVLG---DMYESQFIQNIVEEIGNKLDHRATEMIAPYVVGIDKRVQGI  206

Query  1938  NKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVG  1759
             N WL+D S+DV V VI G+GG+GKTT+AK AYN N+ RF+GS +LA+VRA SE PNG   
Sbjct  207   NMWLKDGSNDVSVAVIYGMGGIGKTTIAKAAYNQNFHRFQGSSYLADVRATSEQPNGLAF  266

Query  1758  LQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFS  1579
             LQ+++  +I KG+++ I++  E + KIK A+  K V IV DDVDQ +  + ++G R+WF 
Sbjct  267   LQRKLLSDIQKGKKKKIYSMGERMSKIKHAVCCKTVLIVLDDVDQSDQFNAILGRREWFH  326

Query  1578  RGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAI  1399
              GSKII+TTR E+LL  H  +  +K+  L + ESL+LF  +AF Q  P++  ++ +   +
Sbjct  327   PGSKIIVTTRHESLLNDHAVYAMFKVGGLGEHESLELFSWHAFKQVRPVKDYIKLTRSVV  386

Query  1398  RHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLF  1222
             +HC GLPLAL+ LGS L G+ ++VW S L+KL  I + KIQ+ L IS + L DD+D+ LF
Sbjct  387   QHCQGLPLALQVLGSSLVGKGVEVWESALQKLNVIPNEKIQKILRISFDSLQDDHDRSLF  446

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
             + I   FVGK  D+ I VL+    +  +GIQNL+D  LV +D DNKL+M QL+ +MG+ I
Sbjct  447   LHIVSFFVGKKIDYTITVLDNLHFYTRIGIQNLVDRCLVDIDEDNKLVMHQLLIDMGRGI  506

Query  1041  LRQDSRDDLHTLSKLL  994
             +R++S +D    S++L
Sbjct  507   IREESPEDPGKRSRVL  522


 Score =   149 bits (376),  Expect(2) = 6e-113, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 107/150 (71%), Gaps = 2/150 (1%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A    Q    S+  R  Y  FLSFRGEDTRK FTDHLY  L  AGI TFRDDD I RG N
Sbjct  2     AAIIAQLDASSTSYRCTYDVFLSFRGEDTRKGFTDHLYRELELAGIHTFRDDDGIERGAN  61

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEG-HAVFPIFYSVGRADV  2225
             I +EL++ I+ESR SIIVFSKDYASSRWCLDEL+ I+ RRK++  H V P+FY V  + V
Sbjct  62    IASELQKAIQESRASIIVFSKDYASSRWCLDELVKIMKRRKTDCRHMVMPVFYDVDPSHV  121

Query  2224  EKQSGSFAEAFERHAKREKMEVEEGRVEWK  2135
              KQ+GSFA+AF RH +R K E+++  VEW+
Sbjct  122   RKQTGSFAQAFARHEERFKEEMDK-VVEWR  150



>ref|XP_009367206.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1215

 Score =   289 bits (739),  Expect(2) = 6e-113, Method: Compositional matrix adjust.
 Identities = 176/376 (47%), Positives = 252/376 (67%), Gaps = 5/376 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLN-RTVLSVPSYTVGLASRVGKI  1939
             R ALR+VA + GMVL    D +E++FIQ I+ EI  KL+ R    +  Y VG+  RV  I
Sbjct  150   RRALRDVADVGGMVLG---DMYESQFIQNIVEEIGNKLDHRATEMIAPYVVGIDKRVQGI  206

Query  1938  NKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVG  1759
             N WL+D S+DV V VI G+GG+GKTT+AK AYN N+ RF+GS +LA+VRA SE PNG   
Sbjct  207   NMWLKDGSNDVSVAVIYGMGGIGKTTIAKAAYNQNFHRFQGSSYLADVRATSEQPNGLAF  266

Query  1758  LQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFS  1579
             LQ+++  +I KG+++ I++  E + KIK A+  K V IV DDVDQ +  + ++G R+WF 
Sbjct  267   LQRKLLSDIQKGKKKKIYSMGERMSKIKHAVCCKTVLIVLDDVDQSDQFNAILGRREWFH  326

Query  1578  RGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAI  1399
              GSKII+TTR E+LL  H  +  +K+  L + ESL+LF  +AF Q  P++  ++ +   +
Sbjct  327   PGSKIIVTTRHESLLNDHAVYAMFKVGGLGEHESLELFSWHAFKQVRPVKDYIKLTRSVV  386

Query  1398  RHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLF  1222
             +HC GLPLAL+ LGS L G+ ++VW S L+KL  I + KIQ+ L IS + L DD+D+ LF
Sbjct  387   QHCQGLPLALQVLGSSLVGKGVEVWESALQKLNVIPNEKIQKILRISFDSLQDDHDRSLF  446

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
             + I   FVGK  D+ I VL+    +  +GIQNL+D  LV +D DNKL+M QL+ +MG+ I
Sbjct  447   LHIVSFFVGKKIDYTITVLDNLHFYTRIGIQNLVDRCLVDIDEDNKLVMHQLLIDMGRGI  506

Query  1041  LRQDSRDDLHTLSKLL  994
             +R++S +D    S++L
Sbjct  507   IREESPEDPGKRSRVL  522


 Score =   149 bits (376),  Expect(2) = 6e-113, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 103/136 (76%), Gaps = 2/136 (1%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresri  2360
             R  Y  FLSFRGEDTRK FTDHLY  L  AGI TFRDDD I RG NI +EL++ I+ESR 
Sbjct  16    RCTYDVFLSFRGEDTRKGFTDHLYRELELAGIHTFRDDDGIERGANIASELQKAIQESRA  75

Query  2359  siIVFSKDYASSRWCLDELLTILGRRKSEG-HAVFPIFYSVGRADVEKQSGSFAEAFERH  2183
             SIIVFSKDYASSRWCLDEL+ I+ RRK++  H V P+FY V  + V KQ+GSFA+AF RH
Sbjct  76    SIIVFSKDYASSRWCLDELVKIMKRRKTDCRHMVMPVFYDVDPSHVRKQTGSFAQAFARH  135

Query  2182  AKREKMEVEEGRVEWK  2135
              +R K E+++  VEW+
Sbjct  136   EERFKEEMDK-VVEWR  150



>ref|XP_007203381.1| hypothetical protein PRUPE_ppa026003mg [Prunus persica]
 gb|EMJ04580.1| hypothetical protein PRUPE_ppa026003mg [Prunus persica]
Length=1037

 Score =   277 bits (709),  Expect(2) = 2e-112, Method: Compositional matrix adjust.
 Identities = 179/367 (49%), Positives = 239/367 (65%), Gaps = 13/367 (4%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL EVA L GMVL  + +G +++FI KI++ I +KL R  LSVP   +G+ SRV ++N
Sbjct  150   REALAEVADLAGMVLPNQANGRDSKFINKIVQVIGEKLRRRPLSVPHIMIGMHSRVNELN  209

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S DVG+ VI G+ G+GKTT+AK  +N N+ RFEGS F+ N+R  S+ PNG V +
Sbjct  210   LWLQDGSDDVGILVIYGMSGIGKTTIAKSLHNTNFGRFEGSSFIENIREISQQPNGLVQI  269

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ   +IL GR+  I +  EG+IKI+DAI SK+V +V DDVD ++ LD V   +D F  
Sbjct  270   QKQFLSDILNGRKMKISSVSEGLIKIEDAISSKRVLLVLDDVDHIDQLDAVFQRKDRFYP  329

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
              SKIIITTR   LLK  +    Y +  L  +ESL+LF  +AFGQD P+E  +EYS K + 
Sbjct  330   RSKIIITTRRARLLKARQVTKVYAVGTLTQKESLELFSWHAFGQDHPIEDYIEYSEKLVD  389

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HCGGLPLALK LGS L G S  +W+S LEKLE I + +I   L +S + L DD+D+ LF+
Sbjct  390   HCGGLPLALKVLGSSLLGESTCLWKSALEKLEAIPNGEIINKLRVSYDSLQDDHDRNLFL  449

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVT-VDNDNKLMMPQLIQNMGKEI  1042
              IAC F+G D+D++  + E           N   I LVT VD  +K+ M  LI+ MG EI
Sbjct  450   HIACFFIGMDKDYSSTMTE-----------NTGWICLVTIVDGWDKVQMHDLIRGMGTEI  498

Query  1041  LRQDSRD  1021
             +R +S +
Sbjct  499   VRLESNE  505


 Score =   159 bits (403),  Expect(2) = 2e-112, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 106/151 (70%), Gaps = 5/151 (3%)
 Frame = -1

Query  2566  QESGISSVPRFF-YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAE  2390
             Q S +SS  R+  YH FLSF+G+DTRK FTDHLYTAL+NAG RTFRDDDE+ RGE I  E
Sbjct  10    QTSSVSSASRYCRYHVFLSFKGQDTRKTFTDHLYTALVNAGFRTFRDDDEVERGEAIKPE  69

Query  2389  LrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSG  2210
             L++ I+ SR S+IVFSK+YASSRWCLDEL+ IL  R S  H V P+FY V  +DV  Q+G
Sbjct  70    LQKAIKHSRTSVIVFSKNYASSRWCLDELVMIL-ERLSADHVVLPVFYDVDPSDVRNQTG  128

Query  2209  SFAEAFERHAKREKMEVEEGRVEWKGKGGEV  2117
             S A+AF RH   +K +      EW+    EV
Sbjct  129   SLAKAFARH---QKTQPSNKVKEWREALAEV  156



>ref|XP_008342527.1| PREDICTED: TMV resistance protein N-like isoform X3 [Malus domestica]
Length=934

 Score =   277 bits (708),  Expect(2) = 2e-112, Method: Compositional matrix adjust.
 Identities = 173/377 (46%), Positives = 244/377 (65%), Gaps = 16/377 (4%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTV---LSVPSYTVGLASRVG  1945
             R ALR+VA L GMVL+   D +E +FIQ+I+  I  +L+      L V    +G    V 
Sbjct  147   RRALRDVADLGGMVLK---DRYEWQFIQEIVEVIGNELDYMTNRRLRVDPXVIGRGYYVE  203

Query  1944  KINKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQ  1765
              +N WL+D S+DVGV VI G+GG+GKTT+AK+AYN N+ +F+ S FL+++R  S   NG 
Sbjct  204   SLNMWLEDGSNDVGVAVIHGMGGIGKTTIAKIAYNQNFXKFQASSFLSDIRETSXQANGF  263

Query  1764  VGLQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDW  1585
             V LQ  +  +I +G+ E I++ DEGI+KIK  +  K+V IV DDV+ LE    ++G RDW
Sbjct  264   VHLQXXLLSDIQRGKMEKIYSLDEGIVKIKRVVRCKRVLIVLDDVENLEQFTAILGMRDW  323

Query  1584  FSRGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVK  1405
             F  GSKIIITTR E  LK HE  +++K++ L   +SL LF  +AFGQ  P E  ME+S  
Sbjct  324   FHPGSKIIITTRHE--LKAHEVCVRFKVEGLHAHQSLTLFSWHAFGQSHPQEGYMEHSRH  381

Query  1404  AIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLER--------ILHHKIQRNLEISLNP  1249
              ++ CGG+PLAL+ LGS L G++ +VW + + KL+         I   KIQ+ L IS + 
Sbjct  382   LVKCCGGVPLALQVLGSSLFGKTANVWENVVRKLKENAVPTLDVITEGKIQKILCISFDS  441

Query  1248  LDDYDKRLFVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQ  1069
             L D+DK LF+ IAC F+GKD+DFA  +L +CD    VG+Q+L+D  LV ++  NKL M Q
Sbjct  442   LQDHDKCLFLHIACFFIGKDKDFATTILXECDFATEVGLQHLVDRCLVEINAXNKLTMHQ  501

Query  1068  LIQNMGKEILRQDSRDD  1018
             L++NMG+ I+  +S +D
Sbjct  502   LLENMGRAIIXBESPED  518


 Score =   159 bits (403),  Expect(2) = 2e-112, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 109/144 (76%), Gaps = 1/144 (1%)
 Frame = -1

Query  2566  QESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAEL  2387
             Q++  SS  R  Y AFLSFRG DTRK FTDHLY AL  AGI TFRDDDEI RGENI  EL
Sbjct  5     QQNPSSSSNRCTYDAFLSFRGADTRKGFTDHLYNALKLAGIHTFRDDDEIERGENIAQEL  64

Query  2386  rrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGS  2207
             +  I+ES++SIIVFSKDYASS WCL+EL  I+ R++++GH V P+FY V  +DV KQ+GS
Sbjct  65    QTAIQESQVSIIVFSKDYASSTWCLNELAIIMERKRTDGHMVIPVFYYVXPSDVRKQTGS  124

Query  2206  FAEAFERHAKREKMEVEEGRVEWK  2135
             FAE+F RH ++ K E+++   EW+
Sbjct  125   FAESFTRHQEQFKDEIDKVE-EWR  147



>ref|XP_008342525.1| PREDICTED: TMV resistance protein N-like isoform X1 [Malus domestica]
Length=1160

 Score =   277 bits (708),  Expect(2) = 2e-112, Method: Compositional matrix adjust.
 Identities = 173/377 (46%), Positives = 244/377 (65%), Gaps = 16/377 (4%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTV---LSVPSYTVGLASRVG  1945
             R ALR+VA L GMVL+   D +E +FIQ+I+  I  +L+      L V    +G    V 
Sbjct  147   RRALRDVADLGGMVLK---DRYEWQFIQEIVEVIGNELDYMTNRRLRVDPXVIGRGYYVE  203

Query  1944  KINKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQ  1765
              +N WL+D S+DVGV VI G+GG+GKTT+AK+AYN N+ +F+ S FL+++R  S   NG 
Sbjct  204   SLNMWLEDGSNDVGVAVIHGMGGIGKTTIAKIAYNQNFXKFQASSFLSDIRETSXQANGF  263

Query  1764  VGLQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDW  1585
             V LQ  +  +I +G+ E I++ DEGI+KIK  +  K+V IV DDV+ LE    ++G RDW
Sbjct  264   VHLQXXLLSDIQRGKMEKIYSLDEGIVKIKRVVRCKRVLIVLDDVENLEQFTAILGMRDW  323

Query  1584  FSRGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVK  1405
             F  GSKIIITTR E  LK HE  +++K++ L   +SL LF  +AFGQ  P E  ME+S  
Sbjct  324   FHPGSKIIITTRHE--LKAHEVCVRFKVEGLHAHQSLTLFSWHAFGQSHPQEGYMEHSRH  381

Query  1404  AIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLER--------ILHHKIQRNLEISLNP  1249
              ++ CGG+PLAL+ LGS L G++ +VW + + KL+         I   KIQ+ L IS + 
Sbjct  382   LVKCCGGVPLALQVLGSSLFGKTANVWENVVRKLKENAVPTLDVITEGKIQKILCISFDS  441

Query  1248  LDDYDKRLFVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQ  1069
             L D+DK LF+ IAC F+GKD+DFA  +L +CD    VG+Q+L+D  LV ++  NKL M Q
Sbjct  442   LQDHDKCLFLHIACFFIGKDKDFATTILXECDFATEVGLQHLVDRCLVEINAXNKLTMHQ  501

Query  1068  LIQNMGKEILRQDSRDD  1018
             L++NMG+ I+  +S +D
Sbjct  502   LLENMGRAIIXBESPED  518


 Score =   159 bits (401),  Expect(2) = 2e-112, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 109/144 (76%), Gaps = 1/144 (1%)
 Frame = -1

Query  2566  QESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAEL  2387
             Q++  SS  R  Y AFLSFRG DTRK FTDHLY AL  AGI TFRDDDEI RGENI  EL
Sbjct  5     QQNPSSSSNRCTYDAFLSFRGADTRKGFTDHLYNALKLAGIHTFRDDDEIERGENIAQEL  64

Query  2386  rrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGS  2207
             +  I+ES++SIIVFSKDYASS WCL+EL  I+ R++++GH V P+FY V  +DV KQ+GS
Sbjct  65    QTAIQESQVSIIVFSKDYASSTWCLNELAIIMERKRTDGHMVIPVFYYVXPSDVRKQTGS  124

Query  2206  FAEAFERHAKREKMEVEEGRVEWK  2135
             FAE+F RH ++ K E+++   EW+
Sbjct  125   FAESFTRHQEQFKDEIDKVE-EWR  147



>ref|XP_008343279.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=1197

 Score =   291 bits (745),  Expect(2) = 3e-112, Method: Compositional matrix adjust.
 Identities = 174/368 (47%), Positives = 249/368 (68%), Gaps = 5/368 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLS-VPSYTVGLASRVGKI  1939
             R ALR+VA + GMVL    D +E++FIQ I+ EI  KL+      +  Y VG+  RV  I
Sbjct  150   RRALRDVADVGGMVLG---DXYESQFIQNIVEEIGNKLDHXATEMIAPYVVGIDKRVQGI  206

Query  1938  NKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVG  1759
             N WL+D S+DV V VI G+GG+GKTT+AK AYN N+ RF+G  +LA+VRA SE PNG   
Sbjct  207   NMWLKDXSNDVSVAVIYGMGGIGKTTIAKAAYNQNFHRFQGCSYLADVRATSEQPNGLAF  266

Query  1758  LQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFS  1579
             LQ+++  +I KG+++ +++  E + KIK A+  K V IV DDVDQ +  + ++G R+WF 
Sbjct  267   LQRKLLSDIQKGKKKKVYSMGERMSKIKHAVCCKTVLIVLDDVDQSDQFNAILGRREWFH  326

Query  1578  RGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAI  1399
              GSKII+TTR E+LL  HE +  +K++ L + ESL+LF  +AF Q  P++  ++ +   +
Sbjct  327   PGSKIIVTTRHESLLNDHEVYAMFKVRGLGEYESLELFSWHAFKQVRPVKDYIKLTRSVV  386

Query  1398  RHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLF  1222
             +HC GLPLAL+ LGS L GRS++VW S L+KL  I + KIQ+ L IS + L DD+D+ LF
Sbjct  387   QHCQGLPLALQVLGSSLVGRSVEVWESALQKLNVIPNEKIQKILRISFDSLQDDHDRSLF  446

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
             + I   FVGK  D+ I VL+    +  +GIQNL+D  LV +D DNKL+M QL+ +MG+ I
Sbjct  447   LHIVSFFVGKKIDYTITVLDNLHFYTRIGIQNLVDRCLVDIDEDNKLVMHQLLIDMGRGI  506

Query  1041  LRQDSRDD  1018
             +R++S +D
Sbjct  507   IREESPED  514


 Score =   144 bits (364),  Expect(2) = 3e-112, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 102/136 (75%), Gaps = 2/136 (1%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresri  2360
             R  Y  FLS+RGEDTRK FTDHLY  L  AGI TFRDDD I RG NI +EL++ I+ESR 
Sbjct  16    RCTYDVFLSYRGEDTRKGFTDHLYRELELAGIHTFRDDDGIXRGANIASELQKAIQESRA  75

Query  2359  siIVFSKDYASSRWCLDELLTILGRRKSEG-HAVFPIFYSVGRADVEKQSGSFAEAFERH  2183
             SIIVFSKDYASSRWCLDEL+ I+ RRK++  H V P+FY V  + V KQ+G FA+AF RH
Sbjct  76    SIIVFSKDYASSRWCLDELVKIMKRRKTDCRHMVXPVFYDVDPSHVRKQTGXFAQAFARH  135

Query  2182  AKREKMEVEEGRVEWK  2135
              +R K E+++  +EW+
Sbjct  136   EERFKEEMDK-VMEWR  150



>ref|XP_004292249.1| PREDICTED: TMV resistance protein N-like [Fragaria vesca subsp. 
vesca]
Length=1206

 Score =   287 bits (734),  Expect(2) = 4e-112, Method: Compositional matrix adjust.
 Identities = 177/367 (48%), Positives = 244/367 (66%), Gaps = 5/367 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL+  A L+G+VL    D +E++ IQ I+ +I KK++   L+V  Y VG+  RV  +N
Sbjct  146   RKALKAAADLRGVVLG---DQYESQVIQNIVDDIEKKMDPVTLNVAPYAVGINDRVEDLN  202

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WL+D S DVGV  I G+GG+GKTT+AK AYNLN   FEG  FLA+VRA +E P+G V L
Sbjct  203   MWLRDGSVDVGVAGIYGMGGIGKTTIAKAAYNLNQHSFEGRSFLADVRATTEQPDGLVRL  262

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+ +  +I + R + I N  EG  KIKD +  K+V IV DDV+ L+ L+ + G R+WF  
Sbjct  263   QRNLLSDIQRRRAKKINNVAEGTSKIKDVVRCKRVLIVLDDVNDLDQLNAIFGMREWFLP  322

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR ++LL  +     + + ELD++ESL+LF  +AF Q  P+E  ME S   ++
Sbjct  323   GSKIIITTRDKHLLTANGVSKMFMVPELDEDESLQLFSWHAFRQAHPIEGFMEVSALVVK  382

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HCGGLPLAL+ LGS L G+S+ VW   LE+L+ +   KIQR L IS + L DD DK LF+
Sbjct  383   HCGGLPLALQVLGSSLFGKSLLVWYDTLERLDEVPDGKIQRILRISYDYLQDDRDKTLFL  442

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F+GK R+  + VL    L    G+QNL+D  L+ +D D+KLMM QLI++MG+ I+
Sbjct  443   HIACFFIGKKRNLTVTVLHHLKLFATSGVQNLVDRCLLKID-DDKLMMHQLIRDMGRGIV  501

Query  1038  RQDSRDD  1018
              ++S DD
Sbjct  502   CEESVDD  508


 Score =   148 bits (374),  Expect(2) = 4e-112, Method: Composition-based stats.
 Identities = 80/136 (59%), Positives = 100/136 (74%), Gaps = 0/136 (0%)
 Frame = -1

Query  2560  SGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrr  2381
             S  S   R  YHAFLSFRGEDTRK F+DHLY AL  AGI TFRDD+EI RG NI AEL +
Sbjct  6     STTSCTYRCRYHAFLSFRGEDTRKGFSDHLYRALELAGIHTFRDDEEIERGANIAAELHK  65

Query  2380  giresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFA  2201
              I+ESR++I+VFS DYASS WCL+EL  I+ R+ ++G+ V P+FY V  + V  QSG FA
Sbjct  66    AIQESRVAIVVFSSDYASSSWCLNELAKIMERQINDGYMVVPVFYKVDPSVVRWQSGCFA  125

Query  2200  EAFERHAKREKMEVEE  2153
             EAF +H +R K E+++
Sbjct  126   EAFVKHEERFKAEMDK  141



>ref|XP_009371023.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1335

 Score =   281 bits (719),  Expect(2) = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/372 (46%), Positives = 245/372 (66%), Gaps = 7/372 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNR-TVLSVPSYTVGLASRVGKI  1939
             R AL +VA L GMVL  + DG+E++FI+KI++ I  KL R T LSV    +G+ SR  +I
Sbjct  150   RAALAQVADLAGMVLPNQADGYESKFIKKIVKVIEGKLRRVTPLSVSPKLIGIQSRAKRI  209

Query  1938  NKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVG  1759
             + WL+D S+DVG+ V+ G+ GVGKTT+AK  YN N+ RFEG  F+ N+R  SE PNG V 
Sbjct  210   DSWLKDGSTDVGILVLYGISGVGKTTIAKSVYNANFRRFEGRSFVENIRELSEQPNGLVQ  269

Query  1758  LQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFS  1579
             +QK +  +IL GR   I +  EG+ K++DAI SK+V ++ DDVD    LD V   +  F 
Sbjct  270   IQKHLLSDILNGRNVEIHSVSEGVSKVEDAIRSKRVLLILDDVDHTNQLDAVFRMKHCFY  329

Query  1578  RGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAI  1399
              GSKIIITTR   LLK  +    + ++ L  +ES++LF  +AF QD P++  M++S + +
Sbjct  330   PGSKIIITTRRAKLLKPQQVSEVHNVEPLSYDESMELFSWHAFEQDHPVDGYMKHSEEVV  389

Query  1398  RHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLF  1222
              HCGGLPLAL+ LGS L G S+ VW+S LEKL+ I   +I + L  S + L D++D+ LF
Sbjct  390   DHCGGLPLALRVLGSSLMGESITVWQSTLEKLKAIPDGQIMKKLRSSYDSLQDNHDRDLF  449

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDN-----KLMMPQLIQN  1057
             + IAC FVGKD+D  + +L++C  + VVGIQNL+D  LVT+         K+ M  L+++
Sbjct  450   LHIACFFVGKDKDCVVRILDECQFYTVVGIQNLVDRCLVTIHQCEWHKYCKIQMHDLVRD  509

Query  1056  MGKEILRQDSRD  1021
             MG+EI+R +S +
Sbjct  510   MGREIVRSESEE  521


 Score =   154 bits (389),  Expect(2) = 4e-112, Method: Composition-based stats.
 Identities = 81/128 (63%), Positives = 97/128 (76%), Gaps = 1/128 (1%)
 Frame = -1

Query  2563  ESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELr  2384
             +  ISS  R  YH FLSFRGEDTRK FTDHLYTALI AG +TFRD+DE+ RGE+I  EL 
Sbjct  10    KDSISSSQRCRYHVFLSFRGEDTRKTFTDHLYTALIGAGFQTFRDNDELERGEDIKPELE  69

Query  2383  rgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGH-AVFPIFYSVGRADVEKQSGS  2207
             + IR+S+ S+IVFSKDYASSRWCLDELL IL R+++     V P+FY V  + + KQ+G 
Sbjct  70    KAIRQSQTSVIVFSKDYASSRWCLDELLIILERKRTNKEFVVLPVFYDVDPSQLRKQTGC  129

Query  2206  FAEAFERH  2183
             FAEAF RH
Sbjct  130   FAEAFSRH  137



>ref|XP_008339325.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=1157

 Score =   291 bits (745),  Expect(2) = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/366 (47%), Positives = 246/366 (67%), Gaps = 1/366 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL E+A L GMVLQ + DG+E+ FI+KI++ +  KL+RT L V    +G+ S+V  IN
Sbjct  151   RKALAEIADLAGMVLQNQADGYESRFIEKIVKVVXDKLSRTPLXVEPKLIGIESQVXDIN  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+DVG+ V+ G+ G+GKTT+AK  YN N+  F+GS F+ N+   ++ PNG   +
Sbjct  211   LWLQDGSTDVGILVVXGMSGIGKTTIAKHVYNSNFRSFKGSSFIENISETADRPNGLXQI  270

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+  +IL GRE  I    EG+ KI+ AI S++V +V DDVD L+ LD V+  +D F  
Sbjct  271   QKQLLSDILNGREVKIHGVSEGLRKIERAISSRRVLLVLDDVDHLDQLDAVLKMKDRFYP  330

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKI+ITTR E LLK H+    +K+  L   ESL+LF  +AF Q  P    +EYS K + 
Sbjct  331   GSKILITTRRERLLKAHQVTKVHKVGTLYXNESLELFSWHAFRQYHPPSGYVEYSKKVVH  390

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             +C GLPLALK LGS LSG  +DVW S LEKL+ I + +I   L +S + L DD+D++LF+
Sbjct  391   YCDGLPLALKVLGSSLSGEXIDVWESALEKLKVIPNGEIMYKLRMSYDSLQDDHDRKLFL  450

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC  +G+++ + + +L+ CD + +VGIQNLID  LVT+D  N + M  +I++MG+ I+
Sbjct  451   HIACFLIGRNKSYIVKILDGCDFYTIVGIQNLIDRCLVTIDGCNNVQMHDMIRDMGRXIV  510

Query  1038  RQDSRD  1021
             R +S +
Sbjct  511   RHESEE  516


 Score =   144 bits (363),  Expect(2) = 4e-112, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 97/142 (68%), Gaps = 4/142 (3%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresri  2360
             R+ Y  FLSFRGE+TRK FTDHLYTAL NAG  TFRDDDE+ RGE+I   L++ I+ SR 
Sbjct  19    RYRYDVFLSFRGEETRKKFTDHLYTALNNAGFLTFRDDDELERGEDIKPGLQKAIQLSRT  78

Query  2359  siIVFSKDYASSRWCLDELLTILGR-RKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERH  2183
              I+VFSKDYASSRWCLDEL+ IL R R +  H V P+FY V  + V KQ+GS  +AF R 
Sbjct  79    CIVVFSKDYASSRWCLDELVVILERKRTTSDHLVLPVFYDVDPSHVRKQTGSVGKAFARS  138

Query  2182  AKREKMEVEEGRVEWKGKGGEV  2117
              K +  E  EG   W+    E+
Sbjct  139   QKNQSPEKVEG---WRKALAEI  157



>ref|XP_009337692.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=812

 Score =   294 bits (752),  Expect(2) = 6e-112, Method: Compositional matrix adjust.
 Identities = 168/364 (46%), Positives = 254/364 (70%), Gaps = 1/364 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL E+A L GMVLQ + DG+E++FI+ I++ I  KL+RT LSV    +G+ S+  +IN
Sbjct  151   RKALAEIADLAGMVLQNQADGYESKFIKNIVKVIGDKLSRTPLSVEPKLIGIQSQAKRIN  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD SSDVG+ V+ G+ G+GKTT+AK  YN N+  F+GS F+ N++  ++ PNG V +
Sbjct  211   LWLQDGSSDVGIFVVYGMSGIGKTTIAKHVYNSNFRSFQGSSFIENIKETADQPNGLVQI  270

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q ++  +ILKGRE  I +  EGIIKI+ A+ ++++ +V DDVDQ++ LD ++  +D F  
Sbjct  271   QMKLLCDILKGREVKIHSVSEGIIKIEGAVSTRRILLVLDDVDQMDQLDAILRMKDQFYP  330

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             G+KI+ITTR E LL+  +    ++++ L   +SLKL   +AFGQD P+E  ME+S + +R
Sbjct  331   GTKILITTRRERLLRADQVTEVHRVQTLYYNDSLKLLSWHAFGQDHPIEEYMEHSKQLVR  390

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             + GGLPLALK LGS LSG+++ VW S LEKL+ I   +I   L IS   L DD+D++LF+
Sbjct  391   YTGGLPLALKVLGSSLSGQNIGVWESALEKLKVIPDGEIMNKLRISYESLKDDHDRKLFL  450

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC  +G+++ + + +L+ CD +  +G++NLID  LVT+D   K+ M  +I+ MG+EI+
Sbjct  451   HIACFLIGRNKSYIVRILDGCDFYTTIGVENLIDRCLVTLDKHGKVKMHDMIRAMGREIV  510

Query  1038  RQDS  1027
             RQ+S
Sbjct  511   RQES  514


 Score =   141 bits (355),  Expect(2) = 6e-112, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 96/139 (69%), Gaps = 4/139 (3%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGE+TRK FTDHLYTAL NAG  TFRDDDE+ RGE+I   L++ I++SR S++
Sbjct  22    YDVFLSFRGEETRKTFTDHLYTALNNAGFLTFRDDDELERGEDIKPGLQKAIQQSRTSVV  81

Query  2350  VFSKDYASSRWCLDELLTILGR-RKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKR  2174
             VFSKDYASS WCLDEL+ IL R R +  H V P+FY V  + V KQ+GS  +AF R  K 
Sbjct  82    VFSKDYASSSWCLDELVLILERKRTTSDHVVLPVFYDVDPSHVRKQTGSVRKAFTRSQKN  141

Query  2173  EKMEVEEGRVEWKGKGGEV  2117
             +  E  EG   W+    E+
Sbjct  142   QSPEKVEG---WRKALAEI  157



>ref|XP_011002582.1| PREDICTED: TMV resistance protein N-like isoform X4 [Populus 
euphratica]
Length=1141

 Score =   265 bits (677),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/364 (43%), Positives = 235/364 (65%), Gaps = 4/364 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL+EVA L GMVL    DG+EA  +Q I+ ++ K L+R +  VP + +G    V  IN
Sbjct  177   RIALKEVADLAGMVLG---DGYEALLVQCIVEKVSKNLDRKIFHVPLHFIGRDPLVNYIN  233

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQDES D    ++ G+GGVGKT +AK  +N N+ +FE   +L+NVR  S+   G V L
Sbjct  234   SWLQDESHDAATAMLYGIGGVGKTAIAKSVFNQNFRKFECRSYLSNVREISKESKGVVCL  293

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +IL    + I + DEGI+KIKDA+  ++  IV DDVD  +  + +IG ++W  +
Sbjct  294   QRQLLSDILNQTVDEIHDVDEGILKIKDALCCRRTLIVLDDVDNRDQFNAIIGMQEWLCK  353

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             G KII+TTR + L+  ++  ++ K++ LD+++SL+LF  +AFGQ  P+E  +E S + + 
Sbjct  354   GCKIIVTTRNKGLIAANDEFVKCKVEPLDNKKSLELFSWHAFGQAYPVEGFVEDSWRIVH  413

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HC GLPLAL+ +GS LSG+   +W S L++L  I + ++Q  LEIS + L DDY K LF+
Sbjct  414   HCNGLPLALRVIGSSLSGKGRKLWGSALQELAVIPNCEVQNVLEISYHSLDDDYQKNLFL  473

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F G D D+A+ +L+   +     I  LID  LV +++D +L M QL+++MG+EI 
Sbjct  474   DIACFFNGMDVDYAVTILDGLGIGARFRIDKLIDRCLVVINSDERLCMHQLVRDMGREIA  533

Query  1038  RQDS  1027
             RQ+S
Sbjct  534   RQES  537


 Score =   169 bits (427),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A A+ Q S  S      Y  FLSFRG+DTRKNFTDHLYTAL+ AGI TFRDDDEIGRGEN
Sbjct  30    AAAKYQASSSSRFSHCKYQVFLSFRGQDTRKNFTDHLYTALVQAGIHTFRDDDEIGRGEN  89

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVE  2222
             I++EL + I++S+I+IIVFSKDYASSRWCLDEL+ I+ RR++    VFP+FY V  + V 
Sbjct  90    IESELLKAIQQSKIAIIVFSKDYASSRWCLDELVMIMERRRTADCRVFPVFYDVDPSQVR  149

Query  2221  KQSGSFAEAFERHAKREKMEVE  2156
             KQ+GSFA AF  H KR K E+E
Sbjct  150   KQTGSFAAAFVEHEKRFKEEME  171



>ref|XP_011002581.1| PREDICTED: TMV resistance protein N-like isoform X3 [Populus 
euphratica]
Length=1156

 Score =   265 bits (677),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/364 (43%), Positives = 235/364 (65%), Gaps = 4/364 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL+EVA L GMVL    DG+EA  +Q I+ ++ K L+R +  VP + +G    V  IN
Sbjct  177   RIALKEVADLAGMVLG---DGYEALLVQCIVEKVSKNLDRKIFHVPLHFIGRDPLVNYIN  233

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQDES D    ++ G+GGVGKT +AK  +N N+ +FE   +L+NVR  S+   G V L
Sbjct  234   SWLQDESHDAATAMLYGIGGVGKTAIAKSVFNQNFRKFECRSYLSNVREISKESKGVVCL  293

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +IL    + I + DEGI+KIKDA+  ++  IV DDVD  +  + +IG ++W  +
Sbjct  294   QRQLLSDILNQTVDEIHDVDEGILKIKDALCCRRTLIVLDDVDNRDQFNAIIGMQEWLCK  353

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             G KII+TTR + L+  ++  ++ K++ LD+++SL+LF  +AFGQ  P+E  +E S + + 
Sbjct  354   GCKIIVTTRNKGLIAANDEFVKCKVEPLDNKKSLELFSWHAFGQAYPVEGFVEDSWRIVH  413

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HC GLPLAL+ +GS LSG+   +W S L++L  I + ++Q  LEIS + L DDY K LF+
Sbjct  414   HCNGLPLALRVIGSSLSGKGRKLWGSALQELAVIPNCEVQNVLEISYHSLDDDYQKNLFL  473

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F G D D+A+ +L+   +     I  LID  LV +++D +L M QL+++MG+EI 
Sbjct  474   DIACFFNGMDVDYAVTILDGLGIGARFRIDKLIDRCLVVINSDERLCMHQLVRDMGREIA  533

Query  1038  RQDS  1027
             RQ+S
Sbjct  534   RQES  537


 Score =   168 bits (426),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A A+ Q S  S      Y  FLSFRG+DTRKNFTDHLYTAL+ AGI TFRDDDEIGRGEN
Sbjct  30    AAAKYQASSSSRFSHCKYQVFLSFRGQDTRKNFTDHLYTALVQAGIHTFRDDDEIGRGEN  89

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVE  2222
             I++EL + I++S+I+IIVFSKDYASSRWCLDEL+ I+ RR++    VFP+FY V  + V 
Sbjct  90    IESELLKAIQQSKIAIIVFSKDYASSRWCLDELVMIMERRRTADCRVFPVFYDVDPSQVR  149

Query  2221  KQSGSFAEAFERHAKREKMEVE  2156
             KQ+GSFA AF  H KR K E+E
Sbjct  150   KQTGSFAAAFVEHEKRFKEEME  171



>ref|XP_008342629.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=603

 Score =   289 bits (739),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 175/371 (47%), Positives = 248/371 (67%), Gaps = 9/371 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRT-----VLSVPSYTVGLASR  1951
             R ALREV  L GMVL E    +E+ FIQ I+     KL+        L V  Y +G    
Sbjct  147   RRALREVTDLGGMVLGER---YESXFIQDIVEAXGNKLDYMNMWXRRLRVDPYVIGRDYY  203

Query  1950  VGKINKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPN  1771
             V  +N WL+D S+DVGV VI G+GG+GKTT+AK+AYN N+ +F+ S FL+++R  S+  N
Sbjct  204   VESLNTWLEDGSNDVGVAVIHGMGGIGKTTIAKIAYNQNFSKFQASSFLSDIRETSKQAN  263

Query  1770  GQVGLQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGAR  1591
             G V LQ+ +  +I K +   I++ DEGI+KIK A+  K+V IV DDV+ LE  +V++G R
Sbjct  264   GFVHLQRNLLSDIQKRKVNNIYSHDEGIVKIKRAVRCKRVLIVLDDVENLEQFNVILGMR  323

Query  1590  DWFSRGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYS  1411
             DW   GSKIIITTR E+LL+  E  +++K++ L + +SLKLF  +AFGQ  P E  ME S
Sbjct  324   DWLHPGSKIIITTRHEHLLRA-EVCVRFKVEGLPEHQSLKLFSWHAFGQTHPQEGYMELS  382

Query  1410  VKAIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDK  1231
                + HCGG+PLAL+ LGS L G+++DVW++    L+ I   KIQ+ L IS + L D+DK
Sbjct  383   RPVVEHCGGVPLALQVLGSSLFGKTVDVWKNAFHNLDVITEGKIQKILGISFHSLQDHDK  442

Query  1230  RLFVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMG  1051
             RLF+ IAC FVGKD+DF   +L++CD    VG+Q+L+D  LV ++  NKL++ QL+Q+MG
Sbjct  443   RLFLHIACFFVGKDKDFTTTILDECDFATEVGLQHLVDRYLVEINVHNKLIVHQLLQDMG  502

Query  1050  KEILRQDSRDD  1018
             + I+ ++S +D
Sbjct  503   RAIIHEESSED  513


 Score =   144 bits (364),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = -1

Query  2566  QESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAEL  2387
             Q++  SS  R  Y AFLSFRG DTRK F DHLY+AL  AGI TFRDDDEI  G NI+ EL
Sbjct  5     QQNASSSSYRCTYDAFLSFRGADTRKGFADHLYSALELAGIHTFRDDDEIEGGANIEQEL  64

Query  2386  rrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGS  2207
             +  I+ESR+S+IVFS DYASS WCL+EL  I+ R K++GH V P+FY V  +DV KQ+GS
Sbjct  65    QTAIQESRVSVIVFSTDYASSTWCLNELAIIMERTKTDGHKVVPVFYDVEPSDVRKQTGS  124

Query  2206  FAEAFERHAKREK  2168
             FA++F  H +R K
Sbjct  125   FADSFTXHEZRFK  137



>ref|XP_011002580.1| PREDICTED: TMV resistance protein N-like isoform X2 [Populus 
euphratica]
Length=1163

 Score =   265 bits (676),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/364 (43%), Positives = 235/364 (65%), Gaps = 4/364 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL+EVA L GMVL    DG+EA  +Q I+ ++ K L+R +  VP + +G    V  IN
Sbjct  177   RIALKEVADLAGMVLG---DGYEALLVQCIVEKVSKNLDRKIFHVPLHFIGRDPLVNYIN  233

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQDES D    ++ G+GGVGKT +AK  +N N+ +FE   +L+NVR  S+   G V L
Sbjct  234   SWLQDESHDAATAMLYGIGGVGKTAIAKSVFNQNFRKFECRSYLSNVREISKESKGVVCL  293

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +IL    + I + DEGI+KIKDA+  ++  IV DDVD  +  + +IG ++W  +
Sbjct  294   QRQLLSDILNQTVDEIHDVDEGILKIKDALCCRRTLIVLDDVDNRDQFNAIIGMQEWLCK  353

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             G KII+TTR + L+  ++  ++ K++ LD+++SL+LF  +AFGQ  P+E  +E S + + 
Sbjct  354   GCKIIVTTRNKGLIAANDEFVKCKVEPLDNKKSLELFSWHAFGQAYPVEGFVEDSWRIVH  413

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HC GLPLAL+ +GS LSG+   +W S L++L  I + ++Q  LEIS + L DDY K LF+
Sbjct  414   HCNGLPLALRVIGSSLSGKGRKLWGSALQELAVIPNCEVQNVLEISYHSLDDDYQKNLFL  473

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F G D D+A+ +L+   +     I  LID  LV +++D +L M QL+++MG+EI 
Sbjct  474   DIACFFNGMDVDYAVTILDGLGIGARFRIDKLIDRCLVVINSDERLCMHQLVRDMGREIA  533

Query  1038  RQDS  1027
             RQ+S
Sbjct  534   RQES  537


 Score =   168 bits (426),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A A+ Q S  S      Y  FLSFRG+DTRKNFTDHLYTAL+ AGI TFRDDDEIGRGEN
Sbjct  30    AAAKYQASSSSRFSHCKYQVFLSFRGQDTRKNFTDHLYTALVQAGIHTFRDDDEIGRGEN  89

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVE  2222
             I++EL + I++S+I+IIVFSKDYASSRWCLDEL+ I+ RR++    VFP+FY V  + V 
Sbjct  90    IESELLKAIQQSKIAIIVFSKDYASSRWCLDELVMIMERRRTADCRVFPVFYDVDPSQVR  149

Query  2221  KQSGSFAEAFERHAKREKMEVE  2156
             KQ+GSFA AF  H KR K E+E
Sbjct  150   KQTGSFAAAFVEHEKRFKEEME  171



>ref|XP_011002579.1| PREDICTED: TMV resistance protein N-like isoform X1 [Populus 
euphratica]
Length=1163

 Score =   265 bits (677),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/364 (43%), Positives = 235/364 (65%), Gaps = 4/364 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL+EVA L GMVL    DG+EA  +Q I+ ++ K L+R +  VP + +G    V  IN
Sbjct  177   RIALKEVADLAGMVLG---DGYEALLVQCIVEKVSKNLDRKIFHVPLHFIGRDPLVNYIN  233

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQDES D    ++ G+GGVGKT +AK  +N N+ +FE   +L+NVR  S+   G V L
Sbjct  234   SWLQDESHDAATAMLYGIGGVGKTAIAKSVFNQNFRKFECRSYLSNVREISKESKGVVCL  293

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +IL    + I + DEGI+KIKDA+  ++  IV DDVD  +  + +IG ++W  +
Sbjct  294   QRQLLSDILNQTVDEIHDVDEGILKIKDALCCRRTLIVLDDVDNRDQFNAIIGMQEWLCK  353

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             G KII+TTR + L+  ++  ++ K++ LD+++SL+LF  +AFGQ  P+E  +E S + + 
Sbjct  354   GCKIIVTTRNKGLIAANDEFVKCKVEPLDNKKSLELFSWHAFGQAYPVEGFVEDSWRIVH  413

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HC GLPLAL+ +GS LSG+   +W S L++L  I + ++Q  LEIS + L DDY K LF+
Sbjct  414   HCNGLPLALRVIGSSLSGKGRKLWGSALQELAVIPNCEVQNVLEISYHSLDDDYQKNLFL  473

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F G D D+A+ +L+   +     I  LID  LV +++D +L M QL+++MG+EI 
Sbjct  474   DIACFFNGMDVDYAVTILDGLGIGARFRIDKLIDRCLVVINSDERLCMHQLVRDMGREIA  533

Query  1038  RQDS  1027
             RQ+S
Sbjct  534   RQES  537


 Score =   168 bits (426),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A A+ Q S  S      Y  FLSFRG+DTRKNFTDHLYTAL+ AGI TFRDDDEIGRGEN
Sbjct  30    AAAKYQASSSSRFSHCKYQVFLSFRGQDTRKNFTDHLYTALVQAGIHTFRDDDEIGRGEN  89

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVE  2222
             I++EL + I++S+I+IIVFSKDYASSRWCLDEL+ I+ RR++    VFP+FY V  + V 
Sbjct  90    IESELLKAIQQSKIAIIVFSKDYASSRWCLDELVMIMERRRTADCRVFPVFYDVDPSQVR  149

Query  2221  KQSGSFAEAFERHAKREKMEVE  2156
             KQ+GSFA AF  H KR K E+E
Sbjct  150   KQTGSFAAAFVEHEKRFKEEME  171



>ref|XP_007219232.1| hypothetical protein PRUPE_ppa017814mg [Prunus persica]
 gb|EMJ20431.1| hypothetical protein PRUPE_ppa017814mg [Prunus persica]
Length=782

 Score =   282 bits (722),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 171/357 (48%), Positives = 220/357 (62%), Gaps = 30/357 (8%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL EVA L GMVLQ E DGHEA+FI+KI++ I  KL+RT LSV  Y +G+  RV  IN
Sbjct  151   RAALTEVADLAGMVLQNEADGHEAKFIKKIVKVIEGKLSRTPLSVSPYLIGINHRVKDIN  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD SSDVG+            T+A+V YN N+ RFEG  FL N+R  SE PNG V +
Sbjct  211   SWLQDGSSDVGIY-----------TIAQVVYNSNFSRFEGRSFLENIREISEQPNGLVQV  259

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +IL GR+  I N  EGI KIKD I  KKV ++ DDVD +  LD ++  +DWF  
Sbjct  260   QMQLLSHILNGRKVKIHNISEGITKIKDVISCKKVLLILDDVDHMRQLDAILRMKDWFCP  319

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR   LLK H+    + I+ L+  ESL+LF  + FGQD P+            
Sbjct  320   GSKIIITTRSVGLLKAHQDVKVHNIETLNHVESLELFSWHVFGQDFPIG-----------  368

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
                    AL+ LGS LSG+S+DVW S  +KLE I +  I   L IS + L D++D+ LF+
Sbjct  369   -------ALQTLGSSLSGQSIDVWGSAFKKLEVIPNSDIMSKLRISYDSLQDEHDQNLFL  421

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGK  1048
              IAC F+G D D  + +L+ CD   +VG+QNLID  LVT+D   K+ M Q+IQN  +
Sbjct  422   HIACFFIGNDMDVVVTILDGCDFFTIVGMQNLIDRCLVTIDEYKKVKMHQMIQNRSR  478


 Score =   150 bits (380),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 109/158 (69%), Gaps = 5/158 (3%)
 Frame = -1

Query  2581  AEARTQESGISSV-PRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGE  2405
             A  R+QE+  S       YH FLSFRGEDTR+ FTDHLYTA +N+G++TFRDDDE+ RGE
Sbjct  2     ALVRSQEASSSDTNCSCSYHVFLSFRGEDTRRTFTDHLYTAFVNSGLQTFRDDDELERGE  61

Query  2404  NIDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGR-RKSEGHAVFPIFYSVGRAD  2228
              I  EL + I+ SR S+IVF K+YASS+WCLDEL+ IL R R S+ H + P+FY +  ++
Sbjct  62    GIKTELEKAIQHSRSSVIVFVKNYASSKWCLDELVKILERKRASDDHVILPVFYDIDPSE  121

Query  2227  VEKQSGSFAEAFERHAKREKMEVEEGRVE-WKGKGGEV  2117
             V KQ+GS A+AF RH  R+   + + R+  W+    EV
Sbjct  122   VRKQTGSLAKAFARH--RQNRSLNKDRISGWRAALTEV  157



>ref|XP_009361477.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1181

 Score =   294 bits (752),  Expect(2) = 3e-111, Method: Compositional matrix adjust.
 Identities = 183/364 (50%), Positives = 245/364 (67%), Gaps = 4/364 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL EVA L GMVL    DG+E +FI+ I++ I  KL+RT LSV S  VG+ SRV  IN
Sbjct  151   REALAEVANLAGMVL---ADGYEGKFIKDIVKVIRDKLSRTHLSVESKLVGIHSRVEHIN  207

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S +VG+ V+ GL G+GKTT+AK  YN N++ FEGS ++ ++R  +  P+G V +
Sbjct  208   LWLQDPSHNVGILVVYGLPGIGKTTIAKCVYNSNFESFEGSSYVESIREIASHPDGLVQI  267

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQI  +IL G  E I N  EGIIKI  AI  ++V +V DDVD ++  D V+  +D F  
Sbjct  268   QKQILYDILNGENEKIHNVSEGIIKIGRAISFRRVLLVLDDVDHMDQFDAVLRMKDQFYL  327

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR + LLK HE    + +  L  +ESL+L  ++AFGQD PLE   +YS + ++
Sbjct  328   GSKIIITTRRKRLLKAHEGITVHDVGPLGFDESLELLSQHAFGQDHPLEGYEKYSEEVVQ  387

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             H G LPLALK LGS L G    VW+S LEKL+ I + +I   L IS + L DD+D++LF+
Sbjct  388   HGGRLPLALKVLGSSLFGEPKRVWKSTLEKLKVIPNGEIMNKLRISYDSLQDDHDQKLFL  447

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F+GKD D+ + +L+ CD   + GIQ+L D  LVT+D DNKL M  LI++MG+EI 
Sbjct  448   HIACFFIGKDEDYIVRLLDGCDFKTICGIQDLKDRCLVTIDRDNKLCMHDLIRDMGREIA  507

Query  1038  RQDS  1027
             R++S
Sbjct  508   RRES  511


 Score =   138 bits (348),  Expect(2) = 3e-111, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 90/121 (74%), Gaps = 1/121 (1%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGEDTRK FTDHLYTAL NAG  TFRDD+E+ RGE+I   L+R I+ SR S++
Sbjct  22    YDVFLSFRGEDTRKTFTDHLYTALNNAGFLTFRDDNELERGEDIKPGLQRAIQLSRTSVV  81

Query  2350  VFSKDYASSRWCLDELLTIL-GRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKR  2174
             VFSKDYASSRWCLDEL+ IL  +R S  H V P+FY V  + + KQ+GS  +AF +H + 
Sbjct  82    VFSKDYASSRWCLDELVVILEHKRTSIDHVVLPVFYDVDPSQLRKQTGSIEKAFAQHQRT  141

Query  2173  E  2171
             +
Sbjct  142   Q  142



>ref|XP_002316552.2| hypothetical protein POPTR_0011s01400g, partial [Populus trichocarpa]
 gb|EEE97164.2| hypothetical protein POPTR_0011s01400g, partial [Populus trichocarpa]
Length=1039

 Score =   263 bits (673),  Expect(2) = 6e-111, Method: Compositional matrix adjust.
 Identities = 157/364 (43%), Positives = 233/364 (64%), Gaps = 4/364 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL+EVA L GMVL    DG+EA  +Q I+ ++ K L+R +  VP + +G    V  IN
Sbjct  149   RIALKEVADLAGMVLG---DGYEALLVQCIVGKVSKNLDRKIFHVPLHFIGRDPLVNYIN  205

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQDES D    ++ G+GGVGKT +AK  +N N+ +FE   +L+NVR  S    G V L
Sbjct  206   SWLQDESHDAATAMLYGIGGVGKTAIAKSVFNQNFRKFECRSYLSNVREISNKSKGVVCL  265

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +IL    + I + DEGI+KIKDA+  ++  IV DDVD  +  + +IG ++W  +
Sbjct  266   QRQLLSDILNQTVDEIHDVDEGILKIKDALCCRRTLIVLDDVDNRDQFNAIIGMQEWLCQ  325

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             G KII+TTR + L+   +  ++ K++ LD+++SL+LF  +AFGQ  P+E  +E S + + 
Sbjct  326   GCKIIVTTRNKGLIAADDEFVKCKVEPLDNKKSLELFSWHAFGQAYPVEGFVEDSWRIVH  385

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HC GLPLAL+ +GS LSG+   +W S L++L  I + ++Q  LEIS + L DDY K +F+
Sbjct  386   HCNGLPLALRVIGSSLSGKGRKLWGSALQELAVIPNCEVQNVLEISYHSLDDDYQKNIFL  445

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F G D D+A+ +L+   +     I  LID  LV ++ND +L M QL+++MG+EI 
Sbjct  446   DIACFFNGMDVDYAVTILDGLGIGARFRIDKLIDRCLVEINNDKRLWMHQLVRDMGREIA  505

Query  1038  RQDS  1027
             RQ+S
Sbjct  506   RQES  509


 Score =   167 bits (424),  Expect(2) = 6e-111, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A A+ Q S  S      Y  FLSFRGEDTRKNFTDHLYTAL+ AGI TFRDDDEIGRGEN
Sbjct  2     AAAKYQASSSSRFSHCKYQVFLSFRGEDTRKNFTDHLYTALVQAGIHTFRDDDEIGRGEN  61

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVE  2222
             I++EL++ I++S+I+IIVFSKDYASSRWCLDEL+ I+ RR++    V P+FY V  + V 
Sbjct  62    IESELQKAIQQSKIAIIVFSKDYASSRWCLDELVMIMERRRTADCRVLPVFYDVDPSQVR  121

Query  2221  KQSGSFAEAFERHAKREKMEVE  2156
             KQ+GSFA AF  H KR K E+E
Sbjct  122   KQTGSFAAAFVEHEKRFKEEME  143



>ref|XP_007201127.1| hypothetical protein PRUPE_ppa017276mg [Prunus persica]
 gb|EMJ02326.1| hypothetical protein PRUPE_ppa017276mg [Prunus persica]
Length=1098

 Score =   282 bits (721),  Expect(2) = 1e-110, Method: Compositional matrix adjust.
 Identities = 172/367 (47%), Positives = 245/367 (67%), Gaps = 2/367 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL EVA L GMVLQ + DGHE++FI+KI++ I  KL+RT  +V  + +G+ SRV  IN
Sbjct  134   RAALTEVADLAGMVLQNQADGHESKFIKKIVKVIEGKLSRTAFNVAPHLIGIHSRVRDIN  193

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WL D S+ V V +I G+ G+GKTT+AK  YN+N+ R++GS FL N++  S+  NG V +
Sbjct  194   LWLHDGSTKVRVLLIYGMRGIGKTTLAKFVYNINFKRYKGSSFLENIKEHSKQTNGLVQI  253

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QK++  ++L G+   + N  EGIIKI+DA+ SK+V +VFDDVD +E LD V+  +  F  
Sbjct  254   QKKLLSDVLNGKRVKVGNISEGIIKIEDALSSKRVLLVFDDVDHVEQLDAVLRMQGQFCP  313

Query  1575  GSKIIITTRCENLLKGHERHLQ-YKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAI  1399
             GSKIIITT    LL    + ++ + ++  +  ESL+LF  +AFGQD P +  ME S + +
Sbjct  314   GSKIIITTSHAALLNASHQAIKVHNLETFNSNESLELFSWHAFGQDHPEKDYMELSERVV  373

Query  1398  RHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLF  1222
                GGLPLALK LGS LSG+S  VW S L KLE I + +I   L IS + L D +D+ LF
Sbjct  374   NLSGGLPLALKILGSSLSGKSTVVWESALNKLEAIPNGEILNKLRISYDSLQDQHDRSLF  433

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
             + IAC F+G ++D  + +L+ C  + +VGIQNLID  LVTVD  NK+ M  +I++MG+ I
Sbjct  434   LHIACFFIGMEKDVIVRILDSCGFYTIVGIQNLIDRCLVTVDEYNKVRMHYMIRDMGRGI  493

Query  1041  LRQDSRD  1021
             +  +S++
Sbjct  494   VHLESKE  500


 Score =   149 bits (375),  Expect(2) = 1e-110, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 103/144 (72%), Gaps = 5/144 (3%)
 Frame = -1

Query  2548  SVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgire  2369
             ++P   Y  FLSFRGEDTRK FTDHLYTA +NAG RTFRDDDE+ RGE+I  EL+R I++
Sbjct  2     ALPPHSYDVFLSFRGEDTRKTFTDHLYTAFVNAGFRTFRDDDELERGEDIKPELQRAIQQ  61

Query  2368  srisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFE  2189
             SR S+IVFSK+YASSRWCLDEL+ IL R+++  H V P+FY V  + V K + S A AF 
Sbjct  62    SRSSVIVFSKNYASSRWCLDELVMILERKRTSDHVVLPVFYDVDPSQVRKPTASLATAFV  121

Query  2188  RHAKREKMEVEEGRVEWKGKGGEV  2117
             ++    K++VE    +W+    EV
Sbjct  122   KNGSL-KVKVE----KWRAALTEV  140



>ref|XP_002316558.2| hypothetical protein POPTR_0011s00210g [Populus trichocarpa]
 gb|EEE97170.2| hypothetical protein POPTR_0011s00210g [Populus trichocarpa]
Length=519

 Score =   265 bits (678),  Expect(2) = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/370 (43%), Positives = 237/370 (64%), Gaps = 4/370 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL+EVA L GMVL    DG+EA  +Q I+ ++ K L+R +  VP + +G    V  IN
Sbjct  149   RIALKEVADLAGMVLG---DGYEALLVQCIVAKVSKNLDRKIFHVPLHFIGRDPLVNYIN  205

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQDES DV   ++ G+GGVGKT +AK  +N N+ +FE   +L+NVR  S+   G V L
Sbjct  206   SWLQDESHDVATAMLYGIGGVGKTAIAKSVFNQNFRKFECRSYLSNVREISKESKGVVCL  265

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +IL    + I + DEGI+KIKDA+  ++  IV DDVD  +  + +IG ++W  +
Sbjct  266   QRQLLSDILNQTVDEIHDVDEGILKIKDALCCRRTLIVLDDVDNRDQFNAIIGMQEWLCQ  325

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             G KII+TTR + L+   +  ++ K++ LD+++SL+LF  +AFGQ  P+E  +E S + + 
Sbjct  326   GCKIIVTTRNKGLIAAQDEFVKCKVEPLDNKKSLELFSWHAFGQAYPVEGFVEDSWRIVH  385

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HC GLPLAL+ +GS LSG+   +W S L++L  I + ++Q  LEIS + L DDY K +F+
Sbjct  386   HCNGLPLALRVIGSSLSGKGRKLWGSALQELAVIPNCEVQNVLEISYHSLDDDYQKNIFL  445

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F G D D+A+ +L+   +     I  LID  LV ++ND +L M QL+++MG+EI 
Sbjct  446   DIACFFNGMDVDYAVTILDGLGIGARFRIDKLIDRCLVEINNDKRLWMHQLVRDMGREIA  505

Query  1038  RQDSRDDLHT  1009
             RQ+S   L T
Sbjct  506   RQESPKFLST  515


 Score =   164 bits (416),  Expect(2) = 1e-110, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A A+ Q S  S      Y  FLSFRGEDTRKNFTDHLYTAL+ AGI TFRDDDEIGRGEN
Sbjct  2     AAAKYQASSSSRFSHCKYRVFLSFRGEDTRKNFTDHLYTALVQAGIHTFRDDDEIGRGEN  61

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVE  2222
             I++EL++ I++S+I+IIVFSKDYASSRWCLDE++ I+ RR++    V P+FY V  + V 
Sbjct  62    IESELQKAIQQSKIAIIVFSKDYASSRWCLDEIVMIMERRRTADCRVLPVFYDVDPSQVR  121

Query  2221  KQSGSFAEAFERHAKREKMEVE  2156
             KQ+GSFA AF  H K  K E+E
Sbjct  122   KQTGSFAAAFVEHEKHFKEEME  143



>ref|XP_004308512.1| PREDICTED: TMV resistance protein N-like [Fragaria vesca subsp. 
vesca]
Length=1241

 Score =   284 bits (726),  Expect(2) = 2e-110, Method: Compositional matrix adjust.
 Identities = 167/361 (46%), Positives = 246/361 (68%), Gaps = 1/361 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTV-LSVPSYTVGLASRVGKI  1939
             ++AL +VA L GMVL+ + DG+E++FI+ I++EI  KL+RTV LSV +  +G+ +R  KI
Sbjct  152   KDALTKVADLGGMVLRNQDDGYESKFIKTIVKEIGDKLSRTVPLSVGTNLIGIHARANKI  211

Query  1938  NKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVG  1759
             N+W+QD  +DVG+ VI G+ G+GKTTVAK  YN N+  FEGS F+ N+R  S+  NG V 
Sbjct  212   NRWIQDGPNDVGIHVIFGMSGIGKTTVAKHVYNSNFRNFEGSSFIENIRQTSDQINGIVK  271

Query  1758  LQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFS  1579
             LQKQ+  +IL GRE  I N+ EG   I+DAI  K++ +VFDDVD ++  D ++  RD F 
Sbjct  272   LQKQLLHDILNGREVRIRNSSEGKSAIEDAISCKRILLVFDDVDHMDQFDALLTMRDRFH  331

Query  1578  RGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAI  1399
             +GSKIIITTR   +LK       + ++ L++ ESL LF  +AF Q+ P+E  ME + K +
Sbjct  332   KGSKIIITTRRAWVLKAQGITKVHYVRALNESESLTLFSLHAFRQEHPIEGYMELTEKFV  391

Query  1398  RHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFV  1219
             RHC GLPLAL+ LGS L G  + VW S L K+E I + +I   L +S + LD +D+ +F+
Sbjct  392   RHCAGLPLALRVLGSSLFGEDVAVWESALRKVESIPNSEIVHKLRMSFDALDKHDQEVFL  451

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F+G ++D+ ++VL+ C+ +  +GI NLID  LV +  +NKL+M  ++++MG+ I+
Sbjct  452   HIACFFIGNEKDYTVDVLDGCEFYTTIGIINLIDRCLVGIGANNKLVMHDMVRDMGRGIV  511

Query  1038  R  1036
             R
Sbjct  512   R  512


 Score =   145 bits (367),  Expect(2) = 2e-110, Method: Composition-based stats.
 Identities = 77/133 (58%), Positives = 98/133 (74%), Gaps = 4/133 (3%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             YH FLSFRG+DTRKNF+DHLYTAL+NA  RTFRD+DE+ RGE I+  + R IR+SR S+I
Sbjct  23    YHVFLSFRGKDTRKNFSDHLYTALVNARFRTFRDEDELERGEGINPGIERAIRQSRSSVI  82

Query  2350  VFSKDYASSRWCLDELLTILGRRK-SEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKR  2174
             VFSKD+ASS WCLDE++ IL R++ +  H V P+FY+V  + V KQ+GSF EAF RH   
Sbjct  83    VFSKDFASSNWCLDEVVMILERKRVTSDHVVLPVFYNVDPSQVRKQTGSFGEAFGRH---  139

