BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80267_g1_i1 len=959 path=[1:0-958]

Length=959
                                                                      Score     E

ref|XP_006352525.1|  PREDICTED: ethylene-responsive transcription...    172   6e-48   
ref|XP_006346195.1|  PREDICTED: ethylene-responsive transcription...    172   7e-48   
gb|AEM63545.1|  ethylene response factor ERF4                           169   3e-47   
ref|NP_001239044.1|  ethylene responsive factor                         166   2e-45   
ref|XP_004248374.1|  PREDICTED: ethylene-responsive transcription...    154   3e-41   
ref|XP_009770784.1|  PREDICTED: ethylene-responsive transcription...    154   4e-41   
ref|XP_009614946.1|  PREDICTED: ethylene-responsive transcription...    148   4e-39   
gb|ADP37423.1|  ethylene-responsive-element-binding factor 8            143   5e-37   
gb|AET99099.1|  ethylene response factor 2                              133   1e-33   
ref|XP_009780689.1|  PREDICTED: ethylene-responsive transcription...    126   7e-31   
ref|XP_004513889.1|  PREDICTED: ethylene-responsive transcription...    122   2e-29   
dbj|BAL68169.1|  ethylene response factor #205                          121   9e-29   
ref|XP_009598342.1|  PREDICTED: ethylene-responsive transcription...    120   9e-29   
ref|XP_011095450.1|  PREDICTED: ethylene-responsive transcription...    120   2e-28   
gb|AFH56414.1|  ethylene response factor 7                              116   3e-27   
gb|KEH33908.1|  ethylene response factor                                115   1e-26   
ref|XP_003551866.1|  PREDICTED: ethylene-responsive transcription...    114   2e-26   
ref|XP_002531192.1|  Ethylene-responsive transcription factor, pu...    114   2e-26   Ricinus communis
gb|EYU27372.1|  hypothetical protein MIMGU_mgv1a013229mg                114   3e-26   
ref|XP_011097839.1|  PREDICTED: ethylene-responsive transcription...    113   5e-26   
emb|CDP13789.1|  unnamed protein product                                114   5e-26   
gb|AIC83902.1|  C-repeat binding transcription factor 2                 113   8e-26   
gb|KDP39186.1|  hypothetical protein JCGZ_00943                         112   1e-25   
ref|XP_007020716.1|  Ethylene responsive element binding factor 3...    111   3e-25   
gb|ADJ67438.1|  ethylene response factor 9                              109   9e-25   
gb|AAV85852.1|  AT-rich element binding factor 2                        109   9e-25   Pisum sativum [garden pea]
gb|EYU33670.1|  hypothetical protein MIMGU_mgv1a013001mg                109   1e-24   
gb|AAV54034.1|  ethylene-responsive element binding protein 6           109   2e-24   Nicotiana tabacum [American tobacco]
ref|XP_003532144.1|  PREDICTED: ethylene-responsive transcription...    106   1e-23   
gb|KDO62117.1|  hypothetical protein CISIN_1g045783mg                   107   1e-23   
ref|XP_006452450.1|  hypothetical protein CICLE_v10009361mg             107   1e-23   
ref|XP_010479528.1|  PREDICTED: ethylene-responsive transcription...    106   2e-23   
gb|ACD87818.1|  putative ethylene responsive factor                     105   3e-23   Vicia faba [broad bean]
gb|ADE41098.1|  AP2 domain class transcription factor                   105   3e-23   
ref|XP_008385842.1|  PREDICTED: ethylene-responsive transcription...    105   3e-23   
ref|XP_008385843.1|  PREDICTED: ethylene-responsive transcription...    105   3e-23   
gb|ACM49845.1|  ethylene responsive transcription factor 3a             105   4e-23   Prunus salicina [Japanese plum]
ref|XP_009348308.1|  PREDICTED: ethylene-responsive transcription...    105   4e-23   
ref|XP_008226996.1|  PREDICTED: ethylene-responsive transcription...    105   4e-23   
ref|XP_007146520.1|  hypothetical protein PHAVU_006G047800g             104   4e-23   
ref|XP_010500641.1|  PREDICTED: ethylene-responsive transcription...    105   5e-23   
ref|XP_009334154.1|  PREDICTED: ethylene-responsive transcription...    103   1e-22   
gb|EPS68575.1|  ethylene-responsive-element-binding factor 8            103   3e-22   
ref|XP_002278022.1|  PREDICTED: ethylene-responsive transcription...    102   3e-22   Vitis vinifera
ref|XP_010252581.1|  PREDICTED: ethylene-responsive transcription...    102   4e-22   
ref|XP_007142329.1|  hypothetical protein PHAVU_008G271100g             101   1e-21   
gb|ACU20659.1|  unknown                                                 100   1e-21   Glycine max [soybeans]
ref|XP_007211978.1|  hypothetical protein PRUPE_ppa010893mg             100   2e-21   
ref|XP_010461919.1|  PREDICTED: ethylene-responsive transcription...    100   2e-21   
ref|XP_009361043.1|  PREDICTED: ethylene-responsive transcription...    100   3e-21   
ref|XP_003519443.1|  PREDICTED: ethylene-responsive transcription...    100   3e-21   
ref|XP_008364528.1|  PREDICTED: ethylene-responsive transcription...    100   3e-21   
ref|XP_006304201.1|  hypothetical protein CARUB_v10010284mg           99.8    4e-21   
ref|XP_010545496.1|  PREDICTED: ethylene-responsive transcription...  99.8    5e-21   
gb|AHA82411.1|  ERF transcription factor                              99.0    5e-21   
ref|XP_008345035.1|  PREDICTED: ethylene-responsive transcription...  99.4    6e-21   
gb|ADE41145.1|  AP2 domain class transcription factor                 99.4    6e-21   
gb|AIL90391.1|  ethylene responsive element binding factor            98.6    9e-21   
gb|AFH56413.1|  ethylene response factor 6                            99.0    9e-21   
ref|XP_011046715.1|  PREDICTED: ethylene-responsive transcription...  97.4    3e-20   
emb|CDY36045.1|  BnaC03g41530D                                        96.7    4e-20   
ref|XP_007141662.1|  hypothetical protein PHAVU_008G214700g           95.9    5e-20   
gb|AFR11378.1|  ERF3                                                  95.9    7e-20   
emb|CED89883.1|  ethylene-responsive transcription factor 7           95.9    7e-20   
ref|XP_004167752.1|  PREDICTED: ethylene-responsive transcription...  95.5    9e-20   
ref|XP_002298817.1|  Ethylene responsive element binding factor 3...  95.5    1e-19   Populus trichocarpa [western balsam poplar]
ref|XP_002894264.1|  ATERF3/ERF3                                      95.5    1e-19   
emb|CBI26688.3|  unnamed protein product                              95.9    1e-19   
ref|XP_004143195.1|  PREDICTED: ethylene-responsive transcription...  95.5    1e-19   
ref|XP_008449140.1|  PREDICTED: ethylene-responsive transcription...  95.9    2e-19   
ref|XP_004149347.1|  PREDICTED: ethylene-responsive transcription...  95.9    2e-19   
ref|XP_010270056.1|  PREDICTED: ethylene-responsive transcription...  94.4    3e-19   
gb|KDP39187.1|  hypothetical protein JCGZ_00944                       93.2    7e-19   
ref|XP_002275892.1|  PREDICTED: ethylene-responsive transcription...  91.7    2e-18   Vitis vinifera
ref|XP_010096105.1|  Ethylene-responsive transcription factor 3       92.0    2e-18   
ref|XP_004491090.1|  PREDICTED: ethylene-responsive transcription...  90.9    3e-18   
ref|XP_010542116.1|  PREDICTED: ethylene-responsive transcription...  89.7    9e-18   
ref|XP_004294432.1|  PREDICTED: ethylene-responsive transcription...  89.4    1e-17   
gb|AGE97358.1|  ethylene response factor 3                            89.7    1e-17   
emb|CDY37113.1|  BnaC06g03860D                                        87.4    6e-17   
gb|EPS59785.1|  ethylene-responsive transcription factor 3            85.5    1e-16   
ref|NP_175479.1|  ethylene-responsive transcription factor 3          86.7    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010557690.1|  PREDICTED: ethylene-responsive transcription...  84.3    8e-16   
gb|KFK35918.1|  hypothetical protein AALP_AA4G053400                  83.2    1e-15   
ref|XP_006447664.1|  hypothetical protein CICLE_v10016668mg           83.2    2e-15   
ref|XP_003544774.1|  PREDICTED: ethylene-responsive transcription...  82.8    2e-15   
ref|XP_006406399.1|  hypothetical protein EUTSA_v10021393mg           83.2    2e-15   
ref|XP_009145644.1|  PREDICTED: ethylene-responsive transcription...  82.0    5e-15   
emb|CDX82253.1|  BnaA03g35680D                                        80.9    1e-14   
ref|XP_008362296.1|  PREDICTED: ethylene-responsive transcription...  80.9    1e-14   
gb|KDO59560.1|  hypothetical protein CISIN_1g027990mg                 80.1    2e-14   
ref|XP_002885365.1|  hypothetical protein ARALYDRAFT_479554           79.7    4e-14   
emb|CDY25410.1|  BnaA05g18740D                                        82.0    6e-14   
ref|XP_010943238.1|  PREDICTED: ethylene-responsive transcription...  79.0    7e-14   
ref|XP_006393127.1|  hypothetical protein EUTSA_v10011689mg           80.1    7e-14   
ref|XP_003519594.1|  PREDICTED: ethylene-responsive transcription...  78.6    8e-14   
emb|CDY29818.1|  BnaC05g31720D                                        81.3    1e-13   
ref|XP_009135680.1|  PREDICTED: ethylene-responsive transcription...  77.8    2e-13   
gb|AAZ83347.1|  ethylene-responsive element-binding factor            77.4    2e-13   Gossypium hirsutum [American cotton]
ref|XP_010060282.1|  PREDICTED: ethylene-responsive transcription...  77.4    2e-13   
ref|XP_008449487.1|  PREDICTED: ethylene-responsive transcription...  76.6    4e-13   
ref|XP_004140127.1|  PREDICTED: ethylene-responsive transcription...  76.6    4e-13   
ref|XP_004304075.1|  PREDICTED: ethylene-responsive transcription...  76.3    6e-13   
gb|AEX25891.1|  ERF transcription factor 5                            75.9    6e-13   
ref|XP_003545604.1|  PREDICTED: ethylene-responsive transcription...  75.9    6e-13   
ref|XP_008801873.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...  75.9    9e-13   
ref|XP_009111164.1|  PREDICTED: ethylene-responsive transcription...  75.5    1e-12   
ref|XP_010675777.1|  PREDICTED: ethylene-responsive transcription...  75.5    1e-12   
ref|XP_009395279.1|  PREDICTED: ethylene-responsive transcription...  74.3    2e-12   
gb|KHN38250.1|  Ethylene-responsive transcription factor 3            74.7    2e-12   
gb|ACU20209.1|  unknown                                               73.9    2e-12   Glycine max [soybeans]
gb|KFK39353.1|  hypothetical protein AALP_AA3G233300                  74.7    3e-12   
gb|AHA93908.1|  ethylene response factor 9                            72.4    4e-12   
ref|NP_188666.1|  ethylene-responsive transcription factor 7          73.9    5e-12   Arabidopsis thaliana [mouse-ear cress]
gb|KCW66915.1|  hypothetical protein EUGRSUZ_F00659                   73.6    6e-12   
ref|XP_010046158.1|  PREDICTED: ethylene-responsive transcription...  73.2    7e-12   
ref|XP_009630856.1|  PREDICTED: ethylene-responsive transcription...  72.8    7e-12   
ref|XP_006298403.1|  hypothetical protein CARUB_v10014475mg           73.2    1e-11   
ref|XP_007215910.1|  hypothetical protein PRUPE_ppa010804mg           72.8    1e-11   
gb|ACM49844.1|  ethylene responsive transcription factor 3b           71.6    3e-11   Prunus salicina [Japanese plum]
gb|KCW66914.1|  hypothetical protein EUGRSUZ_F00659                   71.6    3e-11   
ref|XP_003616861.1|  Ethylene responsive transcription factor         72.0    4e-11   
ref|NP_001149587.1|  ethylene-responsive transcription factor 3       68.9    2e-10   Zea mays [maize]
ref|XP_008229812.1|  PREDICTED: ethylene-responsive transcription...  68.9    3e-10   
ref|XP_010488002.1|  PREDICTED: ethylene-responsive transcription...  68.6    5e-10   
ref|XP_009395503.1|  PREDICTED: ethylene-responsive transcription...  65.1    4e-09   
gb|AHL44126.1|  EREB1                                                 64.3    7e-09   
ref|XP_009402848.1|  PREDICTED: ethylene-responsive transcription...  63.5    1e-08   
ref|XP_006842613.1|  hypothetical protein AMTR_s00077p00176570        63.9    1e-08   
gb|ABB51576.1|  putative ethylene responsive element binding factor   62.0    2e-08   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_010466214.1|  PREDICTED: ethylene-responsive transcription...  63.5    3e-08   
ref|XP_008383896.1|  PREDICTED: ethylene-responsive transcription...  61.6    3e-08   
ref|XP_008803496.1|  PREDICTED: ethylene-responsive transcription...  62.8    4e-08   
gb|ABU88496.1|  putative ethylene responsive element binding factor   61.2    5e-08   Prunus domestica
ref|XP_002865377.1|  hypothetical protein ARALYDRAFT_494572           62.0    5e-08   
ref|XP_008225132.1|  PREDICTED: ethylene-responsive transcription...  61.6    5e-08   
ref|XP_007212159.1|  hypothetical protein PRUPE_ppa012385mg           61.6    5e-08   
ref|XP_009352875.1|  PREDICTED: ethylene-responsive transcription...  61.2    6e-08   
ref|XP_008358678.1|  PREDICTED: ethylene-responsive transcription...  61.2    6e-08   
ref|XP_008371401.1|  PREDICTED: ethylene-responsive transcription...  61.2    6e-08   
ref|XP_009342721.1|  PREDICTED: ethylene-responsive transcription...  60.8    8e-08   
ref|XP_004307758.1|  PREDICTED: ethylene-responsive transcription...  60.8    8e-08   
ref|XP_001772402.1|  predicted protein                                59.3    8e-08   
ref|XP_006449387.1|  hypothetical protein CICLE_v10016982mg           60.8    8e-08   
ref|XP_009147819.1|  PREDICTED: ethylene-responsive transcription...  61.2    9e-08   
ref|XP_010928245.1|  PREDICTED: ethylene-responsive transcription...  61.2    1e-07   
ref|XP_010111191.1|  Ethylene-responsive transcription factor 12      60.8    1e-07   
dbj|BAJ90918.1|  predicted protein                                    60.8    1e-07   
ref|XP_009394455.1|  PREDICTED: ethylene-responsive transcription...  60.1    1e-07   
ref|XP_010441914.1|  PREDICTED: ethylene-responsive transcription...  60.5    1e-07   
ref|XP_009418395.1|  PREDICTED: ethylene-responsive transcription...  59.3    2e-07   
ref|XP_010272367.1|  PREDICTED: ethylene-responsive transcription...  59.7    2e-07   
gb|KDP20998.1|  hypothetical protein JCGZ_21469                       59.3    2e-07   
ref|XP_002279760.1|  PREDICTED: ethylene-responsive transcription...  59.3    2e-07   Vitis vinifera
ref|XP_007025561.1|  ERF domain protein 12                            59.3    3e-07   
gb|ADJ67437.1|  ethylene response factor 8                            58.9    3e-07   
ref|XP_011096343.1|  PREDICTED: ethylene-responsive transcription...  58.9    3e-07   
ref|XP_011043423.1|  PREDICTED: ethylene-responsive transcription...  58.9    4e-07   
gb|EYU28000.1|  hypothetical protein MIMGU_mgv1a015643mg              58.5    4e-07   
ref|NP_199234.1|  ethylene-responsive transcription factor 9          59.3    4e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009780882.1|  PREDICTED: ethylene-responsive transcription...  59.3    4e-07   
ref|XP_010928407.1|  PREDICTED: ethylene-responsive transcription...  59.7    4e-07   
gb|ADM77618.1|  ethylene-responsive element binding factor-like p...  59.3    4e-07   
gb|ADM77614.1|  ethylene-responsive element binding factor-like p...  59.3    4e-07   
gb|ABK21906.1|  unknown                                               59.3    4e-07   Picea sitchensis
gb|ADM77615.1|  ethylene-responsive element binding factor-like p...  59.3    4e-07   
ref|XP_010494425.1|  PREDICTED: ethylene-responsive transcription...  58.9    4e-07   
gb|ADM77645.1|  ethylene-responsive element binding factor-like p...  59.3    5e-07   
gb|AGS80331.1|  ethylene response factor                              58.5    5e-07   
ref|XP_011082648.1|  PREDICTED: ethylene-responsive transcription...  58.2    5e-07   
emb|CDY22810.1|  BnaA06g02670D                                        58.9    6e-07   
ref|XP_002977127.1|  hypothetical protein SELMODRAFT_443461           61.2    6e-07   
ref|XP_009593007.1|  PREDICTED: ethylene-responsive transcription...  58.2    6e-07   
ref|XP_006281207.1|  hypothetical protein CARUB_v10027246mg           57.8    8e-07   
ref|XP_011027787.1|  PREDICTED: ethylene-responsive transcription...  57.8    9e-07   
ref|XP_002305780.1|  ERF domain protein 12                            57.8    9e-07   Populus trichocarpa [western balsam poplar]
dbj|BAJ91227.1|  predicted protein                                    58.2    9e-07   
ref|XP_007199249.1|  hypothetical protein PRUPE_ppa022435mg           57.8    1e-06   
ref|XP_008778306.1|  PREDICTED: ethylene-responsive transcription...  58.2    1e-06   
ref|XP_008235314.1|  PREDICTED: ethylene-responsive transcription...  57.8    1e-06   
gb|AHA93909.1|  ethylene response factor 4                            57.4    1e-06   
ref|XP_007148135.1|  hypothetical protein PHAVU_006G183200g           57.4    1e-06   
emb|CDO99509.1|  unnamed protein product                              57.0    1e-06   
ref|XP_002509444.1|  Ethylene-responsive transcription factor, pu...  57.4    1e-06   Ricinus communis
ref|XP_008802835.1|  PREDICTED: ethylene-responsive transcription...  57.8    1e-06   
ref|XP_004295554.1|  PREDICTED: ethylene-responsive transcription...  57.4    1e-06   
ref|XP_003593626.1|  Ethylene responsive transcription factor         57.4    1e-06   
ref|XP_006377396.1|  ERF domain protein 12                            57.0    2e-06   
ref|XP_009392111.1|  PREDICTED: ethylene-responsive transcription...  57.8    2e-06   
ref|XP_010278126.1|  PREDICTED: ethylene-responsive transcription...  57.0    2e-06   
ref|XP_010110221.1|  Ethylene-responsive transcription factor 3       57.8    2e-06   
ref|XP_010932878.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...  57.4    2e-06   
ref|XP_009614490.1|  PREDICTED: ethylene-responsive transcription...  58.5    2e-06   
ref|XP_003543033.1|  PREDICTED: ethylene-responsive transcription...  56.6    2e-06   
gb|AHI87860.1|  MYB5                                                  57.0    2e-06   
emb|CDP03705.1|  unnamed protein product                              57.0    2e-06   
gb|AFK48691.1|  unknown                                               56.6    2e-06   
ref|XP_008442801.1|  PREDICTED: ethylene-responsive transcription...  56.6    2e-06   
ref|XP_004485812.1|  PREDICTED: ethylene-responsive transcription...  56.6    2e-06   
ref|XP_010906034.1|  PREDICTED: ethylene-responsive transcription...  57.0    2e-06   
ref|XP_002456480.1|  hypothetical protein SORBIDRAFT_03g037085        55.5    2e-06   Sorghum bicolor [broomcorn]
ref|XP_009339319.1|  PREDICTED: ethylene-responsive transcription...  56.6    2e-06   
ref|XP_010260298.1|  PREDICTED: ethylene-responsive transcription...  56.2    2e-06   
ref|XP_004146616.1|  PREDICTED: ethylene-responsive transcription...  56.2    3e-06   
ref|XP_008643722.1|  PREDICTED: ethylene-responsive transcription...  57.0    3e-06   
ref|XP_003545996.1|  PREDICTED: ethylene-responsive transcription...  56.2    3e-06   
emb|CBI28872.3|  unnamed protein product                              54.7    3e-06   
ref|XP_004493753.1|  PREDICTED: ethylene-responsive transcription...  55.8    3e-06   
dbj|BAJ72664.1|  ethylene response factor 3                           57.0    3e-06   
ref|XP_009340673.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...  56.2    3e-06   
dbj|BAL68167.1|  ethylene response factor #116                        55.8    3e-06   
ref|XP_008788768.1|  PREDICTED: ethylene-responsive transcription...  57.0    3e-06   
ref|XP_009123936.1|  PREDICTED: ethylene-responsive transcription...  56.2    3e-06   
emb|CDX96955.1|  BnaC02g30930D                                        56.2    4e-06   
gb|ADE41150.1|  AP2 domain class transcription factor                 57.0    4e-06   
gb|AIL90392.1|  ethylene responsive element binding factor            56.2    4e-06   
emb|CDY14914.1|  BnaA02g22560D                                        56.2    4e-06   
ref|XP_004951621.1|  PREDICTED: ethylene-responsive transcription...  56.2    4e-06   
ref|XP_007211989.1|  hypothetical protein PRUPE_ppa010982mg           57.0    4e-06   
ref|XP_003616864.1|  Ethylene responsive transcription factor 3a      57.4    4e-06   
tpg|DAA57264.1|  TPA: putative AP2/EREBP transcription factor sup...  55.8    4e-06   
ref|XP_009356864.1|  PREDICTED: ethylene-responsive transcription...  55.5    4e-06   
ref|XP_002890772.1|  ATERF12/ERF12                                    55.8    5e-06   
emb|CDX94610.1|  BnaC07g10480D                                        55.5    5e-06   
ref|XP_004970252.1|  PREDICTED: ethylene-responsive transcription...  55.8    5e-06   
ref|XP_006367798.1|  PREDICTED: ethylene-responsive transcription...  56.6    5e-06   
ref|XP_009397201.1|  PREDICTED: ethylene-responsive transcription...  55.5    5e-06   
ref|XP_003567200.2|  PREDICTED: ethylene-responsive transcription...  55.5    5e-06   
gb|KFK44706.1|  hypothetical protein AALP_AA1G292500                  55.8    5e-06   
ref|XP_001770627.1|  predicted protein                                57.4    5e-06   
dbj|BAJ72663.1|  ethylene response factor 3b                          56.2    5e-06   
ref|XP_010478205.1|  PREDICTED: ethylene-responsive transcription...  55.8    6e-06   
ref|XP_009772525.1|  PREDICTED: ethylene-responsive transcription...  56.2    6e-06   
ref|XP_002992124.1|  hypothetical protein SELMODRAFT_430375           58.2    6e-06   
ref|XP_010499360.1|  PREDICTED: ethylene-responsive transcription...  55.5    6e-06   
