BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80297_g1_i1 len=888 path=[866:0-887]

Length=888
                                                                      Score     E

ref|XP_010326913.1|  PREDICTED: uncharacterized protein LOC101246284    160   5e-44   
ref|XP_009609938.1|  PREDICTED: uncharacterized protein LOC104103717    154   4e-42   
ref|XP_009757777.1|  PREDICTED: uncharacterized protein LOC104210548    149   3e-40   
ref|XP_006364671.1|  PREDICTED: uncharacterized protein LOC102598137    145   6e-39   
ref|XP_007034000.1|  Uncharacterized protein TCM_020072                 131   3e-33   
ref|XP_004979179.1|  PREDICTED: uncharacterized protein LOC101757522    128   6e-32   
ref|XP_010105200.1|  hypothetical protein L484_011034                   128   7e-32   
ref|XP_002321117.1|  hypothetical protein POPTR_0014s14900g             126   3e-31   Populus trichocarpa [western balsam poplar]
ref|XP_006663918.1|  PREDICTED: uncharacterized protein LOC102709974    126   3e-31   
ref|XP_002301635.1|  hypothetical protein POPTR_0002s23210g             125   4e-31   Populus trichocarpa [western balsam poplar]
ref|XP_004960738.1|  PREDICTED: uncharacterized protein LOC101757141    126   7e-31   
ref|XP_010999984.1|  PREDICTED: uncharacterized protein LOC105107671    125   7e-31   
ref|XP_002271254.1|  PREDICTED: uncharacterized protein LOC100251518    125   2e-30   Vitis vinifera
gb|KDP42872.1|  hypothetical protein JCGZ_23814                         124   3e-30   
ref|XP_008222658.1|  PREDICTED: uncharacterized protein LOC103322510    123   3e-30   
ref|XP_007224575.1|  hypothetical protein PRUPE_ppa1027228mg            122   5e-30   
gb|KHF99431.1|  ATP-dependent helicase/nuclease subunit A               123   5e-30   
ref|XP_002531024.1|  conserved hypothetical protein                     122   2e-29   Ricinus communis
ref|XP_011042790.1|  PREDICTED: uncharacterized protein LOC105138424    119   8e-29   
dbj|BAK05465.1|  predicted protein                                      120   8e-29   
gb|EMT15001.1|  hypothetical protein F775_32131                         119   1e-28   
ref|XP_010912818.1|  PREDICTED: uncharacterized protein LOC105038647    119   2e-28   
ref|XP_002442048.1|  hypothetical protein SORBIDRAFT_08g008250          119   4e-28   Sorghum bicolor [broomcorn]
ref|XP_010930161.1|  PREDICTED: uncharacterized protein LOC105051416    118   4e-28   
gb|EAY82666.1|  hypothetical protein OsI_37886                          118   5e-28   Oryza sativa Indica Group [Indian rice]
ref|NP_001152094.1|  WW domain containing protein                       116   8e-28   Zea mays [maize]
ref|XP_008674157.1|  PREDICTED: uncharacterized protein LOC103650339    117   9e-28   
ref|XP_003578750.1|  PREDICTED: uncharacterized protein LOC100823520    117   1e-27   
ref|XP_006443130.1|  hypothetical protein CICLE_v10023373mg             116   1e-27   
gb|EMS47120.1|  hypothetical protein TRIUR3_32584                       117   2e-27   
gb|ABA96334.2|  WW domain containing protein, expressed                 116   3e-27   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001137040.1|  hypothetical protein                               115   5e-27   Zea mays [maize]
ref|XP_006662894.1|  PREDICTED: uncharacterized protein LOC102700469    115   6e-27   
gb|EAY80670.1|  hypothetical protein OsI_35847                          112   5e-26   Oryza sativa Indica Group [Indian rice]
gb|KGN45930.1|  hypothetical protein Csa_6G023890                       112   5e-26   
ref|NP_001067715.1|  Os11g0294400                                       112   9e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009405093.1|  PREDICTED: uncharacterized protein LOC103988268    110   2e-25   
ref|XP_009391144.1|  PREDICTED: uncharacterized protein LOC103977377    109   4e-25   
ref|XP_009389881.1|  PREDICTED: uncharacterized protein LOC103976416    107   4e-24   
ref|XP_009415642.1|  PREDICTED: uncharacterized protein LOC103996444    102   4e-22   
ref|XP_008804209.1|  PREDICTED: uncharacterized protein LOC103717553  91.7    3e-19   
ref|NP_001176855.1|  Os12g0233100                                     90.9    7e-19   
ref|XP_006853132.1|  hypothetical protein AMTR_s00038p00161690        91.7    8e-19   
gb|AFW56705.1|  hypothetical protein ZEAMMB73_574320                  90.5    1e-18   
gb|EAZ20052.1|  hypothetical protein OsJ_35653                        89.7    7e-18   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001170239.1|  uncharacterized protein LOC100384192             88.6    7e-18   Zea mays [maize]
ref|XP_008795551.1|  PREDICTED: uncharacterized protein LOC103711252  85.5    2e-16   
ref|XP_007224574.1|  hypothetical protein PRUPE_ppa1027228mg          79.7    2e-15   
ref|XP_004301920.1|  PREDICTED: uncharacterized protein LOC101299013  78.2    8e-14   
ref|XP_009409267.1|  PREDICTED: uncharacterized protein LOC103991503  76.6    3e-13   
ref|XP_009389553.1|  PREDICTED: uncharacterized protein LOC103976...  74.3    1e-12   
ref|XP_009409162.1|  PREDICTED: uncharacterized protein LOC103991427  73.2    3e-12   
ref|XP_002301050.2|  hypothetical protein POPTR_0002s09660g           72.4    8e-12   Populus trichocarpa [western balsam poplar]
gb|EMT10599.1|  hypothetical protein F775_26180                       72.4    1e-11   
gb|KHG09905.1|  BAG family molecular chaperone regulator 3            71.2    2e-11   
ref|XP_002465717.1|  hypothetical protein SORBIDRAFT_01g044450        71.6    2e-11   Sorghum bicolor [broomcorn]
ref|XP_006364848.1|  PREDICTED: uncharacterized protein LOC102605844  70.9    3e-11   
ref|XP_008466035.1|  PREDICTED: uncharacterized protein LOC103503587  71.6    5e-11   
ref|XP_009614518.1|  PREDICTED: uncharacterized protein LOC104107423  70.1    5e-11   
ref|XP_009389552.1|  PREDICTED: uncharacterized protein LOC103976...  69.7    6e-11   
ref|XP_004237904.1|  PREDICTED: uncharacterized protein LOC101252482  69.7    6e-11   
ref|XP_004152643.1|  PREDICTED: uncharacterized protein LOC101203360  69.7    8e-11   
ref|XP_002513915.1|  conserved hypothetical protein                   68.9    1e-10   Ricinus communis
ref|XP_002307383.1|  hypothetical protein POPTR_0005s17030g           68.6    2e-10   Populus trichocarpa [western balsam poplar]
ref|XP_010269265.1|  PREDICTED: uncharacterized protein LOC104605984  68.6    2e-10   
ref|XP_008374058.1|  PREDICTED: uncharacterized protein LOC103437334  68.9    2e-10   
ref|NP_001144712.1|  uncharacterized protein LOC100277752             68.9    2e-10   Zea mays [maize]
ref|XP_009344523.1|  PREDICTED: uncharacterized protein LOC103936414  68.6    2e-10   
ref|XP_004985390.1|  PREDICTED: actin cytoskeleton-regulatory com...  68.2    3e-10   
ref|XP_011004807.1|  PREDICTED: uncharacterized protein LOC105111206  67.8    3e-10   
ref|XP_009373153.1|  PREDICTED: uncharacterized protein LOC103962200  67.4    6e-10   
ref|XP_010267953.1|  PREDICTED: uncharacterized protein LOC104605047  67.0    7e-10   
ref|XP_006472611.1|  PREDICTED: uncharacterized protein LOC102608787  67.0    7e-10   
ref|XP_006433995.1|  hypothetical protein CICLE_v10002416mg           67.0    7e-10   
ref|XP_010676609.1|  PREDICTED: uncharacterized protein LOC104892385  66.6    1e-09   
ref|XP_008444823.1|  PREDICTED: uncharacterized protein LOC103488058  66.2    1e-09   
ref|XP_009386378.1|  PREDICTED: uncharacterized protein LOC103973519  65.9    2e-09   
ref|XP_011016390.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  65.5    3e-09   
ref|XP_006649537.1|  PREDICTED: uncharacterized protein LOC102720124  64.3    9e-09   
ref|NP_001131648.1|  hypothetical protein                             63.9    1e-08   Zea mays [maize]
gb|EEE51990.1|  hypothetical protein OsJ_33675                        60.8    9e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008219421.1|  PREDICTED: uncharacterized protein LOC103319639  61.2    1e-07   
ref|NP_001049232.1|  Os03g0191200                                     61.2    1e-07   Oryza sativa Japonica Group [Japonica rice]
gb|EEE58473.1|  hypothetical protein OsJ_09727                        60.5    2e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003615100.1|  WW domain containing protein expressed           60.1    2e-07   
ref|XP_011074180.1|  PREDICTED: uncharacterized protein LOC105158955  58.5    5e-07   
gb|EMS46309.1|  hypothetical protein TRIUR3_23859                     57.4    7e-07   
ref|XP_010926289.1|  PREDICTED: uncharacterized protein LOC105048625  55.5    8e-06   
ref|XP_008782143.1|  PREDICTED: uncharacterized protein LOC103701757  53.5    3e-05   
ref|XP_006387371.1|  hypothetical protein POPTR_1140s00200g           50.4    1e-04   
ref|XP_002530166.1|  conserved hypothetical protein                   50.1    5e-04   Ricinus communis
ref|XP_009381722.1|  PREDICTED: uncharacterized protein LOC103969803  49.7    5e-04   
ref|XP_001780311.1|  predicted protein                                51.2    7e-04   



>ref|XP_010326913.1| PREDICTED: uncharacterized protein LOC101246284 [Solanum lycopersicum]
Length=197

 Score =   160 bits (404),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 113/185 (61%), Gaps = 20/185 (11%)
 Frame = -1

Query  795  YISMEFPELSLSLAASNFNGDNAADSDQDIRLPMKRKIQSGGGGSVDLHQPWMEPLPVDW  616
            YI MEFPELSL  A S+     A      I LPMKRK Q     SVDL     +PLP+DW
Sbjct  29   YIVMEFPELSL--APSHL----ANYESHQINLPMKRK-QEMIQASVDLQ--LKDPLPLDW  79

Query  615  EQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTSGAHSYEDRhhkkhqhps  436
            EQCLDLQSGRMYY+NRKT++KTW+WPK+QK   L+LELN+S+                  
Sbjct  80   EQCLDLQSGRMYYLNRKTLRKTWDWPKDQK---LDLELNMSSRSI----PMDDDHDYDYY  132

Query  435  sppSNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCKFVQYSAAGNRSPAKP----FHSG  268
            S   N +G  NMIALPCSNCHLLVIVSQ+SP CPNCK+V      N++ A       +  
Sbjct  133  SKKHNSSGSNNMIALPCSNCHLLVIVSQSSPCCPNCKYVHSLVLSNKNNATTSTPKCYDT  192

Query  267  LSLFN  253
            LSL N
Sbjct  193  LSLLN  197



>ref|XP_009609938.1| PREDICTED: uncharacterized protein LOC104103717 [Nicotiana tomentosiformis]
Length=168

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 112/178 (63%), Gaps = 10/178 (6%)
 Frame = -1

Query  786  MEFPELSLSLAASNFNGDNAADSDQDIRLPMKRKIQSGGGGSVDLHQPWMEPLPVDWEQC  607
            MEFPELSL+ +     G +     + + LPMKRK Q     SVDL     +PLP+DWEQC
Sbjct  1    MEFPELSLAPSV----GKSYNYESEVVNLPMKRK-QDMIQASVDLQ--LKDPLPLDWEQC  53

Query  606  LDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTSGAHSYEDRhhkkhqhpsspp  427
            LDL+SGRMYY+NRKT++KTW+WPK+QK   L+LELN+S+       +  H  +       
Sbjct  54   LDLESGRMYYLNRKTLRKTWDWPKDQK---LDLELNMSSFSQQETMEYDHMYYNSKKQNK  110

Query  426  SNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCKFVQYSAAGNRSPAKPFHSGLSLFN  253
            S+ +   +MIALPCSNCHLLVIVSQ+SPSCPNCKFV    +         +  LSL N
Sbjct  111  SSSSSSSSMIALPCSNCHLLVIVSQSSPSCPNCKFVHSLLSKKDPSTAKCYDTLSLLN  168



>ref|XP_009757777.1| PREDICTED: uncharacterized protein LOC104210548 [Nicotiana sylvestris]
Length=167

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 112/178 (63%), Gaps = 11/178 (6%)
 Frame = -1

Query  786  MEFPELSLSLAASNFNGDNAADSDQDIRLPMKRKIQSGGGGSVDLHQPWMEPLPVDWEQC  607
            MEFPELSL+ +     G +     + + LPMKRK Q     SVDL     +PLP+DWEQC
Sbjct  1    MEFPELSLAPSV----GKSYNYESEVVNLPMKRK-QDMIQASVDLQ--LKDPLPLDWEQC  53

Query  606  LDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTSGAHSYEDRhhkkhqhpsspp  427
            LDL+SGRMYY+NRKT++KTW+WPK+QK   L+LELN+S S +      +  K+ +     
Sbjct  54   LDLESGRMYYLNRKTLRKTWDWPKDQK---LDLELNMS-SFSQQETMEYDHKYYNSKKQN  109

Query  426  SNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCKFVQYSAAGNRSPAKPFHSGLSLFN  253
             +     +MIALPCSNCHLLVIVSQ+SPSCPNCKFV    +         +  LSL N
Sbjct  110  KSNNSSSSMIALPCSNCHLLVIVSQSSPSCPNCKFVHSPLSKKDPSTAKCYDTLSLLN  167



>ref|XP_006364671.1| PREDICTED: uncharacterized protein LOC102598137 [Solanum tuberosum]
Length=140