Query  2173  EKMEVEEGRVEWK  2135
             +  +      EWK
Sbjct  140   QNTQPSNKVKEWK  152



>ref|XP_009341509.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=961

 Score =   276 bits (705),  Expect(2) = 3e-110, Method: Compositional matrix adjust.
 Identities = 168/356 (47%), Positives = 238/356 (67%), Gaps = 2/356 (1%)
 Frame = -2

Query  2082  GMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKINKWLQDESSDvg  1903
             GMVLQ E DGHE++FI KI++ I  KL RT +SV S  VG+ SRV  IN WLQD S DVG
Sbjct  163   GMVLQNEEDGHESKFIMKIVKVIEDKLRRTPISVDSNLVGIQSRVKDINLWLQDGSKDVG  222

Query  1902  vgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGLQKQIFENILKG  1723
             + VI G+ G+GKTT+AK  Y  N++RFE   F+ N+R  SE  NG + +QKQ+  +IL G
Sbjct  223   ILVIHGMRGIGKTTIAKFVYGSNFERFERHSFVENIRDFSEKSNGLIQIQKQLLHDILNG  282

Query  1722  REEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSRGSKIIITTRCE  1543
             R+  I +  EG+ KI+DAI SK+V +V DDVD +E LD ++  +D F  GSK IITT   
Sbjct  283   RKVKIHSISEGMAKIEDAICSKRVLLVLDDVDCMEQLDGLLRMQDQFYPGSKFIITTSNA  342

Query  1542  NLLKGHERHLQY-KIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIRHCGGLPLALK  1366
              LL  +   +++   + L++ ESL+LF  +AFGQD P E   + S + + HCGGLPLALK
Sbjct  343   GLLNSYHHMVKFHSCQTLNNSESLELFSLHAFGQDHPTESYSDVSKRFVHHCGGLPLALK  402

Query  1365  DLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFVLIACHFVGKD  1189
              LGS ++G+++ VW S + KL+ I   +I + L+IS   L D +D+ LF+ IAC F+G +
Sbjct  403   ILGSSMAGKNIAVWESAISKLKVIPDSQILKKLKISYESLQDSHDQDLFLHIACFFIGME  462

Query  1188  RDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEILRQDSRD  1021
             +D  + +L+ CD   VVGIQNLID +LV +D DN + M  +I++M + I+R +S++
Sbjct  463   KDIIVRILDACDFFTVVGIQNLIDRNLVRLDGDNMVQMHHMIRDMARGIVRLESKE  518


 Score =   153 bits (386),  Expect(2) = 3e-110, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 95/130 (73%), Gaps = 0/130 (0%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresri  2360
             R  Y  FLSFRGEDTRK FTDHLYTA +NA  RTFRDDDE+ RGE+I  E  + I++SR 
Sbjct  21    RCSYDVFLSFRGEDTRKTFTDHLYTAFVNASFRTFRDDDELERGEDIKLEFVKAIQQSRS  80

Query  2359  siIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHA  2180
             S++VFSKDYASSRWCL+EL+ IL RR++  H V P+FY V  + + KQ+G  A+AF RH 
Sbjct  81    SVVVFSKDYASSRWCLNELVMILKRRRTSNHVVLPVFYDVDPSHLRKQTGCIAKAFARHQ  140

Query  2179  KREKMEVEEG  2150
             K +  +  +G
Sbjct  141   KTQSFDTVKG  150



>ref|XP_008364363.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=555

 Score =   286 bits (732),  Expect(2) = 4e-110, Method: Compositional matrix adjust.
 Identities = 168/356 (47%), Positives = 242/356 (68%), Gaps = 2/356 (1%)
 Frame = -2

Query  2082  GMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKINKWLQDESSDvg  1903
             GMVLQ E DGHEA+FIQKI++ I  KL RT +S   Y +G+ SRV  IN WLQD S +VG
Sbjct  158   GMVLQNEEDGHEAKFIQKIVKVIEDKLRRTHVSFDPYLIGIHSRVQSINSWLQDXSKEVG  217

Query  1902  vgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGLQKQIFENILKG  1723
             + VI G+ G+GKT +AK  Y  N++ FE   FL N+R  +E PNG + +QKQ+  +I  G
Sbjct  218   ILVIYGMHGMGKTXMAKFVYKSNFEIFERHSFLENIRETAEXPNGXIQIQKQLLHDITNG  277

Query  1722  REEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelld-vVIGARDWFSRGSKIIITTRC  1546
             R+  I++T +G+  I+D I SK+V +V DDVD ++ L   VIG +D    GSKII+TT  
Sbjct  278   RKIKIYSTSQGMSAIEDVISSKRVLLVLDDVDDMDQLLGEVIGMQDRLYPGSKIIVTTTY  337

Query  1545  ENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIRHCGGLPLALK  1366
               LL  H++ L +  + L+D+ESL+LF  +AFGQD P E  M++S + ++HCGGLPLALK
Sbjct  338   AGLLNAHQQVLSHNAETLNDDESLELFSLHAFGQDIPTERYMDHSRRVVQHCGGLPLALK  397

Query  1365  DLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDD-YDKRLFVLIACHFVGKD  1189
              LGS LSG+ + +W S L KLE I + +I + L++S + L D +D+ LF+ IAC F+G D
Sbjct  398   VLGSSLSGKXVAIWESTLNKLETIPNGQISQKLKLSYDSLQDTHDQDLFLHIACFFIGMD  457

Query  1188  RDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEILRQDSRD  1021
             RD  + +L++CD    VGIQNL+D  L T++  N++ M  +I++MG+ I+R +S++
Sbjct  458   RDDIVRILDECDFFTDVGIQNLMDRYLXTLNGYNQVQMHHMIRDMGRGIVRLESKE  513


 Score =   142 bits (358),  Expect(2) = 4e-110, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 95/132 (72%), Gaps = 3/132 (2%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGEDTRK FTDHLYTA +NA  RTFRD+DE+ RGE+I    +R I++SR S++
Sbjct  19    YDVFLSFRGEDTRKTFTDHLYTAFVNANFRTFRDNDELERGEDIKPGFKRAIQQSRSSVV  78

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKRE  2171
             VFSKDYASS+WCL+EL+ IL  +K+  H V P+FY V  + + KQ+GS A AF +H K +
Sbjct  79    VFSKDYASSKWCLNELVMILKLKKTSDHVVLPVFYDVDPSHLRKQTGSLAXAFXKHQKVQ  138

Query  2170  KMEVEEGRVEWK  2135
               +  +   EW+
Sbjct  139   SFDTVK---EWR  147



>ref|XP_008345646.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=721

 Score =   288 bits (738),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 170/362 (47%), Positives = 244/362 (67%), Gaps = 1/362 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL E+A L GMVL+ + DG+E+ FI+ I++ I  KL+R  LSV    +G+ S+  +IN
Sbjct  150   RKALAEIADLAGMVLKNQADGYESTFIKNIVKVIGDKLSRMPLSVEPKLIGIQSQAERIN  209

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD SS VG+ V+ G+ G+GKTT+AK  YN N+  F+GS F+ N++  ++ PNG V +
Sbjct  210   LWLQDGSSHVGIFVVYGMSGIGKTTIAKHVYNSNFGSFQGSSFIENIKETADRPNGLVQI  269

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +IL GRE  I +  EGIIKI+ AI +++V +V DDVDQ++  D ++  +D F  
Sbjct  270   QMQLLCDILNGREVKIHSVSEGIIKIERAISTRRVLLVLDDVDQMDXFDAILRMKDQFYX  329

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKI+ITTR E LLK  +    ++++ L   ESLKLF  +AFGQD P+E  ME+S + ++
Sbjct  330   GSKILITTRRERLLKADQVTEVHRVQTLXYNESLKLFSWHAFGQDHPIEEYMEHSKQLVQ  389

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             H  GLPLALK LGS LSG S+ VW S LEKL+ I   +I   L IS   L DD+D++LF+
Sbjct  390   HSDGLPLALKVLGSSLSGESIGVWESALEKLKVIPDGEIINKLRISYESLKDDHDRKLFL  449

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC  +G+++ + + + + CD + ++GIQNLID  LVT D   K+ M  +I+ MG EI+
Sbjct  450   HIACFLIGRNKTYIVRIFDGCDFYTIIGIQNLIDRCLVTFDEHGKVKMHDMIRAMGXEIV  509

Query  1038  RQ  1033
             RQ
Sbjct  510   RQ  511


 Score =   138 bits (348),  Expect(2) = 1e-109, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 95/139 (68%), Gaps = 5/139 (4%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGE TRK FTDHLYTAL NAG  TFRDDDE+ RGE+I   L+  I++SR S++
Sbjct  22    YDVFLSFRGE-TRKTFTDHLYTALNNAGFLTFRDDDELERGEDIKPGLQNAIQQSRTSVV  80

Query  2350  VFSKDYASSRWCLDELLTILGR-RKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKR  2174
             VFSKDYASSRWCLDEL+ IL R R +  H V P+FY V  + V KQ+GS  +AF R  K 
Sbjct  81    VFSKDYASSRWCLDELVLILERKRTTSDHVVLPVFYDVDPSHVRKQTGSVGKAFARSQKN  140

Query  2173  EKMEVEEGRVEWKGKGGEV  2117
             +  E  EG   W+    E+
Sbjct  141   QSSEKVEG---WRKALAEI  156



>ref|XP_009361478.1| PREDICTED: TMV resistance protein N-like, partial [Pyrus x bretschneideri]
Length=752

 Score =   284 bits (727),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 174/365 (48%), Positives = 246/365 (67%), Gaps = 2/365 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL EVA L G VLQ +  G+E++FI+ I++ I  KL+RT LSV    VG+ SRV  +N
Sbjct  151   RKALAEVANLAGKVLQNQAYGYESKFIEDIVQVIRDKLSRTHLSVEPKLVGIHSRVEHVN  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQ+ S DVG+ V  GL G+GKTT+AK  YN N++ FE S ++ ++R  +  P+G V +
Sbjct  211   LWLQNPSHDVGILVFYGLPGIGKTTIAKCVYNSNFESFERSSYVESIRETASHPDGLVRI  270

Query  1755  QKQIFENILKGREEIIFNTDEGIIKI-KDAIGSKKVFIvfddvdqlelldvVIGARDWFS  1579
             QKQI  +IL G++E I N  EG IKI + AI  ++V +V DDVD ++  D V+  +D F 
Sbjct  271   QKQILCDILNGKKEKIHNVSEGTIKIGRRAISLRRVLLVLDDVDHMDQFDAVLSMKDQFY  330

Query  1578  RGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAI  1399
              GSKIIITTR + LLK HE    +++  L  +ESL+L  ++AFG+D P E    YS + +
Sbjct  331   PGSKIIITTRRKRLLKAHEGITVHEVGPLGFDESLELLSQHAFGRDHPFEGYEIYSEEVV  390

Query  1398  RHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLF  1222
             +H GGLPLALK LGS L G    VW S L+KL+ I + +I + L IS + L DD+D++LF
Sbjct  391   QHSGGLPLALKVLGSSLFGEPKLVWESTLKKLKDIPNGEIMKKLRISYDSLQDDHDQKLF  450

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
             + IAC F+GKD D+++ +L+ CD   + GIQNL D  LVT+D D KL M  +I++MG+EI
Sbjct  451   LHIACFFIGKDEDYSVRILDGCDFKTICGIQNLRDRCLVTIDRDKKLSMHDMIRDMGREI  510

Query  1041  LRQDS  1027
             +R++S
Sbjct  511   VRRES  515


 Score =   142 bits (357),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 98/141 (70%), Gaps = 4/141 (3%)
 Frame = -1

Query  2536  FFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresris  2357
             + Y  FLSFRGEDTRK FTDHLY ALI+AG RTFRDDDE+  GE+I   L++ I+ SR S
Sbjct  20    YHYDVFLSFRGEDTRKTFTDHLYAALISAGYRTFRDDDELETGEDIKLGLKQAIQMSRTS  79

Query  2356  iIVFSKDYASSRWCLDELLTILGRRKSEG-HAVFPIFYSVGRADVEKQSGSFAEAFERHA  2180
             +IVFSKDY SSRWCL+EL+ I+  +++   H + P+FY +  + V KQ+GS AEAF RH 
Sbjct  80    VIVFSKDYTSSRWCLNELVEIVDHKRTRSDHVIIPVFYDIDPSHVRKQTGSVAEAFARHR  139

Query  2179  KREKMEVEEGRVEWKGKGGEV  2117
             K E  ++ E    W+    EV
Sbjct  140   KTEPPDMME---RWRKALAEV  157



>ref|XP_009782738.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
Length=1227

 Score =   318 bits (815),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 176/374 (47%), Positives = 267/374 (71%), Gaps = 1/374 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL+EVA L GMVLQ + DGHE++FIQKI++ +  KL+R VL +  + +G+  RV KIN
Sbjct  140   REALKEVADLGGMVLQNQADGHESKFIQKILKVVENKLSRPVLYICPHLIGIERRVEKIN  199

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WL+D S++V   VICG+GG+GKTT+AK  YNLN+ +F+GS FL+N+R  S    G V L
Sbjct  200   TWLEDGSTEVDTLVICGIGGIGKTTMAKYVYNLNFSKFDGSSFLSNIRENSTHRKGLVTL  259

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q   +I K +++ +F+ DEG+ ++++A+  K++ +V DDVD  + LDV++G +DWF  
Sbjct  260   QRQFLSDICKRKKKAMFSVDEGMTEMREAVRCKRILLVLDDVDNRDQLDVLLGMKDWFYP  319

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSK+I+TTR + LL+  + H  Y+ + L+ +ES++L   +AFGQD P++     S +   
Sbjct  320   GSKVIVTTRNKRLLRPFDVHKIYEFEALNRDESVELLSWHAFGQDCPIKGFEMCSEQVAI  379

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HCGGLPLAL+ LG+ L+GR++D+W+S ++KLE I +H+I R L IS   L DD+DK LF+
Sbjct  380   HCGGLPLALEVLGATLAGRNIDIWKSTIQKLETIPNHQILRKLTISYESLEDDHDKNLFL  439

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              +AC F+GKDRD A+ +L +C+ + V+GI+NLID + + V   N L+M Q+I++MG++I+
Sbjct  440   HLACFFIGKDRDLAVAILNRCNFYTVIGIENLIDRNFIKVGKSNMLIMHQMIRDMGRDIV  499

Query  1038  RQDSRDDLHTLSKL  997
             RQ+S  D    S+L
Sbjct  500   RQESPVDPGKRSRL  513


 Score =   106 bits (264),  Expect(2) = 1e-108, Method: Composition-based stats.
 Identities = 60/116 (52%), Positives = 74/116 (64%), Gaps = 1/116 (1%)
 Frame = -1

Query  2527  HAFLSFRGEDTRKNFTDHLYTALINAGIRTFRD-DDEIGRGENIDAELrrgiresrisiI  2351
               FLSF+ +DT  NF DHLY AL+ AG  T R   DE   GE+I   L++ I+ES +S+I
Sbjct  8     QVFLSFKAKDTGNNFADHLYEALVGAGFVTLRSCGDENEGGEDIKLNLQKDIKESGVSVI  67

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERH  2183
             VFS DY  S WCLDEL+ IL  ++    AV PIFY V  +DV KQ G   EAF+RH
Sbjct  68    VFSNDYVCSSWCLDELVMILDCKRIARRAVLPIFYHVDPSDVRKQMGKIGEAFDRH  123



>ref|XP_008347442.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
[Malus domestica]
Length=784

 Score =   290 bits (742),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 177/366 (48%), Positives = 251/366 (69%), Gaps = 1/366 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REA+ EVA L GMVLQ + DG+E++FI+KI++ I  KL+RT LSV    +G+ S+V  IN
Sbjct  151   REAVAEVADLAGMVLQNQDDGYESKFIKKIVKVIGGKLSRTPLSVEPKLIGIKSQVKDIN  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQ+ SSDVG+ V+ G+ G+GKTT+AK  YN N+  FE S F+ N+   ++ PNG V +
Sbjct  211   LWLQNGSSDVGILVVYGMSGIGKTTIAKHVYNSNFIGFERSSFIENINERADRPNGLVQI  270

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +IL G E  I    EGIIKI+ AI S+KV +V DDVD+++ LD V+  +D F  
Sbjct  271   QMQLLSDILIGCEVKIQTVSEGIIKIESAISSRKVLLVLDDVDRMDQLDAVLKMKDRFYP  330

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKI+ITTR E LL+ H+    YK++ L+  ESL+LF  +AFGQD P E  M++S   ++
Sbjct  331   GSKILITTRRERLLRAHQVIKVYKVETLNYNESLELFSWHAFGQDRPTEDYMKHSKMVVQ  390

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             H GGL LAL+ LGS LSG SM VW S LEKL  I + +I   L +S + L DD+D++LF+
Sbjct  391   HSGGLLLALQVLGSSLSGESMGVWESALEKLNVIPNGEIMNKLRVSYDSLQDDHDRKLFL  450

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC  + +++++   +L+ CD + +VGIQNLID  LVT+D   K+ M  +I++MG+EI+
Sbjct  451   HIACFLIKRNKNYIAKILDGCDFYTIVGIQNLIDRCLVTIDKYGKVNMHDMIRDMGREIV  510

Query  1038  RQDSRD  1021
             R +S +
Sbjct  511   RLESEE  516


 Score =   134 bits (336),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 94/139 (68%), Gaps = 4/139 (3%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGEDTRK FTDHLYTAL NAG  TFRD+DE+ RGE+I   L++ I+ SR S++
Sbjct  22    YDVFLSFRGEDTRKTFTDHLYTALNNAGFLTFRDNDELERGEDIKPGLQKAIQLSRASVV  81

Query  2350  VFSKDYASSRWCLDELLTIL-GRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKR  2174
             VFSKDYASS WCLDEL+ IL  +R +  H V P+FY V  + + KQ  S  +AF RH + 
Sbjct  82    VFSKDYASSGWCLDELVLILEHKRTTSDHVVLPVFYDVDPSHLRKQMASVGKAFARHERT  141

Query  2173  EKMEVEEGRVEWKGKGGEV  2117
             +  +  +G   W+    EV
Sbjct  142   QSSKRVKG---WREAVAEV  157



>ref|XP_007207278.1| hypothetical protein PRUPE_ppa024010m2g, partial [Prunus persica]
 gb|EMJ08477.1| hypothetical protein PRUPE_ppa024010m2g, partial [Prunus persica]
Length=507

 Score =   298 bits (764),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 183/357 (51%), Positives = 241/357 (68%), Gaps = 6/357 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNR--TVLSVPSYTVGLASRVGK  1942
             R ALREVA L GMVL+ E DG+E++F+ +IIREI  KL+R  T  +V  Y +G+ SRV  
Sbjct  151   RAALREVADLSGMVLKNEADGYESKFVNQIIREIDDKLSRMRTPFTVAPYPIGMDSRVEF  210

Query  1941  INKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQV  1762
             IN WLQD S+DVG+ +I G+GG+GKTT+AK AYN NY  FE  CFL +VR  S+ PNG V
Sbjct  211   INSWLQDGSTDVGILLINGVGGIGKTTIAKFAYNSNYRGFERRCFLEDVRETSKQPNGLV  270

Query  1761  GLQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWF  1582
              LQ+Q   +I+ GRE  I +  EG  KI+DAI SK V +V DDVD ++ +D +   +DWF
Sbjct  271   LLQRQFLHHIMSGREVKIHSVSEGNKKIRDAIISKPVLLVLDDVDHMKQIDAIFSMQDWF  330

Query  1581  SRGSKIIITTRCENLLKGHE--RHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSV  1408
               GSKI+ITTRC  LL+ HE      Y ++ L   ESL+LF  +AF Q  P E  ++ S 
Sbjct  331   CPGSKIMITTRCAGLLRDHELSNCSVYNVETLKANESLELFSWHAFRQAHPREDWLKLSE  390

Query  1407  KAIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDY--D  1234
                  CGGLPLAL+ LGS LSGR++DVW+S LEKL+ I +++I + L IS + L D   D
Sbjct  391   MIADRCGGLPLALQILGSSLSGRTIDVWKSALEKLKAIPNNEILQRLRISYDALQDNPDD  450

Query  1233  KRLFVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLI  1063
             + LF+ IAC FVGK +D+ + +L+ CD   VVGI+NL+D  LVTVD D K+ M Q+I
Sbjct  451   QNLFLHIACFFVGKRKDYIVRILDGCDFFTVVGIENLMDRCLVTVDQDEKVSMHQMI  507


 Score =   124 bits (311),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 91/140 (65%), Gaps = 3/140 (2%)
 Frame = -1

Query  2581  AEARTQE--SGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRG  2408
             A  R QE  S  SS  R  Y  FLSFRG+DTRK FTDHLY A +  G  TFRD +E+ RG
Sbjct  2     ARFRHQEPSSSNSSPCRCCYDVFLSFRGKDTRKTFTDHLYAAFVEKGFPTFRDKEEVERG  61

Query  2407  ENIDAELrrgiresrisiIVFSKDYASSRWCLDELLTIL-GRRKSEGHAVFPIFYSVGRA  2231
             E I  EL++ I++SR S+IVFSKDYASS WCLDEL+ IL  +R S  H V P+FY V  +
Sbjct  62    EGIKPELQKAIQQSRSSVIVFSKDYASSGWCLDELVFILEHKRISSDHVVLPVFYDVDPS  121

Query  2230  DVEKQSGSFAEAFERHAKRE  2171
              +  Q+G   EAF  H + +
Sbjct  122   HLRHQTGRVGEAFSWHEENQ  141



>ref|XP_008224252.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1339

 Score =   306 bits (784),  Expect(2) = 4e-108, Method: Compositional matrix adjust.
 Identities = 185/371 (50%), Positives = 251/371 (68%), Gaps = 6/371 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNR--TVLSVPSYTVGLASRVGK  1942
             R ALREVA L GMVL+ + +G+E++F+ +II+ I  KL+R  T  ++  Y  G+ SRV  
Sbjct  522   RVALREVADLSGMVLKNQANGYESKFVNQIIKVIDDKLSRMRTPFTIAPYPTGMDSRVEF  581

Query  1941  INKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQV  1762
             IN WLQD S+DVG+ +I G+GG+GKTT+AK AYN NY  FE SCFL +VR  S+ PNG V
Sbjct  582   INSWLQDGSTDVGILLINGVGGIGKTTIAKFAYNSNYRGFERSCFLEDVRETSKQPNGLV  641

Query  1761  GLQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWF  1582
              LQ+Q   +I+ GRE  I +  EG  KI+DAI SK V +V DDVD ++ +  +   +DWF
Sbjct  642   LLQRQFLHHIMSGREVKIHSVGEGNKKIRDAIISKTVLLVLDDVDHMKQIGAIFSMQDWF  701

Query  1581  SRGSKIIITTRCENLLKGHE--RHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSV  1408
               GSKI+ITTRC  LL+ HE      Y ++ L+  ESL+LF  +AF Q  P E  M+ S 
Sbjct  702   CPGSKIMITTRCAGLLRDHELSNCTVYNVETLNANESLQLFSWHAFRQAHPREDWMKLSE  761

Query  1407  KAIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDY--D  1234
                  CGGLPLAL+ LGS LSGR +DVW+S LEKL+ I +++I + L IS + L D   D
Sbjct  762   MIADRCGGLPLALQILGSSLSGRPIDVWKSALEKLKAIPNNEILQRLRISYDALQDNPDD  821

Query  1233  KRLFVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNM  1054
             + LF+ IAC FVGK +D+ + +L+ CD   VVGI+NL+D  LVTVD D K+ M Q+I +M
Sbjct  822   QNLFLHIACFFVGKRKDYIVRILDGCDFFTVVGIENLMDRCLVTVDQDEKVSMHQMICDM  881

Query  1053  GKEILRQDSRD  1021
             G+EI+R +S++
Sbjct  882   GREIVRLESKE  892


 Score =   115 bits (289),  Expect(2) = 4e-108, Method: Composition-based stats.
 Identities = 61/114 (54%), Positives = 79/114 (69%), Gaps = 1/114 (1%)
 Frame = -1

Query  2506  GEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiIVFSKDYAS  2327
             G+DTRK FTDHLY A +  G  TFRD +E+ RGE I  EL++ I++SR S+IVFSKDYAS
Sbjct  400   GKDTRKTFTDHLYAAFVEKGFPTFRDKEEVERGEGIKPELQKAIQQSRSSVIVFSKDYAS  459

Query  2326  SRWCLDELLTIL-GRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKREK  2168
             S WCLDEL+ IL  +R S  H V P+FY V  + +  Q+G   EAF RH + ++
Sbjct  460   SGWCLDELVFILEHKRISSDHVVLPVFYDVDPSHLRNQTGRVGEAFSRHEENQQ  513


 Score =   189 bits (479),  Expect(2) = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/249 (49%), Positives = 162/249 (65%), Gaps = 4/249 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNR--TVLSVPSYTVGLASRVGK  1942
             R ALREVA L GMVL+ + +G+E++F+ +II+ I  KL+R  T  ++  Y  G+ SRV  
Sbjct  151   RVALREVADLSGMVLKNQANGYESKFVNQIIKVIDDKLSRMRTPFTIAPYPTGMDSRVEF  210

Query  1941  INKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQV  1762
             IN WLQD S+DVG+ +I G+GG+GKTT+AK AYN NY  FE SCFL +VR  S+ PNG V
Sbjct  211   INSWLQDGSTDVGILLINGVGGIGKTTIAKFAYNSNYRGFERSCFLEDVRETSKQPNGLV  270

Query  1761  GLQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWF  1582
              LQ+Q   +I+ GRE  I +  EG  KI+DAI SK V +V DDVD ++ +  +   +DWF
Sbjct  271   LLQRQFLHHIMSGREVKIHSVGEGNKKIRDAIISKTVLLVLDDVDHMKQIGAIFSMQDWF  330

Query  1581  SRGSKIIITTRCENLLKGHE--RHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSV  1408
               GSKI+ITTRC  LL+ HE      Y ++ L+  ESL+LF  +AF Q  P E  M+ S 
Sbjct  331   CPGSKIMITTRCAGLLRDHELSNCTVYNVETLNANESLQLFSWHAFRQAHPREDWMKLSE  390

Query  1407  KAIRHCGGL  1381
                  CGGL
Sbjct  391   MIADRCGGL  399


 Score =   130 bits (326),  Expect(2) = 4e-77, Method: Composition-based stats.
 Identities = 71/132 (54%), Positives = 89/132 (67%), Gaps = 1/132 (1%)
 Frame = -1

Query  2560  SGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrr  2381
             S  SS  R  Y  FLSFRG+DTRK FTDHLY A +  G  TFRD +E+ RGE I  EL++
Sbjct  11    SSNSSPCRCRYDVFLSFRGKDTRKTFTDHLYAAFVEKGFPTFRDKEEVERGEGIKPELQK  70

Query  2380  giresrisiIVFSKDYASSRWCLDELLTIL-GRRKSEGHAVFPIFYSVGRADVEKQSGSF  2204
              I++SR S+IVFSKDYASS WCLDEL+ IL  +R S  H V P+FY V  + +  Q+G  
Sbjct  71    AIQQSRSSVIVFSKDYASSGWCLDELVFILEHKRISSDHVVLPVFYDVDPSHLRNQTGRV  130

Query  2203  AEAFERHAKREK  2168
              EAF RH + ++
Sbjct  131   GEAFSRHEENQQ  142



>ref|XP_008235925.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1021

 Score =   276 bits (706),  Expect(2) = 6e-108, Method: Compositional matrix adjust.
 Identities = 172/369 (47%), Positives = 245/369 (66%), Gaps = 4/369 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVP--SYTVGLASRVGK  1942
             R AL EVA L GMVLQ + DGHE++FI+KI++ I  KL+RT  +V   ++ +G+ SRV  
Sbjct  146   RAALTEVADLAGMVLQNQADGHESKFIKKIVKVIEGKLSRTAFNVAPHAHLIGIHSRVQD  205

Query  1941  INKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQV  1762
             IN WL D SS V V +I G+ G+GKTT+AK  YN+N+ R++GS FL N++  S+  NG V
Sbjct  206   INLWLHDGSSKVRVLLIYGMRGIGKTTLAKFVYNINFKRYKGSSFLENIKEHSKQTNGLV  265

Query  1761  GLQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWF  1582
              +QK++  ++  G+   + N  EGIIKI+DA+ SK+V +VFDDVD +E LD V+  +  F
Sbjct  266   QIQKKLLSDVSNGKRVKVGNISEGIIKIEDALSSKRVLLVFDDVDHVEQLDAVLKMQGQF  325

Query  1581  SRGSKIIITTRCENLLKGHERHLQ-YKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVK  1405
               GSKIIITT    LL    + ++ + ++     ESL+LF  +AFGQD P +  ME S +
Sbjct  326   CPGSKIIITTSHAALLNASHQAIKVHNLETFSRNESLELFSWHAFGQDHPEKDYMELSER  385

Query  1404  AIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKR  1228
              +   GGLPLALK LGS LSG+S  VW S L KLE I + +I   L IS + L D++D+ 
Sbjct  386   VVNLSGGLPLALKILGSSLSGKSTVVWESALNKLEAIPNGEILNKLRISYDSLQDEHDRS  445

Query  1227  LFVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGK  1048
             LF+ IAC F+G ++D  + +L+ C  + +VGIQNLID  LVTVD  NK+ M  +I++MG+
Sbjct  446   LFLHIACFFIGMEKDVIVRILDSCGFYTIVGIQNLIDRCLVTVDEYNKVHMHYMIRDMGR  505

Query  1047  EILRQDSRD  1021
              I+  +S++
Sbjct  506   GIVHLESKE  514


 Score =   145 bits (366),  Expect(2) = 6e-108, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 101/139 (73%), Gaps = 1/139 (1%)
 Frame = -1

Query  2563  ESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELr  2384
             +S  +S P   Y  FLSFRGEDTRK FTDHLYTA +NAG RTFRDDDE+ RGE+I  EL+
Sbjct  9     QSQNASHPPHSYDVFLSFRGEDTRKTFTDHLYTAFVNAGFRTFRDDDELERGEDIKPELQ  68

Query  2383  rgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSF  2204
             + I++SR S+IV SK+YASSRWCLDEL+ IL R+++  + V P+FY V  + V K + S 
Sbjct  69    KAIQQSRSSVIVLSKNYASSRWCLDELVMILERKRTSDYVVLPVFYDVDPSQVRKPTASL  128

Query  2203  AEAFERHAKREKMEVEEGR  2147
             A AF ++    K++VE+ R
Sbjct  129   ATAFVKNGSL-KVKVEKRR  146



>ref|XP_009333811.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1235

 Score =   273 bits (697),  Expect(2) = 6e-108, Method: Compositional matrix adjust.
 Identities = 166/356 (47%), Positives = 236/356 (66%), Gaps = 2/356 (1%)
 Frame = -2

Query  2082  GMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKINKWLQDESSDvg  1903
             GMVLQ E DGHE++FI KI++ I  KL RT +SV S  VG+ SRV  IN WLQ  S DV 
Sbjct  163   GMVLQNEEDGHESKFIMKIVKVIEDKLRRTPISVDSNLVGIQSRVKHINLWLQVGSKDVV  222

Query  1902  vgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGLQKQIFENILKG  1723
             + VI G+ G+GKTT+AK  Y  N++RFE   F+ N+R  SE  NG + +QKQ+  +IL G
Sbjct  223   ILVIHGMRGIGKTTIAKFVYGSNFERFERHSFVENIRDFSEKSNGLIQIQKQLLHDILNG  282

Query  1722  REEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSRGSKIIITTRCE  1543
             R+  I +  EG+ KI+DAI SK+V +V DDVD +E LD ++  +D F  GSK IITT   
Sbjct  283   RKVKIHSISEGMAKIEDAICSKRVLLVLDDVDCMEQLDGLLRMQDQFYPGSKFIITTSNA  342

Query  1542  NLLKGHERHLQY-KIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIRHCGGLPLALK  1366
              LL  +   +++   + L++ ESL+LF  +AFGQD P E   + S + + HCGGLPLALK
Sbjct  343   GLLNSYHHMVKFHSCQTLNNSESLELFSLHAFGQDHPTESYSDVSKRFVHHCGGLPLALK  402

Query  1365  DLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFVLIACHFVGKD  1189
              LGS ++G+++ VW S + KL+ I   +I + L+IS   L D +D+ LF+ IAC F+G +
Sbjct  403   ILGSSMAGKNIAVWESAISKLKVIPDSQILKKLKISYESLQDSHDQDLFLHIACFFIGME  462

Query  1188  RDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEILRQDSRD  1021
             +D  + +L+ CD   VVGIQNLID +LV +D DN + M  +I++M + I+R +S++
Sbjct  463   KDIIVRILDACDFFTVVGIQNLIDRNLVRLDGDNMVQMHHMIRDMARGIVRLESKE  518


 Score =   149 bits (375),  Expect(2) = 6e-108, Method: Composition-based stats.
 Identities = 72/127 (57%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGEDTRK FTDHLYTA +NA  RTFRDDDE+ R E+I  E  + I++SR S++
Sbjct  24    YDVFLSFRGEDTRKTFTDHLYTAFVNASFRTFRDDDELERREDIKLEFVKAIQQSRSSVV  83

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKRE  2171
             VFSKDYASSRWCL+EL+ IL RR++  H V P+FY V  + +  Q+G  A+AF RH K +
Sbjct  84    VFSKDYASSRWCLNELVMILKRRRTSNHVVLPVFYDVDPSHLRMQTGCIAKAFARHQKTQ  143

Query  2170  KMEVEEG  2150
               +  +G
Sbjct  144   SFDTVKG  150



>ref|XP_008377461.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=1003

 Score =   286 bits (733),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 176/366 (48%), Positives = 248/366 (68%), Gaps = 1/366 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REA+ EVA L GMVLQ + DG+E++FI+KI++ I  KL+RT LSV    +G+ S+V  IN
Sbjct  151   REAVAEVADLAGMVLQNQDDGYESKFIKKIVKVIGGKLSRTPLSVEPKLIGIKSQVKDIN  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQ+ SSDVG+ V+ G+ G+GKTT+AK  YN N+  FE S F+ N+   ++ PNG V +
Sbjct  211   LWLQNGSSDVGILVVYGMSGIGKTTIAKHVYNSNFXXFEXSSFIENIXERADRPNGLVQI  270

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +IL G E  I    EGIIKI+ AI S+KV +V DDVD  + LD V+  +D F  
Sbjct  271   QMQLLSDILIGXEVKIQTVSEGIIKIESAISSRKVLLVLDDVDXXDQLDXVLKMKDRFYP  330

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKI+ITTR E LL+ H+    YK++ L+   SL+LF  +AFGQD P E  M++S   ++
Sbjct  331   GSKILITTRRERLLRAHQVIKVYKVETLNYNXSLELFSWHAFGQDRPTEDYMKHSKMVVQ  390

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             H GGL LAL+ LGS LSG SM VW S LEKL  I + +I   L +S + L DD+D++LF+
Sbjct  391   HXGGLXLALQVLGSSLSGESMGVWESALEKLNVIPNGEIMNKLRVSYDSLQDDHDRKLFL  450

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC  + +++++   +L+ CD + +VGIQNLID  LVT+D   K+ M  +I++MG+EI+
Sbjct  451   HIACFLIKRNKNYIXKILDGCDFYTIVGIQNLIDRCLVTIDKYGKVNMHDMIRDMGREIV  510

Query  1038  RQDSRD  1021
             R +S +
Sbjct  511   RLESEE  516


 Score =   134 bits (336),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 94/139 (68%), Gaps = 4/139 (3%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGEDTRK FTDHLYTAL NAG  TFRD+DE+ RGE+I   L++ I+ SR S++
Sbjct  22    YDVFLSFRGEDTRKTFTDHLYTALNNAGFLTFRDNDELERGEDIKPGLQKAIQLSRASVV  81

Query  2350  VFSKDYASSRWCLDELLTIL-GRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKR  2174
             VFSKDYASS WCLDEL+ IL  +R +  H V P+FY V  + + KQ  S  +AF RH + 
Sbjct  82    VFSKDYASSGWCLDELVLILEHKRTTSBHVVLPVFYDVDPSHLRKQMASVGKAFARHERT  141

Query  2173  EKMEVEEGRVEWKGKGGEV  2117
             +  +  +G   W+    EV
Sbjct  142   QSSKRVKG---WREAVAEV  157



>ref|XP_008350436.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=836

 Score =   274 bits (700),  Expect(2) = 3e-107, Method: Compositional matrix adjust.
 Identities = 165/360 (46%), Positives = 232/360 (64%), Gaps = 4/360 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL E+A L GMVLQ + DG+E++FI+KI++ I  KL+RT LSV    +G+ S+  +IN
Sbjct  151   RKALAEIADLAGMVLQNQADGYESKFIKKIVKVIGDKLSRTPLSVEPKLIGIQSQAKRIN  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD SSDVG+ V+ G+G   KTT+AK  YN N+  F+GS F+ N++  ++ PNG V +
Sbjct  211   LWLQDGSSDVGIFVVYGIG---KTTIAKHVYNSNFRSFQGSXFIENIKETADXPNGLVQI  267

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +IL GRE  I +  EGIIKI+ AI S +V +V  DVD ++  D ++  +D F  
Sbjct  268   QMQLLCDILNGREVKIHSVSEGIIKIEXAISSXRVLLVLXDVDXMDQXDAILXMKDQFYX  327

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKI+ITTR E LLK  +    +++  L    SLKLF  +AFGQD P E  ME+S + + 
Sbjct  328   GSKILITTRXERLLKXDQVTXVHRVXTLXXXXSLKLFSWHAFGQDHPXEEYMEHSKQJVZ  387

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             H  GLPLALK LGS LSG  +  W S LEKL+ I   +I   L IS   L DD+D +LF+
Sbjct  388   HSXGLPLALKVLGSSLSGXXIXXWESALEKLKVIPDXEIMXKLXISYESLKDDHDXKLFL  447

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC  +G+++ + + + + CD + ++G Q LID  LVT D   K+ M   I+ MG+EI+
Sbjct  448   HIACFLIGRNKXYIVRIXDGCDFYTIIGXQXLIDRCLVTXDXXGKVXMHDXIRAMGREIV  507


 Score =   145 bits (367),  Expect(2) = 3e-107, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 97/139 (70%), Gaps = 4/139 (3%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y AFLSFRGE+TRK FTDHLYTAL NAG  TFRDDDE+ RGE+I   L + I++S+ S++
Sbjct  22    YDAFLSFRGEETRKTFTDHLYTALNNAGFLTFRDDDELERGEDIKPGLLKAIQQSQTSVV  81

Query  2350  VFSKDYASSRWCLDELLTILGR-RKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKR  2174
             VFSKDYASSRWCLDEL+ IL R R +  H V P+FY V  + V KQ+GS  +AF R  K 
Sbjct  82    VFSKDYASSRWCLDELVLILERKRTTSDHVVLPVFYDVDPSHVRKQAGSVGKAFARSQKN  141

Query  2173  EKMEVEEGRVEWKGKGGEV  2117
             +  E  EG   W+    E+
Sbjct  142   QSSEKVEG---WRKALAEI  157



>gb|KDP37035.1| hypothetical protein JCGZ_06091 [Jatropha curcas]
Length=1142

 Score =   360 bits (925),  Expect(2) = 3e-107, Method: Compositional matrix adjust.
 Identities = 203/376 (54%), Positives = 268/376 (71%), Gaps = 7/376 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REALR+ A L GMVLQ   DG+E++FIQ I+RE+  KL+RTVL+V  Y VG+ SR+ +IN
Sbjct  84    REALRQAADLGGMVLQ---DGYESQFIQNIVREVENKLSRTVLNVDPYLVGMDSRIARIN  140

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
             +WLQD S DV +  I G+GG+GKTT+AK+ YNLN++RFE   FLANVR  SE PNG V L
Sbjct  141   RWLQDVSDDVEIAAIYGIGGIGKTTIAKIVYNLNFNRFEARSFLANVREISEQPNGLVRL  200

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+  +I+KG+   I+N DEG I I++A+  KK+ +V DDVD  +  + VIG R+WF  
Sbjct  201   QKQLLSDIVKGKTSKIYNVDEGSIMIRNALCRKKILLVVDDVDDADQFNTVIGMREWFYP  260

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR E LLK     L ++++ELD++ESLKLF  + FGQD P      YS   + 
Sbjct  261   GSKIIITTRRERLLK---FVLNFEVEELDNKESLKLFSWHVFGQDQPANGYQNYSENVVN  317

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HCGGLPLAL+ LGS LSG+S+ VW S L+KLE+I   KIQ+ L IS + L DD+DK LF+
Sbjct  318   HCGGLPLALRVLGSSLSGKSISVWESALQKLEKIADSKIQQILRISFDSLQDDHDKSLFL  377

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F   D  +A+ +L  C+ H +VGIQNLI+  L+T+  +NKLMM QL+++MG+EI+
Sbjct  378   DIACFFTRMDIGYAVRILNGCEFHTIVGIQNLINRCLITISEENKLMMHQLLRDMGREIV  437

Query  1038  RQDSRDDLHTLSKLLD  991
             RQ+S DD    S+L D
Sbjct  438   RQESPDDPGKRSRLWD  453


 Score = 59.3 bits (142),  Expect(2) = 3e-107, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 45/66 (68%), Gaps = 3/66 (5%)
 Frame = -1

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHA---  2180
             V S+DYASSRWCLDEL  I+ RR+  GH V P+FY V    V  Q+GS+ EAF RH    
Sbjct  16    VLSRDYASSRWCLDELAMIMERRRVVGHVVVPVFYDVDPKQVRDQTGSYGEAFARHEKNF  75

Query  2179  KREKME  2162
             K+E+ME
Sbjct  76    KKEEME  81



>gb|ABF81452.1| TIR-NBS type disease resistance protein [Populus trichocarpa]
Length=1309

 Score =   270 bits (689),  Expect(2) = 4e-107, Method: Compositional matrix adjust.
 Identities = 162/365 (44%), Positives = 242/365 (66%), Gaps = 10/365 (3%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL+EVA L GMVL    DG+EA+F+Q I+ ++ KKL++ +  +P + +G    V  IN
Sbjct  462   RIALKEVADLAGMVLG---DGYEAQFVQSIVEKVSKKLDQKMFHLPLHFIGRDPLVNYIN  518

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQ+ S D  + ++ G+GGVGKT +AK  +N N  +FEG  FL+N R+        V L
Sbjct  519   SWLQEGSHDAAIAILYGIGGVGKTIIAKSVFNQNIHKFEGKSFLSNFRSKD-----IVCL  573

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +ILK   + I + DEGI+KIKDA+  +K  IV DDVD+ +  + +IG ++W  +
Sbjct  574   QRQLLSDILKKTIDEINDEDEGILKIKDALCCRKTLIVLDDVDKRDQFNKIIGMQNWLCK  633

Query  1575  GSKIIITTRCENLLKGHE-RHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAI  1399
             GSKII+TTR + L   ++   +++K++ LD+E+SL+LF   AFGQ DP++  +E S + +
Sbjct  634   GSKIIVTTRNKGLFSANDIERVEFKVEPLDNEKSLELFSWNAFGQADPVDGFVEDSWRIV  693

Query  1398  RHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLD-DYDKRLF  1222
              HC GLPLAL+ +GS LSG+  ++W S L+++E IL+ ++Q+ L IS + LD DY K LF
Sbjct  694   HHCNGLPLALRVIGSLLSGKGREIWESALQQMEVILNFEVQKVLRISYDFLDGDYPKNLF  753

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
             + IAC F G D D A+ +L+  D     GI NLID  LV ++ND +L M QL+++MG+EI
Sbjct  754   LDIACFFNGMDVDDAVRILDGLDKGARFGIDNLIDRCLVEINNDQRLWMHQLVRDMGREI  813

Query  1041  LRQDS  1027
              RQ+S
Sbjct  814   ARQES  818


 Score =   149 bits (376),  Expect(2) = 4e-107, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 102/142 (72%), Gaps = 2/142 (1%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A  + QES  S      Y  FLSFRGEDTR+NFTDHLY AL++AGI TFRDDDEI RGE+
Sbjct  315   AAGKYQESYSSRFSNCKYQVFLSFRGEDTRRNFTDHLYKALVDAGIHTFRDDDEIRRGES  374

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVE  2222
             ID EL+  I++S+ISIIVFS DYASSRWCLDEL+ I+ R++++   V P+FY V  + V 
Sbjct  375   IDFELQMAIQQSKISIIVFSIDYASSRWCLDELVMIMERKRNDDCIVLPVFYDVDPSQVG  434

Query  2221  KQSGSFAEAFERHAK--REKME  2162
             +Q+GSFA  F  H K   E ME
Sbjct  435   RQTGSFAATFVEHEKSFNEDME  456



>ref|XP_009776630.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
sylvestris]
Length=1243

 Score =   304 bits (779),  Expect(2) = 5e-107, Method: Compositional matrix adjust.
 Identities = 186/366 (51%), Positives = 243/366 (66%), Gaps = 3/366 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R A REVA L GMVLQ + DG+E+ FIQ+I++ +  KLNRT+LSV  + +G+ SRV  +N
Sbjct  144   RAAFREVADLGGMVLQNQADGYESRFIQEIVKVVASKLNRTILSVALHPIGIDSRVKDLN  203

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQ+ES+ V +  I G+ G+GK+T+AK  YNLN+DRFEGS FLA+VR A E  +G   L
Sbjct  204   LWLQEESTTVDILAIHGMAGIGKSTIAKTVYNLNFDRFEGSSFLADVRKALEKYDGLARL  263

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  NIL    E ++N +EG +KI++AI  KKV +V DDVD+L+ L+ VIG R  F  
Sbjct  264   QRQLLSNILGKNVEKLYNVNEGAVKIQEAISCKKVLVVLDDVDELDQLNAVIGMRQLFYP  323

Query  1575  GSKIIITTRCENLLKGHE--RHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKA  1402
             GSKIIITTR  +LL   E  R   YK+  LD  ESL+LF  +AFG   P    M  S   
Sbjct  324   GSKIIITTRNGHLLNSSEACRCKMYKLNSLDARESLQLFSWHAFGAKYPPLDYMNLSTDV  383

Query  1401  IRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRL  1225
             I HC G+PLALK LGS L  RS +VW S L KL+ I   KI   L IS   L DD  + L
Sbjct  384   IVHCQGIPLALKVLGSSLCDRSTEVWESALRKLKAIPDSKILEKLRISYECLPDDNVQNL  443

Query  1224  FVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKE  1045
             F+ I   FVGKD+D+A+ +L+ C    VVGIQ LID  L+ V ++ KLM+ QL+Q+MG+E
Sbjct  444   FLDIIYFFVGKDKDYAVTILDGCGFFSVVGIQILIDRCLLAVTDNKKLMVHQLLQDMGRE  503

Query  1044  ILRQDS  1027
             I+RQ+S
Sbjct  504   IIRQES  509


 Score =   114 bits (284),  Expect(2) = 5e-107, Method: Composition-based stats.
 Identities = 68/137 (50%), Positives = 91/137 (66%), Gaps = 0/137 (0%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresri  2360
             +F +H FLS R ++    F DHL TAL+NAGIR F+ D+E+   E    ++++ I+E RI
Sbjct  3     QFVHHVFLSSRSKEVSNTFGDHLQTALVNAGIRAFKFDEELVEEEEHQKKVQKVIQEYRI  62

Query  2359  siIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHA  2180
              I+VFSKDYASS+ CLDEL+ IL  +K+ GH V P+FY V  + V KQ G F EAF R+ 
Sbjct  63    LIVVFSKDYASSQNCLDELVYILESKKAFGHFVLPVFYDVDPSQVRKQKGCFEEAFFRYE  122

Query  2179  KREKMEVEEGRVEWKGK  2129
             +R K E +E R EW  K
Sbjct  123   ERYKTENDERRKEWMEK  139



>ref|XP_009776637.1| PREDICTED: TMV resistance protein N-like isoform X2 [Nicotiana 
sylvestris]
Length=1241

 Score =   304 bits (779),  Expect(2) = 5e-107, Method: Compositional matrix adjust.
 Identities = 186/366 (51%), Positives = 243/366 (66%), Gaps = 3/366 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R A REVA L GMVLQ + DG+E+ FIQ+I++ +  KLNRT+LSV  + +G+ SRV  +N
Sbjct  144   RAAFREVADLGGMVLQNQADGYESRFIQEIVKVVASKLNRTILSVALHPIGIDSRVKDLN  203

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQ+ES+ V +  I G+ G+GK+T+AK  YNLN+DRFEGS FLA+VR A E  +G   L
Sbjct  204   LWLQEESTTVDILAIHGMAGIGKSTIAKTVYNLNFDRFEGSSFLADVRKALEKYDGLARL  263

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  NIL    E ++N +EG +KI++AI  KKV +V DDVD+L+ L+ VIG R  F  
Sbjct  264   QRQLLSNILGKNVEKLYNVNEGAVKIQEAISCKKVLVVLDDVDELDQLNAVIGMRQLFYP  323

Query  1575  GSKIIITTRCENLLKGHE--RHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKA  1402
             GSKIIITTR  +LL   E  R   YK+  LD  ESL+LF  +AFG   P    M  S   
Sbjct  324   GSKIIITTRNGHLLNSSEACRCKMYKLNSLDARESLQLFSWHAFGAKYPPLDYMNLSTDV  383

Query  1401  IRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRL  1225
             I HC G+PLALK LGS L  RS +VW S L KL+ I   KI   L IS   L DD  + L
Sbjct  384   IVHCQGIPLALKVLGSSLCDRSTEVWESALRKLKAIPDSKILEKLRISYECLPDDNVQNL  443

Query  1224  FVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKE  1045
             F+ I   FVGKD+D+A+ +L+ C    VVGIQ LID  L+ V ++ KLM+ QL+Q+MG+E
Sbjct  444   FLDIIYFFVGKDKDYAVTILDGCGFFSVVGIQILIDRCLLAVTDNKKLMVHQLLQDMGRE  503

Query  1044  ILRQDS  1027
             I+RQ+S
Sbjct  504   IIRQES  509


 Score =   114 bits (284),  Expect(2) = 5e-107, Method: Composition-based stats.
 Identities = 68/137 (50%), Positives = 91/137 (66%), Gaps = 0/137 (0%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresri  2360
             +F +H FLS R ++    F DHL TAL+NAGIR F+ D+E+   E    ++++ I+E RI
Sbjct  3     QFVHHVFLSSRSKEVSNTFGDHLQTALVNAGIRAFKFDEELVEEEEHQKKVQKVIQEYRI  62

Query  2359  siIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHA  2180
              I+VFSKDYASS+ CLDEL+ IL  +K+ GH V P+FY V  + V KQ G F EAF R+ 
Sbjct  63    LIVVFSKDYASSQNCLDELVYILESKKAFGHFVLPVFYDVDPSQVRKQKGCFEEAFFRYE  122

Query  2179  KREKMEVEEGRVEWKGK  2129
             +R K E +E R EW  K
Sbjct  123   ERYKTENDERRKEWMEK  139



>ref|XP_011011346.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
 ref|XP_011011347.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=1176

 Score =   269 bits (687),  Expect(2) = 6e-107, Method: Compositional matrix adjust.
 Identities = 159/367 (43%), Positives = 242/367 (66%), Gaps = 7/367 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL+EVA L GMVL    DG+EA+F+Q I+ ++ K L+R +  +P + +G  S +  IN
Sbjct  149   RIALKEVADLGGMVLG---DGYEAQFVQSIVEKVSKNLDRKIFHLPFHFIGRDSVIQYIN  205

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S    + ++ G+GGVGKT +AK  YN N+ +FEG  FL+N R  S+   G V L
Sbjct  206   SWLQDRSHSAAIALLYGIGGVGKTAIAKNVYNQNFYKFEGKSFLSNFRERSKEYKGVVCL  265

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +ILK   + I + DEGI+KIKDAI  ++  IV DDV++ +  + ++G + W  +
Sbjct  266   QRQLLFDILKRNVDEINDVDEGIVKIKDAICCRRTLIVLDDVEERDQFNAIVGMQSWLCK  325

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKII+TTR + L+  ++  ++ K++ LD+ +SL+LF  +AFGQ  P+E  +E S K + 
Sbjct  326   GSKIIVTTRNKGLISANDEWVKCKVEPLDNGQSLELFSWHAFGQAYPVEGFVEDSWKIVN  385

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HC GLPLAL+ +GS LSG+S +VW S L ++E I + ++Q+ L IS + L D+Y K LF+
Sbjct  386   HCNGLPLALRVIGSSLSGKSREVWESALHEMEVIPNCEVQKVLRISYDSLNDEYQKNLFL  445

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLID---ISLVTVDNDNKLMMPQLIQNMGK  1048
              IAC F G D ++A+ +L+   +     I NLID   + +V ++ND +L M QL+++MG+
Sbjct  446   DIACFFNGMDYNYAVRILDGLGIGARFRIDNLIDRCLVEIVEINNDKRLWMHQLVRDMGR  505

Query  1047  EILRQDS  1027
             EI RQ+S
Sbjct  506   EISRQES  512


 Score =   149 bits (376),  Expect(2) = 6e-107, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A  + QES  S      +  FLSFRGEDTR+ FTDHLY AL+ AGIRTFRDDDEI RG N
Sbjct  2     AGGKYQESSSSRFSNCKHQVFLSFRGEDTRRKFTDHLYMALVQAGIRTFRDDDEIQRGHN  61

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVE  2222
             I+ E+++GI++S ISIIVFSKDYA SRWCLDEL+ I+ RR++    V P+FY V  + + 
Sbjct  62    IELEIQKGIQQSNISIIVFSKDYARSRWCLDELVMIMERRRTTNSIVLPVFYDVDPSQIR  121

Query  2221  KQSGSFAEAFERHAKREKMEVE  2156
              Q+GSFA AF  H K  K E++
Sbjct  122   NQTGSFAAAFVEHEKHFKEEMD  143



>ref|XP_007221572.1| hypothetical protein PRUPE_ppa025473mg, partial [Prunus persica]
 gb|EMJ22771.1| hypothetical protein PRUPE_ppa025473mg, partial [Prunus persica]
Length=1107

 Score =   287 bits (735),  Expect(2) = 7e-107, Method: Compositional matrix adjust.
 Identities = 178/421 (42%), Positives = 259/421 (62%), Gaps = 35/421 (8%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R ALR+VA L GMVL    D +E++FIQ I+ EI  KLN T  ++  Y VG+ +RV  IN
Sbjct  149   RRALRDVADLGGMVLG---DRYESQFIQNIVEEIENKLNHTTPNISPYVVGIDNRVRGIN  205

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WL+D S+DV            KTT+AK AY  N+D F+GS FL +VRAASE PNG V L
Sbjct  206   MWLKDGSNDVVG----------KTTIAKAAYKQNFDEFQGSSFLPDVRAASEQPNGLVCL  255

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+++  +I KG+ + I++ DEG+ KIK  +  K+V IV DDV+  E  + V+G R+WF  
Sbjct  256   QRKLLSDIQKGKTKKIYSIDEGMSKIKLVVRCKRVLIVLDDVNHSEQFNAVLGMREWFHP  315

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR ENLL  H  +  +           KLF  +AF Q  P++  M  S   ++
Sbjct  316   GSKIIITTRHENLLIDHAVYAMF-----------KLFSWHAFKQAHPIKGYMNLSRSVVQ  364

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HC GLPLAL+ LGS L G+S+D+W+S L+KL  I   KIQ+ L IS + L DD+D+ LF+
Sbjct  365   HCEGLPLALQVLGSSLFGKSVDLWQSALQKLHVIPDDKIQKILRISFDSLKDDHDRNLFL  424

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              I C F+ K   + I VL+  + +  +GIQNL+D  LV +D DN+L++ QL+++MG+ I+
Sbjct  425   HIVCFFIEKKMGYTITVLDNLNFYTRIGIQNLVDRCLVEIDIDNRLIVYQLLRDMGRAII  484

Query  1038  RQDSRDD-------LHTLSKLLDQLVSSTESTGNGVVN---ESASHVNSPKRPYSQEFED  889
             R++S +D        H  S  + + ++ TE+    ++N   E+    ++ KR + ++F+ 
Sbjct  485   REESPEDPGKRSRVWHKDSSDVLRKLTGTETIKGLMLNLPSEAIFSTSNQKRRHVEDFDG  544

Query  888   N  886
             N
Sbjct  545   N  545


 Score =   130 bits (327),  Expect(2) = 7e-107, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 93/131 (71%), Gaps = 1/131 (1%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A    Q    S+  R  Y  FLS+RG+DTRK FTDHLY AL  AG  TFRDDDEI RG N
Sbjct  2     AAIIAQLDASSTFYRCSYDVFLSYRGKDTRKGFTDHLYRALEQAGFHTFRDDDEIKRGAN  61

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKS-EGHAVFPIFYSVGRADV  2225
             I AE++R I+ESR+SIIVFSK+YASS WCLDEL+ I+ RRK+ +G  V P+FY V  + V
Sbjct  62    IAAEIQRAIQESRVSIIVFSKNYASSTWCLDELVKIMERRKADDGLMVMPVFYDVDPSHV  121

Query  2224  EKQSGSFAEAF  2192
              K +GSFA AF
Sbjct  122   RKLTGSFANAF  132



>ref|XP_002317136.2| hypothetical protein POPTR_0011s01755g, partial [Populus trichocarpa]
 gb|EEE97748.2| hypothetical protein POPTR_0011s01755g, partial [Populus trichocarpa]
Length=628

 Score =   254 bits (650),  Expect(2) = 5e-106, Method: Compositional matrix adjust.
 Identities = 160/365 (44%), Positives = 234/365 (64%), Gaps = 11/365 (3%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL+EVA L GMVL    DG+EA+F+Q I+  ++K L+  +  VP + +G    V  IN
Sbjct  149   RIALKEVADLAGMVLG---DGYEAQFVQSIVENVLKNLDPKIFHVPLHFIGRGPLVQYIN  205

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD +    + ++ G+GGVGKT +AK  +N NY  FEG  FL+N R+        V L
Sbjct  206   SWLQDGTHGAAIALLYGIGGVGKTAIAKSVFNQNYYTFEGKSFLSNFRSKD-----IVCL  260

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +IL    EI  + DEGI+KIKDA+  ++  IV DDVD+ +  + +I  ++W  +
Sbjct  261   QRQLLFDILNKTVEI-NDPDEGILKIKDALCCRRTLIVLDDVDKRDQFNKIIVMQNWLCK  319

Query  1575  GSKIIITTRCENLLKGHE-RHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAI  1399
             GSKII+TTR + L  G++   ++ KI+ LDDE+SL+LF   AFGQ DP++  +E S + +
Sbjct  320   GSKIIVTTRNKGLFSGNDIEWVRCKIEPLDDEKSLELFSWNAFGQADPIDGFVEDSWRIV  379

Query  1398  RHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLD-DYDKRLF  1222
              HC G+PLAL  +GS L G+   +W S L+++E IL+ ++Q+ L IS + LD DY K LF
Sbjct  380   HHCNGVPLALGVIGSSLFGKGRGIWESALQQMEVILNFEVQKVLRISYDFLDGDYPKNLF  439

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
             + IAC F G D D A+ +L+  D     GI NLID  LV +++D +L M QL+++MG+EI
Sbjct  440   LDIACFFNGMDVDDAVRILDGLDKGARFGIDNLIDRCLVEINSDQRLWMHQLVRDMGREI  499

Query  1041  LRQDS  1027
              RQ+S
Sbjct  500   ARQES  504


 Score =   160 bits (405),  Expect(2) = 5e-106, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A  + +ES  S  P   Y  FLSFRGEDTRKNFTDHLYT L+ AGI TFRDD+EI RGEN
Sbjct  2     AAGKYKESYSSRFPNCKYQVFLSFRGEDTRKNFTDHLYTTLVQAGIHTFRDDNEIRRGEN  61

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVE  2222
             ID EL++ I++S+ISIIVFSK+YA SRWCLDEL+ I+ RR++ G  VFP+FY V  ++V 
Sbjct  62    IDFELQKAIQQSKISIIVFSKNYAWSRWCLDELVMIMERRRTTGSIVFPVFYDVLPSEVR  121

Query  2221  KQSGSFAEAFERHAKREKMEVE  2156
              Q+GSFA AF    KR K E+E
Sbjct  122   NQTGSFAAAFVEQEKRFKEEME  143



>ref|XP_011046323.1| PREDICTED: TMV resistance protein N-like isoform X1 [Populus 
euphratica]
Length=1114

 Score =   260 bits (665),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/374 (44%), Positives = 240/374 (64%), Gaps = 1/374 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL E A L G  L+   DGHEA+FI+KI+ EI+++L+ T L V  Y VG+  RV ++N
Sbjct  155   RMALTEAANLSGWDLRNVADGHEAKFIKKIVGEILRELSSTYLFVAFYPVGINPRVQQLN  214

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               L   SS+V +  I G+GG+GKTT+AK  YN  +  F+G CFLANVR  S+ PNG V L
Sbjct  215   FLLNAGSSEVCIVGIYGMGGIGKTTIAKAMYNELFHSFDGKCFLANVREISQQPNGHVKL  274

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+   ILK  +  I N D G+  IK+ + S+KV ++ DDVD+L+ L  + G+RDWF  
Sbjct  275   QEQLLFEILKKDKIKIGNVDRGMNMIKERLHSRKVLVILDDVDKLDQLQAIAGSRDWFGS  334

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS+II+TTR +++L        Y  +E++D E+L+LF  +AF  + P+E     S + + 
Sbjct  335   GSRIIVTTRDKHVLTVLGADQVYMAREMNDIEALELFSWHAFRTNHPVEDYKVLSEQIVD  394

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             +CG LPLAL+ +GS+L GRS+  W+S LEKL RI   +IQ+ L+IS + L DD  K +F+
Sbjct  395   YCGRLPLALEVIGSFLFGRSIVEWKSALEKLRRIPDDQIQKKLQISFDGLNDDTQKDIFL  454

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              I+C FVG D+++ + +L  CD    +G   L    LV+V+  NKL+M  L+++MG+EI+
Sbjct  455   DISCFFVGMDKEYVLPILNGCDFFADIGFSVLTQRCLVSVNEKNKLIMHDLLRDMGREIV  514

Query  1038  RQDSRDDLHTLSKL  997
             R  S ++    S+L
Sbjct  515   RVQSPNNPGRRSRL  528


 Score =   154 bits (388),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 106/135 (79%), Gaps = 1/135 (1%)
 Frame = -1

Query  2536  FFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresris  2357
             + Y  FLSFRGEDTRKNFTDHLY AL +AGI TFRDD+E+ RGE+I  EL + I++SRIS
Sbjct  21    WIYDVFLSFRGEDTRKNFTDHLYFALKDAGINTFRDDNELRRGEDISTELLQAIQKSRIS  80

Query  2356  iIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAK  2177
             +IVFS++YA+SRWCL+EL+ I+  R+S    VFPIFY V  +DV KQ+GSFAEAF RH +
Sbjct  81    VIVFSRNYANSRWCLEELVKIMECRRSCRQLVFPIFYDVDPSDVRKQTGSFAEAFARHDE  140

Query  2176  REKMEVEEGRV-EWK  2135
             R  ++ ++G+V  W+
Sbjct  141   RFVLQTDKGKVATWR  155



>ref|XP_009350224.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=548

 Score =   278 bits (711),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 170/343 (50%), Positives = 232/343 (68%), Gaps = 1/343 (0%)
 Frame = -2