emb|CDM84527.1|  unnamed protein product                              55.1    7e-06   
emb|CDY30806.1|  BnaC05g21820D                                        55.5    7e-06   
ref|NP_174158.1|  ethylene-responsive transcription factor 12         55.5    7e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306124.1|  hypothetical protein CARUB_v10011585mg           55.5    7e-06   
gb|KDP20136.1|  hypothetical protein JCGZ_05905                       55.8    7e-06   
ref|XP_009788087.1|  PREDICTED: ethylene-responsive transcription...  55.1    7e-06   
ref|XP_009618026.1|  PREDICTED: ethylene-responsive transcription...  55.1    7e-06   
ref|XP_006415666.1|  hypothetical protein EUTSA_v10009947mg           55.5    8e-06   
emb|CDY15674.1|  BnaA07g08450D                                        55.1    8e-06   
ref|XP_008674936.1|  PREDICTED: ethylene-responsive transcription...  56.6    8e-06   
ref|XP_004291503.1|  PREDICTED: ethylene-responsive transcription...  56.2    8e-06   
ref|XP_009102914.1|  PREDICTED: ethylene-responsive transcription...  55.1    8e-06   
ref|XP_009788813.1|  PREDICTED: ethylene-responsive transcription...  55.1    9e-06   
gb|AFW90611.1|  ethylene-responsive element binding protein           55.8    9e-06   
ref|XP_008349999.1|  PREDICTED: ethylene-responsive transcription...  55.8    1e-05   
ref|XP_007162505.1|  hypothetical protein PHAVU_001G157600g           54.3    1e-05   
gb|ADE76173.1|  unknown                                               54.7    1e-05   
ref|XP_010460624.1|  PREDICTED: ethylene-responsive transcription...  55.1    1e-05   
gb|ADE41136.1|  AP2 domain class transcription factor                 56.2    1e-05   
gb|ADP37422.1|  ethylene-responsive-element-binding factor 7          55.1    1e-05   
gb|ADM76329.1|  ethylene-responsive element binding factor-like p...  54.3    1e-05   
emb|CDY34107.1|  BnaA09g27330D                                        54.7    1e-05   
ref|XP_009396099.1|  PREDICTED: ethylene-responsive transcription...  55.1    1e-05   
ref|XP_009113670.1|  PREDICTED: ethylene-responsive transcription...  54.3    1e-05   
ref|XP_008226493.1|  PREDICTED: ethylene-responsive transcription...  55.1    1e-05   
gb|AFH56412.1|  ethylene response factor 5                            55.1    1e-05   
ref|XP_008363615.1|  PREDICTED: ethylene-responsive transcription...  55.1    1e-05   
ref|XP_004243371.1|  PREDICTED: ethylene-responsive transcription...  55.1    1e-05   
ref|XP_009109734.1|  PREDICTED: ethylene-responsive transcription...  54.3    1e-05   
emb|CDY35734.1|  BnaC03g58550D                                        54.3    1e-05   
gb|ABK21902.1|  unknown                                               55.1    1e-05   Picea sitchensis
gb|ADE41103.1|  AP2 domain class transcription factor                 55.1    1e-05   
gb|AFK35885.1|  unknown                                               54.7    1e-05   
ref|XP_003593630.1|  Ethylene-responsive transcription factor         54.7    1e-05   
gb|AAF16760.1|AC010155_13  F3M18.21                                   55.8    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009400503.1|  PREDICTED: ethylene-responsive transcription...  53.9    2e-05   
gb|AFG58594.1|  hypothetical protein 2_1437_01                        53.5    2e-05   
ref|XP_009393257.1|  PREDICTED: ethylene-responsive transcription...  54.7    2e-05   
ref|XP_010100082.1|  Ethylene-responsive transcription factor 3       54.7    2e-05   
gb|AHB18381.1|  ethylene-responsive transcription factor              55.1    2e-05   
gb|ADM76331.1|  ethylene-responsive element binding factor-like p...  53.9    2e-05   
gb|AFG58586.1|  hypothetical protein 2_1437_01                        53.5    2e-05   
ref|XP_010057374.1|  PREDICTED: ethylene-responsive transcription...  55.1    2e-05   
ref|XP_008657150.1|  PREDICTED: ethylene-responsive transcription...  53.9    2e-05   
ref|XP_008778008.1|  PREDICTED: ethylene-responsive transcription...  53.9    2e-05   
gb|AFG58587.1|  hypothetical protein 2_1437_01                        53.5    2e-05   
ref|XP_004232911.1|  PREDICTED: ethylene-responsive transcription...  53.5    2e-05   
gb|AEW08150.1|  hypothetical protein 2_1437_01                        53.1    2e-05   
ref|XP_010686418.1|  PREDICTED: ethylene-responsive transcription...  53.5    2e-05   
ref|XP_009345519.1|  PREDICTED: uncharacterized protein LOC103937...  55.5    2e-05   
ref|XP_009345518.1|  PREDICTED: TMV resistance protein N-like iso...  55.5    2e-05   
ref|XP_009413291.1|  PREDICTED: ethylene-responsive transcription...  54.3    2e-05   
gb|AFG53974.1|  hypothetical protein 2_6360_01                        53.1    2e-05   
ref|XP_009627746.1|  PREDICTED: ethylene-responsive transcription...  55.8    2e-05   
ref|XP_008789748.1|  PREDICTED: ethylene-responsive transcription...  53.5    2e-05   
gb|ABU53677.1|  ethylene-responsive element binding protein           54.3    2e-05   
ref|XP_006347004.1|  PREDICTED: ethylene-responsive transcription...  53.5    2e-05   
gb|AFG53966.1|  hypothetical protein 2_6360_01                        53.1    2e-05   
gb|AFI98120.1|  ethylene-responsive element-binding protein 4         53.5    2e-05   
gb|AIW08302.1|  ethylene-responsive element binding factor            54.3    2e-05   
ref|XP_002987951.1|  hypothetical protein SELMODRAFT_49950            51.6    3e-05   
gb|AIW08208.1|  ethylene-responsive element binding factor            53.9    3e-05   
gb|AIW08207.1|  ethylene-responsive element binding factor            53.9    3e-05   
gb|AEW08321.1|  hypothetical protein 2_6360_01                        53.1    3e-05   
ref|XP_010928920.1|  PREDICTED: ethylene-responsive transcription...  53.5    3e-05   
ref|XP_002973557.1|  hypothetical protein SELMODRAFT_72880            51.6    3e-05   
gb|AFG53969.1|  hypothetical protein 2_6360_01                        53.1    3e-05   
gb|AFX83939.1|  AP2/ERF super family protein                          53.9    3e-05   
ref|XP_001768766.1|  predicted protein                                51.6    3e-05   
ref|XP_008378510.1|  PREDICTED: uncharacterized protein LOC103441606  55.5    3e-05   
ref|XP_001767185.1|  predicted protein                                51.6    3e-05   
ref|XP_011028745.1|  PREDICTED: ethylene-responsive transcription...  53.1    3e-05   
ref|XP_007025558.1|  Erf domain protein 9, putative                   54.3    3e-05   
ref|XP_002300797.1|  hypothetical protein POPTR_0002s04430g           53.1    3e-05   
ref|XP_009609806.1|  PREDICTED: ethylene-responsive transcription...  53.9    3e-05   
gb|ADP37417.1|  ethylene-responsive-element-binding factor 2          55.1    3e-05   
sp|Q40477.1|ERF4_TOBAC  RecName: Full=Ethylene-responsive transcr...  53.9    3e-05   
gb|AEW08322.1|  hypothetical protein 2_6360_01                        52.8    4e-05   
ref|XP_001770354.1|  predicted protein                                51.6    4e-05   
ref|XP_007043656.1|  Erf domain protein 9, putative                   53.5    4e-05   
ref|XP_010908748.1|  PREDICTED: ethylene-responsive transcription...  52.8    4e-05   
ref|XP_010052290.1|  PREDICTED: ethylene-responsive transcription...  53.1    4e-05   
ref|XP_003527423.1|  PREDICTED: ethylene-responsive transcription...  53.1    5e-05   
ref|XP_002307631.1|  hypothetical protein POPTR_0005s24110g           52.8    5e-05   
gb|AFN02502.1|  salinity inducible transcription factor ERF4          53.1    5e-05   
ref|NP_001236636.1|  uncharacterized protein LOC100500601             53.1    5e-05   
ref|XP_002517871.1|  Ethylene-responsive transcription factor, pu...  53.1    5e-05   
ref|XP_008787571.1|  PREDICTED: ethylene-responsive transcription...  53.1    5e-05   
ref|XP_009415607.1|  PREDICTED: ethylene-responsive transcription...  53.5    5e-05   
ref|XP_004136839.1|  PREDICTED: ethylene-responsive transcription...  53.1    5e-05   
gb|KFK31657.1|  hypothetical protein AALP_AA6G141700                  52.8    6e-05   
gb|EMT05217.1|  Ethylene-responsive transcription factor 4            55.1    6e-05   
ref|NP_001267525.1|  ethylene-responsive transcription factor 4-like  53.5    6e-05   
ref|XP_006838844.1|  hypothetical protein AMTR_s00002p00264660        52.8    6e-05   
ref|XP_002453442.1|  hypothetical protein SORBIDRAFT_04g006080        53.1    6e-05   
gb|AEV40965.1|  AP2 domain-containing protein                         52.8    6e-05   
ref|XP_009413363.1|  PREDICTED: ethylene-responsive transcription...  52.4    6e-05   
gb|KEH38683.1|  AP2 domain class transcription factor                 52.8    7e-05   
ref|XP_007149489.1|  hypothetical protein PHAVU_005G074700g           52.4    7e-05   
gb|ACS35626.1|  ethylene signal transcription factor                  53.9    8e-05   
ref|XP_009618542.1|  PREDICTED: ethylene-responsive transcription...  53.1    8e-05   
gb|AGE97356.1|  ethylene response factor 1                            53.9    8e-05   
ref|XP_009389584.1|  PREDICTED: ethylene-responsive transcription...  53.9    8e-05   
ref|XP_004485813.1|  PREDICTED: ethylene-responsive transcription...  52.8    8e-05   
ref|XP_006298478.1|  hypothetical protein CARUB_v10014552mg           52.8    9e-05   
gb|AAX20034.1|  ethylene responsive element binding protein C1        52.4    9e-05   
ref|XP_010487341.1|  PREDICTED: ethylene-responsive transcription...  52.8    9e-05   
ref|NP_188139.1|  ethylene-responsive transcription factor 4          52.8    9e-05   
gb|AAC49771.1|  AP2 domain containing protein RAP2.5                  52.4    1e-04   
ref|XP_002975585.1|  hypothetical protein SELMODRAFT_73144            50.1    1e-04   
ref|XP_010273830.1|  PREDICTED: ethylene-responsive transcription...  53.5    1e-04   
ref|XP_009352873.1|  PREDICTED: ethylene-responsive transcription...  52.8    1e-04   
gb|AAR84424.1|  ethylene-responsive element binding factor            52.4    1e-04   
ref|XP_009769304.1|  PREDICTED: ethylene-responsive transcription...  53.1    1e-04   
ref|XP_008382937.1|  PREDICTED: ethylene-responsive transcription...  52.0    1e-04   
ref|XP_006305665.1|  hypothetical protein CARUB_v10010374mg           52.0    1e-04   
ref|NP_001054201.1|  Os04g0669200                                     52.0    1e-04   
gb|KFK38866.1|  hypothetical protein AALP_AA3G170600                  52.4    1e-04   
gb|AFG53385.1|  hypothetical protein 0_6931_01                        51.2    1e-04   
ref|XP_010502620.1|  PREDICTED: ethylene-responsive transcription...  52.4    1e-04   
ref|XP_010465471.1|  PREDICTED: ethylene-responsive transcription...  52.4    1e-04   
ref|XP_002305121.2|  ERF domain protein 11                            52.4    1e-04   
gb|AEV41062.1|  AP2 domain-containing protein                         51.6    1e-04   
gb|EAY95981.1|  hypothetical protein OsI_17852                        51.6    1e-04   
ref|XP_008679899.1|  PREDICTED: ethylene-responsive transcription...  52.0    1e-04   
ref|NP_001147188.1|  ethylene-responsive transcription factor 3       52.0    1e-04   
gb|AFG53382.1|  hypothetical protein 0_6931_01                        51.2    1e-04   
ref|XP_008439819.1|  PREDICTED: ethylene-responsive transcription...  52.8    1e-04   
gb|AFP90058.1|  transcription factor 1                                52.0    1e-04   
gb|AFK39605.1|  unknown                                               51.6    1e-04   
gb|AFP90062.1|  transcription factor 1                                52.0    1e-04   
gb|AFP90036.1|  transcription factor 1                                52.0    1e-04   
ref|XP_002882920.1|  ATERF-4/ATERF4/ERF4/RAP2.5                       52.0    1e-04   
ref|XP_002282315.1|  PREDICTED: ethylene-responsive transcription...  51.2    1e-04   
gb|AFP90060.1|  transcription factor 1                                52.0    1e-04   
gb|AFP90029.1|  transcription factor 1                                51.6    1e-04   
gb|AFP90038.1|  transcription factor 1                                51.6    1e-04   
gb|AFP90032.1|  transcription factor 1                                51.6    1e-04   
gb|AFP90053.1|  transcription factor 1                                51.6    1e-04   
gb|AFP90037.1|  transcription factor 1                                51.6    1e-04   
gb|AFP90043.1|  transcription factor 1                                51.6    1e-04   
gb|ABC65861.1|  ethylene-responsive factor-like transcription fac...  52.0    1e-04   
ref|XP_010666079.1|  PREDICTED: ethylene-responsive transcription...  52.0    2e-04   
ref|XP_006342909.1|  PREDICTED: ethylene-responsive transcription...  53.1    2e-04   
ref|XP_003607496.1|  Ethylene-responsive transcription factor         52.0    2e-04   
gb|AFP90072.1|  transcription factor 1                                51.6    2e-04   
gb|AFP90071.1|  transcription factor 1                                51.6    2e-04   
gb|AFP90047.1|  transcription factor 1                                51.6    2e-04   
gb|AFP90031.1|  transcription factor 1                                51.6    2e-04   
gb|AFP90027.1|  transcription factor 1                                51.6    2e-04   
ref|XP_003545997.1|  PREDICTED: ethylene-responsive transcription...  52.0    2e-04   
gb|AFP90046.1|  transcription factor 1                                51.6    2e-04   
gb|AFP90070.1|  transcription factor 1                                51.6    2e-04   
ref|XP_010233948.1|  PREDICTED: ethylene-responsive transcription...  51.6    2e-04   
gb|AFP90059.1|  transcription factor 1                                51.6    2e-04   
ref|XP_006342907.1|  PREDICTED: ethylene-responsive transcription...  53.1    2e-04   
gb|AFP90067.1|  transcription factor 1                                51.6    2e-04   
ref|XP_006407000.1|  hypothetical protein EUTSA_v10021456mg           52.0    2e-04   
ref|XP_008358676.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...  52.4    2e-04   
gb|AFP90056.1|  transcription factor 1                                51.6    2e-04   
gb|AFP90035.1|  transcription factor 1                                51.6    2e-04   
ref|XP_010060618.1|  PREDICTED: ethylene-responsive transcription...  52.0    2e-04   
emb|CBI30599.3|  unnamed protein product                              52.0    2e-04   
ref|XP_011027786.1|  PREDICTED: ethylene-responsive transcription...  52.0    2e-04   
ref|XP_010535074.1|  PREDICTED: ethylene-responsive transcription...  51.2    2e-04   
gb|AFH56410.1|  ethylene response factor 3                            52.8    2e-04   
ref|XP_009409040.1|  PREDICTED: ethylene-responsive transcription...  52.8    2e-04   
gb|AGE97359.1|  ethylene response factor 4                            52.0    2e-04   
gb|ABC65859.1|  ethylene-responsive factor-like transcription fac...  52.0    2e-04   
gb|ABC65860.1|  ethylene-responsive factor-like transcription fac...  52.0    2e-04   
gb|AAQ96341.1|  putative ethylene response factor ERF3a               52.0    2e-04   
emb|CAN68434.1|  hypothetical protein VITISV_002078                   50.8    2e-04   
ref|XP_002279692.1|  PREDICTED: ethylene-responsive transcription...  52.0    2e-04   
ref|XP_003527229.1|  PREDICTED: ethylene-responsive transcription...  50.8    2e-04   
ref|XP_010660119.1|  PREDICTED: ethylene-responsive transcription...  50.8    2e-04   
ref|NP_001234462.1|  JERF3                                            52.4    2e-04   
ref|XP_011096344.1|  PREDICTED: ethylene-responsive transcription...  51.6    2e-04   
ref|XP_004251528.1|  PREDICTED: ethylene-responsive transcription...  51.2    2e-04   
ref|XP_010062850.1|  PREDICTED: ethylene-responsive transcription...  51.6    2e-04   
gb|AFI98119.1|  ethylene-responsive element-binding protein 3         51.6    3e-04   
ref|XP_008463800.1|  PREDICTED: ethylene-responsive transcription...  50.8    3e-04   
gb|AHI16460.1|  ethylene-responsive transcription factor              51.6    3e-04   
gb|AFW84855.1|  putative AP2/EREBP transcription factor superfami...  51.6    3e-04   
emb|CDY20105.1|  BnaA01g28970D                                        51.2    3e-04   
gb|EEE61873.1|  hypothetical protein OsJ_16559                        51.2    3e-04   
ref|XP_011100355.1|  PREDICTED: ethylene-responsive transcription...  51.2    3e-04   
ref|XP_009391708.1|  PREDICTED: ethylene-responsive transcription...  52.4    3e-04   
ref|XP_010500952.1|  PREDICTED: ethylene-responsive transcription...  50.8    3e-04   
ref|XP_010462184.1|  PREDICTED: ethylene-responsive transcription...  50.8    3e-04   
ref|XP_011029083.1|  PREDICTED: ethylene-responsive transcription...  50.4    3e-04   
ref|XP_010318410.1|  PREDICTED: JERF3 isoform X3                      52.0    3e-04   
ref|XP_010479863.1|  PREDICTED: ethylene-responsive transcription...  50.8    3e-04   
ref|XP_010318409.1|  PREDICTED: JERF3 isoform X2                      52.0    3e-04   
tpg|DAA57266.1|  TPA: putative AP2/EREBP transcription factor sup...  51.2    3e-04   
ref|NP_001148689.1|  ethylene-responsive transcription factor 4       51.2    3e-04   
ref|XP_003520585.1|  PREDICTED: ethylene-responsive transcription...  50.1    3e-04   
ref|XP_010318408.1|  PREDICTED: JERF3 isoform X1                      52.0    3e-04   
ref|XP_011047675.1|  PREDICTED: ethylene-responsive transcription...  50.8    4e-04   
ref|XP_004960227.1|  PREDICTED: ethylene-responsive transcription...  50.4    4e-04   
ref|XP_009131505.1|  PREDICTED: ethylene-responsive transcription...  50.1    4e-04   
ref|XP_009386127.1|  PREDICTED: ethylene-responsive transcription...  50.4    4e-04   
ref|XP_008807399.1|  PREDICTED: ethylene-responsive transcription...  50.4    4e-04   
gb|KDP24095.1|  hypothetical protein JCGZ_25752                       50.8    4e-04   
ref|XP_009116439.1|  PREDICTED: ethylene-responsive transcription...  50.8    4e-04   
gb|EYU21280.1|  hypothetical protein MIMGU_mgv1a008553mg              52.0    4e-04   
ref|NP_001238595.1|  ethylene-responsive element binding factor 4     50.8    4e-04   
ref|XP_010107942.1|  Ethylene-responsive transcription factor         51.6    4e-04   
gb|EYU45910.1|  hypothetical protein MIMGU_mgv1a009975mg              51.6    4e-04   
gb|AAX07461.1|  ethylene-responsive element binding protein ERF4      50.8    4e-04   
ref|XP_006841505.1|  hypothetical protein AMTR_s00003p00135920        51.6    4e-04   
ref|XP_009402998.1|  PREDICTED: ethylene-responsive transcription...  50.1    4e-04   
ref|NP_001149766.1|  LOC100283393                                     50.8    4e-04   
gb|ACU23153.1|  unknown                                               51.2    4e-04   
ref|XP_009408242.1|  PREDICTED: ethylene-responsive transcription...  50.4    5e-04   
ref|XP_006828662.1|  hypothetical protein AMTR_s00129p00119770        51.2    5e-04   
gb|AFP90061.1|  transcription factor 1                                50.4    5e-04   
ref|NP_001275619.1|  ethylene-responsive transcription factor 7-like  50.1    5e-04   
ref|XP_009131504.1|  PREDICTED: ethylene-responsive transcription...  50.1    5e-04   
ref|NP_001046143.1|  Os02g0189600                                     50.1    5e-04   
ref|XP_009391208.1|  PREDICTED: ethylene-responsive transcription...  51.6    5e-04   
ref|XP_009413994.1|  PREDICTED: ethylene-responsive transcription...  51.6    5e-04   
ref|XP_006604931.1|  PREDICTED: ethylene-responsive transcription...  51.2    5e-04   
ref|XP_009413995.1|  PREDICTED: ethylene-responsive transcription...  51.2    5e-04   
ref|XP_009413996.1|  PREDICTED: ethylene-responsive transcription...  51.2    5e-04   
ref|XP_010089706.1|  Ethylene-responsive transcription factor         51.2    5e-04   
ref|XP_006354281.1|  PREDICTED: ethylene-responsive transcription...  50.8    6e-04   
gb|AEQ58797.1|  ethylene response factor                              51.2    6e-04   
ref|XP_002310408.2|  hypothetical protein POPTR_0007s01110g           50.1    6e-04   
ref|XP_006351942.1|  PREDICTED: ethylene-responsive transcription...  50.8    6e-04   
ref|XP_009412068.1|  PREDICTED: ethylene-responsive transcription...  49.7    7e-04   
ref|XP_006403128.1|  hypothetical protein EUTSA_v10003431mg           49.7    7e-04   
ref|NP_001170261.1|  putative AP2/EREBP transcription factor supe...  49.7    7e-04   
ref|XP_002276215.1|  PREDICTED: ethylene-responsive transcription...  50.1    7e-04   
ref|XP_009385288.1|  PREDICTED: ethylene-responsive transcription...  49.3    7e-04   
emb|CDY70796.1|  BnaCnng69830D                                        48.9    8e-04   
ref|XP_004303745.1|  PREDICTED: ethylene-responsive transcription...  50.8    8e-04   
ref|XP_010552191.1|  PREDICTED: ethylene-responsive transcription...  50.8    8e-04   
ref|XP_009417991.1|  PREDICTED: ethylene-responsive transcription...  50.8    8e-04   
ref|XP_010552190.1|  PREDICTED: ethylene-responsive transcription...  50.8    8e-04   
ref|XP_010686416.1|  PREDICTED: ethylene-responsive transcription...  50.4    9e-04   
gb|KHG20924.1|  Ethylene-responsive transcription factor RAP2-3 -...  50.4    9e-04   
gb|EYU17901.1|  hypothetical protein MIMGU_mgv1a018153mg              48.5    0.001   
ref|XP_006426779.1|  hypothetical protein CICLE_v10025816mg           50.4    0.001   
gb|AFP25469.1|  ERF2                                                  50.1    0.001   