 Score =   145 bits (365),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 98/148 (66%), Gaps = 8/148 (5%)
 Frame = -1

Query  696  MKRKIQSGGGGSVDLHQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQ  517
            MKRK +     SVDL     +PLP+DWEQCLDL+SGRMYY+NRKT++KTW+WPK+QK   
Sbjct  1    MKRK-EEMIQASVDLQLK--DPLPLDWEQCLDLESGRMYYLNRKTLRKTWDWPKDQK---  54

Query  516  LNLELNISTSGAHSYEDRhhkkhqhpssppSNGAGGENMIALPCSNCHLLVIVSQTSPSC  337
            L+LELNIS+      +D     +    +  ++ +G  NMIALPCSNCHLLVIVSQ+SP C
Sbjct  55   LDLELNISSRSIQMDDDH--DYYSRKQNKSNSTSGSNNMIALPCSNCHLLVIVSQSSPCC  112

Query  336  PNCKFVQYSAAGNRSPAKPFHSGLSLFN  253
            PNCK+V    +   +     +  LSL N
Sbjct  113  PNCKYVHSLLSNKNNATTKCYDTLSLLN  140



>ref|XP_007034000.1| Uncharacterized protein TCM_020072 [Theobroma cacao]
 gb|EOY04926.1| Uncharacterized protein TCM_020072 [Theobroma cacao]
Length=188

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 108/182 (59%), Gaps = 22/182 (12%)
 Frame = -1

Query  786  MEFPELS-LSLAASNFNGD---NAADSDQ-DIRLPMKRK------IQSGGG---GSVDLH  649
            M+  EL+ LSLA + F  D   +++ SDQ D  +P K++      + S G     SVDL 
Sbjct  1    MDIMELTELSLAPNQFLADKSCHSSSSDQADFNIPSKKRKLFPDHLLSAGSQFQTSVDLQ  60

Query  648  QPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTSGAHSYE  469
                +PLP+DWEQCLDL+SG+MYY+NRKT+++TW WPK+QK   L+LELNIS     S +
Sbjct  61   --VKDPLPLDWEQCLDLESGKMYYLNRKTLQRTWNWPKDQK---LDLELNISQKSNCSEQ  115

Query  468  DRhhkkhqhpssppSNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCKFVQYSAAGNRSP  289
                             + G NM+AL C NCHLLVI+S++SP+CPNCK+V         P
Sbjct  116  ---CSASVSLEDSNKQHSTGTNMVALACLNCHLLVILSKSSPACPNCKYVHSLPTLKAQP  172

Query  288  AK  283
             K
Sbjct  173  PK  174



>ref|XP_004979179.1| PREDICTED: uncharacterized protein LOC101757522 [Setaria italica]
Length=196

 Score =   128 bits (321),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 87/122 (71%), Gaps = 5/122 (4%)
 Frame = -1

Query  636  EPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPK---EQKQAQLNLELNISTSGAHSYED  466
            +PLP DWEQCLDL SGRMYY+NRKTMKK+W  P+   +++Q  LNLELNIST+ +  ++ 
Sbjct  61   DPLPPDWEQCLDLHSGRMYYLNRKTMKKSWVRPRSSNKEEQGALNLELNISTTPS-IFDG  119

Query  465  RhhkkhqhpssppSNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCKFVQYSA-AGNRSP  289
            +        +    +  GG +M+A+PC+NCHLLV++ ++SPSCPNCKFVQ S  A  R+P
Sbjct  120  KASSIGAAVADETRSPNGGGHMVAVPCANCHLLVMLCKSSPSCPNCKFVQPSVPAMPRTP  179

Query  288  AK  283
             +
Sbjct  180  PR  181



>ref|XP_010105200.1| hypothetical protein L484_011034 [Morus notabilis]
 gb|EXC04054.1| hypothetical protein L484_011034 [Morus notabilis]
Length=193

 Score =   128 bits (321),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 101/171 (59%), Gaps = 22/171 (13%)
 Frame = -1

Query  786  MEFPELSLSLA-ASNFNGDNAADSDQ--DIRLPMKRKI----------QSGGGGSVDLHQ  646
            MEFPELSL+   A N N        +  D     KRK+          +     SVDL  
Sbjct  1    MEFPELSLAPTHAVNVNKSRNGLPLEYSDTNASRKRKLFQDHLLMKTHEPALQASVDLQ-  59

Query  645  PWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQ-AQLNLELNIST-SGAHSY  472
               +PLP+DWEQCLDL+SG MYY+NRKT++K+W WP   +Q A L+LELNIST S  H  
Sbjct  60   -LKDPLPLDWEQCLDLESGEMYYLNRKTLRKSWNWPLPMEQTAALDLELNISTFSDNHRG  118

Query  471  EDRhhkkhqhpssppSNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCKFV  319
             D+  K+    +     G    NM+AL C NCHLLVI+S++SPSCPNCK+V
Sbjct  119  SDQVKKQSCSAA-----GNTNSNMVALACLNCHLLVILSKSSPSCPNCKYV  164



>ref|XP_002321117.1| hypothetical protein POPTR_0014s14900g [Populus trichocarpa]
 gb|EEE99432.1| hypothetical protein POPTR_0014s14900g [Populus trichocarpa]
Length=190

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 92/144 (64%), Gaps = 12/144 (8%)
 Frame = -1

Query  666  GSVDLHQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTS  487
             SVDLH    +PLP+DWEQCLDL+SGRMYY+NRKT++K+W WPK+QK   L+LELN+S++
Sbjct  53   ASVDLHV--KDPLPLDWEQCLDLESGRMYYLNRKTLRKSWNWPKKQK---LDLELNMSST  107

Query  486  GAHSYEDRhhkkhqhpssppSNGAGG-ENMIALPCSNCHLLVIVSQTSPSCPNCKFVQ--  316
              +  ++          S   N A    NM+AL C NCHLLVI S++SPSCPNCK+V   
Sbjct  108  IPNCPDECSSSNSSLEDSNNKNHASSNSNMVALACLNCHLLVIFSKSSPSCPNCKYVHSF  167

Query  315  ---YSAAGNRSPAKPFHSGLSLFN  253
                S     SP +   S LSL N
Sbjct  168  PTLQSPQRKVSPTRSL-STLSLLN  190



>ref|XP_006663918.1| PREDICTED: uncharacterized protein LOC102709974 [Oryza brachyantha]
Length=212

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 83/121 (69%), Gaps = 15/121 (12%)
 Frame = -1

Query  636  EPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTSGAHSYED---  466
            +PLP+DWEQCLDLQSGRMYY+NRKTMKK+W  PKEQ    +NLELNIST+ A +      
Sbjct  73   DPLPLDWEQCLDLQSGRMYYLNRKTMKKSWMRPKEQ---SVNLELNISTTQASAVPTIDG  129

Query  465  --------RhhkkhqhpssppSNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCKFVQYS  310
                        +     +  S+G GG NM+A+PC+NCHLLV++ ++SPSCPNCKFVQ  
Sbjct  130  STGAATPVAAVAEETKKGTVVSSGPGG-NMVAVPCANCHLLVMLCKSSPSCPNCKFVQAL  188

Query  309  A  307
            A
Sbjct  189  A  189



>ref|XP_002301635.1| hypothetical protein POPTR_0002s23210g [Populus trichocarpa]
 gb|EEE80908.1| hypothetical protein POPTR_0002s23210g [Populus trichocarpa]
Length=188

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 84/117 (72%), Gaps = 6/117 (5%)
 Frame = -1

Query  666  GSVDLHQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTS  487
             SVDLH    +PLP+DWEQCLDL+SGRMYY+NRKT++K+W WP+ QK   L+LELN+S++
Sbjct  51   ASVDLHV--KDPLPLDWEQCLDLESGRMYYLNRKTLRKSWNWPRNQK---LDLELNMSST  105

Query  486  GAHSYEDR-hhkkhqhpssppSNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCKFV  319
               +  D+     +   +S   +     NM+AL C NCHLLVI+S++SPSCPNCK+V
Sbjct  106  VVSNCLDQCSSSNNSLEASNKIHAPSNSNMVALACLNCHLLVILSKSSPSCPNCKYV  162



>ref|XP_004960738.1| PREDICTED: uncharacterized protein LOC101757141 [Setaria italica]
Length=235

 Score =   126 bits (317),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 93/142 (65%), Gaps = 20/142 (14%)
 Frame = -1

Query  693  KRKIQSGGGGSVDLHQP-------WMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPK  535
            KRK  + G G  +  QP         +PLP+DWEQCLDLQSGRMYY+NRKT+KK+W  P+
Sbjct  64   KRKHYADGAGWEEPQQPPASLELQLNDPLPLDWEQCLDLQSGRMYYLNRKTLKKSWVRPR  123

Query  534  EQKQAQLNLELNIST---------SGAHSYEDRhhkkhqhpssppSNGAGGENMIALPCS  382
            EQ    +NL+LNIST         +G  +  D   +  + P+   S+G G  NM+A+PC+
Sbjct  124  EQS---VNLDLNISTAATIDDTTSAGVVAAPDEDAEPTKRPTGAVSSG-GNNNMVAVPCA  179

Query  381  NCHLLVIVSQTSPSCPNCKFVQ  316
            NCHLLV++ ++SPSCPNCKFVQ
Sbjct  180  NCHLLVMLCKSSPSCPNCKFVQ  201



>ref|XP_010999984.1| PREDICTED: uncharacterized protein LOC105107671 [Populus euphratica]
Length=190

 Score =   125 bits (313),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 91/144 (63%), Gaps = 12/144 (8%)
 Frame = -1

Query  666  GSVDLHQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTS  487
             SVDLH    +PLP+DWEQCLDL+SGRMYY+NRKT++K+W WPK QK   L+LELN+S++
Sbjct  53   ASVDLHV--KDPLPLDWEQCLDLESGRMYYLNRKTLRKSWNWPKNQK---LDLELNMSST  107

Query  486  GAHSYEDRhhkkhqhpssppSNGAGG-ENMIALPCSNCHLLVIVSQTSPSCPNCKFVQ--  316
              +  ++          S   N A    NM+AL C NCHLLVI S++SPSCPNCK+V   
Sbjct  108  IPNCPDECSSSNSSLEDSNNKNHASSNSNMVALACLNCHLLVIFSKSSPSCPNCKYVHSF  167

Query  315  ---YSAAGNRSPAKPFHSGLSLFN  253
                S     SP +   S LSL N
Sbjct  168  PTLQSPQPKVSPTRSL-STLSLLN  190



>ref|XP_002271254.1| PREDICTED: uncharacterized protein LOC100251518 [Vitis vinifera]
 emb|CBI39156.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 85/199 (43%), Positives = 117/199 (59%), Gaps = 27/199 (14%)
 Frame = -1

Query  786  MEFPELSLSLAASN--FNGDNAADSDQDIRLPMKRKIQSGG---------GGSVDLHQPW  640
            MEFPELSL+ +  +      N++ S+ +   P K++  S             SVDL    
Sbjct  28   MEFPELSLAPSPRHGVDKSTNSSSSESEANYPSKKRKFSDHLFNRSDPMIQTSVDLQ--L  85

Query  639  MEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNIST-----SGAHS  475
             +PLP+DWEQCLDL+SGRMYY+NRKT++K+W  PK+  Q +L+LELNIST         S
Sbjct  86   KDPLPLDWEQCLDLESGRMYYLNRKTLRKSWNCPKDHNQQKLDLELNISTLSNCPEKCSS  145

Query  474  YEDRhhkkhqhpssppSNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCKFVQYSAAGNR  295
            ++ +   + Q  S    + +   NM+AL C NCHLLVI+S++SPSCPNCK+V +S    +
Sbjct  146  FDSQ---RLQDHSKKHQHCSSSSNMVALACLNCHLLVILSKSSPSCPNCKYV-HSLPTQQ  201

Query  294  SP---AKPFHS--GLSLFN  253
             P   A P  S   LSL N
Sbjct  202  IPTSKAPPIKSLDTLSLLN  220



>gb|KDP42872.1| hypothetical protein JCGZ_23814 [Jatropha curcas]
Length=197

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 87/125 (70%), Gaps = 6/125 (5%)
 Frame = -1

Query  663  SVDLHQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTSG  484
            SVDLH    +PLP+DWEQCLDL++GR+YY+NRKT+K++W+WPK+QK   ++LELNIS   
Sbjct  59   SVDLHV--KDPLPLDWEQCLDLETGRVYYLNRKTLKRSWDWPKDQK---VDLELNIS-PF  112

Query  483  AHSYEDRhhkkhqhpssppSNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCKFVQYSAA  304
            ++ +        +       +     NM+AL C NCHLLVI+S+TSPSCPNCK+V    +
Sbjct  113  SNQHLTILEGSKKKNGQKSQSRTNNNNMVALACLNCHLLVILSRTSPSCPNCKYVHSLPS  172

Query  303  GNRSP  289
             +++P
Sbjct  173  THQAP  177



>ref|XP_008222658.1| PREDICTED: uncharacterized protein LOC103322510 [Prunus mume]
Length=179

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 97/171 (57%), Gaps = 21/171 (12%)
 Frame = -1

Query  786  MEFPELSLS------LAASNFNGDNAADSDQDIRLPMKRKI---------QSGGGGSVDL  652
            ME PELSL+      +   + +G N      +     KRK+         ++    SVDL
Sbjct  1    MELPELSLAPTQAQLVFKKSISGSNNPLESAESNTSRKRKLFQDHQLLKTEASFQTSVDL  60

Query  651  HQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTSGAHSY  472
                 +PLP+DWEQCLDL+SG+MYY+NRKT +K+W WP +Q    +NLELNIST    S 
Sbjct  61   Q--LKDPLPLDWEQCLDLESGKMYYLNRKTSRKSWNWPMDQA---VNLELNISTISGSSS  115

Query  471  EDRhhkkhqhpssppSNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCKFV  319
            + +             N     NM+AL C NCHLLVI+S++SPSCPNCK+V
Sbjct  116  D-QRSSPSLKTIEEAKNEEQQSNMVALACFNCHLLVILSKSSPSCPNCKYV  165