Query  2052  HEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKINKWLQDESSDvgvgvicglggv  1873
             +EA FI+ I++ I  KL+RT LSV S  VG+ SRV  IN WLQD S +VG+ V+ GL G+
Sbjct  162   YEANFIKDIVKVIRDKLSRTYLSVESKLVGIHSRVEHINLWLQDPSHNVGILVVYGLPGI  221

Query  1872  GKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGLQKQIFENILKGREEIIFNTDE  1693
             GKTT+AK  YN N++ FEGS ++ ++R  +  P+G V +QKQI  +IL G    I N  E
Sbjct  222   GKTTIAKCVYNSNFESFEGSSYVESIREIASHPDGLVQIQKQILYDILNGENNKIHNVSE  281

Query  1692  GIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSRGSKIIITTRCENLLKGHERHL  1513
             GIIKI  AI  ++V +V DDVD ++  D V+  +D F  GSKIIITTR ++LLK HE   
Sbjct  282   GIIKIGRAISFRRVLLVLDDVDHMDQFDAVLRMKDQFYPGSKIIITTRRKSLLKAHEGIT  341

Query  1512  QYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIRHCGGLPLALKDLGSYLSGRSM  1333
               ++  L  +ESLKL  ++AFGQD PLE   +YS + ++H G LPLALK LGS L G   
Sbjct  342   VNEVGPLGFDESLKLLSQHAFGQDHPLEGYEKYSEEVVQHSGRLPLALKVLGSSLFGEPK  401

Query  1332  DVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFVLIACHFVGKDRDFAINVLEKC  1156
              VW+S LEKL+ I + +I   L IS + L DD+D++LF+ IAC F+GKD D+ + +L+ C
Sbjct  402   CVWKSTLEKLKVIPNGEIMNKLRISYDSLHDDHDQKLFLHIACFFIGKDEDYIVRILDGC  461

Query  1155  DLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEILRQDS  1027
             D   + GIQNL D  LVT+D DNKL M  +I++MG+EI+R++S
Sbjct  462   DFKTICGIQNLRDRCLVTIDRDNKLSMHDMIRDMGREIVRRES  504


 Score =   135 bits (341),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 102/153 (67%), Gaps = 12/153 (8%)
 Frame = -1

Query  2536  FFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresris  2357
             + Y  FLSFRGEDTRK FTDHLYTAL NAG  TFRDD+E+ RGE+I   L++ I+ SR S
Sbjct  20    YHYDVFLSFRGEDTRKTFTDHLYTALNNAGFLTFRDDNELERGEDIKPGLQKAIQLSRTS  79

Query  2356  iIVFSKDYASSRWCLDELLTIL-GRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHA  2180
             ++VF KDYASSRWCLDEL+ IL  +R S  H V P+FY V  + + KQ+ S  +AF   A
Sbjct  80    VVVFPKDYASSRWCLDELVVILEHKRTSIDHVVLPVFYDVDPSHLRKQTRSIEKAF---A  136

Query  2179  KREKMEVEEGRVEWKGKGGEVERSSQRSCRIAR  2081
             +R++ +          K  E+ER + R C+ +R
Sbjct  137   QRQRTQ--------SSKKVEMERGTCRGCKSSR  161



>ref|XP_011046325.1| PREDICTED: TMV resistance protein N-like isoform X2 [Populus 
euphratica]
Length=1110

 Score =   260 bits (664),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/374 (44%), Positives = 240/374 (64%), Gaps = 1/374 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL E A L G  L+   DGHEA+FI+KI+ EI+++L+ T L V  Y VG+  RV ++N
Sbjct  151   RMALTEAANLSGWDLRNVADGHEAKFIKKIVGEILRELSSTYLFVAFYPVGINPRVQQLN  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               L   SS+V +  I G+GG+GKTT+AK  YN  +  F+G CFLANVR  S+ PNG V L
Sbjct  211   FLLNAGSSEVCIVGIYGMGGIGKTTIAKAMYNELFHSFDGKCFLANVREISQQPNGHVKL  270

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+   ILK  +  I N D G+  IK+ + S+KV ++ DDVD+L+ L  + G+RDWF  
Sbjct  271   QEQLLFEILKKDKIKIGNVDRGMNMIKERLHSRKVLVILDDVDKLDQLQAIAGSRDWFGS  330

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS+II+TTR +++L        Y  +E++D E+L+LF  +AF  + P+E     S + + 
Sbjct  331   GSRIIVTTRDKHVLTVLGADQVYMAREMNDIEALELFSWHAFRTNHPVEDYKVLSEQIVD  390

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             +CG LPLAL+ +GS+L GRS+  W+S LEKL RI   +IQ+ L+IS + L DD  K +F+
Sbjct  391   YCGRLPLALEVIGSFLFGRSIVEWKSALEKLRRIPDDQIQKKLQISFDGLNDDTQKDIFL  450

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              I+C FVG D+++ + +L  CD    +G   L    LV+V+  NKL+M  L+++MG+EI+
Sbjct  451   DISCFFVGMDKEYVLPILNGCDFFADIGFSVLTQRCLVSVNEKNKLIMHDLLRDMGREIV  510

Query  1038  RQDSRDDLHTLSKL  997
             R  S ++    S+L
Sbjct  511   RVQSPNNPGRRSRL  524


 Score =   153 bits (387),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 106/135 (79%), Gaps = 1/135 (1%)
 Frame = -1

Query  2536  FFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresris  2357
             + Y  FLSFRGEDTRKNFTDHLY AL +AGI TFRDD+E+ RGE+I  EL + I++SRIS
Sbjct  17    WIYDVFLSFRGEDTRKNFTDHLYFALKDAGINTFRDDNELRRGEDISTELLQAIQKSRIS  76

Query  2356  iIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAK  2177
             +IVFS++YA+SRWCL+EL+ I+  R+S    VFPIFY V  +DV KQ+GSFAEAF RH +
Sbjct  77    VIVFSRNYANSRWCLEELVKIMECRRSCRQLVFPIFYDVDPSDVRKQTGSFAEAFARHDE  136

Query  2176  REKMEVEEGRV-EWK  2135
             R  ++ ++G+V  W+
Sbjct  137   RFVLQTDKGKVATWR  151



>ref|XP_002524855.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF37479.1| ATP binding protein, putative [Ricinus communis]
Length=673

 Score =   266 bits (681),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/377 (43%), Positives = 240/377 (64%), Gaps = 1/377 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL E A L G  LQ   +GHE++ I+K++ +++ KL+R  L+V  + VG+ SR+  + 
Sbjct  151   RNALLEAANLSGWDLQNVANGHESKNIRKVVEDVLSKLSRNCLNVAKHPVGIDSRIKDVI  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               L   + DV +  I G+GG+GKTT+AK  +N   D FE  CFL+NV+  SE PNG + L
Sbjct  211   VLLSVGTKDVRMIGIHGMGGIGKTTIAKAVFNQLCDGFEVRCFLSNVKEISEQPNGLIQL  270

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+   +LK +   I + D GI  I++    K++ +V DD+D ++  + ++G R WF  
Sbjct  271   QEQLLRAVLKPKSLQIGSVDRGINMIRERFRHKRLLVVIDDLDHMKQFNALMGDRTWFGL  330

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS++IIT+R E+LL   E   +Y++KELD  ESL+LF  +AF +  P+   +E S   + 
Sbjct  331   GSRLIITSRDEHLLAQLEVDEKYQVKELDHNESLELFSWHAFRKTHPVGDYVELSNGVVD  390

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYD-KRLFV  1219
             + GGLPLAL+ LGSYL  RS+  W S L KL+RI HH+IQR L +S + LDD   K +F+
Sbjct  391   YGGGLPLALEVLGSYLCKRSIPEWTSALRKLKRIPHHQIQRKLRLSFDTLDDDKVKDIFL  450

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F+G DRD+A+ +L+ C   P +GI  LI  SLVTVD+ NKL M  L+++MG+EI+
Sbjct  451   DIACFFIGTDRDYAVKILDGCGFFPEIGISVLIQRSLVTVDSKNKLSMHDLLRDMGREIV  510

Query  1038  RQDSRDDLHTLSKLLDQ  988
             R+ S +     S+L  Q
Sbjct  511   RELSPNQPGKRSRLWFQ  527


 Score =   147 bits (370),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 95/125 (76%), Gaps = 3/125 (2%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGEDTRKNFTDHLY AL+ AGI  FRDD  + RG +I +EL + I+ES++SI+
Sbjct  23    YDVFLSFRGEDTRKNFTDHLYNALLQAGIHAFRDDKHLSRGNHISSELLKAIQESKVSIV  82

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERH---A  2180
             VFSK YASSRWCLDEL+ I+  + + G  V PIFY V  +DV KQ+GSFAEA +RH   +
Sbjct  83    VFSKGYASSRWCLDELVKIMQCKNTAGQIVVPIFYDVSPSDVRKQTGSFAEALQRHEQFS  142

Query  2179  KREKM  2165
             +REK+
Sbjct  143   EREKV  147



>ref|XP_009350229.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=544

 Score =   277 bits (708),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 170/343 (50%), Positives = 232/343 (68%), Gaps = 1/343 (0%)
 Frame = -2

Query  2052  HEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKINKWLQDESSDvgvgvicglggv  1873
             +EA FI+ I++ I  KL+RT LSV S  VG+ SRV  IN WLQD S +VG+ V+ GL G+
Sbjct  162   YEANFIKDIVKVIRDKLSRTYLSVESKLVGIHSRVEHINLWLQDPSHNVGILVVYGLPGI  221

Query  1872  GKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGLQKQIFENILKGREEIIFNTDE  1693
             GKTT+AK  YN N++ FEGS ++ ++R  +  P+G V +QKQI  +IL G    I N  E
Sbjct  222   GKTTIAKCVYNSNFESFEGSSYVESIREIASHPDGLVQIQKQILYDILNGENNKIHNVSE  281

Query  1692  GIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSRGSKIIITTRCENLLKGHERHL  1513
             GIIKI  AI  ++V +V DDVD ++  D V+  +D F  GSKIIITTR ++LLK HE   
Sbjct  282   GIIKIGRAISFRRVLLVLDDVDHMDQFDAVLRMKDQFYPGSKIIITTRRKSLLKAHEGIT  341

Query  1512  QYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIRHCGGLPLALKDLGSYLSGRSM  1333
               ++  L  +ESLKL  ++AFGQD PLE   +YS + ++H G LPLALK LGS L G   
Sbjct  342   VNEVGPLGFDESLKLLSQHAFGQDHPLEGYEKYSEEVVQHSGRLPLALKVLGSSLFGEPK  401

Query  1332  DVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFVLIACHFVGKDRDFAINVLEKC  1156
              VW+S LEKL+ I + +I   L IS + L DD+D++LF+ IAC F+GKD D+ + +L+ C
Sbjct  402   CVWKSTLEKLKVIPNGEIMNKLRISYDSLHDDHDQKLFLHIACFFIGKDEDYIVRILDGC  461

Query  1155  DLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEILRQDS  1027
             D   + GIQNL D  LVT+D DNKL M  +I++MG+EI+R++S
Sbjct  462   DFKTICGIQNLRDRCLVTIDRDNKLSMHDMIRDMGREIVRRES  504


 Score =   135 bits (341),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 102/153 (67%), Gaps = 12/153 (8%)
 Frame = -1

Query  2536  FFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresris  2357
             + Y  FLSFRGEDTRK FTDHLYTAL NAG  TFRDD+E+ RGE+I   L++ I+ SR S
Sbjct  20    YHYDVFLSFRGEDTRKTFTDHLYTALNNAGFLTFRDDNELERGEDIKPGLQKAIQLSRTS  79

Query  2356  iIVFSKDYASSRWCLDELLTIL-GRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHA  2180
             ++VF KDYASSRWCLDEL+ IL  +R S  H V P+FY V  + + KQ+ S  +AF   A
Sbjct  80    VVVFPKDYASSRWCLDELVVILEHKRTSIDHVVLPVFYDVDPSHLRKQTRSIEKAF---A  136

Query  2179  KREKMEVEEGRVEWKGKGGEVERSSQRSCRIAR  2081
             +R++ +          K  E+ER + R C+ +R
Sbjct  137   QRQRTQ--------SSKKVEMERGTCRGCKSSR  161



>ref|XP_007198927.1| hypothetical protein PRUPE_ppa000477mg [Prunus persica]
 gb|EMJ00126.1| hypothetical protein PRUPE_ppa000477mg [Prunus persica]
Length=1140

 Score =   283 bits (723),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 173/367 (47%), Positives = 246/367 (67%), Gaps = 14/367 (4%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R ALR+V  L GMVL    D +E++FIQ I+ EI  KLN T  ++  Y VG+       N
Sbjct  150   RRALRDVEDLGGMVLG---DRYESQFIQNIVEEIENKLNHTTPNMAPYVVGID------N  200

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
             +W++D    VGV VI G+GGVGKTT+AK AY  N+++F+GS FL +VRAASE PNG V L
Sbjct  201   RWIKD----VGVAVIYGMGGVGKTTIAKAAYKQNFEKFQGSSFLPDVRAASEQPNGLVCL  256

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+ +  +I KG+ + I++ DEG+ KIK  +  K+V IV DDV+  E  + ++G R+WF  
Sbjct  257   QRILLSDIQKGKTKKIYSIDEGMSKIKLLVRCKRVLIVLDDVNHSEQFNAILGMREWFHP  316

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKII+TTR ENLL  H  +  +K+K L + ESL+LF  +AF Q  P++  M  S   ++
Sbjct  317   GSKIIVTTRHENLLNDHAVYAMFKVKGLGEGESLELFSWHAFKQAHPIKGYMNLSRSVVQ  376

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HC GLPLAL+ LGS L G+S+D+W+S L+KL  I   KIQ+ L IS + L DD+D+ LF+
Sbjct  377   HCEGLPLALQVLGSSLFGKSVDLWQSALQKLHVIPDDKIQKILRISFDSLKDDHDRNLFL  436

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              I C F+ K   + I VL+  + +  +GIQNL+D  LV +D DN+L+M QL+++MG+ I+
Sbjct  437   HIVCFFIEKKMGYTITVLDNLNFYTRIGIQNLVDRCLVEIDIDNRLIMHQLLRDMGRAII  496

Query  1038  RQDSRDD  1018
             R++S +D
Sbjct  497   REESPED  503


 Score =   127 bits (320),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 100/149 (67%), Gaps = 4/149 (3%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A    Q    S+  R  Y  FLS+RGEDTRK FTDHLY AL  AG  TFRDDDEI RG N
Sbjct  2     AAIIAQLDASSTFYRCTYDVFLSYRGEDTRKGFTDHLYRALEQAGFHTFRDDDEIKRGAN  61

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKS-EGHAVFPIFYSVGRADV  2225
             I AE++R ++ESR+SIIVFSK+YASS WCLDEL+ I+ RRK+ +G  V  +FY V  + V
Sbjct  62    IAAEIQRAVQESRVSIIVFSKNYASSTWCLDELVKIMERRKADDGLMVMLVFYDVDPSHV  121

Query  2224  EKQSGSFAEAF---ERHAKREKMEVEEGR  2147
              K +GSFA +F   E H K +  +VE  R
Sbjct  122   RKLTGSFANSFSGPEDHFKEDIDKVEGWR  150



>ref|XP_009598203.1| PREDICTED: TMV resistance protein N-like [Nicotiana tomentosiformis]
Length=1229

 Score =   308 bits (790),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 169/364 (46%), Positives = 259/364 (71%), Gaps = 1/364 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL+EVA L GMVLQ + DGHE++FIQKI++ +  KL+R VL +  + +G+  RV KIN
Sbjct  140   REALKEVADLGGMVLQNQADGHESKFIQKILKVVENKLSRPVLYICPHLIGIERRVEKIN  199

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WL+D S DV   VICG+GG+GKTT+AK  YNLN+ +F+GS FL+N+R  S    G V L
Sbjct  200   LWLEDGSIDVDTLVICGIGGIGKTTMAKFVYNLNFSKFDGSSFLSNIRENSTHRKGLVTL  259

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q++   +I K +++ +F+ DEG+ ++++A+  K++ +V DDVD  + +D ++G +D    
Sbjct  260   QRKFLSDICKRKKKAMFSVDEGMTEMREAVQCKRILLVLDDVDNRDQVDALLGMKDLLYP  319

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSK+I+TTR + LL+  + H  Y+ + L+ +ES++L   +AFGQD P++     S +   
Sbjct  320   GSKVIVTTRNKRLLRPFDVHKIYEFEALNRDESVELLSWHAFGQDCPIKGFEMCSEQVAI  379

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HCGGLPLAL+ LG+ L+GR++D+W+S ++KLE I +H+I R L IS   L DD+DK LF+
Sbjct  380   HCGGLPLALEVLGATLAGRNIDIWKSTIQKLETIPNHQILRKLTISYESLEDDHDKNLFL  439

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              +AC F+GKDRD A+ +L +C+ + V+GI+NLID + + V   N L+M Q+I++MG++I+
Sbjct  440   HLACFFIGKDRDLAVTILNRCNFYTVIGIENLIDRNFIKVGKSNSLIMHQMIRDMGRDIV  499

Query  1038  RQDS  1027
             RQ+S
Sbjct  500   RQES  503


 Score =   101 bits (252),  Expect(2) = 1e-104, Method: Composition-based stats.
 Identities = 65/139 (47%), Positives = 84/139 (60%), Gaps = 2/139 (1%)
 Frame = -1

Query  2527  HAFLSFRGEDTRKNFTDHLYTALINAGIRTFRD-DDEIGRGENIDAELrrgiresrisiI  2351
               +LSF+ +DT K F DHLY AL+ AG  T R   DE   GE+I   L++GI+ES +S+I
Sbjct  8     QVYLSFKAKDTGKIFADHLYEALVGAGFVTLRSCGDENEGGEDIKFNLQKGIKESGVSVI  67

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKRE  2171
             +FS DY SS WCLDEL+ IL  +K    AV PIFY V  +DV KQ G   EAF+   +  
Sbjct  68    IFSNDYVSSSWCLDELVMILDCKKIAKRAVLPIFYHVDPSDVRKQKGRIGEAFDMDKELG  127

Query  2170  KMEVEEGRV-EWKGKGGEV  2117
               + E  RV +W+    EV
Sbjct  128   GNQGENERVRKWREALKEV  146



>ref|XP_006363488.1| PREDICTED: TMV resistance protein N-like isoform X2 [Solanum 
tuberosum]
Length=1219

 Score =   306 bits (783),  Expect(2) = 5e-104, Method: Compositional matrix adjust.
 Identities = 181/366 (49%), Positives = 252/366 (69%), Gaps = 4/366 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R ALR+VA L GMVLQ + DG E+ FIQ+I++ +V KL RTVLSV  + +G+ SRV +I+
Sbjct  126   RAALRQVADLGGMVLQNQADGSESRFIQEIVKVVVGKLRRTVLSVDPHPIGIDSRVKEID  185

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQ+ S++V +  I G+GG+GKTT+AK+AYNLN+DRFEGS FLA+VR   E  +G   L
Sbjct  186   LWLQEGSNNVDILAIHGMGGIGKTTIAKIAYNLNFDRFEGSSFLADVRKVLEKYDGLARL  245

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  NIL    E I+N +EG +KI++AI  K+V +V DD+D ++ L+ V+G RDWF  
Sbjct  246   QRQLLSNILGKNVEKIYNVNEGSVKIQEAISCKRVLLVLDDIDNIDQLNAVLGMRDWFYP  305

Query  1575  GSKIIITTRCENLLKGHE--RHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKA  1402
             GSKII+TTR  +LL   E  R   YK+K LD +ESL+LF  +AF  + P    M+ ++  
Sbjct  306   GSKIIVTTRNGHLLSSTEACRCRMYKLKTLDAKESLQLFSWHAFRDESPPLEYMDLTIDV  365

Query  1401  IRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRL  1225
             + HC G+PLALK LGS L   S+++W S L KL+ I   KI   L IS   L DD  + L
Sbjct  366   VHHCKGIPLALKVLGSSLGDLSIEIWESALRKLKAIPDSKILEKLRISYECLPDDNVQNL  425

Query  1224  FVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKE  1045
             F+ I C F GKDRD+A+ +L+ C    VVGIQ L+D  L+ +++ NKLM+ QL+Q+MG+E
Sbjct  426   FLDIVCFFAGKDRDYAVTILDGCGFFSVVGIQILVDRCLLAIEH-NKLMVHQLLQDMGRE  484

Query  1044  ILRQDS  1027
             I+R++S
Sbjct  485   IIREES  490


 Score =   102 bits (255),  Expect(2) = 5e-104, Method: Composition-based stats.
 Identities = 62/126 (49%), Positives = 81/126 (64%), Gaps = 9/126 (7%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresri  2360
             +F +H FLSFR     K F DHL+TAL+NAGI +FR DD+      +D +L+  I+ESRI
Sbjct  4     QFVHHVFLSFRS----KTFGDHLHTALLNAGIPSFRPDDK-----ELDKKLQNSIQESRI  54

Query  2359  siIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHA  2180
              I + SKDYASS  CLDEL  ++  +K+ G+ + P+FY V  +DV KQ GSF E F    
Sbjct  55    LIAIISKDYASSYRCLDELTHMIQTKKAFGNFLLPVFYDVDPSDVRKQKGSFEEPFFNFK  114

Query  2179  KREKME  2162
             KR K E
Sbjct  115   KRYKTE  120



>ref|XP_008353085.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
[Malus domestica]
Length=1293

 Score =   259 bits (662),  Expect(2) = 5e-104, Method: Compositional matrix adjust.
 Identities = 174/366 (48%), Positives = 234/366 (64%), Gaps = 17/366 (5%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL EVA L G VLQ +  G+E++FI+ I++ I  KL+RT LSV S  VG+ S V  IN
Sbjct  151   RKALAEVADLAGKVLQNQAYGYESKFIKDIVKVIRDKLSRTHLSVESKLVGIHSXVDHIN  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S D G+ V+ GL G+GKTT+AK  YN N + FEGS ++ ++R  +  P+G V +
Sbjct  211   LWLQDPSHDXGILVVYGLPGIGKTTIAKCVYNSNXESFEGSSYVESIRETASHPDGLVQI  270

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQI  +IL G++E I N  EGIIKI  AI  ++V +V DDVD  + LD V+  +D F  
Sbjct  271   QKQILYDILNGKKEKIHNXSEGIIKIGRAISFRRVLLVLDDVDHXDQLDAVLRMKDQFYP  330

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR + LLK HE    +++  L  +ESL+L  ++AFGQD PLE   +YS + ++
Sbjct  331   GSKIIITTRRKRLLKAHEGITVHEVGPLGFDESLELLSQHAFGQDHPLEGYEKYSEEVVQ  390

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             H G LPLALK LGS L G    VW+S LEKLE I + +I   L IS + L DD+D++LF+
Sbjct  391   HSGRLPLALKVLGSSLFGEPKXVWKSTLEKLEXIPNGEIMXKLRISYDSLQDDHDQKLFL  450

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IA                 CD   + GIQNL D  LVT+  D KL M  +I++MG+EI+
Sbjct  451   HIA---------------YGCDFKTICGIQNLRDRCLVTIGRD-KLSMHDVIRDMGREIV  494

Query  1038  RQDSRD  1021
             RQ+S +
Sbjct  495   RQESYE  500


 Score =   149 bits (375),  Expect(2) = 5e-104, Method: Composition-based stats.
 Identities = 86/154 (56%), Positives = 105/154 (68%), Gaps = 6/154 (4%)
 Frame = -1

Query  2569  TQESGISSVPRFFYH--AFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENID  2396
             TQ +   S  R  YH   FLSFRGEDTRK FTDHLYTALI+AG RTFRDDDE+  GE+I 
Sbjct  7     TQGASSDSNTRRGYHYDVFLSFRGEDTRKTFTDHLYTALISAGYRTFRDDDELKTGEDIK  66

Query  2395  AELrrgiresrisiIVFSKDYASSRWCLDELLTILG-RRKSEGHAVFPIFYSVGRADVEK  2219
             + L++ I+ SR S+IVFSKDYASSRWCL+EL+ I+  +R S  H V P+FY V  + V K
Sbjct  67    SGLKQAIQMSRTSVIVFSKDYASSRWCLNELVEIVDHKRASSDHVVIPVFYDVDPSHVRK  126

Query  2218  QSGSFAEAFERHAKREKMEVEEGRVEWKGKGGEV  2117
             Q+GS AEAF  H K E  ++ E    W+    EV
Sbjct  127   QTGSIAEAFAGHRKTEPPDMME---RWRKALAEV  157



>ref|XP_006363487.1| PREDICTED: TMV resistance protein N-like isoform X1 [Solanum 
tuberosum]
Length=1222

 Score =   305 bits (782),  Expect(2) = 6e-104, Method: Compositional matrix adjust.
 Identities = 181/366 (49%), Positives = 252/366 (69%), Gaps = 4/366 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R ALR+VA L GMVLQ + DG E+ FIQ+I++ +V KL RTVLSV  + +G+ SRV +I+
Sbjct  126   RAALRQVADLGGMVLQNQADGSESRFIQEIVKVVVGKLRRTVLSVDPHPIGIDSRVKEID  185

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQ+ S++V +  I G+GG+GKTT+AK+AYNLN+DRFEGS FLA+VR   E  +G   L
Sbjct  186   LWLQEGSNNVDILAIHGMGGIGKTTIAKIAYNLNFDRFEGSSFLADVRKVLEKYDGLARL  245

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  NIL    E I+N +EG +KI++AI  K+V +V DD+D ++ L+ V+G RDWF  
Sbjct  246   QRQLLSNILGKNVEKIYNVNEGSVKIQEAISCKRVLLVLDDIDNIDQLNAVLGMRDWFYP  305

Query  1575  GSKIIITTRCENLLKGHE--RHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKA  1402
             GSKII+TTR  +LL   E  R   YK+K LD +ESL+LF  +AF  + P    M+ ++  
Sbjct  306   GSKIIVTTRNGHLLSSTEACRCRMYKLKTLDAKESLQLFSWHAFRDESPPLEYMDLTIDV  365

Query  1401  IRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRL  1225
             + HC G+PLALK LGS L   S+++W S L KL+ I   KI   L IS   L DD  + L
Sbjct  366   VHHCKGIPLALKVLGSSLGDLSIEIWESALRKLKAIPDSKILEKLRISYECLPDDNVQNL  425

Query  1224  FVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKE  1045
             F+ I C F GKDRD+A+ +L+ C    VVGIQ L+D  L+ +++ NKLM+ QL+Q+MG+E
Sbjct  426   FLDIVCFFAGKDRDYAVTILDGCGFFSVVGIQILVDRCLLAIEH-NKLMVHQLLQDMGRE  484

Query  1044  ILRQDS  1027
             I+R++S
Sbjct  485   IIREES  490


 Score =   102 bits (255),  Expect(2) = 6e-104, Method: Composition-based stats.
 Identities = 62/126 (49%), Positives = 81/126 (64%), Gaps = 9/126 (7%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresri  2360
             +F +H FLSFR     K F DHL+TAL+NAGI +FR DD+      +D +L+  I+ESRI
Sbjct  4     QFVHHVFLSFRS----KTFGDHLHTALLNAGIPSFRPDDK-----ELDKKLQNSIQESRI  54

Query  2359  siIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHA  2180
              I + SKDYASS  CLDEL  ++  +K+ G+ + P+FY V  +DV KQ GSF E F    
Sbjct  55    LIAIISKDYASSYRCLDELTHMIQTKKAFGNFLLPVFYDVDPSDVRKQKGSFEEPFFNFK  114

Query  2179  KREKME  2162
             KR K E
Sbjct  115   KRYKTE  120



>ref|XP_011041388.1| PREDICTED: TMV resistance protein N-like isoform X1 [Populus 
euphratica]
Length=1190

 Score =   251 bits (642),  Expect(2) = 7e-104, Method: Compositional matrix adjust.
 Identities = 151/364 (41%), Positives = 229/364 (63%), Gaps = 4/364 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL+ VA L GM L    DG+EA+F+Q I+ ++  KL+R +  VP + +G    +  IN
Sbjct  178   RIALKNVADLGGMDLG---DGYEAQFVQSIVEKVSMKLDRKIFQVPLHFIGRDLLINCIN  234

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQ+ S    + ++ G+GGVGKT +AK  YN N+ +F G  FL+NVR  S+  NG V L
Sbjct  235   SWLQNGSDGAAIVILYGIGGVGKTAIAKSVYNQNFYKFAGKSFLSNVRERSKESNGVVRL  294

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +IL    + I + DEGIIKI+DA+  ++ FI  DDVD+ E  + ++  R+W  +
Sbjct  295   QRQLLSDILNKIVDEIHDVDEGIIKIEDALCCRRTFITLDDVDKREQFNAIVDMRNWLCQ  354

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKII+TTR ++ +   +  +++K+K LD+E+SL+LF  + FGQ  P+E   + S + + 
Sbjct  355   GSKIIVTTRNKSWITADDEFVEFKVKPLDNEKSLELFSWHTFGQAHPVEDFTDLSWRIVN  414

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HC GLPLA + +GS LS +   VW S L+++E I + ++Q+ L IS + L DDY K LF+
Sbjct  415   HCNGLPLAHRVIGSSLSRKRRQVWESILQEMEVIPNCEVQKVLRISYDSLDDDYQKDLFL  474

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F G D D+   +L+   +     + NLID  L+  D   +L M QLI++MG++I 
Sbjct  475   DIACFFNGMDEDYVSTILDGLGVGATYRVDNLIDRCLLERDQKKRLCMHQLIRDMGRQIA  534

Query  1038  RQDS  1027
             RQ+S
Sbjct  535   RQES  538


 Score =   156 bits (395),  Expect(2) = 7e-104, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 117/175 (67%), Gaps = 5/175 (3%)
 Frame = -1

Query  2680  VLVFLSFVDHSLV*FSTPQPNPYFTFHLV**MEAEARTQESGISSVPRFFYHAFLSFRGE  2501
             VL  LSF+  S+    + +      F +     A  + QES  S   R  Y  FLSFRGE
Sbjct  3     VLFLLSFISCSICSIRSLKSFCSAGFEM-----ASGKYQESSSSRFSRCKYQVFLSFRGE  57

Query  2500  DTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiIVFSKDYASSR  2321
             DTRKNFTDHLYTAL+ A IRTFR+D+EI  GENID EL++ I++S+I+IIVFSK+YASSR
Sbjct  58    DTRKNFTDHLYTALVQARIRTFREDNEIRGGENIDLELQQAIQQSKIAIIVFSKNYASSR  117

Query  2320  WCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKREKMEVE  2156
             WCLDEL+ I+ R ++    VFP+FY V  + V KQ+GSFA AF  H K  K E++
Sbjct  118   WCLDELVMIMERVRTGSCIVFPVFYDVDPSQVRKQTGSFAAAFVEHQKHFKEEMD  172



>ref|XP_011002554.1| PREDICTED: TMV resistance protein N-like isoform X1 [Populus 
euphratica]
 ref|XP_011002555.1| PREDICTED: TMV resistance protein N-like isoform X1 [Populus 
euphratica]
 ref|XP_011002556.1| PREDICTED: TMV resistance protein N-like isoform X1 [Populus 
euphratica]
Length=1136

 Score =   257 bits (656),  Expect(2) = 7e-104, Method: Compositional matrix adjust.
 Identities = 160/365 (44%), Positives = 236/365 (65%), Gaps = 10/365 (3%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL+EVA L GMVL    DG+EA F+Q I+ +++K L++ +  +P + +G    V  IN
Sbjct  148   RIALKEVADLAGMVLG---DGYEAPFVQSIVEKVLKNLDQKMFHLPPHFIGRDPLVQDIN  204

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S    + ++ G+GGVGKTT+AK  +N N+ +FEG  FL+N R+        V L
Sbjct  205   SWLQDGSHGAAIALLYGIGGVGKTTIAKSVFNQNFYKFEGKSFLSNFRSKD-----IVCL  259

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +ILK   + I + DEGI+KIKDAI  ++  IV DDVD+ +  + +IG ++W  +
Sbjct  260   QRQLLSDILKKTIDEINDEDEGILKIKDAICCRRTLIVLDDVDKRDQFNKIIGMQNWLCK  319

Query  1575  GSKIIITTRCENLLKGHE-RHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAI  1399
             GSKII+TTR + L   ++      K+K LD E+SL+LF   AFGQ DP++  +E S + +
Sbjct  320   GSKIIVTTRNKGLFSANDIEWFACKVKLLDIEKSLELFSWNAFGQADPVDGFVEDSWRIV  379

Query  1398  RHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLD-DYDKRLF  1222
             RHC GLPLAL+ +GS LSG+  ++W S L+++E I +  +Q+ L+IS + LD DY K LF
Sbjct  380   RHCNGLPLALRVIGSSLSGKGRELWESALQQMEMIPNFDVQKVLQISYDFLDGDYPKNLF  439

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
             + I+C F G D D A+ +L+  D     GI  LID  LV ++ D +L M QL+++MG+EI
Sbjct  440   LDISCFFNGMDVDDAVRILDGLDKGARFGIDILIDRCLVEINIDKRLWMHQLVRDMGREI  499

Query  1041  LRQDS  1027
              RQ+S
Sbjct  500   ARQES  504


 Score =   150 bits (380),  Expect(2) = 7e-104, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 110/157 (70%), Gaps = 6/157 (4%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A  + QES  S  P   Y  FLSFRG+DTRKNFTDHLYTAL+ AGI TFRDD+EI R EN
Sbjct  2     AAGKYQESYSSRFPDCKYQVFLSFRGQDTRKNFTDHLYTALVGAGIHTFRDDNEIRR-EN  60

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVE  2222
             ID EL++ I++S+ISIIVFSKDYASSRWCLDEL+ I+ R+++    V P+FY V  + V 
Sbjct  61    IDFELQKAIQQSKISIIVFSKDYASSRWCLDELVMIMERKRNADCIVLPVFYDVDPSQVG  120

Query  2221  KQSGSFAEAFERHAK--REKMEVEEGRVEWKGKGGEV  2117
             +Q+GSFA AF  H K   E+ME   G   W+    EV
Sbjct  121   RQTGSFAAAFVEHEKSFNEEMERVNG---WRIALKEV  154



>ref|XP_011041389.1| PREDICTED: TMV resistance protein N-like isoform X2 [Populus 
euphratica]
Length=1189

 Score =   251 bits (641),  Expect(2) = 8e-104, Method: Compositional matrix adjust.
 Identities = 151/364 (41%), Positives = 229/364 (63%), Gaps = 4/364 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL+ VA L GM L    DG+EA+F+Q I+ ++  KL+R +  VP + +G    +  IN
Sbjct  178   RIALKNVADLGGMDLG---DGYEAQFVQSIVEKVSMKLDRKIFQVPLHFIGRDLLINCIN  234

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQ+ S    + ++ G+GGVGKT +AK  YN N+ +F G  FL+NVR  S+  NG V L
Sbjct  235   SWLQNGSDGAAIVILYGIGGVGKTAIAKSVYNQNFYKFAGKSFLSNVRERSKESNGVVRL  294

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +IL    + I + DEGIIKI+DA+  ++ FI  DDVD+ E  + ++  R+W  +
Sbjct  295   QRQLLSDILNKIVDEIHDVDEGIIKIEDALCCRRTFITLDDVDKREQFNAIVDMRNWLCQ  354

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKII+TTR ++ +   +  +++K+K LD+E+SL+LF  + FGQ  P+E   + S + + 
Sbjct  355   GSKIIVTTRNKSWITADDEFVEFKVKPLDNEKSLELFSWHTFGQAHPVEDFTDLSWRIVN  414

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HC GLPLA + +GS LS +   VW S L+++E I + ++Q+ L IS + L DDY K LF+
Sbjct  415   HCNGLPLAHRVIGSSLSRKRRQVWESILQEMEVIPNCEVQKVLRISYDSLDDDYQKDLFL  474

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F G D D+   +L+   +     + NLID  L+  D   +L M QLI++MG++I 
Sbjct  475   DIACFFNGMDEDYVSTILDGLGVGATYRVDNLIDRCLLERDQKKRLCMHQLIRDMGRQIA  534

Query  1038  RQDS  1027
             RQ+S
Sbjct  535   RQES  538


 Score =   156 bits (395),  Expect(2) = 8e-104, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 117/175 (67%), Gaps = 5/175 (3%)
 Frame = -1

Query  2680  VLVFLSFVDHSLV*FSTPQPNPYFTFHLV**MEAEARTQESGISSVPRFFYHAFLSFRGE  2501
             VL  LSF+  S+    + +      F +     A  + QES  S   R  Y  FLSFRGE
Sbjct  3     VLFLLSFISCSICSIRSLKSFCSAGFEM-----ASGKYQESSSSRFSRCKYQVFLSFRGE  57

Query  2500  DTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiIVFSKDYASSR  2321
             DTRKNFTDHLYTAL+ A IRTFR+D+EI  GENID EL++ I++S+I+IIVFSK+YASSR
Sbjct  58    DTRKNFTDHLYTALVQARIRTFREDNEIRGGENIDLELQQAIQQSKIAIIVFSKNYASSR  117

Query  2320  WCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKREKMEVE  2156
             WCLDEL+ I+ R ++    VFP+FY V  + V KQ+GSFA AF  H K  K E++
Sbjct  118   WCLDELVMIMERVRTGSCIVFPVFYDVDPSQVRKQTGSFAAAFVEHQKHFKEEMD  172



>ref|XP_011041390.1| PREDICTED: TMV resistance protein N-like isoform X3 [Populus 
euphratica]
Length=1161

 Score =   251 bits (642),  Expect(2) = 9e-104, Method: Compositional matrix adjust.
 Identities = 151/364 (41%), Positives = 229/364 (63%), Gaps = 4/364 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL+ VA L GM L    DG+EA+F+Q I+ ++  KL+R +  VP + +G    +  IN
Sbjct  149   RIALKNVADLGGMDLG---DGYEAQFVQSIVEKVSMKLDRKIFQVPLHFIGRDLLINCIN  205

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQ+ S    + ++ G+GGVGKT +AK  YN N+ +F G  FL+NVR  S+  NG V L
Sbjct  206   SWLQNGSDGAAIVILYGIGGVGKTAIAKSVYNQNFYKFAGKSFLSNVRERSKESNGVVRL  265

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +IL    + I + DEGIIKI+DA+  ++ FI  DDVD+ E  + ++  R+W  +
Sbjct  266   QRQLLSDILNKIVDEIHDVDEGIIKIEDALCCRRTFITLDDVDKREQFNAIVDMRNWLCQ  325

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKII+TTR ++ +   +  +++K+K LD+E+SL+LF  + FGQ  P+E   + S + + 
Sbjct  326   GSKIIVTTRNKSWITADDEFVEFKVKPLDNEKSLELFSWHTFGQAHPVEDFTDLSWRIVN  385

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HC GLPLA + +GS LS +   VW S L+++E I + ++Q+ L IS + L DDY K LF+
Sbjct  386   HCNGLPLAHRVIGSSLSRKRRQVWESILQEMEVIPNCEVQKVLRISYDSLDDDYQKDLFL  445

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F G D D+   +L+   +     + NLID  L+  D   +L M QLI++MG++I 
Sbjct  446   DIACFFNGMDEDYVSTILDGLGVGATYRVDNLIDRCLLERDQKKRLCMHQLIRDMGRQIA  505

Query  1038  RQDS  1027
             RQ+S
Sbjct  506   RQES  509


 Score =   155 bits (393),  Expect(2) = 9e-104, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 105/142 (74%), Gaps = 0/142 (0%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A  + QES  S   R  Y  FLSFRGEDTRKNFTDHLYTAL+ A IRTFR+D+EI  GEN
Sbjct  2     ASGKYQESSSSRFSRCKYQVFLSFRGEDTRKNFTDHLYTALVQARIRTFREDNEIRGGEN  61

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVE  2222
             ID EL++ I++S+I+IIVFSK+YASSRWCLDEL+ I+ R ++    VFP+FY V  + V 
Sbjct  62    IDLELQQAIQQSKIAIIVFSKNYASSRWCLDELVMIMERVRTGSCIVFPVFYDVDPSQVR  121

Query  2221  KQSGSFAEAFERHAKREKMEVE  2156
             KQ+GSFA AF  H K  K E++
Sbjct  122   KQTGSFAAAFVEHQKHFKEEMD  143



>ref|XP_006388945.1| hypothetical protein POPTR_0069s00220g [Populus trichocarpa]
 gb|ERP47859.1| hypothetical protein POPTR_0069s00220g [Populus trichocarpa]
Length=1130

 Score =   255 bits (652),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 158/365 (43%), Positives = 236/365 (65%), Gaps = 10/365 (3%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL+EVA L GMVL    DG+EA+F+Q I+ ++ K L+R +  VP + +G    V  IN
Sbjct  149   RIALKEVADLAGMVLG---DGYEAQFVQSIVEKVSKNLDRKLFHVPLHFIGRDPLVNYIN  205

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S D  + ++ G+GGVGKTT+AK  +N N  +FEG  FL+N R+        V L
Sbjct  206   SWLQDGSHDAAIAILYGIGGVGKTTIAKSVFNQNIHKFEGKSFLSNFRSKD-----IVCL  260

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +ILK   + I + DEGI+KIKDA+  ++  IV DDVD  +  + +IG ++W  +
Sbjct  261   QRQLLSDILKKTVDEINDEDEGILKIKDALCCRRTLIVLDDVDNRDQFNKIIGMQNWLCK  320

Query  1575  GSKIIITTRCENLLKGHE-RHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAI  1399
             GSKII+TTR + L   ++   ++ K++ LD+E+SL+LF   AFGQ DP++  +E S + +
Sbjct  321   GSKIIVTTRNKGLFSANDIECVECKVEPLDNEKSLELFSWNAFGQADPVDGFVEDSWRIV  380

Query  1398  RHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLD-DYDKRLF  1222
              HC GLPLAL+ +GS LS +  ++W S L+++E I + ++Q+ L IS + LD DY K LF
Sbjct  381   HHCNGLPLALRVIGSSLSRKGREIWESALQQMEVIPNFEVQKVLRISYDFLDGDYPKNLF  440

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
             + IAC F G D D  + +L+  D     GI NLI+  LV ++ D +L M QL++++G+EI
Sbjct  441   LDIACFFNGMDVDDVVRILDGLDKGARFGIDNLINRCLVEINIDRRLWMHQLVRDIGREI  500

Query  1041  LRQDS  1027
              RQ+S
Sbjct  501   ARQES  505


 Score =   152 bits (383),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 106/152 (70%), Gaps = 3/152 (2%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A  + QES  S      Y  FLSFRG DTRKNFTDHLY ALI AGI TFRD DEI RGEN
Sbjct  2     AAGKYQESYSSRFSNCKYQVFLSFRGPDTRKNFTDHLYKALIQAGIHTFRDVDEIRRGEN  61

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVE  2222
             ID EL++ I++S+ISIIVFSKDYASSRWCLDEL+ I+ R++++   V P+FY V  + V 
Sbjct  62    IDFELQKAIQQSKISIIVFSKDYASSRWCLDELVMIMERKRNDDCIVLPVFYDVDPSQVG  121

Query  2221  KQSGSFAEAF---ERHAKREKMEVEEGRVEWK  2135
             +Q+GSFA AF   E+H   EK  V   R+  K
Sbjct  122   RQTGSFAAAFMEHEKHFNEEKERVSGWRIALK  153



>ref|XP_010242715.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nelumbo 
nucifera]
Length=1247

 Score =   256 bits (655),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 162/374 (43%), Positives = 244/374 (65%), Gaps = 4/374 (1%)
 Frame = -2

Query  2109  ALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKINKW  1930
             ALR+ A L G  LQ+  +GHEA+ + +I+ E++ KLN+  L V  + VG+ SRV  +   
Sbjct  142   ALRKAANLSGWDLQKVDNGHEAKCVWRIVEEVLTKLNQVHLDVAVFPVGIDSRVQCVESL  201

Query  1929  LQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGLQK  1750
             L    + V +  I G+GG+GKTTVAK  YNL + +F+GS FL NVR  S+ PNG V LQ 
Sbjct  202   LNVRLNGVCIVGIYGMGGIGKTTVAKAVYNLMFRKFDGSSFLENVREVSKQPNGLVCLQN  261

Query  1749  QIFENILKGREE--IIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+  +IL  +EE   + N D GII I++ +  K+VFIV DDVDQ + L  ++G R WF  
Sbjct  262   QLISDILMDKEEKQYVKNADRGIIVIQERLRRKRVFIVLDDVDQFDQLKALVG-RGWFES  320

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR E+LL   +   +YK KEL+++ES++LF  +AF +D P E  +E S   + 
Sbjct  321   GSKIIITTRDEHLLDILQVDSKYKAKELNNDESIQLFSWHAFKKDHPKEDYVELSTNIVS  380

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYD-KRLFV  1219
             +  GLPLAL+ LGS L G+++  WRS LEK++RI  +++QR L IS + LDDY+ K +F+
Sbjct  381   YVKGLPLALEVLGSSLYGKTLPEWRSALEKIKRIPPNQVQRKLRISFDALDDYELKNIFL  440

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              I C F+G D+++ + +L+ CD     GI  L   SL+T++ +N+L +  L+++MG+ I+
Sbjct  441   DIVCFFLGMDKNYVVKILDGCDFAAEYGIGVLCRRSLLTINKNNELRVHDLLRDMGRTIV  500

Query  1038  RQDSRDDLHTLSKL  997
              ++S +++   S+L
Sbjct  501   HEESLEEIGKCSRL  514


 Score =   150 bits (380),  Expect(2) = 1e-103, Method: Composition-based stats.
 Identities = 80/131 (61%), Positives = 98/131 (75%), Gaps = 0/131 (0%)
 Frame = -1

Query  2551  SSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgir  2372
             SSV R+ Y  FLSFRGEDTRKNFTDHLYTAL  AGI TFRDD+E+ RG+ I +EL+  I 
Sbjct  3     SSVHRWNYDVFLSFRGEDTRKNFTDHLYTALDRAGIYTFRDDEELKRGKEISSELQTAIE  62

Query  2371  esrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAF  2192
             ESRISI+VFS++YASSRWCLDELL IL   ++ G  VFP+FY V  ++V  Q+GSF   F
Sbjct  63    ESRISIVVFSRNYASSRWCLDELLKILYCNETMGQLVFPVFYDVEPSEVRNQTGSFGSGF  122

Query  2191  ERHAKREKMEV  2159
              +  KR K ++
Sbjct  123   SQTKKRFKADM  133



>ref|XP_006370902.1| hypothetical protein POPTR_0019s01570g, partial [Populus trichocarpa]
 gb|ERP48699.1| hypothetical protein POPTR_0019s01570g, partial [Populus trichocarpa]
Length=886

 Score =   261 bits (667),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 161/374 (43%), Positives = 243/374 (65%), Gaps = 1/374 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL E A L G  L+   DGHEA+FI+KI+REI ++L+ T L V  Y VG+  RV ++N
Sbjct  149   RMALTEAANLSGWDLRNVADGHEAKFIKKIVREISRELSSTYLFVAFYPVGINPRVQQLN  208

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               L   SS+V +  I G+GG+GKTT+AK  YN  +  F+G CFLANVR  S+ P+G V L
Sbjct  209   FLLNAGSSEVCIVGIYGMGGIGKTTIAKAMYNELFHSFDGKCFLANVREISQQPDGHVKL  268

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +ILK  +  I N D+G+  IK+ + S+KV ++ DD+D+L+ L  + G+RDWF  
Sbjct  269   QEQLLFDILKTDKIKIGNVDKGMNMIKERLHSRKVLLILDDIDKLDQLQAIAGSRDWFGS  328

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS+II+TTR +++L        Y  +E++D E+L+LF  +AF    P+E   E S + + 
Sbjct  329   GSRIIVTTRDKHVLTVLGADRVYMAREMNDIEALELFSWHAFRTSHPVEDYKELSEQIVD  388

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             +CG LPLAL+ +GS+L GRS+  W+S LEKL RI   +IQ+ L+IS + L DD  K +F+
Sbjct  389   YCGRLPLALEVIGSFLFGRSIVEWKSALEKLRRIPDDQIQKKLQISFDGLNDDTQKDIFL  448

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              I+C+F+G  +++ + +L  CD    +G+  L    LV+V+  NKL+M  L+++MG+EI+
Sbjct  449   DISCYFIGMYKEYVLPILNGCDFFADIGLSVLTQRCLVSVNEKNKLIMHDLLRDMGREIV  508

Query  1038  RQDSRDDLHTLSKL  997
             R  S ++    S+L
Sbjct  509   RAQSPNNPGRRSRL  522


 Score =   145 bits (367),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 104/135 (77%), Gaps = 1/135 (1%)
 Frame = -1

Query  2536  FFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresris  2357
             + Y  FLSFRGEDTRKNFTDHLY A  +AGI TFRDD+E+ RGE+I  EL + I++SRIS
Sbjct  15    WIYDVFLSFRGEDTRKNFTDHLYFAFKDAGINTFRDDNELRRGEDISTELLQAIQKSRIS  74

Query  2356  iIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAK  2177
             +IVFS++YA+SRWCL+EL+ I+  R+S    VFPIFY V  +DV KQ+GSFA+AF  H +
Sbjct  75    VIVFSENYANSRWCLEELVKIMECRRSCRQLVFPIFYDVDPSDVRKQTGSFAKAFAGHEE  134

Query  2176  REKMEVEEGRV-EWK  2135
             R  ++ ++G+V  W+
Sbjct  135   RFVLQTDKGKVATWR  149



>ref|XP_010242716.1| PREDICTED: TMV resistance protein N-like isoform X2 [Nelumbo 
nucifera]
Length=1246

 Score =   256 bits (655),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 162/374 (43%), Positives = 244/374 (65%), Gaps = 4/374 (1%)
 Frame = -2

Query  2109  ALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKINKW  1930
             ALR+ A L G  LQ+  +GHEA+ + +I+ E++ KLN+  L V  + VG+ SRV  +   
Sbjct  142   ALRKAANLSGWDLQKVDNGHEAKCVWRIVEEVLTKLNQVHLDVAVFPVGIDSRVQCVESL  201

Query  1929  LQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGLQK  1750
             L    + V +  I G+GG+GKTTVAK  YNL + +F+GS FL NVR  S+ PNG V LQ 
Sbjct  202   LNVRLNGVCIVGIYGMGGIGKTTVAKAVYNLMFRKFDGSSFLENVREVSKQPNGLVCLQN  261

Query  1749  QIFENILKGREE--IIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+  +IL  +EE   + N D GII I++ +  K+VFIV DDVDQ + L  ++G R WF  
Sbjct  262   QLISDILMDKEEKQYVKNADRGIIVIQERLRRKRVFIVLDDVDQFDQLKALVG-RGWFES  320

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR E+LL   +   +YK KEL+++ES++LF  +AF +D P E  +E S   + 
Sbjct  321   GSKIIITTRDEHLLDILQVDSKYKAKELNNDESIQLFSWHAFKKDHPKEDYVELSTNIVS  380

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYD-KRLFV  1219
             +  GLPLAL+ LGS L G+++  WRS LEK++RI  +++QR L IS + LDDY+ K +F+
Sbjct  381   YVKGLPLALEVLGSSLYGKTLPEWRSALEKIKRIPPNQVQRKLRISFDALDDYELKNIFL  440

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              I C F+G D+++ + +L+ CD     GI  L   SL+T++ +N+L +  L+++MG+ I+
Sbjct  441   DIVCFFLGMDKNYVVKILDGCDFAAEYGIGVLCRRSLLTINKNNELRVHDLLRDMGRTIV  500

Query  1038  RQDSRDDLHTLSKL  997
              ++S +++   S+L
Sbjct  501   HEESLEEIGKCSRL  514


 Score =   150 bits (380),  Expect(2) = 1e-103, Method: Composition-based stats.
 Identities = 80/131 (61%), Positives = 98/131 (75%), Gaps = 0/131 (0%)
 Frame = -1

Query  2551  SSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgir  2372
             SSV R+ Y  FLSFRGEDTRKNFTDHLYTAL  AGI TFRDD+E+ RG+ I +EL+  I 
Sbjct  3     SSVHRWNYDVFLSFRGEDTRKNFTDHLYTALDRAGIYTFRDDEELKRGKEISSELQTAIE  62

Query  2371  esrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAF  2192
             ESRISI+VFS++YASSRWCLDELL IL   ++ G  VFP+FY V  ++V  Q+GSF   F
Sbjct  63    ESRISIVVFSRNYASSRWCLDELLKILYCNETMGQLVFPVFYDVEPSEVRNQTGSFGSGF  122

Query  2191  ERHAKREKMEV  2159
              +  KR K ++
Sbjct  123   SQTKKRFKADM  133



>ref|XP_002316572.2| hypothetical protein POPTR_0011s01695g [Populus trichocarpa]
 gb|EEE97184.2| hypothetical protein POPTR_0011s01695g [Populus trichocarpa]
Length=950

 Score =   251 bits (642),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 155/363 (43%), Positives = 233/363 (64%), Gaps = 10/363 (3%)
 Frame = -2

Query  2109  ALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKINKW  1930
             AL+EVA L GMVL    DG+EA F+Q I+ +++K L++ +  VP + +G    V  IN W
Sbjct  151   ALKEVADLAGMVLG---DGYEAPFVQSIVEKVLKNLDQKMFHVPPHFIGRDPLVQDINSW  207

Query  1929  LQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGLQK  1750
             LQD S    + ++ G+GGVGKT +AK  YN N+ +FEG  FL+N R+        V LQ+
Sbjct  208   LQDGSHGAAIALLYGIGGVGKTAIAKSVYNQNFYKFEGKSFLSNFRSKD-----IVCLQR  262

Query  1749  QIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSRGS  1570
             Q+  +ILK   + I + DEGI+KIKDA+  ++  IV DDV + +  + ++G ++W  +GS
Sbjct  263   QLLSDILKKTVDEINDEDEGILKIKDALCCRRTLIVLDDVHKRDQFNKIVGMQNWLCKGS  322

Query  1569  KIIITTRCENLLKGHE-RHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIRH  1393
             KII+TTR + L   ++ +    K+K LD E+SL+LF   AFGQ DP++  +E S++ + H
Sbjct  323   KIIVTTRNKGLFLANDIKWFDCKVKLLDIEKSLELFSWNAFGQADPVDGFVEDSLRIVHH  382

Query  1392  CGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLD-DYDKRLFVL  1216
             C  LPLAL+ +GS LSG+  ++W   L+++E I + ++Q+ L IS + LD DY K LF+ 
Sbjct  383   CNRLPLALRVIGSSLSGKGREIWERALQQMEVIPNFEVQKVLRISYDFLDGDYPKNLFLD  442

Query  1215  IACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEILR  1036
             IAC F G D D A+ +L+  D     GI NLI+  LV ++ D +L M QL+++MG+EI R
Sbjct  443   IACFFNGIDVDDAVRILDGIDKGARFGIDNLINRCLVEINIDKRLWMHQLVRHMGREIAR  502

Query  1035  QDS  1027
             Q+S
Sbjct  503   QES  505


 Score =   155 bits (391),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A    QES  S  P   Y  FLSFRG+DTRKNFTDHLYTAL+ AGI TFRD +EI RGEN
Sbjct  2     AAGNYQESYSSRFPNCKYQVFLSFRGKDTRKNFTDHLYTALVQAGIHTFRDGNEIWRGEN  61

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVE  2222
             ID EL++ I++S+ISIIVFSKDYASSRWCLDEL+ I+ R+++    V P+FY V  + V 
Sbjct  62    IDVELQKAIQQSKISIIVFSKDYASSRWCLDELVMIMERKRNADCIVLPVFYDVDPSQVG  121

Query  2221  KQSGSFAEAFERHAKREKMEVE  2156
             +Q+GSF+ AF  H K    E+E
Sbjct  122   RQTGSFSAAFVEHEKSFNEEIE  143



>ref|XP_010315689.1| PREDICTED: TMV resistance protein N-like isoform X2 [Solanum 
lycopersicum]
Length=1218

 Score =   272 bits (696),  Expect(2) = 3e-103, Method: Compositional matrix adjust.
 Identities = 181/421 (43%), Positives = 261/421 (62%), Gaps = 14/421 (3%)
 Frame = -2

Query  2115  REALREVA--GLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGK  1942
             R ALREVA     GMVLQ      E  FI+K+++    K+NR++LSV  Y +G+  RV  
Sbjct  154   RAALREVADQSGSGMVLQSSSKETELRFIEKLVKVTENKVNRSILSVAPYLIGMHFRVNN  213

Query  1941  INKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQV  1762
             I  WLQ ++ DVG+  ICG+GG+GKTT+AK A+N N++ FE S FL NVR  SE  +G +
Sbjct  214   ICLWLQHKTHDVGIWGICGMGGIGKTTIAKYAFNSNFESFERSSFLYNVRDFSESTDGLI  273

Query  1761  GLQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWF  1582
              LQKQ   +IL GR+  I + ++G+ +IK A+  K+V IV DDVD++E L  ++G RDWF
Sbjct  274   YLQKQFLCDILDGRKIDIQSVEDGMNQIKSAVYGKRVLIVLDDVDEVEQLAAIVGMRDWF  333

Query  1581  SRGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKA  1402
               GSKII+TTR   LL+  E  L   +++L   ES++LF  +AFGQD P+E+  ++  + 
Sbjct  334   YSGSKIIVTTRHIELLRACEIELIDHVQKLSLGESVELFSWHAFGQDHPVENYTKFLTRI  393

Query  1401  IRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRL  1225
             I +C G PLAL+ LGS LSG+S+DVW S L+KLE I + K+ + L+IS   + DD+DK L
Sbjct  394   IEYCIGCPLALQVLGSSLSGKSLDVWESTLKKLEAIPNSKVSKKLQISFEFIQDDHDKSL  453

Query  1224  FVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKE  1045
             F+ IA  F+GK+ D  + +L  C  + +VG+QNL D  L+ +D   KL M  L+++MG+E
Sbjct  454   FLDIASFFLGKNVDHVVTILNACGYYTMVGLQNLRDRFLLIIDEYGKLRMHPLVRDMGRE  513

Query  1044  ILRQDSRDDLHTLSKLL---DQLVSSTESTGNGVVN----ESASHVNSPKR----PYSQE  898
             I+RQ+S       S+L    D      E  G  ++      S +H + P R    P + E
Sbjct  514   IIRQESPKHPERRSRLWHFKDSFNVLREKIGTDMIRGLNVRSCAHKDKPPRFFYHPTAHE  573

Query  897   F  895
             +
Sbjct  574   Y  574


 Score =   133 bits (335),  Expect(2) = 3e-103, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 88/122 (72%), Gaps = 0/122 (0%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresri  2360
             R  Y  F+SFRGEDTRK FTD LY AL++ G RTFRDD+EI RGE+I +EL + I  S+ 
Sbjct  15    RCMYDVFMSFRGEDTRKTFTDELYKALVDEGYRTFRDDNEIERGEDIKSELDKAIHSSKS  74

Query  2359  siIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHA  2180
             SII+ SK+YA+S WCLDEL+ IL  ++  GHA+ P+FY V   DV KQ GSFA AF  H 
Sbjct  75    SIIILSKNYATSSWCLDELVMILENKRKRGHAILPVFYYVDPLDVGKQMGSFATAFATHE  134

Query  2179  KR  2174
             +R
Sbjct  135   QR  136



>ref|XP_010315688.1| PREDICTED: TMV resistance protein N-like isoform X1 [Solanum 
lycopersicum]
Length=1222

 Score =   272 bits (695),  Expect(2) = 4e-103, Method: Compositional matrix adjust.
 Identities = 181/421 (43%), Positives = 261/421 (62%), Gaps = 14/421 (3%)
 Frame = -2

Query  2115  REALREVA--GLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGK  1942
             R ALREVA     GMVLQ      E  FI+K+++    K+NR++LSV  Y +G+  RV  
Sbjct  154   RAALREVADQSGSGMVLQSSSKETELRFIEKLVKVTENKVNRSILSVAPYLIGMHFRVNN  213

Query  1941  INKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQV  1762
             I  WLQ ++ DVG+  ICG+GG+GKTT+AK A+N N++ FE S FL NVR  SE  +G +
Sbjct  214   ICLWLQHKTHDVGIWGICGMGGIGKTTIAKYAFNSNFESFERSSFLYNVRDFSESTDGLI  273

Query  1761  GLQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWF  1582
              LQKQ   +IL GR+  I + ++G+ +IK A+  K+V IV DDVD++E L  ++G RDWF
Sbjct  274   YLQKQFLCDILDGRKIDIQSVEDGMNQIKSAVYGKRVLIVLDDVDEVEQLAAIVGMRDWF  333

Query  1581  SRGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKA  1402
               GSKII+TTR   LL+  E  L   +++L   ES++LF  +AFGQD P+E+  ++  + 
Sbjct  334   YSGSKIIVTTRHIELLRACEIELIDHVQKLSLGESVELFSWHAFGQDHPVENYTKFLTRI  393

Query  1401  IRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRL  1225
             I +C G PLAL+ LGS LSG+S+DVW S L+KLE I + K+ + L+IS   + DD+DK L
Sbjct  394   IEYCIGCPLALQVLGSSLSGKSLDVWESTLKKLEAIPNSKVSKKLQISFEFIQDDHDKSL  453

Query  1224  FVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKE  1045
             F+ IA  F+GK+ D  + +L  C  + +VG+QNL D  L+ +D   KL M  L+++MG+E
Sbjct  454   FLDIASFFLGKNVDHVVTILNACGYYTMVGLQNLRDRFLLIIDEYGKLRMHPLVRDMGRE  513

Query  1044  ILRQDSRDDLHTLSKLL---DQLVSSTESTGNGVVN----ESASHVNSPKR----PYSQE  898
             I+RQ+S       S+L    D      E  G  ++      S +H + P R    P + E
Sbjct  514   IIRQESPKHPERRSRLWHFKDSFNVLREKIGTDMIRGLNVRSCAHKDKPPRFFYHPTAHE  573

Query  897   F  895
             +
Sbjct  574   Y  574


 Score =   133 bits (335),  Expect(2) = 4e-103, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 88/122 (72%), Gaps = 0/122 (0%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresri  2360
             R  Y  F+SFRGEDTRK FTD LY AL++ G RTFRDD+EI RGE+I +EL + I  S+ 
Sbjct  15    RCMYDVFMSFRGEDTRKTFTDELYKALVDEGYRTFRDDNEIERGEDIKSELDKAIHSSKS  74

Query  2359  siIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHA  2180
             SII+ SK+YA+S WCLDEL+ IL  ++  GHA+ P+FY V   DV KQ GSFA AF  H 
Sbjct  75    SIIILSKNYATSSWCLDELVMILENKRKRGHAILPVFYYVDPLDVGKQMGSFATAFATHE  134

Query  2179  KR  2174
             +R
Sbjct  135   QR  136



>ref|XP_011002553.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=1129

 Score =   254 bits (648),  Expect(2) = 8e-103, Method: Compositional matrix adjust.
 Identities = 159/365 (44%), Positives = 234/365 (64%), Gaps = 11/365 (3%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL+EVA L GM L    DGHEA+F+Q I++ + K L+  +  VP + +G  + V  IN
Sbjct  149   RIALKEVANLAGMDLG---DGHEAQFVQSIVKNVSKNLDPKIFYVPLHFIGRDALVQDIN  205