>ref|XP_006352525.1| PREDICTED: ethylene-responsive transcription factor 3-like [Solanum 
tuberosum]
Length=223

 Score =   172 bits (435),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 145/186 (78%), Gaps = 12/186 (6%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AA+AYD AAR LRGPKAKTNFPLP  S    +H  QFNQ  
Sbjct  46   RDPWKKTRVWLGTFDSAEDAAKAYDTAARTLRGPKAKTNFPLPLYSQ---HH--QFNQSL  100

Query  778  NANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPVSQPv  599
            N ND  VD ++Y QE PI+ QRPTSSGMSSTVESFSGPRPPRQQT A LPSR+HP S PV
Sbjct  101  NPNDRLVDPRLYSQEAPIVCQRPTSSGMSSTVESFSGPRPPRQQT-AVLPSRKHPRSPPV  159

Query  598  vpddchsdcdssssvvddmdCE----NIASSSFRKPLPFDLNLPPAVEYNVDAEAYELQC  431
             PDDC SDCDSSSSVV+D DCE    NI SSSFR PLPFDLN PP ++ +V A + +L  
Sbjct  160  EPDDCRSDCDSSSSVVEDGDCEGGNDNIVSSSFRNPLPFDLNFPPPMD-DVYANSNDLY-  217

Query  430  CTALCL  413
            CTALCL
Sbjct  218  CTALCL  223



>ref|XP_006346195.1| PREDICTED: ethylene-responsive transcription factor 3-like [Solanum 
tuberosum]
Length=240

 Score =   172 bits (435),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 140/187 (75%), Gaps = 6/187 (3%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPA-PSHLPPYHNLQFNQR  782
            RDPWKKTRVWLGTF+SAE AARAYD AAR LRGPKAKTNFPLP+     P  H+ QFNQ 
Sbjct  55   RDPWKKTRVWLGTFDSAEDAARAYDTAARTLRGPKAKTNFPLPSSHHLPPYPHHHQFNQS  114

Query  781  PNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPR-PPRQQTAAALPSRRHPVSQ  605
             N ND FVD ++Y Q+HPI+SQRPTSS MSSTVESFSGPR PPRQQTAA++PSR++P S 
Sbjct  115  INPNDPFVDSRLYSQDHPIVSQRPTSSSMSSTVESFSGPRPPPRQQTAASVPSRKYPRSP  174

Query  604  Pvv--pddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLP-PAVEYNVDAEAYELQ  434
            PVV        D  SS     + D +NIASSSFRKPLPFDLNLP P  ++  DA A +L 
Sbjct  175  PVVPDDCHSDCDSSSSVVEDGECDNDNIASSSFRKPLPFDLNLPAPMDDFGADAYADDLH  234

Query  433  CCTALCL  413
             CTALCL
Sbjct  235  -CTALCL  240



>gb|AEM63545.1| ethylene response factor ERF4 [Solanum tuberosum]
Length=223

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 144/186 (77%), Gaps = 12/186 (6%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AA+AYD AAR LRGPKAKTNFPLP  S    +H  QFNQ  
Sbjct  46   RDPWKKTRVWLGTFDSAEDAAKAYDTAARTLRGPKAKTNFPLPLYSQ---HH--QFNQSL  100

Query  778  NANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPVSQPv  599
            N ND  VD ++Y QE PI+ QRPTSSGMSSTVESFSGPRPPRQQT A LP R+HP S PV
Sbjct  101  NRNDRLVDPRLYSQEAPIVCQRPTSSGMSSTVESFSGPRPPRQQT-AVLPLRKHPRSPPV  159

Query  598  vpddchsdcdssssvvddmdCE----NIASSSFRKPLPFDLNLPPAVEYNVDAEAYELQC  431
             PDDC SDCDSSSSVV+D DCE    NI SSSFR PLPFDLN PP ++ +V A + +L  
Sbjct  160  EPDDCRSDCDSSSSVVEDGDCEGGNDNIVSSSFRNPLPFDLNFPPPMD-DVYANSNDLY-  217

Query  430  CTALCL  413
            CTALCL
Sbjct  218  CTALCL  223



>ref|NP_001239044.1| ethylene responsive factor [Solanum lycopersicum]
 dbj|BAL04565.1| ethylene responsive factor [Solanum lycopersicum]
Length=240

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 142/187 (76%), Gaps = 6/187 (3%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPA-PSHLPPYHNLQFNQR  782
            RDPWKKTRVWLGTF+SAE AARAYDAAAR LRGPKAKTNFPLP+     P  H+ QFNQ 
Sbjct  55   RDPWKKTRVWLGTFDSAEDAARAYDAAARTLRGPKAKTNFPLPSSHHLPPYPHHHQFNQS  114

Query  781  PNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPR-PPRQQTAAALPSRRHPVSQ  605
             N ND FVD ++Y Q+HP++SQRPTSS MSSTVESFSGPR PPRQQTAA++PSR++P S 
Sbjct  115  INPNDPFVDSRLYSQDHPLVSQRPTSSSMSSTVESFSGPRQPPRQQTAASVPSRKYPRSP  174

Query  604  Pvv--pddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLP-PAVEYNVDAEAYELQ  434
            PVV        D  SS     + D +NIASSSFRKPLPFDLNLP P  +++ DA A +L 
Sbjct  175  PVVPDDCHSDCDSSSSVVEDGECDNDNIASSSFRKPLPFDLNLPAPMDDFSADAYADDLH  234

Query  433  CCTALCL  413
             CTALCL
Sbjct  235  -CTALCL  240



>ref|XP_004248374.1| PREDICTED: ethylene-responsive transcription factor 3-like [Solanum 
lycopersicum]
Length=221

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 144/186 (77%), Gaps = 12/186 (6%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AA+AYDAAAR LRGPKAKTNFPLP  S    +H  QFN+  
Sbjct  44   RDPWKKTRVWLGTFDSAEDAAKAYDAAARTLRGPKAKTNFPLPMYSQ---HH--QFNRSL  98

Query  778  NANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPVSQPv  599
            N ND  VD ++Y QE PI+ QRPTSS MSSTVESFSGPRPPRQQT A LPSR+HP S PV
Sbjct  99   NPNDRLVDPRLYSQEAPIICQRPTSSSMSSTVESFSGPRPPRQQT-AVLPSRKHPRSPPV  157

Query  598  vpddchsdcdssssvvddmdCE----NIASSSFRKPLPFDLNLPPAVEYNVDAEAYELQC  431
             PDDC SDCDSSSSVV+D DCE    NI SSS R PLPFDLN PP ++ +V A + +L  
Sbjct  158  EPDDCRSDCDSSSSVVEDGDCEGGNDNIVSSSLRNPLPFDLNFPPPMD-DVYANSNDLY-  215

Query  430  CTALCL  413
            CTALCL
Sbjct  216  CTALCL  221



>ref|XP_009770784.1| PREDICTED: ethylene-responsive transcription factor 3-like [Nicotiana 
sylvestris]
Length=219

 Score =   154 bits (388),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 128/187 (68%), Gaps = 18/187 (10%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AA+AYD AAR LRGPKAKTNFPL   SH        FNQ  
Sbjct  46   RDPWKKTRVWLGTFDSAEEAAKAYDTAARTLRGPKAKTNFPLLPYSH--------FNQTV  97

Query  778  NANDSFVDQQMYMQE-HPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPVSQP  602
            N ND F+D ++Y QE HPI+ QRPTSS MSSTVESFSGPRPP +Q  A LPSR+HP S P
Sbjct  98   NPNDPFIDPRLYSQENHPIVIQRPTSSSMSSTVESFSGPRPPPRQQTAVLPSRKHPRSPP  157

Query  601  vv----pddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAYELQ  434
            VV      DC S          D + +NI SS FRKPLPFDLN PP     +DA++ +L 
Sbjct  158  VVPDDCRSDCDSSSSVVEDGDCDNENDNIVSSVFRKPLPFDLNFPPP----MDADSDDLH  213

Query  433  CCTALCL  413
             CTALCL
Sbjct  214  -CTALCL  219



>ref|XP_009614946.1| PREDICTED: ethylene-responsive transcription factor 3-like [Nicotiana 
tomentosiformis]
 dbj|BAL68173.1| ethylene response factor #229 [Nicotiana tabacum]
Length=221

 Score =   148 bits (374),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 130/189 (69%), Gaps = 20/189 (11%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AA+AYDAAAR LRGPKAKTNFPLP  SH        FNQ  
Sbjct  46   RDPWKKTRVWLGTFDSAEEAAKAYDAAARTLRGPKAKTNFPLPPYSH--------FNQTI  97

Query  778  NANDSFVDQQMYMQE-HPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPVSQP  602
            N N  F+D ++Y QE HPI+ QRPTSS MSSTVESFSGPRPP +Q  A LPSR+HP S P
Sbjct  98   NPNGPFIDPRLYSQENHPIVIQRPTSSSMSSTVESFSGPRPPPRQQTAVLPSRKHPRSPP  157

Query  601  vv------pddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAYE  440
            VV        D  S         +D + +NI SS+FRKPLPFDLN PP     +DA++ +
Sbjct  158  VVPDDCRSDCDSSSSVVEDGDCDNDNENDNIVSSAFRKPLPFDLNFPPP----MDADSDD  213

Query  439  LQCCTALCL  413
            L  CTALCL
Sbjct  214  LH-CTALCL  221



>gb|ADP37423.1| ethylene-responsive-element-binding factor 8 [Petunia x hybrida]
Length=217

 Score =   143 bits (360),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 146/190 (77%), Gaps = 21/190 (11%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAAR LRGPKAKTNFPLP   H P  +N  FN   
Sbjct  41   RDPWKKTRVWLGTFDSAEDAARAYDAAARTLRGPKAKTNFPLP---HHP--YNQSFNNN-  94

Query  778  NANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPP--RQQTAAALPSRRHPVSQ  605
              N+ FV+ ++Y Q++P+++QRPTSSGMSSTVESFSGPRPP  RQQT   +PSR++P S 
Sbjct  95   PNNEGFVNSRIYPQDNPVITQRPTSSGMSSTVESFSGPRPPLLRQQT---VPSRKYPRSP  151

Query  604  PvvpddchsdcdssssvvddmdCEN------IASSSFRKPLPFDLNLPPAVEYNVDAEAY  443
            PVVPDDC SDCDSSSSVV D +C+       I SSSFRKPLPFDLNLPP ++   D ++ 
Sbjct  152  PVVPDDCRSDCDSSSSVVVDGECDGDGENDVIVSSSFRKPLPFDLNLPPPMD---DVDSD  208

Query  442  ELQCCTALCL  413
            EL+ CT LCL
Sbjct  209  ELR-CTELCL  217



>gb|AET99099.1| ethylene response factor 2 [Solanum tuberosum]
Length=195

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 100/121 (83%), Gaps = 2/121 (2%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPA-PSHLPPYHNLQFNQR  782
            RDPWKKTRVWLGTF+SAE AARAYD AAR LRGPKAKTNFPLP+     P  H+ QFNQ 
Sbjct  55   RDPWKKTRVWLGTFDSAEDAARAYDTAARTLRGPKAKTNFPLPSSHHLPPYPHHHQFNQS  114

Query  781  PNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPR-PPRQQTAAALPSRRHPVSQ  605
             N ND FVD ++Y Q+HPI+SQRPTSS MSSTVESFSGPR PPRQQTAA++PSR++P S 
Sbjct  115  INPNDPFVDSRLYSQDHPIVSQRPTSSSMSSTVESFSGPRPPPRQQTAASVPSRKYPRSP  174

Query  604  P  602
            P
Sbjct  175  P  175



>ref|XP_009780689.1| PREDICTED: ethylene-responsive transcription factor 3 [Nicotiana 
sylvestris]
 sp|Q9SXS8.1|ERF3_TOBAC RecName: Full=Ethylene-responsive transcription factor 3; AltName: 
Full=Ethylene-responsive element-binding factor 3 homolog; 
AltName: Full=Ethylene-responsive element-binding factor 
5; Short=EREBP-5; AltName: Full=NtERF5 [Nicotiana tabacum]
 dbj|BAA76734.1| ethylene responsive element binding factor [Nicotiana tabacum]
 dbj|BAL68172.1| ethylene response factor #227 [Nicotiana tabacum]
Length=225

 Score =   126 bits (317),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 120/192 (63%), Gaps = 20/192 (10%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAAR LRGPKAKTNFPLP        H+ QFNQ  
Sbjct  44   RDPWKKTRVWLGTFDSAEDAARAYDAAARALRGPKAKTNFPLPYA------HHHQFNQGH  97

Query  778  N-ANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPVSQP  602
            N  ND FVD + Y Q++PI+SQRPTSS MSSTVESFSGPRPP         S R     P
Sbjct  98   NPNNDPFVDSRFYPQDNPIISQRPTSSSMSSTVESFSGPRPPPAPRQQTTASSRKYTRSP  157

Query  601  ---------vvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAE  449
                                      +D D +NIASSSFRKPL FDLNLPP ++   DA 
Sbjct  158  PVVPDDCHSDCDSSSSVVDHGDCEKENDNDNDNIASSSFRKPLLFDLNLPPPMD---DAG  214

Query  448  AYELQCCTALCL  413
            A +L  CTALCL
Sbjct  215  ADDLH-CTALCL  225



>ref|XP_004513889.1| PREDICTED: ethylene-responsive transcription factor 7-like [Cicer 
arietinum]
Length=223

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 128/195 (66%), Gaps = 27/195 (14%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDP KK RVWLGTF++AE AARAYD AARNLRGPKAKTNFPL  P     YHNL+     
Sbjct  43   RDPLKKARVWLGTFDTAEEAARAYDTAARNLRGPKAKTNFPLSPPF----YHNLE-----  93

Query  778  NANDSFVDQQMY--------MQEHPILSQRPTSSGMSSTVESFSGPRPPRQQT-AAALPS  626
             A D F DQ+ Y         Q+H    +RPTSSGMSSTVESFSGPRP       + +  
Sbjct  94   -AGDPFSDQRFYAGAVAGDGFQDH----RRPTSSGMSSTVESFSGPRPAGTLAPPSVVTG  148

Query  625  RRHPVSQPvvpddchsdcdssssvvddmdCENIASS---SF-RKPLPFDLNLPPAVEYNV  458
            RR+P + PV P+DC SDCDSSSSVVDD D +N+ASS   SF R+PLPFDLN PP  + +V
Sbjct  149  RRYPRTPPVAPEDCRSDCDSSSSVVDDGDGDNVASSVMLSFQRQPLPFDLNAPPLDDADV  208

Query  457  DAEAYELQCCTALCL  413
                 E   CT LCL
Sbjct  209  AIGGGEDLHCTVLCL  223



>dbj|BAL68169.1| ethylene response factor #205 [Nicotiana tabacum]
Length=227

 Score =   121 bits (303),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 142/194 (73%), Gaps = 24/194 (12%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAAR LRGPKAKTNF LP        H+ QFNQ  
Sbjct  46   RDPWKKTRVWLGTFDSAEDAARAYDAAARALRGPKAKTNFSLPY------AHHHQFNQGL  99

Query  778  N-ANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFS---GPRPPRQQTAAALPSRRHPV  611
            N  ND FVD + Y Q++PI+SQRPTSS MSSTVESFS    P  PRQQT A+  SR++P 
Sbjct  100  NPNNDPFVDSRFYPQDNPIISQRPTSSSMSSTVESFSRPRPPPAPRQQTTAS--SRKYPR  157

Query  610  SQPvvpddchsdcdssssvvddmdCEN--------IASSSFRKPLPFDLNLPPAVEYNVD  455
            S PV+PDDCHSDCDSSSSVVDD DCE         IASSSFRKPLPFDLNL P ++   D
Sbjct  158  SPPVLPDDCHSDCDSSSSVVDDGDCEKDNDNDNDNIASSSFRKPLPFDLNLLPPMD---D  214

Query  454  AEAYELQCCTALCL  413
            A   +L  CTALCL
Sbjct  215  AGTDDLH-CTALCL  227



>ref|XP_009598342.1| PREDICTED: ethylene-responsive transcription factor 3 [Nicotiana 
tomentosiformis]
Length=227

 Score =   120 bits (302),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 142/194 (73%), Gaps = 24/194 (12%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAAR LRGPKAKTNF LP        H+ QFNQ  
Sbjct  46   RDPWKKTRVWLGTFDSAEDAARAYDAAARALRGPKAKTNFSLPY------AHHHQFNQGL  99

Query  778  N-ANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFS---GPRPPRQQTAAALPSRRHPV  611
            N  ND FVD + Y Q++PI+SQRPTSS MSSTVESFS    P  PRQQT A+  SR++P 
Sbjct  100  NPNNDPFVDSRFYPQDNPIISQRPTSSSMSSTVESFSRPRPPPAPRQQTTAS--SRKYPR  157

Query  610  SQPvvpddchsdcdssssvvddmdCEN--------IASSSFRKPLPFDLNLPPAVEYNVD  455
            S PV+PDDCHSDCDSSSSVVDD DCE         IASSSFRKPLPFDLNL P ++   D
Sbjct  158  SPPVLPDDCHSDCDSSSSVVDDGDCEKDNDNDNDNIASSSFRKPLPFDLNLLPPMD---D  214

Query  454  AEAYELQCCTALCL  413
            A   +L  CTALCL
Sbjct  215  AGTDDLH-CTALCL  227



>ref|XP_011095450.1| PREDICTED: ethylene-responsive transcription factor 3-like [Sesamum 
indicum]
Length=235

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 126/166 (76%), Gaps = 8/166 (5%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYD+AAR+LRGPKAKTNFPLP    + P  N Q   +P
Sbjct  46   RDPWKKTRVWLGTFDSAEEAARAYDSAARSLRGPKAKTNFPLPPNGTVFPDFNPQNPNQP  105

Query  778  ----NANDSFVDQQMYMQEHPILS-QRPTSSGMSSTVESFSGPRPPRQQTAAAL--PSRR  620
                N ND F+D + Y +EH I++ QRPTSSGMSSTVESFSGPR P       L    RR
Sbjct  106  QIINNPNDPFMDSRFYSEEHQIIAQQRPTSSGMSSTVESFSGPRQPPPPPRPLLMQQQRR  165

Query  619  HPVSQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNL  482
            HP S PVVPDDCHSDCDSSSSVVDD +C+ IASSS +KPLPFDLN+
Sbjct  166  HPRSPPVVPDDCHSDCDSSSSVVDDAECD-IASSSCKKPLPFDLNM  210



>gb|AFH56414.1| ethylene response factor 7, partial [Diospyros kaki]
Length=219

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 117/186 (63%), Gaps = 22/186 (12%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKK RVWLGTF+SAE AARAYD+AAR LRGPKAKTNF         P  +       
Sbjct  52   RDPWKKARVWLGTFDSAEDAARAYDSAARALRGPKAKTNF---------PPSSPFSPFHQ  102

Query  778  NANDSFVDQQMY----MQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPV  611
            N +D  ++ ++Y      EH I++QRPT+S +SSTVESFSGPRPP+     A+P+RRHP 
Sbjct  103  NPSDPMIEHRLYAPHHFPEHQIVAQRPTTSSLSSTVESFSGPRPPQ----PAVPARRHPR  158

Query  610  SQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAYELQC  431
            + P V  +       SSS V D    +IASSSFRKPLPFDLNLPP  +   D + +    
Sbjct  159  T-PPVSPEDCHSDCDSSSSVVDDGDGDIASSSFRKPLPFDLNLPPPSDQAGDDDLF----  213

Query  430  CTALCL  413
            CT L L
Sbjct  214  CTDLRL  219



>gb|KEH33908.1| ethylene response factor [Medicago truncatula]
Length=225

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 128/198 (65%), Gaps = 31/198 (16%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDP KK RVWLGTF++AE AARAYD AARNLRGPKAKTNFPL      P YHNL      
Sbjct  43   RDPLKKARVWLGTFDTAEQAARAYDTAARNLRGPKAKTNFPL----QQPFYHNLD-----  93

Query  778  NANDSFVDQQMYM-----------QEHPILSQRPTSSGMSSTVESFSGPRPPR-QQTAAA  635
             A D F DQ+ +            Q+H    +RPTSSGMSSTVESFSGPRP       +A
Sbjct  94   AAGDPFSDQRFFTGAGAGVVAGEYQDH----RRPTSSGMSSTVESFSGPRPFLPPAIPSA  149

Query  634  LPSRRHPVSQPvvpddchsdcdssssvvddmdCENIASS---SF-RKPLPFDLNLPPAVE  467
            +  RR+P + PV P+DC SDCDSSSSVVDD D +N ASS   SF R PLPFDLN PP  +
Sbjct  150  VTGRRYPRTPPVAPEDCRSDCDSSSSVVDDGDNDNAASSVMLSFKRAPLPFDLNAPPLED  209

Query  466  YNVDAEAYELQCCTALCL  413
             +V A   +L  CT LCL
Sbjct  210  ADV-AGGEDLH-CTVLCL  225



>ref|XP_003551866.1| PREDICTED: ethylene-responsive transcription factor 7-like [Glycine 
max]
Length=212

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 125/183 (68%), Gaps = 15/183 (8%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLP-PYHNLQFNQR  782
            RDP KK RVWLGTF++AE AARAYD AAR LRGPKAKTNFPL  P + P P+ + ++   
Sbjct  44   RDPLKKARVWLGTFDTAEEAARAYDTAARTLRGPKAKTNFPLSPPFYHPDPFSDHRYFDG  103

Query  781  PNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPVSQP  602
              A + F       Q+H    +RPTSSGMSSTVESFSGPR      A  + +RR+P + P
Sbjct  104  AGAGEDF-------QDH----RRPTSSGMSSTVESFSGPRAAVPAKAPVIVNRRYPRTPP  152