>ref|XP_007224575.1| hypothetical protein PRUPE_ppa1027228mg [Prunus persica]
 gb|EMJ25774.1| hypothetical protein PRUPE_ppa1027228mg [Prunus persica]
Length=179

 Score =   122 bits (307),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 96/171 (56%), Gaps = 21/171 (12%)
 Frame = -1

Query  786  MEFPELSLS------LAASNFNGDNAADSDQDIRLPMKRKI---------QSGGGGSVDL  652
            ME PELSL+      +   + NG N      +     KRK+         ++    SVDL
Sbjct  1    MELPELSLAPTQAHVVFKKSINGSNNPLESAESNTSRKRKLFQDHQLLKTEASFQTSVDL  60

Query  651  HQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTSGAHSY  472
                 +PLP+DWEQCLDL+SG+MYY+NRKT +K+W WP +Q    +NLELNIST    S 
Sbjct  61   Q--LKDPLPLDWEQCLDLESGKMYYLNRKTSRKSWNWPMDQA---VNLELNISTISGSSS  115

Query  471  EDRhhkkhqhpssppSNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCKFV  319
            + +             N     NM+AL C NCHLLVI+S++SP CPNCK+V
Sbjct  116  D-QRSSPSLKTIEEAKNEEQQSNMVALACFNCHLLVILSKSSPCCPNCKYV  165



>gb|KHF99431.1| ATP-dependent helicase/nuclease subunit A [Gossypium arboreum]
Length=193

 Score =   123 bits (308),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 85/127 (67%), Gaps = 10/127 (8%)
 Frame = -1

Query  684  IQSGGGGSVDLHQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLE  505
            + S    SVDL     +PLP+DWEQCLDL+SG+MYY+NRKT++KTW WPK+ K   L+LE
Sbjct  53   VDSQFQTSVDLQ--VKDPLPLDWEQCLDLESGKMYYMNRKTLEKTWNWPKDHK---LDLE  107

Query  504  LNISTSGAHSYEDRhhkkhqhpssppSNG-----AGGENMIALPCSNCHLLVIVSQTSPS  340
            LNIS + ++  E  +        S  +N      +   NM+ALPC NCHLLVI+ ++SP+
Sbjct  108  LNISPTSSNGLEHFNGSSISSEDSNNNNKQQQHFSSTTNMVALPCLNCHLLVILPKSSPA  167

Query  339  CPNCKFV  319
            CPNCK+V
Sbjct  168  CPNCKYV  174



>ref|XP_002531024.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31362.1| conserved hypothetical protein [Ricinus communis]
Length=211

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 93/150 (62%), Gaps = 18/150 (12%)
 Frame = -1

Query  666  GSVDLHQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNIS--  493
             S DLH    +PLP+DWEQCLDL+SGRMYY+NRKT++K+W WPK+QK   L+LELNIS  
Sbjct  68   ASFDLH--VKDPLPLDWEQCLDLESGRMYYLNRKTLRKSWNWPKDQK---LDLELNISPL  122

Query  492  ---TSGAHSYEDRhhkkhqhpssppSN-GAGGENMIALPCSNCHLLVIVSQTSPSCPNCK  325
               T   H   + +           +N  +   NM+AL C NCHLLVI+S++SPSCPNCK
Sbjct  123  TDCTPDHHQQCNNNGSNSVLLEDSRNNFSSPSSNMVALACLNCHLLVILSRSSPSCPNCK  182

Query  324  FVQYSAAGNR------SPAKPFHSGLSLFN  253
            +V      ++      SP K  ++ LSL N
Sbjct  183  YVHSLPITHQVLLPKISPTKSLNT-LSLLN  211



>ref|XP_011042790.1| PREDICTED: uncharacterized protein LOC105138424 [Populus euphratica]
Length=188

 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 82/117 (70%), Gaps = 6/117 (5%)
 Frame = -1

Query  666  GSVDLHQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTS  487
             SVDLH    +PLP+DWEQCLDL+SGRMYY+NRKT++K+W  P  QK   L+LELN+S++
Sbjct  51   ASVDLH--VKDPLPLDWEQCLDLESGRMYYLNRKTLRKSWSRPHNQK---LDLELNMSST  105

Query  486  GAHSYEDR-hhkkhqhpssppSNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCKFV  319
               +  D+     +   +S   +     NM+AL C NCHLLVI+S++SPSCPNCK++
Sbjct  106  VVSNCLDQCSSSNNSLEASNKIHAPSNSNMVALACLNCHLLVILSKSSPSCPNCKYI  162



>dbj|BAK05465.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=227

 Score =   120 bits (302),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 79/115 (69%), Gaps = 11/115 (10%)
 Frame = -1

Query  636  EPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTS---GAHSYED  466
            +PLP+DWEQCLDLQSG+MYY+NRKT+K++W  PKEQ    +NLELN+ST+    A   +D
Sbjct  85   DPLPLDWEQCLDLQSGKMYYLNRKTLKRSWNRPKEQG---VNLELNMSTTPTKQAVVADD  141

Query  465  -----RhhkkhqhpssppSNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCKFVQ  316
                          ++    G  G NMIA+PCSNCHLLV++ ++ P+CPNCKFVQ
Sbjct  142  GNTGATAPATLSQAAATKRGGTAGGNMIAVPCSNCHLLVMMCKSCPTCPNCKFVQ  196



>gb|EMT15001.1| hypothetical protein F775_32131 [Aegilops tauschii]
Length=207

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 76/113 (67%), Gaps = 9/113 (8%)
 Frame = -1

Query  636  EPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTSGAHSY-----  472
            +PLP+DWEQCLDLQSG+MYY+NRKT+K++W  PKE+    +NLELN+ST+ A        
Sbjct  65   DPLPLDWEQCLDLQSGKMYYLNRKTLKRSWNRPKEEG---VNLELNMSTTAARQVVVADD  121

Query  471  -EDRhhkkhqhpssppSNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCKFVQ  316
                        ++       G NMIA+PC+NCHLLV++ ++ P+CPNCKFVQ
Sbjct  122  GNTGATAPTLSQAAATKRSTAGGNMIAVPCTNCHLLVMLCKSYPTCPNCKFVQ  174



>ref|XP_010912818.1| PREDICTED: uncharacterized protein LOC105038647 [Elaeis guineensis]
Length=206

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 76/106 (72%), Gaps = 7/106 (7%)
 Frame = -1

Query  636  EPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTSGAHSYEDRhh  457
            +PLP DWEQCLDLQSGRMYY+NRKT++K+W  PKEQK   L+LELNIST    S E++  
Sbjct  80   DPLPFDWEQCLDLQSGRMYYLNRKTLRKSWIRPKEQK---LDLELNIST--LPSSEEKAG  134

Query  456  kkhqhpssppSNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCKFV  319
                      +N  G  NM+A+ C NCHLLV++ ++SPSCPNCK+V
Sbjct  135  TTTPEEPKKHNNSGG--NMVAIVCINCHLLVMICKSSPSCPNCKYV  178



>ref|XP_002442048.1| hypothetical protein SORBIDRAFT_08g008250 [Sorghum bicolor]
 gb|EES15886.1| hypothetical protein SORBIDRAFT_08g008250 [Sorghum bicolor]
Length=231

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 78/115 (68%), Gaps = 11/115 (10%)
 Frame = -1

Query  636  EPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTSGA-----HSY  472
            +PLP+DWEQCLDLQSGRMYY+NRKT+KK+W  P+EQ    +NL+LNIST+ A      + 
Sbjct  89   DPLPLDWEQCLDLQSGRMYYLNRKTLKKSWVRPREQS---VNLDLNISTTAAVDSCAVAD  145

Query  471  EDRhhkkhqhpssppSNGAG---GENMIALPCSNCHLLVIVSQTSPSCPNCKFVQ  316
                    +        G     G NM+A+PC+NCHLLV++ ++SPSCPNCKFVQ
Sbjct  146  GAAAAAPDEDDEPRKPTGRALFSGGNMVAVPCANCHLLVMLCKSSPSCPNCKFVQ  200



>ref|XP_010930161.1| PREDICTED: uncharacterized protein LOC105051416 [Elaeis guineensis]
Length=208

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 77/106 (73%), Gaps = 7/106 (7%)
 Frame = -1

Query  636  EPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTSGAHSYEDRhh  457
            +PLP+DWEQCLDLQSGRMYY+NRKT+KK+W  PKEQK   L+LELNIST    S E +  
Sbjct  82   DPLPLDWEQCLDLQSGRMYYLNRKTLKKSWIRPKEQK---LDLELNIST--LPSSEGKAS  136

Query  456  kkhqhpssppSNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCKFV  319
                      +N +G  +M+A+ C NCHLLV++ ++SPSCPNCK+V
Sbjct  137  STTPDEPKKHNNSSG--SMVAVVCINCHLLVMICKSSPSCPNCKYV  180



>gb|EAY82666.1| hypothetical protein OsI_37886 [Oryza sativa Indica Group]
Length=223

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 78/123 (63%), Gaps = 19/123 (15%)
 Frame = -1

Query  636  EPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTS----------  487
            +PLP+DWEQCLDLQSGRMYY+NRKT+KK+W  PKEQ    +NLELNIST+          
Sbjct  77   DPLPLDWEQCLDLQSGRMYYLNRKTLKKSWIRPKEQ---SVNLELNISTTQPTVVVVPTI  133

Query  486  ------GAHSYEDRhhkkhqhpssppSNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCK  325
                  GA +       +         +   G NM+A+PC NCHLLV++ ++SPSCPNCK
Sbjct  134  IDGGSTGAAATPVAVVAEETKKGGTIVSSGPGGNMVAVPCVNCHLLVMLCKSSPSCPNCK  193

Query  324  FVQ  316
            FVQ
Sbjct  194  FVQ  196



>ref|NP_001152094.1| WW domain containing protein [Zea mays]
 gb|ACG45755.1| WW domain containing protein [Zea mays]
 gb|AFW65092.1| WW domain containing protein [Zea mays]
Length=174

 Score =   116 bits (291),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 79/124 (64%), Gaps = 19/124 (15%)
 Frame = -1

Query  669  GGSVDLHQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWP-KEQKQAQLNLELNIS  493
            G S+DL     +PLP+DWEQCLDL SGRMYY NRKT  K+W+ P  +++Q  LNLEL IS
Sbjct  45   GSSLDLQ--LGDPLPLDWEQCLDLHSGRMYYQNRKTKNKSWDRPSSKEEQGTLNLELGIS  102

Query  492  TSGAHSYEDRhhkkhqhpssppSNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCKFVQY  313
            T+                     +   G +M+A+PC NCHLLV++ ++SP+CPNCKFVQ 
Sbjct  103  TT----------------PDTFKSHTSGGHMVAVPCVNCHLLVMLCKSSPACPNCKFVQP  146

Query  312  SAAG  301
            S AG
Sbjct  147  SVAG  150



>ref|XP_008674157.1| PREDICTED: uncharacterized protein LOC103650339 [Zea mays]
 tpg|DAA54840.1| TPA: hypothetical protein ZEAMMB73_859049 [Zea mays]
Length=209

 Score =   117 bits (293),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 75/118 (64%), Gaps = 12/118 (10%)
 Frame = -1

Query  633  PLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTSGAHSYEDRhhk  454
            PLP+DWEQCLDLQSGRMYY+NRKT+KK+W  P+EQ     N++LNIST+       +   
Sbjct  88   PLPLDWEQCLDLQSGRMYYLNRKTLKKSWVRPREQSLN--NVDLNISTAPDEDEPGKPAG  145

Query  453  khqhpssppSNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCKFVQYSAAGNRSPAKP  280
                          G NM+A+PC+NCHLLV++  +SPSCPNCKFVQ        PA P
Sbjct  146  TLF----------SGGNMVAVPCANCHLLVMLCMSSPSCPNCKFVQPLPPSVVPPAYP  193



>ref|XP_003578750.1| PREDICTED: uncharacterized protein LOC100823520 [Brachypodium 
distachyon]
Length=215

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 80/113 (71%), Gaps = 9/113 (8%)
 Frame = -1

Query  636  EPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTS----GAHSYE  469
            +PLP+DWEQCLDLQSGRMYY+NRKT+K++W  PKEQ    +NLELN+ST+    G     
Sbjct  78   DPLPLDWEQCLDLQSGRMYYLNRKTLKRSWIRPKEQG---VNLELNMSTTPMNVGVVDGN  134

Query  468  DRhhkkhqhpssppSNG--AGGENMIALPCSNCHLLVIVSQTSPSCPNCKFVQ  316
            +          +  ++   + G NMIA+PC+NCHLLV++ ++SPSCPNCK+VQ
Sbjct  135  NGAAFPTLPQVTERADAVSSSGGNMIAVPCANCHLLVMLCKSSPSCPNCKYVQ  187



>ref|XP_006443130.1| hypothetical protein CICLE_v10023373mg [Citrus clementina]
 gb|ESR56370.1| hypothetical protein CICLE_v10023373mg [Citrus clementina]
 gb|KDO46426.1| hypothetical protein CISIN_1g029636mg [Citrus sinensis]
Length=190

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 90/159 (57%), Gaps = 27/159 (17%)
 Frame = -1

Query  687  KIQSGGGGSVDLHQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNL  508
            K +     SVDL     +PLP+DWE+CLDLQSGRMYY NRK+ KK+W  P E KQ +L+L
Sbjct  45   KTEPAIQTSVDLQ--IKDPLPLDWERCLDLQSGRMYYFNRKSSKKSWSLP-ENKQ-KLDL  100

Query  507  ELNIS-------TSGAHSYEDRhhkkhqhpssppSNGAGGENMIALPCSNCHLLVIVSQT  349
            ELNIS       TS A   E  +              +   NM+AL C NCHLLVI+S++
Sbjct  101  ELNISSSSVSNCTSAADDDESNNKHHL---------SSASNNMVALACMNCHLLVILSKS  151

Query  348  SPSCPNCKFVQ-------YSAAGNRSPAKPFHSGLSLFN  253
            SPSCPNCKFV         S++   S  K   + LSL N
Sbjct  152  SPSCPNCKFVHSLPNQQTQSSSAKVSGTKSMINTLSLLN  190