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S    + ++ G+GGVGKT +AK  +N NY +FEG  FL+N R+        V L
Sbjct  206   SWLQDGSHGAAIALLYGIGGVGKTAIAKSVFNQNYYKFEGKSFLSNFRSKD-----IVCL  260

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +IL    EI  + DEGI+KIKDA+  ++  IV DDVD+ +  + +IG ++W  +
Sbjct  261   QRQLLFDILNKTVEIN-DPDEGILKIKDALCCRRTLIVLDDVDKRDQFNKIIGMQNWLCK  319

Query  1575  GSKIIITTRCENLLKGHE-RHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAI  1399
             GSKII+TTR + L   ++   ++ K++ LDDE+SL+LF   AFGQ DP++  +E S + +
Sbjct  320   GSKIIVTTRNKGLFSANDIAGVRCKVEPLDDEKSLELFSWNAFGQADPVDGFVEDSWRIV  379

Query  1398  RHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLD-DYDKRLF  1222
              HC GLPLAL  +GS LSG+  ++W S L+++E I + ++ + L IS + LD DY K LF
Sbjct  380   HHCNGLPLALGVIGSSLSGKEREIWESALQQMEVIPNFEVHKVLRISYDFLDGDYPKNLF  439

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
             + IAC F G D D A+ +L+  D     GI NLID  LV ++ D +L M QL+++MG+EI
Sbjct  440   LDIACFFNGMDVDDAVRILDGLDKGARFGIDNLIDRCLVEINGDQRLWMHQLVRDMGREI  499

Query  1041  LRQDS  1027
              R++S
Sbjct  500   ARRES  504


 Score =   150 bits (380),  Expect(2) = 8e-103, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A  + QES  S      Y  FLSFRGEDTRKNFTDHLY AL++AG  TFRDDD I RG+N
Sbjct  2     AAGKYQESYSSRFANCKYQVFLSFRGEDTRKNFTDHLYKALVDAGFHTFRDDDGIRRGKN  61

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVE  2222
             I  EL++ I++S+I+IIVFSK+YASSRWCLDEL+ I+ R+++    VFP+FY V  ++V 
Sbjct  62    IQLELQKAIQQSKIAIIVFSKNYASSRWCLDELVMIMERKRNADCIVFPVFYHVDPSEVR  121

Query  2221  KQSGSFAEAFERHAKREKMEVE  2156
              Q+GSFA AF  H K  K E+E
Sbjct  122   NQTGSFAAAFVEHEKHYKEEME  143



>ref|XP_008244976.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1135

 Score =   270 bits (689),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 165/373 (44%), Positives = 239/373 (64%), Gaps = 2/373 (1%)
 Frame = -2

Query  2109  ALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKINKW  1930
             AL E A L G  L+   DGHEA FI+KII EI ++LN   L V  Y VG+ SRV  ++ +
Sbjct  146   ALTEAANLSGWDLRNTADGHEARFIRKIIAEITRQLNNAYLFVAVYPVGINSRVEDMSSY  205

Query  1929  LQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGLQK  1750
             L   S+D+ +  I G+GG+GKTT+AK  YN  Y  FEG  F+A+VR  S+ PNGQV LQ+
Sbjct  206   LGVGSNDIRMVGILGMGGLGKTTIAKAIYNQFYHSFEGKSFVADVRETSKQPNGQVRLQE  265

Query  1749  QIFENILKGREEI-IFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSRG  1573
             Q+  ++LK  ++I +   D+GI  IK+ +G +KV ++ DD DQ+E L  + G RDWF  G
Sbjct  266   QLLSDVLKPAKKIKVGCVDKGINIIKERLGCRKVLVIIDDADQMEQLRAIAGKRDWFGSG  325

Query  1572  SKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIRH  1393
             S+IIITTR ++LLK  E    +   E+++EE+L+LF  +AF    P E  ++ S   + +
Sbjct  326   SRIIITTRDQHLLKQLEVDTVFLAPEMNEEEALELFSWHAFRNSYPNEGYLDLSTSVVSY  385

Query  1392  CGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFVL  1216
             CGGLPLAL+ LGS+L GRS+  W S LEKL+RI H +IQ+ L IS + L DD  + +F+ 
Sbjct  386   CGGLPLALEVLGSFLFGRSIPEWTSALEKLKRIPHDQIQKKLRISFDGLSDDKQRDIFLD  445

Query  1215  IACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEILR  1036
             I+C F+GKD+++   +L+ C     + I  L+   LVTV   NKL M  L+++MG+E++R
Sbjct  446   ISCFFIGKDKNYVKQILDGCGFFAEIEISVLLQRCLVTVSERNKLTMHDLLRDMGREVVR  505

Query  1035  QDSRDDLHTLSKL  997
             + S  +    S+L
Sbjct  506   EKSPKEPGKCSRL  518


 Score =   134 bits (337),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 99/143 (69%), Gaps = 2/143 (1%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A + TQES  S   ++ Y  FLSFRGEDTRKNFT HLY AL  AGI  F DD+E+ RGE+
Sbjct  2     ATSTTQESFSSK--QWIYDVFLSFRGEDTRKNFTGHLYMALKEAGINAFIDDNELRRGED  59

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVE  2222
             I AEL + I+ SRIS+IVFS+ YA S WCL+EL+ I+  R++    V PIFY V  +DV 
Sbjct  60    ITAELVQAIQGSRISVIVFSRRYADSGWCLEELVKIMECRRTVRQMVLPIFYDVDPSDVR  119

Query  2221  KQSGSFAEAFERHAKREKMEVEE  2153
             KQ+G F +AFE+H +R    V++
Sbjct  120   KQNGCFGQAFEKHEERVLFAVDK  142



>ref|XP_011012496.1| PREDICTED: TMV resistance protein N-like isoform X2 [Populus 
euphratica]
Length=1109

 Score =   246 bits (628),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/365 (43%), Positives = 232/365 (64%), Gaps = 11/365 (3%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL+EVA L GM L    DG+EA+F+Q I+  + K L+  +  VP + +G  + V  IN
Sbjct  149   RIALKEVANLAGMDLG---DGYEAQFVQSIMENVSKNLDPKIFYVPLHFIGRDALVQDIN  205

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S    + ++ G+GGVGKT +AK  +N NY +FEG  FL+N R+        V L
Sbjct  206   SWLQDGSHGAAIALLYGIGGVGKTAIAKSVFNQNYYKFEGKSFLSNFRSKD-----IVCL  260

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +IL    EI  + DEGI+KIKDA+  ++  IV DDVD+ +  + +   ++W  +
Sbjct  261   QRQLLFDILNKTVEIN-DPDEGILKIKDALCCRRTLIVLDDVDKRDQFNKISVMQNWLCK  319

Query  1575  GSKIIITTRCENLLKGHE-RHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAI  1399
             GSKII+TTR + L   ++ + + YK++ LDDE+SL+LF   AFGQ +P++  +E S + +
Sbjct  320   GSKIILTTRNKGLFSANDIQWIGYKVELLDDEKSLELFSWNAFGQANPVDGFVEDSWRIV  379

Query  1398  RHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLD-DYDKRLF  1222
              HC GLPLAL  +GS LSG+  ++W S L+++E I + ++ + L IS + LD DY K LF
Sbjct  380   HHCNGLPLALGVIGSSLSGKEREIWESALQQMEVIPNFEVHKVLRISYDFLDGDYPKNLF  439

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
             + IAC F G D D A+ +L+  D     GI NLID  L+ ++ D +L M QL+++MG+EI
Sbjct  440   LDIACFFNGMDVDDAVRILDGLDKGARFGIDNLIDRCLIEINGDQRLWMHQLVRDMGREI  499

Query  1041  LRQDS  1027
              RQ+S
Sbjct  500   ARQES  504


 Score =   157 bits (398),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 104/142 (73%), Gaps = 0/142 (0%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A  + QES  S  P   Y  FLSFRGEDTRKNFTDHLY AL+ AG  TFRDDDEI RGEN
Sbjct  2     AAGKYQESYSSRFPNCKYQVFLSFRGEDTRKNFTDHLYWALVQAGFHTFRDDDEIRRGEN  61

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVE  2222
             I+ EL++ I+ES+ISIIVFSK YASSRWCLDEL+ I+ R+++    VFP+FY V  ++V 
Sbjct  62    IELELQKAIQESKISIIVFSKGYASSRWCLDELVMIMERKRNADCIVFPVFYHVDPSEVR  121

Query  2221  KQSGSFAEAFERHAKREKMEVE  2156
              Q+GSFA AF  H K  K EVE
Sbjct  122   NQTGSFATAFVEHEKHYKDEVE  143



>ref|XP_011012495.1| PREDICTED: TMV resistance protein N-like isoform X1 [Populus 
euphratica]
Length=1122

 Score =   246 bits (628),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/365 (43%), Positives = 232/365 (64%), Gaps = 11/365 (3%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL+EVA L GM L    DG+EA+F+Q I+  + K L+  +  VP + +G  + V  IN
Sbjct  162   RIALKEVANLAGMDLG---DGYEAQFVQSIMENVSKNLDPKIFYVPLHFIGRDALVQDIN  218

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S    + ++ G+GGVGKT +AK  +N NY +FEG  FL+N R+        V L
Sbjct  219   SWLQDGSHGAAIALLYGIGGVGKTAIAKSVFNQNYYKFEGKSFLSNFRSKD-----IVCL  273

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +IL    EI  + DEGI+KIKDA+  ++  IV DDVD+ +  + +   ++W  +
Sbjct  274   QRQLLFDILNKTVEIN-DPDEGILKIKDALCCRRTLIVLDDVDKRDQFNKISVMQNWLCK  332

Query  1575  GSKIIITTRCENLLKGHE-RHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAI  1399
             GSKII+TTR + L   ++ + + YK++ LDDE+SL+LF   AFGQ +P++  +E S + +
Sbjct  333   GSKIILTTRNKGLFSANDIQWIGYKVELLDDEKSLELFSWNAFGQANPVDGFVEDSWRIV  392

Query  1398  RHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLD-DYDKRLF  1222
              HC GLPLAL  +GS LSG+  ++W S L+++E I + ++ + L IS + LD DY K LF
Sbjct  393   HHCNGLPLALGVIGSSLSGKEREIWESALQQMEVIPNFEVHKVLRISYDFLDGDYPKNLF  452

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
             + IAC F G D D A+ +L+  D     GI NLID  L+ ++ D +L M QL+++MG+EI
Sbjct  453   LDIACFFNGMDVDDAVRILDGLDKGARFGIDNLIDRCLIEINGDQRLWMHQLVRDMGREI  512

Query  1041  LRQDS  1027
              RQ+S
Sbjct  513   ARQES  517


 Score =   157 bits (398),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 104/142 (73%), Gaps = 0/142 (0%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A  + QES  S  P   Y  FLSFRGEDTRKNFTDHLY AL+ AG  TFRDDDEI RGEN
Sbjct  15    AAGKYQESYSSRFPNCKYQVFLSFRGEDTRKNFTDHLYWALVQAGFHTFRDDDEIRRGEN  74

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVE  2222
             I+ EL++ I+ES+ISIIVFSK YASSRWCLDEL+ I+ R+++    VFP+FY V  ++V 
Sbjct  75    IELELQKAIQESKISIIVFSKGYASSRWCLDELVMIMERKRNADCIVFPVFYHVDPSEVR  134

Query  2221  KQSGSFAEAFERHAKREKMEVE  2156
              Q+GSFA AF  H K  K EVE
Sbjct  135   NQTGSFATAFVEHEKHYKDEVE  156



>ref|XP_006377439.1| hypothetical protein POPTR_0011s05930g [Populus trichocarpa]
 gb|ERP55236.1| hypothetical protein POPTR_0011s05930g [Populus trichocarpa]
Length=1096

 Score =   257 bits (656),  Expect(2) = 3e-102, Method: Compositional matrix adjust.
 Identities = 161/365 (44%), Positives = 235/365 (64%), Gaps = 10/365 (3%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL+EVA L GM L    DG+EA+F+Q I+ ++ KKL++ +  +P   +G    V  IN
Sbjct  149   RIALKEVADLAGMDLG---DGYEAQFVQSIVEKVSKKLDQKMFHLPLRFIGRDPLVNYIN  205

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S D  + ++ G+GGVGKTT+AK   N N  +FEG  FL+N R+        V L
Sbjct  206   SWLQDGSHDAAIAILYGIGGVGKTTIAKSVLNQNIRKFEGKSFLSNFRSKD-----IVCL  260

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +ILK   + I + DEGI+KIKDA+  ++  IV DDVD+ +  + +IG ++W  +
Sbjct  261   QRQLLSDILKKTVDEINDEDEGILKIKDALCCRRTLIVLDDVDKRDQFNKIIGMQNWLCK  320

Query  1575  GSKIIITTRCENLLKGHE-RHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAI  1399
             GSKII+TTR + L   ++ + ++ K++ LDDE+SL+LF   AFGQ DP++  +E S + +
Sbjct  321   GSKIIVTTRNKGLFSANDTKWVRCKVEPLDDEKSLELFSWNAFGQADPVDGFVEDSWRIV  380

Query  1398  RHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLD-DYDKRLF  1222
             RHC GLPLAL  +GS LSG+  ++W S L+++E I + ++Q+ L IS + LD DY K L 
Sbjct  381   RHCNGLPLALGVIGSSLSGKGREIWESALQQIEVIPNFEVQKVLRISYDFLDGDYPKNLL  440

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
             + IAC F G D D  + +L+  D     GI NLID  LV +  D +L M QL+++MGKEI
Sbjct  441   IDIACFFNGMDVDDVVRILDGLDKGARFGIDNLIDRCLVEISIDQRLWMHQLVRDMGKEI  500

Query  1041  LRQDS  1027
              RQ+S
Sbjct  501   ARQES  505


 Score =   145 bits (367),  Expect(2) = 3e-102, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 105/145 (72%), Gaps = 6/145 (4%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFF---YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGR  2411
             A  + QES  S   RFF   Y  FLSFRGEDTR NFTDHLY AL+ AGI TFRDDDEI  
Sbjct  2     AAGKYQESYSS---RFFNCKYQVFLSFRGEDTRNNFTDHLYKALVQAGIHTFRDDDEIRI  58

Query  2410  GENIDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRA  2231
             GENI+ EL++ I++S+ISIIVFSK+YA SRWCLDEL+ I+ R+++    V+P+FY V  +
Sbjct  59    GENIELELQKAIQQSKISIIVFSKNYAWSRWCLDELVKIMERKRNAACIVYPVFYHVDPS  118

Query  2230  DVEKQSGSFAEAFERHAKREKMEVE  2156
             +V  Q+GSFA AF    KR K E++
Sbjct  119   EVRNQTGSFAVAFVEQDKRFKEEMD  143



>gb|KDP34368.1| hypothetical protein JCGZ_11251 [Jatropha curcas]
Length=912

 Score =   255 bits (652),  Expect(2) = 3e-102, Method: Compositional matrix adjust.
 Identities = 160/364 (44%), Positives = 232/364 (64%), Gaps = 1/364 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL +   L G  LQ   +GHE++FI+KI+ +++ KLN     V  + VG+ SRV  + 
Sbjct  146   RVALEDAGKLSGFALQNMENGHESKFIEKIVEDVLSKLNYNYFDVAKHPVGIDSRVTDVI  205

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               L  + +DV +  I G+GG+GKTT+AK  +N     FEGS FL NVR  SE  NG V L
Sbjct  206   SLLSLDINDVSIVGIHGMGGIGKTTIAKAVFNHLCHGFEGSSFLLNVREVSEQTNGLVKL  265

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+  + LK  +  I+N D GI  IK  + +++V +V DD+DQLE LD ++G  +WF  
Sbjct  266   QKQLLSDTLKSNKFKIYNIDSGISLIKQRLCAERVLVVLDDLDQLEQLDALVGEGNWFGL  325

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS+IIITTR E+LL   E   +YK+  L+ +ESL+LF ++AF +  PLE  ++ S   + 
Sbjct  326   GSRIIITTRDEHLLAQLELVEKYKVNILNRDESLQLFSKHAFKKTHPLEEYVDLSNSVVD  385

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYD-KRLFV  1219
             + GGLPL L+ LGSYL  R++  W S ++KL +I H +IQ+ L IS + LDD   K +F+
Sbjct  386   YVGGLPLGLEVLGSYLCNRTIPEWESAVQKLRKIPHWQIQKKLRISFDTLDDDKVKDIFL  445

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F  KD+D  + +LE C   P +GI  LI  SL+T+D +N+L+M  L+++MG+EI+
Sbjct  446   DIACFFTCKDKDSVLKILEDCGFFPEIGISVLIQRSLLTIDYENRLIMHDLLRDMGREII  505

Query  1038  RQDS  1027
             R+ S
Sbjct  506   REMS  509


 Score =   147 bits (370),  Expect(2) = 3e-102, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 102/130 (78%), Gaps = 1/130 (1%)
 Frame = -1

Query  2524  AFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiIVF  2345
              FLSFRGEDTRK+FTDH+YTAL+ +GIRTFRDDDE+ RGE+I + L + I++SRIS+IVF
Sbjct  18    VFLSFRGEDTRKSFTDHVYTALVRSGIRTFRDDDELRRGEDISSALIKAIQQSRISLIVF  77

Query  2344  SKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKREKM  2165
             SK YASSRWCLDE+  I+  + + G  V PIFY V  +DV +Q+G F +AF+RH KR + 
Sbjct  78    SKRYASSRWCLDEVTEIINCKNTIGQIVIPIFYDVDPSDVRRQTGPFQQAFDRHEKRFRE  137

Query  2164  EVEEGRVEWK  2135
             E+E+ + +W+
Sbjct  138   EMEKVK-KWR  146



>ref|XP_006377253.1| hypothetical protein POPTR_0011s03000g [Populus trichocarpa]
 gb|ERP55050.1| hypothetical protein POPTR_0011s03000g [Populus trichocarpa]
Length=926

 Score =   248 bits (632),  Expect(2) = 4e-102, Method: Compositional matrix adjust.
 Identities = 156/363 (43%), Positives = 232/363 (64%), Gaps = 11/363 (3%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL+EVA L GMVL    DG+EA+F+Q I+ ++ KKL++ +  VP + +G    V  IN
Sbjct  149   RIALKEVADLAGMVLG---DGYEAQFVQSIVEKVSKKLDQKMFHVPLHFIGRDPLVNYIN  205

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S D  + ++ G+GGVGKTT+AK  +N N  +FEG  FL+N R+        V L
Sbjct  206   SWLQDGSHDAAIVILYGIGGVGKTTIAKSVFNQNIHKFEGKSFLSNFRSKD-----IVCL  260

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+   ILK     I + DEGI+KIKDA+  ++  IV DDVD+ +  + +IG ++W  +
Sbjct  261   QRQLLSVILKKTVVEINDEDEGILKIKDALCCRRTLIVLDDVDKRDQFNKIIGVQNWLCK  320

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKII+T+R +         ++ K++ LDDE+SL+LF   AFGQ +P++  +E S + + 
Sbjct  321   GSKIIVTSRNK---ANDIEWVRCKVEPLDDEKSLELFSWNAFGQANPVDGFVEDSWRIVH  377

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFVL  1216
             HC GLPLAL  +GS LSG+  ++W S L+++E I + ++Q+ L I+ + LD+Y   LF+ 
Sbjct  378   HCNGLPLALGFIGSSLSGKGREIWESALQQMEVIPNFEVQKVLRITYDFLDNYLMNLFLD  437

Query  1215  IACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEILR  1036
             IA  F G D D A+ +L+  D     GI NLID  LV ++ D +L M QL+++MG+EI R
Sbjct  438   IAYFFYGMDVDDAVRILDGLDKGARFGIDNLIDRCLVEINIDQRLWMHQLVRDMGREIAR  497

Query  1035  QDS  1027
             Q+S
Sbjct  498   QES  500


 Score =   154 bits (389),  Expect(2) = 4e-102, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 101/135 (75%), Gaps = 0/135 (0%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A  + QES  S      Y  FLSFRGEDTRKNFTDHLY AL++AGI TFRDDDEI RGEN
Sbjct  2     APGKYQESYSSRFSNCKYQVFLSFRGEDTRKNFTDHLYKALVDAGIHTFRDDDEIQRGEN  61

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVE  2222
             ID EL++ I++S+ISIIVF KDYASSRWCLDEL+ I+ R++++   V P+FY V  + V 
Sbjct  62    IDFELQKAIQQSKISIIVFFKDYASSRWCLDELVMIMERKRNDDCIVLPVFYDVDPSQVG  121

Query  2221  KQSGSFAEAFERHAK  2177
             +Q+GSFA AF  H K
Sbjct  122   RQTGSFAAAFVEHEK  136



>ref|XP_010242717.1| PREDICTED: TMV resistance protein N-like isoform X3 [Nelumbo 
nucifera]
Length=1069

 Score =   257 bits (657),  Expect(2) = 7e-102, Method: Compositional matrix adjust.
 Identities = 162/374 (43%), Positives = 244/374 (65%), Gaps = 4/374 (1%)
 Frame = -2

Query  2109  ALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKINKW  1930
             ALR+ A L G  LQ+  +GHEA+ + +I+ E++ KLN+  L V  + VG+ SRV  +   
Sbjct  142   ALRKAANLSGWDLQKVDNGHEAKCVWRIVEEVLTKLNQVHLDVAVFPVGIDSRVQCVESL  201

Query  1929  LQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGLQK  1750
             L    + V +  I G+GG+GKTTVAK  YNL + +F+GS FL NVR  S+ PNG V LQ 
Sbjct  202   LNVRLNGVCIVGIYGMGGIGKTTVAKAVYNLMFRKFDGSSFLENVREVSKQPNGLVCLQN  261

Query  1749  QIFENILKGREE--IIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+  +IL  +EE   + N D GII I++ +  K+VFIV DDVDQ + L  ++G R WF  
Sbjct  262   QLISDILMDKEEKQYVKNADRGIIVIQERLRRKRVFIVLDDVDQFDQLKALVG-RGWFES  320

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR E+LL   +   +YK KEL+++ES++LF  +AF +D P E  +E S   + 
Sbjct  321   GSKIIITTRDEHLLDILQVDSKYKAKELNNDESIQLFSWHAFKKDHPKEDYVELSTNIVS  380

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYD-KRLFV  1219
             +  GLPLAL+ LGS L G+++  WRS LEK++RI  +++QR L IS + LDDY+ K +F+
Sbjct  381   YVKGLPLALEVLGSSLYGKTLPEWRSALEKIKRIPPNQVQRKLRISFDALDDYELKNIFL  440

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              I C F+G D+++ + +L+ CD     GI  L   SL+T++ +N+L +  L+++MG+ I+
Sbjct  441   DIVCFFLGMDKNYVVKILDGCDFAAEYGIGVLCRRSLLTINKNNELRVHDLLRDMGRTIV  500

Query  1038  RQDSRDDLHTLSKL  997
              ++S +++   S+L
Sbjct  501   HEESLEEIGKCSRL  514


 Score =   144 bits (363),  Expect(2) = 7e-102, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 98/131 (75%), Gaps = 0/131 (0%)
 Frame = -1

Query  2551  SSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgir  2372
             SSV R+ Y  FLSFRGEDTRKNFTDHLYTAL  AGI TFRDD+E+ RG+ I +EL+  I 
Sbjct  3     SSVHRWNYDVFLSFRGEDTRKNFTDHLYTALDRAGIYTFRDDEELKRGKEISSELQTAIE  62

Query  2371  esrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAF  2192
             ESRISI+VFS++YASSRWCLDELL IL   ++ G  VFP+FY V  ++V  Q+GSF   F
Sbjct  63    ESRISIVVFSRNYASSRWCLDELLKILYCNETMGQLVFPVFYDVEPSEVRNQTGSFGSGF  122

Query  2191  ERHAKREKMEV  2159
              +  KR K ++
Sbjct  123   SQTKKRFKADM  133



>ref|XP_006388459.1| hypothetical protein POPTR_0182s00240g [Populus trichocarpa]
 gb|ERP47373.1| hypothetical protein POPTR_0182s00240g [Populus trichocarpa]
Length=1026

 Score =   259 bits (663),  Expect(2) = 2e-101, Method: Compositional matrix adjust.
 Identities = 164/374 (44%), Positives = 242/374 (65%), Gaps = 1/374 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL E A L G  L+   DGHEA+FI+KI+ EI ++L+ T L +  Y VG+ SRV ++N
Sbjct  153   RMALTEAANLSGWDLRNVADGHEAKFIKKIVGEISRELSSTYLFIAFYPVGINSRVQQLN  212

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               L   S++V +  ICG+GG+GKTT+AK  Y   +  F+G CFLANVR  S+ PNG V L
Sbjct  213   FLLNAGSNEVCIVGICGMGGIGKTTIAKAMYYELFHSFDGKCFLANVREISQQPNGHVKL  272

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +ILK  +  I N D G+  IK+ + S+KV ++ DDVD+L+ L  + G+RDWF  
Sbjct  273   QEQLLFDILKTDKIKIGNVDRGMNMIKERLHSRKVLLILDDVDKLDQLQAIAGSRDWFGS  332

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS+II+TTR +++L        Y  +E++D E+L+LF  +AF    P+E   E S + + 
Sbjct  333   GSRIIVTTRDKHVLTVLGADRVYMAREMNDIEALELFSWHAFRTSHPVEDYKELSEQIVD  392

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             +CG LPLAL+ +GS+L GRS+  W+S LEKL RI   +IQ+ L+IS + L DD  K LF+
Sbjct  393   YCGRLPLALEVIGSFLFGRSIVEWKSALEKLRRIPDDQIQKKLQISFDGLNDDTQKDLFL  452

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              I+C FVG D+++ + +L  CD    +G+  L    LV+V+  NKL+M  L+++MG+EI+
Sbjct  453   DISCFFVGMDKEYVLPILNGCDFFADIGLGVLTQRCLVSVNEKNKLIMHDLLRDMGREIV  512

Query  1038  RQDSRDDLHTLSKL  997
             R  S ++    S+L
Sbjct  513   RAQSPNNPGRRSRL  526


 Score =   140 bits (353),  Expect(2) = 2e-101, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 102/135 (76%), Gaps = 1/135 (1%)
 Frame = -1

Query  2536  FFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresris  2357
             + Y  FLSFRGEDTRKNFTDHLY AL +AGI TFRDD+E+  GE+I  EL + I++SRIS
Sbjct  19    WIYDVFLSFRGEDTRKNFTDHLYFALKDAGINTFRDDNELRSGEDISTELLQAIQKSRIS  78

Query  2356  iIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAK  2177
             +I+FS++YA+SRWCL+ L+ I+   +S    VFPIFY V  +DV KQ+GSFAEAF  H +
Sbjct  79    VILFSRNYANSRWCLEGLVKIMECWRSCRQLVFPIFYDVDPSDVRKQTGSFAEAFSGHEE  138

Query  2176  REKMEVEEGRV-EWK  2135
             R  ++ ++G+V  W+
Sbjct  139   RFVLQTDKGKVATWR  153



>ref|XP_011026208.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=1178

 Score =   265 bits (678),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 169/393 (43%), Positives = 245/393 (62%), Gaps = 5/393 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+ALREVA L+G+ L+   DGHEAE +  I++EI  +L+RT+L V  + VGL SR  ++ 
Sbjct  144   RDALREVAYLKGLDLRRHLDGHEAENVDYIVKEISVRLDRTILRVAIHPVGLDSRAKEVI  203

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               L DES DV +  I G+GG+GKTT+AK  YNL + RFEGSCFL NVR    I NG   L
Sbjct  204   SLLDDESIDVRIVGIIGMGGIGKTTLAKEVYNLVFKRFEGSCFLENVRQQI-ISNGIAYL  262

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVI-GARDWFS  1579
             Q+Q+  +ILK + E I+N D G   IK+ +  K+VFIV DD++  +     I G  DW  
Sbjct  263   QRQLLSDILKRKHEKIYNVDRGSKVIKERLRCKRVFIVLDDIEDKQEELDKILGNLDWLY  322

Query  1578  RGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAI  1399
              GS++IITTR +NLL+  + + QY++KEL+  +SL+L   +AF +  P E  M+ + + +
Sbjct  323   PGSRVIITTRIKNLLQPSKLYRQYEVKELNGSDSLQLLSLHAFNKRCPDESYMDSASRIV  382

Query  1398  RHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFV  1219
              +  G PLAL  LGS L G+++DVW S+LEKL+ I H      L+IS + LD  +K +F+
Sbjct  383   SYARGNPLALTVLGSDLGGQNIDVWNSRLEKLKVISHKGTHSILKISYDSLDAAEKSIFL  442

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F+G  +D+ +++L+ C   P+ GI  L    LV V  +NK +M  L+++MG+EI+
Sbjct  443   DIACFFIGYKKDYVMSILDGCGFFPIDGINTLTRRCLVKVGANNKFLMHDLLRDMGREIV  502

Query  1038  RQDSRDDLHTLSKLL---DQLVSSTESTGNGVV  949
              Q+S  D    S+L    D +   T+ TG   V
Sbjct  503   LQESFRDPGERSRLWYKEDVIELLTDRTGTKAV  535


 Score =   131 bits (329),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 94/138 (68%), Gaps = 2/138 (1%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRG DTR  FTDHLY+AL+  GI TFRD +EI  GE I  E  +GI  SR SI+
Sbjct  15    YDVFLSFRGADTRSGFTDHLYSALVREGIHTFRDANEIDHGEEIGPECLQGIENSRFSIV  74

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKRE  2171
             + SK YASS WCLDEL+ ILG RK EGH V+P+FY +  +DVE+Q GSF EAF  H K  
Sbjct  75    ILSKGYASSPWCLDELVHILGCRK-EGHGVWPVFYDIDPSDVEEQKGSFEEAFAVHEKSF  133

Query  2170  KMEVEEGRVEWKGKGGEV  2117
             K +V++   +W+    EV
Sbjct  134   KDDVDKVE-KWRDALREV  150



>ref|XP_011016381.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=948

 Score =   249 bits (636),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 159/365 (44%), Positives = 235/365 (64%), Gaps = 11/365 (3%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL+EVA L GM L+   DG+EA+FIQ I+  + K L+  +  VP + +G  + V  IN
Sbjct  197   RIALKEVANLAGMDLR---DGYEAQFIQSIVENVSKNLDPKIFYVPLHFIGRDALVQDIN  253

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S    + ++ G+GGVGKT +AK  +N NY +FEG  FL+N R+        V L
Sbjct  254   SWLQDGSHGAAIALLYGIGGVGKTAIAKSVFNQNYYKFEGKSFLSNFRSKD-----IVCL  308

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +I+    EI  + DEGI+KIKDA+  ++  IV DDVD+ +  + +I  ++W  +
Sbjct  309   QRQLLFDIINKTVEIN-DPDEGILKIKDALCCRRTLIVLDDVDKRDQFNKIIVMQNWLCK  367

Query  1575  GSKIIITTRCENLLKGHE-RHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAI  1399
             GSKII+TTR + LL G++    + K++ LDDE+SL+LF   AFGQ DP++  +E S + +
Sbjct  368   GSKIIVTTRNKGLLSGNDIEWARCKVEPLDDEKSLELFSWNAFGQADPVDGFVEDSWRIV  427

Query  1398  RHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLD-DYDKRLF  1222
              HC GLPLAL  +GS LSG+  ++W S L+++E I + ++ + L IS + LD DY K LF
Sbjct  428   HHCNGLPLALGVIGSSLSGKERELWESALQQMEVIPNIEVHKVLRISYDFLDGDYPKNLF  487

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
             + IAC F G D D A+ +L+  D     GI NLID  LV +++D +L M QL++++G+EI
Sbjct  488   LDIACFFNGMDVDDAVRILDGLDKGARFGIDNLIDRCLVEINSDQRLWMHQLVRDIGREI  547

Query  1041  LRQDS  1027
              RQ+S
Sbjct  548   ARQES  552


 Score =   146 bits (369),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGEN  2402
             A  + QES  S      Y  FL+FRGEDTRKNFTDHL  AL++AG  TFRDDDEI RG+N
Sbjct  50    AAGKYQESYSSRFANCKYQVFLTFRGEDTRKNFTDHLSKALVDAGFHTFRDDDEIRRGKN  109

Query  2401  IDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVE  2222
             I  EL++ I++S+I+IIVFSK++ASSRWCLDEL+ I+ R+++    VFP+FY V  ++V 
Sbjct  110   IQLELQKAIQQSKIAIIVFSKNHASSRWCLDELVMIMERKRNADCIVFPVFYHVDPSEVR  169

Query  2221  KQSGSFAEAFERHAKREKMEVE  2156
              Q+GSFA AF  H K  K E+E
Sbjct  170   NQTGSFAAAFVEHEKHFKEEME  191



>ref|XP_010263414.1| PREDICTED: TMV resistance protein N-like [Nelumbo nucifera]
Length=1134

 Score =   238 bits (607),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 161/374 (43%), Positives = 225/374 (60%), Gaps = 1/374 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             +EAL E A + G  LQ   +GH++  IQ I  E++ KL++T+L V  Y +G+ SR   + 
Sbjct  147   KEALVEAADVSGWDLQSVTNGHQSMLIQGIAEEVLTKLSKTLLDVAVYPIGIDSRARDMY  206

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               L     DV +  I G+GG+GKTT+AK  YN  + RFEG  FLANV    +  NG V L
Sbjct  207   TLLSIRPDDVRIVGIWGMGGIGKTTIAKAIYNQIFGRFEGGSFLANVAENFKQHNGIVQL  266

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +IL  ++  I N   G   IK+ +  KKV +V D VDQ + L  +    +WF  
Sbjct  267   QEQLLLDILMVKDLKIKNIASGSSVIKERLCYKKVLLVLDHVDQPDQLYALAREHNWFGA  326

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS+IIITTR  +LL   +    Y+ KEL  EES+KLF  +AFG+D P E  ME S + + 
Sbjct  327   GSRIIITTRDVHLLNVLQVDEIYEAKELSYEESIKLFSWHAFGKDHPTEDYMELSKRVVS  386

Query  1395  HCGGLPLALKDLGSYL-SGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFV  1219
             + GGLPLAL+ LGS+L   RS   W S LEKL+RI H +IQ+ L IS + LDD  + +F+
Sbjct  387   YVGGLPLALEVLGSFLLDKRSKPEWISVLEKLKRIPHDQIQKKLRISFDALDDQMRDIFL  446

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F+G DRD  I +L+ C      GI +LI  SL+ V  +N+L M   I++MG+EI+
Sbjct  447   DIACFFIGMDRDHVIRILDGCGFFSETGINDLIRKSLLKVGENNELRMHDQIRDMGREII  506

Query  1038  RQDSRDDLHTLSKL  997
             R+ S  +  + S+L
Sbjct  507   REKSPKEPGSRSRL  520


 Score =   157 bits (396),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 109/146 (75%), Gaps = 1/146 (1%)
 Frame = -1

Query  2569  TQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAE  2390
             TQE+  S+ PR+ Y  FLSFRGEDTRK+FTDHLY AL+  GI TFRDD+++ RGE+I +E
Sbjct  2     TQEASFSNDPRWNYDVFLSFRGEDTRKSFTDHLYNALVQRGIHTFRDDEKLKRGEDIASE  61

Query  2389  LrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSG  2210
             L + I ESRISIIVFS++YASSRWC+DEL+ IL  RK  G  V P+FY V  +DV KQ+G
Sbjct  62    LHKTIEESRISIIVFSRNYASSRWCMDELVKILECRKMMGQLVLPVFYDVHPSDVRKQTG  121

Query  2209  SFAEAFERHAKREKMEVEEGRVE-WK  2135
             SFAEAF +H +  +    E +V+ WK
Sbjct  122   SFAEAFAKHEEHFRAAGTERKVQKWK  147



>ref|XP_008347091.1| PREDICTED: TMV resistance protein N-like, partial [Malus domestica]
Length=459

 Score =   253 bits (645),  Expect(2) = 7e-100, Method: Compositional matrix adjust.
 Identities = 152/309 (49%), Positives = 208/309 (67%), Gaps = 1/309 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL E+A L GMVLQ + DG+E++FI+KI+  I  KL R  LSV    +G+ S+  +IN
Sbjct  151   RKALAEIADLAGMVLQNQADGYESKFIKKIVXVIGDKLXRXXLSVEPKLIGIQSQAERIN  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              W QD SS VG+ V+ G+ G+GKTT+AK  YN N+  F+GS F+ N++  ++ PNG V +
Sbjct  211   LWFQDGSSXVGIFVVYGMSGIGKTTIAKHVYNSNFGSFQGSSFIENIKETADRPNGLVQI  270

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +IL GRE  I +  EGIIKI+ AI   +V +V DDVD ++ LD ++  +D F  
Sbjct  271   QMQLLCDILNGREVKIHSVSEGIIKIERAISXXRVLLVLDDVDHMDQLDAILRMKDQFYP  330

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKI+ITTRCE LLK  +    ++++ LDD ESLKLF  +AFGQD P+E  ME+S + + 
Sbjct  331   GSKILITTRCERLLKADQVTKVHRVQTLDDNESLKLFSWHAFGQDHPIEEYMEHSKQLVZ  390

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             H GGLPLALK LGS LSG  + VW S LEKL+ I   +I   L IS   L DD+D++LF+
Sbjct  391   HSGGLPLALKVLGSSLSGGRIGVWESALEKLKVIPDGEIMXKLRISYESLKDDHDRKLFL  450

Query  1218  LIACHFVGK  1192
              IAC  +G+
Sbjct  451   HIACFLIGR  459


 Score =   141 bits (356),  Expect(2) = 7e-100, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 96/139 (69%), Gaps = 4/139 (3%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGE+TRK FTDHLYTAL NAG  TFRDDDE+ RGE I   L++ I++SR S++
Sbjct  22    YDVFLSFRGEETRKTFTDHLYTALNNAGFLTFRDDDELERGEYIKPGLQKAIQQSRTSVV  81

Query  2350  VFSKDYASSRWCLDELLTILGR-RKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKR  2174
             VFSKDYASSRWCLDEL+ IL R R +  H V P+FY V  + V KQ+GS  +AF R  K 
Sbjct  82    VFSKDYASSRWCLDELVLILERKRTTSDHVVLPVFYDVDPSHVRKQTGSVGKAFARSQKN  141

Query  2173  EKMEVEEGRVEWKGKGGEV  2117
             +  E  EG   W+    E+
Sbjct  142   QSSEKVEG---WRKALAEI  157



>ref|XP_011032762.1| PREDICTED: TMV resistance protein N-like isoform X5 [Populus 
euphratica]
Length=846

 Score =   271 bits (692),  Expect(2) = 8e-100, Method: Compositional matrix adjust.
 Identities = 167/376 (44%), Positives = 252/376 (67%), Gaps = 1/376 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             ++ALREVA L+G+ LQ+  DGHEA+ I  I+++I  +L+RT+LSV ++ VGL SR  ++ 
Sbjct  143   KDALREVACLKGLDLQKHWDGHEAKNIDYIVKDISDRLDRTILSVTTHPVGLLSRAKEVI  202

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               L ++  DV +  I G+GG+GKTTVAK  YNL +  FEGSCFL NVR  S I  G   L
Sbjct  203   SLLGEKLVDVRIVGIYGMGGIGKTTVAKKVYNLVFHEFEGSCFLENVRKES-ISKGIAYL  261

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+    LK + E I N   G+  I+D +  K++FIV DD+D+LE L+ +IG  +W   
Sbjct  262   QRQLLSETLKRKHEKIDNISRGLNVIRDRLRRKRIFIVLDDIDELEQLNKIIGNFEWLFP  321

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS++IITTR ++LL+  E +LQY++KEL++++SL+L   +AF +  P+++ M+   + + 
Sbjct  322   GSRVIITTRIKDLLQPSELYLQYEVKELNNDDSLQLLRLHAFNEHHPVDNYMDCMRRIVS  381

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFVL  1216
             +  G+PLAL+ LGS L G+S++VW SKLEKL+ I +  I   L+IS + LDD +K +F+ 
Sbjct  382   YVRGIPLALEVLGSSLCGQSINVWNSKLEKLKVIGNGDIHNKLKISYDSLDDTEKFIFLD  441

Query  1215  IACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEILR  1036
             IAC F+G ++D+ +++LE C   P  GI  L+   L+ V  DNKL M  L+++MG+EI+R
Sbjct  442   IACFFIGYNKDYIMSILEDCGFFPADGINTLMRRCLLKVGPDNKLSMHDLLRDMGREIVR  501

Query  1035  QDSRDDLHTLSKLLDQ  988
             Q+S  D    S+L  Q
Sbjct  502   QESSTDPGERSRLWRQ  517


 Score =   123 bits (309),  Expect(2) = 8e-100, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = -1

Query  2560  SGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrr  2381
             S  S+  ++ Y  FLSF+G DT K FTDHLY+AL+  GI TFRD +EI  GE I  +  +
Sbjct  3     SSNSNSSKWDYDVFLSFKGADTGKGFTDHLYSALVRDGIHTFRDANEINSGEEIGPDCLQ  62

Query  2380  giresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFA  2201
              I +SR S+++ SK YASS  CLDEL+ IL  RK  GHAV+P+FY +  +DVE+  GSF 
Sbjct  63    AIEKSRFSVVILSKGYASSTSCLDELVHILECRKEGGHAVWPVFYDIDPSDVEELKGSFE  122

Query  2200  EAFERHAKREKMEVEEGRVEWKGKGGEV  2117
             EAF  H KR K ++++ + +WK    EV
Sbjct  123   EAFAEHEKRFKDDMDKVQ-KWKDALREV  149



>ref|XP_010314215.1| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
 ref|XP_010314217.1| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
Length=1174

 Score =   283 bits (723),  Expect(2) = 9e-100, Method: Compositional matrix adjust.
 Identities = 166/364 (46%), Positives = 237/364 (65%), Gaps = 4/364 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R +L +VA + G+VL+   DG E +FIQ+I++EI  KL+R VLS   Y VG+ SRV ++N
Sbjct  153   RSSLTDVANMAGIVLE---DGDELKFIQEIVKEIWGKLSRKVLSFAPYPVGIYSRVKEVN  209

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S++    +I G  G+GKTT+AK  +NL+ DRF+ S FL ++R  ++   G + L
Sbjct  210   FWLQDSSTNSRTLMIYGEPGIGKTTIAKALFNLHCDRFQCSSFLGDIREIAKESCGLIDL  269

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QK +  ++LK  +  + + D G   IKD +  KK  +V DDVD L  L  ++ +RDW   
Sbjct  270   QKNLLSDLLKEDKIDLNDIDRGASTIKDFLVHKKFLLVLDDVDDLTQLKAILDSRDWIPP  329

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSK+IITT  E+LL  H+  L Y+ K +D+ E+LKLF  + FGQD P++  M +S + ++
Sbjct  330   GSKVIITTTNEHLLNPHDACLMYESKRMDNHEALKLFSLHTFGQDHPVKEYMTHSKQIVK  389

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HC GLPLAL+ L S L G S+D+W   ++KLER       + LE+S   L DD+DK +F+
Sbjct  390   HCQGLPLALQVLASSLHGGSIDMWEGAIKKLERYSESHNHKVLELSYEALPDDHDKNVFL  449

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IA  FVGKD+D+ I VL++C  H    IQNLID  L+TV  DNKLMM QL+Q MGKE++
Sbjct  450   DIASFFVGKDKDYTIKVLDECGFHATAEIQNLIDRYLLTVTPDNKLMMHQLLQEMGKEVI  509

Query  1038  RQDS  1027
              ++S
Sbjct  510   CRES  513


 Score =   111 bits (278),  Expect(2) = 9e-100, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 99/148 (67%), Gaps = 1/148 (1%)
 Frame = -1

Query  2572  RTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDA  2393
             R +++ +S  PR  YH +LS+RG++   NF + L+TAL + GI+TF+   E   G+ + +
Sbjct  2     RAEKASVSR-PRCSYHVYLSYRGQEISMNFINILHTALTDVGIQTFKRHSESRNGKTVGS  60

Query  2392  ELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQS  2213
             EL++ ++ESRISI+VF++DY  SR CLDEL++IL R++  GH + P+FY V  + V KQ 
Sbjct  61    ELQKAVKESRISIVVFTEDYGYSRRCLDELVSILERKQIAGHMILPVFYRVDPSHVRKQR  120

Query  2212  GSFAEAFERHAKREKMEVEEGRVEWKGK  2129
             GSFA+AF  + ++  +E  E R E   K
Sbjct  121   GSFAKAFHNYEEQIMVEKVERRNEHIAK  148



>ref|XP_011032759.1| PREDICTED: TMV resistance protein N-like isoform X2 [Populus 
euphratica]
 ref|XP_011032760.1| PREDICTED: TMV resistance protein N-like isoform X3 [Populus 
euphratica]
Length=1120

 Score =   270 bits (691),  Expect(2) = 9e-100, Method: Compositional matrix adjust.
 Identities = 167/376 (44%), Positives = 252/376 (67%), Gaps = 1/376 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             ++ALREVA L+G+ LQ+  DGHEA+ I  I+++I  +L+RT+LSV ++ VGL SR  ++ 
Sbjct  143   KDALREVACLKGLDLQKHWDGHEAKNIDYIVKDISDRLDRTILSVTTHPVGLLSRAKEVI  202

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               L ++  DV +  I G+GG+GKTTVAK  YNL +  FEGSCFL NVR  S I  G   L
Sbjct  203   SLLGEKLVDVRIVGIYGMGGIGKTTVAKKVYNLVFHEFEGSCFLENVRKES-ISKGIAYL  261

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+    LK + E I N   G+  I+D +  K++FIV DD+D+LE L+ +IG  +W   
Sbjct  262   QRQLLSETLKRKHEKIDNISRGLNVIRDRLRRKRIFIVLDDIDELEQLNKIIGNFEWLFP  321

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS++IITTR ++LL+  E +LQY++KEL++++SL+L   +AF +  P+++ M+   + + 
Sbjct  322   GSRVIITTRIKDLLQPSELYLQYEVKELNNDDSLQLLRLHAFNEHHPVDNYMDCMRRIVS  381

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFVL  1216
             +  G+PLAL+ LGS L G+S++VW SKLEKL+ I +  I   L+IS + LDD +K +F+ 
Sbjct  382   YVRGIPLALEVLGSSLCGQSINVWNSKLEKLKVIGNGDIHNKLKISYDSLDDTEKFIFLD  441

Query  1215  IACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEILR  1036
             IAC F+G ++D+ +++LE C   P  GI  L+   L+ V  DNKL M  L+++MG+EI+R
Sbjct  442   IACFFIGYNKDYIMSILEDCGFFPADGINTLMRRCLLKVGPDNKLSMHDLLRDMGREIVR  501

Query  1035  QDSRDDLHTLSKLLDQ  988
             Q+S  D    S+L  Q
Sbjct  502   QESSTDPGERSRLWRQ  517


 Score =   124 bits (310),  Expect(2) = 9e-100, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = -1

Query  2560  SGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrr  2381
             S  S+  ++ Y  FLSF+G DT K FTDHLY+AL+  GI TFRD +EI  GE I  +  +
Sbjct  3     SSNSNSSKWDYDVFLSFKGADTGKGFTDHLYSALVRDGIHTFRDANEINSGEEIGPDCLQ  62

Query  2380  giresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFA  2201
              I +SR S+++ SK YASS  CLDEL+ IL  RK  GHAV+P+FY +  +DVE+  GSF 
Sbjct  63    AIEKSRFSVVILSKGYASSTSCLDELVHILECRKEGGHAVWPVFYDIDPSDVEELKGSFE  122

Query  2200  EAFERHAKREKMEVEEGRVEWKGKGGEV  2117
             EAF  H KR K ++++ + +WK    EV
Sbjct  123   EAFAEHEKRFKDDMDKVQ-KWKDALREV  149



>ref|XP_011032761.1| PREDICTED: TMV resistance protein N-like isoform X4 [Populus 
euphratica]
Length=930

 Score =   270 bits (690),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 167/376 (44%), Positives = 252/376 (67%), Gaps = 1/376 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             ++ALREVA L+G+ LQ+  DGHEA+ I  I+++I  +L+RT+LSV ++ VGL SR  ++ 
Sbjct  143   KDALREVACLKGLDLQKHWDGHEAKNIDYIVKDISDRLDRTILSVTTHPVGLLSRAKEVI  202

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               L ++  DV +  I G+GG+GKTTVAK  YNL +  FEGSCFL NVR  S I  G   L
Sbjct  203   SLLGEKLVDVRIVGIYGMGGIGKTTVAKKVYNLVFHEFEGSCFLENVRKES-ISKGIAYL  261

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+    LK + E I N   G+  I+D +  K++FIV DD+D+LE L+ +IG  +W   
Sbjct  262   QRQLLSETLKRKHEKIDNISRGLNVIRDRLRRKRIFIVLDDIDELEQLNKIIGNFEWLFP  321

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS++IITTR ++LL+  E +LQY++KEL++++SL+L   +AF +  P+++ M+   + + 
Sbjct  322   GSRVIITTRIKDLLQPSELYLQYEVKELNNDDSLQLLRLHAFNEHHPVDNYMDCMRRIVS  381

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFVL  1216
             +  G+PLAL+ LGS L G+S++VW SKLEKL+ I +  I   L+IS + LDD +K +F+ 
Sbjct  382   YVRGIPLALEVLGSSLCGQSINVWNSKLEKLKVIGNGDIHNKLKISYDSLDDTEKFIFLD  441

Query  1215  IACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEILR  1036
             IAC F+G ++D+ +++LE C   P  GI  L+   L+ V  DNKL M  L+++MG+EI+R
Sbjct  442   IACFFIGYNKDYIMSILEDCGFFPADGINTLMRRCLLKVGPDNKLSMHDLLRDMGREIVR  501

Query  1035  QDSRDDLHTLSKLLDQ  988
             Q+S  D    S+L  Q
Sbjct  502   QESSTDPGERSRLWRQ  517


 Score =   124 bits (310),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = -1

Query  2560  SGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrr  2381
             S  S+  ++ Y  FLSF+G DT K FTDHLY+AL+  GI TFRD +EI  GE I  +  +
Sbjct  3     SSNSNSSKWDYDVFLSFKGADTGKGFTDHLYSALVRDGIHTFRDANEINSGEEIGPDCLQ  62

Query  2380  giresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFA  2201
              I +SR S+++ SK YASS  CLDEL+ IL  RK  GHAV+P+FY +  +DVE+  GSF 
Sbjct  63    AIEKSRFSVVILSKGYASSTSCLDELVHILECRKEGGHAVWPVFYDIDPSDVEELKGSFE  122

Query  2200  EAFERHAKREKMEVEEGRVEWKGKGGEV  2117
             EAF  H KR K ++++ + +WK    EV
Sbjct  123   EAFAEHEKRFKDDMDKVQ-KWKDALREV  149



>ref|XP_006358466.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=1238

 Score =   298 bits (762),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 181/367 (49%), Positives = 248/367 (68%), Gaps = 5/367 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             + +L EVA L GMVLQ + DG E+ FIQ+I++ +  +LNR VLSV  + VG+ SRV  IN
Sbjct  142   KASLTEVADLGGMVLQNQSDGCESRFIQEIVKVVAGRLNRAVLSVALHPVGIDSRVKDIN  201

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+ V +  I G+GG+GK+T+AK AYNLN+D+F+GS FLA+V   SE  +G V L
Sbjct  202   LWLQDGSTSVDIMAIYGMGGLGKSTLAKTAYNLNFDKFDGSSFLADVNKTSERYDGLVSL  261

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  N+L  + E I+N DEG+IKI++AI  +++ +V DDVD  + L+ V+G R+WF  
Sbjct  262   QRQLLSNVLGKKVEKIYNVDEGVIKIQEAIHCRRILLVLDDVDDRDQLNAVLGMREWFYP  321

Query  1575  GSKIIITTRCENLLKGHE--RHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKA  1402
             GSKIIITTR ++L    E      YK+  L+ +ES++LF  +AFG++ P E   + S K 
Sbjct  322   GSKIIITTRNQHLFDASEVCSCKMYKVMPLNAQESIRLFSWHAFGKEKPSEDHEDLSEKV  381

Query  1401  IRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEIS--LNPLDDYDKR  1228
             I HC G PLALK LGS L  RS++VW S L KL+ I  +KI   L IS  L P DD  ++
Sbjct  382   ILHCKGTPLALKVLGSSLCDRSIEVWESALRKLKAIPDNKILEKLRISYDLLPDDDDVQK  441

Query  1227  LFVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGK  1048
             +F+ I C FVGKDRD+A+ +L+ C    VVGIQ L D  L+ +D D KL M  LIQ+MG+
Sbjct  442   IFLDIVCFFVGKDRDYAVTILDGCGFFSVVGIQILSDRCLIEMDKD-KLKMHSLIQDMGR  500

Query  1047  EILRQDS  1027
             EI+R +S
Sbjct  501   EIIRLES  507


 Score = 96.3 bits (238),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 87/140 (62%), Gaps = 2/140 (1%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresri  2360
             +F +HAFLS     T K+F +HL++AL NAGIR F   DE+   E    EL++ I+ESRI
Sbjct  3     QFAFHAFLSL-ATKTGKSFGNHLHSALSNAGIRAF-SVDELDIDEKGCKELQKTIQESRI  60

Query  2359  siIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHA  2180
              I+V SKDY SS  CLDEL+ IL  +K  G  V P+FY V  ++V KQ GSF + F  + 
Sbjct  61    LIVVLSKDYTSSERCLDELVFILESKKLFGRFVLPVFYDVDPSEVRKQKGSFEQDFLMYE  120

Query  2179  KREKMEVEEGRVEWKGKGGE  2120
             +R +   EE R+EW  K  E
Sbjct  121   QRYRSGTEERRLEWLQKVKE  140



>ref|XP_011032756.1| PREDICTED: TMV resistance protein N-like isoform X1 [Populus 
euphratica]
 ref|XP_011032757.1| PREDICTED: TMV resistance protein N-like isoform X1 [Populus 
euphratica]
 ref|XP_011032758.1| PREDICTED: TMV resistance protein N-like isoform X1 [Populus 
euphratica]
Length=1151

 Score =   270 bits (690),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 167/376 (44%), Positives = 252/376 (67%), Gaps = 1/376 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             ++ALREVA L+G+ LQ+  DGHEA+ I  I+++I  +L+RT+LSV ++ VGL SR  ++ 
Sbjct  143   KDALREVACLKGLDLQKHWDGHEAKNIDYIVKDISDRLDRTILSVTTHPVGLLSRAKEVI  202

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               L ++  DV +  I G+GG+GKTTVAK  YNL +  FEGSCFL NVR  S I  G   L
Sbjct  203   SLLGEKLVDVRIVGIYGMGGIGKTTVAKKVYNLVFHEFEGSCFLENVRKES-ISKGIAYL  261

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+    LK + E I N   G+  I+D +  K++FIV DD+D+LE L+ +IG  +W   
Sbjct  262   QRQLLSETLKRKHEKIDNISRGLNVIRDRLRRKRIFIVLDDIDELEQLNKIIGNFEWLFP  321

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS++IITTR ++LL+  E +LQY++KEL++++SL+L   +AF +  P+++ M+   + + 
Sbjct  322   GSRVIITTRIKDLLQPSELYLQYEVKELNNDDSLQLLRLHAFNEHHPVDNYMDCMRRIVS  381

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFVL  1216
             +  G+PLAL+ LGS L G+S++VW SKLEKL+ I +  I   L+IS + LDD +K +F+ 
Sbjct  382   YVRGIPLALEVLGSSLCGQSINVWNSKLEKLKVIGNGDIHNKLKISYDSLDDTEKFIFLD  441

Query  1215  IACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEILR  1036
             IAC F+G ++D+ +++LE C   P  GI  L+   L+ V  DNKL M  L+++MG+EI+R
Sbjct  442   IACFFIGYNKDYIMSILEDCGFFPADGINTLMRRCLLKVGPDNKLSMHDLLRDMGREIVR  501

Query  1035  QDSRDDLHTLSKLLDQ  988
             Q+S  D    S+L  Q
Sbjct  502   QESSTDPGERSRLWRQ  517


 Score =   124 bits (310),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = -1

Query  2560  SGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrr  2381
             S  S+  ++ Y  FLSF+G DT K FTDHLY+AL+  GI TFRD +EI  GE I  +  +
Sbjct  3     SSNSNSSKWDYDVFLSFKGADTGKGFTDHLYSALVRDGIHTFRDANEINSGEEIGPDCLQ  62

Query  2380  giresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFA  2201
              I +SR S+++ SK YASS  CLDEL+ IL  RK  GHAV+P+FY +  +DVE+  GSF 
Sbjct  63    AIEKSRFSVVILSKGYASSTSCLDELVHILECRKEGGHAVWPVFYDIDPSDVEELKGSFE  122

Query  2200  EAFERHAKREKMEVEEGRVEWKGKGGEV  2117
             EAF  H KR K ++++ + +WK    EV
Sbjct  123   EAFAEHEKRFKDDMDKVQ-KWKDALREV  149



>ref|XP_008375765.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=563

 Score =   300 bits (767),  Expect(2) = 5e-99, Method: Compositional matrix adjust.
 Identities = 178/366 (49%), Positives = 253/366 (69%), Gaps = 1/366 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL E+A L GMVLQ + DG+E+ FI+ II+ I  KL+RT LSV    +G+ S+  +IN
Sbjct  139   RKALAEIADLAGMVLQNQADGYESTFIKNIIKVIGDKLSRTPLSVEPKLIGIQSQAERIN  198

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              W QD SSDVG+ V+ G+ G+GKTT+AK  YN N+  F+GS F+ N++  ++ PNG V +
Sbjct  199   LWFQDGSSDVGIFVVYGMSGIGKTTIAKHVYNSNFGSFQGSSFIENIKETADRPNGLVQI  258

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +IL GRE  I +  EGIIKI+ AI SK+V +V DDVD ++ LD ++  +D F  
Sbjct  259   QMQLLCDILNGREVKIHSVSEGIIKIERAISSKRVLLVLDDVDHMDQLDAILRMKDQFYP  318

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKI+ITTRCE LLK  +    ++++ LDD ESLKLF  +AFGQD P+E  ME+S + ++
Sbjct  319   GSKILITTRCERLLKADQVTXVHRVQTLDDNESLKLFSWHAFGQDHPIEEYMEHSKQLVQ  378

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             H GGLPLALK LGS LSG  + VW S LEKL+ I   +I   L IS   L DD+D++LF+
Sbjct  379   HSGGLPLALKVLGSSLSGGXIGVWESALEKLKVIPDGEIMXKLRISYESLKDDHDRKLFL  438

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC  +G+++ + + + + CD + ++G+QNLID  LVT+D   K+ M  +I+ MG+EI+
Sbjct  439   HIACFLIGRNKSYIVRIFDGCDFYTIIGMQNLIDRCLVTLDEYGKVKMHDMIRAMGREIV  498

Query  1038  RQDSRD  1021
             RQ+S +
Sbjct  499   RQESEE  504


 Score = 92.4 bits (228),  Expect(2) = 5e-99, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 76/134 (57%), Gaps = 4/134 (3%)
 Frame = -1

Query  2515  SFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiIVFSKD  2336
             S   + T K  T  L T L      TF   DE+ RGE I   L++ I++SR S++VFSKD
Sbjct  15    SXXXZXTXKTXTXXLXTXLNXXXFXTFXXXDELERGEXIKPGLQKAIQQSRTSVVVFSKD  74

Query  2335  YASSRWCLDELLTILGR-RKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKREKMEV  2159
             YASS WCLDEL+ IL R R +  H V P+FY V  + V KQ+GS  +AF R  K +  E 
Sbjct  75    YASSSWCLDELVLILERKRTTSDHVVLPVFYDVDPSHVRKQTGSVGKAFARSQKNQSPEK  134

Query  2158  EEGRVEWKGKGGEV  2117
              +G   W+    E+
Sbjct  135   VQG---WRKALAEI  145



>ref|XP_009779439.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
Length=1212

 Score =   281 bits (719),  Expect(2) = 6e-99, Method: Compositional matrix adjust.
 Identities = 171/366 (47%), Positives = 252/366 (69%), Gaps = 2/366 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL++VA L GM LQ + DG+EA+FI+ I+  I  KL    L+   Y + ++ R   I 
Sbjct  143   RNALKQVADLGGMPLQNQADGYEAKFIENIVEVIASKLRPRALNNAPYLIEISYRAEDII  202

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S++VG+ VICG+GG+GKTT+AK AYN +   FEGS FLAN+   ++  NG V L
Sbjct  203   LWLQDRSTNVGLYVICGIGGIGKTTLAKFAYNSSARSFEGSSFLANINETAKQCNGLVRL  262

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+  +I+ G++E I N DEGI+ I+DA+  +++ +V DDVD+++ +D ++G RDW + 
Sbjct  263   QKQVLYDIV-GKKERISNADEGIMMIEDALRYEQILLVLDDVDEVDQIDKILGMRDWLNP  321

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
              SKIIITTR E+LLK    H   K++ L+  +SLKLF  +AFG+D PLE  +E S + + 
Sbjct  322   ASKIIITTRHESLLKPFVPHKVLKVEALNKMDSLKLFSWHAFGEDHPLEGYVELSKRVVL  381

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
              C GLPLAL+ LGS LSGR  ++W S LEKLE I    +   L++S   L DD+DK +F+
Sbjct  382   QCAGLPLALRVLGSALSGRRPEIWGSALEKLETIPDGHVIEKLKVSFYSLEDDHDKDIFL  441

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IA  F+G DRD ++ +L  C  + ++G+QNLID SL+T+++ NKL M QL++++G++I+
Sbjct  442   HIALFFLGMDRDDSVRILNGCGFYTIIGMQNLIDRSLLTINDLNKLEMHQLLRDLGRDIV  501

Query  1038  RQDSRD  1021
             R++S+D
Sbjct  502   RRESQD  507


 Score =   110 bits (274),  Expect(2) = 6e-99, Method: Composition-based stats.
 Identities = 61/138 (44%), Positives = 93/138 (67%), Gaps = 5/138 (4%)
 Frame = -1

Query  2563  ESGISSVP---RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFR--DDDEIGRGENI  2399
             E GI S P   +  YH FLSFR +DT K FTDHL+  L+ AG   F+  +DD  G  E++
Sbjct  2     EQGIPSSPPTSQCSYHVFLSFRAKDTGKTFTDHLHRNLVRAGFHVFKCDNDDYDGEKEDL  61

Query  2398  DAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEK  2219
              ++L++GI +S++S+IV S++YASS  CLDEL+ IL ++++ GH V P+F++V  +DV K
Sbjct  62    KSKLQKGIEQSKMSVIVLSQNYASSERCLDELVVILEQKRNFGHIVLPVFFNVDPSDVRK  121

Query  2218  QSGSFAEAFERHAKREKM  2165
               GSF + F  + + +K+
Sbjct  122   LKGSFGQPFSANGESQKL  139



>gb|KDP42474.1| hypothetical protein JCGZ_00271 [Jatropha curcas]
Length=1296

 Score =   278 bits (712),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 170/376 (45%), Positives = 239/376 (64%), Gaps = 6/376 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL  +A L G  L    +  EA+ IQ+I+  +  +  RT L +PSY VG+ SRV +IN
Sbjct  146   RSALSLIANLSGFCLD---NRSEAKCIQQIVNHVENRFKRTRLYLPSYLVGIDSRVKEIN  202