Query  601  vvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAYELQCCTA  422
            VVP+DC SDCDSSSSVVDD D +N+ASS  R+PLPFDLN+ P  + +V   A +   CT 
Sbjct  153  VVPEDCRSDCDSSSSVVDDGDGDNVASSFRREPLPFDLNVLPLDDADV---ATDDLFCTV  209

Query  421  LCL  413
            LCL
Sbjct  210  LCL  212



>ref|XP_002531192.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
 gb|EEF31169.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
Length=228

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 127/189 (67%), Gaps = 19/189 (10%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYD AAR LRGPKAKTNFP+ A S L P+         
Sbjct  52   RDPWKKTRVWLGTFDSAEDAARAYDTAARTLRGPKAKTNFPINA-SQLSPFAYQ------  104

Query  778  NANDSFVDQQMYM-------QEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRR  620
            N  D FVD    +       + HP+  QRPTSS +SSTVESFSGPRPP   T      R 
Sbjct  105  NPPDPFVDYHHRVFTTNNGYESHPVNPQRPTSSSLSSTVESFSGPRPP--PTTVGSQKRH  162

Query  619  HPVSQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAYE  440
            HP + PVVP+DCHSDCDSSSSVVDD D  + +S  +RKPLPFDLN PP  +  VD    +
Sbjct  163  HPRTPPVVPEDCHSDCDSSSSVVDDGDIASSSSLCYRKPLPFDLNFPPLDQ--VDFAGDD  220

Query  439  LQCCTALCL  413
            LQ CTALCL
Sbjct  221  LQ-CTALCL  228



>gb|EYU27372.1| hypothetical protein MIMGU_mgv1a013229mg [Erythranthe guttata]
Length=227

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 133/184 (72%), Gaps = 6/184 (3%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAAR+LRGPKAKTNFP P    + P  N Q    P
Sbjct  48   RDPWKKTRVWLGTFDSAEDAARAYDAAARSLRGPKAKTNFPFPQNGAVFPDFNPQNPNPP  107

Query  778  NANDSFVD-QQMYMQEHPILS-QRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPVSQ  605
            +  ++  D  + Y Q+H I++ QRPTSSGMSSTVESFSGPR            RR+P S 
Sbjct  108  HLKNNHGDPSRFYAQDHQIIAQQRPTSSGMSSTVESFSGPRQQLPPPPPMQQQRRYPRSP  167

Query  604  PvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAYELQCCT  425
            PVVPDDCHSDCDSS+SVVDD +C+ IASSS +KPLPFDLN+PP ++   D +  EL  CT
Sbjct  168  PVVPDDCHSDCDSSASVVDDTECD-IASSSCKKPLPFDLNMPPPMDAAADVD--ELT-CT  223

Query  424  ALCL  413
            AL L
Sbjct  224  ALRL  227



>ref|XP_011097839.1| PREDICTED: ethylene-responsive transcription factor 3-like [Sesamum 
indicum]
Length=228

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 134/189 (71%), Gaps = 14/189 (7%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNL------  797
            RDPWKKTRVWLGTF+SAE AARAYD AAR+LRGPKAKTNFPL    ++  +H+       
Sbjct  47   RDPWKKTRVWLGTFDSAEEAARAYDTAARSLRGPKAKTNFPLTPSGNV--FHDFNPQNPN  104

Query  796  QFNQRPNANDSFVDQQMYMQEHPILS-QRPTSSGMSSTVESFSGPRPPRQQTAAALPSRR  620
            Q     N ND F+D + Y Q+  I++ QRPTSSGMSSTVESFSGPRPP          RR
Sbjct  105  QPQINNNPNDPFMDSRYYPQDQDIIAQQRPTSSGMSSTVESFSGPRPPPPPPLVQ-QQRR  163

Query  619  HPVSQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAYE  440
            HP S PVVPDDC SDCDSSSSVVDD +C +IASSS +KPLPFDLN+ P V+   D +  E
Sbjct  164  HPRSPPVVPDDCRSDCDSSSSVVDDTEC-DIASSSCKKPLPFDLNMLPPVDAAADLD--E  220

Query  439  LQCCTALCL  413
            L  CTAL L
Sbjct  221  L-ACTALRL  228



>emb|CDP13789.1| unnamed protein product [Coffea canephora]
Length=241

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 146/203 (72%), Gaps = 31/203 (15%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAAR LRGPKAKTNFPLP+ S    +H  QF+   
Sbjct  49   RDPWKKTRVWLGTFDSAEDAARAYDAAARTLRGPKAKTNFPLPSTSSY--HHPHQFSNYQ  106

Query  778  NANDS---------FVDQ---QMYMQE-HPILS-QRPTSSGMSSTVESFSGPRPPRQQTA  641
            N N+          F+D    ++Y QE H IL  QRPTSS +SSTVESFSGPRP  Q TA
Sbjct  107  NPNNPNFNNNDPAMFIDHPQNRLYHQEPHQILHPQRPTSSSLSSTVESFSGPRP--QTTA  164

Query  640  AA----LP--SRRHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRK-PLPFDLNL  482
            AA    +P  SRRHP S PVVPDDCHSDCDSSSSV+DD DC+ IASSSFRK PLPFDLNL
Sbjct  165  AAATSMIPSSSRRHPRSPPVVPDDCHSDCDSSSSVIDDGDCD-IASSSFRKPPLPFDLNL  223

Query  481  PPAVEYNVDAEAYELQCCTALCL  413
            P      VD +A +L  CTALCL
Sbjct  224  PAP----VDVDADDLH-CTALCL  241



>gb|AIC83902.1| C-repeat binding transcription factor 2 [Jatropha curcas]
Length=242

 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 117/199 (59%), Gaps = 27/199 (14%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYD AAR LRGPKAKTNFP+ + S+L P+         
Sbjct  54   RDPWKKTRVWLGTFDSAEDAARAYDKAARTLRGPKAKTNFPI-STSNLSPF------TYQ  106

Query  778  NANDSFVDQQMY----MQEHPILSQRPTSSGMSSTVESFSGPRPP----------RQQTA  641
            N  D F+D ++Y     QEH +  QRPTSS +SSTVESFSGPRPP          +    
Sbjct  107  NPPDPFMDHRIYSSNAFQEHHVNPQRPTSSSLSSTVESFSGPRPPTTVLPPISTTKSGVL  166

Query  640  AALPSRRHPVSQPvv-pddchsdcdssssvvddmdCENIASSS--FRKPLPFDLNLPPAV  470
             A  +R H    P   P           S    +D  +IASSS  +RKPLPFDLN PP  
Sbjct  167  LATVTRGHKRHHPRTPPVVPEDCHSDCDSSSSVVDDGDIASSSSLYRKPLPFDLNFPPLD  226

Query  469  EYNVDAEAYELQCCTALCL  413
            +  VD    +LQ CTALCL
Sbjct  227  Q--VDFAGDDLQ-CTALCL  242



>gb|KDP39186.1| hypothetical protein JCGZ_00943 [Jatropha curcas]
 gb|AIC83901.1| C-repeat binding transcription factor 1 [Jatropha curcas]
Length=242

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 117/199 (59%), Gaps = 27/199 (14%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYD AAR LRGPKAKTNFP+ + S+L P+         
Sbjct  54   RDPWKKTRVWLGTFDSAEDAARAYDKAARTLRGPKAKTNFPI-STSNLSPF------TYQ  106

Query  778  NANDSFVDQQMY----MQEHPILSQRPTSSGMSSTVESFSGPRPP----------RQQTA  641
            N  D F+D ++Y     QEH +  QRPTSS +SSTVESFSGPRPP          +    
Sbjct  107  NPPDPFMDHRIYSSNAFQEHHVNPQRPTSSSLSSTVESFSGPRPPTTVLPPISTTKSGVL  166

Query  640  AALPSRRHPVSQPvv-pddchsdcdssssvvddmdCENIASSS--FRKPLPFDLNLPPAV  470
             A  +R H    P   P           S    +D  +IASSS  +RKPLPFDLN PP  
Sbjct  167  LATVTRGHKRHHPRTPPVVPEDCHSDCDSSSSVVDDGDIASSSSLYRKPLPFDLNFPPLD  226

Query  469  EYNVDAEAYELQCCTALCL  413
            +  VD    +LQ CTALCL
Sbjct  227  Q--VDFAGDDLQ-CTALCL  242



>ref|XP_007020716.1| Ethylene responsive element binding factor 3, putative [Theobroma 
cacao]
 gb|EOY12241.1| Ethylene responsive element binding factor 3, putative [Theobroma 
cacao]
Length=228

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 136/192 (71%), Gaps = 24/192 (13%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAAR+LRG KAKTNFP+ + S++P +    F    
Sbjct  51   RDPWKKTRVWLGTFDSAEEAARAYDAAARSLRGSKAKTNFPINS-SNIPAF---PFETHH  106

Query  778  NANDSFVDQQ-MY----MQEHPILSQRPTSSGMSSTVESFSGPR---PPRQQTAAALPSR  623
            + N+ F+DQQ +Y     Q+  +  QRPT S MSSTVESFSGPR   PP++ T  A+ S 
Sbjct  107  HNNEGFIDQQRLYPMGDFQDPEVNPQRPTRSSMSSTVESFSGPRPAQPPQKSTDFAVVST  166

Query  622  R--HPVSQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAE  449
            R  HP + PVVP+DCHSDCDSSSSVVDD    +IASSS RK LPFDLN PP  + +    
Sbjct  167  RKYHPRTPPVVPEDCHSDCDSSSSVVDDG---DIASSSCRKTLPFDLNFPPLDDVD----  219

Query  448  AYELQCCTALCL  413
              +LQ CTALCL
Sbjct  220  --DLQ-CTALCL  228



>gb|ADJ67438.1| ethylene response factor 9 [Actinidia deliciosa]
Length=210

 Score =   109 bits (273),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 127/181 (70%), Gaps = 19/181 (10%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPL-----PAPSHLPPYHNLQ  794
            RDPWKK RVWLGTF+SAE AARAYDAAARNLRG KAKTNFPL     P   H P      
Sbjct  39   RDPWKKARVWLGTFDSAEDAARAYDAAARNLRGAKAKTNFPLSSILAPLAPHSP------  92

Query  793  FNQRPNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHP  614
            F+Q+P+  D F+++ +Y   H I+ QRPTSS +SSTVESFSGP+PPR   A     RR P
Sbjct  93   FDQKPH--DPFIERHLYPPHHQIIPQRPTSSSLSSTVESFSGPKPPRPAVAPPSSFRRRP  150

Query  613  VSQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAYELQ  434
             + PV PDDC SDCDSSSSVVDD DC +IASSSFRK L FDLNL P ++     EA +L 
Sbjct  151  RTPPVSPDDCRSDCDSSSSVVDDGDC-DIASSSFRKALDFDLNLTPTLD-----EADDLY  204

Query  433  C  431
            C
Sbjct  205  C  205



>gb|AAV85852.1| AT-rich element binding factor 2 [Pisum sativum]
Length=218

 Score =   109 bits (273),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 119/194 (61%), Gaps = 26/194 (13%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDP KK RVWLGTF++AE AARAYD AARNLRGPKAKTNFPL  P          F Q P
Sbjct  39   RDPLKKARVWLGTFDTAEEAARAYDTAARNLRGPKAKTNFPLAQP----------FYQNP  88

Query  778  NANDSFVDQQMY-------MQEHPILSQRPTSSGMSSTVESFSG-PRPPRQQTAAALPSR  623
             A + F + + Y        Q+H    +RPTSSGMSSTVESF G          +A+  R
Sbjct  89   EAGNPFGELRFYAGGAGEGFQDH----RRPTSSGMSSTVESFGGPRPVRPPMPPSAVTGR  144

Query  622  RHPVSQPvvpddchsdcdssssvvddmdCENIASSSF----RKPLPFDLNLPPAVEYNVD  455
            R+P + PV P DC SDCDSSSSVVDD D +N ASS+     R+PLPFDLN PP  E +V 
Sbjct  145  RYPRTPPVAPGDCRSDCDSSSSVVDDADNDNAASSTMLSFKRQPLPFDLNAPPLEEGDVA  204

Query  454  AEAYELQCCTALCL  413
                E   CT LCL
Sbjct  205  NGLGEDLHCTLLCL  218



>gb|EYU33670.1| hypothetical protein MIMGU_mgv1a013001mg [Erythranthe guttata]
Length=233

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 135/190 (71%), Gaps = 9/190 (5%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAAR+LRGPKA+TNFP P  + + P  N +   +P
Sbjct  45   RDPWKKTRVWLGTFDSAEDAARAYDAAARSLRGPKARTNFPPPPNAAVFPDFNPRNPNQP  104

Query  778  ----NANDSFVDQQMYMQEHPILS-QRPTSSGMSSTVESFSGPRPPRQQTA-AALPSRRH  617
                N ND  +D + Y Q+  +++ QRPT+SGMSSTVESFSGPR P       A   RRH
Sbjct  105  HINSNPNDPLMDSRYYTQDQQLIAQQRPTTSGMSSTVESFSGPRAPPPPRPLIAQQQRRH  164

Query  616  PVSQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAYEL  437
            P S PVVPDDC SDCDSSSSVVDD +C+ IASSS +KPL FDLN+PP     +DA A +L
Sbjct  165  PRSPPVVPDDCRSDCDSSSSVVDDAECD-IASSSCKKPLAFDLNMPPPPPTPMDAAASDL  223

Query  436  Q--CCTALCL  413
                CTAL L
Sbjct  224  DELACTALRL  233



>gb|AAV54034.1| ethylene-responsive element binding protein 6 [Nicotiana tabacum]
Length=244

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 89/120 (74%), Gaps = 10/120 (8%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKK   WLGTF+SAE AA+AYDAAAR LRGPKAKTNFPLP  SH        FNQ  
Sbjct  46   RDPWKKLG-WLGTFDSAEEAAKAYDAAARTLRGPKAKTNFPLPPYSH--------FNQTI  96

Query  778  NANDSFVDQQMYMQE-HPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPVSQP  602
            N N  F+D ++Y QE HPI+ QRPTSS MSSTVESFSGPRPP +Q  A LPSR+HP S P
Sbjct  97   NPNGPFIDPRLYSQENHPIVIQRPTSSSMSSTVESFSGPRPPPRQQTAVLPSRKHPRSPP  156



>ref|XP_003532144.1| PREDICTED: ethylene-responsive transcription factor 3-like [Glycine 
max]
Length=210

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 120/183 (66%), Gaps = 17/183 (9%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLP-PYHNLQFNQR  782
            RDP KK RVWLGTF++AE AARAYD AAR LRGPKAKTNFPL  P + P P+ + +    
Sbjct  44   RDPLKKARVWLGTFDTAEEAARAYDTAARTLRGPKAKTNFPLSPPFYHPDPFSDHR--HF  101

Query  781  PNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPVSQP  602
             N  + F D            +RPTSSGMSSTVESFSGPR     TA     RR+P + P
Sbjct  102  ANTGEDFHDH-----------RRPTSSGMSSTVESFSGPRAAVPATAPVATGRRYPRTPP  150

Query  601  vvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAYELQCCTA  422
            V+P+DC SDCDSSSSVVDD + +N+ASS  R+PLPFDLN  P  + +V   A +   CT 
Sbjct  151  VIPEDCRSDCDSSSSVVDDGEGDNVASSFPREPLPFDLNALPLDDADV---ATDDLFCTV  207

Query  421  LCL  413
            LCL
Sbjct  208  LCL  210



>gb|KDO62117.1| hypothetical protein CISIN_1g045783mg [Citrus sinensis]
Length=234

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 120/193 (62%), Gaps = 22/193 (11%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAAR LRGPKAKTNFP+   +    Y N       
Sbjct  53   RDPWKKTRVWLGTFDSAEDAARAYDAAARTLRGPKAKTNFPIHNTNVSSYYPN-------  105

Query  778  NANDSFVDQQMY------MQEHPILS-QRPTSSGMSSTVESFSGPRPPR-QQTAAALP--  629
            N ND F+DQ++Y      +Q+  I++ QRPT+S MSSTVESFSGPRPP   Q +A L   
Sbjct  106  NNNDPFLDQRLYGSVFHDIQDQQIVNPQRPTTSSMSSTVESFSGPRPPHPPQRSANLTDG  165

Query  628  SRRHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRKP-LPFDLNLPPAVEYNVDA  452
            SRR+P + P          D  SS     D  +IA SS RK  LPFDLN PP ++     
Sbjct  166  SRRYPRTPP--VVPEDCHSDCDSSSSVIDDDGDIALSSCRKSLLPFDLNFPP-LDDVDFN  222

Query  451  EAYELQCCTALCL  413
               +LQ CTALCL
Sbjct  223  GDDDLQ-CTALCL  234



>ref|XP_006452450.1| hypothetical protein CICLE_v10009361mg [Citrus clementina]
 ref|XP_006475008.1| PREDICTED: ethylene-responsive transcription factor 3-like [Citrus 
sinensis]
 gb|ESR65690.1| hypothetical protein CICLE_v10009361mg [Citrus clementina]
Length=234

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 120/193 (62%), Gaps = 22/193 (11%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAAR LRGPKAKTNFP+   +    Y N       
Sbjct  53   RDPWKKTRVWLGTFDSAEDAARAYDAAARTLRGPKAKTNFPIHNTNVSSYYPN-------  105

Query  778  NANDSFVDQQMY------MQEHPILS-QRPTSSGMSSTVESFSGPRPPR-QQTAAALP--  629
            N ND F+DQ++Y      +Q+  I++ QRPT+S MSSTVESFSGPRPP   Q +A L   
Sbjct  106  NNNDPFLDQRLYGSVFHDIQDQQIVNPQRPTTSSMSSTVESFSGPRPPHPPQRSANLTDG  165

Query  628  SRRHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRKP-LPFDLNLPPAVEYNVDA  452
            SRR+P + P          D  SS     D  +IA SS RK  LPFDLN PP ++     
Sbjct  166  SRRYPRTPP--VVPEDCHSDCDSSSSVIDDDGDIALSSCRKSLLPFDLNFPP-LDDVDFN  222

Query  451  EAYELQCCTALCL  413
               +LQ CTALCL
Sbjct  223  GDDDLQ-CTALCL  234



>ref|XP_010479528.1| PREDICTED: ethylene-responsive transcription factor 3-like [Camelina 
sativa]
 ref|XP_010479529.1| PREDICTED: ethylene-responsive transcription factor 3-like [Camelina 
sativa]
Length=233

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 120/202 (59%), Gaps = 35/202 (17%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQF----  791
            RDPWKK+RVWLGTF+SAE AARAYD+AARNLRGPKAKTNFP+   S   P  NL+F    
Sbjct  47   RDPWKKSRVWLGTFDSAEEAARAYDSAARNLRGPKAKTNFPIDPSS---PSPNLRFTAFP  103

Query  790  ---NQRPNANDSFVDQQMY--------MQEHPILSQRPTSSGMSSTVESFSGPRPPRQQT  644
               NQ  N  D F+D ++Y         Q HP+++ RPT+S MSSTVESFSGPRP    T
Sbjct  104  NTVNQNQNQVDPFMDHRLYPGDNNNNNQQFHPVVN-RPTTSSMSSTVESFSGPRP----T  158

Query  643  AA---ALPSRRHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRK--PLPFDLNLP  479
            AA      ++R+P + P              S    +D ++IASSS R+  P  FDLN+P
Sbjct  159  AAKPVTTAAKRYPRTPP---VVPEDCHSDCDSSSSVIDDDDIASSSRRRSPPFQFDLNIP  215

Query  478  PAVEYNVDAEAYELQCCTALCL  413
            P  E+N   + +    CT L L
Sbjct  216  PLDEFNGSDDLH----CTDLRL  233



>gb|ACD87818.1| putative ethylene responsive factor [Vicia faba]
Length=221

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 125/194 (64%), Gaps = 23/194 (12%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHL-----PPYHNLQ  794
            RDP KK RVWLGTF++AE AARAYD AARNLRGPKAKTNFPL  P +       P+  L+
Sbjct  39   RDPLKKARVWLGTFDTAEEAARAYDTAARNLRGPKAKTNFPLAQPFYQNPETGNPFGELR  98

Query  793  FNQRPNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPS-RRH  617
            F     A D F       Q+H    +RPTSSGMSSTVESFSGPRP R     ++ + RR+
Sbjct  99   FYAGAGAGDGF-------QDH----RRPTSSGMSSTVESFSGPRPVRPPMPPSVVTGRRY  147

Query  616  PVSQPvvpddchsdcdssssvvddmdCENIASSSF----RKPLPFDLNLPPAVEYNVDAE  449
            P + PV P+DC SDCDSSSSVVDD D +N ASS+     R+PLPFDLN PP  + + D  
Sbjct  148  PRTPPVAPEDCRSDCDSSSSVVDDADNDNAASSTMLSFKRQPLPFDLNAPPLEDADADVA  207

Query  448  A--YELQCCTALCL  413
                E   CT LCL
Sbjct  208  IGLGEDLHCTLLCL  221



>gb|ADE41098.1| AP2 domain class transcription factor [Malus domestica]
Length=230

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 119/194 (61%), Gaps = 22/194 (11%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAAR LRGPKAKTNF +      P ++N       
Sbjct  47   RDPWKKTRVWLGTFDSAEDAARAYDAAARILRGPKAKTNFQISC--AYPTFYN-------  97

Query  778  NANDSFVDQQMY-----MQEHPILS-QRPTSSGMSSTVESFSGPRPPRQQT--AAALPSR  623
            N  D  ++ +++      Q+HP +  QRP SS +SSTVESFSGPRPP Q T  AA L  R
Sbjct  98   NPTDPAIEAKLFGSGYGFQDHPAVDPQRPASSSLSSTVESFSGPRPPLQSTTVAAELTRR  157

Query  622  RHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRK-PLPFDLNLPPA---VEYNVD  455
            +     P V  +       SSS V + D + +ASSSFRK PLPFDLN PP     E    
Sbjct  158  KRQPRTPPVVPEDCHSDCDSSSSVVEDDGDFVASSSFRKAPLPFDLNFPPLDVDGEMGGG  217

Query  454  AEAYELQCCTALCL  413
             +  +L+ CTALCL
Sbjct  218  VDGQDLR-CTALCL  230



>ref|XP_008385842.1| PREDICTED: ethylene-responsive transcription factor 3-like [Malus 
domestica]
Length=230

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 119/194 (61%), Gaps = 22/194 (11%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAAR LRGPKAKTNF +      P ++N       
Sbjct  47   RDPWKKTRVWLGTFDSAEDAARAYDAAARILRGPKAKTNFQISC--AYPXFYN-------  97

Query  778  NANDSFVDQQMY-----MQEHPILS-QRPTSSGMSSTVESFSGPRPPRQQT--AAALPSR  623
            N  D  ++ +++      Q+HP +  QRP SS +SSTVESFSGPRPP Q T  AA L  R
Sbjct  98   NPTDPAIEAKLFGSGYGFQDHPAVDPQRPASSSLSSTVESFSGPRPPLQSTTVAAELTRR  157