>gb|EMS47120.1| hypothetical protein TRIUR3_32584 [Triticum urartu]
Length=213

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 79/114 (69%), Gaps = 11/114 (10%)
 Frame = -1

Query  636  EPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTSGAH-------  478
            +PLP+DWEQCLDLQSG+MYY+NRKT+K++W  PKEQ    ++LELN+ST+          
Sbjct  73   DPLPLDWEQCLDLQSGKMYYLNRKTLKRSWNRPKEQG---VSLELNMSTTPTRQVVVVDD  129

Query  477  SYEDRhhkkhqhpssppSNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCKFVQ  316
            S            ++   + AGG NMIA+PC+NCHLLV++ ++ P+CPNCKF+Q
Sbjct  130  SNTSATAPTLSQAAATKRDTAGG-NMIAVPCTNCHLLVMLCKSYPTCPNCKFMQ  182



>gb|ABA96334.2| WW domain containing protein, expressed [Oryza sativa Japonica 
Group]
Length=225

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 77/125 (62%), Gaps = 21/125 (17%)
 Frame = -1

Query  636  EPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTS----------  487
            +PLP+DWEQCLDLQSGRMYY+NRKT+KK+W  PKEQ    +NLELNIST+          
Sbjct  77   DPLPLDWEQCLDLQSGRMYYLNRKTLKKSWIRPKEQ---SVNLELNISTTQPTVVVVPTI  133

Query  486  --GAHSYEDRhhkkhqhpssppSNGAG------GENMIALPCSNCHLLVIVSQTSPSCPN  331
              G  +            +     G        G NM+A+PC NCHLLV++ ++SPSCPN
Sbjct  134  IDGGSTGAAATPVAVAVVAEETKKGGTIVSSGPGGNMVAVPCVNCHLLVMLCKSSPSCPN  193

Query  330  CKFVQ  316
            CKFVQ
Sbjct  194  CKFVQ  198



>ref|NP_001137040.1| hypothetical protein [Zea mays]
 gb|ACF83136.1| unknown [Zea mays]
 gb|AFW56704.1| hypothetical protein ZEAMMB73_574320 [Zea mays]
Length=224

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 101/179 (56%), Gaps = 19/179 (11%)
 Frame = -1

Query  804  IHIYISMEF-PELSLSLAASNFN-GDNAADSDQDIRLPMKRKIQSGGGGS--------VD  655
            + ++ +ME  PELSL      F  GD AA S         RK +     S          
Sbjct  19   LSLHKTMELQPELSLGPVWPGFAAGDLAAKSSSSESDGTSRKKRKHYTASWEEPQQPPAS  78

Query  654  LHQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTSGA--  481
            L     +PLP+DWEQCLDLQSGRMYY+NRKT+KK+W  P+ Q    +NL+LNIST+ A  
Sbjct  79   LELQLNDPLPLDWEQCLDLQSGRMYYLNRKTLKKSWVRPQVQ---SVNLDLNISTAAAID  135

Query  480  HSYEDRhhkkhqhpssppSNGAG----GENMIALPCSNCHLLVIVSQTSPSCPNCKFVQ  316
            +   +            P   AG    G +M+A+PC+NCHLLV++ ++SPSCPNCKFVQ
Sbjct  136  NCAANGAAAAASDDEDEPRKPAGTLFSGGSMVAVPCANCHLLVMLCKSSPSCPNCKFVQ  194



>ref|XP_006662894.1| PREDICTED: uncharacterized protein LOC102700469 [Oryza brachyantha]
Length=200

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 82/125 (66%), Gaps = 10/125 (8%)
 Frame = -1

Query  636  EPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNIST--------SGA  481
            +PLP+DWEQCLDL SGRMYY+NRKTM+K+W  P E+  + L+LELNIST         G 
Sbjct  58   DPLPLDWEQCLDLHSGRMYYLNRKTMRKSWVRPMEEHGSTLDLELNISTIPCTFGNGDGK  117

Query  480  HSYEDRhhkkhqhpssppSNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCKFVQYSA-A  304
             S      +     S     G+ G +M+A+PC NCHLLV++ ++SP+CPNCKF+Q S  A
Sbjct  118  ASPGTIAEEDEDDASWSGGRGSVG-SMVAIPCINCHLLVMLCKSSPACPNCKFLQPSVPA  176

Query  303  GNRSP  289
              R+P
Sbjct  177  MARTP  181



>gb|EAY80670.1| hypothetical protein OsI_35847 [Oryza sativa Indica Group]
Length=212

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 82/141 (58%), Gaps = 14/141 (10%)
 Frame = -1

Query  666  GSVDLHQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQ--LNLELNIS  493
             S+DLH    +PLP+DWEQCLDL SGRMYY+NRKTM+K+W  P E+      L+LELNIS
Sbjct  55   ASLDLH--LNDPLPMDWEQCLDLHSGRMYYLNRKTMRKSWVRPMEEHGGSNTLDLELNIS  112

Query  492  TSGAHSYEDRhhkkhqhpssppSNGA----------GGENMIALPCSNCHLLVIVSQTSP  343
            T  +  +           ++   + A              M+A+PC NCHLLV++ ++SP
Sbjct  113  TVPSTFHVGASKASSGGAAAIAEDDARIAGGGSGVGSLGPMVAVPCVNCHLLVMLCKSSP  172

Query  342  SCPNCKFVQYSAAGNRSPAKP  280
            +CPNCKFVQ S      P  P
Sbjct  173  ACPNCKFVQPSVPAPAMPRTP  193



>gb|KGN45930.1| hypothetical protein Csa_6G023890 [Cucumis sativus]
Length=197

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 97/177 (55%), Gaps = 26/177 (15%)
 Frame = -1

Query  792  ISMEFPELSLSLAASNFNGD--NAADSDQDIRLP----MKRKIQ-------SGGGGSVDL  652
            + MEFPELSL+        D  N++ S   + +      KRK+             SVDL
Sbjct  2    LDMEFPELSLAPTRQFVKSDEMNSSSSKHLVEISSQCSRKRKLLLHDHHHFIKSQTSVDL  61

Query  651  HQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPK--------EQKQAQLNLELNI  496
                 +PLP+ WEQCLDLQSG+MYY+NRKT++K+W WPK          ++  L LELN 
Sbjct  62   Q--LKDPLPLHWEQCLDLQSGKMYYLNRKTLRKSWNWPKDQDHHQQHHHQKLDLALELNN  119

Query  495  STSGAHSYEDRhhkkhqhpssppSNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCK  325
              S +   ++     +        + +   NM+ALPC NCHLLVI+S++SPSCPNCK
Sbjct  120  INSPSSKADN---LMNFGHEHGNYSFSESSNMVALPCLNCHLLVILSKSSPSCPNCK  173



>ref|NP_001067715.1| Os11g0294400 [Oryza sativa Japonica Group]
 gb|AAX95449.1| WW domain, putative [Oryza sativa Japonica Group]
 gb|AAX96146.1| WW domain, putative [Oryza sativa Japonica Group]
 gb|ABA92731.1| WW domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28078.1| Os11g0294400 [Oryza sativa Japonica Group]
 gb|EAZ18132.1| hypothetical protein OsJ_33676 [Oryza sativa Japonica Group]
 dbj|BAG88312.1| unnamed protein product [Oryza sativa Japonica Group]
Length=212

 Score =   112 bits (279),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 82/141 (58%), Gaps = 14/141 (10%)
 Frame = -1

Query  666  GSVDLHQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQ--LNLELNIS  493
             S+DLH    +PLP+DWEQCLDL SGRMYY+NRKTM+K+W  P E+      L+LELNIS
Sbjct  55   ASLDLH--LNDPLPMDWEQCLDLHSGRMYYLNRKTMRKSWVRPMEEHGGSNTLDLELNIS  112

Query  492  TSGAHSYEDRhhkkhqhpssppSNGA----------GGENMIALPCSNCHLLVIVSQTSP  343
            T  +  +           ++   + A              M+A+PC NCHLLV++ ++SP
Sbjct  113  TIPSTFHVGAGKASSGGAAAIAEDDARIAGGGGGVGSLGPMVAVPCVNCHLLVMLCKSSP  172

Query  342  SCPNCKFVQYSAAGNRSPAKP  280
            +CPNCKFVQ S      P  P
Sbjct  173  ACPNCKFVQPSVPAPAMPRTP  193



>ref|XP_009405093.1| PREDICTED: uncharacterized protein LOC103988268 [Musa acuminata 
subsp. malaccensis]
Length=177

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 77/113 (68%), Gaps = 10/113 (9%)
 Frame = -1

Query  663  SVDLHQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTSG  484
            S+DL     +PLP+DWEQCLDLQSGR+Y++NRKT++K+W  PKEQK   L+LELNI+T  
Sbjct  47   SIDLQ--LNDPLPLDWEQCLDLQSGRIYFLNRKTLRKSWSRPKEQK---LDLELNIAT--  99

Query  483  AHSYEDRhhkkhqhpssppSNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCK  325
               +    +K        P+  +   NM+A  C NCHLLV++ ++SPSCPNCK
Sbjct  100  ---FASSENKTTSASPEKPTKSSSSGNMVAAVCVNCHLLVMLCKSSPSCPNCK  149



>ref|XP_009391144.1| PREDICTED: uncharacterized protein LOC103977377 [Musa acuminata 
subsp. malaccensis]
Length=187

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 95/179 (53%), Gaps = 41/179 (23%)
 Frame = -1

Query  786  MEFPELSLSLAASNFNG-DNAADSDQDIRLPMKRKIQSGGGGSVDLHQPWMEPLPVDWEQ  610
            M+  ELSL L  S  +   ++A ++ D     KRK+Q      +DLH     PLP++WEQ
Sbjct  1    MDHAELSLGLPGSMMSEITSSASTESDAIAKRKRKMQQTWDHGIDLHLN--HPLPLEWEQ  58

Query  609  CLDLQ----------------------SGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNI  496
            CLDLQ                      SG MYY+NRKTMKK+W   +E+    + LELNI
Sbjct  59   CLDLQVNTFSLSLSLMASQCCNLDLWQSGNMYYLNRKTMKKSWVRLEEK---SMKLELNI  115

Query  495  STSGAHSYEDRhhkkhqhpssppSNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCKFV  319
            ST G+   + +               + G +M+AL C NCHLLV++ ++SPSCPNCK+V
Sbjct  116  STFGSSETKKQC-------------SSSGSSMMALVCVNCHLLVMLRKSSPSCPNCKYV  161



>ref|XP_009389881.1| PREDICTED: uncharacterized protein LOC103976416 [Musa acuminata 
subsp. malaccensis]
Length=195

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 72/107 (67%), Gaps = 5/107 (5%)
 Frame = -1

Query  636  EPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTSGAHSYEDRhh  457
            +PLP+DWE+CLDLQ+GR+YY+NRKT+K++W  PKEQ    L+LELNIST  +        
Sbjct  67   DPLPLDWERCLDLQTGRIYYMNRKTLKRSWSRPKEQ---NLDLELNISTFSSSEEAPNSR  123

Query  456  kkhqhpssppSNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCKFVQ  316
                  +    +  G  +M A+ C NCHLLV++ ++SPSCPNCK +Q
Sbjct  124  STTPEEAKKQHSSCG--SMAAVVCVNCHLLVMLCKSSPSCPNCKCMQ  168



>ref|XP_009415642.1| PREDICTED: uncharacterized protein LOC103996444 [Musa acuminata 
subsp. malaccensis]
Length=210

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 75/106 (71%), Gaps = 7/106 (7%)
 Frame = -1

Query  636  EPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTSGAHSYEDRhh  457
            +PLP++WEQCLDLQSGRMYY++RKT+KK+W  PKE    +L+L+LNIS+  +   +    
Sbjct  83   DPLPLEWEQCLDLQSGRMYYLDRKTLKKSWIRPKEH---ELDLDLNISSFSSSEEQSNLT  139

Query  456  kkhqhpssppSNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCKFV  319
               +    P S G+    M+A+ C NCHLLV++ ++SPSCPNCKF+
Sbjct  140  NSDEAKKQPNSCGS----MVAVVCINCHLLVMLCESSPSCPNCKFM  181



>ref|XP_008804209.1| PREDICTED: uncharacterized protein LOC103717553 [Phoenix dactylifera]
Length=128

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 62/99 (63%), Gaps = 7/99 (7%)
 Frame = -1

Query  615  EQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTSGAHSYEDRhhkkhqhps  436
            E   D  SGRMYY+NRKT+KK+W  PKEQK   L+LELNIST       +          
Sbjct  9    EAVRDFMSGRMYYLNRKTLKKSWIRPKEQK---LDLELNISTLP---ISEGKASSTTPDD  62

Query  435  sppSNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCKFV  319
                N + G NM+A+ C NCHLLV++ ++SPSCPNCK+V
Sbjct  63   QKKHNSSSG-NMVAVVCVNCHLLVMICKSSPSCPNCKYV  100



>ref|NP_001176855.1| Os12g0233100 [Oryza sativa Japonica Group]
 dbj|BAH95583.1| Os12g0233100, partial [Oryza sativa Japonica Group]
Length=138

 Score = 90.9 bits (224),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 64/112 (57%), Gaps = 21/112 (19%)
 Frame = -1

Query  597  QSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTS------------GAHSYEDRhhk  454
            QSGRMYY+NRKT+KK+W  PKEQ    +NLELNIST+            G  +       
Sbjct  3    QSGRMYYLNRKTLKKSWIRPKEQ---SVNLELNISTTQPTVVVVPTIIDGGSTGAAATPV  59

Query  453  khqhpssppSNGAG------GENMIALPCSNCHLLVIVSQTSPSCPNCKFVQ  316
                 +     G        G NM+A+PC NCHLLV++ ++SPSCPNCKFVQ
Sbjct  60   AVAVVAEETKKGGTIVSSGPGGNMVAVPCVNCHLLVMLCKSSPSCPNCKFVQ  111



>ref|XP_006853132.1| hypothetical protein AMTR_s00038p00161690 [Amborella trichopoda]
 gb|ERN14599.1| hypothetical protein AMTR_s00038p00161690 [Amborella trichopoda]
Length=178

 Score = 91.7 bits (226),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 76/136 (56%), Gaps = 7/136 (5%)
 Frame = -1