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQ+ S DV +  ICG+GGVGKTT+AK  +NLNY RF+GSCFL++VR  S+ PNG V L
Sbjct  203   LWLQEGSDDVAIAAICGIGGVGKTTIAKAVFNLNYYRFDGSCFLSDVRKTSKQPNGLVKL  262

Query  1755  QKQIFENILK---GREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDW  1585
             Q+Q+   ILK        I N  EGIIKIK+    +++ IV DD++  E L+  IG R W
Sbjct  263   QRQLLSEILKVDISTIRKIHNLHEGIIKIKEVTQMRRILIVLDDIEWKEHLEAFIGDRSW  322

Query  1584  FSRGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVK  1405
                 S++IITTR ++     E   ++++  L + ESL+LF  +AF Q  P+   +E++ +
Sbjct  323   LFPASRVIITTRYQHAPSSVEPCKKFEVPVLSENESLQLFSLHAFRQTYPMVDYIEHAKR  382

Query  1404  AIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRL  1225
              + HCGGLPLAL+  GS L GRS+ +W   L+K E I   K+   L IS + L+D+DK L
Sbjct  383   VVNHCGGLPLALEVWGSSLFGRSIYMWECFLKKREAINDPKVHEILRISYDSLNDHDKDL  442

Query  1224  FVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKE  1045
             F+ I C FVG D+D+   +LE C    ++G QNLID  L+ +D +NKLMM QL+++MG+E
Sbjct  443   FLDICCFFVGMDKDYVSAILEGCGYCSIIGFQNLIDRFLLIIDEENKLMMNQLVRDMGRE  502

Query  1044  ILRQDSRDDLHTLSKL  997
             I+RQ+S  DL   S+L
Sbjct  503   IVRQESTFDLGIRSRL  518


 Score =   111 bits (278),  Expect(2) = 2e-98, Method: Composition-based stats.
 Identities = 70/140 (50%), Positives = 91/140 (65%), Gaps = 5/140 (4%)
 Frame = -1

Query  2575  ARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENID  2396
             A + ES  S+   + Y  FLS+RGEDTR NF  +L ++L   GIRTFRD+  + RGE+I 
Sbjct  4     ANSHESS-SATSGYVYDVFLSYRGEDTR-NFVHYLVSSLEQLGIRTFRDE-VVTRGEDIL  60

Query  2395  AELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQ  2216
                 + I ES+I+I+V S DYASSR+CLDEL  I+ R KS G  V P+FY V  + V KQ
Sbjct  61    IATLKAIEESKIAIVVLSNDYASSRFCLDELAFIMERTKSVGLIVLPVFYDVDPSQVRKQ  120

Query  2215  SGSFAEAFERHAK--REKME  2162
             + SF EAF RH K  +E M+
Sbjct  121   TDSFKEAFSRHEKFFKEDMK  140



>gb|ABF81465.1| TIR-NBS-LRR type disease resistance protein [Populus trichocarpa]
Length=1139

 Score =   246 bits (627),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/366 (42%), Positives = 229/366 (63%), Gaps = 14/366 (4%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+ L E A L G  LQE  +GHEA+FI+K++ +++ KLN   L+V SY VG+ SRV  + 
Sbjct  333   RKVLVEAANLSGWHLQEMENGHEAKFIEKMVEDVLHKLNCKYLTVASYPVGIDSRVKDVV  392

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               L   + DV    I G+GG+GKTT+AK  +N   + FEGSC L N++  SE P+G V L
Sbjct  393   SMLSVYTDDVRTVGIYGMGGIGKTTIAKAVFNELCNEFEGSCCLLNIKEISEQPSGLVQL  452

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  ++++ +   I N D G   IK+ +  K+V +V DD+DQL+ L  ++G R+WF  
Sbjct  453   QEQLISDLIQSKTFKINNVDRGSALIKERLCHKRVLVVLDDLDQLKQLGALMGERNWFGL  512

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS++IITTR E+LL   + H +Y ++EL+ +ESL+LF  +AF ++ P E  +  S   ++
Sbjct  513   GSRVIITTRDEHLLTQLQVHNKYLVEELNHDESLQLFIAHAFKENRPTEEFLGISKGVVQ  572

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYD-KRLFV  1219
             + GGLPLAL+ LGSYL  RS+  WRS              R L+IS N LDD D K +F+
Sbjct  573   YVGGLPLALEVLGSYLCKRSIGEWRSA-------------RKLQISFNALDDDDIKGIFL  619

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              I C F+G D D+   +L+ C  H  +GI+ L+  SL+T +  NKL M  L+++MG+EI+
Sbjct  620   DITCFFIGMDVDYVSKLLDGCGFHSRIGIEVLMQRSLITTNWYNKLRMHDLLRDMGREII  679

Query  1038  RQDSRD  1021
             R+ S D
Sbjct  680   REMSPD  685


 Score =   144 bits (362),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 97/129 (75%), Gaps = 0/129 (0%)
 Frame = -1

Query  2542  PRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresr  2363
             P++ Y  FLSFRGEDTRK FTDHLYTALI+AGI TFRD+DE+ RGE+I + + R I+ESR
Sbjct  199   PQWKYDVFLSFRGEDTRKKFTDHLYTALIHAGIHTFRDNDELPRGEDISSIISRPIQESR  258

Query  2362  isiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERH  2183
             I+I+VFSK YASS WCL EL  IL  + + G    PIFY +  +DV KQ+ SFAEAF+RH
Sbjct  259   IAIVVFSKGYASSTWCLGELSEILACKSAIGQLAVPIFYDIDPSDVRKQTASFAEAFKRH  318

Query  2182  AKREKMEVE  2156
              +R K  +E
Sbjct  319   EERFKENIE  327



>ref|XP_006385577.1| hypothetical protein POPTR_0003s08250g [Populus trichocarpa]
 gb|ERP63374.1| hypothetical protein POPTR_0003s08250g [Populus trichocarpa]
Length=1141

 Score =   246 bits (627),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/366 (42%), Positives = 229/366 (63%), Gaps = 14/366 (4%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+ L E A L G  LQE  +GHEA+FI+K++ +++ KLN   L+V SY VG+ SRV  + 
Sbjct  335   RKVLVEAANLSGWHLQEMENGHEAKFIEKMVEDVLHKLNCKYLTVASYPVGIDSRVKDVV  394

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               L   + DV    I G+GG+GKTT+AK  +N   + FEGSC L N++  SE P+G V L
Sbjct  395   SMLSVYTDDVRTVGIYGMGGIGKTTIAKAVFNELCNEFEGSCCLLNIKEISEQPSGLVQL  454

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  ++++ +   I N D G   IK+ +  K+V +V DD+DQL+ L  ++G R+WF  
Sbjct  455   QEQLISDLIQSKTFKINNVDRGSALIKERLCHKRVLVVLDDLDQLKQLGALMGERNWFGL  514

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS++IITTR E+LL   + H +Y ++EL+ +ESL+LF  +AF ++ P E  +  S   ++
Sbjct  515   GSRVIITTRDEHLLTQLQVHNKYLVEELNHDESLQLFIAHAFKENRPTEEFLGISKGVVQ  574

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYD-KRLFV  1219
             + GGLPLAL+ LGSYL  RS+  WRS              R L+IS N LDD D K +F+
Sbjct  575   YVGGLPLALEVLGSYLCKRSIGEWRSA-------------RKLQISFNALDDDDIKGIFL  621

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              I C F+G D D+   +L+ C  H  +GI+ L+  SL+T +  NKL M  L+++MG+EI+
Sbjct  622   DITCFFIGMDVDYVSKLLDGCGFHSRIGIEVLMQRSLITTNWYNKLRMHDLLRDMGREII  681

Query  1038  RQDSRD  1021
             R+ S D
Sbjct  682   REMSPD  687


 Score =   144 bits (362),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 97/129 (75%), Gaps = 0/129 (0%)
 Frame = -1

Query  2542  PRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresr  2363
             P++ Y  FLSFRGEDTRK FTDHLYTALI+AGI TFRD+DE+ RGE+I + + R I+ESR
Sbjct  201   PQWKYDVFLSFRGEDTRKKFTDHLYTALIHAGIHTFRDNDELPRGEDISSIISRPIQESR  260

Query  2362  isiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERH  2183
             I+I+VFSK YASS WCL EL  IL  + + G    PIFY +  +DV KQ+ SFAEAF+RH
Sbjct  261   IAIVVFSKGYASSTWCLGELSEILACKSAIGQLAVPIFYDIDPSDVRKQTASFAEAFKRH  320

Query  2182  AKREKMEVE  2156
              +R K  +E
Sbjct  321   EERFKENIE  329



>ref|XP_009801307.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
Length=1176

 Score =   278 bits (710),  Expect(2) = 3e-98, Method: Compositional matrix adjust.
 Identities = 164/365 (45%), Positives = 251/365 (69%), Gaps = 6/365 (2%)
 Frame = -2

Query  2112  EALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKINK  1933
             +AL + A L GMVL+ +   HE+ FI+KII  I  +L+R  L + S T+G+  R   IN 
Sbjct  164   DALSQAADLAGMVLENQ---HESRFIKKIINVISTRLSRPALYISSCTIGIHRRARPINS  220

Query  1932  WLQDES-SDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
             W+Q ES +D+G+ ++ G+GG+GKTT+AK  YNLN+  FE SCFLAN+R  S++PNG + L
Sbjct  221   WVQHESNTDIGILLVSGIGGIGKTTLAKFVYNLNFGYFECSCFLANIRETSKLPNGVIIL  280

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+   +LK  +  I + DEGIIKI++A+  +K+ ++ DDVD+ +L++ +   +DWF  
Sbjct  281   QKQLLSTLLKHDKVKISSVDEGIIKIRNALCYRKILLILDDVDEPDLVEAIFDIKDWFGF  340

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLE-HLMEYSVKAI  1399
             GSKII+TTR +NLL+    H  ++++ L   E+ +LF  +AFG+++  E +  EYS + I
Sbjct  341   GSKIIVTTRHKNLLRPQIGHEVHEVEILYTTEATELFNWHAFGENNTSEGYYKEYSEEVI  400

Query  1398  RHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDD-YDKRLF  1222
               C GLPLA++ +GS L+G+S DVWRS +EKL  I  +KI   L +S   LDD +D+ LF
Sbjct  401   EWCRGLPLAIQVIGSSLAGKSKDVWRSAIEKLRDIPTNKIVDKLRLSYELLDDDHDQNLF  460

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
             + + C F G  +DF + +L+KCD + +VGIQNLID SLVT+   N++ M QL+++MG++I
Sbjct  461   LHLCCFFEGMKKDFVVRILDKCDFYTLVGIQNLIDRSLVTIGYVNEITMHQLVRDMGRDI  520

Query  1041  LRQDS  1027
             +R+++
Sbjct  521   VRREA  525


 Score =   111 bits (278),  Expect(2) = 3e-98, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 92/149 (62%), Gaps = 4/149 (3%)
 Frame = -1

Query  2581  AEARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRG--  2408
             A  +  E  IS+  R  Y  FLSF+ EDT KNFTDHL TAL  AG RTF+  D+  R   
Sbjct  2     ATEQDYEQSISNTYRGSYDVFLSFKSEDTGKNFTDHLSTALNQAGFRTFKGGDDESRSTE  61

Query  2407  -ENIDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRR-KSEGHAVFPIFYSVGR  2234
              E+  ++  + I+ES+I  IVFS++YASS WCLD+L+TIL R+ K     + PIFY V  
Sbjct  62    EEDSSSDFAKAIQESKICTIVFSQNYASSSWCLDQLVTILERKMKFACTTILPIFYHVDP  121

Query  2233  ADVEKQSGSFAEAFERHAKREKMEVEEGR  2147
             +++ K  GSF EA  RH ++ K E+  G 
Sbjct  122   SNLRKHKGSFGEALNRHEEKFKSELRHGN  150



>ref|XP_010263209.1| PREDICTED: TMV resistance protein N-like isoform X2 [Nelumbo 
nucifera]
Length=977

 Score =   250 bits (638),  Expect(2) = 3e-98, Method: Compositional matrix adjust.
 Identities = 163/374 (44%), Positives = 235/374 (63%), Gaps = 4/374 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL E A L G  L+    G E++FIQ I+ E++ KLN    +V  Y +G+  RV ++ 
Sbjct  156   REALTESANLPGWDLRNVATGCESKFIQVIVEEVLTKLN---FNVAKYPIGIDFRVREMY  212

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               L   S DV +  I G+GG+GKTT+AK  YNL + +F+GS FL NVR  SE PNG V L
Sbjct  213   SLLDIWSDDVRIVGISGMGGIGKTTIAKATYNLIFHKFDGSSFLGNVREVSEQPNGLVSL  272

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+++  +ILK     I + + GI  IK  + +K+V +V DDVDQ   L+ + G  +WF  
Sbjct  273   QEKLLSDILKKENLGISDVNIGINVIKKRLSTKRVIVVLDDVDQQIQLNSLAGKSNWFGL  332

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS+IIITTR E+LL   E    YK+KELDD+ES++L  R+AF ++ P E  ++ S     
Sbjct  333   GSRIIITTRNEHLLHQLEVDEIYKLKELDDKESVQLLSRHAFRKNHPTEDYLDISKHIAG  392

Query  1395  HCGGLPLALKDLGSYLSG-RSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFV  1219
             H GGLPLAL+  GS+L G R+M  W++ +E+L RI   +I R L  SL  LDD ++ +F+
Sbjct  393   HVGGLPLALEVQGSFLCGRRNMPEWKNTVEELIRIPCDQIYRRLRTSLGDLDDKERDIFL  452

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC FVG D+D+AI + E C     +GI +L+  SL+T++  N+L+M  L+++M KEI+
Sbjct  453   DIACFFVGMDKDYAIGIWESCGFFSKIGISDLVQRSLITINERNELVMHDLLRDMAKEIV  512

Query  1038  RQDSRDDLHTLSKL  997
              ++S  D    S+L
Sbjct  513   CEESFKDSGKRSRL  526


 Score =   139 bits (349),  Expect(2) = 3e-98, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 95/137 (69%), Gaps = 1/137 (1%)
 Frame = -1

Query  2542  PRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresr  2363
             P + Y  FLSFRGEDTRKNF + L++ALI  G+  F+DD+E+ RGE I +EL + I ES+
Sbjct  20    PPWNYEVFLSFRGEDTRKNFINPLHSALIEKGVLAFKDDNELRRGEEISSELLKAIAESK  79

Query  2362  isiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERH  2183
              SI+V S++YASSRWCLDELL I+  RK+ G  V P+FY V R  V  QSGSFAEAF  H
Sbjct  80    TSIVVISRNYASSRWCLDELLKIMECRKTMGQLVMPVFYEVDRLVVRNQSGSFAEAFAAH  139

Query  2182  AKREK-MEVEEGRVEWK  2135
              +R K  E+ E    W+
Sbjct  140   EERFKEAEMVEKMQNWR  156



>ref|XP_007203445.1| hypothetical protein PRUPE_ppa022023mg [Prunus persica]
 gb|EMJ04644.1| hypothetical protein PRUPE_ppa022023mg [Prunus persica]
Length=988

 Score =   308 bits (790),  Expect(2) = 5e-98, Method: Compositional matrix adjust.
 Identities = 184/366 (50%), Positives = 252/366 (69%), Gaps = 11/366 (3%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL EVA L GMVLQ + DGHE++FI KI++ I +KL R  LSVP   +G  SR+ ++N
Sbjct  89    RKALAEVADLAGMVLQNQADGHESKFINKIVQVIGEKLRRRPLSVPHIMIGRHSRIHELN  148

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S DVG+ VI G+ G+GKTT+AK  YN +++RFEGS F+ N+R  S+ PNG V +
Sbjct  149   LWLQDGSDDVGILVIYGMSGIGKTTIAKYVYNTDFERFEGSSFIENIREISQQPNGLVQI  208

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q  +  +IL GR+  I +  +G+ +I+DAI SKKVF+V DDVD +  LDVV+  +D F  
Sbjct  209   QTHLLSDILYGRKVKIQSVSKGMAEIEDAISSKKVFLVLDDVDHISQLDVVLRMKDQFYP  268

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR   LLK H+    + ++ L  EESL+LF  +AFGQD P+E  +EYS K + 
Sbjct  269   GSKIIITTRRAGLLKAHQDTKVHAVETLTQEESLELFSWHAFGQDHPIEDYIEYSEKLVD  328

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HC GLPLAL+ LGS L G S+ VW+S LEKL+          L +S + L DD+DK+LF+
Sbjct  329   HCRGLPLALQVLGSSLLGESIGVWKSALEKLK----------LRVSYDSLQDDHDKKLFL  378

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F+GKD+D+   +L+ CD + +VGIQNLID  LV ++  +K+ M  LI+ MG+EI+
Sbjct  379   HIACFFIGKDKDYIAKILDGCDFYTIVGIQNLIDRCLVIINGWDKVQMHDLIRGMGREIV  438

Query  1038  RQDSRD  1021
             R +S +
Sbjct  439   RLESNE  444


 Score = 80.1 bits (196),  Expect(2) = 5e-98, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 50/79 (63%), Gaps = 6/79 (8%)
 Frame = -1

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKRE  2171
             VFSK+YASSRWCLDEL+ IL  R S  H V P+FY V  +DV  Q+GS A+AF RH K +
Sbjct  22    VFSKNYASSRWCLDELVMIL-ERLSADHVVLPVFYDVDPSDVRNQTGSLAKAFARHQKTQ  80

Query  2170  KMEVEEGRV-EWKGKGGEV  2117
                    RV EW+    EV
Sbjct  81    P----SNRVKEWRKALAEV  95



>ref|XP_010263207.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010263208.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nelumbo 
nucifera]
Length=1186

 Score =   250 bits (638),  Expect(2) = 5e-98, Method: Compositional matrix adjust.
 Identities = 163/374 (44%), Positives = 235/374 (63%), Gaps = 4/374 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL E A L G  L+    G E++FIQ I+ E++ KLN    +V  Y +G+  RV ++ 
Sbjct  156   REALTESANLPGWDLRNVATGCESKFIQVIVEEVLTKLN---FNVAKYPIGIDFRVREMY  212

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               L   S DV +  I G+GG+GKTT+AK  YNL + +F+GS FL NVR  SE PNG V L
Sbjct  213   SLLDIWSDDVRIVGISGMGGIGKTTIAKATYNLIFHKFDGSSFLGNVREVSEQPNGLVSL  272

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+++  +ILK     I + + GI  IK  + +K+V +V DDVDQ   L+ + G  +WF  
Sbjct  273   QEKLLSDILKKENLGISDVNIGINVIKKRLSTKRVIVVLDDVDQQIQLNSLAGKSNWFGL  332

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS+IIITTR E+LL   E    YK+KELDD+ES++L  R+AF ++ P E  ++ S     
Sbjct  333   GSRIIITTRNEHLLHQLEVDEIYKLKELDDKESVQLLSRHAFRKNHPTEDYLDISKHIAG  392

Query  1395  HCGGLPLALKDLGSYLSG-RSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFV  1219
             H GGLPLAL+  GS+L G R+M  W++ +E+L RI   +I R L  SL  LDD ++ +F+
Sbjct  393   HVGGLPLALEVQGSFLCGRRNMPEWKNTVEELIRIPCDQIYRRLRTSLGDLDDKERDIFL  452

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC FVG D+D+AI + E C     +GI +L+  SL+T++  N+L+M  L+++M KEI+
Sbjct  453   DIACFFVGMDKDYAIGIWESCGFFSKIGISDLVQRSLITINERNELVMHDLLRDMAKEIV  512

Query  1038  RQDSRDDLHTLSKL  997
              ++S  D    S+L
Sbjct  513   CEESFKDSGKRSRL  526


 Score =   138 bits (348),  Expect(2) = 5e-98, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 95/137 (69%), Gaps = 1/137 (1%)
 Frame = -1

Query  2542  PRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresr  2363
             P + Y  FLSFRGEDTRKNF + L++ALI  G+  F+DD+E+ RGE I +EL + I ES+
Sbjct  20    PPWNYEVFLSFRGEDTRKNFINPLHSALIEKGVLAFKDDNELRRGEEISSELLKAIAESK  79

Query  2362  isiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERH  2183
              SI+V S++YASSRWCLDELL I+  RK+ G  V P+FY V R  V  QSGSFAEAF  H
Sbjct  80    TSIVVISRNYASSRWCLDELLKIMECRKTMGQLVMPVFYEVDRLVVRNQSGSFAEAFAAH  139

Query  2182  AKREK-MEVEEGRVEWK  2135
              +R K  E+ E    W+
Sbjct  140   EERFKEAEMVEKMQNWR  156



>ref|XP_010263318.1| PREDICTED: TMV resistance protein N-like isoform X2 [Nelumbo 
nucifera]
Length=741

 Score =   257 bits (657),  Expect(2) = 6e-98, Method: Compositional matrix adjust.
 Identities = 163/373 (44%), Positives = 236/373 (63%), Gaps = 3/373 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             +E+L E A L G  LQ+  DG+ ++FIQ I+ E  KKLN     V +Y VG+  RV +IN
Sbjct  156   KESLAEAADLPGWNLQDIADGNVSKFIQVIVEEFSKKLN---FDVATYPVGIDLRVEEIN  212

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               L  +S DV +  ICG+GGVGKTT+AK  YNL   RFEG CFLAN+R   E PNG V L
Sbjct  213   SLLSIQSDDVRIVGICGMGGVGKTTIAKAVYNLISCRFEGGCFLANIREVLEQPNGLVHL  272

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+ +  +IL+     I    EG   IK+ +  K+V IV DDVDQ   L  ++G+ +WF  
Sbjct  273   QELLLSDILREERPRINEVGEGTKMIKERLFRKRVLIVLDDVDQKSQLIALVGSCNWFGL  332

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS+II+TTR E+LL   E    Y++KEL+ EESL+L  R+AF ++ P+E   E S   I 
Sbjct  333   GSRIIVTTRNEHLLCEIEADEIYQVKELNSEESLQLLSRHAFRRNHPMEDYKELSSDVIN  392

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFVL  1216
             + GGLPLAL+  GS+L  + +  W++ L+KLERI H++IQ+ L I  + LDD +K +F+ 
Sbjct  393   YVGGLPLALEVQGSFLFEKGISEWKNSLKKLERIPHNQIQQKLRIVFDELDDVEKDIFLD  452

Query  1215  IACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEILR  1036
             IAC F G D+D AI +L  CD  P +G   L+   L+T++  N+L M  ++++MG++++ 
Sbjct  453   IACFFNGMDKDSAITILGGCDFFPEIGTSFLLRRCLITINEKNELWMHDMLRDMGRQVVY  512

Query  1035  QDSRDDLHTLSKL  997
             ++S ++    S+L
Sbjct  513   EESPEEPGKRSRL  525


 Score =   131 bits (329),  Expect(2) = 6e-98, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 101/141 (72%), Gaps = 1/141 (1%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresri  2360
             R+ Y  FLSFRGEDTR++F D LY+AL++  I  F+DD+++ RGE I +EL + I ES+ 
Sbjct  21    RWNYDVFLSFRGEDTRRSFIDPLYSALVDGRILAFKDDEKLRRGEEISSELLKAIEESKS  80

Query  2359  siIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHA  2180
             SI+VFS++YASS+WCLDEL  I+  +K+ G  V P+FY V ++DV +Q+G+FAEAF RH 
Sbjct  81    SIVVFSRNYASSKWCLDELAKIVECKKTMGLLVLPVFYDVDQSDVREQTGTFAEAFVRHE  140

Query  2179  KREK-MEVEEGRVEWKGKGGE  2120
             +R K  E+ +   +WK    E
Sbjct  141   ERFKGTEMLDKVQKWKESLAE  161



>ref|XP_009804962.1| PREDICTED: TMV resistance protein N-like isoform X2 [Nicotiana 
sylvestris]
Length=1231

 Score =   292 bits (748),  Expect(2) = 7e-98, Method: Compositional matrix adjust.
 Identities = 178/366 (49%), Positives = 249/366 (68%), Gaps = 4/366 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             + AL EVA L GMVLQ + DG E++FI++I++ + +KLNR VLSV  + VG+ SRV  IN
Sbjct  142   KAALTEVADLGGMVLQNQSDGCESKFIEEIVKVVARKLNRAVLSVALHPVGIDSRVRDIN  201

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+ V +  I G+GG+GKTT+AK AYNLN+D+F+GS FLA+V   SE  +G V L
Sbjct  202   LWLQDGSTSVDIMAIYGMGGIGKTTLAKTAYNLNFDKFDGSSFLADVNKTSERHDGLVNL  261

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  N+L  + E I+N DEG+ KI++AI  +++ +V DDVD  + L+VV+G R W+  
Sbjct  262   QRQLLSNVLGKKVEKIYNVDEGVSKIQEAIRCRRILLVLDDVDDRDQLNVVLGMRGWYYP  321

Query  1575  GSKIIITTRCENLLKGHE--RHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKA  1402
             GSKIIITTR ++L    E  R   YK+  L+ +ES++LF  +AFG++ P E   +     
Sbjct  322   GSKIIITTRNQHLFDASEVCRCKMYKVTPLNAQESIRLFSWHAFGKEQPSEDHKDLLENV  381

Query  1401  IRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYD-KRL  1225
             I HC G+PLALK LGS L  RS++VW S L KL+ I  +KI   L +S + L D D + L
Sbjct  382   ILHCKGIPLALKVLGSSLCDRSIEVWESALRKLKAIPDNKILEKLRVSYDLLPDDDVQNL  441

Query  1224  FVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKE  1045
             F+ I C FVGKD+D+A+ +L+ C    VVG++ L D  L+ +DND KL +  LIQ+MGKE
Sbjct  442   FLDIVCFFVGKDKDYAVTILDGCGFFSVVGLEILSDRCLIEMDND-KLKVHSLIQDMGKE  500

Query  1044  ILRQDS  1027
             I+R +S
Sbjct  501   IIRLES  506


 Score = 95.5 bits (236),  Expect(2) = 7e-98, Method: Composition-based stats.
 Identities = 65/140 (46%), Positives = 86/140 (61%), Gaps = 2/140 (1%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresri  2360
             +F YHAFLS        +F DHL +AL NAGIR FR D E+   E    EL++ I+ESRI
Sbjct  3     QFAYHAFLSL-ATKIGMSFGDHLLSALSNAGIRAFRVD-ELEIDEKGCKELQKTIQESRI  60

Query  2359  siIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHA  2180
              I+VF+K+Y SS  CLDEL+ IL  +++ G  V P+FY V  ++V KQ GSF + F  + 
Sbjct  61    LIVVFTKEYTSSERCLDELVFILESKRTFGRFVLPVFYDVDPSEVRKQKGSFEQDFLMYE  120

Query  2179  KREKMEVEEGRVEWKGKGGE  2120
             +R K   E  R+EW  K  E
Sbjct  121   ERFKSGAEGRRLEWLQKVKE  140



>ref|XP_009804951.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
sylvestris]
Length=1233

 Score =   292 bits (748),  Expect(2) = 8e-98, Method: Compositional matrix adjust.
 Identities = 178/366 (49%), Positives = 249/366 (68%), Gaps = 4/366 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             + AL EVA L GMVLQ + DG E++FI++I++ + +KLNR VLSV  + VG+ SRV  IN
Sbjct  142   KAALTEVADLGGMVLQNQSDGCESKFIEEIVKVVARKLNRAVLSVALHPVGIDSRVRDIN  201

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+ V +  I G+GG+GKTT+AK AYNLN+D+F+GS FLA+V   SE  +G V L
Sbjct  202   LWLQDGSTSVDIMAIYGMGGIGKTTLAKTAYNLNFDKFDGSSFLADVNKTSERHDGLVNL  261

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  N+L  + E I+N DEG+ KI++AI  +++ +V DDVD  + L+VV+G R W+  
Sbjct  262   QRQLLSNVLGKKVEKIYNVDEGVSKIQEAIRCRRILLVLDDVDDRDQLNVVLGMRGWYYP  321

Query  1575  GSKIIITTRCENLLKGHE--RHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKA  1402
             GSKIIITTR ++L    E  R   YK+  L+ +ES++LF  +AFG++ P E   +     
Sbjct  322   GSKIIITTRNQHLFDASEVCRCKMYKVTPLNAQESIRLFSWHAFGKEQPSEDHKDLLENV  381

Query  1401  IRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYD-KRL  1225
             I HC G+PLALK LGS L  RS++VW S L KL+ I  +KI   L +S + L D D + L
Sbjct  382   ILHCKGIPLALKVLGSSLCDRSIEVWESALRKLKAIPDNKILEKLRVSYDLLPDDDVQNL  441

Query  1224  FVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKE  1045
             F+ I C FVGKD+D+A+ +L+ C    VVG++ L D  L+ +DND KL +  LIQ+MGKE
Sbjct  442   FLDIVCFFVGKDKDYAVTILDGCGFFSVVGLEILSDRCLIEMDND-KLKVHSLIQDMGKE  500

Query  1044  ILRQDS  1027
             I+R +S
Sbjct  501   IIRLES  506


 Score = 95.5 bits (236),  Expect(2) = 8e-98, Method: Composition-based stats.
 Identities = 65/140 (46%), Positives = 86/140 (61%), Gaps = 2/140 (1%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresri  2360
             +F YHAFLS        +F DHL +AL NAGIR FR D E+   E    EL++ I+ESRI
Sbjct  3     QFAYHAFLSL-ATKIGMSFGDHLLSALSNAGIRAFRVD-ELEIDEKGCKELQKTIQESRI  60

Query  2359  siIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHA  2180
              I+VF+K+Y SS  CLDEL+ IL  +++ G  V P+FY V  ++V KQ GSF + F  + 
Sbjct  61    LIVVFTKEYTSSERCLDELVFILESKRTFGRFVLPVFYDVDPSEVRKQKGSFEQDFLMYE  120

Query  2179  KREKMEVEEGRVEWKGKGGE  2120
             +R K   E  R+EW  K  E
Sbjct  121   ERFKSGAEGRRLEWLQKVKE  140



>ref|XP_006344768.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=1205

 Score =   310 bits (793),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 169/364 (46%), Positives = 259/364 (71%), Gaps = 1/364 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             +EAL++VA L GMVLQ + DGHE++FIQKI++ +  KL+R VL +  + +G+  RV KIN
Sbjct  125   KEALKQVADLGGMVLQNQADGHESKFIQKILKVVENKLSRPVLYICPHLIGIERRVEKIN  184

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WL+D S+DV   VICG+GG+GKTT+AK  YNLNY +F+GS FL+N+R  S    G V L
Sbjct  185   SWLEDGSTDVDTLVICGIGGIGKTTMAKYVYNLNYSKFDGSSFLSNIRENSTHHKGFVTL  244

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q   +I K +++ +F+ DEG+ +++DA+  K++ +V DDVD  + LD ++  +D    
Sbjct  245   QRQFLSDICKRKKKPMFSVDEGMTEMRDAVSCKRILLVLDDVDSRDQLDALLEMKDLLYP  304

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSK+I+TTR + LL+  + H  Y+ + L+ +ES++L   +AFGQD P++     S +   
Sbjct  305   GSKVIVTTRNKRLLRPFDVHKLYEFEALNRDESVELLSWHAFGQDCPIKGFEVCSEQVAI  364

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HCGGLPLAL+ LG+ L+GR++D+WRS ++KLE I +H+I + L IS   L DD+DK LF+
Sbjct  365   HCGGLPLALEVLGATLAGRNIDIWRSTIQKLETIPNHQILKKLAISYESLEDDHDKNLFL  424

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              +AC F+GKDRD  I +L +C+ + V+GI+NL+D + V +   N+L+M Q+I++MG++I+
Sbjct  425   HLACFFIGKDRDLVIAILNRCNFYTVIGIENLVDRNFVKISESNRLIMHQMIRDMGRDIV  484

Query  1038  RQDS  1027
             RQ+S
Sbjct  485   RQES  488


 Score = 77.8 bits (190),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 75/132 (57%), Gaps = 15/132 (11%)
 Frame = -1

Query  2527  HAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiIV  2348
                LSF+G      F DHLY AL  AG  T R  D    GE I  +LR+G+ ES ISII+
Sbjct  8     QVLLSFKGN----TFADHLYEALAGAGFVTLRGGDGNEGGEEIKLKLRKGVEESGISIII  63

Query  2347  FSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKREK  2168
             FS DY SS  CLDEL+ IL    S+  +V PIFY V  +DV KQ G   EAF+R+     
Sbjct  64    FSNDYVSSSLCLDELVMILN--CSKRRSVLPIFYHVDPSDVRKQKGRIGEAFDRY-----  116

Query  2167  MEVEEGRV-EWK  2135
                EE +V +WK
Sbjct  117   ---EEAKVRKWK  125



>ref|XP_004231677.2| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
Length=1214

 Score =   295 bits (756),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 180/366 (49%), Positives = 247/366 (67%), Gaps = 4/366 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R  LREVA L GMVLQ + DG E+ FIQ+I++ +V KL RTVLSV    VG+  RV +I+
Sbjct  122   RADLREVADLGGMVLQNQADGSESRFIQEIVKVVVGKLRRTVLSVAPRPVGIDCRVKEID  181

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WL++  + V +  I G+GG+GKTT+AK AYNLN+ RFEGS FLA+V    E  +G   L
Sbjct  182   LWLKEGYNYVDILAIHGMGGIGKTTIAKTAYNLNFHRFEGSSFLADVGKVLEKYDGLGRL  241

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  NIL    E I+N +EG +KI++AI  K+V +V DD+D ++ L+ V+G RDWFS 
Sbjct  242   QRQLLSNILGKDVEKIYNVNEGSVKIQEAISCKRVLLVLDDIDNIDQLNAVLGMRDWFSP  301

Query  1575  GSKIIITTRCENLLKGHE--RHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKA  1402
             GSKIIITTR  +LL   E  R   YK+K LD +ESL+LF  YAFG++ P    M+ ++  
Sbjct  302   GSKIIITTRNGHLLSSTEACRCRMYKLKTLDAKESLQLFSWYAFGEESPPLEYMDLTIDV  361

Query  1401  IRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRL  1225
             + HC G+PLALK LGS L   S+++W S L KL+ I   KI   L IS   L DD  + L
Sbjct  362   VHHCKGIPLALKVLGSSLGDLSIEIWGSALRKLKDIPDSKILEKLRISYECLPDDNVQNL  421

Query  1224  FVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKE  1045
             F+ I C F GKD+D+A+ +L+ C    V+GIQ L+D  L+ +D+ NKLM+ QL+Q+MG+E
Sbjct  422   FLDIVCFFAGKDKDYAVRILDGCGFFSVIGIQILVDRCLLEIDH-NKLMVHQLLQDMGRE  480

Query  1044  ILRQDS  1027
             I+R++S
Sbjct  481   IIREES  486


 Score = 92.0 bits (227),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 82/141 (58%), Gaps = 16/141 (11%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresri  2360
             +F +H FLSF        F DHL+TAL+ AGI +FR DD+         +L+  I+ESRI
Sbjct  4     QFVHHVFLSF----ISNTFGDHLHTALLTAGIPSFRPDDK---------KLQNAIQESRI  50

Query  2359  siIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHA  2180
              I + SKDYASS  CLDEL  ++  RKS G+ + P+FY V  +DV KQ G+F + F    
Sbjct  51    LIAIISKDYASSHRCLDELTHMIQTRKSLGNFLLPVFYDVDPSDVRKQKGTFEQPFFNFE  110

Query  2179  KREKMEVEEGRVEWKGKGGEV  2117
             KR K E  +   +W+    EV
Sbjct  111   KRYKTEKVD---QWRADLREV  128



>ref|XP_008368273.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=1077

 Score =   333 bits (855),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 201/366 (55%), Positives = 256/366 (70%), Gaps = 1/366 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL EVA L GMVLQ E DGHEA+FI+KI++ I  KL+RT LSV  Y VG+ SRV +I 
Sbjct  54    RAALAEVADLAGMVLQNENDGHEAQFIKKIVKVIEAKLSRTPLSVAPYLVGINSRVEEIT  113

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD SSDVG+ VICG+GG+GKTT+A+V YN N+ RFEG  FL N+R  SE PNG V +
Sbjct  114   LWLQDGSSDVGIFVICGIGGIGKTTIAQVVYNSNFSRFEGRSFLENIREISERPNGLVQV  173

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +IL GRE  I +  EGIIKIKD I  KKVF+V DDVD    LD ++  RDWF  
Sbjct  174   QMQLLYDILGGREVKIHSISEGIIKIKDVISCKKVFLVLDDVDHTSQLDAILRMRDWFYP  233

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR   LLK  +    + +K L+  ESL+LF  +AFGQD P+   +E S + + 
Sbjct  234   GSKIIITTRRAGLLKSQKAVKVHNVKTLNHVESLELFSWHAFGQDHPIXGYIELSERVVS  293

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             + GGLPLAL+ LGS LSG+++DVW S L+KLE I +  I   L IS + L DD+DK LF+
Sbjct  294   NSGGLPLALQVLGSSLSGQNLDVWESALKKLEAIPNSDIVNKLRISYDSLQDDHDKNLFL  353

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F+GKD+D  + +L+ C     VGIQNL D  LVTVD  NK+ M Q+I++MG+EI+
Sbjct  354   HIACFFIGKDKDVIVKILDGCGFFTTVGIQNLSDRCLVTVDEYNKVKMHQMIRDMGREIV  413

Query  1038  RQDSRD  1021
             RQ+S++
Sbjct  414   RQESKE  419


 Score = 53.1 bits (126),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 38/62 (61%), Gaps = 3/62 (5%)
 Frame = -1

Query  2299  TILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKREKMEVEEGRVE-WKGKGG  2123
              IL R+K+  H V P+FY +  ++V KQ+G+FA+AF RH K   + + + RV  W+    
Sbjct  1     MILERKKASKHVVIPVFYDIDPSEVRKQTGTFAKAFSRHQK--NLSLSKDRVNGWRAALA  58

Query  2122  EV  2117
             EV
Sbjct  59    EV  60



>ref|XP_009594180.1| PREDICTED: TMV resistance protein N-like [Nicotiana tomentosiformis]
Length=1189

 Score =   286 bits (732),  Expect(2) = 5e-97, Method: Compositional matrix adjust.
 Identities = 172/366 (47%), Positives = 253/366 (69%), Gaps = 2/366 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL+EVA L GM LQ + DGHE++FI+ I+  I  KL    L+   Y + ++ R   I 
Sbjct  146   RNALKEVADLGGMPLQNQADGHESKFIENIVEVIASKLRPRALNNAPYLIEISYRAEDII  205

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S++VG+ VICG+GG+GKTT+AK AYN +   FEGS FLAN+   ++  NG V L
Sbjct  206   LWLQDRSTNVGLYVICGIGGIGKTTLAKFAYNSSARSFEGSSFLANISETAKQCNGLVRL  265

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+F +I+ G+++ I N DEGI+ I+DA+  K++ +V DD+D+++ +D ++G R+W + 
Sbjct  266   QKQVFYDIV-GKKKRISNADEGIMMIEDALRYKQILLVLDDIDEVDQIDTILGMREWLNP  324

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
              SKIIITTR E+LLK    H   K++ L+  +SLKLF  +AFG+D PLE  +E S + + 
Sbjct  325   ASKIIITTRHESLLKPSVPHKVLKVEALNKMDSLKLFSLHAFGEDHPLEIYLELSKRVVI  384

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
              C GLPLAL+ LGS LSGR  ++W S LEKLE I    +   L++S   L DD+DK +F+
Sbjct  385   QCAGLPLALRVLGSALSGRRPEIWGSALEKLETIPDGHVIEKLKVSFYSLEDDHDKNIFL  444

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IA  F+G DRD ++ +L  C  H ++G+QNLID SL+T+++ NKL M QL++++G++I+
Sbjct  445   HIALFFLGMDRDDSVRILNGCGFHTIIGMQNLIDRSLLTINDLNKLEMHQLLRDLGRDIV  504

Query  1038  RQDSRD  1021
             R++S+D
Sbjct  505   RRESQD  510


 Score = 99.0 bits (245),  Expect(2) = 5e-97, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 94/158 (59%), Gaps = 14/158 (9%)
 Frame = -1

Query  2566  QESGISSVP---RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDD-----EIGR  2411
              E  I S+P   R  YH FLSFR +DT K FTDHL+  L+ AG   F+ DD     E  +
Sbjct  1     MEQAIPSLPSISRCSYHVFLSFRAKDTGKTFTDHLHRNLVRAGFHVFKCDDDDYDGEKEK  60

Query  2410  GENIDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRA  2231
              E++ ++L++ I +S++S+IV S++YASS   LD L+ IL ++++ GH V P+F+ V  +
Sbjct  61    KEDLKSKLQKAIEQSKMSVIVLSQNYASSEKYLDLLVMILEQKRNFGHIVLPVFFHVDPS  120

Query  2230  DVEKQSGSFAEAFERHAKREKMEVEEGRVEWKGKGGEV  2117
             DV K  GSF + F  + + +K+       +W+    EV
Sbjct  121   DVRKLKGSFGQPFSVNGESQKLR------DWRNALKEV  152



>ref|XP_010263244.1| PREDICTED: TMV resistance protein N-like [Nelumbo nucifera]
Length=1176

 Score =   260 bits (664),  Expect(2) = 8e-97, Method: Compositional matrix adjust.
 Identities = 165/367 (45%), Positives = 236/367 (64%), Gaps = 1/367 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL E A L G  L++   GH ++FIQ I+ E+  KL +T L V  Y VG+ SRV  + 
Sbjct  149   REALTEAANLSGWDLRKVATGHASKFIQGIVSEVSTKLKQTHLKVAIYPVGIESRVESVI  208

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               L  +S+D  +  I G+GG+GKTT+AK  YNL + RFEGS FLA VR  SE P+G + L
Sbjct  209   SLLHMDSNDFRIIGIYGIGGIGKTTLAKAVYNLIFRRFEGSSFLAYVREVSEEPSGLLQL  268

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+++  +IL      I + D G+  IK  + SK+V +V DDVD L+ L+ + G  DWF  
Sbjct  269   QEKLLADILVKENLKISSIDIGVNMIKRRLKSKRVLVVLDDVDHLKQLEALAGECDWFGL  328

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS+II+TTR ++LL   +    Y +KELD++ES++LF  +AFG+D P E  +E S   + 
Sbjct  329   GSRIIVTTRDKDLLCDLQVSEIYTVKELDNDESIQLFSWHAFGKDHPKEDYVELSNGIVD  388

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             H  GLPLAL+ LGS+LSGRS+  WRS LEKL+ I  ++IQR L IS + L  D +K +F+
Sbjct  389   HVRGLPLALEVLGSFLSGRSVSEWRSALEKLKIIPPNQIQRKLRISYDALGGDAEKDIFL  448

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F+ +D+D+ I +L+ C      GI  L+  SL+T+D  NK+ M  L+++MG+EI+
Sbjct  449   DIACFFIREDKDYIIKILDGCGFCSENGINTLVRRSLITIDEYNKIRMHDLLRDMGREIV  508

Query  1038  RQDSRDD  1018
             R++   D
Sbjct  509   REECPKD  515


 Score =   124 bits (311),  Expect(2) = 8e-97, Method: Composition-based stats.
 Identities = 65/116 (56%), Positives = 83/116 (72%), Gaps = 0/116 (0%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             +  FLSF+GEDT  NFT HLYTAL+  GI TFR + E+GR E +   +   I +SRI+II
Sbjct  17    HDVFLSFKGEDTYTNFTSHLYTALVQIGIHTFRCNIELGRTEEVAPAILEAIEKSRIAII  76

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERH  2183
             VFSK+YA+SRWCLDEL+ IL  R+  G  V PIFY V  ++V KQ+GSF++AF  H
Sbjct  77    VFSKNYATSRWCLDELVKILECRRKVGQWVLPIFYDVDPSNVRKQTGSFSQAFMTH  132



>emb|CAN61853.1| hypothetical protein VITISV_027841 [Vitis vinifera]
Length=1244

 Score =   243 bits (620),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 167/375 (45%), Positives = 236/375 (63%), Gaps = 5/375 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL + A L G  LQ   +G+E++ I+KII EI+ KL+R +L V  + VG++SR+ +I 
Sbjct  146   RAALTQAANLSGWHLQ---NGYESKLIKKIIEEILSKLSRKLLYVDKHLVGVSSRLKEIL  202

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               +  ES+DV +  ICG+GGVGKTT+AKV YNL   +FEG  FLAN+R  S+   G + L
Sbjct  203   LRVSIESNDVRMVGICGIGGVGKTTIAKVVYNLISSQFEGISFLANIREVSK-NCGLLPL  261

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+  +IL G  + I N +EGI  + D + SKKV I+ DDVD L  L+ + G  DWF  
Sbjct  262   QKQLLGDILMGWSQRISNLBEGINVLMDRLHSKKVLIILDDVDDLNQLESLAGNVDWFGI  321

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS+I+ITTR ++LL  H     Y+ KEL+ EE+L+LF +YAF +  P +  M  S   + 
Sbjct  322   GSRIVITTRDKHLLNVHGVSEIYEAKELEPEEALQLFSQYAFKRKSPXKDYMNLSDNVVH  381

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFVL  1216
             +  GLPLALK LGS+L  +++  W S+L KL++ L+ K+Q  L IS + LD   K +F+ 
Sbjct  382   YAKGLPLALKVLGSFLFSKTILEWESELHKLKKELNTKVQDVLRISFDGLDFTQKEIFLD  441

Query  1215  IACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEILR  1036
             +AC F G++ DF I +L+ C  H   GI+ L D  L+ +  DN+L M  LIQ MG EI+R
Sbjct  442   LACFFKGQEYDFVIKILDGCGFHAKSGIRVLSDRCLIDLL-DNRLWMHDLIQQMGWEIVR  500

Query  1035  QDSRDDLHTLSKLLD  991
             Q+   D    S+L D
Sbjct  501   QECPKDPGKWSRLWD  515


 Score =   140 bits (353),  Expect(2) = 1e-96, Method: Composition-based stats.
 Identities = 74/139 (53%), Positives = 94/139 (68%), Gaps = 2/139 (1%)
 Frame = -1

Query  2548  SVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgire  2369
             S   + Y  FLSFRGEDTR++FTDHLY AL+  G+RTFRDD+E+ RG+ I  EL + I E
Sbjct  11    SASHWNYDVFLSFRGEDTRRSFTDHLYAALVEKGVRTFRDDEELERGKEIAPELLKAIEE  70

Query  2368  srisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFE  2189
             SRIS++VFSK+YA S WC+DEL+ I+   K++G  V P+FY V    V KQ+GSF EAF 
Sbjct  71    SRISVVVFSKNYARSGWCMDELVKIIECMKAKGQTVLPVFYDVDPTHVRKQTGSFMEAFA  130

Query  2188  RHAKREKMEVEEGRVEWKG  2132
              H   E  EV E    W+ 
Sbjct  131   SHG--EDTEVIERAKRWRA  147



>ref|XP_006349259.1| PREDICTED: TMV resistance protein N-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006349260.1| PREDICTED: TMV resistance protein N-like isoform X2 [Solanum 
tuberosum]
Length=1174

 Score =   277 bits (709),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 179/439 (41%), Positives = 264/439 (60%), Gaps = 19/439 (4%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R +L EVA + G+VL+   DG E +FIQ+I+ +I  KL+R VLS   Y VG+ SRV +IN
Sbjct  154   RSSLTEVANMAGIVLE---DGDELKFIQEIVEDIWGKLSRKVLSFAPYPVGIYSRVKEIN  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S++    +I G  G+GKTT+AK  +NL+ DRF+ S FL ++R  ++   G + L
Sbjct  211   FWLQDSSTNSRTLMIYGEPGIGKTTIAKALFNLHCDRFQCSRFLGDIREIAKESCGLINL  270

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QK +  ++LK  +  + + D G   IK+ +  KK  +V DDVD L  L  ++ +R+W   
Sbjct  271   QKNLLSDLLKEDKIDLNDIDRGASTIKECLVHKKFLLVLDDVDDLNQLKGLLDSREWIPP  330

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSK+IITT  E+LL   +  + Y+ K +++ E+LKLF  + FGQD P++  M++S + ++
Sbjct  331   GSKVIITTTNEHLLNPLDACVMYETKRMNNYEALKLFSLHTFGQDHPVKEYMKHSKQIVK  390

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HC GLPLAL+ L S L G S+D+W   ++KLER       + LE+S   L DD+DK +F+
Sbjct  391   HCRGLPLALQVLASSLRGGSIDMWEGAIQKLERYSECHNHKVLELSYEALPDDHDKNVFL  450

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC FVGKD+D+ I VL++C  H    IQNLID  L+TV  DNKLMM QL+Q MGKE++
Sbjct  451   DIACFFVGKDKDYTIKVLDECGFHATAEIQNLIDRYLLTVTPDNKLMMHQLLQEMGKEVI  510

Query  1038  RQDSRDDLHTLSKLL---DQLV-----SSTESTGNGVVNESASHVNSP-------KRPYS  904
              ++S  +    S++    D L      + TES    V+    S  + P       KRPY 
Sbjct  511   CRESPIEPGKRSRIWHHKDALSILHEETVTESIEGLVLKMCGSDESKPDRHESISKRPYF  570

Query  903   QEFEDNSIIPHQSNWKRRF  847
              + +  S +  + N  +R 
Sbjct  571   NDSQSTSTLTLKKNSSKRL  589


 Score =   106 bits (265),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 91/130 (70%), Gaps = 1/130 (1%)
 Frame = -1

Query  2572  RTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDA  2393
             R +++ +S  PR  YH +LS+RG++   NF + L+TAL + GI+TF+   E  +G+ + +
Sbjct  3     RVEKASVSR-PRCSYHVYLSYRGKEISVNFINILHTALTDVGIQTFKRHSEARKGKIVGS  61

Query  2392  ELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQS  2213
             EL++ ++ESRISIIVF++DY  SR CLDEL+ IL R++S GH + P+FY V  + + KQ 
Sbjct  62    ELQKAVKESRISIIVFTEDYGYSRRCLDELVNILERKQSAGHMILPVFYRVDPSHIRKQR  121

Query  2212  GSFAEAFERH  2183
              S+A+AF  +
Sbjct  122   ESYAKAFHNY  131



>ref|XP_010665235.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010665237.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1276

 Score =   243 bits (619),  Expect(2) = 2e-96, Method: Compositional matrix adjust.
 Identities = 168/375 (45%), Positives = 236/375 (63%), Gaps = 5/375 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL + A L G  LQ   +G+E++ I+KII EI+ KL+R +L V  + VG++SR+ +I 
Sbjct  146   RAALTQAANLSGWHLQ---NGYESKLIKKIIEEILSKLSRKLLYVDKHLVGVSSRLKEIL  202

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               +  ES+DV +  ICG+GGVGKTT+AKV YNL   +FEG  FLAN+R  S+   G + L
Sbjct  203   LRVSIESNDVRMVGICGIGGVGKTTIAKVVYNLISSQFEGISFLANIREVSK-NCGLLPL  261

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+  +IL G  + I N DEGI  + D + SKKV I+ DDVD L  L+ + G  DWF  
Sbjct  262   QKQLLGDILMGWSQRISNLDEGINVLMDRLHSKKVLIILDDVDDLNQLESLAGNVDWFGI  321

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS+I+ITTR ++LL  H     Y+ KEL+ EE+L+LF +YAF +  P +  M  S   + 
Sbjct  322   GSRIVITTRDKHLLNVHGVSEIYEAKELEPEEALQLFSQYAFKRKSPDKDYMNLSDNVVH  381

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFVL  1216
             +  GLPLALK LGS+L  +++  W S+L KL++ L+ K+Q  L IS + LD   K +F+ 
Sbjct  382   YAKGLPLALKVLGSFLFSKTILEWESELHKLKKELNTKVQDVLRISFDGLDFTQKEIFLD  441

Query  1215  IACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEILR  1036
             +AC F G++ DF I +L+ C  H   GI+ L D  L+ +  DN+L M  LIQ MG EI+R
Sbjct  442   LACFFKGQEYDFVIKILDGCGFHAKSGIRVLSDRCLIDLL-DNRLWMHDLIQQMGWEIVR  500

Query  1035  QDSRDDLHTLSKLLD  991
             Q+   D    S+L D
Sbjct  501   QECPKDPGKWSRLWD  515


 Score =   140 bits (353),  Expect(2) = 2e-96, Method: Composition-based stats.
 Identities = 74/139 (53%), Positives = 94/139 (68%), Gaps = 2/139 (1%)
 Frame = -1

Query  2548  SVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgire  2369
             S   + Y  FLSFRGEDTR++FTDHLY AL+  G+RTFRDD+E+ RG+ I  EL + I E
Sbjct  11    SASHWNYDVFLSFRGEDTRRSFTDHLYAALVEKGVRTFRDDEELERGKEIAPELLKAIEE  70

Query  2368  srisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFE  2189
             SRIS++VFSK+YA S WC+DEL+ I+   K++G  V P+FY V    V KQ+GSF EAF 
Sbjct  71    SRISVVVFSKNYARSGWCMDELVKIIECMKAKGQTVLPVFYDVDPTHVRKQTGSFMEAFA  130

Query  2188  RHAKREKMEVEEGRVEWKG  2132
              H   E  EV E    W+ 
Sbjct  131   SHG--EDTEVIERAKRWRA  147



>ref|XP_010256441.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010256442.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nelumbo 
nucifera]
Length=1120

 Score =   243 bits (621),  Expect(2) = 7e-96, Method: Compositional matrix adjust.
 Identities = 169/406 (42%), Positives = 244/406 (60%), Gaps = 8/406 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL E A L G  L+    GHEA+F+ KI+ E+  KL +  + V ++ VGL SRV K+ 
Sbjct  162   RSALTEAANLSGWDLRYLAKGHEAKFVHKIVEEVFTKLIQMQMKVATHLVGLDSRVEKMT  221

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               L   S DV    I G+GG+GKTT+AK  Y+L + RFEG  FL ++R  SE PNG V L
Sbjct  222   SLLSVGSHDVRFVGIWGMGGIGKTTIAKAIYSLIFHRFEGCSFLHDIRDISEEPNGLVRL  281

Query  1755  QKQIFENILK-GREEIIFNT-DEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWF  1582
             Q+Q+  +IL   +E I  +T D G+  IK+ +  K+V +V D+VDQL  LD +  ARDWF
Sbjct  282   QEQLLSDILMVSKENIRISTLDRGVNLIKEKLSCKRVLVVLDNVDQLNQLDALARARDWF  341

Query  1581  SRGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKA  1402
               GS++IITTR E+LL        YK+++LD EESL+LF  + F +D P+    E +   
Sbjct  342   GMGSRVIITTRDEHLLNELRVDTVYKVRKLDKEESLELFSWHTFRKDHPISEYEELARNI  401

Query  1401  IRHCGGLPLALKDLGSYLSG-RSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRL  1225
             +   GGLPLAL+ LGS+L   RS+  WRS LEKL+RI +  IQ+ L +S + LD+ +K +
Sbjct  402   VSCLGGLPLALQVLGSFLGEYRSIPEWRSALEKLKRIPNKDIQKQLRLSFDALDENEKDI  461

Query  1224  FVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKE  1045
             F+ IAC F+  +++  + VL+ C     +GI  L   SL+ +D  N+L M  L+++MG+E
Sbjct  462   FLDIACFFIRIEKEDVVTVLDSCGFFSEIGISVLARRSLLIIDEKNELRMHDLVRDMGRE  521

Query  1044  ILRQDSRDDLHTLSKLL---DQLVSSTESTGNGVVNESASHVNSPK  916
             I+R+++  +    S+L    D     T+ TG   V   A  +N PK
Sbjct  522   IVREEAPKEPEERSRLWYHEDAFQVLTKHTGTRKVEGLA--LNFPK  565


 Score =   137 bits (346),  Expect(2) = 7e-96, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 90/123 (73%), Gaps = 4/123 (3%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGEDTRKNFT++LYTAL+  GI TFRDD E+ RGE I   L + I ESRI II
Sbjct  25    YDVFLSFRGEDTRKNFTEYLYTALVKKGIHTFRDDKELQRGEEISPALLKAIEESRICII  84

Query  2350  VFSKDYASSRWCLDELLTIL---GRRKSEGHA-VFPIFYSVGRADVEKQSGSFAEAFERH  2183
             +FSK+YASSRWCLDEL  IL   G+++  G   V P+FY +  +DV KQ+GSFAEAF  H
Sbjct  85    IFSKNYASSRWCLDELCKILECRGKKRKIGRTIVMPVFYDIDPSDVRKQTGSFAEAFASH  144

Query  2182  AKR  2174
              KR
Sbjct  145   EKR  147



>ref|XP_010256443.1| PREDICTED: TMV resistance protein N-like isoform X2 [Nelumbo 
nucifera]
Length=1116

 Score =   243 bits (620),  Expect(2) = 8e-96, Method: Compositional matrix adjust.
 Identities = 169/406 (42%), Positives = 244/406 (60%), Gaps = 8/406 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL E A L G  L+    GHEA+F+ KI+ E+  KL +  + V ++ VGL SRV K+ 
Sbjct  162   RSALTEAANLSGWDLRYLAKGHEAKFVHKIVEEVFTKLIQMQMKVATHLVGLDSRVEKMT  221

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               L   S DV    I G+GG+GKTT+AK  Y+L + RFEG  FL ++R  SE PNG V L
Sbjct  222   SLLSVGSHDVRFVGIWGMGGIGKTTIAKAIYSLIFHRFEGCSFLHDIRDISEEPNGLVRL  281

Query  1755  QKQIFENILK-GREEIIFNT-DEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWF  1582
             Q+Q+  +IL   +E I  +T D G+  IK+ +  K+V +V D+VDQL  LD +  ARDWF
Sbjct  282   QEQLLSDILMVSKENIRISTLDRGVNLIKEKLSCKRVLVVLDNVDQLNQLDALARARDWF  341

Query  1581  SRGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKA  1402
               GS++IITTR E+LL        YK+++LD EESL+LF  + F +D P+    E +   
Sbjct  342   GMGSRVIITTRDEHLLNELRVDTVYKVRKLDKEESLELFSWHTFRKDHPISEYEELARNI  401

Query  1401  IRHCGGLPLALKDLGSYLSG-RSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRL  1225
             +   GGLPLAL+ LGS+L   RS+  WRS LEKL+RI +  IQ+ L +S + LD+ +K +
Sbjct  402   VSCLGGLPLALQVLGSFLGEYRSIPEWRSALEKLKRIPNKDIQKQLRLSFDALDENEKDI  461

Query  1224  FVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKE  1045
             F+ IAC F+  +++  + VL+ C     +GI  L   SL+ +D  N+L M  L+++MG+E
Sbjct  462   FLDIACFFIRIEKEDVVTVLDSCGFFSEIGISVLARRSLLIIDEKNELRMHDLVRDMGRE  521

Query  1044  ILRQDSRDDLHTLSKLL---DQLVSSTESTGNGVVNESASHVNSPK  916
             I+R+++  +    S+L    D     T+ TG   V   A  +N PK
Sbjct  522   IVREEAPKEPEERSRLWYHEDAFQVLTKHTGTRKVEGLA--LNFPK  565


 Score =   137 bits (346),  Expect(2) = 8e-96, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 90/123 (73%), Gaps = 4/123 (3%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGEDTRKNFT++LYTAL+  GI TFRDD E+ RGE I   L + I ESRI II
Sbjct  25    YDVFLSFRGEDTRKNFTEYLYTALVKKGIHTFRDDKELQRGEEISPALLKAIEESRICII  84

Query  2350  VFSKDYASSRWCLDELLTIL---GRRKSEGHA-VFPIFYSVGRADVEKQSGSFAEAFERH  2183
             +FSK+YASSRWCLDEL  IL   G+++  G   V P+FY +  +DV KQ+GSFAEAF  H
Sbjct  85    IFSKNYASSRWCLDELCKILECRGKKRKIGRTIVMPVFYDIDPSDVRKQTGSFAEAFASH  144

Query  2182  AKR  2174
              KR
Sbjct  145   EKR  147



>ref|XP_008237268.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=811

 Score =   243 bits (621),  Expect(2) = 9e-96, Method: Compositional matrix adjust.
 Identities = 164/406 (40%), Positives = 244/406 (60%), Gaps = 8/406 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKK-LNRTVLSVPSYTVGLASRVGKI  1939
             R AL +VA L G  L E     E++FIQ II +I K  LN   L V  Y VG+ ++V  +
Sbjct  149   RAALSQVAALSGFTLDER--QSESKFIQNIIEKISKHVLNTVCLEVAEYPVGMQAQVQVM  206

Query  1938  NKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVG  1759
             N+ L    SDV +  + G GG+GKTT+AK  YN    +F+G  FLANVR  S    G VG
Sbjct  207   NELLDLGESDVRMVGVWGTGGIGKTTIAKAVYNSIAHKFKGCSFLANVRERSTSHEGSVG  266

Query  1758  LQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFS  1579
             LQ+ +  +I + +   + N D+G+  IK+ +  +K+ +V DDVD +E L  ++GA DWF 
Sbjct  267   LQENLLSDIQRVKNLKVTNVDKGVTIIKEWLSRRKILLVLDDVDDMEQLHKLVGACDWFG  326

Query  1578  RGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDP-LEHLMEYSVKA  1402
              GS+IIITTR + LL  H+ +L +++K LDD+++L+LFC +AF +  P L+  ++ +  A
Sbjct  327   AGSRIIITTRDKQLLTAHDVNLIHEVKILDDDKALELFCWHAFKRSGPSLDDYVKLAESA  386

Query  1401  IRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLF  1222
             IR+  GLPLALK LGS L G S+D W   L+  +     KIQ  L++S + LDD  K +F
Sbjct  387   IRYAQGLPLALKVLGSCLCGGSIDKWEHALDGFKS---KKIQDVLKVSYDTLDDIVKEVF  443

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
             + IAC F GK R++ I  LE CDL P  GI+ LI+ +L++V++ + + M  L++ MGK+I
Sbjct  444   LDIACFFKGKSRNYVIETLEACDLSPRYGIEVLIEKALISVEHGDYIRMHDLLEEMGKDI  503

Query  1041  LRQDSRDDLHTLSKL-LDQLVSSTESTGNGVVNESASHVNSPKRPY  907
             + Q+S  +    S+L   + V    +   G    +   +NSPK+ Y
Sbjct  504   VEQESPTEAGGRSRLWFHEDVEHVLTNNTGKKKITGIMLNSPKKDY  549


 Score =   137 bits (345),  Expect(2) = 9e-96, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 100/154 (65%), Gaps = 4/154 (3%)
 Frame = -1

Query  2569  TQESGISSVP---RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENI  2399
              +E+  SS P    + YH  LSFRGEDTR NFTDHLY+AL   GI TFRDDDE+ RGE I
Sbjct  3     NREASSSSAPFTKSWKYHVVLSFRGEDTRHNFTDHLYSALCQQGINTFRDDDELIRGEEI  62

Query  2398  DAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEK  2219
              + L   I ES+IS++VFSK+YASS+WCLDEL+ IL  +KS+   V P+FY V  +DV  
Sbjct  63    SSALFTAIEESKISVVVFSKNYASSKWCLDELVKILDCKKSKQQLVIPVFYKVNPSDVRN  122

Query  2218  QSGSFAEAFERHAKREKMEVEEGRVEWKGKGGEV  2117
             Q GSF +A      + K  +++   +W+    +V
Sbjct  123   QRGSFGDALANMECKYKENMQKVN-KWRAALSQV  155