Query  622  RHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRK-PLPFDLNLPPA---VEYNVD  455
            +     P V  +       SSS V + D + +ASSSFRK PLPFDLN PP     E    
Sbjct  158  KRQPRTPPVVPEDCHSDCDSSSSVVEDDGDFVASSSFRKAPLPFDLNFPPLDVDGEMGGG  217

Query  454  AEAYELQCCTALCL  413
             +  +L+ CTALCL
Sbjct  218  VDGQDLR-CTALCL  230



>ref|XP_008385843.1| PREDICTED: ethylene-responsive transcription factor 3-like [Malus 
domestica]
 ref|XP_008359254.1| PREDICTED: ethylene-responsive transcription factor 3-like [Malus 
domestica]
Length=230

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 119/194 (61%), Gaps = 22/194 (11%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAAR LRGPKAKTNF +      P ++N       
Sbjct  47   RDPWKKTRVWLGTFDSAEDAARAYDAAARILRGPKAKTNFQISC--AYPTFYN-------  97

Query  778  NANDSFVDQQMY-----MQEHPILS-QRPTSSGMSSTVESFSGPRPPRQQT--AAALPSR  623
            N  D  ++ +++      Q+HP +  QRP SS +SSTVESFSGPRPP Q T  AA L  R
Sbjct  98   NPTDPAIEAKLFGSGYGFQDHPAVDPQRPASSSLSSTVESFSGPRPPLQSTTVAAELTRR  157

Query  622  RHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRK-PLPFDLNLPPA---VEYNVD  455
            +     P V  +       SSS V + D + +ASSSFRK PLPFDLN PP     E    
Sbjct  158  KRQPRTPPVVPEDCHSDCDSSSSVVEDDGDFVASSSFRKAPLPFDLNFPPLDVDGEMGGG  217

Query  454  AEAYELQCCTALCL  413
             +  +L+ CTALCL
Sbjct  218  VDGQDLR-CTALCL  230



>gb|ACM49845.1| ethylene responsive transcription factor 3a [Prunus salicina]
Length=231

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 117/192 (61%), Gaps = 18/192 (9%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAAR LRGPKAKTNFP+   ++ PP++N       
Sbjct  48   RDPWKKTRVWLGTFDSAEDAARAYDAAARILRGPKAKTNFPISC-AYPPPFYN-------  99

Query  778  NANDSFVDQQMY-----MQEHPILS-QRPTSSGMSSTVESFSGPRPPRQQTAAALPS--R  623
            N  D  ++ +++      Q+HP++  QRPTSS +SSTVESFSGPRPP Q T  A  S  R
Sbjct  100  NPTDQAIETKLFGSGYGFQDHPVVDPQRPTSSSLSSTVESFSGPRPPPQSTTIAAESSRR  159

Query  622  RHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRKP-LPFDLNLPPAVEYNVDAEA  446
            +     P V  +       SSS V   D +  ASSSFRK  LPFDLN PP  E       
Sbjct  160  KRQPRTPPVVPEDCHSDCDSSSSVVLDDGDFAASSSFRKTLLPFDLNFPPLDEEGELGGG  219

Query  445  YELQC-CTALCL  413
                  CTALCL
Sbjct  220  DGQDLRCTALCL  231



>ref|XP_009348308.1| PREDICTED: ethylene-responsive transcription factor 3-like [Pyrus 
x bretschneideri]
Length=230

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 121/197 (61%), Gaps = 28/197 (14%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAAR LRGPKAKTNF +      P ++N       
Sbjct  47   RDPWKKTRVWLGTFDSAEDAARAYDAAARILRGPKAKTNFQISC--AYPSFYN-------  97

Query  778  NANDSFVDQQMY-----MQEHPILS-QRPTSSGMSSTVESFSGPRPPRQQT--AAALPSR  623
            N  D  ++ +++      Q+HP +  QRP SS +SSTVESFSGPRPP Q T  AA L  R
Sbjct  98   NPTDPAIEAKLFGSGYGFQDHPAVDPQRPASSSLSSTVESFSGPRPPLQSTTVAAELTRR  157

Query  622  RHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRK-PLPFDLNLPPAVEYNVDAE-  449
            +     P V  +       SSS V + D + +ASSSFRK PLPFDLN PP    +VD E 
Sbjct  158  KRQPRTPPVVPEDCHSDCDSSSSVVEDDGDFVASSSFRKAPLPFDLNFPP---LDVDGES  214

Query  448  -----AYELQCCTALCL  413
                   +L+ CTALCL
Sbjct  215  GGGVDGQDLR-CTALCL  230



>ref|XP_008226996.1| PREDICTED: ethylene-responsive transcription factor 3-like [Prunus 
mume]
Length=231

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 118/192 (61%), Gaps = 18/192 (9%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAAR LRGPKAKTNFP+   ++ PP++N       
Sbjct  48   RDPWKKTRVWLGTFDSAEDAARAYDAAARILRGPKAKTNFPVSC-AYPPPFYN-------  99

Query  778  NANDSFVDQQMY-----MQEHPILS-QRPTSSGMSSTVESFSGPRPPRQQTAAALPS--R  623
            N  D  ++ +++      Q+HP++  QRPTSS +SSTVESFSGPRPP Q T  A  S  R
Sbjct  100  NPTDQAIETKLFGSGYGFQDHPVVDPQRPTSSSLSSTVESFSGPRPPPQSTTIAAESSRR  159

Query  622  RHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRKP-LPFDLNLPPAVEYNVDAEA  446
            +     P V  +       SSS V + D +  ASSSFRK  LPFDLN PP  E       
Sbjct  160  KRQPRTPPVVPEDCHSDCDSSSSVVEDDGDFAASSSFRKTLLPFDLNFPPLDEEGELGGG  219

Query  445  YELQC-CTALCL  413
                  CTALCL
Sbjct  220  DGQDLRCTALCL  231



>ref|XP_007146520.1| hypothetical protein PHAVU_006G047800g [Phaseolus vulgaris]
 gb|ESW18514.1| hypothetical protein PHAVU_006G047800g [Phaseolus vulgaris]
Length=207

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 118/185 (64%), Gaps = 17/185 (9%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDP KK RVWLGTF+SAE AARAYDAAAR LRGPKAKTNFPLP P + P           
Sbjct  37   RDPLKKARVWLGTFDSAEDAARAYDAAARTLRGPKAKTNFPLPPPFYQP-----------  85

Query  778  NANDSFVDQQMYMQE-HPILSQR-PTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPVSQ  605
               D F D + +     P    R PTSSGMSSTVESFSGPR    +      +RR+P + 
Sbjct  86   ---DPFTDHRYFAGSGEPFHDHRQPTSSGMSSTVESFSGPRATAPRATPVTVARRYPRTP  142

Query  604  PvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAYELQC-C  428
            PVVP+DC SDCDSSSSVV+D D +N ASS  R+PLPFDLN+ P  + +V     +    C
Sbjct  143  PVVPEDCRSDCDSSSSVVEDGDGDNAASSFRREPLPFDLNVLPLEDADVPNGGMDNDMFC  202

Query  427  TALCL  413
            T LCL
Sbjct  203  TVLCL  207



>ref|XP_010500641.1| PREDICTED: ethylene-responsive transcription factor 3-like [Camelina 
sativa]
Length=235

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 120/204 (59%), Gaps = 37/204 (18%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQF----  791
            RDPWKK+RVWLGTF+SAE AARAYD+AARNLRGPKAKTNFP+  PS  PP  NL+F    
Sbjct  47   RDPWKKSRVWLGTFDSAEEAARAYDSAARNLRGPKAKTNFPI-DPS--PPSPNLRFAAFP  103

Query  790  ---NQRPNANDSFVDQQMY----------MQEHPILSQRPTSSGMSSTVESFSGPRPPRQ  650
               NQ  N  D F+D ++Y           Q HP+++ RPT S MSSTVESFSGPRP   
Sbjct  104  TTVNQNQNQVDPFMDHRLYPGDNNNNNNNQQFHPVVN-RPTCSSMSSTVESFSGPRP---  159

Query  649  QTAA---ALPSRRHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRK--PLPFDLN  485
             TAA      ++R+P + P              S    +D ++IASSS R+  P  FDLN
Sbjct  160  -TAAKPVTTAAKRYPRTPP---VVPEDCHSDCDSSSSVIDDDDIASSSRRRNPPFQFDLN  215

Query  484  LPPAVEYNVDAEAYELQCCTALCL  413
             PP  E+N   + +    CT L L
Sbjct  216  FPPLDEFNGSDDLH----CTDLRL  235



>ref|XP_009334154.1| PREDICTED: ethylene-responsive transcription factor 3-like [Pyrus 
x bretschneideri]
Length=230

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 120/197 (61%), Gaps = 28/197 (14%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAAR LRGPKAKTNF +      P ++N       
Sbjct  47   RDPWKKTRVWLGTFDSAEDAARAYDAAARILRGPKAKTNFQISC--AYPSFYN-------  97

Query  778  NANDSFVDQQMY-----MQEHPILS-QRPTSSGMSSTVESFSGPRPPRQQ--TAAALPSR  623
            N  D  ++ +++      Q+HP +  QRP SS +SSTVESFSGPRPP Q    AA L  R
Sbjct  98   NPTDPAIEAKLFGSGYGFQDHPAVDPQRPASSSLSSTVESFSGPRPPLQSMTVAAELTRR  157

Query  622  RHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRK-PLPFDLNLPPAVEYNVDAE-  449
            +     P V  +       SSS V + D + +ASSSFRK PLPFDLN PP    +VD E 
Sbjct  158  KRQPRTPPVVPEDCHSDCDSSSSVVEDDGDFVASSSFRKAPLPFDLNFPP---LDVDGES  214

Query  448  -----AYELQCCTALCL  413
                   +L+ CTALCL
Sbjct  215  GGGVDGQDLR-CTALCL  230



>gb|EPS68575.1| ethylene-responsive-element-binding factor 8 [Genlisea aurea]
Length=225

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 108/186 (58%), Gaps = 12/186 (6%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDP KKTRVWLGTF+SAE AARAYDAAA +LRGPKAK NFPLP       +++   NQ  
Sbjct  48   RDPLKKTRVWLGTFDSAEDAARAYDAAALSLRGPKAKINFPLPGNGGATDFNSRNPNQPQ  107

Query  778  NAN---DSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPVS  608
              N   DSF+  + Y Q+  +   RPTSSGMSSTVESFS PRP +Q T      RR+  S
Sbjct  108  IVNYHGDSFMGPEYYPQQQILAQLRPTSSGMSSTVESFSRPRPMQQPTLTQQQPRRYHRS  167

Query  607  QPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLN-LPPAVEYNVDAEAYELQC  431
             P          D  SS     + E   + S RKPLPFDLN LPP      DA+ Y   C
Sbjct  168  PP--MAPDDCHSDCDSSSSVVDNAECDTAPSCRKPLPFDLNMLPPG---GGDADDY---C  219

Query  430  CTALCL  413
            CT L L
Sbjct  220  CTVLRL  225



>ref|XP_002278022.1| PREDICTED: ethylene-responsive transcription factor 3 [Vitis 
vinifera]
Length=224

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 102/165 (62%), Gaps = 7/165 (4%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPL--PAPSHLPPYHNLQFNQ  785
            RDPWKKTRVWLGTF+S E AARAYDAAAR LRGPKAKTNFP    A   +P +      Q
Sbjct  47   RDPWKKTRVWLGTFDSPEEAARAYDAAARTLRGPKAKTNFPAVSGAAVAVPAFDRNLNGQ  106

Query  784  RPNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRP-PRQQTAAALPSRRHPVS  608
              + + + V +    QE  I +QRPTSSGMSSTVESFSGPRP P     A L  RRHP S
Sbjct  107  FGDGHHNRVYRADQFQEQQIHAQRPTSSGMSSTVESFSGPRPAPANLPPATL--RRHPRS  164

Query  607  QPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPA  473
             P          D  SS     + +  A++S RKPLPFDLN+ P+
Sbjct  165  PP--LLPDDCHSDCDSSSSVIDNGDIAAATSVRKPLPFDLNVMPS  207



>ref|XP_010252581.1| PREDICTED: ethylene-responsive transcription factor 3-like [Nelumbo 
nucifera]
Length=235

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 110/194 (57%), Gaps = 19/194 (10%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPY---------  806
            RDP KKTRVWLGTF+SAE AARAYD AAR LRGPKAKTNFPL +P    P          
Sbjct  49   RDPRKKTRVWLGTFDSAEDAARAYDTAARTLRGPKAKTNFPLSSPPQSYPLQQQQQHHHH  108

Query  805  -HNLQFNQRPNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALP  629
             H+L F Q P  ND   + Q++ Q H    QRPTSS MSSTVESFSGP+      + A P
Sbjct  109  HHHLAFQQNP--NDPHYNPQLHTQNHH-QPQRPTSSNMSSTVESFSGPKLSSAVHSVA-P  164

Query  628  SRRH--PVSQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVD  455
             R H      P  P           S    +D  +I SSSFRKPLPFDLNLPP  + +  
Sbjct  165  GRHHRRQNLPPPPPILPDDCHSDCDSSSSVIDDGDIVSSSFRKPLPFDLNLPPLDDVDFA  224

Query  454  AEAYELQCCTALCL  413
             + ++    TAL L
Sbjct  225  GDDFQ---STALRL  235



>ref|XP_007142329.1| hypothetical protein PHAVU_008G271100g [Phaseolus vulgaris]
 gb|ESW14323.1| hypothetical protein PHAVU_008G271100g [Phaseolus vulgaris]
Length=219

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 110/192 (57%), Gaps = 27/192 (14%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLP-----PYHNLQ  794
            RDP KK RVWLGTF+SAE AARAYDAAAR+LRGPKAKTNFPL  P   P     P     
Sbjct  45   RDPLKKARVWLGTFDSAEEAARAYDAAARSLRGPKAKTNFPLTHPFCYPHPTTNPLFYAG  104

Query  793  FNQRPNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAAL-----P  629
            F+   + N S  +            QRPTSSGMSSTVESFSGPRPP    A ++      
Sbjct  105  FHDNNHHNGSLNNP-----------QRPTSSGMSSTVESFSGPRPPAAAAATSMTPFLTT  153

Query  628  SRRHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAE  449
            +RR+P + P          D  SS     D +NI SSSFR PLPFDLN PP      DA 
Sbjct  154  TRRYPRTPP--LVPEDCHSDCDSSSSVVDDGDNIVSSSFRPPLPFDLNAPPF----DDAS  207

Query  448  AYELQCCTALCL  413
            A +   CTALCL
Sbjct  208  ADDDLRCTALCL  219



>gb|ACU20659.1| unknown [Glycine max]
Length=215

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 86/184 (47%), Positives = 104/184 (57%), Gaps = 13/184 (7%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNF-PLPAPSHLPPYHNLQFNQR  782
            RDPWKK RVWLGTF+SAE AARAYD AAR+ RGPKAKTNF P P P+    +  +   Q 
Sbjct  43   RDPWKKQRVWLGTFDSAEDAARAYDKAARSFRGPKAKTNFPPFPGPAEADHHSQIPLYQA  102

Query  781  PNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAA-LPSRRHPVSQ  605
               +  F        E  +   RPTSSGMSSTVESFSGPR P   + A  L    +P+  
Sbjct  103  HGLSTKF--------EPVVQVNRPTSSGMSSTVESFSGPRVPSSSSRAKPLVVVVNPIIP  154

Query  604  PvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAYELQCCT  425
                +D       SSS V     + +  SSFR+PLPFDLNLPP+   + + +       T
Sbjct  155  LNDDEDDCHSDCDSSSSVVGDGQDCVLISSFRQPLPFDLNLPPSDADDDNDDDLP---AT  211

Query  424  ALCL  413
            ALCL
Sbjct  212  ALCL  215



>ref|XP_007211978.1| hypothetical protein PRUPE_ppa010893mg [Prunus persica]
 gb|EMJ13177.1| hypothetical protein PRUPE_ppa010893mg [Prunus persica]
Length=231

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 116/192 (60%), Gaps = 18/192 (9%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAA  LRGPKAKTNFP+   ++ PP +N       
Sbjct  48   RDPWKKTRVWLGTFDSAEDAARAYDAAAHILRGPKAKTNFPISC-AYPPPLYN-------  99

Query  778  NANDSFVDQQMY-----MQEHPILS-QRPTSSGMSSTVESFSGPRPPRQQTAAALPS--R  623
            N  D  ++ +++      Q++P++  QRPTSS +SSTVESFSGPRPP Q T  A  S  R
Sbjct  100  NPTDQAIETKLFGSGYGFQDNPVVDPQRPTSSSLSSTVESFSGPRPPPQSTTIAAESSRR  159

Query  622  RHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRKP-LPFDLNLPPAVEYNVDAEA  446
            +     P V  +       SSS V + D +  ASSSFRK  LPFDLN PP  E       
Sbjct  160  KRQPRTPPVVPEDCHSDCDSSSSVVEDDGDFAASSSFRKTLLPFDLNFPPLDEEGELGGG  219

Query  445  YELQC-CTALCL  413
                  CTALCL
Sbjct  220  EGQDLRCTALCL  231



>ref|XP_010461919.1| PREDICTED: ethylene-responsive transcription factor 3-like [Camelina 
sativa]
Length=234

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 116/202 (57%), Gaps = 34/202 (17%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKK+RVWLGTF+SAE AARAYD+AARNLRGPKAKTNFP+   S   P  NL+F   P
Sbjct  47   RDPWKKSRVWLGTFDSAEEAARAYDSAARNLRGPKAKTNFPVDPSS---PSPNLRFAAFP  103

Query  778  NA---------NDSFVDQQMY-------MQEHPILSQRPTSSGMSSTVESFSGPRPPRQQ  647
                        D F+D ++Y        Q HP++  RPT S MSSTVESFSGPRP   +
Sbjct  104  TTVNQNQNQNQVDPFMDHRLYPGDNNNNQQFHPVV-NRPTCSSMSSTVESFSGPRPTAAK  162

Query  646  --TAAALPSRRHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRK--PLPFDLNLP  479
              T AA   +R+P + P              S    +D ++IASSS R+  P  FDLN+P
Sbjct  163  PVTTAA---KRYPRTPP---VVPEDCHSDCDSSSSVIDDDDIASSSRRRSPPFKFDLNIP  216

Query  478  PAVEYNVDAEAYELQCCTALCL  413
            P  E+N   + +    CT L L
Sbjct  217  PLDEFNGSDDLH----CTDLRL  234



>ref|XP_009361043.1| PREDICTED: ethylene-responsive transcription factor 3-like [Pyrus 
x bretschneideri]
Length=230

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 117/193 (61%), Gaps = 20/193 (10%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAAR LRGPKAKTNFP+      PP++N       
Sbjct  47   RDPWKKTRVWLGTFDSAEDAARAYDAAARILRGPKAKTNFPISC--AYPPFYN-------  97

Query  778  NANDSFVDQQMY-----MQEHPILS-QRPTSSGMSSTVESFSGPRPPRQQT--AAALPSR  623
            N  D  ++ +++      Q++P++  QRP SS +SSTVESFSGPRPP Q T  AA L   
Sbjct  98   NPTDPAIEAKLFGSGYGFQDNPVVHPQRPASSSLSSTVESFSGPRPPPQFTTMAAELSRP  157

Query  622  RHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRK-PLPFDLNLPPAVEYNVDAEA  446
            +     P +  +       SSS V + D + +ASSSFRK PLPFDLN PP          
Sbjct  158  KRQPRTPPMVPEDCHSDCDSSSSVVEDDEDFVASSSFRKAPLPFDLNFPPLDVDGDLGGG  217

Query  445  YELQC--CTALCL  413
             +     CTALCL
Sbjct  218  VDGHDLRCTALCL  230



>ref|XP_003519443.1| PREDICTED: ethylene-responsive transcription factor 3 [Glycine 
max]
Length=215

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 105/184 (57%), Gaps = 13/184 (7%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNF-PLPAPSHLPPYHNLQFNQR  782
            RDPWKK RVWLGTF+SAE AARAYD AAR+ RGPKAKTNF P P P+    +  +   Q 
Sbjct  43   RDPWKKQRVWLGTFDSAEDAARAYDKAARSFRGPKAKTNFPPFPGPAEADHHSQIPLYQA  102

Query  781  PNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAA-LPSRRHPVSQ  605
               +  F        E  +   RPTSSGMSSTVESFSGPR P   + A  L    +P+  
Sbjct  103  HGLSTKF--------EPVVQVNRPTSSGMSSTVESFSGPRVPSSSSRAKPLVVVVNPIIP  154

Query  604  PvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAYELQCCT  425
                +D       SSS V D   + +  SSFR+PLPFDLNLPP+   + + +       T
Sbjct  155  LNDDEDDCHSDCDSSSSVVDDGQDCVLISSFRQPLPFDLNLPPSDADDDNDDDLP---AT  211

Query  424  ALCL  413
            ALCL
Sbjct  212  ALCL  215



>ref|XP_008364528.1| PREDICTED: ethylene-responsive transcription factor 3-like [Malus 
domestica]
Length=230

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 116/193 (60%), Gaps = 20/193 (10%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAAR LRGPKAKTNFP+      PP +N       
Sbjct  47   RDPWKKTRVWLGTFDSAEDAARAYDAAARILRGPKAKTNFPISC--AYPPXYN-------  97

Query  778  NANDSFVDQQMY-----MQEHPILS-QRPTSSGMSSTVESFSGPRPPRQQT--AAALPSR  623
            N  D  ++ +++      Q++P++  QRP SS +SSTVESFSGPRPP Q T  AA L   
Sbjct  98   NPTDXXIEAKLFGSGYGFQDNPVVDPQRPASSSLSSTVESFSGPRPPPQFTTMAAELSRP  157

Query  622  RHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRK-PLPFDLNLPPAVEYNVDAEA  446
            +     P V  +       SSS V + D + +ASSSFRK PLPFDLN PP          
Sbjct  158  KRQPRTPPVVPEDCHSDCDSSSSVVEDDGDFVASSSFRKAPLPFDLNFPPLDVDGDLGGG  217

Query  445  YELQC--CTALCL  413
             +     CTALCL
Sbjct  218  VDGHDLRCTALCL  230



>ref|XP_006304201.1| hypothetical protein CARUB_v10010284mg [Capsella rubella]
 gb|EOA37099.1| hypothetical protein CARUB_v10010284mg [Capsella rubella]
Length=213