Query  663  SVDLHQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTSG  484
             V+LH     PLP +W+QCLDLQSG +++ N +T K+TW+ P+E     + L+L ++ + 
Sbjct  46   DVELH--LERPLPREWQQCLDLQSGEIHFYNIRTQKRTWKDPREAPHPSMRLDLELNLTL  103

Query  483  AHSYEDRhhkkhqhpssppSNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCKFVQYSAA  304
              +  D      + P +          M+A PC  CH+LV++ ++SP+CPNCKF+ +   
Sbjct  104  PENDGDH----LKRPKTDDPKHFPATEMVATPCFRCHMLVVLCKSSPTCPNCKFL-HPLE  158

Query  303  GNRSPAKPFHSGLSLF  256
              + P  PF   +SL 
Sbjct  159  QKKEPNLPFRQTMSLL  174



>gb|AFW56705.1| hypothetical protein ZEAMMB73_574320 [Zea mays]
Length=148

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 68/103 (66%), Gaps = 9/103 (9%)
 Frame = -1

Query  606  LDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTSGA--HSYEDRhhkkhqhpss  433
            L +QSGRMYY+NRKT+KK+W  P+ Q    +NL+LNIST+ A  +   +           
Sbjct  19   LCMQSGRMYYLNRKTLKKSWVRPQVQ---SVNLDLNISTAAAIDNCAANGAAAAASDDED  75

Query  432  ppSNGAG----GENMIALPCSNCHLLVIVSQTSPSCPNCKFVQ  316
             P   AG    G +M+A+PC+NCHLLV++ ++SPSCPNCKFVQ
Sbjct  76   EPRKPAGTLFSGGSMVAVPCANCHLLVMLCKSSPSCPNCKFVQ  118



>gb|EAZ20052.1| hypothetical protein OsJ_35653 [Oryza sativa Japonica Group]
Length=201

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 64/112 (57%), Gaps = 21/112 (19%)
 Frame = -1

Query  597  QSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTS------------GAHSYEDRhhk  454
            +SGRMYY+NRKT+KK+W  PKEQ    +NLELNIST+            G  +       
Sbjct  66   RSGRMYYLNRKTLKKSWIRPKEQ---SVNLELNISTTQPTVVVVPTIIDGGSTGAAATPV  122

Query  453  khqhpssppSNGAG------GENMIALPCSNCHLLVIVSQTSPSCPNCKFVQ  316
                 +     G        G NM+A+PC NCHLLV++ ++SPSCPNCKFVQ
Sbjct  123  AVAVVAEETKKGGTIVSSGPGGNMVAVPCVNCHLLVMLCKSSPSCPNCKFVQ  174



>ref|NP_001170239.1| uncharacterized protein LOC100384192 [Zea mays]
 gb|ACN36340.1| unknown [Zea mays]
Length=148

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 67/103 (65%), Gaps = 9/103 (9%)
 Frame = -1

Query  606  LDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTSGA--HSYEDRhhkkhqhpss  433
            L +Q GRMYY+NRKT+KK+W  P+ Q    +NL+LNIST+ A  +   +           
Sbjct  19   LCMQFGRMYYLNRKTLKKSWVRPQVQ---SVNLDLNISTAAAIDNCAANGAAAAASDDED  75

Query  432  ppSNGAG----GENMIALPCSNCHLLVIVSQTSPSCPNCKFVQ  316
             P   AG    G +M+A+PC+NCHLLV++ ++SPSCPNCKFVQ
Sbjct  76   EPRKPAGTLFSGGSMVAVPCANCHLLVMLCKSSPSCPNCKFVQ  118



>ref|XP_008795551.1| PREDICTED: uncharacterized protein LOC103711252 [Phoenix dactylifera]
Length=199

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 86/153 (56%), Gaps = 20/153 (13%)
 Frame = -1

Query  690  RKIQSGGGGSVDLHQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQA---  520
            ++ +S     VDLH     PLP++WE+CLD++SG++++ N +T ++T+  P+E  +    
Sbjct  41   KEFKSSKAEDVDLH--LDSPLPLEWERCLDIKSGQIHFYNTRTHRRTYRDPRESTEPPAS  98

Query  519  --QLNLELNISTSGAHSYEDRhhkkhqhpssppSNGAGG----------ENMIALPCSNC  376
               L+LELN++     S+     +  Q  +S  ++G+            + M+A  C  C
Sbjct  99   CPSLDLELNLTFEPPRSHISGEERIKQGCNSRDNSGSLSRSLTSLETQQQEMVAAVCMRC  158

Query  375  HLLVIVSQTSPSCPNCKFVQ---YSAAGNRSPA  286
            H+LV++S+ +PSCPNCKFV    YS++ +  P 
Sbjct  159  HMLVMMSKATPSCPNCKFVHPPSYSSSRSLKPG  191



>ref|XP_007224574.1| hypothetical protein PRUPE_ppa1027228mg [Prunus persica]
 gb|EMJ25773.1| hypothetical protein PRUPE_ppa1027228mg [Prunus persica]
Length=99

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 55/89 (62%), Gaps = 4/89 (4%)
 Frame = -1

Query  585  MYYVNRKTMKKTWEWPKEQKQAQLNLELNISTSGAHSYEDRhhkkhqhpssppSNGAGGE  406
            MYY+NRKT +K+W WP +Q    +NLELNIST    S  D+             N     
Sbjct  1    MYYLNRKTSRKSWNWPMDQA---VNLELNISTISGSS-SDQRSSPSLKTIEEAKNEEQQS  56

Query  405  NMIALPCSNCHLLVIVSQTSPSCPNCKFV  319
            NM+AL C NCHLLVI+S++SP CPNCK+V
Sbjct  57   NMVALACFNCHLLVILSKSSPCCPNCKYV  85



>ref|XP_004301920.1| PREDICTED: uncharacterized protein LOC101299013 [Fragaria vesca 
subsp. vesca]
Length=215

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 77/158 (49%), Gaps = 16/158 (10%)
 Frame = -1

Query  699  PMKRKIQSGGGGSVDLHQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQA  520
            P   +I+      V+LH     PLP++W++CLD+QSG++++ N +T  KT   P+     
Sbjct  45   PAADQIRPKSFFDVELH--LETPLPLEWQRCLDIQSGQIHFYNTRTQMKTSRDPRRSTTP  102

Query  519  Q---------LNLELNISTSGAHSYEDRhhkkhqhpssppSNGAGGE-----NMIALPCS  382
            +         L+LELN+       + +      +      S+  G E      M+A  C 
Sbjct  103  EPPSTNHHMSLDLELNLRCDSQPHHPEISPNSFRALFKNNSSRLGLELDHDQEMVATVCM  162

Query  381  NCHLLVIVSQTSPSCPNCKFVQYSAAGNRSPAKPFHSG  268
             CH+LV++ ++SP+CPNCK++        +P KP   G
Sbjct  163  RCHMLVMLCKSSPACPNCKYMHTPDQSPSTPFKPMSQG  200



>ref|XP_009409267.1| PREDICTED: uncharacterized protein LOC103991503 [Musa acuminata 
subsp. malaccensis]
Length=221

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 73/134 (54%), Gaps = 16/134 (12%)
 Frame = -1

Query  633  PLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQA-----QLNLELNISTSGAHSYE  469
            PLP++W++CLDL+SG +++ N +T ++T   P+   +       L+LELN++     S+ 
Sbjct  79   PLPLEWQRCLDLKSGEIHFYNTRTHRRTSRDPRLNLEPPSSPLSLDLELNLACEPPRSHI  138

Query  468  DRhhkkhqhpssppSNG-----------AGGENMIALPCSNCHLLVIVSQTSPSCPNCKF  322
            D   ++ +      S G           AG E M+A  C  CH+LV++++ + SCPNCKF
Sbjct  139  DGGGREEERRKQDNSGGKACSLSWVSLDAGPEEMMATVCMRCHMLVMMNKATLSCPNCKF  198

Query  321  VQYSAAGNRSPAKP  280
            +     G+ +  KP
Sbjct  199  IHPPDHGSSTSIKP  212



>ref|XP_009389553.1| PREDICTED: uncharacterized protein LOC103976092 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=195

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 63/111 (57%), Gaps = 11/111 (10%)
 Frame = -1

Query  633  PLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPK------EQKQAQLNLELNISTSGAHSY  472
            PLP +W++CLDL+SG +++ N +T ++T   P+         + +L+LELN+   G+H Y
Sbjct  64   PLPSEWQRCLDLKSGAIHFYNTRTHRRTAMDPRLSSLEPPSSRPRLDLELNLEPPGSHLY  123

Query  471  EDRhhkkhqhpssppSNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCKFV  319
                    Q         +  + M+A  C  CH+LV++S+ S SCP+CKFV
Sbjct  124  GGEGDLVKQDAC-----NSEDDEMVATACMRCHMLVMMSKASLSCPSCKFV  169



>ref|XP_009409162.1| PREDICTED: uncharacterized protein LOC103991427 [Musa acuminata 
subsp. malaccensis]
Length=169

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 62/115 (54%), Gaps = 10/115 (9%)
 Frame = -1

Query  633  PLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPK---EQKQAQLNLELNISTSGAHSYEDR  463
            PLP++W+QCLD++SG MY+ N KT K+T+  P+      +  L+L+L +    A + +D 
Sbjct  38   PLPLEWQQCLDIRSGEMYFYNTKTRKRTFRDPRLIPTPPRPCLSLDLKLKIDPAVTDDDE  97

Query  462  hhkkhqhpssppSN-------GAGGENMIALPCSNCHLLVIVSQTSPSCPNCKFV  319
                 +      S         A    M+A  C  CH+LV++ + + SCPNCKFV
Sbjct  98   FRCNPRSSRGSASRSLPWISLDADRREMVATVCMRCHMLVMMCKAALSCPNCKFV  152



>ref|XP_002301050.2| hypothetical protein POPTR_0002s09660g [Populus trichocarpa]
 gb|EEE80323.2| hypothetical protein POPTR_0002s09660g [Populus trichocarpa]
Length=217

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 77/161 (48%), Gaps = 38/161 (24%)
 Frame = -1

Query  633  PLPVDWEQCLDLQSGRMYYVNRKTMKKTW-------EWPKEQKQAQLNLELNI--STSGA  481
            PLP++W++CLD+QSG++++ N +T K+T        E P       L LELN+    S  
Sbjct  59   PLPLEWQRCLDIQSGQIHFYNTRTHKRTSRDPRGSPEPPSPDHDMSLELELNLPYDQSQR  118

Query  480  HSYEDRhhkkhqh-----------pssppSNGAGG---------------ENMIALPCSN  379
             SY   H  K                S   NG+ G               + M+A  C+ 
Sbjct  119  KSYTHDHITKQNPGGSIRGFGDLFKESSRDNGSSGGLTRRPSWLAFEKDQQEMLATVCTK  178

Query  378  CHLLVIVSQTSPSCPNCKFVQYSAAGNRSPAKPFHSGLSLF  256
            CH+LV++ ++SP+CPNCKF+       +SP K F   LSLF
Sbjct  179  CHMLVMLCRSSPTCPNCKFLH---PLEQSPPKLFKQRLSLF  216



>gb|EMT10599.1| hypothetical protein F775_26180 [Aegilops tauschii]
Length=215

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 67/130 (52%), Gaps = 25/130 (19%)
 Frame = -1

Query  633  PLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQ--------------LNLELNI  496
            PLP++W +CLD++SG+++Y N +T K+T + P+    A               L+L+LN+
Sbjct  59   PLPLEWRRCLDIKSGQIHYYNTRTHKRTSKDPRRHGGAAPAVEEDVANCGPQGLDLDLNL  118

Query  495  STSGAHSYEDRhhkkhqhpssppSNG-----------AGGENMIALPCSNCHLLVIVSQT  349
            +     S   +  +K+       + G           +GG  M+A  C  CH+LV++ + 
Sbjct  119  AFEPRRSSPVKELQKNAEAKPAAAGGDRHGDQAPGSASGGMEMVAAVCMRCHMLVMMCRA  178

Query  348  SPSCPNCKFV  319
             P+CPNCKF+
Sbjct  179  CPACPNCKFL  188



>gb|KHG09905.1| BAG family molecular chaperone regulator 3 [Gossypium arboreum]
Length=198

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 79/164 (48%), Gaps = 26/164 (16%)
 Frame = -1

Query  741  NGDNAADSDQDIRLPMKRKIQSGGGGSVDLHQPWMEPLPVDWEQCLDLQSGRMYYVNRKT  562
            N +   D D +  +   +  ++  G  ++LH     PLP++W++CLDLQSG +++ N +T
Sbjct  16   NLEEPLDGDGETLIKRLKTERTKPGFDMELHLD--TPLPIEWQRCLDLQSGTIHFYNSRT  73

Query  561  MKKTWEWPKEQKQA------QLNLELNI-STSGAHSYEDRhhkkhqhpssppSNGAGG--  409
              +T + P+   +        L+LELN+   S A + E    +          N  GG  
Sbjct  74   DTRTCKDPRTSPECPSTGHMSLDLELNLPCVSNATNPEAVSKQNCVGSVEKKLNSWGGLM  133

Query  408  ---------------ENMIALPCSNCHLLVIVSQTSPSCPNCKF  322
                           E M+A  C  CH+LV++ ++SP+CPNCKF
Sbjct  134  QKRPWLTMEEAKEEEEEMVATVCRQCHMLVMLIKSSPACPNCKF  177



>ref|XP_002465717.1| hypothetical protein SORBIDRAFT_01g044450 [Sorghum bicolor]
 gb|EER92715.1| hypothetical protein SORBIDRAFT_01g044450 [Sorghum bicolor]
Length=244

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/144 (28%), Positives = 68/144 (47%), Gaps = 39/144 (27%)
 Frame = -1

Query  633  PLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQ---------------------  517
            PLP +W++CLD++SG+++Y N +T K+TW+ P+     +                     
Sbjct  65   PLPPEWQRCLDIKSGQIHYYNTRTQKRTWKDPRGDSDYRAAAPTSGEDDGEEEEEDSANC  124