>ref|XP_008391553.1| PREDICTED: uncharacterized protein LOC103453763 [Malus domestica]
Length=1588

 Score =   249 bits (635),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/368 (41%), Positives = 231/368 (63%), Gaps = 6/368 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRT-VLSVPSYTVGLASRVGKI  1939
             + AL E A + GMV+  + D + ++FI+ ++    +++ R+    +  Y VG+ SRV  I
Sbjct  150   KSALTEAANISGMVMLNQADWNASKFIEDLVATTKERVQRSRPFRMSPYLVGIDSRVKDI  209

Query  1938  NKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVG  1759
             N WLQDE SD+G+ V+ G  G+GKTT+AK AYNLN  RF  S FL N+   S++P+G + 
Sbjct  210   NSWLQDEYSDIGLLVVHGTSGIGKTTIAKCAYNLNMARFYRSSFLENISETSQLPSGLLH  269

Query  1758  LQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFS  1579
             +Q+++  +I  GR+  + N  EG  +I  A+ S++ F+V D ++ ++  D V        
Sbjct  270   VQERVLYDIC-GRKVKLKNVSEGKFEIGRAVYSQRFFLVLDGLESMDEFDAVTCGLKEAR  328

Query  1578  RGSKIIITTRCENLLKGHERHLQYKIKE---LDDEESLKLFCRYAFGQDDPLEHLMEYSV  1408
              GSKIIITT    +L        YK+     L+D ESL+LFC +AF Q  P+E  ME S 
Sbjct  329   FGSKIIITTTNARVLSA-ALEFGYKVCTVGILNDNESLELFCWHAFKQFQPIEGYMERSK  387

Query  1407  KAIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKR  1228
               +++CGGLPLAL  LGS LSGRS+D W S L++L+ I    I R L+IS + L D+++ 
Sbjct  388   SIVQYCGGLPLALAILGSSLSGRSIDAWESTLKELKTIPDSSIMRTLKISYDSLYDHERA  447

Query  1227  LFVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGK  1048
             LF+ IAC FVG DRD+ +++L  CD   +  +++LI+  L+T+D DNK+ M +LI ++G+
Sbjct  448   LFLHIACFFVGIDRDYIVSILHGCDFDIIAAMESLIEKCLLTIDRDNKVYMHRLILDVGR  507

Query  1047  EILRQDSR  1024
             EI RQ++R
Sbjct  508   EIARQEAR  515


 Score =   130 bits (327),  Expect(2) = 2e-95, Method: Composition-based stats.
 Identities = 70/125 (56%), Positives = 87/125 (70%), Gaps = 0/125 (0%)
 Frame = -1

Query  2536  FFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresris  2357
             + Y  FLSFRG DTRKNF DH+Y AL   G   FRD DE+ RGE+I +EL R IR+SR S
Sbjct  20    YLYDVFLSFRGGDTRKNFVDHVYAALEKEGFLIFRDGDELERGEDIKSELMRAIRKSRCS  79

Query  2356  iIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAK  2177
             I+VFS+ YASSRWCLDEL+ IL  ++     VFP+FY V  + V  Q GS AEAF+RH K
Sbjct  80    IVVFSEGYASSRWCLDELVMILECKRKFDQFVFPVFYGVDPSHVRDQKGSVAEAFDRHVK  139

Query  2176  REKME  2162
              + ++
Sbjct  140   SQPLD  144


 Score =   130 bits (327),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 68/126 (54%), Positives = 91/126 (72%), Gaps = 0/126 (0%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresri  2360
             ++ Y  FLSFRGEDTR+NF DHLY AL   G+  FRDD+E+ RGE+++  L R IR+SR 
Sbjct  564   QYLYDVFLSFRGEDTRENFVDHLYAALKKEGLLAFRDDNELERGEDVEPRLLRTIRKSRC  623

Query  2359  siIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHA  2180
             SI+VFS+ YASSRWCLDEL+ IL  +++    V P+FY V  +DV KQ+ S A+AF RH 
Sbjct  624   SIVVFSEGYASSRWCLDELVMILECKRTFDQFVLPVFYGVDPSDVRKQTESIAKAFARHE  683

Query  2179  KREKME  2162
             K + ++
Sbjct  684   KGQPLD  689



>gb|ABM55687.1| TIR-NBS-LRR class disease resistance protein [(Populus tomentosa 
x Populus bolleana) x Populus tomentosa]
Length=678

 Score =   234 bits (596),  Expect(2) = 3e-95, Method: Compositional matrix adjust.
 Identities = 152/378 (40%), Positives = 229/378 (61%), Gaps = 5/378 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL+E   L G  L +  +GHEA+FI++II ++  KL+R  LSVP + VG+      I 
Sbjct  181   RKALKEAGNLSGWNLNDMANGHEAKFIKEIINDVFNKLSREYLSVPEHLVGM-DLAHDIL  239

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              +L   + DV +  I G+ G+GKTT+AKV +N  Y RFEGSCFL+N+   S+  NG   L
Sbjct  240   DFLSTATDDVCIAGIHGMPGIGKTTIAKVVFNQLYYRFEGSCFLSNINETSKQFNGLALL  299

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+  +ILK     I   D G + IK+ I  K+V +V DDV   E L+ ++G R W  R
Sbjct  300   QKQLLHDILKQDVANINCVDRGKVLIKERIRRKRVLVVADDVAHPEQLNALMGERSWLGR  359

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS++IITTR  ++L   ++   Y+I+EL   ESL+LF  +A     P E  ME S  A+ 
Sbjct  360   GSRVIITTRDSSVLLKADQ--TYQIEELKPYESLQLFRWHALRDTKPTEDYMELSKDAVD  417

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKR-LFV  1219
             +CGGLPLAL+ +G+ LSG++ D W+  +EKL RI HH IQ  L  S + LD  + R  F+
Sbjct  418   YCGGLPLALEVMGACLSGKNRDGWKCVIEKLRRIPHHDIQGKLRTSFDALDGEELRNAFL  477

Query  1218  LIACHFVGKDRDFAINVL-EKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
              IAC F+ + +++   VL  +C  +P V ++ L + SL+ V+   K+ M  L ++MG+E+
Sbjct  478   DIACFFIDRKKEYVAKVLGARCGYNPEVDLETLRERSLIKVNCFGKITMHDLFRDMGREV  537

Query  1041  LRQDSRDDLHTLSKLLDQ  988
             +R+ S  +    +++ +Q
Sbjct  538   VRESSPKEPGKRTRIWNQ  555


 Score =   145 bits (366),  Expect(2) = 3e-95, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 105/154 (68%), Gaps = 4/154 (3%)
 Frame = -1

Query  2575  ARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENID  2396
             A+T+     S P   Y  FLSFRGEDTRK FTDHLYTAL+ AGI TFRDDDE+ RGE I 
Sbjct  37    AKTEPESSRSRPEGAYDVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEIS  96

Query  2395  AELrrgiresrisiIVFSKDYASSRWCLDELLTIL-GRRKSEGHAVFPIFYSVGRADVEK  2219
               L R I ESRISI+VFSK YASSRWCL+EL+ IL  + +  G  V PIF+ +  +DV K
Sbjct  97    HHLLRAIEESRISIVVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFFDIDPSDVRK  156

Query  2218  QSGSFAEAFERHAKR--EKMEVEEGRVEWKGKGG  2123
             Q+ SFAEAF +H +R  EK+ V+E R   K  G 
Sbjct  157   QTASFAEAFVKHEERSQEKL-VQEWRKALKEAGN  189



>ref|XP_010263317.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nelumbo 
nucifera]
Length=754

 Score =   248 bits (633),  Expect(2) = 3e-95, Method: Compositional matrix adjust.
 Identities = 163/386 (42%), Positives = 236/386 (61%), Gaps = 16/386 (4%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDG-------------HEAEFIQKIIREIVKKLNRTVLSVPS  1975
             +E+L E A L G  LQ+  DG             + ++FIQ I+ E  KKLN     V +
Sbjct  156   KESLAEAADLPGWNLQDIADGCMDFRGFLFIGVRNVSKFIQVIVEEFSKKLN---FDVAT  212

Query  1974  YTVGLASRVGKINKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANV  1795
             Y VG+  RV +IN  L  +S DV +  ICG+GGVGKTT+AK  YNL   RFEG CFLAN+
Sbjct  213   YPVGIDLRVEEINSLLSIQSDDVRIVGICGMGGVGKTTIAKAVYNLISCRFEGGCFLANI  272

Query  1794  RAASEIPNGQVGLQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlel  1615
             R   E PNG V LQ+ +  +IL+     I    EG   IK+ +  K+V IV DDVDQ   
Sbjct  273   REVLEQPNGLVHLQELLLSDILREERPRINEVGEGTKMIKERLFRKRVLIVLDDVDQKSQ  332

Query  1614  ldvVIGARDWFSRGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDP  1435
             L  ++G+ +WF  GS+II+TTR E+LL   E    Y++KEL+ EESL+L  R+AF ++ P
Sbjct  333   LIALVGSCNWFGLGSRIIVTTRNEHLLCEIEADEIYQVKELNSEESLQLLSRHAFRRNHP  392

Query  1434  LEHLMEYSVKAIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISL  1255
             +E   E S   I + GGLPLAL+  GS+L  + +  W++ L+KLERI H++IQ+ L I  
Sbjct  393   MEDYKELSSDVINYVGGLPLALEVQGSFLFEKGISEWKNSLKKLERIPHNQIQQKLRIVF  452

Query  1254  NPLDDYDKRLFVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMM  1075
             + LDD +K +F+ IAC F G D+D AI +L  CD  P +G   L+   L+T++  N+L M
Sbjct  453   DELDDVEKDIFLDIACFFNGMDKDSAITILGGCDFFPEIGTSFLLRRCLITINEKNELWM  512

Query  1074  PQLIQNMGKEILRQDSRDDLHTLSKL  997
               ++++MG++++ ++S ++    S+L
Sbjct  513   HDMLRDMGRQVVYEESPEEPGKRSRL  538


 Score =   130 bits (328),  Expect(2) = 3e-95, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 101/141 (72%), Gaps = 1/141 (1%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresri  2360
             R+ Y  FLSFRGEDTR++F D LY+AL++  I  F+DD+++ RGE I +EL + I ES+ 
Sbjct  21    RWNYDVFLSFRGEDTRRSFIDPLYSALVDGRILAFKDDEKLRRGEEISSELLKAIEESKS  80

Query  2359  siIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHA  2180
             SI+VFS++YASS+WCLDEL  I+  +K+ G  V P+FY V ++DV +Q+G+FAEAF RH 
Sbjct  81    SIVVFSRNYASSKWCLDELAKIVECKKTMGLLVLPVFYDVDQSDVREQTGTFAEAFVRHE  140

Query  2179  KREK-MEVEEGRVEWKGKGGE  2120
             +R K  E+ +   +WK    E
Sbjct  141   ERFKGTEMLDKVQKWKESLAE  161



>ref|XP_006370901.1| hypothetical protein POPTR_0019s01560g, partial [Populus trichocarpa]
 gb|ERP48698.1| hypothetical protein POPTR_0019s01560g, partial [Populus trichocarpa]
Length=758

 Score =   243 bits (619),  Expect(2) = 9e-95, Method: Compositional matrix adjust.
 Identities = 153/353 (43%), Positives = 231/353 (65%), Gaps = 1/353 (0%)
 Frame = -2

Query  2052  HEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKINKWLQDESSDvgvgvicglggv  1873
             HEA+FI+KI+ EI ++L+ T L +  Y VG+ SRV ++N  L   S++V +  ICG+GG+
Sbjct  140   HEAKFIKKIVGEISRELSSTYLFIAFYPVGINSRVQQLNFLLNAGSNEVCIVGICGMGGI  199

Query  1872  GKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGLQKQIFENILKGREEIIFNTDE  1693
             GKTT+AK  Y   +  F+G CFLANVR  S+ PNG V LQ+Q+  +ILK  +  I N D 
Sbjct  200   GKTTIAKAMYYELFHSFDGKCFLANVREISQQPNGHVKLQEQLLFDILKTDKIKIGNVDR  259

Query  1692  GIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSRGSKIIITTRCENLLKGHERHL  1513
             G+  IK+ + S+KV ++ DDVD+L+ L  + G+RDWF  GS+II+TTR +++L       
Sbjct  260   GMNMIKERLHSRKVLLILDDVDKLDQLQAIAGSRDWFGSGSRIIVTTRDKHVLTVLGADR  319

Query  1512  QYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIRHCGGLPLALKDLGSYLSGRSM  1333
              Y  +E++D E+L+LF  +AF    P+E   E S + + +CG LPLAL+ +GS+L GRS+
Sbjct  320   VYMAREMNDIEALELFSWHAFRTSHPVEDYKELSEQIVDYCGRLPLALEVIGSFLFGRSI  379

Query  1332  DVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFVLIACHFVGKDRDFAINVLEKC  1156
               W+S LEKL RI   +IQ+ L+IS + L DD  K LF+ I+C FVG D+++ + +L  C
Sbjct  380   VEWKSALEKLRRIPDDQIQKKLQISFDGLNDDTQKDLFLDISCFFVGMDKEYVLPILNGC  439

Query  1155  DLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEILRQDSRDDLHTLSKL  997
             D    +G+  L    LV+V+  NKL+M  L++++G+EI+R  S ++    S+L
Sbjct  440   DFFADIGLGVLTQRCLVSVNEKNKLIMHDLLRDLGREIVRAQSPNNPGRRSRL  492


 Score =   135 bits (339),  Expect(2) = 9e-95, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = -1

Query  2536  FFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresris  2357
             + Y  FLSFRGEDTRKNFTDHLY AL +AGI TFRDD+E+  GE+I  EL + I++SRIS
Sbjct  19    WIYDVFLSFRGEDTRKNFTDHLYFALKDAGINTFRDDNELRSGEDISTELLQAIQKSRIS  78

Query  2356  iIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAK  2177
             +I+FS++YA+SRWCL+ L+ I+   +S    VFPIFY V  +DV KQ+GSFAEAF  H +
Sbjct  79    VILFSRNYANSRWCLEGLVKIMECWRSWRQLVFPIFYDVDPSDVRKQTGSFAEAFSGHEE  138

Query  2176  R  2174
             R
Sbjct  139   R  139



>ref|XP_008238607.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=539

 Score =   254 bits (650),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 163/379 (43%), Positives = 237/379 (63%), Gaps = 5/379 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREI-VKKLNRTVLSVPSYTVGLASRVGKI  1939
             R AL + A   G       DGHE++FI  I+ EI ++  NRT L V  Y VGL SRV  +
Sbjct  159   RAALTQAANFSGWHFP---DGHESKFIHNIVEEISLQTSNRTYLKVAKYPVGLESRVRDM  215

Query  1938  NKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVG  1759
             ++ L    +DV +  I GLGG+GKTT+AK  Y     +FEG+CFLANVR  S +P+G V 
Sbjct  216   DELLSLGENDVRMIGIWGLGGIGKTTIAKAVYGSIAHKFEGNCFLANVREMSSMPHGLVE  275

Query  1758  LQKQIFENILKG-REEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWF  1582
             LQK +  +IL G R+  + + D+G   I+  + +++V +V DDVD    LD + G  +WF
Sbjct  276   LQKTLLSDILGGNRKFKVTSVDQGANTIETRLRNRRVLLVLDDVDHRHQLDNLAGGSNWF  335

Query  1581  SRGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKA  1402
              RGS+II+TTR ++LL  H  +L YK+KELD  ES +LF   +F +D P    ++   +A
Sbjct  336   GRGSRIIVTTRDKHLLTAHGVNLTYKVKELDFYESSELFSWNSFKRDKPPNDYLKLVGRA  395

Query  1401  IRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLF  1222
             + +  GLPLAL  LGS+L GRS++ W+  L+  E I + +IQ  L+IS N L+ + K +F
Sbjct  396   VCYTKGLPLALTVLGSHLCGRSIEEWKDALDSYEIIPNKEIQEILKISFNGLEHFQKEVF  455

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
             + IAC F G+D+D  +++L  CDL P++ I+ LID SL+ V+  N L M  L+++MGKEI
Sbjct  456   LDIACFFKGEDKDQIVDILRSCDLFPIISIRVLIDKSLLVVNEHNMLTMHDLLEDMGKEI  515

Query  1041  LRQDSRDDLHTLSKLLDQL  985
             +RQ+S  +    S+L  QL
Sbjct  516   VRQESPTEPGERSRLWVQL  534


 Score =   122 bits (306),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 81/119 (68%), Gaps = 1/119 (1%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresri  2360
             R+ Y  FLSFRGEDTR NFT HLYTAL   G+ TF DD E+ RGE I   L + I+ES  
Sbjct  22    RWSYDVFLSFRGEDTRNNFTGHLYTALCQRGLNTFMDD-ELRRGEEIAPTLIKAIQESMA  80

Query  2359  siIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERH  2183
             SI+VFS++YASS+WCLDEL  IL  ++S+   V PIFY V  +D+  Q GSF  A  RH
Sbjct  81    SIVVFSENYASSKWCLDELACILDCKESKRQIVLPIFYKVDPSDIRNQRGSFGVALSRH  139



>ref|XP_008364791.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=452

 Score =   233 bits (594),  Expect(2) = 4e-94, Method: Compositional matrix adjust.
 Identities = 143/293 (49%), Positives = 197/293 (67%), Gaps = 0/293 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL E+A L GMVLQ + DG+E++FI+KI++ I  KL+R  LSV    +G+ S+  +IN
Sbjct  151   RKALTEIADLAGMVLQNQADGYESKFIKKIVKVIGDKLSRMPLSVEPKLIGIQSQAERIN  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              W QD SSDVG+ V+ G+ G+GKTT+AK  YN N+  F+GS F+ N++  ++ PNG V +
Sbjct  211   LWFQDGSSDVGIFVVYGMSGIGKTTIAKHVYNSNFGSFQGSSFIENIKETADRPNGLVQI  270

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +IL GRE  I +  EGIIKI+ AI SK+V +V DDVD ++ LD ++  +D F  
Sbjct  271   QMQLLCDILNGREVKIHSVSEGIIKIEXAISSKRVLLVLDDVDHMDQLDAILXMKDQFYP  330

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKI+ITTR E LLK  +    ++++ LD  ESLKLF  +AFGQD P+E  ME+S + + 
Sbjct  331   GSKILITTRXERLLKADQVTXVHRVQTLDXXESLKLFSWHAFGQDHPIEEYMEHSKQJVZ  390

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDY  1237
             H  GLPLALK LGS LSG  + VW S LEKL+ I   K+    + SL  + DY
Sbjct  391   HSXGLPLALKVLGSSLSGXXIGVWESALEKLKVIPDEKLFAKNQKSLRNVVDY  443


 Score =   142 bits (358),  Expect(2) = 4e-94, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 93/130 (72%), Gaps = 1/130 (1%)
 Frame = -1

Query  2536  FFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresris  2357
             + Y  FLSFRGE+TRK FTDHLYTAL NAG  TFRDDDE+ RGE I   L++ I++SR S
Sbjct  20    YXYDVFLSFRGEETRKTFTDHLYTALNNAGFLTFRDDDELERGEYIKPGLQKAIQQSRTS  79

Query  2356  iIVFSKDYASSRWCLDELLTILGR-RKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHA  2180
             ++VFSKDYASSRWCLDEL+ IL R R +  H V P+FY V  + V KQ+GS  +AF R  
Sbjct  80    VVVFSKDYASSRWCLDELVLILERKRTTSDHVVLPVFYDVDPSHVRKQTGSVGKAFARSQ  139

Query  2179  KREKMEVEEG  2150
             K +  E  EG
Sbjct  140   KNQSSEKVEG  149



>ref|XP_009771867.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
Length=1171

 Score =   269 bits (687),  Expect(2) = 4e-94, Method: Compositional matrix adjust.
 Identities = 169/443 (38%), Positives = 263/443 (59%), Gaps = 19/443 (4%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R +L+EVA + G+VL+   DG E  FIQ+I+ +I  K++R VLS+  Y VG+  RV +I+
Sbjct  156   RASLKEVANMAGIVLE---DGDELTFIQEIVEDIWGKMSRKVLSIAQYPVGIYHRVKEIS  212

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD  +     +I G  G+GKTT+A+  +NL+ DRF+ S FLAN+R  ++  +  + L
Sbjct  213   FWLQDSLTGAHTLMIYGEPGIGKTTIARALFNLHCDRFQYSSFLANIREIAKESSSLISL  272

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QK +  ++LK     +++ D G  KIK+ +  ++  +V DDVD L+ L  ++ +RDW   
Sbjct  273   QKNLLSDLLKEDRIDLYDIDGGASKIKECLVHRRFLLVLDDVDDLDQLKALLDSRDWIPP  332

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSK+IITT  ++L+  H+  + Y+ K  D  E+L+LF  + FGQD P +  M  S + ++
Sbjct  333   GSKVIITTTNKSLVNPHDACVMYEAKRFDIPEALQLFSLHTFGQDHPAKEYMMQSKQIVK  392

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             HC G+PLAL+ L S L G S+D+W + + KLER       + LE+S   L DD++K +F+
Sbjct  393   HCRGVPLALQVLASSLRGGSIDLWEAAINKLERYSEFHKHKILELSYEALPDDHEKNVFL  452

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC FVGKD+D+ I +L++C  H    IQNLID  L+TV  +NKLMM QL+Q MGKE++
Sbjct  453   DIACFFVGKDKDYTIKILDECGFHATAEIQNLIDRCLLTVTPENKLMMHQLLQEMGKEVI  512

Query  1038  RQDSRDDLHTLSKLL---DQLVSSTESTGNGVV------------NESASHVNSPKRPYS  904
              ++S  +    S++    D L    E T    +            ++S  H N  KRP+ 
Sbjct  513   CRESPTEPGKRSRIWHHKDALSILQEETVTESIEGLTLKMRGSDESKSDKHENMSKRPHC  572

Query  903   QEFEDNSIIPHQSNWKRRFMGIF  835
              +  + S +  +++ KR  +  F
Sbjct  573   DDSPNTSTLILKNSSKRLCLRFF  595


 Score =   106 bits (265),  Expect(2) = 4e-94, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 88/130 (68%), Gaps = 1/130 (1%)
 Frame = -1

Query  2572  RTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDA  2393
             R +++  SS PR  YH +LS+RG++   NF + L+T L   G+RTF+   E  +G+ + +
Sbjct  5     RAEKASFSS-PRCPYHVYLSYRGQEISMNFINLLHTELTRVGLRTFKKHGEARKGKIVGS  63

Query  2392  ELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQS  2213
             EL++  +E+RISIIVFS+DYA SR CLDEL+ IL R+ S GH + P+FY +  + V KQ 
Sbjct  64    ELQKAFKEARISIIVFSEDYAYSRRCLDELVNILERKFSAGHMILPVFYHMDPSHVRKQK  123

Query  2212  GSFAEAFERH  2183
             GS+A+A   +
Sbjct  124   GSYAKALHNY  133



>ref|XP_010263405.1| PREDICTED: uncharacterized protein LOC104601664 [Nelumbo nucifera]
Length=2291

 Score =   254 bits (650),  Expect(2) = 4e-94, Method: Compositional matrix adjust.
 Identities = 158/364 (43%), Positives = 238/364 (65%), Gaps = 1/364 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL EVA L G  L+     ++++FIQ I+  ++ KLN  +L V +Y VG+ SR+G + 
Sbjct  1276  RTALTEVANLSGWDLRNVAYRNQSKFIQGIVEGVLTKLNNKLLDVTTYLVGMDSRMGDVY  1335

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               L   SSD+ +  ICG+GG+GKTT+AK  YN+ + RF G CFL +VR  SE PNG V L
Sbjct  1336  SLLNVYSSDIRIIGICGMGGIGKTTIAKAVYNITFRRFNGRCFLQHVREVSEQPNGLVCL  1395

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+   +L  ++  + N  EGI +IK+ + +K+V IV DDVDQL+ ++V+   R+WF  
Sbjct  1396  QEQLLSGVLMEKDLKVINISEGINQIKERLSNKRVLIVLDDVDQLDQINVLAREREWFGS  1455

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS+IIITTR E+LL   E    YK  EL ++ES++LF  +AF +  P+E  ++ +   +R
Sbjct  1456  GSRIIITTRDEHLLYELEVDEIYKATELTEDESIELFSWHAFRKYHPIEGYVDLTNNLVR  1515

Query  1395  HCGGLPLALKDLGSYL-SGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFV  1219
             H GG+PLAL+ LGS+L   RS+  W S LEKLE+I  ++IQ+ L IS + L+  +K +F+
Sbjct  1516  HVGGIPLALEVLGSFLHDKRSIPEWTSALEKLEKIPPNQIQKKLRISFDALNHQEKNIFL  1575

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F+G D+D    +L+ C+     GI  L+  SL+TV+  N++ M  L+++MG+EI+
Sbjct  1576  DIACFFIGMDKDIVTIILDGCEFPSEFGIGILVRRSLMTVNEKNEVRMHDLLRDMGREIV  1635

Query  1038  RQDS  1027
             R++S
Sbjct  1636  REES  1639


 Score =   120 bits (302),  Expect(2) = 4e-94, Method: Composition-based stats.
 Identities = 68/132 (52%), Positives = 91/132 (69%), Gaps = 3/132 (2%)
 Frame = -1

Query  2572  RTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRD--DDEIGRGENI  2399
             + QE+  S+ P + Y  F+SFRGE T +NF D LY AL+  GI T RD  +DE+ RG   
Sbjct  1128  QAQEASTSTHP-WNYDVFMSFRGEYTNRNFIDRLYAALVKRGIHTLRDNSEDELERGRQA  1186

Query  2398  DAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEK  2219
              +E  R I+ESR+++IVFS++YASS WCLD+L+ IL  R++ G  V P+FY V  +DV K
Sbjct  1187  PSEPMRIIQESRVAVIVFSRNYASSSWCLDKLVRILECRRTIGQLVLPVFYDVDPSDVRK  1246

Query  2218  QSGSFAEAFERH  2183
             Q G FAEAF+RH
Sbjct  1247  QCGDFAEAFKRH  1258


 Score =   229 bits (583),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 156/371 (42%), Positives = 233/371 (63%), Gaps = 10/371 (3%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL++   L G  L       +   I++I+R ++ KL++T+L + +Y VG+ SRV ++N
Sbjct  139   RTALKQAGNLSGWHLDNATKREQILIIKQIVRVVLTKLSKTLLDITTYPVGIDSRVERVN  198

Query  1935  KWLQDESS--DvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQV  1762
               L+   S  D+ +  ICG+GG+GKTT+AK  YNL +  FEGS FLANV   S+  NG V
Sbjct  199   SLLKIHQSGDDIRIVGICGMGGIGKTTIAKSVYNLLFHSFEGSSFLANVNEDSKKSNGLV  258

Query  1761  GLQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWF  1582
              LQ+++  NILK     I N DEGI  IK  +GS++V +V DDV Q+  L+ +   R WF
Sbjct  259   LLQEKLLSNILKEERLKISNVDEGITLIKGRLGSRRVLLVLDDVHQINQLNALARERSWF  318

Query  1581  SRGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKA  1402
               GS+IIIT+R E++L       +Y  + L D+ES++LF  +AFG D P E  +  S   
Sbjct  319   GAGSRIIITSRDEDVLDVLHVDEKYNAETLSDDESIQLFSWHAFGIDQPKEEYLGVSKDI  378

Query  1401  IRHCGGLPLALKDLGSYLS-GRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYD--K  1231
             + +  GLPLAL+ LGS+L+  RSM  WRS LEKL+RI +++IQ+ L IS + LDD +  K
Sbjct  379   VHYAQGLPLALEVLGSFLAENRSMAEWRSALEKLKRIPYNQIQKKLRISFDGLDDDENAK  438

Query  1230  RLFVLIACHFVGKDRDFAINVLEKC---DLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQ  1060
              +F+ IA  F+G D+ +   +L+ C   D    +GI  L+  SL+TV+ +N+L M  L++
Sbjct  439   DIFLDIAFFFIGMDKGYVTTILDGCGFNDSENEIGI--LVRKSLLTVNENNELRMHDLLR  496

Query  1059  NMGKEILRQDS  1027
             +MG+EI+R++S
Sbjct  497   DMGREIVREES  507


 Score =   111 bits (277),  Expect(2) = 2e-83, Method: Composition-based stats.
 Identities = 61/124 (49%), Positives = 88/124 (71%), Gaps = 1/124 (1%)
 Frame = -1

Query  2521  FLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGR-GENIDAELrrgiresrisiIVF  2345
             FLS  GE++ +NF D LYT+L+  G++T RD +E+ R GE I  E+++ + ESRIS+IVF
Sbjct  11    FLSSVGEESNQNFIDDLYTSLVQKGVQTIRDHEEVSRNGEEIPPEVQKTMEESRISVIVF  70

Query  2344  SKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKREKM  2165
             S++YASSR CLD+L+ IL  R+  G  V P+FY V  +DV KQSG FA+AF  H + + +
Sbjct  71    SRNYASSRCCLDKLVKILECRRKMGQFVLPVFYDVHPSDVRKQSGCFAKAFAEHEEEQGV  130

Query  2164  EVEE  2153
              +E+
Sbjct  131   RMEK  134



>ref|XP_011001241.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=933

 Score =   225 bits (573),  Expect(2) = 7e-94, Method: Compositional matrix adjust.
 Identities = 142/365 (39%), Positives = 225/365 (62%), Gaps = 4/365 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL E   L G  L +  +G+E++FIQ II++++ KL+   ++V +  VG+   V  I+
Sbjct  180   RKALEEAGNLSGWNLNDMENGYESKFIQDIIKDVLNKLDPKYINVATNLVGIDRLVHTIS  239

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              +L   + +V +  I G+ G+GKTT+AKV +N     FEG CFL+N+   SE  NG V L
Sbjct  240   DFLSTATDEVCIVGIHGMPGIGKTTIAKVLFNQLCYGFEGRCFLSNINDTSEQSNGVVLL  299

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +ILK     I N D G++ IK+ +  K+V +V DDV   + L+ ++G R WF  
Sbjct  300   QEQLLRDILKQNGANIDNVDRGMVLIKEGLCHKRVLVVLDDVAHQKQLNAMMGERSWFGP  359

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS++IITT+   LL   +R   Y+++EL  + SL+LF  +AF    P +  +E S   + 
Sbjct  360   GSRVIITTKDARLLLKVDR--TYQVEELKRDASLQLFSWHAFRDTKPAKDYVEVSNDVVD  417

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYD-KRLFV  1219
             +CGGLPLAL+ LGS LSG++   W+  ++KL +I +  IQ  L IS + LDD+  K  F+
Sbjct  418   YCGGLPLALEVLGSCLSGKNKSRWKCVIDKLRKIPNRDIQEKLRISFDKLDDHKLKNTFL  477

Query  1218  LIACHFVGKDRDFAINVLE-KCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
              IAC F+G+++++  NVLE +C  HP   +  L + SL+ V+   K+ M  L+++MG+EI
Sbjct  478   DIACFFIGRNKEYVANVLEVRCGYHPEDDLGTLSERSLIKVNASGKISMHDLLRDMGREI  537

Query  1041  LRQDS  1027
             + ++S
Sbjct  538   VHKES  542


 Score =   149 bits (377),  Expect(2) = 7e-94, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 104/144 (72%), Gaps = 1/144 (1%)
 Frame = -1

Query  2575  ARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENID  2396
             A T+     S P+  Y  FLSFRGED RKNFTDHLYTAL+ AGI TFRD +EI RGE I 
Sbjct  37    AMTEPESSRSRPKGAYDVFLSFRGEDNRKNFTDHLYTALVQAGIHTFRDHNEIPRGEEIS  96

Query  2395  AELrrgiresrisiIVFSKDYASSRWCLDELLTIL-GRRKSEGHAVFPIFYSVGRADVEK  2219
               L + I+ES+I I+VFSK YASSRWCL+EL+ IL  +++  G  + P+FY +  ++V K
Sbjct  97    KHLLKAIQESKIYIVVFSKGYASSRWCLNELVEILECKKRKTGQIILPVFYDIHPSEVRK  156

Query  2218  QSGSFAEAFERHAKREKMEVEEGR  2147
             Q+GSFA+AF+RH +R K +V+E R
Sbjct  157   QTGSFAKAFDRHEERFKKKVKEWR  180



>ref|XP_008227563.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=921

 Score =   243 bits (620),  Expect(2) = 1e-93, Method: Compositional matrix adjust.
 Identities = 164/406 (40%), Positives = 244/406 (60%), Gaps = 8/406 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKK-LNRTVLSVPSYTVGLASRVGKI  1939
             R AL +VA L G  L E     E++FIQ II +I K  LN   L V  Y VG+ ++V  +
Sbjct  149   RAALSQVAALSGFTLDER--QSESKFIQNIIEKISKHVLNTVCLEVAEYPVGMQAQVQVM  206

Query  1938  NKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVG  1759
             N+ L    SDV +  + G GG+GKTT+AK  YN    +F+G  FLANVR  S    G VG
Sbjct  207   NELLDLGESDVRMVGVWGTGGIGKTTIAKAVYNSIAHKFKGCSFLANVRERSTSHEGSVG  266

Query  1758  LQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFS  1579
             LQ+ +  +I + +   + N D+G+  IK+ +  +K+ +V DDVD +E L  ++GA DWF 
Sbjct  267   LQENLLSDIQRVKNLKVTNVDKGVTIIKEWLSRRKILLVLDDVDDMEQLHKLVGACDWFG  326

Query  1578  RGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDP-LEHLMEYSVKA  1402
              GS+IIITTR + LL  H+ +L +++K LDD+++L+LFC +AF +  P L+  ++ +  A
Sbjct  327   AGSRIIITTRDKQLLTAHDVNLIHEVKILDDDKALELFCWHAFKRSGPSLDDYVKLAESA  386

Query  1401  IRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLF  1222
             IR+  GLPLALK LGS L G S+D W   L+  +     KIQ  L++S + LDD  K +F
Sbjct  387   IRYAQGLPLALKVLGSCLCGGSIDKWEHTLDGFKS---KKIQDVLKVSYDTLDDIVKEVF  443

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
             + IAC F GK R++ I  LE CDL P  GI+ LI+ +L++V++ + + M  L++ MGK+I
Sbjct  444   LDIACFFKGKSRNYVIETLEACDLSPRYGIEVLIEKALISVEHGDYIRMHDLLEEMGKDI  503

Query  1041  LRQDSRDDLHTLSKL-LDQLVSSTESTGNGVVNESASHVNSPKRPY  907
             + Q+S  +    S+L   + V    +   G    +   +NSPK+ Y
Sbjct  504   VEQESPTEAGGRSRLWFHEDVEHVLTNNTGKKKITGIMLNSPKKDY  549


 Score =   130 bits (328),  Expect(2) = 1e-93, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = -1

Query  2527  HAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiIV  2348
               FLSFRGEDTR NFTDHLY+AL    I TFRDDD++GRGE I   L   I ES+IS+IV
Sbjct  20    QVFLSFRGEDTRHNFTDHLYSALCQRRINTFRDDDDLGRGEEISRALLTAIEESKISVIV  79

Query  2347  FSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAF  2192
             FSK+YASSRWCLDEL+ IL  +KS+   V P+FY V  +DV  Q GSF +A 
Sbjct  80    FSKNYASSRWCLDELVKILDCKKSKQQLVIPVFYKVNPSDVRNQRGSFGDAL  131



>ref|XP_008224273.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1105

 Score =   255 bits (652),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 164/395 (42%), Positives = 252/395 (64%), Gaps = 12/395 (3%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLN-RTVLSVPSYTVGLASRVGKI  1939
             R+AL E A L G       DGHE++FI+KI+ +I  +++    L V +Y VG+ S VG+I
Sbjct  153   RKALSEAANLSGWTFS---DGHESQFIRKIVEDISAEVSYHAYLDVAAYPVGIESYVGEI  209

Query  1938  NKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVG  1759
             NK L+     V +  I G GG+GKTT+AK  YN    +F+GSCFLANVR  S    G V 
Sbjct  210   NKLLEVGEESVRMVGIWGTGGIGKTTIAKAVYNSIVHKFDGSCFLANVRENSMPHGGLVQ  269

Query  1758  LQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFS  1579
             LQ+ +  +IL+ ++  + N D+G+  IK+ + +KKV ++ DDV+QLE L  +    DWF 
Sbjct  270   LQETLLIDILRVKKLKVTNIDKGVAMIKNRLSNKKVLLILDDVNQLEQLHSLARGSDWFG  329

Query  1578  RGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAI  1399
              GS+IIITTR ++LL  H+ +L YK+K LD  E+LKLF   AF ++ P    ++ + +A+
Sbjct  330   SGSRIIITTRDKHLLTAHQVYLIYKVKVLDYHEALKLFSWNAFKRNVPPSDYVKVARRAV  389

Query  1398  RHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFV  1219
              +  GLPLAL  LGS+L GRS+D W++ L+  +R+ + +IQ  L+IS + L+D  K +F+
Sbjct  390   HYVQGLPLALTVLGSHLCGRSIDQWQASLDSYKRVPNKEIQEILKISFDALEDIAKEIFL  449

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F GK  D+   +LE CDL+P++GI+ L++ +L+T+D    ++M  L++ MGKEI+
Sbjct  450   HIACFFKGKYVDYVTQMLECCDLNPMIGIELLVEKALITIDG-CWVLMHDLLEEMGKEIV  508

Query  1038  RQDSRDDLHTLSKL-----LDQLVSSTESTGNGVV  949
             RQ+S ++    S+L     +D ++  TE+TG   +
Sbjct  509   RQESPNNPGKRSRLWFHEDVDHVL--TENTGTDTI  541


 Score =   117 bits (293),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 85/126 (67%), Gaps = 1/126 (1%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGEDTR NFTDHLY+AL+  GI TF DD ++ RG  I + L + I +SRISII
Sbjct  24    YDVFLSFRGEDTRHNFTDHLYSALVQNGINTFIDD-KLRRGGEISSSLLKAIEKSRISII  82

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKRE  2171
             VFS +YA+S+WCLDEL  IL  +K     V+PIFY V  +DV  Q GSF EA  +H  + 
Sbjct  83    VFSTNYAASKWCLDELDKILECKKLRQQKVWPIFYKVEPSDVRHQRGSFGEALAKHECKF  142

Query  2170  KMEVEE  2153
             K  + +
Sbjct  143   KNNIHK  148



>gb|ABF81471.1| TIR-NBS type disease resistance protein [Populus trichocarpa]
Length=1368

 Score =   219 bits (558),  Expect(2) = 4e-93, Method: Compositional matrix adjust.
 Identities = 144/378 (38%), Positives = 230/378 (61%), Gaps = 5/378 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL E   L G  L++  +GHEA+FIQ II+E+  KL+   ++V ++ VG+   V +I 
Sbjct  249   REALEEAGNLSGWNLKDMTNGHEAKFIQHIIKEVWNKLSPKDMNVGTHPVGIDPLVNEIR  308

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              ++ + +  V +  I G+ G+GKTT+AK  ++   D FEGS FL NV+  SE  +  V L
Sbjct  309   DFVSNGTEKVCIVGIHGMPGIGKTTIAKEVFDKLCDEFEGSSFLLNVKEKSESKD-MVLL  367

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+  +IL+   E I N D G + IK+ +  K+V +V DDV + + L  ++G   W   
Sbjct  368   QKQLLHDILRQNTEKINNVDRGKVLIKERLPHKRVLVVVDDVARPDQLLDLMGEPSWLGP  427

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS++IITTR E+LL   E   +Y+++EL+ + SL+LFCR+AF    P +  +E S   + 
Sbjct  428   GSRVIITTRDESLLL--EADQRYQVQELNRDNSLQLFCRHAFRDTKPAKDYVELSNDVVE  485

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYD-KRLFV  1219
             +CGGLPLALK LGS L G++   W S +++L +  + +IQ+ L IS + LD+   K  F+
Sbjct  486   YCGGLPLALKVLGSCLYGKNQARWESVIDRLRKFPNSEIQKKLRISFDTLDESTLKNTFL  545

Query  1218  LIACHFVGKDRDFAINVLE-KCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
              IAC F+G+ +++   VLE +   +P      LI+ SL+ VD+   + M  L++ MG+EI
Sbjct  546   DIACFFIGRKKEYVAKVLEGRYGYNPEDDFGTLIERSLIKVDDSGTIGMHDLLRGMGREI  605

Query  1041  LRQDSRDDLHTLSKLLDQ  988
             ++++S ++    S++  Q
Sbjct  606   VKEESPENPAQRSRIWSQ  623


 Score =   152 bits (385),  Expect(2) = 4e-93, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 102/144 (71%), Gaps = 1/144 (1%)
 Frame = -1

Query  2575  ARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENID  2396
             A T+     S P++ Y  FLSFRGEDTRK FTDHLYTAL+ AGI TFRDDDE+ RGE I 
Sbjct  106   AMTEPDSSRSRPQWAYDVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEIS  165

Query  2395  AELrrgiresrisiIVFSKDYASSRWCLDELLTIL-GRRKSEGHAVFPIFYSVGRADVEK  2219
               L   I+ES+I I+VFSK YASSRWCLDEL+ IL  + +  G    PIFY +  +DV K
Sbjct  166   QHLLEAIQESKICIVVFSKGYASSRWCLDELVEILKCKYRKTGQIALPIFYDIDPSDVRK  225

Query  2218  QSGSFAEAFERHAKREKMEVEEGR  2147
             Q+GSFAEAF +H +R + +V+E R
Sbjct  226   QTGSFAEAFVKHEERSEEKVKEWR  249



>ref|XP_002310389.2| hypothetical protein POPTR_0007s00600g [Populus trichocarpa]
 gb|EEE90839.2| hypothetical protein POPTR_0007s00600g [Populus trichocarpa]
Length=1113

 Score =   219 bits (558),  Expect(2) = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/378 (38%), Positives = 230/378 (61%), Gaps = 5/378 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL E   L G  L++  +GHEA+FIQ II+E+  KL+   ++V ++ VG+   V +I 
Sbjct  143   REALEEAGNLSGWNLKDMTNGHEAKFIQHIIKEVWNKLSPKDMNVGTHPVGIDPLVNEIR  202

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              ++ + +  V +  I G+ G+GKTT+AK  ++   D FEGS FL NV+  SE  +  V L
Sbjct  203   DFVSNGTEKVCIVGIHGMPGIGKTTIAKEVFDKLCDEFEGSSFLLNVKEKSESKD-MVLL  261

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+  +IL+   E I N D G + IK+ +  K+V +V DDV + + L  ++G   W   
Sbjct  262   QKQLLHDILRQNTEKINNVDRGKVLIKERLPHKRVLVVVDDVARPDQLLDLMGEPSWLGP  321

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS++IITTR E+LL   E   +Y+++EL+ + SL+LFCR+AF    P +  +E S   + 
Sbjct  322   GSRVIITTRDESLLL--EADQRYQVQELNRDNSLQLFCRHAFRDTKPAKDYVELSNDVVE  379

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYD-KRLFV  1219
             +CGGLPLALK LGS L G++   W S +++L +  + +IQ+ L IS + LD+   K  F+
Sbjct  380   YCGGLPLALKVLGSCLYGKNQARWESVIDRLRKFPNSEIQKKLRISFDTLDESTLKNTFL  439

Query  1218  LIACHFVGKDRDFAINVLE-KCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
              IAC F+G+ +++   VLE +   +P      LI+ SL+ VD+   + M  L++ MG+EI
Sbjct  440   DIACFFIGRKKEYVAKVLEGRYGYNPEDDFGTLIERSLIKVDDSGTIGMHDLLRGMGREI  499

Query  1041  LRQDSRDDLHTLSKLLDQ  988
             ++++S ++    S++  Q
Sbjct  500   VKEESPENPAQRSRIWSQ  517


 Score =   150 bits (379),  Expect(2) = 2e-92, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 101/142 (71%), Gaps = 1/142 (1%)
 Frame = -1

Query  2569  TQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAE  2390
             T+     S P++ Y  FLSFRG+DTRK FTDHLYTAL+ AGI TFRDDDE+ RGE I   
Sbjct  2     TEPDSSRSRPQWAYDVFLSFRGKDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISQH  61

Query  2389  LrrgiresrisiIVFSKDYASSRWCLDELLTIL-GRRKSEGHAVFPIFYSVGRADVEKQS  2213
             L   I+ES+I I+VFSK YASSRWCLDEL+ IL  + +  G    PIFY +  +DV KQ+
Sbjct  62    LLEAIQESKICIVVFSKGYASSRWCLDELVEILKCKYRKTGQIALPIFYDIDPSDVRKQT  121

Query  2212  GSFAEAFERHAKREKMEVEEGR  2147
             GSFAEAF +H +R + +V+E R
Sbjct  122   GSFAEAFVKHEERSEEKVKEWR  143



>ref|XP_004515064.1| PREDICTED: TMV resistance protein N-like, partial [Cicer arietinum]
Length=850

 Score =   257 bits (656),  Expect(2) = 8e-92, Method: Compositional matrix adjust.
 Identities = 163/373 (44%), Positives = 235/373 (63%), Gaps = 3/373 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL + A L G       +G+E +FIQ I+ E+ +KLNR  L+V ++ +GL +RV  + 
Sbjct  142   RLALTQAANLSGWHFN---NGYEFKFIQSIVDEVSRKLNRIPLNVATHPIGLQARVSDVT  198

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               LQ ES+DV +  I G+GG+GKTT+AK  YN  Y+RF  + FLANVR  S   +G V L
Sbjct  199   SLLQLESNDVKMIGIHGIGGIGKTTIAKAVYNTIYNRFRYASFLANVRENSRHKSGLVKL  258

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+++   +L  +   + N D+GI  IKD +  KKV +V D+VD +E L  ++G  DWF  
Sbjct  259   QEKLLFELLGEQGIKLGNVDKGINVIKDRLCRKKVLLVIDNVDDVEQLQALVGGFDWFGL  318

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR ++LL  HE  L Y++K+L+  ESL+LF   AF + +P +   + S +A+ 
Sbjct  319   GSKIIITTRDKHLLTSHEIGLTYEVKKLNHVESLQLFSWNAFKRSEPDDTFFDVSNRAVL  378

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFVL  1216
             +  GLPLAL  LGS L GR++  W+S L+K +R  + KIQ  L IS   L++ +K +F+ 
Sbjct  379   YAEGLPLALTVLGSDLCGRTIHQWKSALDKYKRSPNRKIQDILRISFEGLEENEKEIFLY  438

Query  1215  IACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEILR  1036
             IAC F G+  ++A   L  CDLHP++G+  L+D SL+ +D    L M  LIQ+MGKEI+R
Sbjct  439   IACFFKGEIMEYAAKALRACDLHPIIGVAVLVDKSLINLDERGVLSMHDLIQDMGKEIVR  498

Query  1035  QDSRDDLHTLSKL  997
             Q+S  D    S+L
Sbjct  499   QESPLDPGKRSRL  511


 Score =   110 bits (276),  Expect(2) = 8e-92, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 79/115 (69%), Gaps = 0/115 (0%)
 Frame = -1

Query  2536  FFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresris  2357
             + YH FLSFRGEDTR+ FT HLY AL   GI TF DD+ + +GE I   L + I ESRIS
Sbjct  10    YVYHVFLSFRGEDTRETFTGHLYNALDQRGINTFIDDEGLRKGEEISQSLLKAIEESRIS  69

Query  2356  iIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAF  2192
             II+FSK+YA+S WCLDEL+ IL  +K +G  V  +FY V  +DV  Q  ++ EAF
Sbjct  70    IIIFSKNYANSTWCLDELVKILECKKDKGQIVCSVFYDVNPSDVRHQRDTYEEAF  124



>ref|XP_008346333.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=666

 Score =   223 bits (569),  Expect(2) = 8e-92, Method: Compositional matrix adjust.
 Identities = 134/261 (51%), Positives = 183/261 (70%), Gaps = 0/261 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             REAL EVA L GMVLQ + DG+E++FI+KI++ I  KL+RT LS+    +G+ S+V  IN
Sbjct  151   REALAEVADLAGMVLQNQADGYESKFIKKIVKVIXDKLSRTPLSIEPKXIGIQSQVEHIN  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S+DVG+ ++ G+ G+GKTT+AK  YN N+  FEGS F+ N+R  ++  NG V +
Sbjct  211   LWLQDGSNDVGIFIVYGMSGIGKTTIAKHVYNSNFRSFEGSSFIENIREIADRSNGLVQI  270

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  NIL GRE  I +  EGIIKI+ AI S+KV +V DDVD ++ LD V+  +D F  
Sbjct  271   QMQLLSNILNGREVKIHSVSEGIIKIEGAISSRKVLLVLDDVDHMDQLDAVLKMKDRFYX  330

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKI+ITTR E LLK H+    ++++ LD  ES +LF  +AFGQD P+E  ME+S   ++
Sbjct  331   GSKILITTRRERLLKAHQVTKVHRVETLDYNESXELFSWHAFGQDHPIEEYMEHSKMVVQ  390

Query  1395  HCGGLPLALKDLGSYLSGRSM  1333
             H GGLPLAL+ LGS LSG+ +
Sbjct  391   HSGGLPLALRVLGSTLSGKRL  411


 Score =   144 bits (364),  Expect(2) = 8e-92, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 97/141 (69%), Gaps = 4/141 (3%)
 Frame = -1

Query  2536  FFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresris  2357
             + Y  FLSFRGEDTRK FTDHLYTA  NAG  TFRDDDE+ RGE+I   L++ I+ SR S
Sbjct  20    YRYDVFLSFRGEDTRKTFTDHLYTAXNNAGFLTFRDDDELERGEDIKPGLQKAIQLSRAS  79

Query  2356  iIVFSKDYASSRWCLDELLTILGR-RKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHA  2180
             ++VFSKDYASSRWCLDEL+ IL R R +  H V P+FY V  + + KQ+GS  +AF RH 
Sbjct  80    VVVFSKDYASSRWCLDELMLILERKRTTSDHVVLPVFYDVDPSHLRKQTGSIGKAFARHQ  139

Query  2179  KREKMEVEEGRVEWKGKGGEV  2117
             K +  +  +G   W+    EV
Sbjct  140   KTQSQKKVKG---WREALAEV  157



>ref|XP_011005281.1| PREDICTED: LOW QUALITY PROTEIN: TMV resistance protein N-like 
[Populus euphratica]
Length=1609

 Score =   218 bits (555),  Expect(2) = 9e-92, Method: Compositional matrix adjust.
 Identities = 144/378 (38%), Positives = 230/378 (61%), Gaps = 5/378 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             +EAL E   L G  L++  +GHEA+FIQ II+E+  KL    + V ++ VG+   V +I 
Sbjct  428   KEALEEAGNLSGWNLKDMANGHEAKFIQYIIKEVWNKLYPKDMKVGTHPVGIDPLVNEIR  487

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              ++ + +  V +  I G+ G+GKTT+AK  +N   D FEGS FL NV+  SE  +  V L
Sbjct  488   DFVSNATEKVCIVGIHGMPGIGKTTIAKEVFNKLCDEFEGSSFLLNVKEKSESKD-MVLL  546

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +IL+   E I N D G + IK+ +  K+V +VF DVD+ + L  ++G   W   
Sbjct  547   QQQLLHDILRQNAEKINNVDRGKVLIKERLRHKRVLVVFHDVDRPDRLLDLMGEPSWLGP  606

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS++IITT  E+LL   E   +Y+++EL+  +SL+LFCR+AF    P ++ +E S   + 
Sbjct  607   GSRVIITTTDESLLL--EADQRYQVQELNRGDSLQLFCRHAFRDTKPAKYYVELSNDVVE  664

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYD-KRLFV  1219
             +CGGLPLALK LGS L G++   W S +++L +  + +IQ+ L IS + LD+   K  F+
Sbjct  665   YCGGLPLALKVLGSCLYGKNQARWESVIDRLRKFPNSEIQKKLRISFDTLDESTLKNTFL  724

Query  1218  LIACHFVGKDRDFAINVLE-KCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
              IAC F+G+ +++   VLE + D +P      LI+ SL+ VD+   + M  L++ MG+EI
Sbjct  725   DIACFFIGRKKEYVAKVLEGRYDYNPEDDFGTLIERSLIKVDDSGTIGMHDLLRGMGREI  784

Query  1041  LRQDSRDDLHTLSKLLDQ  988
             ++++S ++    S++  Q
Sbjct  785   VKEESPENPAERSRIWSQ  802


 Score =   149 bits (377),  Expect(2) = 9e-92, Method: Composition-based stats.
 Identities = 83/139 (60%), Positives = 101/139 (73%), Gaps = 5/139 (4%)
 Frame = -1

Query  2548  SVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgire  2369
             S P+  Y  FLSFRGEDTRK FTDHLYTAL+ AGI TFR+DDE+ RGE I   L + I+E
Sbjct  294   SRPQGAYDVFLSFRGEDTRKTFTDHLYTALVKAGIHTFREDDELPRGEEISDHLLKAIQE  353

Query  2368  srisiIVFSKDYASSRWCLDELLTILG-RRKSEGHAVFPIFYSVGRADVEKQSGSFAEAF  2192
             S+ISI+VFSK YASSRWCLDEL+ IL  + +  G    PIFY +  +DV KQ+GSFAEAF
Sbjct  354   SKISIVVFSKGYASSRWCLDELVEILKCKYRKTGQIALPIFYDIDPSDVRKQTGSFAEAF  413

Query  2191  ERHAKREKMEVEEGRVEWK  2135
              +H +R K +V+    EWK
Sbjct  414   VKHEERYKEKVK----EWK  428



>ref|XP_008366926.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=421

 Score =   231 bits (588),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/268 (52%), Positives = 186/268 (69%), Gaps = 0/268 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL EVA L GMVL  E DG+E++FI KI++ I  KL RT LSV S  +G+ SRV +IN
Sbjct  151   RKALAEVADLAGMVLPNEADGYESKFITKIVKVIGDKLIRTPLSVQSXLIGIQSRVKRIN  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S DVG+  + G+ G+GKTT+AK  YN N+  FEGS F+ N+R  +  PNG V +
Sbjct  211   LWLQDGSDDVGIVTVYGMSGIGKTTIAKCVYNSNFTSFEGSSFVENIRETANQPNGLVQI  270

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +ILKG++E + N  EGI KI+ AI S++V +V DDVD+++ LD V+  +D F  
Sbjct  271   QMQVLYDILKGKKEKVHNVSEGISKIERAICSRRVLLVLDDVDRMDQLDAVLRMKDRFYP  330

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR E LLK  +  + +++  L  +ESL+LFC +AFGQD P E  MEYS + ++
Sbjct  331   GSKIIITTRRERLLKALQVTMVHEVGTLGYDESLELFCWHAFGQDHPREGYMEYSKELVQ  390

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKL  1312
             HCGGLP AL+ LGS L G S+ VW+  L
Sbjct  391   HCGGLPSALQVLGSSLLGESVGVWKMAL  418


 Score =   137 bits (344),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 95/141 (67%), Gaps = 4/141 (3%)
 Frame = -1

Query  2536  FFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresris  2357
             + Y  FLSFRGEDTR+NFTDHLYTAL NAG  TFRD+DE+ RGE+I   L++ IR SR S
Sbjct  20    YRYDVFLSFRGEDTRRNFTDHLYTALNNAGYLTFRDNDELERGEDIKPGLQKAIRLSRTS  79

Query  2356  iIVFSKDYASSRWCLDELLTILGR-RKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHA  2180
             ++VFSK YASS+WCLDEL  IL R R +  H V P+FY    + V KQ+GS  +AF RH 
Sbjct  80    VVVFSKYYASSKWCLDELXMILERKRTTSDHVVLPVFYDXDPSHVRKQTGSIGKAFARH-  138

Query  2179  KREKMEVEEGRVEWKGKGGEV  2117
               EK ++      W+    EV
Sbjct  139   --EKTQLPNTVKRWRKALAEV  157



>ref|XP_006388454.1| hypothetical protein POPTR_0182s00200g [Populus trichocarpa]
 gb|ERP47368.1| hypothetical protein POPTR_0182s00200g [Populus trichocarpa]
Length=721

 Score =   222 bits (566),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 144/323 (45%), Positives = 208/323 (64%), Gaps = 3/323 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL E A L G  L+   DGHEA+FI+KI+ EI+++L  T L V  Y VG+  RV ++N
Sbjct  153   RMALTEAANLSGWDLRNVADGHEAKFIKKIVGEILRELRSTYLFVAFYPVGINRRVQQLN  212

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               L   SS+V +  I G+GG+GKTT+AK  YN  +  F+G CFLANVR  S+ PNG V L
Sbjct  213   FLLNAGSSEVCIVGIYGMGGIGKTTIAKAMYNELFHSFDGKCFLANVREISKQPNGHVKL  272

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +ILK  +  I + D G+  IK+ + S++V +V DDVD+L+ L  + G+RDWF  
Sbjct  273   QEQLLFDILKKDKIKIGSVDRGMTMIKERLHSRRVLLVLDDVDKLDQLQAIAGSRDWFGS  332

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS+II+TTR E++L        Y  +E++D E+L+LF  +AF    P+E   E S + + 
Sbjct  333   GSRIIVTTRDEHVLTVLGADRVYMAREMNDIEALELFSWHAFRASHPVEDYKELSEQIVD  392

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             +CG LPLAL+ +GS+L GR +  W+S LEKL RI   +IQ+ L+IS + L DD  K +F+
Sbjct  393   YCGRLPLALEVIGSFLFGRRIVEWKSALEKLRRIPDDQIQKKLQISFDGLNDDTQKDIFL  452

Query  1218  LIACHFVGKDRDFAINVLEKCDL  1150
              I+C+F+G  R   + +L +C L
Sbjct  453   DISCYFIG--RQGILCLLARCPL  473


 Score =   145 bits (365),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 103/135 (76%), Gaps = 1/135 (1%)
 Frame = -1

Query  2536  FFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresris  2357
             + Y  FLSFRGED RKNFTDHLY AL +AGI TFRDD+ + RGE+I  EL + I++SRIS
Sbjct  19    WIYDVFLSFRGEDARKNFTDHLYFALKDAGINTFRDDNGLRRGEDISTELLQAIQKSRIS  78

Query  2356  iIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAK  2177
             +IVFS++YA+SRWCL+EL+ I+  R+S    VFPIFY V  +DV KQ+GSFAEAF  H +
Sbjct  79    VIVFSRNYANSRWCLEELVKIMECRRSFRQLVFPIFYDVDPSDVRKQTGSFAEAFAGHEE  138

Query  2176  REKMEVEEGRV-EWK  2135
             R  ++ ++G+V  W+
Sbjct  139   RFVLQTDKGKVATWR  153



>ref|XP_004250576.1| PREDICTED: TMV resistance protein N-like isoform X1 [Solanum 
lycopersicum]
Length=1118

 Score =   293 bits (751),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 178/374 (48%), Positives = 254/374 (68%), Gaps = 2/374 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL E+A   GMVLQ + DGHE++FI+KI+  +  +++R+ L V  + +G+  R   IN
Sbjct  120   RQALAEIADFGGMVLQNQADGHESKFIRKIVNVVTNRISRSGLYVAPHLIGIERRTRHIN  179

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              W++D SSDVG+ V+CG+GG+GKTT+AK  Y  N+  FEGS  + N+R AS+ PNG V L
Sbjct  180   SWMRDGSSDVGLLVVCGMGGIGKTTLAKFIYMSNFYVFEGSSCVLNIREASKQPNGLVKL  239

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQI   ILK   E +   DEGI+KI DA+G KKV +V DDVD    ++ V G +  F  
Sbjct  240   QKQILSEILKKDNERVSCVDEGIVKISDAVGGKKVLLVLDDVDDSNQVNAVFGMKSLFYP  299

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKI+ITTR + +L  H     Y+++ L  +ESL+LF  + FG+  P E  +E S K + 
Sbjct  300   GSKIVITTRQKRILNPHLVDKVYRVETLGRDESLELFSWHTFGKPHPEEGFLECSNKVME  359

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKR-LFV  1219
              CGG PLAL+ LGS L+G+S+DVW+S + KL+ + +++I   L+IS   L+D D R LF+
Sbjct  360   RCGGNPLALRVLGSSLAGKSLDVWQSTINKLKVVPNNRIIELLKISYESLEDNDDRSLFL  419

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F+GKD+DFA+ +L+KC+   VVGIQNLID  L++V  D  L+M +LIQ+MG+EI+
Sbjct  420   HIACFFLGKDKDFAVKILDKCEFFTVVGIQNLIDKDLLSVP-DGHLVMHELIQDMGREIV  478

Query  1038  RQDSRDDLHTLSKL  997
             RQ+S ++    S+L
Sbjct  479   RQESLEEPGRRSRL  492


 Score = 73.9 bits (180),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 65/136 (48%), Gaps = 18/136 (13%)
 Frame = -1

Query  2524  AFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiIVF  2345
               LS+R EDT   FTDHLYTALI AGI+TF+    I R   +               I+ 
Sbjct  9     VLLSYRAEDTATAFTDHLYTALIQAGIQTFKQG--IDRNWKVSV-------------IIL  53

Query  2344  SKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKREKM  2165
             ++ YA  + CL++L  IL  ++    ++ P+FY V  +D+ K  G   EA   H +    
Sbjct  54    TEGYALCQSCLEQLNVILKGKEKLDRSILPVFYDVDPSDIRKHKGKIGEALGLHEQSSGK  113

Query  2164  EVEEGRVEWKGKGGEV  2117
             E  E    W+    E+
Sbjct  114   ESVE---RWRQALAEI  126



>ref|XP_010263320.1| PREDICTED: TMV resistance protein N-like [Nelumbo nucifera]
Length=1151

 Score =   236 bits (603),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 144/364 (40%), Positives = 231/364 (63%), Gaps = 1/364 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL E A L G  ++     ++++FI+ I+  ++  LN+T L+V +Y VG+ SR+  + 
Sbjct  143   RTALTEAANLAGWDVRNANKRNQSKFIRGIVEVVLATLNQTHLNVATYPVGINSRLEDLK  202

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               L   S+DV +  ICG+GG+GKTT+AK  YN  + +FEG CFLA+VR   E P+G + L
Sbjct  203   SLLNLWSNDVHIVGICGMGGIGKTTIAKAVYNALFRKFEGGCFLASVRETLEQPDGLLDL  262

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+++  +IL   +  + N D G   +K+ +  K+V ++ DDV     L+++   R+ F  
Sbjct  263   QRKLLSDILLKEDVKMSNVDRGTHLLKERLSCKRVLVILDDVAYSNQLNLLAIKRNCFGM  322

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS+IIITTR E++L   E    YK+KELD+ ES++LF  +AF +D P+   +E +   + 
Sbjct  323   GSRIIITTRDEHVLHELEVDCIYKVKELDEHESIRLFSWHAFRKDQPMAEFIELTKCIVS  382

Query  1395  HCGGLPLALKDLGSYLS-GRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFV  1219
             + GGLPLAL+ LG +LS  RS+  W+S L+KL+RI +++IQ+ L +  + LDD +K +F+
Sbjct  383   YVGGLPLALEVLGCFLSDNRSILEWKSALDKLKRIPYNQIQKKLRLCFDALDDKEKSIFL  442

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F+G D+D+A+ +L+ C      GI  LI   L+T++  N+L M  LI++MG+ I+
Sbjct  443   DIACFFIGMDKDYAVKILDSCGFFSEFGINVLIRRFLLTINEKNELRMHDLIRDMGRRIV  502