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 109/187 (58%), Gaps = 15/187 (8%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKK+RVWLGTF+SAE AARAYD+AARNLRGPKAKTNFP+     LP   NL F    
Sbjct  37   RDPWKKSRVWLGTFDSAEEAARAYDSAARNLRGPKAKTNFPI-----LPSSPNLPFPSTI  91

Query  778  NANDSFVDQQMYMQE----HPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALP-SRRHP  614
            N  D F+D +++  +    HP++  RPT S MSSTVESFSGPRP   +     P ++R+P
Sbjct  92   NQFDPFMDHRLFHADTNNTHPVV-NRPTCSSMSSTVESFSGPRPTSTKPVTTPPAAKRYP  150

Query  613  VSQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAYELQ  434
             + P        DC S       +  ++IAS     P  FDLN PP  + +    + +  
Sbjct  151  RTPP----VVPEDCHSDCDSSSSVIDDDIASRRRNPPFQFDLNFPPLDDVDFFNGSSDDL  206

Query  433  CCTALCL  413
             CT L L
Sbjct  207  HCTDLRL  213



>ref|XP_010545496.1| PREDICTED: ethylene-responsive transcription factor 3 [Tarenaya 
hassleriana]
 ref|XP_010545497.1| PREDICTED: ethylene-responsive transcription factor 3 [Tarenaya 
hassleriana]
 ref|XP_010545498.1| PREDICTED: ethylene-responsive transcription factor 3 [Tarenaya 
hassleriana]
 ref|XP_010545500.1| PREDICTED: ethylene-responsive transcription factor 3 [Tarenaya 
hassleriana]
Length=246

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 120/204 (59%), Gaps = 28/204 (14%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPA----PSHLPPYHNLQ-  794
            RDP KK+RVWLGTF+SAE AARAYD AAR LRGPKAKTNFP+      P HL   H  Q 
Sbjct  49   RDPLKKSRVWLGTFDSAEEAARAYDTAARRLRGPKAKTNFPIDCSRSSPQHLNHNHYQQQ  108

Query  793  ---------FNQRPNANDSFVDQQMYM----QEHPILSQRPTSSGMSSTVESFSGPRPP-  656
                     F    N  D F+D ++Y     ++ PI+S RP SS MSSTVESFSGPRPP 
Sbjct  109  QNPNLCSFPFPANENRIDPFMDHRLYTGNFPEQFPIIS-RPASSSMSSTVESFSGPRPPA  167

Query  655  RQQTAAALPSRRHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRK-PLPFDLNLP  479
             Q T+ A P++R+P + P          D  SS     D ++IASSS RK P  FDLNLP
Sbjct  168  NQTTSVAKPTKRYPRTPP--VVPEDCHSDCDSSSSVVDDGDDIASSSRRKLPFQFDLNLP  225

Query  478  PA--VEYNVDAEAYELQCCTALCL  413
            PA  V++ V  + +    CT L L
Sbjct  226  PANGVDFFVVGDDFH---CTDLRL  246



>gb|AHA82411.1| ERF transcription factor [Gossypium barbadense]
Length=207

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 112/187 (60%), Gaps = 22/187 (12%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYD AA  LRGPKAKTNFP+  PS+   +     ++R 
Sbjct  38   RDPWKKTRVWLGTFDSAEEAARAYDTAAMTLRGPKAKTNFPI-NPSNTTAFPIDHHHRRL  96

Query  778  NANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPR----PPRQQTA-AALPSRRHP  614
                +F D +M         QRPT S MSSTVESFSGPR    PP++ T  AA+ +R++ 
Sbjct  97   YPMGNFQDLEMN-------PQRPTRSSMSSTVESFSGPRPAQLPPQKSTDFAAVSTRKYR  149

Query  613  VSQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAYELQ  434
               P +  +       SSS V D     IASSS R+ LPFDLN PP        +A +L 
Sbjct  150  PRTPPLAPEDCHSDCDSSSSVVDDGV--IASSSRRRMLPFDLNFPPL------DDADDLH  201

Query  433  CCTALCL  413
             CTALCL
Sbjct  202  -CTALCL  207



>ref|XP_008345035.1| PREDICTED: ethylene-responsive transcription factor 3-like [Malus 
domestica]
Length=229

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 111/188 (59%), Gaps = 11/188 (6%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAAR LRGPKAKTNFP+      PP++N   N   
Sbjct  47   RDPWKKTRVWLGTFDSAEDAARAYDAAARILRGPKAKTNFPISC--AYPPFYN---NPTD  101

Query  778  NANDSFVDQQMYMQEHPILS-QRPTSSGMSSTVESFSGPRPPRQQT--AAALPSRRHPVS  608
                         Q++P++  QRP SS +SSTVESFSGPRPP Q T  AA L   +    
Sbjct  102  TIEAKLFGSGYGFQDNPVVDPQRPASSSLSSTVESFSGPRPPPQFTTMAAELSRPKRQPR  161

Query  607  QPvvpddchsdcdssssvvddmdCENIASSSFRK-PLPFDLNLPPAVEYNVDAEAYELQC  431
             P V  +       SSS V + D + +ASSSFRK PLPFDLN PP           +   
Sbjct  162  TPPVVPEDCHSDCDSSSSVVEDDGDFVASSSFRKAPLPFDLNFPPLDVDGDLGGGVDGHD  221

Query  430  --CTALCL  413
              CTALCL
Sbjct  222  LRCTALCL  229



>gb|ADE41145.1| AP2 domain class transcription factor [Malus domestica]
Length=230

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 116/193 (60%), Gaps = 20/193 (10%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAAR LRGPKAKTNFP+      PP +N       
Sbjct  47   RDPWKKTRVWLGTFDSAEDAARAYDAAARILRGPKAKTNFPISC--AYPPLYN-------  97

Query  778  NANDSFVDQQMY-----MQEHPILS-QRPTSSGMSSTVESFSGPRPPRQQT--AAALPSR  623
            N  D  ++ +++      Q++P++  QRP SS +SSTVESFSGPRPP Q T  AA L   
Sbjct  98   NPTDPAIEAKLFGSGYGFQDNPVVDPQRPASSSLSSTVESFSGPRPPPQFTTMAAELSRP  157

Query  622  RHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRK-PLPFDLNLPPAVEYNVDAEA  446
            +     P V  +       SSS V + D + +ASSSFRK PLPFDLN PP          
Sbjct  158  KRQPRTPPVVPEDCHSDCDSSSSVVEDDGDFVASSSFRKAPLPFDLNFPPLDVDGDLGGG  217

Query  445  YELQC--CTALCL  413
             +     CTALCL
Sbjct  218  VDGHDLRCTALCL  230



>gb|AIL90391.1| ethylene responsive element binding factor [Daucus carota]
Length=209

 Score = 98.6 bits (244),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 91/162 (56%), Gaps = 20/162 (12%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAA N RGPKAKTNFP       P + N      P
Sbjct  47   RDPWKKTRVWLGTFDSAEDAARAYDAAAVNFRGPKAKTNFPFD-----PRFFN------P  95

Query  778  NANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPVS---  608
            N +    D  + +  H     RP SSGMSSTVESFSGP  P  Q AA+LPSRR P S   
Sbjct  96   NLSPFVPDNHLIVAAH-----RPASSGMSSTVESFSGPNRP-AQIAASLPSRRFPRSPPI  149

Query  607  QPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNL  482
             P           S       +   ++ SSS  KPL FDLN 
Sbjct  150  SPDDYHSDCDSSGSVVDNRQGVAHADVGSSSVCKPLGFDLNF  191



>gb|AFH56413.1| ethylene response factor 6, partial [Diospyros kaki]
Length=229

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 96/162 (59%), Gaps = 22/162 (14%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYD AAR+LRGPKA+TNFPL   SH        F+Q  
Sbjct  73   RDPWKKTRVWLGTFDSAEDAARAYDEAARSLRGPKARTNFPLSPYSH--------FDQ--  122

Query  778  NANDSFVDQQMYM-QEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPVSQP  602
            NAN  FVD+ MY  Q H I++QRPTSS +SSTVES SGP+PP+         R  P+   
Sbjct  123  NANHRFVDRWMYSPQHHQIIAQRPTSSSLSSTVESASGPKPPQAVVIPRRRRRTPPI---  179

Query  601  vvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPP  476
                          S  D          S RKPL FDLNLPP
Sbjct  180  --------FPYECHSDCDSSSSVVDDPISSRKPLAFDLNLPP  213



>ref|XP_011046715.1| PREDICTED: ethylene-responsive transcription factor 3 [Populus 
euphratica]
Length=219

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 127/185 (69%), Gaps = 15/185 (8%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAARNLRG KAKTNFP+   + L  + N   NQ P
Sbjct  47   RDPWKKTRVWLGTFDSAEDAARAYDAAARNLRGAKAKTNFPISTTNQLFNHQNQ--NQSP  104

Query  778  NANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQT---AAALPSRRHPVS  608
              ND F+D       H I  QRPTSS +SSTVESFSGPRPP+  T   +   P R HP  
Sbjct  105  --NDPFLDH------HSINPQRPTSSSLSSTVESFSGPRPPQPTTTTKSGNGPRRSHPRI  156

Query  607  QPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAYELQCC  428
             PVVP+DCHSDCDSSSSVVDD D  + ASS  RKPLPFDLN P   +  VD  + +   C
Sbjct  157  PPVVPEDCHSDCDSSSSVVDDRDVASAASSLCRKPLPFDLNFPTLDQ--VDFGSGDDLHC  214

Query  427  TALCL  413
            TALCL
Sbjct  215  TALCL  219



>emb|CDY36045.1| BnaC03g41530D [Brassica napus]
Length=217

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 108/181 (60%), Gaps = 12/181 (7%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQ-FNQR  782
            RDP KK+RVWLGTF+SAE AARAYDAAARNLRGPKAKTNFP+       P   LQ  N R
Sbjct  39   RDPLKKSRVWLGTFDSAEEAARAYDAAARNLRGPKAKTNFPI----DCSPSSPLQPLNHR  94

Query  781  PNANDSFVDQQMYMQEHP-ILSQRPTSSGMSSTVESFSGPRPPRQQTAAALP-SRRHPVS  608
             N  D F+D ++Y  E   I+  RP SS MSSTV+S SG RP     A  LP ++R+P +
Sbjct  95   -NQIDPFMDHRLYAGEQEVIIISRPASSTMSSTVKSCSGVRPASSSVAKPLPATKRYPRT  153

Query  607  QPvvpddchsdcdssssvvddmdCENIASSSFRK--PLPFDLNLPPAVEYNVDAEAYELQ  434
             P          D  SS     D ++IASSS R+  P  FDLN PP    ++ A A +L 
Sbjct  154  PP--VAPEDCRSDCDSSSSVVDDGDDIASSSSRRKPPFTFDLNFPPLDGVDLFAGADDLH  211

Query  433  C  431
            C
Sbjct  212  C  212



>ref|XP_007141662.1| hypothetical protein PHAVU_008G214700g [Phaseolus vulgaris]
 gb|ESW13656.1| hypothetical protein PHAVU_008G214700g [Phaseolus vulgaris]
Length=204

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 99/186 (53%), Gaps = 29/186 (16%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKK RVWLGTF+SAE AARAYDAAAR+ RGPKAKTNFP P P     +  +   Q  
Sbjct  44   RDPWKKQRVWLGTFDSAEDAARAYDAAARSFRGPKAKTNFPFPNPETDHSHSQIPLYQ--  101

Query  778  NANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPVSQPv  599
                         +  P+   RPT+SGMSSTVESFSGPR P   T        HP    V
Sbjct  102  --------AHGLSKFDPVQVNRPTTSGMSSTVESFSGPRVPSSSTL-------HPRKPVV  146

Query  598  vpddchsdcdssssvvddmdCEN---IASSSFRKPLPFDLNL-PPAVEYNVDAEAYELQC  431
             P       D  S        E+   + +SSFR+PLPFDLNL PP  + ++ A       
Sbjct  147  SPVVIPPLDDCHSDCDSSSVVEDEDCVLTSSFRQPLPFDLNLPPPGADDDIPA-------  199

Query  430  CTALCL  413
             T LCL
Sbjct  200  -TVLCL  204



>gb|AFR11378.1| ERF3 [Populus x canadensis]
Length=219

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 126/185 (68%), Gaps = 15/185 (8%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAAR LRG KAKTNFPL   + L  + N   NQ P
Sbjct  47   RDPWKKTRVWLGTFDSAEDAARAYDAAARTLRGAKAKTNFPLSTTNQLFNHQNQ--NQSP  104

Query  778  NANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQT---AAALPSRRHPVS  608
               D F+D       H I  QRPTSS +SSTVESFSGPRPP+  T   +   P R HP  
Sbjct  105  --TDPFLDH------HSINPQRPTSSSLSSTVESFSGPRPPQPTTTTKSGNGPRRTHPRI  156

Query  607  QPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAYELQCC  428
             PVVP+DCHSDCDSSSSVVDD D  + ASS  RKPLPFDLN PP  +  VD  + +   C
Sbjct  157  PPVVPEDCHSDCDSSSSVVDDRDVASAASSLCRKPLPFDLNFPPLDQ--VDFGSGDDLHC  214

Query  427  TALCL  413
            TALCL
Sbjct  215  TALCL  219



>emb|CED89883.1| ethylene-responsive transcription factor 7 [Cucumis sativus]
Length=214

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 110/192 (57%), Gaps = 30/192 (16%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYD AA  LRG KAKTNFPLP P+         F+  P
Sbjct  43   RDPWKKTRVWLGTFDSAEDAARAYDHAAITLRGSKAKTNFPLPNPTSF-------FDYPP  95

Query  778  ---NANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAAL---PSRRH  617
               NA D F D +  +        RPTSS +SSTVESFSGPRPP     A     PSRR+
Sbjct  96   HPVNAPDPFPDPRYQI--------RPTSSSLSSTVESFSGPRPPSSSLPALTSTSPSRRY  147

Query  616  PVSQPvvpddchsdcdssssvvddmdCENIASSSF----RKPLPFDLNLPPAVEYNVDAE  449
            P + P          D  SS     D ++IASS      + PLPFDLN+PP+  ++  ++
Sbjct  148  PRTPP--LLLEDCHSDCDSSSSVIDDGDDIASSPVVPRKKTPLPFDLNIPPSDLFDFSSD  205

Query  448  AYELQCCTALCL  413
                  CTALCL
Sbjct  206  DLR---CTALCL  214



>ref|XP_004167752.1| PREDICTED: ethylene-responsive transcription factor 7-like [Cucumis 
sativus]
 gb|KGN56099.1| hypothetical protein Csa_3G073900 [Cucumis sativus]
Length=214

 Score = 95.5 bits (236),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 110/192 (57%), Gaps = 30/192 (16%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYD AA  LRG KAKTNFPLP P+         F+  P
Sbjct  43   RDPWKKTRVWLGTFDSAEDAARAYDHAAITLRGSKAKTNFPLPNPTSF-------FDYPP  95

Query  778  ---NANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAAL---PSRRH  617
               NA D F D +  +        RPTSS +SSTVESFSGPRPP     A     PSRR+
Sbjct  96   HPVNAPDPFPDPRYQI--------RPTSSSLSSTVESFSGPRPPSSSLPALTSTSPSRRY  147

Query  616  PVSQPvvpddchsdcdssssvvddmdCENIASSSF----RKPLPFDLNLPPAVEYNVDAE  449
            P + P          D  SS     D ++IASS      + PLPFDLN+PP+  ++  ++
Sbjct  148  PRTPP--LLPEDCHSDCDSSSSVIDDGDDIASSPVVPRKKTPLPFDLNIPPSDLFDFSSD  205

Query  448  AYELQCCTALCL  413
                  CTALCL
Sbjct  206  DLR---CTALCL  214



>ref|XP_002298817.1| Ethylene responsive element binding factor 3 family protein [Populus 
trichocarpa]
 gb|ABK94881.1| unknown [Populus trichocarpa]
 gb|EEE83622.1| Ethylene responsive element binding factor 3 family protein [Populus 
trichocarpa]
Length=219

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 112/185 (61%), Positives = 127/185 (69%), Gaps = 15/185 (8%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAAR LRG KAKTNFP+   + L  +++   NQ P
Sbjct  47   RDPWKKTRVWLGTFDSAEDAARAYDAAARTLRGAKAKTNFPISTTNQL--FNHQNQNQSP  104

Query  778  NANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQT---AAALPSRRHPVS  608
               D F+D       H I  QRPTSS +SSTVESFSGPRPP+  T   +   P R HP  
Sbjct  105  --TDPFLDH------HSINPQRPTSSSLSSTVESFSGPRPPQPTTTTKSGNGPRRSHPRI  156

Query  607  QPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAYELQCC  428
             PVVP+DCHSDCDSSSSVVDD D  + ASS  RKPLPFDLN PP  +  VD  + +   C
Sbjct  157  PPVVPEDCHSDCDSSSSVVDDRDVASAASSLCRKPLPFDLNFPPLDQ--VDLGSGDDLHC  214

Query  427  TALCL  413
            TALCL
Sbjct  215  TALCL  219



>ref|XP_002894264.1| ATERF3/ERF3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70523.1| ATERF3/ERF3 [Arabidopsis lyrata subsp. lyrata]
Length=224

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 111/182 (61%), Gaps = 12/182 (7%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKK RVWLGTF+SA  AARAYD+AARNLRGPKAKTNFP+   S  P     Q   + 
Sbjct  44   RDPWKKARVWLGTFDSAVEAARAYDSAARNLRGPKAKTNFPIDCSSPSPQQRFNQIQNQN  103

Query  778  NAN-DSFVDQQMYM---QEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPV  611
                D F+D ++Y    Q+ PI++ RPTSS MSSTVESFSGPRP   + A    ++R+P 
Sbjct  104  QNQVDPFMDHRLYADHQQQFPIVN-RPTSSSMSSTVESFSGPRPTTMKPAT---TKRYPR  159

Query  610  SQPvvpddchsdcdssssvvddmdCENIASSSFRK--PLPFDLNLPPAVEYNVDAEAYEL  437
            + P          D  SS    +D ++IASSS R+  P  FDLN PP  + ++   + +L
Sbjct  160  TPP--VVPEDCHSDCDSSSSVIVDDDDIASSSRRRNPPFQFDLNFPPLDDVDLFNGSDDL  217

Query  436  QC  431
             C
Sbjct  218  HC  219



>emb|CBI26688.3| unnamed protein product [Vitis vinifera]
Length=252

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 94/163 (58%), Gaps = 28/163 (17%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+S E AARAYDAAAR LRGPKAKTNFP                   
Sbjct  100  RDPWKKTRVWLGTFDSPEEAARAYDAAARTLRGPKAKTNFP-------------------  140

Query  778  NANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRP-PRQQTAAALPSRRHPVSQP  602
                +     +  QE  I +QRPTSSGMSSTVESFSGPRP P     A L  RRHP S P
Sbjct  141  ----AVSGAAVAFQEQQIHAQRPTSSGMSSTVESFSGPRPAPANLPPATL--RRHPRSPP  194

Query  601  vvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPA  473
                      D  SS     + +  A++S RKPLPFDLN+ P+
Sbjct  195  --LLPDDCHSDCDSSSSVIDNGDIAAATSVRKPLPFDLNVMPS  235



>ref|XP_004143195.1| PREDICTED: ethylene-responsive transcription factor 3-like [Cucumis 
sativus]
 ref|XP_004172004.1| PREDICTED: ethylene-responsive transcription factor 3-like [Cucumis 
sativus]
 ref|XP_008456400.1| PREDICTED: ethylene-responsive transcription factor 3-like [Cucumis 
melo]
 gb|KGN47005.1| hypothetical protein Csa_6G167230 [Cucumis sativus]
Length=219

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 110/183 (60%), Gaps = 11/183 (6%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQR-  782
            RDPWKKTRVWLGTF+SAE AARAYD AAR LRG KAKTNFPL  PS +     + F Q  
Sbjct  47   RDPWKKTRVWLGTFDSAEEAARAYDNAARTLRGAKAKTNFPL-HPSTISIQQQIPFYQSP  105

Query  781  PNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPVSQP  602
            P+ +DS        +   + + RPTSS +SSTVESFSGPR     ++ ++  RR PV QP
Sbjct  106  PDLHDS---NGFGAKIECVQANRPTSSSLSSTVESFSGPRISNPLSSLSM-VRRRPV-QP  160

Query  601  vvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAYELQCCTA  422
                      D  SS     D E    +SFR+ LPFDLNLPP ++  VD    +LQ  TA
Sbjct  161  --VSPDDCHSDCDSSSSVVDDDEVCVLASFRRALPFDLNLPPPMDV-VDLTGDDLQ-ATA  216

Query  421  LCL  413
            LCL
Sbjct  217  LCL  219



>ref|XP_008449140.1| PREDICTED: ethylene-responsive transcription factor 3 [Cucumis 
melo]
Length=277

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 108/191 (57%), Gaps = 29/191 (15%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYD AA  LRG KAKTNFPLP P+         F+  P
Sbjct  107  RDPWKKTRVWLGTFDSAEDAARAYDNAAITLRGSKAKTNFPLPNPTSF-------FDYPP  159

Query  778  ---NANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQ--QTAAALPSRRHP  614
               NA D F D +  +        RPTSS +SSTVESFSGPRPP          PSRR+P
Sbjct  160  HPVNAPDPFPDPRFQI--------RPTSSSLSSTVESFSGPRPPSSLPTLTTTSPSRRYP  211

Query  613  VSQPvvpddchsdcdssssvvddmdCENIASSSF----RKPLPFDLNLPPAVEYNVDAEA  446
             + P          D  SS     D ++IASS      + PLPFDLN+PP+  ++   + 
Sbjct  212  RTPP--LLPEDCHSDCDSSSSVIDDGDDIASSPVVPRKKTPLPFDLNIPPSDLFDFSGDD  269

Query  445  YELQCCTALCL  413
                 CTALCL
Sbjct  270  LR---CTALCL  277



>ref|XP_004149347.1| PREDICTED: ethylene-responsive transcription factor 7-like [Cucumis 
sativus]
Length=275

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 110/192 (57%), Gaps = 30/192 (16%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYD AA  LRG KAKTNFPLP P+         F+  P
Sbjct  104  RDPWKKTRVWLGTFDSAEDAARAYDHAAITLRGSKAKTNFPLPNPTSF-------FDYPP  156

Query  778  ---NANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAAL---PSRRH  617
               NA D F D +  +        RPTSS +SSTVESFSGPRPP     A     PSRR+
Sbjct  157  HPVNAPDPFPDPRYQI--------RPTSSSLSSTVESFSGPRPPSSSLPALTSTSPSRRY  208