Query  516  ----LNLELNIS------TSGAHSYE--------DRhhkkhqhpssppSNGAGGENMIAL  391
                L+LELN++       + AH  +        D   +          + +G   M+A 
Sbjct  125  APPGLDLELNLTFEPRRAFAAAHEKKKPKPAVAADDRRRLQLAAEEEAEDSSGSREMVAG  184

Query  390  PCSNCHLLVIVSQTSPSCPNCKFV  319
             C  CH+LV++ + SP+CPNCKF+
Sbjct  185  VCVRCHMLVMMCRASPACPNCKFL  208



>ref|XP_006364848.1| PREDICTED: uncharacterized protein LOC102605844 [Solanum tuberosum]
Length=203

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/135 (30%), Positives = 65/135 (48%), Gaps = 30/135 (22%)
 Frame = -1

Query  633  PLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPK---------EQKQAQLNLELNI-----  496
            PLP++W++CLD++SG++Y+ N +T K+T   P+          Q    L+LELN+     
Sbjct  58   PLPLEWQRCLDIKSGQIYFYNTRTQKRTSRDPRLSEPEPLPTHQVHMSLDLELNLLPSYQ  117

Query  495  STSGAHSYEDRhhkkhqhpssppSN----------------GAGGENMIALPCSNCHLLV  364
            S    +  +D       +      N                    + M+   C  CH+LV
Sbjct  118  SPEKINQIDDNFVSNTSNHFIKKDNYESKGLINRSPSWLTFDVDQQEMVTAVCKKCHMLV  177

Query  363  IVSQTSPSCPNCKFV  319
            ++S++SP+CPNCKFV
Sbjct  178  MMSKSSPTCPNCKFV  192



>ref|XP_008466035.1| PREDICTED: uncharacterized protein LOC103503587 [Cucumis melo]
Length=298

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 77/161 (48%), Gaps = 37/161 (23%)
 Frame = -1

Query  696  MKRKIQSGGG-------GSVDLHQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWP  538
            MKRK +   G        +++LH     PLP++W++CLD+QSG +++ N KT K+T   P
Sbjct  83   MKRKWEDPQGENFNSPTDNIELH--LETPLPLEWQRCLDIQSGEIHFFNTKTQKRTSMDP  140

Query  537  KEQK----------------QA-QLNLELNISTSGAHSYEDRhhkkhqhpssppSNGAG-  412
            +  K                QA  L+LELN++          ++          +N  G 
Sbjct  141  RRNKLEGPTTTPSRSHVSDHQALSLDLELNLNCQSNKKILSNNNDDTGGLMKLQANNYGI  200

Query  411  ----------GENMIALPCSNCHLLVIVSQTSPSCPNCKFV  319
                       + M+A  C  CHLLV++ ++SP+CPNCKF+
Sbjct  201  SCPWLRFEREQQEMVARVCMQCHLLVMLLKSSPTCPNCKFI  241



>ref|XP_009614518.1| PREDICTED: uncharacterized protein LOC104107423 [Nicotiana tomentosiformis]
Length=210

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 88/201 (44%), Gaps = 32/201 (16%)
 Frame = -1

Query  780  FPELSLSLAASNFNGDNAADSDQDIRLPMKRKIQSGGGGSVDLHQPWMEPLPVDWEQCLD  601
            FP +        ++ +  A+       P K K  +   G+  LH     PLP++W++CLD
Sbjct  16   FPNIEDLSKKRKWDDELKAEDQISYEKPQKAKTMTSLFGT-QLH--LETPLPLEWQRCLD  72

Query  600  LQSGRMYYVNRKTMKKTWEWPKEQKQAQ--------LNLELNISTSGA-HSYEDRhhkkh  448
            ++SG +Y+ N +T K+T   P+     +        L+LELN+   G+    ++ +   +
Sbjct  73   IKSGHIYFYNTRTQKRTSRDPRLSTTPEPPTPVHMSLDLELNLLPCGSLEKTQNSYFIGN  132

Query  447  qhpssppSNGAGG-----------------ENMIALPCSNCHLLVIVSQTSPSCPNCKFV  319
               S    N                     + M+   C  CH+LV++S +SP+CPNCKFV
Sbjct  133  NKNSDTKKNSTEAQGLITRSPSWLTFDVDQQEMVTAVCKKCHMLVMMSTSSPTCPNCKFV  192

Query  318  QYSAAGNRSPAKPFHSGLSLF  256
                  + +P   F   LS F
Sbjct  193  N---PPDETPPTLFKRRLSSF  210



>ref|XP_009389552.1| PREDICTED: uncharacterized protein LOC103976092 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=200

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 63/116 (54%), Gaps = 16/116 (14%)
 Frame = -1

Query  633  PLPVDWEQCLDL-----QSGRMYYVNRKTMKKTWEWPK------EQKQAQLNLELNISTS  487
            PLP +W++CLDL     QSG +++ N +T ++T   P+         + +L+LELN+   
Sbjct  64   PLPSEWQRCLDLKISIVQSGAIHFYNTRTHRRTAMDPRLSSLEPPSSRPRLDLELNLEPP  123

Query  486  GAHSYEDRhhkkhqhpssppSNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCKFV  319
            G+H Y        Q         +  + M+A  C  CH+LV++S+ S SCP+CKFV
Sbjct  124  GSHLYGGEGDLVKQDAC-----NSEDDEMVATACMRCHMLVMMSKASLSCPSCKFV  174



>ref|XP_004237904.1| PREDICTED: uncharacterized protein LOC101252482 [Solanum lycopersicum]
Length=211

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 64/136 (47%), Gaps = 31/136 (23%)
 Frame = -1

Query  633  PLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPK----------EQKQAQLNLELNI----  496
            PLP++W++CLD++SG +Y+ N +T K+T   P+           Q    L+LELN+    
Sbjct  58   PLPLEWQRCLDIKSGHIYFYNTRTQKRTSSDPRLSDPEPPQPTHQVHMSLDLELNLLPSC  117

Query  495  -STSGAHSYEDRhhkkhqhpssppSN----------------GAGGENMIALPCSNCHLL  367
             S    +  +D       +      N                    + M+   C  CH+L
Sbjct  118  QSPEKTNQIDDNFVSNSSNHLMKKDNCESKGLINRSPSWLTFDVDQQEMVTAVCKKCHML  177

Query  366  VIVSQTSPSCPNCKFV  319
            V++S++SP+CPNCKFV
Sbjct  178  VMMSKSSPTCPNCKFV  193



>ref|XP_004152643.1| PREDICTED: uncharacterized protein LOC101203360 [Cucumis sativus]
 ref|XP_004162236.1| PREDICTED: uncharacterized protein LOC101231684 [Cucumis sativus]
 gb|KGN62689.1| hypothetical protein Csa_2G368900 [Cucumis sativus]
Length=208

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 42/145 (29%), Positives = 66/145 (46%), Gaps = 30/145 (21%)
 Frame = -1

Query  633  PLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPK------------------EQKQAQLNL  508
            PLP  W++CLD+QSG++++ N  T K+TW+ P+                  ++    L+L
Sbjct  55   PLPFYWQRCLDIQSGKIHFYNMTTQKRTWKDPRDKLEKDDDDDDEEDDNRYDKNDMSLDL  114

Query  507  ELNISTSGAHSYEDRhhkkhqhpssp-----------pSNGAGGENMIALPCSNCHLLVI  361
            ELN++        +    +    +               N      M+A  C  CHLLV+
Sbjct  115  ELNLTCESMEKNNNHQTVQGVRRAINDGMMFGLSENYNHNNNKKAEMVAAVCMRCHLLVM  174

Query  360  VSQTSPSCPNCKFVQYSAAGNRSPA  286
            + ++SP CPNCKF+  S     SPA
Sbjct  175  LCKSSPECPNCKFMN-SPPEQTSPA  198



>ref|XP_002513915.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48498.1| conserved hypothetical protein [Ricinus communis]
Length=216

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/156 (29%), Positives = 71/156 (46%), Gaps = 33/156 (21%)
 Frame = -1

Query  633  PLPVDWEQCLDLQSGRMYYVNRKTMKKTWE------WPKEQKQAQLNLELNISTSGAH--  478
            PLP++W+QCLD+QSG +++ N +T K+T         P       L+LEL++    +   
Sbjct  63   PLPLEWQQCLDIQSGEIHFYNTRTKKRTSRDPRRSPEPPSPGHMSLDLELHLQPCESQRK  122

Query  477  ----------------------SYEDRhhkkhqhpssppSNGAGGENMIALPCSNCHLLV  364
                                  S ED+  +               E M+A  C+ CH+LV
Sbjct  123  NNANDHSLASSIQGFGDLFMDSSKEDKSSEGTIKRCPSWIVEGDQEEMVATVCTRCHMLV  182

Query  363  IVSQTSPSCPNCKFVQYSAAGNRSPAKPFHSGLSLF  256
            ++ ++SP+CPNCKF+      ++SP K F    SL 
Sbjct  183  MLCKSSPACPNCKFMH---PPDQSPPKLFKQRFSLL  215



>ref|XP_002307383.1| hypothetical protein POPTR_0005s17030g [Populus trichocarpa]
 gb|EEE94379.1| hypothetical protein POPTR_0005s17030g [Populus trichocarpa]
Length=211

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/149 (30%), Positives = 73/149 (49%), Gaps = 37/149 (25%)
 Frame = -1

Query  660  VDLHQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQA-------QLNLEL  502
            ++LH+    PLP++W++CLD+QSG++++ N +T K+T   P++  +         L+LEL
Sbjct  53   IELHR--ETPLPLEWQRCLDIQSGQIHFYNTRTHKRTSRDPRKTPEPPSPDHHMSLDLEL  110

Query  501  NIS--------------TSGAHSYEDRhhkkhqhpssppSNGAGG--------------E  406
            N+               T        R        SS     +GG              E
Sbjct  111  NLPYDQSQRKRFANDHITKQNSGGSIRGFGDLFKDSSRDKESSGGLTRRPSWLASERDQE  170

Query  405  NMIALPCSNCHLLVIVSQTSPSCPNCKFV  319
             M+A  C+ CH+LV++ ++SP+CPNCKF+
Sbjct  171  EMVATVCTRCHMLVMLCRSSPACPNCKFM  199



>ref|XP_010269265.1| PREDICTED: uncharacterized protein LOC104605984 [Nelumbo nucifera]
Length=211

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 78/181 (43%), Gaps = 52/181 (29%)
 Frame = -1

Query  660  VDLHQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQA-------QLNLEL  502
            VD+      PLPV+W++CLD++SG++++ N +T K+T + P++  +         L+LEL
Sbjct  33   VDIELQLERPLPVEWQRCLDIKSGQIHFFNTRTQKRTSKDPRQSPERSSPSSNISLDLEL  92

Query  501  NISTSGAHSYEDRhhkkhqhpssppSNGAGG-----------------------------  409
            N++     S   R   +    S+    G G                              
Sbjct  93   NLT---CESLRSRSQSQRDDNSTKSETGDGDLPHNNSNNSIIPPSKNSGSCYGRMAPITP  149

Query  408  ----------ENMIALPCSNCHLLVIVSQTSPSCPNCKFVQYSAAGNRSPAKPFHSGLSL  259
                      + M+A  C  CH+LV++ ++SP+CPNCKF+      ++SP      G  L
Sbjct  150  PSWVSSESDEQEMVAAVCKRCHMLVMLCKSSPACPNCKFMH---PPDQSPPNLLKPGFRL  206

Query  258  F  256
             
Sbjct  207  L  207



>ref|XP_008374058.1| PREDICTED: uncharacterized protein LOC103437334 [Malus domestica]
Length=221

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 77/164 (47%), Gaps = 32/164 (20%)
 Frame = -1

Query  681  QSGGGGSVDLHQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQA------  520
            QS      D+      PLP++W++CLD+QSG++++ N +T  KT   P+   +       
Sbjct  49   QSKPNSLFDIELHLETPLPLEWQRCLDIQSGQIHFYNTRTQMKTSRDPRRSPEPPTSPAA  108

Query  519  -------QLNLELNI---------STSGAHSYEDRhhkkhqhpssppSNGA-------GG  409
                    L+LELN+         S    HS  D   + H+     P+N           
Sbjct  109  DHHHHHMSLDLELNLRSCDQSRANSDISTHSLSDLFMESHRPTKKNPNNLGFPFDHHHHQ  168

Query  408  ENMIALPCSNCHLLVIVSQTSPSCPNCKFVQYSAAGNRSPAKPF  277
            + M+A  C  CH+LV++ ++SP CPNCK++    A ++SP   F
Sbjct  169  QEMVATVCLKCHMLVMLCRSSPXCPNCKYMH---APDQSPPTLF  209



>ref|NP_001144712.1| uncharacterized protein LOC100277752 [Zea mays]
 gb|ACG42547.1| hypothetical protein [Zea mays]
 tpg|DAA43831.1| TPA: hypothetical protein ZEAMMB73_463241 [Zea mays]
Length=239

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 71/137 (52%), Gaps = 32/137 (23%)
 Frame = -1

Query  633  PLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQ------------------LNL  508
            PLP +W++CLD++SG+++Y N +T K+TW+ P+ + + +                  L+L
Sbjct  72   PLPPEWQRCLDIKSGQIHYYNTRTQKRTWKDPRGEPEYRAAAEEEEEEDSANCAPPGLDL  131

Query  507  ELNIS--TSGAHSYEDRh------------hkkhqhpssppSNGAGGENMIALPCSNCHL  370
            ELN++     A ++E +              ++     +  S+      M+A  C  CH+
Sbjct  132  ELNLTFEPRRAVAHEKKRPKPPAANKATHDRRRQPAEEAEDSSSGSSREMVAGVCMRCHM  191

Query  369  LVIVSQTSPSCPNCKFV  319
            LV++ + SP+CPNCKF+
Sbjct  192  LVMMCRASPACPNCKFL  208



>ref|XP_009344523.1| PREDICTED: uncharacterized protein LOC103936414 [Pyrus x bretschneideri]
Length=222

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 78/165 (47%), Gaps = 33/165 (20%)
 Frame = -1