Query  1038  RQDS  1027
              ++S
Sbjct  503   HEES  506


 Score =   130 bits (328),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 92/134 (69%), Gaps = 2/134 (1%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGED+   F DHLYTAL   GIRTFRDDD++  GENI +EL   I ESR SII
Sbjct  10    YDVFLSFRGEDSNSYFIDHLYTALDERGIRTFRDDDQLKTGENISSELLNAIEESRASII  69

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKR-  2174
             VF+ +YASS WCLD+L+ IL  RK+ G  V P+F+    +DV KQSGS+ EAF RH +  
Sbjct  70    VFTVNYASSTWCLDKLVKILECRKTGGRLVLPVFFDADPSDVRKQSGSYEEAFARHEEEY  129

Query  2173  -EKMEVEEGRVEWK  2135
              E ++++E    W+
Sbjct  130   YEVVKMKEKVQRWR  143



>gb|AAZ07902.1| NBS-LRR protein [Ipomoea batatas]
Length=175

 Score =   299 bits (765),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 160/168 (95%), Positives = 162/168 (96%), Gaps = 0/168 (0%)
 Frame = -2

Query  1869  KTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGLQKQIFENILKGREEIIFNTDEG  1690
             KTTVAKVAYNLNYDRFEGS FLANVR ASEIPNG VGLQKQIFENILKGREEIIFNTDEG
Sbjct  7     KTTVAKVAYNLNYDRFEGSSFLANVRKASEIPNGLVGLQKQIFENILKGREEIIFNTDEG  66

Query  1689  IIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSRGSKIIITTRCENLLKGHERHLQ  1510
             IIKIKDAIG+KKVFIVFDDVDQLELLD +IGARDWFSRGSKIIITTRCENLLKGHERHLQ
Sbjct  67    IIKIKDAIGNKKVFIVFDDVDQLELLDALIGARDWFSRGSKIIITTRCENLLKGHERHLQ  126

Query  1509  YKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIRHCGGLPLALK  1366
             YKIKELDDEESLKLF RYAFGQD PLEHLMEYSVKAIRHCGGLPLALK
Sbjct  127   YKIKELDDEESLKLFSRYAFGQDHPLEHLMEYSVKAIRHCGGLPLALK  174



>gb|ABE99701.1| TIR-NBS-LRR disease resistance-like protein [Populus balsamifera]
Length=1116

 Score =   228 bits (581),  Expect(2) = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/365 (39%), Positives = 230/365 (63%), Gaps = 4/365 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL E   L G  L +  +GHE++ IQ+I+++++ KL+   ++V ++ VG+   V  I+
Sbjct  180   RKALEEAGNLSGWNLNDMENGHESKLIQEIVKDVLNKLDPKHINVATHLVGIDPLVLAIS  239

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              +L   + +V +  I G+ G+GKT++AKV +N    RFEGSCFL+N+   SE  NG V L
Sbjct  240   DFLSTATDEVCIVGIHGMPGIGKTSIAKVVFNQFCYRFEGSCFLSNINETSEQSNGLVLL  299

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +ILK     I N   G++ IK+ I  K+V +V DDV     L+ ++G R WF  
Sbjct  300   QEQLLHDILKQNTVNISNVVRGMVLIKERICHKRVLVVVDDVAHQNQLNALMGERSWFGP  359

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS++IITT+ E+LL   +R   Y+++EL  +ESL+LF  +AFG   P +  +E S   + 
Sbjct  360   GSRVIITTKDEHLLLKVDR--TYRVEELKRDESLQLFSWHAFGDTKPAKDYVELSNDVVD  417

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYD-KRLFV  1219
             +CGGLPLAL+ LGS L G++   W+  ++KL +I + +IQ+ L IS + LDD+  +  F+
Sbjct  418   YCGGLPLALEVLGSCLPGKNRARWKCLIDKLRKIPNREIQKKLRISFDSLDDHQLQNTFL  477

Query  1218  LIACHFVGKDRDFAINVLE-KCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
              IAC F+G+++++   VLE +C  +P   +  L + SL+ VD   K+ M  L+++MG++I
Sbjct  478   DIACFFIGRNKEYVAKVLEARCGYNPEDDLGTLSERSLIKVDAFGKISMHDLLRDMGRDI  537

Query  1041  LRQDS  1027
             + ++S
Sbjct  538   IHKES  542


 Score =   138 bits (347),  Expect(2) = 2e-91, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 98/144 (68%), Gaps = 1/144 (1%)
 Frame = -1

Query  2575  ARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENID  2396
             A T+     S P+  Y  FLSFRGED RK FTDHLYTA + AGI TFRD +EI RGE I 
Sbjct  37    AMTEPESSGSRPKGAYDVFLSFRGEDNRKTFTDHLYTAFVQAGIHTFRDQNEIPRGEEIS  96

Query  2395  AELrrgiresrisiIVFSKDYASSRWCLDELLTIL-GRRKSEGHAVFPIFYSVGRADVEK  2219
               L + I+ES+IS++VFSK YASSRWCL+EL+ IL  + +     V PIFY +  ++V K
Sbjct  97    KHLHKAIQESKISVVVFSKGYASSRWCLNELVEILESKNRKTDQIVLPIFYDIDPSEVRK  156

Query  2218  QSGSFAEAFERHAKREKMEVEEGR  2147
             Q+GSFA+AF RH +    +V+E R
Sbjct  157   QTGSFAKAFHRHEEAFTEKVKEWR  180



>ref|XP_010245559.1| PREDICTED: uncharacterized protein LOC104589071 [Nelumbo nucifera]
Length=2320

 Score =   211 bits (538),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 153/376 (41%), Positives = 223/376 (59%), Gaps = 10/376 (3%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL E A L    L    DG+EA+FI  I+RE+  KLN+T L V  Y +G+ SRV  + 
Sbjct  138   RSALTEAASLAKWDLG---DGYEAKFIGGIVREVSTKLNKTHLDVGEYVIGIHSRVIHVI  194

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               L   S+ + +  I G+GG+GKTT+AK  YN  Y+ FEGS FL     ASE  N  + L
Sbjct  195   SLLSLSSNGIRIIGIYGMGGIGKTTIAKAVYNCIYEEFEGSSFLE----ASEQQNDLLKL  250

Query  1755  QKQIFENILKGREEI-IFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFS  1579
             QKQ+   ILK ++ I I N D GI  IK+ +  KKV IV D V+    +D ++  R WF 
Sbjct  251   QKQLLSEILKEKDLIKIGNVDRGINVIKERLCKKKVLIVLDGVNNKSQVDKLVRDRRWFG  310

Query  1578  RGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAI  1399
              GS+IIITTR E  L       +YK++ L  ++S+ LF  +AF QD   +   + S   +
Sbjct  311   NGSRIIITTRDEFFLNWVRADEKYKVQTLSLKDSMNLFSLHAFKQDHLKDGYEDLSRDVV  370

Query  1398  RHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFV  1219
             R+ GG+PLAL+ LGS+LS +    W+  ++KL+RI    IQ  L+IS + LDD +K +F+
Sbjct  371   RYAGGIPLALEVLGSFLSHKRE--WQDVVDKLKRIPAESIQEKLKISFDALDDNEKFIFL  428

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F+G D+++   +L  C     +G+  L  +SLV+++N N+L M  L+++MG+EI+
Sbjct  429   DIACFFIGMDKNYVSRILLGCGFFSDIGLSFLTRLSLVSINNKNELRMHDLLRDMGREIV  488

Query  1038  RQDSRDDLHTLSKLLD  991
             R++  D     S+L D
Sbjct  489   RKECPDSPGKRSRLWD  504


 Score =   154 bits (389),  Expect(2) = 3e-91, Method: Composition-based stats.
 Identities = 81/132 (61%), Positives = 99/132 (75%), Gaps = 3/132 (2%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGEDTRKNFTDHL+TAL+  GI TFRDD E+ RGE I  EL R I +SRISII
Sbjct  10    YDVFLSFRGEDTRKNFTDHLHTALVQRGINTFRDDKELNRGEEISQELLREIEKSRISII  69

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKRE  2171
             VFSK+YASSRWCLDEL  I+  +++ G  V P+FY++G  DV++Q+GSFAEAF +H   E
Sbjct  70    VFSKNYASSRWCLDELSKIMECKRTLGQMVLPVFYNIGPNDVQQQTGSFAEAFAKH---E  126

Query  2170  KMEVEEGRVEWK  2135
             K E+ E    W+
Sbjct  127   KSEMAEKVQRWR  138


 Score =   213 bits (542),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 161/407 (40%), Positives = 234/407 (57%), Gaps = 11/407 (3%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL E A L   V  +  DG+EA+FI  I+RE+  KLN+T L V  Y +G+ SRV  + 
Sbjct  1298  RSALTEAASL---VKWDLGDGYEAKFIDGIVREVSTKLNKTHLDVGKYVIGIHSRVIHVI  1354

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               L   S+ + +  I G+GG+GKTT+AK  YN  Y+ FEGS FL     A E  N  + L
Sbjct  1355  SLLSLSSNGIRIIGIYGMGGIGKTTIAKAVYNCIYEEFEGSSFLE----ALEQQNDLLKL  1410

Query  1755  QKQIFENILKGREEI-IFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFS  1579
             QKQ+   ILK ++ I I N D GI  IK+ +  K+V +V D V++   +D +I     F 
Sbjct  1411  QKQLLSEILKEKDLIKIGNVDRGINVIKERLCKKRVLVVLDGVNESCQVDKLIRGCRGFG  1470

Query  1578  RGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAI  1399
              GS+IIITTR E+ L   +   +Y ++ L  E+S+ LF  +AF QD P E   + S + +
Sbjct  1471  NGSRIIITTRDESFLNRVKVDEKYMVQTLSPEDSMNLFSLHAFKQDHPKEDYEDLSKEVV  1530

Query  1398  RHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFV  1219
             R+ GGLPLAL+ LGS LS +    W + +++L+RI    IQ  L+IS + LDD +K +F+
Sbjct  1531  RYAGGLPLALEVLGSLLSHKRE--WHNVVDQLKRIPQASIQEKLKISFDALDDNEKFIFL  1588

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F+G DR++   +L  CD  P +G+  L  +SLV+++  N+L M  L+++MG+EI+
Sbjct  1589  DIACFFIGMDRNYVSKILHGCDFFPEIGLSILTRLSLVSINYKNQLRMHDLLRDMGREIV  1648

Query  1038  RQDSRDDLHTLSKLLDQ-LVSSTESTGNGVVNESASHVNSPKRPYSQ  901
             R+   D     S+L D   V    +  NG        VN P+   SQ
Sbjct  1649  REKYPDSPEKRSRLWDPDDVRVVLTRQNGTAEIEGLVVNFPQPKDSQ  1695


 Score =   149 bits (377),  Expect(2) = 3e-90, Method: Composition-based stats.
 Identities = 78/123 (63%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGEDTRKNFTDHLYTAL   GI TF DD+E+ RGE I  EL R I +SRISII
Sbjct  1170  YDVFLSFRGEDTRKNFTDHLYTALGQRGINTFIDDEELSRGEEISPELLRAIEKSRISII  1229

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKRE  2171
             VFSK+YASSRWCLDEL  I+  +++ G  V P+FY +G  DV++Q+GSFAEAF +H + E
Sbjct  1230  VFSKNYASSRWCLDELSKIIECKRTLGQVVLPVFYDIGPDDVQQQTGSFAEAFAKHEESE  1289

Query  2170  KME  2162
              +E
Sbjct  1290  MVE  1292



>ref|XP_011047737.1| PREDICTED: LOW QUALITY PROTEIN: TMV resistance protein N-like 
[Populus euphratica]
Length=1507

 Score =   216 bits (551),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 144/378 (38%), Positives = 229/378 (61%), Gaps = 5/378 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             +EAL E   L G  L++  +GHEA+FIQ II+E+  KL    + V ++ VG+   V +I 
Sbjct  326   KEALEEAGNLSGWNLKDMANGHEAKFIQYIIKEVWNKLYPKDMKVGTHPVGIDPLVNEIR  385

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              ++ + +  V +  I G+ G+GKTT+AK  +N   D FEGS FL NV+  SE  +  V L
Sbjct  386   DFVSNATEKVCIVGIHGMPGIGKTTIAKEVFNKLCDEFEGSSFLLNVKEKSESKD-MVLL  444

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +IL+   E I N D G + IK+ +  K+V +VF DVD+ + L  ++G   W   
Sbjct  445   QQQLLHDILRQNAEKINNVDRGKVLIKERLRHKRVLVVFHDVDRPDRLLDLMGEPSWLGP  504

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS++IITT  E+LL   E   +Y+++EL+  +SL+LFCR+AF    P +  +E S   + 
Sbjct  505   GSRVIITTTDESLLL--EADQRYQVQELNRGDSLQLFCRHAFRDTKPAKDYVELSNDVVE  562

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYD-KRLFV  1219
             +CGGLPLALK LGS L G++   W S +++L +  + +IQ+ L IS + LD+   K  F+
Sbjct  563   YCGGLPLALKVLGSCLYGKNQARWESVIDRLRKFPNSEIQKKLRISFDTLDESTLKNTFL  622

Query  1218  LIACHFVGKDRDFAINVLE-KCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
              IAC F+G+ +++   VLE + D +P      LI+ SL+ VD+   + M  L++ MG+EI
Sbjct  623   DIACFFIGRKKEYVAKVLEGRYDYNPEDDFGTLIERSLIKVDDSGTIGMHDLLRGMGREI  682

Query  1041  LRQDSRDDLHTLSKLLDQ  988
             ++++S ++    S++  Q
Sbjct  683   VKEESPENPAERSRIWSQ  700


 Score =   149 bits (376),  Expect(2) = 3e-91, Method: Composition-based stats.
 Identities = 83/139 (60%), Positives = 101/139 (73%), Gaps = 5/139 (4%)
 Frame = -1

Query  2548  SVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgire  2369
             S P+  Y  FLSFRGEDTRK FTDHLYTAL+ AGI TFR+DDE+ RGE I   L + I+E
Sbjct  192   SRPQGAYDVFLSFRGEDTRKTFTDHLYTALVKAGIHTFREDDELPRGEEISDHLLKAIQE  251

Query  2368  srisiIVFSKDYASSRWCLDELLTILG-RRKSEGHAVFPIFYSVGRADVEKQSGSFAEAF  2192
             S+ISI+VFSK YASSRWCLDEL+ IL  + +  G    PIFY +  +DV KQ+GSFAEAF
Sbjct  252   SKISIVVFSKGYASSRWCLDELVEILKCKYRKTGQIALPIFYDIDPSDVRKQTGSFAEAF  311

Query  2191  ERHAKREKMEVEEGRVEWK  2135
              +H +R K +V+    EWK
Sbjct  312   VKHEERYKEKVK----EWK  326



>ref|XP_008232560.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1017

 Score =   323 bits (827),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 188/354 (53%), Positives = 249/354 (70%), Gaps = 1/354 (0%)
 Frame = -2

Query  2079  MVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKINKWLQDESSDvgv  1900
             MVLQ ECDGHEA+FI+KI++ I  KL+RT LSV  Y +G+ SRV +IN WLQD SSDVG+
Sbjct  1     MVLQNECDGHEAKFIKKIVKVIEGKLSRTPLSVAPYLIGIDSRVKEINLWLQDGSSDVGI  60

Query  1899  gvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGLQKQIFENILKGR  1720
              VI G+GG+GKTT+A+V YN N+ RFEG  FL ++R  SE PNG V +Q Q+  +IL GR
Sbjct  61    FVIYGIGGIGKTTIAQVVYNSNFSRFEGRSFLESIREISEGPNGLVQMQVQLLSDILGGR  120

Query  1719  EEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSRGSKIIITTRCEN  1540
                I +  EGIIKIKD I  KKV +V DDVD    LD V+  R WF  GSKIIITTRC  
Sbjct  121   TVKIHSVSEGIIKIKDVISCKKVLLVLDDVDHTNQLDAVLRMRKWFYPGSKIIITTRCVG  180

Query  1539  LLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIRHCGGLPLALKDL  1360
             LLK H+    + ++ L+  ESL+LF  +AFGQ+ P+E  ++ S K + H GGLPLALK L
Sbjct  181   LLKAHQDVKVHNVETLNHVESLELFSCHAFGQNYPVEGYVKLSEKVVNHSGGLPLALKIL  240

Query  1359  GSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFVLIACHFVGKDRD  1183
             GS LSG+S+ VW S L+KLE I +  I   L IS + L DD+D++LF+ IAC F+G ++D
Sbjct  241   GSSLSGQSIHVWESALKKLEIIPNSDIVNKLRISYDSLQDDHDQQLFLHIACFFIGNEKD  300

Query  1182  FAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEILRQDSRD  1021
               + +L+ CD   +VGIQNLID   +T+D  NK+ M Q+I++MG+EI+R +S++
Sbjct  301   VTVKILDGCDFFTIVGIQNLIDRCFLTIDEHNKMKMHQMIRDMGREIVRLESKE  354



>ref|XP_006371054.1| hypothetical protein POPTR_0019s03010g, partial [Populus trichocarpa]
 gb|ERP48851.1| hypothetical protein POPTR_0019s03010g, partial [Populus trichocarpa]
Length=870

 Score =   223 bits (567),  Expect(2) = 5e-91, Method: Compositional matrix adjust.
 Identities = 143/359 (40%), Positives = 218/359 (61%), Gaps = 4/359 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL E   L G  L +  +GHEA+F ++II++++KKL    L VP + VG+      I 
Sbjct  144   RKALEEAGNLSGWNLNDMANGHEAKFTKEIIKDVLKKLEPKYLYVPEHLVGMDRLARSIF  203

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              +L   + DV +  I G+ G+GKTT+AKV +N    RFEGSCFL+N+   S+  NG   L
Sbjct  204   DFLSTATDDVRIVGIHGMPGIGKTTIAKVVFNQLCYRFEGSCFLSNINETSKQFNGLALL  263

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+  +ILK     I   D G + IK+ +  K+V +V DDV + + L+ ++G R WF  
Sbjct  264   QKQLLHDILKQDVANINCVDRGKVLIKERLCRKRVLVVADDVARQDQLNALMGERSWFGP  323

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS++IITTR  ++L   ++   Y+I+EL   ESL+LF  +A     P E  +E S  A+ 
Sbjct  324   GSRVIITTRDSSVLLKADQ--TYQIEELKPYESLQLFRWHALRDTKPTEDYIELSKDAVD  381

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYD-KRLFV  1219
             +CGGLPLAL+ +G+ LSG++ D W+  +EKL RI HH IQ  L IS + LD  + +  F+
Sbjct  382   YCGGLPLALEVMGACLSGKNRDGWKCVIEKLRRIPHHDIQGKLRISFDALDGEELQNAFL  441

Query  1218  LIACHFVGKDRDFAINVL-EKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKE  1045
              IAC F+ + +++   VL  +C  +P V +Q L + SL+ V+   ++ M  L+++MG+E
Sbjct  442   DIACFFIDRKKEYVAKVLGARCGYNPEVDLQTLHERSLIKVNAIGEITMHDLLRDMGRE  500


 Score =   142 bits (358),  Expect(2) = 5e-91, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 100/143 (70%), Gaps = 2/143 (1%)
 Frame = -1

Query  2569  TQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAE  2390
             T+     S P   Y  FLSFRGEDTR+ FTDHLYTAL+ AGI TFRDDDE+ RGE I   
Sbjct  2     TEPESSRSRPEGAYDVFLSFRGEDTRQTFTDHLYTALVQAGIHTFRDDDELPRGEEISDH  61

Query  2389  LrrgiresrisiIVFSKDYASSRWCLDELLTIL-GRRKSEGHAVFPIFYSVGRADVEKQS  2213
             L R I ES+IS++VFSK YASSRWCL+EL+ IL  + +     V PIFY +  +DV KQ+
Sbjct  62    LLRAIHESKISLVVFSKGYASSRWCLNELVEILQCKNRKTNQIVLPIFYDIDPSDVRKQN  121

Query  2212  GSFAEAFERHAKR-EKMEVEEGR  2147
             GSFAEAF +H +R E+  V+E R
Sbjct  122   GSFAEAFVKHEERFEEKLVKEWR  144



>gb|ABB82027.1| TIR-NBS disease resistance-like protein [Populus trichocarpa]
Length=1120

 Score =   223 bits (569),  Expect(2) = 6e-91, Method: Compositional matrix adjust.
 Identities = 143/363 (39%), Positives = 225/363 (62%), Gaps = 6/363 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL +   L G  L +  +GHEA+FI+ II++++ KL R  L VP + VG+      I 
Sbjct  145   RKALEDAGNLSGWSLNDMANGHEAKFIKGIIKDVLNKLRRECLYVPEHLVGM-DLAHDIY  203

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              +L + + DV +  I G+ G+GKTT+AKV +N   + F+GSCFL+++   S+  NG   L
Sbjct  204   DFLSNATDDVRIVGIHGMPGIGKTTIAKVVFNQLCNGFDGSCFLSDINERSKQVNGLALL  263

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QK++  +ILK         D G + IK+ +  K+V +V DDV   + L  ++G R WF  
Sbjct  264   QKRLLHDILKQDAANFDCVDRGKVLIKERLCRKRVLVVADDVAHQDQLKALMGDRSWFGP  323

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS++IITTR  NLL+  +R   Y+I+EL  ++SL+LF  +AF    P E  +E S KA+ 
Sbjct  324   GSRVIITTRNSNLLRKADR--TYQIEELTRDQSLQLFSWHAFEDTKPAEDYIELSKKAVD  381

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYD-KRLFV  1219
             +CGGLPLAL  +G+ LSG++ D W+S ++KL+RI +H IQR L IS + LD  + K  F+
Sbjct  382   YCGGLPLALDVMGACLSGKNRDGWKSVIDKLKRIPNHDIQRKLRISYDLLDGEELKNAFL  441

Query  1218  LIACHFVGKDRDFAINVL-EKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
              IAC F+ + +++   +L  +C  +P V +Q L + SL+ V  +  + M  L+++MG+E+
Sbjct  442   DIACFFIDRKKEYIAKLLGARCGYNPEVDLQTLHERSLIKVLGET-VTMHDLLRDMGREV  500

Query  1041  LRQ  1033
             +R+
Sbjct  501   VRE  503


 Score =   141 bits (355),  Expect(2) = 6e-91, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 99/140 (71%), Gaps = 5/140 (4%)
 Frame = -1

Query  2548  SVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgire  2369
             S+P   Y  FLSFRGE+TRK FT HLY AL  AGI TFRDDDE+ RGE I   L   IRE
Sbjct  9     SIPEGAYDVFLSFRGEETRKTFTGHLYAALDQAGIHTFRDDDELPRGEEISEHLLEAIRE  68

Query  2368  srisiIVFSKDYASSRWCLDELLTIL-GRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAF  2192
             S+ISI+VFSK YASSRWCL+EL+ IL  +RK  G  V PIFY +  +DV KQ+GSFAEAF
Sbjct  69    SKISIVVFSKGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQTGSFAEAF  128

Query  2191  ERHAKREKMEVEEGRV-EWK  2135
             ++H   E+   EE  V EW+
Sbjct  129   DKH---EEERFEEKLVKEWR  145



>gb|KEH25106.1| disease resistance protein (TIR-NBS-LRR class), putative [Medicago 
truncatula]
Length=1160

 Score =   241 bits (615),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 162/393 (41%), Positives = 241/393 (61%), Gaps = 7/393 (2%)
 Frame = -2

Query  2112  EALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKINK  1933
             EALREVAGL G V+      +E+E I+ I+ ++ + LN+T L V     G+ SR+  + +
Sbjct  224   EALREVAGLAGFVVLNS--RNESEAIKDIVEKVTRLLNKTDLFVVDNPAGVESRLQDMIQ  281

Query  1932  WLQ-DESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              L   +S+D+ +  + G+GG+GKTT+ K  YN     FEG  FLAN+R   E P+GQ+ L
Sbjct  282   LLDIQQSNDILLLGMWGMGGIGKTTIVKAIYNKLGHNFEGRSFLANIREVWEQPDGQLHL  341

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+++  +I K     I N + G + +KD +  KK+ +V DDV+ L+ L  + G R+WF  
Sbjct  342   QERLLFDICKETTTKIQNIESGKVILKDRLCHKKILLVLDDVNSLDQLKALCGERNWFGS  401

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKI+ITTR  N+L+G+     Y +KE+D  ESL+LF  +AF Q  P +  +  S   + 
Sbjct  402   GSKIVITTRDMNILRGNRVDQVYVMKEMDANESLELFSWHAFKQASPRDGFVGISENVVE  461

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             +CGGLPLAL+ LGSYL  R    W   LEKL+RI ++++Q+ L+IS + L D+ +K +F+
Sbjct  462   YCGGLPLALEVLGSYLFDRGAVEWNCALEKLKRIPNNQVQKKLKISYDGLNDETEKEIFL  521

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F+G DR+  I +L  C L   +GI  L++ SLV VD+ NKL M  L+++MG+EI+
Sbjct  522   DIACFFIGMDRNDVIQILNGCGLFAEIGISVLVERSLVIVDSKNKLGMHDLLRDMGREIV  581

Query  1038  RQDSRDDLHTLSKLL---DQLVSSTESTGNGVV  949
             R+ S  +L   S+L    D L   +E TG   V
Sbjct  582   REKSPKELGERSRLCFKEDVLDVLSEQTGTQAV  614


 Score =   123 bits (308),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 84/126 (67%), Gaps = 0/126 (0%)
 Frame = -1

Query  2533  FYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisi  2354
              +  FLSFRG+DTR +FT HLY AL NAGI  FRDDD + RG+ I   L R I  ++IS+
Sbjct  86    LHEVFLSFRGKDTRVSFTSHLYAALQNAGITVFRDDDSLQRGDQISTSLLRTIELTQISV  145

Query  2353  IVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKR  2174
             IVFS +Y+ S+WCLDEL+ I+  R++ G  V PIFY V  +++  Q+G F +AF+    R
Sbjct  146   IVFSSNYSDSKWCLDELVRIMKCRRTTGQVVLPIFYDVDPSEIRHQTGEFGKAFQNLLNR  205

Query  2173  EKMEVE  2156
              ++  E
Sbjct  206   IRISNE  211



>ref|XP_008222872.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=869

 Score =   239 bits (609),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 167/406 (41%), Positives = 243/406 (60%), Gaps = 8/406 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKK-LNRTVLSVPSYTVGLASRVGKI  1939
             R AL +VA L G  L E     E+EFIQ II EI K  LN   L V  + VG+ ++V  +
Sbjct  149   RAALSQVAALSGFTLDER--QSESEFIQNIIEEISKHVLNTVCLEVAEHPVGMQAQVQLM  206

Query  1938  NKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVG  1759
             N+ L    SDV +  I G GG+GKTT+AK  YN    +FEG  FLA+VR  S    G VG
Sbjct  207   NELLDLGESDVRMVGIWGTGGIGKTTIAKAVYNSIAHKFEGCSFLASVRERSTSHEGSVG  266

Query  1758  LQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFS  1579
             LQ+ +  +I + +   + N D+G+  IK+ +  +KV +V DDVD +E L  ++GA DWF 
Sbjct  267   LQENLLSDIRRVKNLKVTNVDKGVTMIKEWLSRRKVLLVLDDVDDMEQLHKLVGACDWFG  326

Query  1578  RGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAF-GQDDPLEHLMEYSVKA  1402
              GS+IIITTR + LL  H+ +L +++K LDD+++L+L+C +AF   + PL   M+ +  A
Sbjct  327   AGSRIIITTRDKQLLIAHDVNLIHEVKILDDDKALELYCWHAFKTSEPPLGDYMKLAECA  386

Query  1401  IRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLF  1222
             IR+  GLPLALK LGS L G S+D W   L+  +     KIQ  L+IS + LDD  K +F
Sbjct  387   IRYAQGLPLALKVLGSCLCGGSVDKWEHALDGFKS---KKIQDVLKISYDTLDDIVKEVF  443

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
             + IAC F GK R++ I  LE CDL P  GI+ LI+ +L++V++ + + M  L++ MG++I
Sbjct  444   LDIACFFKGKSRNYVIETLEACDLSPRYGIEVLIEKALISVEHGDYIRMHDLLEEMGRDI  503

Query  1041  LRQDSRDDLHTLSKL-LDQLVSSTESTGNGVVNESASHVNSPKRPY  907
             + Q+S  +    S+L   + V    +   G    +   +NSPK+ Y
Sbjct  504   VEQESPTEAGGRSRLWFHEDVEHVLTNNTGKKKITGIMLNSPKKDY  549


 Score =   124 bits (312),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = -1

Query  2527  HAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiIV  2348
             H FLSFRGEDTR NFTDHLY+AL   GI TFRDD+E+  GE I + L   I +SRIS++V
Sbjct  20    HVFLSFRGEDTRHNFTDHLYSALCREGIITFRDDNELRGGEKISSALLTAIEDSRISVVV  79

Query  2347  FSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAF  2192
             FS++YASS+WCL+EL+ IL  ++S    V P+FY V  +DV  Q GSF +A 
Sbjct  80    FSENYASSKWCLNELVKILDCKESNQQLVIPVFYKVNPSDVRNQRGSFGDAL  131



>ref|XP_009350789.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1436

 Score =   243 bits (619),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 152/365 (42%), Positives = 228/365 (62%), Gaps = 8/365 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNR--TVLSVPSYTVGLASRVGK  1942
             R AL   A L GM++Q E DG+ ++FI+ ++     +L R   +  +P Y VG+ S +  
Sbjct  149   RAALTVAANLAGMIVQSEADGNASKFIENLVAITTARLRRRHPLWDIP-YLVGIDSHLKD  207

Query  1941  INKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQV  1762
             +N WLQDE SD+G+ VI G+ G+GKTT+A+  Y LN  RF+   FL N+R  S+IP G V
Sbjct  208   VNSWLQDEYSDIGMLVIHGMSGIGKTTIARHFYRLNAARFDECSFLENIRETSKIPTGLV  267

Query  1761  GLQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWF  1582
              +Q+++  +I  GR   I N  EGI +++DAI S++VF+V D ++ +   D VI      
Sbjct  268   HIQQKLLYDIC-GRIVKIHNVSEGIAQLRDAIKSERVFVVLDGLEGMHEFDAVINGLKDA  326

Query  1581  SRGSKIIITTRCENLLKGHERH--LQYKIKELDDEESLKLFCRYAFGQDDPLEH-LMEYS  1411
               GSKIIITT    +L+  ++       +  L+  +SL+LFC +AF Q  P+E   ME S
Sbjct  327   LFGSKIIITTTNARVLRATQKFGCKVCTVGVLNYSDSLELFCWHAFEQCHPIEERYMEQS  386

Query  1410  VKAIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYD  1234
              + ++HCGGLPLAL  LGS LSG+S+D W S L + +    + I   L+ S+  L DD+D
Sbjct  387   KRIVQHCGGLPLALTILGSALSGQSIDAWESTLNQQKNFPRYTIMERLKRSIYSLTDDHD  446

Query  1233  KRLFVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNM  1054
             + LF+ IAC F+G DRD+ + +L+ CD H +VG++NLI+  L+TVD DNKL +  + ++ 
Sbjct  447   RALFLHIACFFIGMDRDYVVRILDGCDFHTIVGMENLIEKCLLTVDRDNKLHVHPIFRDT  506

Query  1053  GKEIL  1039
             G+EI+
Sbjct  507   GREIV  511


 Score =   121 bits (303),  Expect(2) = 1e-90, Method: Composition-based stats.
 Identities = 67/130 (52%), Positives = 87/130 (67%), Gaps = 0/130 (0%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresri  2360
             R+ Y  FLSFRGEDTR NF  HLY AL   G+  F D DE+ RGE I   +R+ I +SR 
Sbjct  18    RYIYDVFLSFRGEDTRDNFGHHLYAALEKEGLVIFLDGDEVERGEVISRGVRKAIHKSRC  77

Query  2359  siIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHA  2180
             SI+VF++ YASSRWCLD+L+ IL   ++ G  V P+F  V   DV KQ+GS A+AF RH 
Sbjct  78    SIVVFTECYASSRWCLDDLVMILESTRTSGQFVLPVFNGVDPYDVLKQTGSVAKAFARHD  137

Query  2179  KREKMEVEEG  2150
              RE+++  +G
Sbjct  138   VRERLDKVKG  147



>ref|XP_006349418.1| PREDICTED: TMV resistance protein N-like, partial [Solanum tuberosum]
Length=545

 Score =   277 bits (708),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 174/366 (48%), Positives = 244/366 (67%), Gaps = 2/366 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL+EVA L GM LQ + DGHEA+FI+ I+  +  KL    L    Y + +  R   I 
Sbjct  138   RNALKEVADLGGMPLQNQADGHEAKFIENIVEVVANKLRPRDLHSAPYLIDINYRAEDII  197

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S++VG+ VICG+GG+GKTT+AK AYN +   FEGS FLAN    ++  NG V L
Sbjct  198   SWLQDRSTNVGLYVICGIGGIGKTTIAKFAYNSSARSFEGSSFLANFNEIAKQCNGLVRL  257

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+  +I+ GR+E I N DEGI+ I+DA+G KKV +V DDVD  + +D ++G  DW + 
Sbjct  258   QKQVLYDIV-GRKERISNVDEGIMMIEDAVGYKKVLLVLDDVDDADQIDTILGMTDWLNP  316

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
              SKIIITTR E+LL+    H   K++ L+  +SLKLF  +AFG+D P E  +E S + + 
Sbjct  317   ASKIIITTRHESLLRPSVPHKVLKLEVLNKMDSLKLFSWHAFGEDHPWEGYLELSERVVL  376

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
              C GLPLAL+ LGS LSGR  ++W S LEKLE I    +   L++S + L DD+DK +F+
Sbjct  377   QCVGLPLALRVLGSALSGRRPEIWGSALEKLETIPDGHVIEKLKLSFDTLEDDHDKDIFL  436

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IA  F+G DRD ++ +L+ C  H ++G+QNLID SL+T+ + NKL M +L++++G+ I+
Sbjct  437   HIAHFFLGMDRDDSVRILDGCGFHTIIGMQNLIDRSLLTISDLNKLEMHRLLRDLGRNIV  496

Query  1038  RQDSRD  1021
             R +S D
Sbjct  497   RMESLD  502


 Score = 86.7 bits (213),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 79/117 (68%), Gaps = 3/117 (3%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFR---DDDEIGRGENIDAELrrgire  2369
             +F YH FLSF   DT K FTDHL+  L  AG   F+   DD+E  + + +  +L++GI +
Sbjct  5     KFSYHVFLSFNAHDTGKTFTDHLHRNLFRAGFHVFKCEDDDEEEDKIDELKLKLKKGIEQ  64

Query  2368  srisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAE  2198
             S++S+IV S++YASS  CL EL+ IL +R++ GH V P+F++V  +DV KQ GSF +
Sbjct  65    SKMSVIVLSQNYASSERCLYELVVILEQRRNSGHIVLPVFFNVDPSDVRKQKGSFGK  121



>ref|XP_006478252.1| PREDICTED: TMV resistance protein N-like isoform X1 [Citrus sinensis]
 ref|XP_006478253.1| PREDICTED: TMV resistance protein N-like isoform X2 [Citrus sinensis]
 ref|XP_006478254.1| PREDICTED: TMV resistance protein N-like isoform X3 [Citrus sinensis]
 ref|XP_006478255.1| PREDICTED: TMV resistance protein N-like isoform X4 [Citrus sinensis]
Length=1255

 Score =   238 bits (607),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 167/395 (42%), Positives = 246/395 (62%), Gaps = 11/395 (3%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL+ VA   G  L+   D +E+EFI +I+  I  K+ RT   +    VG+ SR+ K+ 
Sbjct  143   RDALKVVANKSGWELK---DSNESEFIDEIVNVISNKI-RTKPEILKELVGIDSRLEKLR  198

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               +  ESSDV +  I G+GG+GKTT+A+VAY+L    F+GS FLANVR  SE     V L
Sbjct  199   FLIATESSDVRMMGIWGMGGLGKTTLARVAYDLISHEFDGSTFLANVREKSEKEGSVVSL  258

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+  ++LK  +  I+N D+GI  I   +  KKV +V DDV  +E L  +   RDWF  
Sbjct  259   QKQLLSDLLKLADISIWNVDDGINIIGSRLRQKKVLLVIDDVADVEQLQNLARKRDWFGP  318

Query  1575  GSKIIITTRCENLLKGHE---RHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVK  1405
             GSKI+ITTR + LL  HE    H+ Y ++ L ++E+L+LF   AF    P+   +E S +
Sbjct  319   GSKIVITTRDKQLLVAHEVDEEHI-YNLEVLSNDEALQLFSMKAFKTHQPMGEYVELSKR  377

Query  1404  AIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRL  1225
              ++  GGLPLAL  LGS+L+GRS+D+WRS L++L++   +KI   L+IS + L D +K++
Sbjct  378   VLKCAGGLPLALTVLGSFLNGRSVDLWRSTLKRLKKEPPNKIINILQISFDGLQDLEKKI  437

Query  1224  FVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKE  1045
             F+ +AC F   DRD    +LE C   PV+GI+ LI+ SL+TVD+ N+L M  L+Q +G +
Sbjct  438   FLDVACFFKSWDRDHVEKILEGCGFSPVIGIEVLIEKSLLTVDDGNRLWMHDLLQELGHQ  497

Query  1044  ILRQDSRDDLHTLSKLL-DQLVSS--TESTGNGVV  949
             I+++ S +     S++  D+ V    TE+TG+ VV
Sbjct  498   IVQRQSPEQPGKRSRIWRDEEVRHMLTENTGSEVV  532


 Score =   125 bits (313),  Expect(2) = 2e-90, Method: Composition-based stats.
 Identities = 71/126 (56%), Positives = 87/126 (69%), Gaps = 1/126 (1%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y AFLSFRGEDTRK+FTDHLY AL N GI  F+DD E+ +G +I   L   I ESRISII
Sbjct  14    YDAFLSFRGEDTRKSFTDHLYAALKNKGIYVFKDDKELEKGGSISPNLLEAIEESRISII  73

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKRE  2171
             V SK+YASS WCLDEL+ I+  +K +   +FPIFY V    V KQ+ SF EAF +H +  
Sbjct  74    VLSKNYASSTWCLDELVKIVECKKRDDE-IFPIFYDVEPTAVRKQTTSFGEAFAKHEEAF  132

Query  2170  KMEVEE  2153
             K  +E+
Sbjct  133   KDNIEK  138



>ref|XP_006370843.1| hypothetical protein POPTR_0019s00720g [Populus trichocarpa]
 gb|ERP48640.1| hypothetical protein POPTR_0019s00720g [Populus trichocarpa]
Length=532

 Score =   221 bits (564),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/368 (38%), Positives = 224/368 (61%), Gaps = 4/368 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL E   L G  L +  +GHE++FIQ II++++ KL+   ++V ++ VG+   V  I+
Sbjct  143   RKALEETGNLSGWNLSDMENGHESKFIQDIIKDVLNKLDPKYINVSTHVVGIDPLVHTIS  202

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              ++   + DV +  I G+ G+GKTT+AKV +N     FEGSCFL+N+   SE  NG V L
Sbjct  203   DFISTATDDVRLVGIHGMPGIGKTTIAKVVFNQLCYGFEGSCFLSNINETSEQSNGLVLL  262

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +ILK     I N D G++ IK+ +  K+V +V DDV     L+ ++G   WF  
Sbjct  263   QEQLLHDILKQNPANINNVDRGMVLIKERLCHKRVLVVVDDVTHQYQLNALVGDGSWFGP  322

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS++IIT+  E LL   +R     +KEL  + SL+LF  +AF    P +  +E S   + 
Sbjct  323   GSRVIITSEDERLLLKVDRKCH--VKELKRDASLQLFSWHAFRDTKPAKDYVEVSNDVVD  380

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYD-KRLFV  1219
             +CGGLPLAL+ LGS LSG++   W+  ++KL +I +H IQ  L IS + LDD+  +  F+
Sbjct  381   YCGGLPLALEVLGSCLSGKNKSRWKCIIDKLRKIPNHDIQEKLRISFDKLDDHKLQNTFL  440

Query  1218  LIACHFVGKDRDFAINVLE-KCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
              +A  F+G+++++  NVLE +C  +P   +  L + SL+ V+    + M  L+++MG+EI
Sbjct  441   DLASFFIGRNKEYVANVLEARCGYNPEDDLGTLSERSLINVNASGNISMHNLLRDMGREI  500

Query  1041  LRQDSRDD  1018
             + ++S ++
Sbjct  501   IHKESPNN  508


 Score =   141 bits (355),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 99/142 (70%), Gaps = 1/142 (1%)
 Frame = -1

Query  2569  TQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAE  2390
             T+     S P   Y  FLSFRGED RKNFTDHLYTAL+ AGI TFRD +EI RGE I   
Sbjct  2     TEPESSRSRPNGAYDVFLSFRGEDNRKNFTDHLYTALVQAGIYTFRDHNEIPRGEEISKH  61

Query  2389  LrrgiresrisiIVFSKDYASSRWCLDELLTIL-GRRKSEGHAVFPIFYSVGRADVEKQS  2213
             L + I+ES+ISI+VFSK YASSRWCL+EL+ IL  + +  G  V P+FY +  +DV KQ+
Sbjct  62    LLKAIQESKISIVVFSKGYASSRWCLNELVEILECKNRKTGQIVLPVFYDIDPSDVRKQT  121

Query  2212  GSFAEAFERHAKREKMEVEEGR  2147
             GSF +AF++H    K +V+E R
Sbjct  122   GSFVKAFDKHEDCFKEKVKEWR  143



>ref|XP_006371052.1| hypothetical protein POPTR_0019s03000g [Populus trichocarpa]
 ref|XP_006371053.1| hypothetical protein POPTR_0019s03000g [Populus trichocarpa]
 gb|ERP48849.1| hypothetical protein POPTR_0019s03000g [Populus trichocarpa]
 gb|ERP48850.1| hypothetical protein POPTR_0019s03000g [Populus trichocarpa]
Length=863

 Score =   226 bits (575),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 143/363 (39%), Positives = 224/363 (62%), Gaps = 5/363 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL +   L G  L +   GHEA+FI+ II++++ KL R  L VP + VG+      I 
Sbjct  144   RKALEDAGNLSGWSLNDMAYGHEAKFIRGIIKDVLNKLRRECLDVPEHLVGMDRCTHNIY  203

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              +L + + DV +  I G+ G+GKTT+AKV +N   + F+GSCFL+++   S+  NG   L
Sbjct  204   DFLSNATDDVRIVGIHGMPGIGKTTIAKVVFNQLCNGFDGSCFLSDINERSKQVNGLALL  263

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QK++  +ILK         D G + IK+ +  K+V +V DDV   + L  ++G R WF  
Sbjct  264   QKRLLHDILKQDAANFDCVDRGKVLIKERLCRKRVLVVADDVAHQDQLKALMGDRSWFGP  323

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS++IITTR  NLL+  +R   Y+I+EL  ++SL+LF  +AF    P E  +E S KA+ 
Sbjct  324   GSRVIITTRNSNLLRKADR--TYQIEELTRDQSLQLFSWHAFEDTKPAEDYIELSKKAVD  381

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYD-KRLFV  1219
             +CGGLPLAL  +G+ LSG++ D W+S ++KL+RI +H IQR L IS + LD  + K  F+
Sbjct  382   YCGGLPLALDVMGACLSGKNRDGWKSVIDKLKRIPNHDIQRKLRISYDLLDGEELKNAFL  441

Query  1218  LIACHFVGKDRDFAINVL-EKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
              IAC F+ + +++   +L  +C  +P V +Q L + SL+ V  +  + M  L+++MG+E+
Sbjct  442   DIACFFIDRKKEYIAKLLGARCGYNPEVDLQTLHERSLIKVLGET-VTMHDLLRDMGREV  500

Query  1041  LRQ  1033
             +R+
Sbjct  501   VRE  503


 Score =   136 bits (343),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 92/126 (73%), Gaps = 1/126 (1%)
 Frame = -1

Query  2548  SVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgire  2369
             S+P   Y  FLSFRGE+TRK FT HLY AL  AGI TF DD E+ RGE I   L + IRE
Sbjct  9     SIPEGAYDVFLSFRGEETRKTFTGHLYAALDEAGIHTFLDDVELPRGEEISEHLLKAIRE  68

Query  2368  srisiIVFSKDYASSRWCLDELLTIL-GRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAF  2192
             S+ISI+VFSK YASSRWCL+EL+ IL  +RK  G  V PIFY +  +DV KQ+GSFAEAF
Sbjct  69    SKISIVVFSKGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQTGSFAEAF  128

Query  2191  ERHAKR  2174
             ++H +R
Sbjct  129   DKHEER  134



>gb|ABD33460.1| putative NBS-LRR resistance disease protein rsp-22 [Ipomoea batatas]
Length=170

 Score =   295 bits (756),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  1869  KTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGLQKQIFENILKGREEIIFNTDEG  1690
             KTTVAKVAYNLNYDRFEGSCFL NVR ASEIPNG VGLQKQIFENILKGREEIIFNTDEG
Sbjct  5     KTTVAKVAYNLNYDRFEGSCFLVNVREASEIPNGLVGLQKQIFENILKGREEIIFNTDEG  64

Query  1689  IIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSRGSKIIITTRCENLLKGHERHLQ  1510
             IIKIKDAIG+KKVFIVFDDVDQLELLD +IGARDWFSRGSKIIITTRCENLLKGHERHLQ
Sbjct  65    IIKIKDAIGNKKVFIVFDDVDQLELLDALIGARDWFSRGSKIIITTRCENLLKGHERHLQ  124

Query  1509  YKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIRHCGGLPLA  1372
             YKIKELDDEESLKLF RYAFGQD PLEHLMEYSVKAIRHCGG PLA
Sbjct  125   YKIKELDDEESLKLFSRYAFGQDHPLEHLMEYSVKAIRHCGGFPLA  170



>ref|XP_009335301.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1026

 Score =   244 bits (623),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 163/403 (40%), Positives = 242/403 (60%), Gaps = 8/403 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKK-LNRTVLSVPSYTVGLASRVGKI  1939
             REAL E A L G       DGHE++FI  I+ EI  + L++T L V +Y VGL S + ++
Sbjct  150   REALSEAANLSGWPF---LDGHESQFIHMIVEEISGEVLHQTCLDVATYPVGLKSCIPEV  206

Query  1938  NKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVG  1759
             +K+L      V +  I G GG+GKTT+AK  YN    +F+GSCFLANVR  S    G V 
Sbjct  207   DKFLDVGGEGVRMVGIWGTGGIGKTTIAKAVYNSIASKFDGSCFLANVRENSMSCGGVVQ  266

Query  1758  LQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFS  1579
             LQ+ +   IL+G+   + + D+G+  IK  + +KKV ++ DDVDQLE L+ +    DWF 
Sbjct  267   LQETLLAEILRGKGLNVPSVDKGVKLIKTRLHNKKVLLILDDVDQLEQLNKLARGSDWFG  326

Query  1578  RGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAI  1399
              GS+IIITTR ++LL  H+ H  Y++K LDD+++LKLF   AF   +P     + +  A+
Sbjct  327   SGSRIIITTRDQHLLTAHQVHFVYEVKVLDDQKALKLFSWNAFKTSEPPNGYEKLARHAV  386

Query  1398  RHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFV  1219
              +  GLPLAL  LGS+L GRS + W+  ++  +R  + +I   L+IS + L+D  K +F+
Sbjct  387   HYAQGLPLALIVLGSHLCGRSANQWQETIDGYKRASNKQIHEVLKISYSGLEDLVKEVFL  446

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F G D  +   +L+ CDL+P +GIQ L++ +L+T+D   ++MM  L++ MGKEI+
Sbjct  447   DIACFFKGYDVAYVTEILQCCDLNPTIGIQLLVEKALITIDG-TRIMMHDLLEEMGKEIV  505

Query  1038  RQDSRDDLHTLSKLL---DQLVSSTESTGNGVVNESASHVNSP  919
             RQ+S ++    S+L    D     TE+TG   +      V  P
Sbjct  506   RQESPNEPGKRSRLWFPEDVYSVLTENTGTNTIKGIIVKVPKP  548


 Score =   118 bits (295),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 88/128 (69%), Gaps = 1/128 (1%)
 Frame = -1

Query  2536  FFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresris  2357
             + Y  FLSFRGEDTR NFT HL +AL   GI TF DD  I RGENI A L R I +SRIS
Sbjct  19    YTYDVFLSFRGEDTRNNFTGHLNSALRQKGISTFIDDG-IRRGENISASLLRAIEDSRIS  77

Query  2356  iIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAK  2177
             I+VFS++YA S+WCLDEL  IL  +KS+   V PIFY V  +DV  Q GS+ EA  +H +
Sbjct  78    IVVFSENYAESKWCLDELEKILECKKSKQQMVRPIFYKVDPSDVRNQRGSYGEALAQHER  137

Query  2176  REKMEVEE  2153
             + K ++E+
Sbjct  138   KFKDDIEK  145



>ref|XP_006358559.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=1006

 Score =   255 bits (652),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 166/398 (42%), Positives = 249/398 (63%), Gaps = 28/398 (7%)
 Frame = -2

Query  2115  REALREVAGLQGMV--------------LQEECDGHEAEFIQKIIREIVKKLNRTVLSVP  1978
             + AL +VA L GM               L    + HE+ FI+KII  I  +L+R  L + 
Sbjct  160   KNALSQVADLAGMFGADFGGWCCCLCSSLVTFLELHESTFIKKIINVISTRLSRPALYIA  219

Query  1977  SYTVGLASRVGKINKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLAN  1798
             S ++G+  R   IN W+Q + S+     I  + G+GKTT+AK+ YNLN+  FE SCFLAN
Sbjct  220   SCSIGIHRRARPINSWVQADVSNNSNIEILLVCGIGKTTIAKIVYNLNFGYFEISCFLAN  279

Query  1797  VRAASEIPNGQVGLQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqle  1618
             +R  S++PNG + LQKQ+   +LK  +  I + DEGIIKI++A+ ++KV +V DDVD+ +
Sbjct  280   IRETSKLPNGLITLQKQLLSILLKNEKVKISSVDEGIIKIRNALCNRKVLLVLDDVDEPD  339

Query  1617  lldvVIGARDWFSRGSKIIITTRCENLLK---GHERHLQYKIKELDDEESLKLFCRYAFG  1447
             L++ +   +DWF  GSKII+TTR ++LL+   GHE H   ++  L   E+ +LF  +AFG
Sbjct  340   LVEAIFDMKDWFGFGSKIIVTTRHKSLLRLQLGHEVH---EVGILYTIEANELFNFHAFG  396

Query  1446  QDDPLE-----HLMEYSVKAIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHK  1282
              ++  +        EYS + I  CGGLPLAL+ +GS L+G+S DVWRS  EKL  I  +K
Sbjct  397   HENINQISEDKCYKEYSKEVIEWCGGLPLALQVIGSSLAGKSKDVWRSATEKLRDIPTNK  456

Query  1281  IQRNLEISLNPL-DDYDKRLFVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLID-ISL  1108
             I   L +S   L DD+D+ LF+ ++C FV   +DF + +L+KC+ + +VG+QNLID  SL
Sbjct  457   IVDKLRLSYELLEDDHDQNLFLHLSCFFVWMKKDFVVRILDKCEFYTLVGLQNLIDRSSL  516

Query  1107  VTVDND-NKLMMPQLIQNMGKEILRQDSRDDLHTLSKL  997
             VT+D+  N + M QL++ MG++I+R+++  D    S+L
Sbjct  517   VTIDDYVNDIRMHQLVRAMGRDIVRREAPTDPGKHSRL  554


 Score =   107 bits (266),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 90/149 (60%), Gaps = 14/149 (9%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFR-----DDDEIGRGENIDAELrrgires  2366
             Y  FLSF+ EDT K FTDHL TAL  AG  TF+     D DE  RGENI++E    I+ES
Sbjct  21    YDVFLSFKCEDTGKTFTDHLSTALKQAGFCTFKGGGCDDIDESRRGENINSE---SIQES  77

Query  2365  risiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFER  2186
             ++ IIVFS++YASS WCLD+L++IL R+      + PIFY V  +++ K  GS  EA +R
Sbjct  78    KMCIIVFSQNYASSGWCLDQLVSILERKMKFACMILPIFYHVDPSNLRKLKGSIGEALDR  137

Query  2185  H------AKREKMEVEEGRVEWKGKGGEV  2117
             H       + EK   E+   +WK    +V
Sbjct  138   HEEKFKCTRNEKEYWEDKLKKWKNALSQV  166



>gb|KEH25111.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1076

 Score =   240 bits (612),  Expect(2) = 5e-90, Method: Compositional matrix adjust.
 Identities = 157/377 (42%), Positives = 239/377 (63%), Gaps = 6/377 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRV-GKI  1939
             R ALR+ AGL G V+      +E++ IQ I+  + +KL++T L +    VG+ SRV G I
Sbjct  180   RTALRQAAGLAGFVVPN--SRNESKAIQDIVENVTRKLDKTELFIADNPVGVESRVQGMI  237

Query  1938  NKWLQD--ESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQ  1765
                 QD  +S+DV +  + G+GGVGKTT+AK  YN     FEG  FLAN+R   E   G+
Sbjct  238   QLMEQDIQQSNDVLLLGMWGMGGVGKTTIAKAIYNKIGRNFEGRSFLANIREVWEENAGK  297

Query  1764  VGLQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDW  1585
             V LQ+Q+  +I K     I + + G I +KD +  K+V I+ DDV+ L+ L+ + G+R W
Sbjct  298   VNLQEQLLFDICKDMATKIQSIECGKIILKDRLCHKRVLILLDDVNTLDQLNALCGSRKW  357

Query  1584  FSRGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVK  1405
             F  GS+IIITTR  ++L G+  +  +K+K +D+ ES++LF  +AF Q  P +   + S  
Sbjct  358   FGSGSRIIITTRDRHILSGNRVNKVFKMKHMDESESIELFSWHAFKQASPAKDFAKISRN  417

Query  1404  AIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKR  1228
              + + GGLPLAL+ +GSYL  R +  W+S L+KL+RI ++++Q+ L IS + L DDY+K 
Sbjct  418   VVEYSGGLPLALEVIGSYLFDRGITEWKSALDKLKRIPNNQVQKKLRISYDALNDDYEKE  477

Query  1227  LFVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGK  1048
             +F+ +AC F+GKDR+    +L+ C L   +GI  L++ SLVTVD+ NKL M  L+++MG+
Sbjct  478   IFLDVACFFIGKDRNDVTLILDGCGLFAEIGISILVERSLVTVDDKNKLGMHDLLRDMGR  537

Query  1047  EILRQDSRDDLHTLSKL  997
             EI+R  S ++L    +L
Sbjct  538   EIIRGKSPEELEERCRL  554


 Score =   121 bits (304),  Expect(2) = 5e-90, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 101/154 (66%), Gaps = 15/154 (10%)
 Frame = -1

Query  2551  SSVPRFFYHA-----------FLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGE  2405
             S++ RF Y+A           FLSF G++TR +FT HLY +L NAG R FRDDD + RG+
Sbjct  25    SALARFKYYASLRNDTWMHDVFLSFSGKETRASFTSHLYASLQNAGFRVFRDDDSLQRGD  84

Query  2404  NIDAELrrgiresrisiIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADV  2225
             +I   L R I ++RISIIVFSK+YA SRWCLDELL I+  +K+ G  V P+F++V  ++V
Sbjct  85    HISTSLLRAIEQTRISIIVFSKNYAQSRWCLDELLRIMECQKTIGQIVLPVFFNVDPSEV  144

Query  2224  EKQSGSFAEAFE----RHAKREKMEVEEGRVEWK  2135
               Q+G F +AF+    R  ++E+ E+ E  +E K
Sbjct  145   RHQTGEFGKAFQILLNRRIEKEEPELIEFNLEMK  178



>ref|XP_007221584.1| hypothetical protein PRUPE_ppa025848mg [Prunus persica]
 gb|EMJ22783.1| hypothetical protein PRUPE_ppa025848mg [Prunus persica]
Length=860

 Score =   233 bits (594),  Expect(2) = 6e-90, Method: Compositional matrix adjust.
 Identities = 164/406 (40%), Positives = 243/406 (60%), Gaps = 9/406 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKK-LNRTVLSVPSYTVGLASRVGKI  1939
             R AL ++A L G+ L E     E++FIQ II EI K  LN   L V  + VG+ ++V  +
Sbjct  153   RAALAQLAVLSGLTLDEH--QSESKFIQNIIEEISKHVLNTVYLEVAEHPVGMQAQVQVM  210

Query  1938  NKWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVG  1759
             NK L  E +DV +  + G GG+GKTT+AK  YN    +FEG  FLANVR  S    G VG
Sbjct  211   NKLLDLEENDVRMVGVWGTGGIGKTTIAKAVYNSIAHKFEGCSFLANVRERSTSHEGSVG  270

Query  1758  LQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFS  1579
             LQ+ +  +IL+ +   + N D+G+  IK+ +  +KV +V DDVD +E L  ++GA DWF 
Sbjct  271   LQENLLSDILRVKYLKVTNVDKGVTMIKEWLRRRKVLLVLDDVDAMEQLHKLVGACDWFG  330

Query  1578  RGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQD-DPLEHLMEYSVKA  1402
              GS+IIITTR + LL  HE +L +++K LDD+++L+LFC +AF     PL   ++ + +A
Sbjct  331   AGSRIIITTRDKQLLTAHEVNLIHEVKILDDDKALELFCWHAFKTSGPPLGDYVKLAERA  390

Query  1401  IRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLF  1222
             IR+  GLPLALK LG  L G S+D W + L+  +     KIQ  L+IS N LD   + +F
Sbjct  391   IRYAQGLPLALKVLGCCLCGGSIDKWEAALDGFKS---PKIQDVLKISYNALDHSVQEVF  447

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
             + IAC F G++R     +L  C L+   GI+ LI+ +L++V  D  + M  L++ MGK+I
Sbjct  448   LDIACFFKGQNRKDVTEILVACGLNARYGIEVLIEKALISVKFD-YIQMHHLLEEMGKDI  506

Query  1041  LRQDSRDDLHTLSKLLD-QLVSSTESTGNGVVNESASHVNSPKRPY  907
             ++Q+S D+L   S+L   + +    +   G    +   +NSPK+ Y
Sbjct  507   VQQESPDELGGHSRLWSHEDIEHVLTNDTGTKKITGIMLNSPKKDY  552


 Score =   128 bits (322),  Expect(2) = 6e-90, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = -1

Query  2527  HAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiIV  2348
               FLSFRG DTR NFTDHLY+AL   GI TFRDDDE+ RGE I   L   I ES+IS++V
Sbjct  24    QVFLSFRGVDTRHNFTDHLYSALCQRGINTFRDDDELRRGEEISTSLLTAIEESKISVVV  83

Query  2347  FSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAF  2192
             FSK+YASS+WCLDEL+ IL  ++S    V P+FY V  +DV  Q GSF +A 
Sbjct  84    FSKNYASSKWCLDELVKILDCKESNQQQVIPVFYKVNPSDVRNQGGSFGDAL  135



>gb|KDO51715.1| hypothetical protein CISIN_1g001277mg [Citrus sinensis]
Length=1109

 Score =   236 bits (603),  Expect(2) = 8e-90, Method: Compositional matrix adjust.
 Identities = 157/366 (43%), Positives = 232/366 (63%), Gaps = 8/366 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL+ VA   G  L+   D +E+EFI +I+  I  K+ RT   +    VG+ SR+ K+ 
Sbjct  143   RDALKVVANKSGWELK---DSNESEFIDEIVNVISNKI-RTKPEILKELVGIDSRLEKLR  198

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               +  ESSDV +  I G+GG+GKTT+A+VAY+L    F+GS FLANVR  SE     V L
Sbjct  199   FLIATESSDVRMMGIWGMGGLGKTTLARVAYDLISHEFDGSTFLANVREKSEKEGSVVSL  258

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+  ++LK  +  I+N D+GI  I   +  KKV +V DDV  +E L  +   RDWF  
Sbjct  259   QKQLLSDLLKLADISIWNVDDGINIIGSRLRQKKVLLVIDDVADVEQLQNLARKRDWFGP  318

Query  1575  GSKIIITTRCENLLKGHE---RHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVK  1405
             GSKI+ITTR + LL  HE    H+ Y ++ L ++E+L+LF   AF    P+   +E S +
Sbjct  319   GSKIVITTRDKQLLVAHEVDEEHI-YNLEVLSNDEALQLFSMKAFKTRQPMGEYVELSKR  377

Query  1404  AIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRL  1225
              +++ GGLPLAL  LGS+L+GRS+D+WRS L++L++   ++I   L+IS + L D +K++
Sbjct  378   VLKYAGGLPLALTVLGSFLNGRSVDLWRSTLKRLKKEPPNRIINILQISFDGLQDLEKKI  437

Query  1224  FVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKE  1045
             F+ +AC F   DRD    +LE C   PV+GI+ LI+ SL+TVD+ N+L M  L+Q +G +
Sbjct  438   FLDVACFFKSWDRDHVEKILEGCGFSPVIGIEVLIEKSLLTVDDGNRLWMHDLLQELGHQ  497

Query  1044  ILRQDS  1027
             I+++ S
Sbjct  498   IVQRQS  503


 Score =   124 bits (311),  Expect(2) = 8e-90, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 88/126 (70%), Gaps = 1/126 (1%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y AFLSFRGEDTRK+FTDHLY AL N GI  F+DD E+ +G +I   L   I ESRISII
Sbjct  14    YDAFLSFRGEDTRKSFTDHLYAALKNKGIYVFKDDKELEKGGSISPNLLEAIEESRISII  73

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKRE  2171
             V SK+YASS WCLDEL+ I+  +K + H +FPIFY V    V KQ+ SF EAF +H +  
Sbjct  74    VLSKNYASSTWCLDELVKIVECKKRD-HEIFPIFYDVEPTAVRKQTTSFGEAFAKHEEAF  132

Query  2170  KMEVEE  2153
             K  +E+
Sbjct  133   KDNIEK  138



>ref|XP_011013098.1| PREDICTED: TMV resistance protein N-like isoform X1 [Populus 
euphratica]
Length=1166

 Score =   224 bits (572),  Expect(2) = 9e-90, Method: Compositional matrix adjust.
 Identities = 146/378 (39%), Positives = 230/378 (61%), Gaps = 5/378 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL E   L G  L    DGHEA+FI++II+E++ KL+   L VP + VG+      I 
Sbjct  144   RKALEEAGNLSGWNLNHMADGHEAKFIKEIIKEVLNKLDPKYLYVPEHLVGMDRLSRNIF  203

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              +L   + DV +  I G+ G+GKTT+A+V +N   D FEGSCFL+++   S+  NG   L
Sbjct  204   YFLSTATDDVRIVGIHGMPGIGKTTIAQVVFNQLCDGFEGSCFLSDINERSKQFNGLALL  263

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+  +ILK     I   D G + +K+ +  K+V +V DDV  L+    ++G R WF  
Sbjct  264   QKQLLHDILKQDVANINCVDRGKVLVKERLRRKRVLLVADDVAHLDQRKALMGDRSWFGP  323

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS++IITTR  +LL+  E   +Y+IKEL+ +E+L+LF  +AF    P E  ++ S   + 
Sbjct  324   GSRVIITTRDSSLLR--EADQRYQIKELEPDEALQLFSWHAFKDTKPTEDYIDLSKDVVD  381