Query  616  PVSQPvvpddchsdcdssssvvddmdCENIASSSF----RKPLPFDLNLPPAVEYNVDAE  449
            P + P          D  SS     D ++IASS      + PLPFDLN+PP+  ++  ++
Sbjct  209  PRTPP--LLPEDCHSDCDSSSSVIDDGDDIASSPVVPRKKTPLPFDLNIPPSDLFDFSSD  266

Query  448  AYELQCCTALCL  413
                  CTALCL
Sbjct  267  DLR---CTALCL  275



>ref|XP_010270056.1| PREDICTED: ethylene-responsive transcription factor 3-like [Nelumbo 
nucifera]
Length=235

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 113/194 (58%), Gaps = 18/194 (9%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLP--------PYH  803
            RDP KKTRVWLGTF+SAE AARAYDAAARNLRGPKAKTNFPL +    P         YH
Sbjct  48   RDPLKKTRVWLGTFDSAEDAARAYDAAARNLRGPKAKTNFPLSSTPSYPQHHHQHQHHYH  107

Query  802  NLQFNQRPNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPR----PPRQQTAAA  635
            +L F Q P  ND   + Q++  +H    QRPTSS +SSTVESFSGPR     P  Q++ A
Sbjct  108  HLGFQQSP--NDPHYNPQLHPHQH-HQPQRPTSSSLSSTVESFSGPRLSSAGPVVQSSVA  164

Query  634  LPSRRHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVD  455
                R     P  P           S    +D  +I SSSFRKPLPFDLNLPP  E +  
Sbjct  165  PGRHRRQHHPPPPPVLPDDCHSDCDSSSSVIDDGDIVSSSFRKPLPFDLNLPPLDEVDFA  224

Query  454  AEAYELQCCTALCL  413
             + ++    T LCL
Sbjct  225  GDDFQ---STVLCL  235



>gb|KDP39187.1| hypothetical protein JCGZ_00944 [Jatropha curcas]
Length=221

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 117/176 (66%), Gaps = 25/176 (14%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAAR+LRG KAKTNFP  + S L P+         
Sbjct  52   RDPWKKTRVWLGTFDSAEDAARAYDAAARSLRGSKAKTNFPF-STSQLSPF------TYQ  104

Query  778  NANDSFVDQQMY----MQEHPILSQRPTSSGMSSTVESFSGPRPPRQQT---------AA  638
            N +D+ +D ++Y     QEH +  QRPTSS  SSTVESFSGPRPP   T           
Sbjct  105  NPSDTLIDHRLYTSNGFQEHHVNPQRPTSSSQSSTVESFSGPRPPVPATTTKKSGLLLTT  164

Query  637  ALPSRRHPVSQPvvpddchsdcdssssvvddmdCENIASSS--FRKPLPFDLNLPP  476
              P + H  + PVVP+DCHSDCDSSSSV D+    +IASSS   RKPLPFDLN PP
Sbjct  165  TAPRKYHRKTPPVVPEDCHSDCDSSSSVADNG---DIASSSSLCRKPLPFDLNFPP  217



>ref|XP_002275892.1| PREDICTED: ethylene-responsive transcription factor 3-like [Vitis 
vinifera]
Length=204

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 105/189 (56%), Gaps = 33/189 (17%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPS-------HLPPYHN  800
            RDPWKKTRVWLGTF+SAE AARAYDAAAR+LRGPKAKTNFPL +P+         P  + 
Sbjct  42   RDPWKKTRVWLGTFDSAEDAARAYDAAARSLRGPKAKTNFPLSSPAVPLTVPFQQPSQYQ  101

Query  799  LQFNQRPNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRR  620
            +Q            DQ    Q  P   QRPT+SGMSSTVESFSGPR       +  PS  
Sbjct  102  IQ------------DQNHSHQHQP---QRPTTSGMSSTVESFSGPR------LSNPPSAP  140

Query  619  HPVSQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAYE  440
                    P +       SSS V D    ++ SSS RKPLPFDLNL P  E   D +   
Sbjct  141  PRPRLRAPPVNDCQSDCDSSSSVIDECDGDLTSSS-RKPLPFDLNLLPPSEDGDDDDLD-  198

Query  439  LQCCTALCL  413
                TALCL
Sbjct  199  ---ATALCL  204



>ref|XP_010096105.1| Ethylene-responsive transcription factor 3 [Morus notabilis]
 gb|EXB63270.1| Ethylene-responsive transcription factor 3 [Morus notabilis]
Length=241

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 134/200 (67%), Gaps = 25/200 (13%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAAR LRGPKAKTNFP P  +  PP+    +    
Sbjct  49   RDPWKKTRVWLGTFDSAEDAARAYDAAARTLRGPKAKTNFPTPY-ALTPPF---CYQNNA  104

Query  778  NANDSFVDQ----QMY---------MQEHPILS-QRPTSSGMSSTVESFSGPRPPRQQTA  641
             AND F +     +MY          Q H I+  QRPT+S +SST+ESFSGPR  R    
Sbjct  105  AANDPFSENHHNGRMYGNGGGFPDHHQHHQIVHPQRPTTSSLSSTLESFSGPR--RTTAT  162

Query  640  AALPS----RRHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPA  473
             A P+    RR+P + PVVP+DCHSDCDSSSSV+DD + +  ASSS RKPLPFDLN PP 
Sbjct  163  IAPPAVSSRRRYPRTPPVVPEDCHSDCDSSSSVIDDAEGDFAASSSCRKPLPFDLNFPPL  222

Query  472  VEYNVDAEAYELQCCTALCL  413
             E +  ++ ++L  CTALCL
Sbjct  223  DEPDFASDGHDLH-CTALCL  241



>ref|XP_004491090.1| PREDICTED: ethylene-responsive transcription factor 3-like [Cicer 
arietinum]
Length=210

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 102/186 (55%), Gaps = 20/186 (11%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPL----PAPSHLPPYHNLQF  791
            RDPWKK RVWLGTF+SAE AARAYD AAR+ RGPKAKTNFPL       +      N Q 
Sbjct  41   RDPWKKARVWLGTFDSAEEAARAYDTAARSYRGPKAKTNFPLPEEENNHNSNNNIPNHQI  100

Query  790  NQRPNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPV  611
               PN       +    +  P+    PTSSGMSSTVESFSGPR P   T     SR H  
Sbjct  101  PLTPN-------RVGLSKLDPVQVNWPTSSGMSSTVESFSGPRVPSSSTTI---SRVHHA  150

Query  610  SQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAYELQC  431
             +P +        D  SS     D + + +SS RKPL  DLNLPP    N D E  E++ 
Sbjct  151  PRP-IVPIADCHSDCDSSSSVVDDQDFVLTSSVRKPLNIDLNLPPP---NSDDED-EIR-  204

Query  430  CTALCL  413
             TALCL
Sbjct  205  VTALCL  210



>ref|XP_010542116.1| PREDICTED: ethylene-responsive transcription factor 3-like, partial 
[Tarenaya hassleriana]
Length=212

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 120/190 (63%), Gaps = 22/190 (12%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDP KK RVWLGTF+SAE AARAYD AARNLRGPKAKTNFPLP         N+ ++ +P
Sbjct  37   RDPLKKARVWLGTFDSAEDAARAYDTAARNLRGPKAKTNFPLPDSP------NVNYHHQP  90

Query  778  NAND--------SFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSR  623
               D        S  ++       P+   RP SS MSSTVESFSGPR  R  +   +  R
Sbjct  91   YMADGGEGGGGGSEENRGTGFGSSPV--NRPASSSMSSTVESFSGPRVSRPGSEVVV-HR  147

Query  622  RHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAY  443
            + PV QP  PDDC SDCDSSSSVVDD D   + +SSFRK LPFDLNLPP +E   D ++ 
Sbjct  148  KKPV-QPRPPDDCRSDCDSSSSVVDDDDDCVL-TSSFRKVLPFDLNLPPPME---DHDSG  202

Query  442  ELQCCTALCL  413
            E    TALCL
Sbjct  203  EDLKVTALCL  212



>ref|XP_004294432.1| PREDICTED: ethylene-responsive transcription factor 7-like [Fragaria 
vesca subsp. vesca]
Length=229

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 113/188 (60%), Gaps = 12/188 (6%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDP+KK+RVWLGTF SAE AARAYDAAAR LRGPKAKTNFP  + SH   Y+N      P
Sbjct  48   RDPYKKSRVWLGTFESAEDAARAYDAAARVLRGPKAKTNFPTYS-SHF-CYNN---PTDP  102

Query  778  NANDS-FVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQT---AAALPSRRHPV  611
            N +   F     +  ++ +   RP SS +SSTVESFSGPRP  Q++    AA  SRR   
Sbjct  103  NFDGKLFGSGYGFQDDNQMGPARPASSSLSSTVESFSGPRPAPQRSTTIVAAESSRRKQP  162

Query  610  SQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNV--DAEAYEL  437
              P +  +       SSS V + D E  ASSSFRKPL FDLN PP  E +     + ++L
Sbjct  163  RTPPMDPEDCHSDCDSSSSVVEDDGEFAASSSFRKPLEFDLNFPPLDEVDAAGGGDGHDL  222

Query  436  QCCTALCL  413
               TALCL
Sbjct  223  -GWTALCL  229



>gb|AGE97358.1| ethylene response factor 3 [Tamarix hispida]
Length=249

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 96/208 (46%), Positives = 116/208 (56%), Gaps = 28/208 (13%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPL---PAPSHLPPYHNLQF-  791
            RDPWKK RVWLGTF+SAE AARAYD AAR+LRGPKAKTNFP+   P P + P Y+   + 
Sbjct  44   RDPWKKARVWLGTFDSAEEAARAYDDAARSLRGPKAKTNFPISSSPPPLNHPTYNPFGYP  103

Query  790  NQRPNANDSFVD--------------QQMYMQEHP----ILSQRPTSSGMSSTVESFSGP  665
              + + ND+ VD                 Y  E      +   RP SS MSSTVES+SGP
Sbjct  104  RVQIHRNDAVVDPYNNNNVIHGGGCLDHQYCGEDSSSAGVYINRPASSSMSSTVESYSGP  163

Query  664  R----PPRQQTAAALPSRRHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRKPLP  497
            R    P +   A A   RR P S P +  +       SSS V D D E+IASS+ +KPL 
Sbjct  164  RTVVLPTKTTAATAGQGRRQPRS-PPMVPEDCRSDCDSSSSVIDDDGEDIASSTVKKPLL  222

Query  496  FDLNLPPAVEYNVDAEAYELQCCTALCL  413
            FDLNL P    +VD    ++Q  TAL L
Sbjct  223  FDLNLAPPSVDDVDLSMEDIQ-ATALHL  249



>emb|CDY37113.1| BnaC06g03860D [Brassica napus]
Length=208

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 111/192 (58%), Gaps = 37/192 (19%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPL---PAPSHLPPYHNLQFN  788
            RDPWKK RVWLGTF+SA  AARAYDAAARNLRGPKAKTNFP+   P+P  + P       
Sbjct  44   RDPWKKARVWLGTFDSAVDAARAYDAAARNLRGPKAKTNFPIESSPSPPQIDP-------  96

Query  787  QRPNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALP----SRR  620
                    F+D ++Y      +S RPTSSGMSSTVES SG     Q+++ A P    ++R
Sbjct  97   --------FMDHRLYAG----VSSRPTSSGMSSTVESSSG-----QRSSVAKPMSTTAKR  139

Query  619  HPVSQPvvpddchsdcdssssvvddmdCENIASSSFRK---PLPFDLNLPPAVEYNVDAE  449
            +P + P V  +       SSS V D   ++IASSS R+   P  FDLN PP  +  +   
Sbjct  140  YPRT-PPVVPEDCHSDCGSSSSVVDDGDDDIASSSRRRNPPPFKFDLNFPPLDDVGLING  198

Query  448  AYELQCCTALCL  413
              +L  CT L L
Sbjct  199  VDDL--CTDLRL  208



>gb|EPS59785.1| ethylene-responsive transcription factor 3, partial [Genlisea 
aurea]
Length=156

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 78/117 (67%), Gaps = 13/117 (11%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFN-QR  782
            RDPWKKTRVWLGTF+SAE AARAYDAAAR+LRGPKAKTNFP P    + P+   +FN Q 
Sbjct  47   RDPWKKTRVWLGTFDSAEDAARAYDAAARSLRGPKAKTNFPSPGNDVVVPFR--EFNSQN  104

Query  781  PN----ANDSFVDQQMYMQEHPIL-SQRPTSSGMSSTVESFSGPRPPRQQTAAALPS  626
            PN     N+S      +  E  I+  QRP SSGMSSTVESFS     R +T   +PS
Sbjct  105  PNHPQIVNNSLAGAGFFPPEQSIIPQQRPVSSGMSSTVESFS-----RTRTTMIIPS  156



>ref|NP_175479.1| ethylene-responsive transcription factor 3 [Arabidopsis thaliana]
 sp|O80339.1|ERF82_ARATH RecName: Full=Ethylene-responsive transcription factor 3; Short=AtERF3; 
AltName: Full=Ethylene-responsive element-binding 
factor 3; Short=EREBP-3 [Arabidopsis thaliana]
 gb|AAF87871.1|AC012561_4 ethylene responsive element binding factor 3 [Arabidopsis thaliana]
 gb|AAG51201.1|AC079279_22 ethylene responsive element binding factor 3 (ERF3) [Arabidopsis 
thaliana]
 dbj|BAA32420.1| ethylene responsive element binding factor 3 [Arabidopsis thaliana]
 gb|ABF19048.1| At1g50640 [Arabidopsis thaliana]
 dbj|BAH30342.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE32574.1| ethylene-responsive transcription factor 3 [Arabidopsis thaliana]
Length=225

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 125/183 (68%), Gaps = 13/183 (7%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKK RVWLGTF+SAE AARAYD+AARNLRGPKAKTNFP+ + S      NL+FNQ  
Sbjct  44   RDPWKKARVWLGTFDSAEEAARAYDSAARNLRGPKAKTNFPIDSSSPP--PPNLRFNQIR  101

Query  778  NAN----DSFVDQQMYM---QEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRR  620
            N N    D F+D +++    Q+ PI++ RPTSS MSSTVESFSGPRP   + A    ++R
Sbjct  102  NQNQNQVDPFMDHRLFTDHQQQFPIVN-RPTSSSMSSTVESFSGPRPTTMKPAT---TKR  157

Query  619  HPVSQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAYE  440
            +P + PVVP+DCHSDCDSSSSV+DD D    +S     P  FDLN PP    ++   A +
Sbjct  158  YPRTPPVVPEDCHSDCDSSSSVIDDDDDIASSSRRRNPPFQFDLNFPPLDCVDLFNGADD  217

Query  439  LQC  431
            L C
Sbjct  218  LHC  220



>ref|XP_010557690.1| PREDICTED: ethylene-responsive transcription factor 3-like [Tarenaya 
hassleriana]
Length=222

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 122/188 (65%), Gaps = 18/188 (10%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKK RVWLGTF+SAE AARAYD AARNLRGPKAKTNFPL   +  P   N+ ++ +P
Sbjct  47   RDPWKKARVWLGTFDSAEDAARAYDRAARNLRGPKAKTNFPL---AETP---NVNYHHQP  100

Query  778  NANDSFVDQQMYMQEH--PILS----QRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRH  617
              N          +E+  P +      RP SS MSST+ESFSGPR  R +       R+ 
Sbjct  101  YTNCGGGGSGGGSEENRTPGIGSSPMNRPASSSMSSTLESFSGPRVSRPRPVVV--HRKK  158

Query  616  PVSQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAYEL  437
            PV QP  PDDCHSDCDSSSSVVDD D   + +SS RK LPFDLNLPP +E + D    +L
Sbjct  159  PV-QPRAPDDCHSDCDSSSSVVDDDDDCVL-TSSLRKVLPFDLNLPPPMEGH-DFSGEDL  215

Query  436  QCCTALCL  413
            +  TALCL
Sbjct  216  K-VTALCL  222



>gb|KFK35918.1| hypothetical protein AALP_AA4G053400 [Arabis alpina]
Length=195

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 76/119 (64%), Gaps = 25/119 (21%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKK+RVWLGTF+SA  AA+AYD+AARNLRGPKAKTNFP+     LPP         P
Sbjct  41   RDPWKKSRVWLGTFDSAIEAAKAYDSAARNLRGPKAKTNFPISI--SLPP---------P  89

Query  778  NANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPVSQP  602
               D F+D +        LS RPTSSGMSSTVESFS     R ++     ++R+P + P
Sbjct  90   QV-DPFMDHR--------LSDRPTSSGMSSTVESFS-----RSRSIITTTTKRYPRTPP  134



>ref|XP_006447664.1| hypothetical protein CICLE_v10016668mg [Citrus clementina]
 ref|XP_006469596.1| PREDICTED: ethylene-responsive transcription factor 3-like [Citrus 
sinensis]
 gb|ESR60904.1| hypothetical protein CICLE_v10016668mg [Citrus clementina]
Length=215

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 104/161 (65%), Gaps = 14/161 (9%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAAR+LRGPKAKTNFPL    ++    N    +  
Sbjct  45   RDPWKKTRVWLGTFDSAEDAARAYDAAARSLRGPKAKTNFPL----NISDSFNAPIREE-  99

Query  778  NANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAAL--PSRRHPVSQ  605
              N  F      +Q +     RPT+S MSSTVESFSGPRP  Q     L    ++  V Q
Sbjct  100  --NGGFCKFDSVVQVN-----RPTTSSMSSTVESFSGPRPANQLAPPRLQQQQQKKIVVQ  152

Query  604  PvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNL  482
            P   DDC SDCDSSSSV+DD D    +SS FRK LPFDLNL
Sbjct  153  PAAGDDCRSDCDSSSSVIDDGDDCVFSSSLFRKVLPFDLNL  193



>ref|XP_003544774.1| PREDICTED: ethylene-responsive transcription factor 3 [Glycine 
max]
Length=222

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 101/188 (54%), Gaps = 14/188 (7%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDP KK RVWLGTF+SAE AARAYD AARNLRG KAKTNFP      L P+        P
Sbjct  43   RDPLKKARVWLGTFDSAEDAARAYDTAARNLRGSKAKTNFP------LSPFCYQHPTTDP  96

Query  778  NANDSFVDQQMYMQEHPILS---QRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPVS  608
                 F D Q     +       QRPTSSGMSSTVESFSGPRPP   T    P       
Sbjct  97   FFYAGFHDHQNNSNNNNDNLNNPQRPTSSGMSSTVESFSGPRPPTTTTTTTTPFLTTTRR  156

Query  607  QPvv---pddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAYEL  437
             P       +       SSS V D   +NI SSSFR PLPFDLN  P  + +      +L
Sbjct  157  YPRTPPLVPEDCHSDCDSSSSVVDDSDDNIVSSSFRPPLPFDLNALP-FDDDAAVVDDDL  215

Query  436  QCCTALCL  413
            + CTALCL
Sbjct  216  R-CTALCL  222



>ref|XP_006406399.1| hypothetical protein EUTSA_v10021393mg [Eutrema salsugineum]
 gb|ESQ47852.1| hypothetical protein EUTSA_v10021393mg [Eutrema salsugineum]
Length=249

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 90/202 (45%), Positives = 113/202 (56%), Gaps = 29/202 (14%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDP KK+RVWLGTF+SAE AARAYDAAARNLRGPKAKTNFP+   S   P   L +    
Sbjct  46   RDPLKKSRVWLGTFDSAEDAARAYDAAARNLRGPKAKTNFPIDC-SPSSPLQPLNYQNHQ  104

Query  778  NAN--------------DSFVDQQMY----MQEHPILSQRPTSSGMSSTVESFSGPRPPR  653
            N N              D F+D ++Y     Q+  I+  RP SS MSSTV+SFSGPRP  
Sbjct  105  NQNMCSASPFAANQSQIDPFMDHRLYGGGNFQDQQIIISRPASSSMSSTVKSFSGPRPTT  164

Query  652  QQTAAA-----LP-SRRHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRK--PLP  497
             + A++     LP ++R+P + P          D  SS     D ++IASSS R+  P  
Sbjct  165  IEAASSSVAKPLPATKRYPRTPP--VAPEDCHSDCDSSSSVVDDGDDIASSSSRRKPPFQ  222

Query  496  FDLNLPPAVEYNVDAEAYELQC  431
            FDLN PP    ++ A   +L C
Sbjct  223  FDLNFPPLDGVDLFAGTDDLHC  244



>ref|XP_009145644.1| PREDICTED: ethylene-responsive transcription factor 7 [Brassica 
rapa]
Length=225

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 103/183 (56%), Gaps = 12/183 (7%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPL---PAPSHLPPYHNLQFN  788
            RDP KK+RVWLGTF+SA  AARAYD AARNLRGPKAKTNFP+   P+    P YH    +
Sbjct  43   RDPLKKSRVWLGTFDSAVEAARAYDQAARNLRGPKAKTNFPIDCSPSSPLQPLYHQNLRS  102

Query  787  QRPNANDSFVDQQMY--MQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHP  614
               +  D F+D ++Y    E  I+S RP SS MSSTV+SFSG RP          ++R+P
Sbjct  103  ANQSQIDPFMDHRLYGGGGEQQIIS-RPASSSMSSTVKSFSGQRPSSSVAKPLAAAKRYP  161

Query  613  VSQPvvpddchsdcdssssvvddmdCENIASSSFRK--PLPFDLNLPPAVEYNVDAEAYE  440
             + P          D  SS     D ++I SSS R+  P  FDLN PP     VD    +
Sbjct  162  RTPP--VAPEDCHSDCDSSSSVIDDGDDIVSSSTRRKPPFQFDLNFPPL--DGVDLFDDD  217

Query  439  LQC  431
            L C
Sbjct  218  LHC  220



>emb|CDX82253.1| BnaA03g35680D [Brassica napus]
Length=215

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 103/179 (58%), Gaps = 10/179 (6%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDP KK+RVWLGTF+SAE AARAYDAAARNLRGPKAKTNF +       P   LQ     
Sbjct  39   RDPLKKSRVWLGTFDSAEEAARAYDAAARNLRGPKAKTNFQI----DCSPSSPLQPLHHR  94

Query  778  NANDSFVDQQMYMQEHPI-LSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPVSQP  602
            N  D F+D ++Y  E  I +  RP SS MSSTV+S SG RP     A A  ++R+P + P
Sbjct  95   NQIDPFMDHRLYGGEQEIVIISRPASSSMSSTVKSCSGVRPASSSVAKAA-TKRYPRTPP  153

Query  601  vvpddchsdcdssssvvddmdCENIASSSFRK--PLPFDLNLPPAVEYNVDAEAYELQC  431
                      D  SS     D ++IASSS R+  P  FDLN PP    ++   A +L C
Sbjct  154  --VAPEDCRSDCDSSSSVVDDGDDIASSSSRRKPPFEFDLNFPPLDGVDLFVGADDLHC  210