Query  681  QSGGGGSVDLHQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQA------  520
            QS      D+      PLP++W++CLD+QSG++++ N +T  KT   P+   +       
Sbjct  49   QSKPNSLFDIELHLETPLPLEWQRCLDIQSGQIHFYNTRTQMKTSRDPRRSPEPPTSPAA  108

Query  519  -------QLNLELNI---------STSGAHSYEDRhhkkhqhpssppSN--------GAG  412
                    L+LELN+         S    HS  D   + H+     P+N           
Sbjct  109  DHHHHHMSLDLELNLRSCDQSRANSDISTHSLSDLFMESHRPIQKNPNNLGFPVDCHQQQ  168

Query  411  GENMIALPCSNCHLLVIVSQTSPSCPNCKFVQYSAAGNRSPAKPF  277
             + M+A  C  CH+LV++ ++SP+CPNCK++    A ++SP   F
Sbjct  169  QQEMVATVCIKCHMLVMLCRSSPACPNCKYMH---APDQSPPTLF  210



>ref|XP_004985390.1| PREDICTED: actin cytoskeleton-regulatory complex protein pan1-like 
[Setaria italica]
Length=224

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 64/131 (49%), Gaps = 26/131 (20%)
 Frame = -1

Query  633  PLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQ-------------------LN  511
            PLP +W++CLD+QSG+++Y N +T K+T + P+ ++  +                   L+
Sbjct  63   PLPPEWQRCLDIQSGQIHYYNTRTQKRTLKDPRGEQDFRAAPADDDDDEESANCAPPGLD  122

Query  510  LELNISTS-------GAHSYEDRhhkkhqhpssppSNGAGGENMIALPCSNCHLLVIVSQ  352
            LELN++ S            +             P+       M+A  C  CH+LV++ +
Sbjct  123  LELNLTFSPRRPSAPEKKKPKPASPPPAAAQRRQPAEAEDSREMVAAVCVRCHMLVMMCR  182

Query  351  TSPSCPNCKFV  319
             SP+CPNCKF+
Sbjct  183  ASPACPNCKFL  193



>ref|XP_011004807.1| PREDICTED: uncharacterized protein LOC105111206 [Populus euphratica]
Length=211

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/149 (27%), Positives = 72/149 (48%), Gaps = 37/149 (25%)
 Frame = -1

Query  660  VDLHQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQA-------QLNLEL  502
            ++LH+    PLP++W++CLD+QSG++++ N +T K+T   P++  +         L+LEL
Sbjct  53   IELHR--ETPLPLEWQRCLDIQSGQIHFYNTRTHKRTSRDPRKSPEPASPDHHMSLDLEL  110

Query  501  NISTSGAHSYEDRhhkkhqhpssppSNGAGG----------------------------E  406
            N+    +      +    +  S     G G                             +
Sbjct  111  NLPYDQSQRKRFANDHITKQNSDGSIRGLGDLFKDSSRDKETSGGLTRRPSWLASERDQQ  170

Query  405  NMIALPCSNCHLLVIVSQTSPSCPNCKFV  319
             M+A  C+ CH+LV++ ++SP+CPNCKF+
Sbjct  171  EMVATVCTKCHMLVMLCRSSPACPNCKFL  199



>ref|XP_009373153.1| PREDICTED: uncharacterized protein LOC103962200 [Pyrus x bretschneideri]
Length=226

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 72/153 (47%), Gaps = 34/153 (22%)
 Frame = -1

Query  681  QSGGGGSVDLHQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQA------  520
            QS      D+      PLP++W++CLD+QSG++++ N +T  KT   P+   +       
Sbjct  49   QSTPKSLFDIELHLETPLPLEWQRCLDIQSGQIHFYNTRTQMKTSRDPRRSPEPPTSPAA  108

Query  519  ----------QLNLELNIST----------SGAHSYEDRhhkkhqhpssppSN-------  421
                       L+LELN+ +          S  HS+ D   + H+   S P N       
Sbjct  109  DHHRRRRRPMSLDLELNLRSCDQSSANSDISSTHSFSDLFMEPHRPTKSNPINLGFHVDH  168

Query  420  -GAGGENMIALPCSNCHLLVIVSQTSPSCPNCK  325
                 + M+A  C  CH+LV++ ++SP+CPNCK
Sbjct  169  HHQQQQEMVATVCIKCHMLVMLCRSSPACPNCK  201



>ref|XP_010267953.1| PREDICTED: uncharacterized protein LOC104605047 [Nelumbo nucifera]
Length=216

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 42/152 (28%), Positives = 76/152 (50%), Gaps = 34/152 (22%)
 Frame = -1

Query  672  GGGSVDLHQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQ-------KQAQL  514
                VD+      PLPV+W++CLD++SG +++ N +T  +T + P++        +   L
Sbjct  44   SKAVVDIELQLERPLPVEWQRCLDIKSGEIHFYNTRTQMRTCKDPRQSPERSSSPRHISL  103

Query  513  NLELNIS-------------------TSG-AHSYEDRhhkkhqhpssppSNGA-------  415
            +LELN++                   T+G +H+ +D+ H+     S      +       
Sbjct  104  DLELNLTCEPVRSQGDDDNWIKPAAETNGLSHNSDDQPHQSKNCSSGVTRTPSWMSLEAD  163

Query  414  GGENMIALPCSNCHLLVIVSQTSPSCPNCKFV  319
              + M+A  C  CH+LV++ ++SP+CPNCKF+
Sbjct  164  DEQEMVAAVCKRCHMLVMLCKSSPACPNCKFM  195



>ref|XP_006472611.1| PREDICTED: uncharacterized protein LOC102608787 [Citrus sinensis]
 gb|KDO80955.1| hypothetical protein CISIN_1g027645mg [Citrus sinensis]
Length=220

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 75/161 (47%), Gaps = 38/161 (24%)
 Frame = -1

Query  633  PLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQA--------QLNLELNISTSGAH  478
            PLP++WE+CLD+QSG +++ N +T KKT   P+   +          L+LELN+      
Sbjct  62   PLPLEWERCLDIQSGEIHFYNTRTHKKTSGDPRGSPEPPNRAGDHMSLDLELNLPCDSQR  121

Query  477  SYEDRhhkkhqhpssppSNGAGGEN---------------------------MIALPCSN  379
              +  ++   +  S+ P     G++                           M+A  C  
Sbjct  122  KNQGSNNIISKPNSASPPRHHLGDHLKKKSGDHLSRCPSWLAFEGDHDDQQEMVATACMR  181

Query  378  CHLLVIVSQTSPSCPNCKFVQYSAAGNRSPAKPFHSGLSLF  256
            CH+LV++ ++SP+CPNCKF+      ++SP K F    SL 
Sbjct  182  CHMLVMLCKSSPTCPNCKFLH---PPDQSPPKLFKQTFSLL  219



>ref|XP_006433995.1| hypothetical protein CICLE_v10002416mg [Citrus clementina]
 gb|ESR47235.1| hypothetical protein CICLE_v10002416mg [Citrus clementina]
Length=220

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 75/161 (47%), Gaps = 38/161 (24%)
 Frame = -1

Query  633  PLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQA--------QLNLELNISTSGAH  478
            PLP++WE+CLD+QSG +++ N +T KKT   P+   +          L+LELN+      
Sbjct  62   PLPLEWERCLDIQSGEIHFYNTRTHKKTSGDPRGSPEPPNRAGDHMSLDLELNLPCDSQR  121

Query  477  SYEDRhhkkhqhpssppSNGAGGEN---------------------------MIALPCSN  379
              +  ++   +  S+ P     G++                           M+A  C  
Sbjct  122  KNQGSNNIISKPNSASPPRHHLGDHLKKKSGDHLSRCPSWLAFEGDHDDQQEMVATACMR  181

Query  378  CHLLVIVSQTSPSCPNCKFVQYSAAGNRSPAKPFHSGLSLF  256
            CH+LV++ ++SP+CPNCKF+      ++SP K F    SL 
Sbjct  182  CHMLVMLCKSSPTCPNCKFLH---PPDQSPPKLFKQTFSLL  219



>ref|XP_010676609.1| PREDICTED: uncharacterized protein LOC104892385 [Beta vulgaris 
subsp. vulgaris]
Length=233

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 75/177 (42%), Gaps = 46/177 (26%)
 Frame = -1

Query  717  DQDIRLPMKR------KIQSGGGGSVDLHQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMK  556
            D+++ LP K          +     ++LH     PLP +W++CLD+QSG +++ N +T K
Sbjct  40   DEEVILPYKHWKNPKATFATKTFSDIELH--LETPLPSEWQRCLDIQSGEIHFYNTRTQK  97

Query  555  KTWEWPKEQKQA--------QLNLELNIS------------------TSGAHSYEDRhhk  454
            +T   P+E  +          L+LELN+                   T+      +    
Sbjct  98   RTLRDPRESSEPSSPRDYHMSLDLELNLPCGSLNHNNYSKSTSEKNMTTMKKKSSNSPPP  157

Query  453  khqhpssppSNGAGGEN------------MIALPCSNCHLLVIVSQTSPSCPNCKFV  319
                      +  G  N            M+A  C  CH+LV++ ++SP+CPNCK+V
Sbjct  158  PASTDLLRNLSTVGKTNTIDIEATDEAAEMVATACKRCHMLVMLCKSSPTCPNCKYV  214



>ref|XP_008444823.1| PREDICTED: uncharacterized protein LOC103488058 [Cucumis melo]
Length=211

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 65/148 (44%), Gaps = 33/148 (22%)
 Frame = -1

Query  633  PLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPK---------------------EQKQAQ  517
            PLP  W++CLD+QSG++++ N  T K+TW  P+                     ++    
Sbjct  55   PLPFYWQRCLDIQSGKIHFYNMTTQKRTWRDPRDKLVDKDDDDDDEEGKDDDCYDKNDMS  114

Query  516  LNLELNISTSGAHSYEDRhhkkhqhpssppSNGAG-----------GENMIALPCSNCHL  370
            L+LELN++        +    +    +       G              M+A  C  CHL
Sbjct  115  LDLELNLTCESMDKNNNNQTVQGVRRAINNGMVFGLSENYNNNNNKKAEMVAAVCMRCHL  174

Query  369  LVIVSQTSPSCPNCKFVQYSAAGNRSPA  286
            LV++ ++SP CPNCKF+  S     SPA
Sbjct  175  LVMLCKSSPECPNCKFMN-SPPEQTSPA  201



>ref|XP_009386378.1| PREDICTED: uncharacterized protein LOC103973519 [Musa acuminata 
subsp. malaccensis]
Length=197

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 67/120 (56%), Gaps = 14/120 (12%)
 Frame = -1

Query  633  PLPVDWEQCLDLQSGRMYYVNRKTMKKTWE---------WPKEQKQAQLNLELNISTSGA  481
            PLP+DW++CLD++SG++++ N +T ++T            P    +  L+L+LN+ +  +
Sbjct  57   PLPLDWQRCLDIKSGQIHFYNTRTHRRTSRHPSKLSSEPPPPPSSRLSLDLDLNLMSPRS  116

Query  480  HSYED-----RhhkkhqhpssppSNGAGGENMIALPCSNCHLLVIVSQTSPSCPNCKFVQ  316
            H +E      +H K         S+ A    M+A  C  CH+LV++++ + SCPNCKFV 
Sbjct  117  HLHEAEAEQMKHGKARNSCMLRTSDEADPGEMVASVCMRCHMLVMMTKAALSCPNCKFVH  176



>ref|XP_011016390.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105119895 
[Populus euphratica]
Length=214

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 74/158 (47%), Gaps = 35/158 (22%)
 Frame = -1

Query  633  PLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQ----LNLELNI--STSGAHSY  472
            PLP++W++CLD+QSG++++ N +T  +      E         L LELN+    S   SY
Sbjct  59   PLPLEWQRCLDIQSGQIHFYNTRTHXRDPRRSPEPPSPDHDMSLELELNLPYDQSQRKSY  118

Query  471  ED------------RhhkkhqhpssppSNGAGG--------------ENMIALPCSNCHL  370
                          R        SS  +  +GG              + M+A  C+ CH+
Sbjct  119  THDHITKQNPGGSIRSFGDLFKESSRVNGNSGGLTRRPSWLAFEKDQQEMLATVCTKCHM  178

Query  369  LVIVSQTSPSCPNCKFVQYSAAGNRSPAKPFHSGLSLF  256
            LV++ ++SP+CPNCKF+       +SP K F   LSLF
Sbjct  179  LVMLCRSSPTCPNCKFLH---PLEQSPPKLFKQRLSLF  213



>ref|XP_006649537.1| PREDICTED: uncharacterized protein LOC102720124 [Oryza brachyantha]
Length=244

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 72/163 (44%), Gaps = 53/163 (33%)
 Frame = -1

Query  633  PLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPK-------------------EQKQAQ--  517
            PLP++W++CLD++SG+++Y N +T K+T   P+                   E++QA   
Sbjct  62   PLPLEWQRCLDIKSGQIHYYNTRTHKRTSRDPRAEEPAPAPELHHHRASPAEEEEQAANY  121

Query  516  ------LNLELNIS----------------------TSGAHSYEDRhhkkhqhpssppSN  421
                  L+LELN++                      T  A + ++          +    
Sbjct  122  CAPPPGLDLELNLTFEPRRVPVQEIKKPRRPVAETTTKLAAAVDEEKVAAPLELPA----  177

Query  420  GAGGENMIALPCSNCHLLVIVSQTSPSCPNCKFVQYSAAGNRS  292
            G     M+A  C+ CH+LV++ +  P+CPNCKFV  + A   S
Sbjct  178  GGASREMVAAVCTRCHMLVMMCREWPACPNCKFVHPTTANQSS  220



>ref|NP_001131648.1| hypothetical protein [Zea mays]
 gb|ACF80159.1| unknown [Zea mays]
 gb|AFW89407.1| hypothetical protein ZEAMMB73_902895 [Zea mays]
Length=232

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/140 (28%), Positives = 64/140 (46%), Gaps = 41/140 (29%)
 Frame = -1

Query  633  PLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQ---------------------KQAQ  517
            PLP +W++CLD++SG++YY N +T K+T + P+                           
Sbjct  75   PLPPEWQRCLDIKSGQIYYYNTRTQKRTCKDPRGHGLQSDYRAEEGQEEEEDSANCAPPG  134