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKR-LFV  1219
             +CGGLPLAL+ +G+ LSG++ D W+S ++KL RI +H IQ  L IS + LD  + R  F+
Sbjct  382   YCGGLPLALQVMGACLSGKNRDGWKSVIDKLRRIPNHDIQGKLMISFDALDGEELRNAFL  441

Query  1218  LIACHFVGKDRDFAINVL-EKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
              IAC F+ + +++   VL  +C  +P V ++ L + SL+ V  +  + M  L+++MG+EI
Sbjct  442   DIACFFIDRKKEYVAKVLGARCGYNPEVDLETLHERSLIKVLGET-VTMHDLLRDMGREI  500

Query  1041  LRQDSRDDLHTLSKLLDQ  988
             +R+ S  +    +++ +Q
Sbjct  501   VRESSPKEPGKRTRIWNQ  518


 Score =   136 bits (342),  Expect(2) = 9e-90, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 91/130 (70%), Gaps = 1/130 (1%)
 Frame = -1

Query  2569  TQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAE  2390
             T+     S P   Y  FLSFRGEDTRK FTDHLY AL  AGI TFRDDDE+ RGE I   
Sbjct  2     TEPESSRSRPEGAYDVFLSFRGEDTRKTFTDHLYAALDQAGIHTFRDDDELPRGEEISEH  61

Query  2389  LrrgiresrisiIVFSKDYASSRWCLDELLTIL-GRRKSEGHAVFPIFYSVGRADVEKQS  2213
             L R I+ES+ISI+VFSK YASSRWCL+EL+ IL  + +  G  V PIFY +  + V KQ+
Sbjct  62    LLRAIQESKISIVVFSKGYASSRWCLNELVEILKCKNRKPGQIVLPIFYDIDPSYVRKQN  121

Query  2212  GSFAEAFERH  2183
             GSFAEAF +H
Sbjct  122   GSFAEAFVKH  131



>ref|XP_011013099.1| PREDICTED: TMV resistance protein N-like isoform X2 [Populus 
euphratica]
Length=1112

 Score =   224 bits (572),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 146/378 (39%), Positives = 230/378 (61%), Gaps = 5/378 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL E   L G  L    DGHEA+FI++II+E++ KL+   L VP + VG+      I 
Sbjct  144   RKALEEAGNLSGWNLNHMADGHEAKFIKEIIKEVLNKLDPKYLYVPEHLVGMDRLSRNIF  203

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              +L   + DV +  I G+ G+GKTT+A+V +N   D FEGSCFL+++   S+  NG   L
Sbjct  204   YFLSTATDDVRIVGIHGMPGIGKTTIAQVVFNQLCDGFEGSCFLSDINERSKQFNGLALL  263

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+  +ILK     I   D G + +K+ +  K+V +V DDV  L+    ++G R WF  
Sbjct  264   QKQLLHDILKQDVANINCVDRGKVLVKERLRRKRVLLVADDVAHLDQRKALMGDRSWFGP  323

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS++IITTR  +LL+  E   +Y+IKEL+ +E+L+LF  +AF    P E  ++ S   + 
Sbjct  324   GSRVIITTRDSSLLR--EADQRYQIKELEPDEALQLFSWHAFKDTKPTEDYIDLSKDVVD  381

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKR-LFV  1219
             +CGGLPLAL+ +G+ LSG++ D W+S ++KL RI +H IQ  L IS + LD  + R  F+
Sbjct  382   YCGGLPLALQVMGACLSGKNRDGWKSVIDKLRRIPNHDIQGKLMISFDALDGEELRNAFL  441

Query  1218  LIACHFVGKDRDFAINVL-EKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
              IAC F+ + +++   VL  +C  +P V ++ L + SL+ V  +  + M  L+++MG+EI
Sbjct  442   DIACFFIDRKKEYVAKVLGARCGYNPEVDLETLHERSLIKVLGET-VTMHDLLRDMGREI  500

Query  1041  LRQDSRDDLHTLSKLLDQ  988
             +R+ S  +    +++ +Q
Sbjct  501   VRESSPKEPGKRTRIWNQ  518


 Score =   135 bits (341),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 91/130 (70%), Gaps = 1/130 (1%)
 Frame = -1

Query  2569  TQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAE  2390
             T+     S P   Y  FLSFRGEDTRK FTDHLY AL  AGI TFRDDDE+ RGE I   
Sbjct  2     TEPESSRSRPEGAYDVFLSFRGEDTRKTFTDHLYAALDQAGIHTFRDDDELPRGEEISEH  61

Query  2389  LrrgiresrisiIVFSKDYASSRWCLDELLTIL-GRRKSEGHAVFPIFYSVGRADVEKQS  2213
             L R I+ES+ISI+VFSK YASSRWCL+EL+ IL  + +  G  V PIFY +  + V KQ+
Sbjct  62    LLRAIQESKISIVVFSKGYASSRWCLNELVEILKCKNRKPGQIVLPIFYDIDPSYVRKQN  121

Query  2212  GSFAEAFERH  2183
             GSFAEAF +H
Sbjct  122   GSFAEAFVKH  131



>ref|XP_009337704.1| PREDICTED: TMV resistance protein N-like, partial [Pyrus x bretschneideri]
Length=435

 Score =   219 bits (559),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/285 (48%), Positives = 194/285 (68%), Gaps = 0/285 (0%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL E+A L GMVLQ + DG+E++FI+ I++ I  KL+ T LSV    +G+ S+  +IN
Sbjct  151   RKALAEIADLAGMVLQNQADGYESKFIKNIVKVIGDKLSSTPLSVEPKLIGIQSQAERIN  210

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD SSDVG+ V+ G+ G+GKTT+AK  YN N+  F+GS F+ N++  ++ PNG V +
Sbjct  211   LWLQDGSSDVGIFVVYGMSGIGKTTIAKHVYNSNFTSFQGSSFIENIKETADRPNGLVQI  270

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  +IL  RE  I +  EGIIKI+ AI S++V +V DDVDQ++ LD ++  +D F  
Sbjct  271   QMQLLCDILNDREVKIHSVSEGIIKIERAIRSRRVLLVLDDVDQMDQLDAILRMKDQFYP  330

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKI+ITTR E LLK ++    + I+ LD  +SLKLF  +AFGQD P+E  M +S + ++
Sbjct  331   GSKILITTRRERLLKAYQVTEVHIIQTLDYNQSLKLFSWHAFGQDHPIEEYMGHSKQLVQ  390

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEI  1261
             H  GLPLALK LGS LSG ++ VW S L+KL+ I   +I   L I
Sbjct  391   HSDGLPLALKVLGSSLSGENIGVWESALDKLKVIPDGEIMNKLRI  435


 Score =   140 bits (354),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 96/139 (69%), Gaps = 4/139 (3%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGE+TRK FTDHLYTAL NAG  TFRDDDE+ RGE+I   LR+ I++SR S++
Sbjct  22    YDVFLSFRGEETRKTFTDHLYTALNNAGFLTFRDDDELERGEDIKPGLRKAIQQSRTSVV  81

Query  2350  VFSKDYASSRWCLDELLTILGR-RKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKR  2174
             VFSKDYASS WCLDEL+ IL R R +  H V P+FY V  + V KQ+GS  +AF R  K 
Sbjct  82    VFSKDYASSSWCLDELVLILERKRTTSDHVVLPVFYDVDPSHVRKQTGSVRKAFTRSQKN  141

Query  2173  EKMEVEEGRVEWKGKGGEV  2117
             +  E  EG   W+    E+
Sbjct  142   QSPEKVEG---WRKALAEI  157



>ref|XP_006371227.1| hypothetical protein POPTR_0019s06300g [Populus trichocarpa]
 gb|ERP49024.1| hypothetical protein POPTR_0019s06300g [Populus trichocarpa]
Length=850

 Score =   217 bits (553),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 146/389 (38%), Positives = 228/389 (59%), Gaps = 16/389 (4%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL E   L G    +  +GHEA+FI++++++++ KL+   L VP   VG+      I 
Sbjct  144   RKALEESGNLSGWNHNDMANGHEAKFIKEVVKDVLNKLDPKYLYVPERLVGMDRLAHNIF  203

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              +L   + DV +  I G+ G+GKTT+AKV +N     FEGSCFL+N+   S+  NG   L
Sbjct  204   DFLSTATDDVRIVGIHGMPGIGKTTIAKVVFNQLCYGFEGSCFLSNINETSKQFNGLAPL  263

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+  +ILK     I   D G + IK+ +  K+V +V DDV  L+ L+ ++G R WF  
Sbjct  264   QKQLLHDILKQDAANINCDDRGKVLIKERLRRKRVLVVADDVAHLDQLNALMGERSWFGP  323

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS++IITTR  NLL+  E    Y+IKEL  +ESL+LF  +AF    P E  +E S  A+ 
Sbjct  324   GSRVIITTRDSNLLR--EADQTYRIKELTRDESLRLFSWHAFKDTKPAEDYIELSKDAVD  381

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLD-----DYD-  1234
             +CGGLPLAL+ +G+ LSG++ D W+  ++KL RI +H IQ  L IS + LD      +D 
Sbjct  382   YCGGLPLALEVMGACLSGKNRDGWKCVIDKLRRIPNHDIQGKLRISFDALDGKLRISFDA  441

Query  1233  ------KRLFVLIACHFVGKDRDFAINVL-EKCDLHPVVGIQNLIDISLVTVDNDNKLMM  1075
                   +  F+ IAC F+ + +++   VL  +C  +P V ++ L + SL+ V     + M
Sbjct  442   LDGEELQNAFLDIACFFIDRKKEYVAKVLGARCGYNPEVDLETLRERSLIKVLG-GTVTM  500

Query  1074  PQLIQNMGKEILRQDSRDDLHTLSKLLDQ  988
               L+++MG+E++R+ S  +    +++ +Q
Sbjct  501   HDLLRDMGREVVRESSPKEPGKRTRIWNQ  529


 Score =   143 bits (360),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 98/134 (73%), Gaps = 2/134 (1%)
 Frame = -1

Query  2542  PRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresr  2363
             P   Y  FLSFRGEDTRK FTDHLYTAL+ AGI TFRDDDE+ RGE I   L R I+ES+
Sbjct  11    PEGAYDVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELSRGEEISKHLLRAIQESK  70

Query  2362  isiIVFSKDYASSRWCLDELLTIL-GRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFER  2186
             ISI+VFSK YASSRWCL+EL+ IL  + +     V PIFY +  +DV KQ+GSFAEAF +
Sbjct  71    ISIVVFSKGYASSRWCLNELVEILKCKNRKTDQIVLPIFYDIDPSDVRKQNGSFAEAFVK  130

Query  2185  HAKR-EKMEVEEGR  2147
             H +R E+  V+E R
Sbjct  131   HEERFEEKLVKEWR  144



>gb|ABB82029.1| TIR-NBS disease resistance-like protein [Populus trichocarpa]
Length=1147

 Score =   219 bits (557),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/378 (37%), Positives = 230/378 (61%), Gaps = 4/378 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL E   L G  L +  +GHEA+FI++II++++ KL+   L VP + VG+      I 
Sbjct  144   RKALEEAGNLSGWNLNDMANGHEAKFIKEIIKDVLNKLDPKYLYVPEHLVGIDRLAHNII  203

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              +L   + DV +  I G+ G+GKTT+A+V +N     FE SCFL+N+   S+  NG V L
Sbjct  204   DFLSTATDDVLIVGIHGMPGIGKTTIARVVFNQLCYGFEESCFLSNINETSKQFNGLVPL  263

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+  +I K     I   D G + IK+ +  ++V +V DDV + + L+ ++G R WF  
Sbjct  264   QKQLLHDIFKQDAANINCVDRGKVLIKERLCRQRVLVVADDVARQDQLNALMGERSWFGP  323

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS++IITTR  ++L   ++   Y+I+EL  +ESL+LF  +A    +P E  +E S   + 
Sbjct  324   GSRVIITTRDSSVLLKADQ--TYQIEELKPDESLQLFSWHALRDTEPAEDYIELSKDVVD  381

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYD-KRLFV  1219
             +CGGLPLAL+ +G+ LSG++ D W+S ++KL RI +H IQ  L+IS + LD  + +  F+
Sbjct  382   YCGGLPLALEVMGACLSGKNRDGWKSVIDKLRRIPNHDIQGKLKISYDSLDGEELQNAFL  441

Query  1218  LIACHFVGKDRDFAINVL-EKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
              IAC F+ + +++   VL  +C  +P V ++ L   SL+ V+   K+ M  L+++MG+E+
Sbjct  442   DIACFFIDRKKEYVAKVLGARCGYNPEVDLETLRGRSLIKVNAIGKITMHDLLRDMGREV  501

Query  1041  LRQDSRDDLHTLSKLLDQ  988
             +R+ S  +    +++ +Q
Sbjct  502   VRETSPKEPGKRTRIWNQ  519


 Score =   141 bits (355),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 103/143 (72%), Gaps = 2/143 (1%)
 Frame = -1

Query  2569  TQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAE  2390
             T+     S P   Y  FLSFRG+DTRK FTDHLYTAL+ AGI TFRDDDE+ RGE I   
Sbjct  2     TEPESSRSRPEGTYDVFLSFRGKDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEIHDH  61

Query  2389  LrrgiresrisiIVFSKDYASSRWCLDELLTIL-GRRKSEGHAVFPIFYSVGRADVEKQS  2213
             L R I+ES+ISI+VFSK YASSRWCL+EL+ IL  + +  G  V PIFY++  +DV KQ+
Sbjct  62    LLRAIQESKISIVVFSKGYASSRWCLNELVEILKCKNRKTGQIVQPIFYNIDPSDVRKQN  121

Query  2212  GSFAEAFERHAKR-EKMEVEEGR  2147
             GSFA+AF +H +R E+  V+E R
Sbjct  122   GSFAKAFVKHEERFEEKLVKEWR  144



>ref|XP_002514805.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF47359.1| ATP binding protein, putative [Ricinus communis]
Length=1097

 Score =   232 bits (592),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 152/376 (40%), Positives = 235/376 (63%), Gaps = 8/376 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVL--SVPSYTVGLASRVGK  1942
             R A+ E+A L G    +  D HE+E IQ+I++E++ KL +T L  S     VG+ SR+ +
Sbjct  142   RAAISELANLAGW---DSLDRHESELIQEIVKEVLSKLRKTSLESSAAKNFVGMNSRLVE  198

Query  1941  INKWL-QDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQ  1765
             ++  L   +  DV    ICG+GG+GKTT+A+  +     +FEGS FLANVR   E   G 
Sbjct  199   MSMCLDMGQLDDVQFIGICGMGGIGKTTIARFVHEELSSQFEGSSFLANVREVEE-KRGL  257

Query  1764  VGLQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDW  1585
             V LQKQ+   IL  R   I N   G+ +I + +  K+V I+ DDV+QL+ L ++ G  DW
Sbjct  258   VHLQKQLLSEILLDRNITICNAFGGMTEISNRLAHKRVLIILDDVNQLDQLKMLAGMHDW  317

Query  1584  FSRGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVK  1405
             F +GS+II+T+R E+LLK H     Y+++ L  +E+L LFC  AF  D P+E  +E S +
Sbjct  318   FGKGSRIIVTSRDEHLLKCHGVDKIYRVEGLGRDEALHLFCLKAFRNDHPIEDFLELSNQ  377

Query  1404  AIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRL  1225
              + +C GLPLAL   GS+L G+S+  WRS L++L+ I + +I   L IS + L++ +K+L
Sbjct  378   FVNYCNGLPLALDVFGSFLFGKSLSEWRSALDRLKEIPNQEILDKLNISFDGLEEMEKKL  437

Query  1224  FVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKE  1045
             F+ IAC F G+DRD+   VL+ C L+P  GI  L+  SL+T+  + ++ M  L+Q +G++
Sbjct  438   FLDIACFFNGEDRDYVYEVLDSCGLYPDFGISVLVSKSLITISKE-RIWMHDLLQELGRD  496

Query  1044  ILRQDSRDDLHTLSKL  997
             I+R++S+++    S+L
Sbjct  497   IVRRESQEEPGKRSRL  512


 Score =   127 bits (320),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 91/138 (66%), Gaps = 1/138 (1%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGEDTRKNFT HLY AL   G+ TFRDD+E+ RG+ I   L + I  S+I++I
Sbjct  12    YDVFLSFRGEDTRKNFTSHLYAALCQKGVITFRDDEELERGKTISQALLQAIHGSKIAVI  71

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKRE  2171
             VFS+DYASS WCLDEL  I   RK +G  V P+F +V   +V KQ+  F +AF +H  R 
Sbjct  72    VFSRDYASSSWCLDELAEIHKCRKEKGQIVMPVFCNVNPYEVRKQAAGFGKAFAKHELRF  131

Query  2170  KMEVEEGRVEWKGKGGEV  2117
             K +V++ +  W+    E+
Sbjct  132   KNDVQKVQ-RWRAAISEL  148



>ref|XP_006478256.1| PREDICTED: TMV resistance protein N-like isoform X5 [Citrus sinensis]
Length=1101

 Score =   238 bits (608),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 167/395 (42%), Positives = 246/395 (62%), Gaps = 11/395 (3%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL+ VA   G  L+   D +E+EFI +I+  I  K+ RT   +    VG+ SR+ K+ 
Sbjct  143   RDALKVVANKSGWELK---DSNESEFIDEIVNVISNKI-RTKPEILKELVGIDSRLEKLR  198

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               +  ESSDV +  I G+GG+GKTT+A+VAY+L    F+GS FLANVR  SE     V L
Sbjct  199   FLIATESSDVRMMGIWGMGGLGKTTLARVAYDLISHEFDGSTFLANVREKSEKEGSVVSL  258

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+  ++LK  +  I+N D+GI  I   +  KKV +V DDV  +E L  +   RDWF  
Sbjct  259   QKQLLSDLLKLADISIWNVDDGINIIGSRLRQKKVLLVIDDVADVEQLQNLARKRDWFGP  318

Query  1575  GSKIIITTRCENLLKGHE---RHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVK  1405
             GSKI+ITTR + LL  HE    H+ Y ++ L ++E+L+LF   AF    P+   +E S +
Sbjct  319   GSKIVITTRDKQLLVAHEVDEEHI-YNLEVLSNDEALQLFSMKAFKTHQPMGEYVELSKR  377

Query  1404  AIRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRL  1225
              ++  GGLPLAL  LGS+L+GRS+D+WRS L++L++   +KI   L+IS + L D +K++
Sbjct  378   VLKCAGGLPLALTVLGSFLNGRSVDLWRSTLKRLKKEPPNKIINILQISFDGLQDLEKKI  437

Query  1224  FVLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKE  1045
             F+ +AC F   DRD    +LE C   PV+GI+ LI+ SL+TVD+ N+L M  L+Q +G +
Sbjct  438   FLDVACFFKSWDRDHVEKILEGCGFSPVIGIEVLIEKSLLTVDDGNRLWMHDLLQELGHQ  497

Query  1044  ILRQDSRDDLHTLSKLL-DQLVSS--TESTGNGVV  949
             I+++ S +     S++  D+ V    TE+TG+ VV
Sbjct  498   IVQRQSPEQPGKRSRIWRDEEVRHMLTENTGSEVV  532


 Score =   121 bits (304),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 87/126 (69%), Gaps = 1/126 (1%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y AFLSFRGEDTRK+FTDHLY AL N GI  F+DD E+ +G +I   L   I ESRISII
Sbjct  14    YDAFLSFRGEDTRKSFTDHLYAALKNKGIYVFKDDKELEKGGSISPNLLEAIEESRISII  73

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKRE  2171
             V SK+YASS WCLDEL+ I+  +K +   +FPIFY V    V KQ+ SF EAF +H +  
Sbjct  74    VLSKNYASSTWCLDELVKIVECKKRDDE-IFPIFYDVEPTAVRKQTTSFGEAFAKHEEAF  132

Query  2170  KMEVEE  2153
             K  +E+
Sbjct  133   KDNIEK  138



>ref|XP_011001242.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
 ref|XP_011001243.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=1169

 Score =   216 bits (550),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/368 (37%), Positives = 223/368 (61%), Gaps = 4/368 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL E   L G  L +  +GHE++FIQ II++++ KL+   ++V ++ VG+   V  I+
Sbjct  180   RKALEEAGNLSGWNLSDMENGHESKFIQDIIKDVLNKLDPKYINVSTHLVGIDPLVHTIS  239

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              ++   + DV +  I G+ G+GKTT+AKV +N     FEGSCFL+N+   SE  NG   L
Sbjct  240   DFISTATDDVRLVGIHGMPGIGKTTIAKVVFNQLCYGFEGSCFLSNINETSEQSNGLFLL  299

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +ILK     I N D G++ IK+ +  K+V +V DDV     L+ ++G   WF  
Sbjct  300   QEQLLHDILKQNPANINNVDRGMVLIKERLCHKRVLVVVDDVTHQYQLNALVGDGSWFGP  359

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS++IIT+  E LL   +R  Q  ++EL  + SL+LF  +AF    P +  +E S   + 
Sbjct  360   GSRVIITSEDERLLLKVDRKCQ--VEELKRDASLQLFSWHAFRDTKPAKDYVEVSNDVVD  417

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYD-KRLFV  1219
             +CGGLPLAL+ LGS LSG++   W+  ++KL +I +H IQ  L I  + LDD+  +  F+
Sbjct  418   YCGGLPLALEVLGSCLSGKNKSRWKCIIDKLRKIPNHDIQEKLRIRFDKLDDHKLQNTFL  477

Query  1218  LIACHFVGKDRDFAINVLE-KCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
              +A  F+G+++++  NVLE +C  +P   +  L + SL+ V+    + M  L+++MG++I
Sbjct  478   DLASFFIGRNKEYVANVLEARCGYNPEDDLGTLSERSLINVNASGNISMHNLLRDMGRDI  537

Query  1041  LRQDSRDD  1018
             + ++S ++
Sbjct  538   IHKESPNN  545


 Score =   143 bits (360),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 100/144 (69%), Gaps = 1/144 (1%)
 Frame = -1

Query  2575  ARTQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENID  2396
             A T+     S P   Y  FLSFRGED RKNFTDHLYTAL+ AGI TFRD +EI RGE I 
Sbjct  37    AMTEPESSRSRPNGAYDVFLSFRGEDNRKNFTDHLYTALVQAGIYTFRDHNEIPRGEEIS  96

Query  2395  AELrrgiresrisiIVFSKDYASSRWCLDELLTIL-GRRKSEGHAVFPIFYSVGRADVEK  2219
               L + I+ES+ISI+VFSK YASSRWCL+EL+ IL  + +  G  V P+FY +  +DV K
Sbjct  97    KHLLKAIQESKISIVVFSKGYASSRWCLNELVEILECKNRKTGQIVLPVFYDIDPSDVRK  156

Query  2218  QSGSFAEAFERHAKREKMEVEEGR  2147
             Q+GSF +AF++H    K +V+E R
Sbjct  157   QTGSFVKAFDKHEDCFKEKVKEWR  180



>gb|ABM55688.1| TIR-NBS class disease resistance protein [(Populus tomentosa 
x Populus bolleana) x Populus tomentosa]
Length=509

 Score =   220 bits (560),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 146/364 (40%), Positives = 218/364 (60%), Gaps = 4/364 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL +   L G  L +  +GHEA+ I+ II+++V KL    L VP + VG+      I 
Sbjct  144   RKALEDAGNLSGWNLNDMANGHEAKSIKGIIKDVVNKLEPKYLYVPEHLVGM-DLAHDIY  202

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              +L   + DV +  I G+ G+GKTT+AKV +N   + FEGSCFL+++   S+  NG  GL
Sbjct  203   DFLSTATDDVRIVGIHGMSGIGKTTLAKVVFNQLCNGFEGSCFLSDINETSKQFNGLAGL  262

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+  +ILK         D G + IK+ I  K+V +V DDV   E L+ ++G R WF  
Sbjct  263   QKQLLRDILKQDVANFDCVDRGKVLIKERIRRKRVLVVADDVAHPEQLNALMGERSWFGP  322

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS++IITTR  NLL+  E    Y+IKEL   ESL+LF R+AF    P +  +E S KA+ 
Sbjct  323   GSRVIITTRDSNLLR--EADQTYQIKELKPGESLQLFSRHAFKDSKPAKDYIELSKKAVD  380

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFVL  1216
             +CGGLPLAL+ +G+ L  ++   W  +++ L RI +  IQ  L IS + LD   +R F+ 
Sbjct  381   YCGGLPLALQVIGALLYRKNRGEWEREIDNLSRIPNQDIQGKLLISYDALDGELQRAFLD  440

Query  1215  IACHFVGKDRDFAINVLE-KCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
             IAC F+G +R++   VL  +C  +P V ++ L + SL+  +   K+ M  L+++MG+EI+
Sbjct  441   IACFFIGIEREYVAKVLGVRCRPNPEVVLETLSERSLIQFNAFGKITMHDLLRDMGREIV  500

Query  1038  RQDS  1027
             R+ S
Sbjct  501   RESS  504


 Score =   139 bits (350),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 92/123 (75%), Gaps = 1/123 (1%)
 Frame = -1

Query  2548  SVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgire  2369
             S+P   Y  FLSFRGEDTRK FT HLY AL +AGIRTF DD+E+ RGE I   L + IRE
Sbjct  9     SIPEGDYDVFLSFRGEDTRKTFTGHLYAALDDAGIRTFLDDNELPRGEEISEHLLKAIRE  68

Query  2368  srisiIVFSKDYASSRWCLDELLTIL-GRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAF  2192
             S+ISI+VFSK YASSRWCL+EL+ IL  +RK  G  V PIFY +  +DV KQ+G FAEAF
Sbjct  69    SKISIVVFSKGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQTGCFAEAF  128

Query  2191  ERH  2183
             ++H
Sbjct  129   DKH  131



>ref|XP_010087987.1| TMV resistance protein N [Morus notabilis]
 gb|EXB30997.1| TMV resistance protein N [Morus notabilis]
Length=1129

 Score =   233 bits (595),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 153/378 (40%), Positives = 226/378 (60%), Gaps = 29/378 (8%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL E A L G  L+   DGHEA+FI+KI  EI+++L  T L    Y VG+ SRV  + 
Sbjct  170   RSALTEAANLSGWDLRNTADGHEAKFIKKITEEILRQLKNTYLFEALYPVGIDSRVRVMT  229

Query  1935  KWLQ-DESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVG  1759
               L   E  +V +  I G+GG+GKTT+AK  YN  YD FEG CFL NVR     PN +V 
Sbjct  230   SLLNISEEDEVRMVGILGMGGMGKTTIAKAIYNRLYDSFEGRCFLGNVRETWNRPNCEVS  289

Query  1758  LQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFS  1579
             LQ+Q+  +ILK R+  + N D GI++IKD +   ++ +V D++D  + L  V G+RDWF 
Sbjct  290   LQEQLLSDILK-RKVKLNNPDRGIMEIKDRLCRMRILLVVDNIDDADQLKAVAGSRDWFG  348

Query  1578  RGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAI  1399
              GS+IIITTR          ++++                +AF +  P +  ++ S    
Sbjct  349   FGSRIIITTR----------NMRW----------------HAFRRSFPDKDYVQLSGNVA  382

Query  1398  RHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLF  1222
              +CGGLPLAL+ LGS+L GRS+  W + ++KLERI H+KIQ  L+IS   L D+  + +F
Sbjct  383   AYCGGLPLALEVLGSFLFGRSIPEWENAIKKLERIPHNKIQEKLKISYEALTDETIQEMF  442

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
             + I+C FVG DR++ + +L+ C     +GI  L+   LVT++ +NKL M  L+++MG++I
Sbjct  443   LDISCFFVGMDRNYVLQILDGCGFFAEIGISVLLQRCLVTINEENKLTMHGLLRDMGRDI  502

Query  1041  LRQDSRDDLHTLSKLLDQ  988
             +R++S  +L   S+L  Q
Sbjct  503   VRKESPKELGKRSRLWHQ  520


 Score =   125 bits (314),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGEDTRK FT HLY+AL +AG+  F DD E+ +GENI  EL R I+ SRIS++
Sbjct  40    YDVFLSFRGEDTRKTFTGHLYSALTDAGVNAFIDDRELPKGENIPEELVRAIQGSRISVV  99

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAK  2177
             VFS++YA S WCL+EL+ I+  R++    + P+FY V  +DV KQ+G F+++FE+H K
Sbjct  100   VFSRNYADSSWCLEELVKIMECRRTVRQMMIPVFYDVDPSDVRKQTGIFSKSFEKHEK  157



>ref|XP_007034212.1| Disease resistance protein family, putative [Theobroma cacao]
 gb|EOY05138.1| Disease resistance protein family, putative [Theobroma cacao]
Length=1047

 Score =   214 bits (546),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 142/366 (39%), Positives = 219/366 (60%), Gaps = 34/366 (9%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL E A L G  LQ    GHE++FIQKI+ ++++K+NR+ L V ++ V + SRV ++ 
Sbjct  148   RTALTEAADLSGWDLQNVAVGHESKFIQKIVEDVLRKVNRSYLHVATHPVAIESRVRRVM  207

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYD--RFEGSCFLANVRAASEIPNGQV  1762
             ++L   S +V +  I G+GGVGKTTVAK  YN   D  +F+GS FL++++  S+ PNG  
Sbjct  208   EFLSIGSDEVRIMGIYGMGGVGKTTVAKAVYNSVCDGFQFDGSSFLSDIKDNSKQPNGLA  267

Query  1761  GLQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWF  1582
              +Q+Q+  +IL  +   I N D GI  I++ +  ++VFIV DDVD    L+ ++G R WF
Sbjct  268   SVQRQLLSDILNLKSVTIDNVDRGINLIQERLRYRRVFIVLDDVDDSTQLNSLVGDRKWF  327

Query  1581  SRGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKA  1402
               GS+II+TTR E LL   E   +YK++EL+ EES +LF  +AF + +P +   + S   
Sbjct  328   GLGSRIIVTTRDERLLTELEVDERYKVEELNPEESTQLFSWHAFRRPNPKDGYFQLSKSV  387

Query  1401  IRHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLF  1222
             + H  GLPLAL+ LG                               IS + LDD  K +F
Sbjct  388   VDHVQGLPLALEVLG-------------------------------ISFDGLDDQMKAIF  416

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVD-NDNKLMMPQLIQNMGKE  1045
             + IAC F+G D+++ + +L+ C   P +G+  L++ SL+T+D +D+KL M  L+++MG+E
Sbjct  417   LDIACFFIGMDKEYVMKILDGCGFFPEIGVSVLLERSLITIDQHDHKLKMHDLLRDMGRE  476

Query  1044  ILRQDS  1027
             I+R+ S
Sbjct  477   IVREVS  482


 Score =   144 bits (363),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGEDTRKNFTDHLY  L++AG+ TFRDDDE+ RG++I +EL + I+ES++S++
Sbjct  18    YEVFLSFRGEDTRKNFTDHLYATLLSAGVNTFRDDDELARGKDISSELLKVIQESKVSLL  77

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKRE  2171
             VFSK YASSRWCL+EL+ I+  + + G  V PIFY V  + V  Q+GSFA+AF +H +R 
Sbjct  78    VFSKGYASSRWCLNELVNIINCKNTIGQIVIPIFYDVDPSHVRNQTGSFAKAFAKHEERF  137

Query  2170  KMEVE  2156
             + + E
Sbjct  138   EADTE  142



>ref|XP_011012884.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=867

 Score =   213 bits (541),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 159/413 (38%), Positives = 238/413 (58%), Gaps = 9/413 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL E   L G  L    +GHE++ IQ I+ E++ KLN   + V +Y VG+ S+V  I 
Sbjct  146   RTALLEAGILCGFDLHSIANGHESKLIQMIVEEVLSKLNPRYMKVATYPVGIDSQVKDII  205

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
               L   +++V +  I G+ G+GKTT+AK  +N    +FEGS  L N+    +   G + L
Sbjct  206   SMLCVGTNEVRIVGIYGMPGIGKTTIAKAVFNQICHKFEGSSCLLNISERLDQHTGLLKL  265

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             +KQ+  +ILKG      + DEGI  IK     K+V ++ DDVDQL+ L  + G RDWF  
Sbjct  266   KKQLLRDILKGYIWHCNDDDEGINLIKSRFCRKRVLVILDDVDQLKHLRALAGERDWFGP  325

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS+I+ITTR E LL   E   +Y  K L++EESL+LF  +AF +  P++  +E S   + 
Sbjct  326   GSRIVITTRDERLLTRLEVEKKYHAKGLNNEESLQLFSWHAFKRPHPMKEYVELSKVVVD  385

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFVL  1216
             +  G+PLAL+ LGS L  RS+  WRS +EKL++ L H+IQR L  SL+ LD   K +F+ 
Sbjct  386   YVDGVPLALEVLGSKLFKRSITHWRSFIEKLQKHLPHQIQRQLITSLDDLDGEVKGMFLD  445

Query  1215  IACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEILR  1036
             IAC F G D+D+   +L+    +P +G   L + SL+TV+++N+L M  L+++MG+EI+ 
Sbjct  446   IACFFNGMDKDYVGKILDGRGFYPEMGFDILGERSLLTVNSENELQMNNLLRDMGREIIH  505

Query  1035  QDSRDDLHTLSKL---------LDQLVSSTESTGNGVVNESASHVNSPKRPYS  904
             Q + +     S+L         LD+  S TE     V++  AS    P   ++
Sbjct  506   QMAPNHPGKRSRLWHPEDIMDVLDKYCSGTEVVEGIVLDAQASKDVFPSTSFA  558


 Score =   145 bits (367),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 100/132 (76%), Gaps = 1/132 (1%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGEDTRKNFTDHLYTAL+ AGI TFRDD+E+ +GE I + L + I+ES+ISI+
Sbjct  16    YDVFLSFRGEDTRKNFTDHLYTALLQAGIHTFRDDNELRKGEEISSHLLKAIQESKISIV  75

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKRE  2171
             VFSK YASS WCLDEL  IL  R++ G  V P+FY +  +D+ KQ  SFAEAF+RH +  
Sbjct  76    VFSKGYASSTWCLDELSEILDCRQTAGQIVLPVFYDIDPSDIRKQKRSFAEAFDRHEELF  135

Query  2170  KMEVEEGRVEWK  2135
             K E+E+ + +W+
Sbjct  136   KEEMEKVQ-KWR  146



>ref|XP_006371041.1| hypothetical protein POPTR_0019s02900g [Populus trichocarpa]
 gb|ERP48838.1| hypothetical protein POPTR_0019s02900g [Populus trichocarpa]
Length=1147

 Score =   217 bits (553),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 139/378 (37%), Positives = 229/378 (61%), Gaps = 4/378 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL E   L G  L +  +GHEA+FI++II++++ KL+   L VP + VG+      I 
Sbjct  144   RKALEEAGNLSGWNLNDMANGHEAKFIKEIIKDVLNKLDPKYLYVPEHLVGIDRLAHNII  203

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              +L   + DV +  I G+ G+GKTT+ +V +N     FE SCFL+N+   S+  NG V L
Sbjct  204   DFLSTATDDVLIVGIHGMPGIGKTTIGRVVFNQLCYGFEESCFLSNINETSKQFNGLVPL  263

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+  +I K     I   D G + IK+ +  ++V +V DDV + + L+ ++G R WF  
Sbjct  264   QKQLLHDIFKQDAANINCVDRGKVLIKERLCRQRVLVVADDVARQDQLNALMGERSWFGP  323

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS++IITTR  ++L   ++   Y+I+EL  +ESL+LF  +A    +P E  +E S   + 
Sbjct  324   GSRVIITTRDSSVLLKADQ--TYQIEELKPDESLQLFSWHALRDTEPAEDYIELSKDVVD  381

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYD-KRLFV  1219
             +CGGLPLAL+ +G+ LSG++ D W+S ++KL RI +H IQ  L+IS + LD  + +  F+
Sbjct  382   YCGGLPLALEVMGACLSGKNRDGWKSVIDKLRRIPNHDIQGKLKISYDSLDGEELQNAFL  441

Query  1218  LIACHFVGKDRDFAINVL-EKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
              IAC F+ + +++   VL  +C  +P V ++ L   SL+ V+   K+ M  L+++MG+E+
Sbjct  442   DIACFFIDRKKEYVAKVLGARCGYNPEVDLETLRGRSLIKVNAIGKITMHDLLRDMGREV  501

Query  1041  LRQDSRDDLHTLSKLLDQ  988
             +R+ S  +    +++ +Q
Sbjct  502   VRETSPKEPGKRTRIWNQ  519


 Score =   141 bits (355),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 103/143 (72%), Gaps = 2/143 (1%)
 Frame = -1

Query  2569  TQESGISSVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAE  2390
             T+     S P   Y  FLSFRG+DTRK FTDHLYTAL+ AGI TFRDDDE+ RGE I   
Sbjct  2     TEPESSRSRPEGTYDVFLSFRGKDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEIHDH  61

Query  2389  LrrgiresrisiIVFSKDYASSRWCLDELLTIL-GRRKSEGHAVFPIFYSVGRADVEKQS  2213
             L R I+ES+ISI+VFSK YASSRWCL+EL+ IL  + +  G  V PIFY++  +DV KQ+
Sbjct  62    LLRAIQESKISIVVFSKGYASSRWCLNELVEILKCKNRKTGQIVQPIFYNIDPSDVRKQN  121

Query  2212  GSFAEAFERHAKR-EKMEVEEGR  2147
             GSFA+AF +H +R E+  V+E R
Sbjct  122   GSFAKAFVKHEERFEEKLVKEWR  144



>ref|XP_007214464.1| hypothetical protein PRUPE_ppa023828mg [Prunus persica]
 gb|EMJ15663.1| hypothetical protein PRUPE_ppa023828mg [Prunus persica]
Length=1070

 Score =   317 bits (813),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 187/365 (51%), Positives = 254/365 (70%), Gaps = 3/365 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL+EVA L GMVLQ + DG+E++FI KI++ I +KL R  +SVP   +G+ S++ K+N
Sbjct  51    RKALKEVADLAGMVLQNQADGYESKFINKIVQVIGEKLRRKPVSVPHIMIGMHSQLNKLN  110

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              WLQD S DVG+ VI G+ G+GKTT+AK  YN NY RFEG  FL N++  S+ PNG V L
Sbjct  111   LWLQDGSDDVGILVIYGMSGIGKTTIAKFVYNSNYGRFEGRSFLENIKEVSQQPNGLVQL  170

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q Q+  NIL GR   I +  EG+ +I+DAI SKKV +V DDVD ++ LD V   +D F  
Sbjct  171   QTQLLSNILNGRNMKISSVSEGLTEIEDAISSKKVLLVLDDVDHMDQLDAVFQMKDQFYP  230

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GSKIIITTR   LL+ H+    +++  L+ +ESL+LF  +AFGQD P+E  +EYS K + 
Sbjct  231   GSKIIITTRHARLLRAHQVTKVHEVGTLNSKESLELFSWHAFGQDHPIEGYIEYSQKIVG  290

Query  1395  HCGGLPLALKDLGSYLS-GRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLF  1222
             HCGGLPLALK LGS +  G S+DVW+S LEKLE I + +I   L +S + L DD D+ LF
Sbjct  291   HCGGLPLALKVLGSSMYLGDSIDVWKSALEKLEAIPNGEIVNKLRVSYDSLQDDDDRNLF  350

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
             + IAC F+GKD+D+ +N+L+ CD H +VGIQNLID  LV++D    + M  +I  MG++I
Sbjct  351   LHIACFFIGKDKDYIVNILDGCDFHTIVGIQNLIDRCLVSIDG-KVVQMHDMILGMGRQI  409

Query  1041  LRQDS  1027
             +R +S
Sbjct  410   VRLES  414



>ref|XP_007224218.1| hypothetical protein PRUPE_ppa017550mg, partial [Prunus persica]
 gb|EMJ25417.1| hypothetical protein PRUPE_ppa017550mg, partial [Prunus persica]
Length=807

 Score =   225 bits (574),  Expect(2) = 9e-89, Method: Compositional matrix adjust.
 Identities = 156/364 (43%), Positives = 222/364 (61%), Gaps = 6/364 (2%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL E A L G  L+   DGHEA FI+ II+EI ++ N T L V  Y VG+  RV  I+
Sbjct  128   RAALHEAANLSGWDLRNTLDGHEANFIRNIIKEITRRFNNTYLHVAPYQVGIDFRVQAIS  187

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
             + L     DV +  I G+GG+GKTTVAK  YN  YDRF+G  FL  VR         VGL
Sbjct  188   ECLGVGFDDVRIIGISGMGGMGKTTVAKAIYNEFYDRFDGKSFLERVREKQ-----LVGL  242

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+  +ILK  +  + +  EGI  I   +GS KV ++ DD+D +E LD +    D F +
Sbjct  243   QKQLLSDILKPTKIKVSSVAEGINVIGKRLGSLKVLLIVDDIDSVEQLDALAIKHDTFGQ  302

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS+IIITTR E+LL   E    Y+++ +++EE+L+L   +AF    P +   + + + + 
Sbjct  303   GSRIIITTRDEHLLNTLEVDQIYRVQPMEEEEALELLSWHAFKNGSPNQGYFKLAREVVD  362

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPL-DDYDKRLFV  1219
             +CGGLPLAL+ LG +L  RS+  W S L KLE+I  H+I   L+IS + L DDY++ +F 
Sbjct  363   YCGGLPLALQVLGCFLGTRSIGEWESTLGKLEKIPCHEIHNQLKISYDGLSDDYERDIFR  422

Query  1218  LIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
              IAC F+G D+++   +L+ C     +GI+ L++  LV VD  NKLMM  L+++MG+EI 
Sbjct  423   DIACFFIGMDKNYVTQILDGCGFFAEIGIKVLLERCLVFVDEKNKLMMHDLLRDMGREIE  482

Query  1038  RQDS  1027
             R +S
Sbjct  483   RAES  486


 Score =   132 bits (331),  Expect(2) = 9e-89, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 92/128 (72%), Gaps = 0/128 (0%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  F+SFRGEDTRKNFT HLY AL  AGI TF DDDE+ RGE+I AEL R I+ SRIS+I
Sbjct  1     YDVFISFRGEDTRKNFTGHLYVALKEAGINTFIDDDELRRGEDIGAELVRAIQGSRISVI  60

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKRE  2171
             +FS  YA S WCL+EL+ I+  +++ G  V PIFY V  +DV KQ+GSFA++F +H   +
Sbjct  61    IFSSRYADSGWCLEELVKIMECKRTLGQIVLPIFYDVDPSDVRKQTGSFAQSFHKHRDTD  120

Query  2170  KMEVEEGR  2147
               +V+  R
Sbjct  121   HNKVQRWR  128



>ref|XP_006370864.1| hypothetical protein POPTR_0019s01170g [Populus trichocarpa]
 gb|ERP48661.1| hypothetical protein POPTR_0019s01170g [Populus trichocarpa]
Length=1058

 Score =   214 bits (544),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/365 (38%), Positives = 219/365 (60%), Gaps = 5/365 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL E   L G  L +  +GHEA+FI++II++++ KL+   L VP   VG+      I 
Sbjct  181   RKALEEAGNLSGWNLNDMANGHEAKFIKEIIKDVLNKLDPKYLDVPELLVGMDRLSRNIF  240

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              +L   + DV +  I G+ G+GKTT+AKV +N    RFEGSCF +N+   S+  NG   L
Sbjct  241   DFLSTATHDVRIVGIHGMPGIGKTTIAKVVFNQLRYRFEGSCFFSNINETSKQFNGLALL  300

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  +ILK     I   D G + IK+ +  K+V +V DDV + + L+ ++G R WF  
Sbjct  301   QEQLLHDILKQDVANINCVDRGKVLIKERLRRKRVLVVADDVTRQDQLNALMGERGWFGP  360

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS++IITTR  + L  H+    Y+I+EL  +ES +LF  +A     P E  +E S   + 
Sbjct  361   GSRVIITTRDSSFL--HKADQTYQIEELKPDESFQLFSWHALRDTKPAEDYIELSKDVVD  418

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYD-KRLFV  1219
             +CGG+PLAL+ +G+ LSG++ D W+S ++KL RI +  IQ  L IS + LD  + +  F+
Sbjct  419   YCGGIPLALEVMGACLSGKNRDGWKSVIDKLRRIPNRDIQGKLRISFDALDGEELQNAFL  478

Query  1218  LIACHFVGKDRDFAINVL-EKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
              IAC F+ + +++   VL  +C  +P V +Q L + SL+ V  +  + M  L+++MG+E+
Sbjct  479   DIACFFIDRKKEYVAKVLGARCGYNPEVDLQTLHERSLIKVLGET-VTMHDLLRDMGREV  537

Query  1041  LRQDS  1027
             +R+ S
Sbjct  538   VREKS  542


 Score =   143 bits (361),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 104/148 (70%), Gaps = 3/148 (2%)
 Frame = -1

Query  2581  AEARTQESGIS-SVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGE  2405
             + A   E G S S P   Y  FLSFRGEDTRK FTDHLY AL  AGIR FRDDDE+ RGE
Sbjct  34    STATMTEPGSSRSSPEGAYDVFLSFRGEDTRKTFTDHLYAALDQAGIRAFRDDDELPRGE  93

Query  2404  NIDAELrrgiresrisiIVFSKDYASSRWCLDELLTIL-GRRKSEGHAVFPIFYSVGRAD  2228
              I   L R I+ES+ISI+VFSK YASSRWCL+EL+ IL  +++  G  V PIFY +  +D
Sbjct  94    EISDHLLRAIQESKISIVVFSKGYASSRWCLNELVEILECKKRKTGQIVLPIFYDIDPSD  153

Query  2227  VEKQSGSFAEAFERHAKR-EKMEVEEGR  2147
             V KQ+GSFAEAF +H +R E+  V+E R
Sbjct  154   VRKQNGSFAEAFVKHEERFEEKLVKEWR  181



>ref|XP_006371058.1| hypothetical protein POPTR_0019s03040g [Populus trichocarpa]
 gb|ERP48855.1| hypothetical protein POPTR_0019s03040g [Populus trichocarpa]
Length=509

 Score =   211 bits (536),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/364 (38%), Positives = 221/364 (61%), Gaps = 4/364 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL+E   L G  L +  +G EA F+++II++++ KL    L VP + VG+      I 
Sbjct  144   RKALKEAGNLSGWNLNDMANGPEANFVKEIIKDVLNKLGPKHLYVPEHLVGMDRLSRNIF  203

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              +L     DV +  I G+ G+GKTT+AKV +N   + FEGSCFL+++   S+  NG   L
Sbjct  204   YFLSTAIDDVQIVGIHGMLGIGKTTIAKVVFNQLCNGFEGSCFLSDINEKSKQFNGLALL  263

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             Q+Q+  NILK     I   D G + IK+ +  K+V +V DDV + + L+ ++G R WF  
Sbjct  264   QEQLLHNILKQDVANINCVDRGKVLIKERLCRKRVLLVADDVARQDQLNALMGERSWFGP  323

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS++IITTR  NLL+  E     +I+EL+ +E+L+LF  +AF    P +  +E S KA+ 
Sbjct  324   GSRVIITTRDSNLLR--EADQTNRIEELEPDEALQLFSWHAFKDTKPAKDYIELSKKAVD  381

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFVL  1216
             +CGGLP AL+ +G+ LSG++   W S+++ L RI +  IQ  L  S + LD   +R F+ 
Sbjct  382   YCGGLPFALEVIGARLSGKNRVTWESEIDNLSRIPNQDIQGKLLTSYHALDGELQRAFLD  441

Query  1215  IACHFVGKDRDFAINVL-EKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEIL  1039
             IAC F+GK++++   +L  +C  +P V ++ L + S++ V  +  + M  L+++MG+E++
Sbjct  442   IACFFIGKEKEYVAKLLGARCGYNPEVVLETLHERSMIKVLGET-VTMHDLLRDMGREVV  500

Query  1038  RQDS  1027
             R+ S
Sbjct  501   RESS  504


 Score =   146 bits (369),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 101/144 (70%), Gaps = 2/144 (1%)
 Frame = -1

Query  2548  SVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgire  2369
             S+P + Y  FLSFRGEDTRK FTDHLY AL+ A I TFRDDDE+ RGE I   + R I+E
Sbjct  9     SIPEWTYDVFLSFRGEDTRKTFTDHLYAALVQAKIHTFRDDDELPRGEEISDHVLRAIQE  68

Query  2368  srisiIVFSKDYASSRWCLDELLTIL-GRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAF  2192
             S+ISI+VFSK YASSRWCLDEL+ IL  +RK  G  V PIFY +   DV KQ+G FAEAF
Sbjct  69    SKISIVVFSKGYASSRWCLDELVEILKCKRKKTGQIVLPIFYDIDPLDVRKQTGRFAEAF  128

Query  2191  ERHAKR-EKMEVEEGRVEWKGKGG  2123
              +H +R E+  V+E R   K  G 
Sbjct  129   VKHEERFEEKLVKEWRKALKEAGN  152



>gb|ABC55465.1| TIR-NBS disease resistance-like protein [(Populus tomentosa x 
Populus bolleana) x Populus tomentosa var. truncata]
 gb|ABC55466.1| TIR-NBS disease resistance-like protein [(Populus tomentosa x 
Populus bolleana) x Populus tomentosa var. truncata]
Length=642

 Score =   217 bits (553),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 143/378 (38%), Positives = 226/378 (60%), Gaps = 4/378 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R+AL +   L G  L +  +GHEA+ I+ II+++V KL    L VP + VG+      I 
Sbjct  144   RKALEDAGNLSGWNLNDMANGHEAKSIKAIIKDVVNKLEPKYLYVPEHLVGMDPLAHDIY  203

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGL  1756
              +L   + DV +  I G+ G+GKTT+AKV +N   + FEGSCFL+++   S+  NG  GL
Sbjct  204   DFLSTATDDVRIVGIHGMSGIGKTTLAKVVFNQLCNGFEGSCFLSDINETSKQFNGLAGL  263

Query  1755  QKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSR  1576
             QKQ+  +ILK         D G + IK+ I  K+V +V DDV   E L+ ++G R WF  
Sbjct  264   QKQLLRDILKQDVANFDCVDRGKVLIKERIRRKRVLVVADDVAHPEQLNALMGERSWFGP  323

Query  1575  GSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIR  1396
             GS++IITTR  ++L   ++   Y+I+EL   ESL+LF  +A     P E  +E S  A+ 
Sbjct  324   GSRVIITTRDSSVLLKADQ--TYQIEELKPYESLQLFRWHALRDTKPTEDYIELSKDAVD  381

Query  1395  HCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYD-KRLFV  1219
             +CGG+PLAL+ +G+ LSG++ D W+S ++KL RI +  IQ  L IS + LD  + +  F+
Sbjct  382   YCGGIPLALEVMGACLSGKNRDGWKSVIDKLRRIPNRDIQGKLRISFDALDGEELQNAFL  441

Query  1218  LIACHFVGKDRDFAINVL-EKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
              IAC F+ + +++   VL  +C  +P V ++ L + SL+ V+   K+ M  L+++MG+EI
Sbjct  442   DIACFFIDRKKEYVAKVLGARCGYNPEVDLETLRERSLIKVNGFGKITMHDLLRDMGREI  501

Query  1041  LRQDSRDDLHTLSKLLDQ  988
             +R+ S  +    +++ +Q
Sbjct  502   VRESSPKEPGKRTRIWNQ  519


 Score =   139 bits (350),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 92/123 (75%), Gaps = 1/123 (1%)
 Frame = -1

Query  2548  SVPRFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgire  2369
             S+P   Y  FLSFRGEDTRK FT HLY AL +AGIRTF DD+E+ RGE I   L + IRE
Sbjct  9     SIPEGDYDVFLSFRGEDTRKTFTGHLYAALDDAGIRTFLDDNELPRGEEISEHLLKAIRE  68

Query  2368  srisiIVFSKDYASSRWCLDELLTIL-GRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAF  2192
             S+ISI+VFSK YASSRWCL+EL+ IL  +RK  G  V PIFY +  +DV KQ+G FAEAF
Sbjct  69    SKISIVVFSKGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQTGCFAEAF  128

Query  2191  ERH  2183
             ++H
Sbjct  129   DKH  131



>ref|XP_008443388.1| PREDICTED: TMV resistance protein N [Cucumis melo]
Length=1139

 Score =   234 bits (597),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/364 (39%), Positives = 226/364 (62%), Gaps = 2/364 (1%)
 Frame = -2

Query  2115  REALREVAGLQGMVLQEECDGHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKIN  1936
             R AL E A L G  L+   DGHEA+FI+ I+ ++ K++N   L +  Y VG+ SR+  + 
Sbjct  144   RMALTEAANLSGWDLRNIADGHEAKFIRLIVEKVSKEVNSKYLFIALYPVGIESRIKPLL  203

Query  1935  KWLQDESSDvgvgvicglggvGKTTVAKVAYNLNYDRFEGSCFLANVRA-ASEIPNGQVG  1759
               L   S+DV    I G+GG+GKTT+AK  YN  Y  FE  CFL+N++A  S  PN  + 
Sbjct  204   SHLHIGSNDVRFVGILGMGGLGKTTIAKALYNQLYHNFEAKCFLSNIKAETSNQPNALIH  263

Query  1758  LQKQIFENILKGREEIIFNTDEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFS  1579
             LQKQ+  +I    +  + N D+GI  +++ +  K++ ++ DDVD++  L  +   RD F 
Sbjct  264   LQKQLLSSITNSTDINLGNIDQGITVLQERLRCKRLLLILDDVDEISQLTALATRRDLFG  323

Query  1578  RGSKIIITTRCENLLKGHERHLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAI  1399
              GS+IIITTR ++LL   E      I E+DD+E+L+LF  +AF    P E   + S + +
Sbjct  324   SGSRIIITTRDQHLLNQLEVDEICSIDEMDDDEALELFSWHAFRNSYPSETFHQLSKQVV  383

Query  1398  RHCGGLPLALKDLGSYLSGRSMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYD-KRLF  1222
              +CGGLPLAL+ LGS+L GRS + W   L+KL++I + +IQ+ L IS + L+D+  K +F
Sbjct  384   TYCGGLPLALEVLGSFLFGRSREEWEDTLKKLKKIPNDQIQKKLRISFDGLNDHTYKDIF  443

Query  1221  VLIACHFVGKDRDFAINVLEKCDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEI  1042
             + ++C F+G +R++   +L+ C   P +GI  L+   L+T+ + N+LMM  L+++MG+EI
Sbjct  444   LDVSCFFIGMERNYVEQILDGCGFFPRIGISVLLQRCLLTIGDKNRLMMHDLLRDMGREI  503

Query  1041  LRQD  1030
             + ++
Sbjct  504   VHEN  507


 Score =   122 bits (306),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 83/119 (70%), Gaps = 0/119 (0%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGEDTRKNFTDHLY A  +AGI  FRDD  + RGE+I +EL R I  S+++++
Sbjct  14    YDVFLSFRGEDTRKNFTDHLYYAFKDAGINVFRDDPGLERGEDISSELVRAIEGSKVAVV  73

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKR  2174
             VFS+ YA S WCL+EL+ I+  R++    VFP+FY+V  + V  Q G F EAF +H  R
Sbjct  74    VFSERYAESGWCLEELVKIMECRRTLRQLVFPVFYNVDPSSVRNQKGEFEEAFVKHEVR  132



>ref|XP_006389335.1| hypothetical protein POPTR_0030s00570g, partial [Populus trichocarpa]
 gb|ERP48249.1| hypothetical protein POPTR_0030s00570g, partial [Populus trichocarpa]
Length=1016

 Score =   201 bits (512),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 150/393 (38%), Positives = 230/393 (59%), Gaps = 11/393 (3%)
 Frame = -2

Query  2055  GHEAEFIQKIIREIVKKLNRTVLSVPSYTVGLASRVGKINKWLQDESSDvgvgvicglgg  1876
             GHE++ IQ I+ E++ KLN   + V +Y VG+ S+V  I   L   +++V +  I G+ G
Sbjct  160   GHESKLIQMIVEEVLSKLNPRYMKVATYPVGIDSQVKDIISMLCVGTNEVRIVGIYGMPG  219

Query  1875  vGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGLQKQIFENILKGREEIIFNTD  1696
             +GKTT+AK  +N    +FEGS  L N+R   +   G + LQ+Q+  +  KG   I  + D
Sbjct  220   IGKTTIAKAVFNQICHQFEGSSCLLNIRERLDQHRGLLQLQQQLLRDAFKGYIRIHDDDD  279

Query  1695  EGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSRGSKIIITTRCENLLKGHERH  1516
             E    IK     K+V ++ DDVDQL+ L  + G RDWF  GS+I+ITTR E LL   E  
Sbjct  280   ED--GIKSQFCRKRVLVILDDVDQLKHLRGLAGERDWFGPGSRIVITTRDERLLTRLEVE  337

Query  1515  LQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIRHCGGLPLALKDLGSYLSGRS  1336
              QY  + L+++ESL+LF  +AF +  P++  +E S   + + GG+PLAL+ LGS L  RS
Sbjct  338   KQYHAEGLNNDESLQLFSWHAFKKPHPMKEYVELSKVVVDYVGGVPLALEVLGSKLFKRS  397

Query  1335  MDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFVLIACHFVGKDRDFAINVLEKC  1156
             +  WRS +EKL++ L H+IQR L  SL+ LD   K +F+ IAC F G D+D+   +L+  
Sbjct  398   ITHWRSFIEKLQKHLPHQIQRQLITSLDDLDGEVKGMFLDIACFFNGMDKDYVGKILDGR  457

Query  1155  DLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEILRQDSRDDLHTLSKL-------  997
               +P +G   L + SL+TV+++N+L M  L+++MG+EI+ Q + +     S+L       
Sbjct  458   GFYPEMGFDILRERSLLTVNSENELQMNNLLRDMGREIIHQMAPNHPGKRSRLWHREDIM  517

Query  996   --LDQLVSSTESTGNGVVNESASHVNSPKRPYS  904
               LD+  S TE+    V++  AS    P   ++
Sbjct  518   DVLDKYCSGTEAVEGIVLDAQASKDVVPSTSFA  550


 Score =   154 bits (389),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 106/142 (75%), Gaps = 1/142 (1%)
 Frame = -1

Query  2530  YHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresrisiI  2351
             Y  FLSFRGEDTRKNFTDHLYTAL NAGI TFRDD+E+ +GE I + L + I+ES+ISI+
Sbjct  19    YDVFLSFRGEDTRKNFTDHLYTALQNAGIHTFRDDNELPKGEEISSHLLKAIKESKISIV  78

Query  2350  VFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHAKRE  2171
             VFSK YASS WCLDEL  IL  R++ G  V P+FY +  +D+ KQ+GSFAEAF+RH +R 
Sbjct  79    VFSKGYASSTWCLDELSEILDCRQTAGQIVLPVFYDIDPSDIRKQTGSFAEAFDRHEERF  138

Query  2170  KMEVEEGRVEWKGKGGEVERSS  2105
             K E+E+ + +W+    E  R S
Sbjct  139   KEEMEKVQ-KWRKALVEAGRLS  159



>ref|XP_007210009.1| hypothetical protein PRUPE_ppa016162mg [Prunus persica]
 gb|EMJ11208.1| hypothetical protein PRUPE_ppa016162mg [Prunus persica]
Length=1108

 Score =   231 bits (590),  Expect(2) = 4e-88, Method: Compositional matrix adjust.
 Identities = 148/354 (42%), Positives = 219/354 (62%), Gaps = 2/354 (1%)
 Frame = -2

Query  2052  HEAEFIQKIIREI-VKKLNRTVLSVPSYTVGLASRVGKINKWLQDESSDvgvgvicglgg  1876
             HE+ FI  I+ EI ++  NRT L V  Y VGL SR+  +++ L    +DV +  I G+GG
Sbjct  180   HESNFIHNIVEEISLRTSNRTYLKVAKYPVGLESRIRDMDELLCVGKTDVRMVGIWGIGG  239

Query  1875  vGKTTVAKVAYNLNYDRFEGSCFLANVRAASEIPNGQVGLQKQIFENILKGREE-IIFNT  1699
             +GKTT+AK  Y     +FEG CFLANVR  S +PNG V LQ  +   IL G  + ++ + 
Sbjct  240   IGKTTIAKAVYGSIAHKFEGQCFLANVREMSSMPNGLVQLQNNLLSEILGGSTKFMVTSC  299

Query  1698  DEGIIKIKDAIGSKKVFIvfddvdqlelldvVIGARDWFSRGSKIIITTRCENLLKGHER  1519
              +G   I+  + +K+V +V DDVD  + LD + G  DWF  GS+II+TTR ++LL  H  
Sbjct  300   HQGANVIEKRLHNKRVLLVLDDVDHRDQLDNLAGGPDWFGPGSRIIVTTRDKHLLTAHGV  359

Query  1518  HLQYKIKELDDEESLKLFCRYAFGQDDPLEHLMEYSVKAIRHCGGLPLALKDLGSYLSGR  1339
                YK KELD  ES +LF   +F +D P    +    +A+ +  GLPLAL  LGS+L GR
Sbjct  360   ASTYKAKELDFHESSELFSWNSFKRDKPPNDYVNLVGRAVCYTKGLPLALTVLGSHLCGR  419

Query  1338  SMDVWRSKLEKLERILHHKIQRNLEISLNPLDDYDKRLFVLIACHFVGKDRDFAINVLEK  1159
             S++ W+  L+  E I + +IQ  L+IS N L+ + K +F+ IAC F G+++D  +++L  
Sbjct  420   SIEEWKDALDSYEIIPNKEIQEILKISFNGLEHFQKEVFLDIACFFKGENKDDIVDILRS  479

Query  1158  CDLHPVVGIQNLIDISLVTVDNDNKLMMPQLIQNMGKEILRQDSRDDLHTLSKL  997
             CDL PV+ I+ LID SL+ ++  N L M  L+++MGKEI+R++S ++    S+L
Sbjct  480   CDLFPVISIRVLIDKSLLAINEHNMLTMHDLLEDMGKEIVREESPNEPGERSRL  533


 Score =   124 bits (310),  Expect(2) = 4e-88, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 97/155 (63%), Gaps = 12/155 (8%)
 Frame = -1

Query  2539  RFFYHAFLSFRGEDTRKNFTDHLYTALINAGIRTFRDDDEIGRGENIDAELrrgiresri  2360
             R+ Y  FLSFRGEDTR NFT HLYTAL   G+ TF DD E+ RGE +   L + I+ES  
Sbjct  30    RWSYDVFLSFRGEDTRNNFTGHLYTALCRRGLNTFIDD-ELRRGEEVAPTLFKTIQESMT  88

Query  2359  siIVFSKDYASSRWCLDELLTILGRRKSEGHAVFPIFYSVGRADVEKQSGSFAEAFERHA  2180
             SI+VFS++YASS+WCLDEL+ IL  ++S+   V+PIF+ V  +DV  Q GSF EA   H 
Sbjct  89    SIVVFSENYASSKWCLDELVCILDCKESKNQIVWPIFHKVAPSDVRNQRGSFGEALRGHE  148

Query  2179  KREKMEVEEGRVE-WKGKGGEVERSSQRSCRIARN  2078
                +M+    RVE WK      +  S + C I  N
Sbjct  149   ANFRMD----RVERWK------QLYSSKCCYIFVN  173



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8760143115306