Query  516  LNLELNISTSGAHSYEDRhhkkhqhpssppSNG--------------AGGENMIALPCSN  379
            L+LELN++      +E R        +   +N               +    M+A  C  
Sbjct  135  LDLELNLT------FEPRRVLAAHRKTMKRANKQPAEEEEAEDDDSSSSSREMVAGVCVR  188

Query  378  CHLLVIVSQTSPSCPNCKFV  319
            CH+LV++ + SP+CPNCKF+
Sbjct  189  CHMLVMMCRASPACPNCKFL  208



>gb|EEE51990.1| hypothetical protein OsJ_33675 [Oryza sativa Japonica Group]
Length=207

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 64/145 (44%), Gaps = 62/145 (43%)
 Frame = +2

Query  320  TNLQLGQEGEV*ETMTRRWQLEHGNAIM--------------------------FSPPAP  421
            TNLQLG  GE  ++MTRRWQL HG A +                           + PAP
Sbjct  10   TNLQLGHAGEDLQSMTRRWQLTHGTATIGPNEPTPPPPPAILASSSAMAAAPPELALPAP  69

Query  422  ---FDGGDDGCWCFL*WRSS*E*APLVEMLSSR---LS*ACFCSFGHSHVFFIVFLFT*Y  583
                DG                   +VEMLSSR   L   C  S G + +F +VFLF   
Sbjct  70   TWKVDG-------------------IVEMLSSRSRVLLPPC-SSMGLTQLFLMVFLF---  106

Query  584  ILPD*RSRHCSQSTGRGSIQGWWRS  658
                 RSRHCSQS GRGS++  WRS
Sbjct  107  -----RSRHCSQSMGRGSLR--WRS  124



>ref|XP_008219421.1| PREDICTED: uncharacterized protein LOC103319639 [Prunus mume]
Length=230

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 85/194 (44%), Gaps = 41/194 (21%)
 Frame = -1

Query  723  DSDQDIRLPMKR-KIQSGGGGSVDLHQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTW  547
            D DQ  ++  KR K Q+      D+      PLP++W++CLD+QSG++++ N +T  KT 
Sbjct  38   DHDQVEQIFEKRWKPQNTAKSLFDIELHQETPLPLEWQRCLDIQSGQIHFYNTRTHMKTS  97

Query  546  E-------WPKEQKQAQLNLELNI-----------------------STSGAHSYEDRhh  457
                     P       L+LELN+                       S    H++ D   
Sbjct  98   RDPRRSPEPPSPAPHMSLDLELNLRSCESMIRKANISDHNSENSRPNSDISLHNFHDLFM  157

Query  456  kkhqhpssppSNGAG-------GENMIALPCSNCHLLVIVSQTSPSCPNCKFVQYSAAGN  298
            +  +   S   +  G        + M+A  C  CH+LV++ ++SP+CPNCK++      +
Sbjct  158  EPSRPTKSKNPSRLGLQIDHLHHQEMVATVCMKCHMLVMLCRSSPACPNCKYMH---PPD  214

Query  297  RSPAKPFHSGLSLF  256
            ++P   F    S F
Sbjct  215  QTPPTLFKPRCSSF  228



>ref|NP_001049232.1| Os03g0191200 [Oryza sativa Japonica Group]
 gb|ABF94400.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11146.1| Os03g0191200 [Oryza sativa Japonica Group]
 gb|EAY88861.1| hypothetical protein OsI_10336 [Oryza sativa Indica Group]
 dbj|BAG91844.1| unnamed protein product [Oryza sativa Japonica Group]
Length=244

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 66/155 (43%), Gaps = 46/155 (30%)
 Frame = -1

Query  633  PLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQ---------------------  517
            PLP++W++CLD++SG+++Y N +T K+T   P+ +                         
Sbjct  64   PLPLEWQRCLDIKSGQIHYYNTRTHKRTSRDPRAEAPPAPAPESHHRRAAPAEEEEEEEA  123

Query  516  ---------LNLELNIS--------------TSGAHSYEDRhhkkhqhpssppSNGAGG-  409
                     L+LELN++               S A     +               AGG 
Sbjct  124  ANYCAPPLGLDLELNLTFEPRRVPIQEAKKHRSSAVETTTKPAAAVAAEKLALELPAGGA  183

Query  408  -ENMIALPCSNCHLLVIVSQTSPSCPNCKFVQYSA  307
               M+A  C+ CH+LV++ +  P+CPNCKFV  +A
Sbjct  184  SREMVAAVCARCHMLVMMCREWPACPNCKFVHPTA  218



>gb|EEE58473.1| hypothetical protein OsJ_09727 [Oryza sativa Japonica Group]
Length=244

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 66/155 (43%), Gaps = 46/155 (30%)
 Frame = -1

Query  633  PLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQ---------------------  517
            PLP++W++CLD++SG+++Y N +T K+T   P+ +                         
Sbjct  64   PLPLEWQRCLDIKSGQIHYYNTRTDKRTSRDPRAEAPPAPAPESHHRRAAPAEEEEEEEA  123

Query  516  ---------LNLELNIS--------------TSGAHSYEDRhhkkhqhpssppSNGAGG-  409
                     L+LELN++               S A     +               AGG 
Sbjct  124  ANYCAPPLGLDLELNLTFEPRRVPIQEAKKHRSSAVETTTKPAAAVAAEKLALELPAGGA  183

Query  408  -ENMIALPCSNCHLLVIVSQTSPSCPNCKFVQYSA  307
               M+A  C+ CH+LV++ +  P+CPNCKFV  +A
Sbjct  184  SREMVAAVCARCHMLVMMCREWPACPNCKFVHPTA  218



>ref|XP_003615100.1| WW domain containing protein expressed [Medicago truncatula]
 gb|AES98058.1| hypothetical protein MTR_5g063720 [Medicago truncatula]
Length=213

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 69/139 (50%), Gaps = 27/139 (19%)
 Frame = -1

Query  660  VDLHQPWMEPLPVD-WEQCLDLQSGRMYY----VNRKTMKKTWEWPKEQKQA----QLNL  508
            ++LH     PLP D W+Q L +QSG++      +N KT +   E+P  +K +     L+L
Sbjct  56   IELH--LKTPLPSDKWQQYLTVQSGQIQLCNTKMNMKTQESKREYPLPEKSSLGHLSLDL  113

Query  507  ELNIS----TSGAHSYEDRhhkkhqhpssppS------------NGAGGENMIALPCSNC  376
            ELN++         SY ++ +       S               NG   + MIA  C  C
Sbjct  114  ELNLTCETLKKKEESYYEKKNNLVNESISKNKKDSSSWLSSSSSNGDDYKEMIATVCMKC  173

Query  375  HLLVIVSQTSPSCPNCKFV  319
            H+LV++ ++SPSCPNCKF+
Sbjct  174  HMLVMLCKSSPSCPNCKFM  192



>ref|XP_011074180.1| PREDICTED: uncharacterized protein LOC105158955 [Sesamum indicum]
Length=191

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 62/129 (48%), Gaps = 24/129 (19%)
 Frame = -1

Query  633  PLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPK------EQKQAQLNLELN---------  499
            P P++W+Q LD++SG+M++ N KT K+    PK            L+LELN         
Sbjct  54   PSPLEWQQYLDIKSGQMFFYNTKTSKRASNDPKLSIHPYNPAPMSLDLELNPPCQSHQVV  113

Query  498  -------ISTSGAHSYEDRhhkkhqhpssppSNGAGGEN--MIALPCSNCHLLVIVSQTS  346
                    ST+  +  +D          SP      G+   M+   C  C++LV++ +++
Sbjct  114  DSNRKHGFSTTSIYHQKDHVMISSAITRSPSWLTFEGDQQEMVTAVCKKCYMLVMMCKST  173

Query  345  PSCPNCKFV  319
            P+CPNCKF+
Sbjct  174  PACPNCKFM  182



>gb|EMS46309.1| hypothetical protein TRIUR3_23859 [Triticum urartu]
Length=145

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 63/137 (46%), Gaps = 23/137 (17%)
 Frame = -1

Query  600  LQSGRMYYVNRKTMKKTWEWPKEQKQAQ--------------LNLELNISTSGAHSYEDR  463
            LQSG+++Y N +T K+T + P+    A               L+L+LN++     S   +
Sbjct  6    LQSGQIHYYNTRTHKRTSKDPRRHGGAAPAVEEDVANCGPQGLDLDLNLAFEPRRSSPVK  65

Query  462  hhkkhqhpssppSNG--------AGGENMIALPCSNCHLLVIVSQTSPSCPNCKFVQYSA  307
              +K       P+ G          G  M+A  C  CH+LV++ +  P+CPNCKF+  ++
Sbjct  66   ELQKKAEAKPAPARGDHHGDQTPGSGMEMVAAVCMRCHMLVMMCRACPACPNCKFLHPTS  125

Query  306  AGNRSPAKPFHSGLSLF  256
                 PA P   GL L 
Sbjct  126  RPTPEPA-PLKLGLQLL  141



>ref|XP_010926289.1| PREDICTED: uncharacterized protein LOC105048625 [Elaeis guineensis]
Length=211

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 71/150 (47%), Gaps = 27/150 (18%)
 Frame = -1

Query  633  PLPVDWEQ-CLDLQSGRMYYVNRKTMKKTWEWPKEQKQA-----QLNLELNISTSGAHSY  472
            PLP++W Q CLD +SG+++  + +T K++ + P+   +       L+LELN++     S+
Sbjct  61   PLPLEWRQRCLDGKSGQIHLDSIRTHKRSSKDPRGSAEPLTSCPSLDLELNLTFEPPRSH  120

Query  471  ---EDRhhkkhqhpssppSNGAGG---------------ENMIALPCSNCHLLVIVSQTS  346
               EDR  +        P + +G                  M+A  C  CH+LV++ + +
Sbjct  121  INGEDRAKQDSCGNWCNPKDNSGSMLKSLSWISLDADQPAEMVATVCMRCHMLVVMCKAT  180

Query  345  PSCPNCKFVQYSAAGNRSPAKPFHSGLSLF  256
             +CP+CKFV      NRS +     G  L 
Sbjct  181  LTCPSCKFVH---PPNRSSSTLVKPGFKLL  207



>ref|XP_008782143.1| PREDICTED: uncharacterized protein LOC103701757 [Phoenix dactylifera]
Length=208

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 71/151 (47%), Gaps = 28/151 (19%)
 Frame = -1

Query  633  PLPVDWEQCLDLQSG-RMYYVNRKTMKKTWEWPKEQKQA-----QLNLELN-ISTSGAHS  475
            P P++W++CLD+QSG ++++ N  T K+T + P+   +       L+LELN ++     S
Sbjct  57   PSPLEWQRCLDIQSGGQIHFYNTMTNKRTSKNPRGSSEPPTSCPSLDLELNNLTFEPPRS  116

Query  474  Y---EDRhhkkhqhpssppSNGAGG---------------ENMIALPCSNCHLLVIVSQT  349
            +   E+R  +          + +G                  M+A  C  CH+LV++ + 
Sbjct  117  HINGEERAKQDSCGSWCNSKDSSGRMLKSLSWFSFDADQPAEMVAAVCMRCHMLVVMCKA  176

Query  348  SPSCPNCKFVQYSAAGNRSPAKPFHSGLSLF  256
            + +CP+CKFV      NRS +     G  L 
Sbjct  177  TLTCPSCKFVH---PPNRSSSALVKPGFELL  204



>ref|XP_006387371.1| hypothetical protein POPTR_1140s00200g [Populus trichocarpa]
 gb|ERP46285.1| hypothetical protein POPTR_1140s00200g [Populus trichocarpa]
Length=115

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (67%), Gaps = 3/51 (6%)
 Frame = -1

Query  408  ENMIALPCSNCHLLVIVSQTSPSCPNCKFVQYSAAGNRSPAKPFHSGLSLF  256
            + M+A  C+ CH+LV++ ++SP+CPNCKF+       +SP K F   LSLF
Sbjct  67   QEMLATVCTKCHMLVMLCRSSPTCPNCKFLH---PLEQSPPKLFKQRLSLF  114



>ref|XP_002530166.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32221.1| conserved hypothetical protein [Ricinus communis]
Length=195

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 62/129 (48%), Gaps = 21/129 (16%)
 Frame = -1

Query  660  VDLHQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQAQLNLELNISTSGA  481
            ++L +P+  PLP+ W++ L+LQ+G +YY  + T KKT    +     +L+L+LN+S   A
Sbjct  53   IELEEPF--PLPLGWQKFLNLQTGEIYYT-KNTRKKTMSR-RNGNGPKLDLKLNLSPPRA  108

Query  480  HSYEDRhhkkhqhpsspp-----------------SNGAGGENMIALPCSNCHLLVIVSQ  352
                +  ++      + P                 SN     +M+ + C  C + V++S+
Sbjct  109  DPRVESPNRSATVSPTSPPSSCVSSELNQDDTLRYSNSPEATSMVLVGCPRCLMYVMLSE  168

Query  351  TSPSCPNCK  325
              P CP CK
Sbjct  169  DDPKCPKCK  177



>ref|XP_009381722.1| PREDICTED: uncharacterized protein LOC103969803 [Musa acuminata 
subsp. malaccensis]
Length=189

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 34/49 (69%), Gaps = 2/49 (4%)
 Frame = -1

Query  681  QSGGGGSVDLHQPWMEPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPK  535
            +S GG +V+L+      LP  WEQCLD+++G +YY+NR+T  +T E P+
Sbjct  35   ESAGGITVELNSDTA--LPYHWEQCLDMRTGEIYYINRETGVRTGEDPR  81



>ref|XP_001780311.1| predicted protein [Physcomitrella patens]
 gb|EDQ54870.1| predicted protein [Physcomitrella patens]
Length=932

 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  636  EPLPVDWEQCLDLQSGRMYYVNRKTMKKTWEWPKEQKQ  523
            +PLP DWE+CLDL++G +Y+VN+ T  +T E P++ +Q
Sbjct  611  QPLPADWEKCLDLKTGELYFVNKSTGVRTSEDPRKVQQ  648



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1844883144792