>ref|XP_008362296.1| PREDICTED: ethylene-responsive transcription factor 3-like [Malus 
domestica]
 gb|ADE41130.1| AP2 domain class transcription factor [Malus domestica]
Length=227

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 98/195 (50%), Positives = 118/195 (61%), Gaps = 31/195 (16%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAP-----SHLPPYHNLQ  794
            RDPWKKTRVWLGTF+SAE AARAYDAAAR+LRGPKAKTNFP+PA       HLPP  +L 
Sbjct  51   RDPWKKTRVWLGTFDSAEDAARAYDAAARSLRGPKAKTNFPIPAEYDNNHHHLPPPSHLS  110

Query  793  FNQRPNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRR--  620
                   +D+  D         + + RPTSS +SSTVESFSGPRP  + T+   P RR  
Sbjct  111  L----YPDDTVCDV--------VQASRPTSSSLSSTVESFSGPRPRPRPTSDPQPQRRPV  158

Query  619  HPVSQPvvpddchsdcdssssvvddmdCENIASSSFRK--PLPFDLNLPPAVE----YNV  458
             PVS      +       SSS V D   + +  SSFR+  PLPFDLNLPP ++    +  
Sbjct  159  LPVS-----PEDCHSDCDSSSSVVDDGDDCVLMSSFRRISPLPFDLNLPPPMDGLDLFKS  213

Query  457  DAEAYELQCCTALCL  413
              + Y+LQ  TALCL
Sbjct  214  GDDDYDLQ-ATALCL  227



>gb|KDO59560.1| hypothetical protein CISIN_1g027990mg [Citrus sinensis]
Length=216

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 69/103 (67%), Gaps = 12/103 (12%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAAR+LRGPKAKTNFPL    ++    N    +  
Sbjct  45   RDPWKKTRVWLGTFDSAEDAARAYDAAARSLRGPKAKTNFPL----NISDSFNAPIREE-  99

Query  778  NANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQ  650
              N  F      +Q +     RPT+S MSSTVESFSGPRP  Q
Sbjct  100  --NGGFCKFDSVVQVN-----RPTTSSMSSTVESFSGPRPANQ  135



>ref|XP_002885365.1| hypothetical protein ARALYDRAFT_479554 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61624.1| hypothetical protein ARALYDRAFT_479554 [Arabidopsis lyrata subsp. 
lyrata]
Length=233

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 113/203 (56%), Gaps = 24/203 (12%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPA--PSHLPPYHNLQFNQ  785
            RDP KK+RVWLGTF+SA  AARAYD AARNLRGPKAKTNFP+     S L P + LQ NQ
Sbjct  34   RDPLKKSRVWLGTFDSAIEAARAYDTAARNLRGPKAKTNFPIDCSPSSPLQPLNYLQ-NQ  92

Query  784  R---PNAN----DSFVDQQMY----MQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAA  638
                P AN    D F+D ++Y     QE   +  RP SS MSSTV+S SGPRP     A+
Sbjct  93   NLCSPAANQNQIDPFMDHRLYGGGNFQEQQQIISRPASSSMSSTVKSCSGPRPMEAAAAS  152

Query  637  ALPS------RRHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRK--PLPFDLNL  482
            +  +      +R+P + P          D  SS     D ++IASSS R+  P  FDLN 
Sbjct  153  SSVAKPLHAIKRYPRTPP--VAPEDCHSDCDSSSSVIDDGDDIASSSSRRKPPFQFDLNF  210

Query  481  PPAVEYNVDAEAYELQCCTALCL  413
            PP    ++ A   +   CT L L
Sbjct  211  PPLDGVDLFAGGTDDLHCTDLRL  233



>emb|CDY25410.1| BnaA05g18740D [Brassica napus]
Length=659

 Score = 82.0 bits (201),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 103/183 (56%), Gaps = 12/183 (7%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPL---PAPSHLPPYHNLQFN  788
            RDP KK+RVWLGTF+SA  AARAYD AARNLRGPKAKTNFP+   P+    P YH    +
Sbjct  477  RDPLKKSRVWLGTFDSAVEAARAYDQAARNLRGPKAKTNFPIDCSPSSPLQPLYHQNLRS  536

Query  787  QRPNANDSFVDQQMY--MQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHP  614
               +  D F+D ++Y    E  I+S RP SS MSSTV+SFSG RP          ++R+P
Sbjct  537  ANQSQIDPFMDHRLYGGGGEQQIIS-RPASSSMSSTVKSFSGQRPSSSVAKPLAAAKRYP  595

Query  613  VSQPvvpddchsdcdssssvvddmdCENIASSSFRK--PLPFDLNLPPAVEYNVDAEAYE  440
             + P          D  SS     D ++I SSS R+  P  FDLN PP     VD    +
Sbjct  596  RTPP--VAPEDCHSDCDSSSSVIDDGDDIVSSSTRRKPPFQFDLNFPPL--DGVDLFDDD  651

Query  439  LQC  431
            L C
Sbjct  652  LHC  654



>ref|XP_010943238.1| PREDICTED: ethylene-responsive transcription factor 3-like [Elaeis 
guineensis]
 ref|XP_010943239.1| PREDICTED: ethylene-responsive transcription factor 3-like [Elaeis 
guineensis]
Length=223

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 96/181 (53%), Gaps = 8/181 (4%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKK RVWLGTF+SAE AARAYD AAR LRGPKAKTNFPL   S LPP      +   
Sbjct  44   RDPWKKARVWLGTFDSAEDAARAYDTAARALRGPKAKTNFPLGPGSSLPPALPFPSSTAA  103

Query  778  NANDSFVDQQMY---MQEHPILSQRPTSSGMSSTVESFSGPR----PPRQQTAAALPSRR  620
             A   F     +        +  QRPTSS +SSTVESFSGPR    P   ++ + L    
Sbjct  104  AAAAGFPFHHHHNPDSPPDLLPPQRPTSSSLSSTVESFSGPRLSAPPLPLRSNSHLRRPA  163

Query  619  HPVSQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAYE  440
             P   P V            S    +D  +IAS+  R+PLPFDLN  P  + +  A A  
Sbjct  164  KPPPPPRVLSGDQDCHSDCGSSSSVIDDGDIASAC-RQPLPFDLNFLPPADDDFHATALH  222

Query  439  L  437
            L
Sbjct  223  L  223



>ref|XP_006393127.1| hypothetical protein EUTSA_v10011689mg [Eutrema salsugineum]
 gb|ESQ30413.1| hypothetical protein EUTSA_v10011689mg [Eutrema salsugineum]
Length=305

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 123/200 (62%), Gaps = 30/200 (15%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPL----PAPSHLPPYHNLQF  791
            RDPWKK+RVWLGTF+SAE AARAYDAAARNLRGPKAKTNFP+     +P     + NL+F
Sbjct  107  RDPWKKSRVWLGTFDSAEEAARAYDAAARNLRGPKAKTNFPIDCSPSSPLQQQQHQNLRF  166

Query  790  -----NQRPNAN--DSFVDQQMYM--------QEHPILSQRPTSSGMSSTVESFSGPRPP  656
                 NQ  N N  D F+D ++Y         Q++PI+S+  +SS MSSTVESFSGPRP 
Sbjct  167  SSFPTNQIQNQNQVDPFMDHRLYGGVSLHLPEQQYPIVSRPTSSS-MSSTVESFSGPRP-  224

Query  655  RQQTAAALP---SRRHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRK--PLPFD  491
               TAA  P   ++R+P + P V  +       SSS V D   +++ASSS R+  P  FD
Sbjct  225  ---TAANKPPSTTKRYPRT-PPVVPEDCHSDCGSSSSVIDDGDDDLASSSRRRNPPFQFD  280

Query  490  LNLPPAVEYNVDAEAYELQC  431
            LN PP  + +    + +L C
Sbjct  281  LNFPPLDDVDFFNGSDDLHC  300



>ref|XP_003519594.1| PREDICTED: ethylene-responsive transcription factor 3-like [Glycine 
max]
Length=222

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 112/191 (59%), Gaps = 19/191 (10%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDP KK RVWLGTF+SAE AARAYDAAAR LRGPKAKTNFP      L P+        P
Sbjct  42   RDPLKKARVWLGTFDSAEDAARAYDAAARTLRGPKAKTNFP-----PLSPFCYPHPTTDP  96

Query  778  NANDSFVDQQMYMQEHPILS-QRPTSSGMSSTVESFSGPRPPRQQTAAA--------LPS  626
                 F DQ  +   + + + QRPTSSGMSSTVESFSGPRPP   T             +
Sbjct  97   FFYTGFHDQHHHHNNNNLNNPQRPTSSGMSSTVESFSGPRPPTTTTTTTITTATPFLTAT  156

Query  625  RRHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEA  446
            RR+P + P +  +       SSS V D   +NI SSSFR PLPFDLN   A+ ++  A  
Sbjct  157  RRYPRT-PPLVPEDCHSDCDSSSSVVDDGDDNIVSSSFRPPLPFDLN---ALPFDDAAAD  212

Query  445  YELQCCTALCL  413
             +L+  TALCL
Sbjct  213  DDLR-RTALCL  222



>emb|CDY29818.1| BnaC05g31720D [Brassica napus]
Length=652

 Score = 81.3 bits (199),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 109/188 (58%), Gaps = 19/188 (10%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPL---PAPSHLPPYHNLQFN  788
            RDP KK+RVWLGTF+SA  AARAYD AARNLRGPKAKTNFP+   P+    P YH    N
Sbjct  467  RDPLKKSRVWLGTFDSAVEAARAYDQAARNLRGPKAKTNFPIDCSPSSPLQPLYHQNHQN  526

Query  787  QRPNAN----DSFVDQQMY--MQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALP-  629
             R +AN    D F+D ++Y    E  I+S RP SS MSSTV+SFSG RP     A  LP 
Sbjct  527  LR-SANQSQIDPFMDHRLYGGGGEQQIIS-RPASSSMSSTVKSFSGQRPS-SSVAKPLPA  583

Query  628  SRRHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRK--PLPFDLNLPPAVEYNVD  455
            ++R+P + P          D  SS     D ++I SSS R+  P  FDLN PP     VD
Sbjct  584  AKRYPRTPP--VAPEDCHSDCDSSSSVIDDGDDIVSSSTRRKPPFQFDLNFPPL--DGVD  639

Query  454  AEAYELQC  431
                +L C
Sbjct  640  LFDDDLHC  647



>ref|XP_009135680.1| PREDICTED: ethylene-responsive transcription factor 7-like [Brassica 
rapa]
Length=215

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 104/181 (57%), Gaps = 14/181 (8%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPA--PSHLPPYHNLQFNQ  785
            RDP KK+RVWLGTF+SAE AARAYDAAARNLRGPKAKTNF +     S L P H+     
Sbjct  39   RDPLKKSRVWLGTFDSAEEAARAYDAAARNLRGPKAKTNFQIDCSPSSPLQPLHHR----  94

Query  784  RPNANDSFVDQQMYMQEHP-ILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPVS  608
              N  D F+D ++Y  E   ++  RP SS MSSTV+S SG RP     A A  ++R+P +
Sbjct  95   --NQIDPFMDHRLYGGEQEVVIISRPASSSMSSTVKSCSGVRPASSSVAKAA-TKRYPRT  151

Query  607  QPvvpddchsdcdssssvvddmdCENIASSSFRK--PLPFDLNLPPAVEYNVDAEAYELQ  434
             P          D  SS     D ++IASSS R+  P  FDLN P     ++   A +L 
Sbjct  152  PP--VAPEDCRSDCDSSSSVVDDGDDIASSSSRRKPPFEFDLNFPTLDGVDLFVGADDLH  209

Query  433  C  431
            C
Sbjct  210  C  210



>gb|AAZ83347.1| ethylene-responsive element-binding factor [Gossypium hirsutum]
Length=225

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 101/176 (57%), Gaps = 12/176 (7%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDP KKTRVWLGTF+SAE AARAYDAAA   RG KAKTNFP  + S  P +  +  + R 
Sbjct  46   RDPLKKTRVWLGTFDSAEEAARAYDAAAITFRGNKAKTNFPFNS-SDFPAF-GIDRHHRR  103

Query  778  NANDSFVDQQMYMQ-----EHPILS-QRPTSSGMSSTVESFSGPR---PPRQ-QTAAALP  629
            N      D   + Q     E P ++ QRP  S MSSTVESFSGPR   PPR+     A+ 
Sbjct  104  NNEGFIADGHRFHQTGGDYEDPEVNPQRPARSSMSSTVESFSGPRPTQPPRKPSDFEAVS  163

Query  628  SRRHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYN  461
            +R++    P +  +       SSS V D   ++  SSS RK LPFDLN PP  E +
Sbjct  164  TRKYHPKMPRMAPEDCRSDCDSSSSVVDDGDDDNVSSSRRKILPFDLNFPPLDEVD  219



>ref|XP_010060282.1| PREDICTED: ethylene-responsive transcription factor 3-like [Eucalyptus 
grandis]
Length=239

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 91/185 (49%), Gaps = 14/185 (8%)
 Frame = -2

Query  955  DPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRPN  776
            DP KK RVWLGTF SAE AARAYD AA   RG KAKTNFP    + L    + Q      
Sbjct  59   DPVKKARVWLGTFASAEEAARAYDLAAVRFRGSKAKTNFP----ASLYDRDDAQAQAPAR  114

Query  775  ANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPS------RRHP  614
                   ++   Q      QRPT S +SSTVESFSGPRPP    AAA         RR P
Sbjct  115  IRRHAAAREDPQQGRRAFPQRPTCSSLSSTVESFSGPRPPPSAAAAAPQQQPEKRYRRSP  174

Query  613  VSQPvvpddchsdcdssssvvddmdCENIASSSF---RKPLPFDLNLPPAVEYNVDAEAY  443
              +P           S          E  +S+S+   R PLPFDLNLPP+    VD +  
Sbjct  175  PVEPEDCQSDCDSSSSVVDDCGGGVEEGSSSTSWFRRRGPLPFDLNLPPS-SGGVDLDGE  233

Query  442  ELQCC  428
            +L+ C
Sbjct  234  DLRLC  238



>ref|XP_008449487.1| PREDICTED: ethylene-responsive transcription factor 3-like [Cucumis 
melo]
Length=214

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 72/99 (73%), Gaps = 6/99 (6%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF++AE AARAYD AA +LRGPKAKTNFPL  PS +  +  + F+Q+ 
Sbjct  41   RDPWKKTRVWLGTFDTAEDAARAYDEAALSLRGPKAKTNFPL-HPSTISVHQQIPFSQQF  99

Query  778  NANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPR  662
            + +  F +    +   P+   RPTSS +SSTVESFSGPR
Sbjct  100  HDSGGFCEISNII---PV--NRPTSSSLSSTVESFSGPR  133



>ref|XP_004140127.1| PREDICTED: ethylene-responsive transcription factor 3-like [Cucumis 
sativus]
 ref|XP_004156088.1| PREDICTED: ethylene-responsive transcription factor 3-like [Cucumis 
sativus]
 gb|KGN47972.1| hypothetical protein Csa_6G421660 [Cucumis sativus]
Length=214

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 72/99 (73%), Gaps = 6/99 (6%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF++AE AARAYD AA +LRGPKAKTNFPL  PS +  +  + F+Q+ 
Sbjct  41   RDPWKKTRVWLGTFDTAEDAARAYDEAALSLRGPKAKTNFPL-HPSTISVHQQIPFSQQF  99

Query  778  NANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPR  662
            + +  F +    +   P+   RPTSS +SSTVESFSGPR
Sbjct  100  HDSGGFCEISNII---PV--NRPTSSSLSSTVESFSGPR  133



>ref|XP_004304075.1| PREDICTED: ethylene-responsive transcription factor 3-like [Fragaria 
vesca subsp. vesca]
Length=227

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 88/185 (48%), Positives = 110/185 (59%), Gaps = 19/185 (10%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAAR+LRGPKAKTNF LP      P++  +FN   
Sbjct  59   RDPWKKTRVWLGTFDSAEDAARAYDAAARSLRGPKAKTNFSLPC----DPFYGGEFN---  111

Query  778  NANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPVSQPv  599
                   D  +  +   I + RPTSS +SSTVESFSGPR    +     P++R PV    
Sbjct  112  -------DDAICSKIDVIQASRPTSSSLSSTVESFSGPRVNSGKPPPMKPTQRRPVY--P  162

Query  598  vpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPP---AVEYNVDAEAYELQCC  428
            V  +       SSS V D   + + +SSFR+ LPFDLN+PP     +++ D    +    
Sbjct  163  VSPEDCHSDCDSSSSVVDDGDDCVLTSSFRRVLPFDLNMPPPMDGFDFSSDNVDDDDLRA  222

Query  427  TALCL  413
            TALCL
Sbjct  223  TALCL  227



>gb|AEX25891.1| ERF transcription factor 5 [Glycine max]
Length=211

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 97/160 (61%), Gaps = 9/160 (6%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFP-LPAPSHLPPYHNLQFNQR  782
            RDPWKK RVWLGTF+SAE AARAYD AAR+ RGPKAKTNFP  P P+    +H+ Q  Q 
Sbjct  39   RDPWKKQRVWLGTFDSAEDAARAYDKAARSFRGPKAKTNFPSFPGPTD---HHSSQ--QI  93

Query  781  PNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPVSQP  602
            P    +     +  +  P    RPT+SGMSSTVESFSGPR P   +++  P        P
Sbjct  94   PPLYQA---HGLSTKFEPAQVNRPTTSGMSSTVESFSGPRVPPSSSSSRKPLVVVNPIIP  150

Query  601  vvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNL  482
            +  DD     D  SS     D + + +SSFR+PLPFDLNL
Sbjct  151  LDDDDDDCHSDCDSSSSVVDDQDCVLTSSFRQPLPFDLNL  190



>ref|XP_003545604.1| PREDICTED: ethylene-responsive transcription factor 3 [Glycine 
max]
Length=212

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 97/160 (61%), Gaps = 9/160 (6%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFP-LPAPSHLPPYHNLQFNQR  782
            RDPWKK RVWLGTF+SAE AARAYD AAR+ RGPKAKTNFP  P P+    +H+ Q  Q 
Sbjct  39   RDPWKKQRVWLGTFDSAEDAARAYDKAARSFRGPKAKTNFPSFPGPTD---HHSSQ--QI  93

Query  781  PNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPVSQP  602
            P    +     +  +  P    RPT+SGMSSTVESFSGPR P   +++  P        P
Sbjct  94   PPLYQA---HGLSTKFEPAQVNRPTTSGMSSTVESFSGPRVPPSSSSSRKPLVVVNPIIP  150

Query  601  vvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNL  482
            +  DD     D  SS     D + + +SSFR+PLPFDLNL
Sbjct  151  LDDDDDDCHSDCDSSSSVVDDQDCVLTSSFRQPLPFDLNL  190



>ref|XP_008801873.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor 3-like [Phoenix dactylifera]
Length=232

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 99/181 (55%), Gaps = 20/181 (11%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLP---PYHNLQFN  788
            RDPWKK RVWLGTF+SAE AARAYDAAAR LRGPKAKTNFP P PS      P+H  + +
Sbjct  65   RDPWKKARVWLGTFDSAEDAARAYDAAARALRGPKAKTNFPHPFPSSAAAGFPFHRRRHH  124

Query  787  QRPNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPR----PPRQQTAAALPSRR  620
                  D              L QRPTSS +SSTVESFSGPR    P   + ++ L    
Sbjct  125  DPATPPDL------------PLPQRPTSSSLSSTVESFSGPRLSAPPVPLRFSSHLRRSA  172

Query  619  HPVSQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAYE  440
            +P   P V            S    +D  +IA S +R+PLPFDLNL P  + +  A A  
Sbjct  173  NPPPPPRVLSGDQDCHSDCGSSSSVVDDGDIA-SVYRQPLPFDLNLLPPHDDDFHATALH  231

Query  439  L  437
            L
Sbjct  232  L  232



>ref|XP_009111164.1| PREDICTED: ethylene-responsive transcription factor 7-like [Brassica 
rapa]
Length=224

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 103/190 (54%), Gaps = 23/190 (12%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPA--PSHLPP--YHNLQF  791
            RDP KK+RVWLGTF+SA  AARAYDAAARNLRG KAKTNFP+     S L P  Y N   
Sbjct  39   RDPLKKSRVWLGTFDSAVEAARAYDAAARNLRGSKAKTNFPIDCSPSSPLQPLNYQNHHR  98

Query  790  NQRPNAN--DSFVDQQMYMQ------EHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAA  635
            N  PN N  D F+D ++Y        E   +  RP SS +SSTV+S SGPR      AA 
Sbjct  99   NLAPNQNQMDPFMDHRLYGGGGGSFPEQQQVISRPASSSLSSTVKSCSGPR-----AAAK  153

Query  634  LPSRRHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRK--PLPFDLNLPPAVEYN  461
               R HP + P          D  SS     D ++IASSS R+  P  FDLN PP     
Sbjct  154  ATKRYHPRTPP--VAPEDCHSDCDSSSSVIDDGDDIASSSSRRKAPFMFDLNFPPLD--G  209

Query  460  VDAEAYELQC  431
             D  A +L C
Sbjct  210  ADLFADDLHC  219



>ref|XP_010675777.1| PREDICTED: ethylene-responsive transcription factor 3 [Beta vulgaris 
subsp. vulgaris]
Length=242

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 97/197 (49%), Gaps = 26/197 (13%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYD AAR LRGPKAKTNF L      P   N+     P
Sbjct  57   RDPWKKTRVWLGTFDSAEDAARAYDKAARQLRGPKAKTNFSLS-----PQNDNVLLTSPP  111

Query  778  --NANDS-FVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPVS  608
              + ND+  VD    +    I  QRP SSGMSSTVES       +         + H  S
Sbjct  112  FYHQNDAVLVDHDEIIVAEMI--QRPASSGMSSTVES---SHAIKINHHHNHHRKEHVTS  166

Query  607  Q-PvvpddchsdcdssssvvddmdCENIASSSF-----------RKPLPFDLNLPPAVEY  464
              P+          S    VD  D +NI  SS            + PL FDLNLPP  E 
Sbjct  167  HVPMDCRSDCDSSSSVIDDVDGCDDDNIGCSSSVLAVGLTRNHQQPPLSFDLNLPPPPE-  225

Query  463  NVDAEAYELQCCTALCL  413
            N     ++    TALCL
Sbjct  226  NGGFFGFDDFPTTALCL  242



>ref|XP_009395279.1| PREDICTED: ethylene-responsive transcription factor 3-like [Musa 
acuminata subsp. malaccensis]
Length=207

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 99/185 (54%), Gaps = 21/185 (11%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPL-----PAPSHLPPYHNLQ  794
            RDPWKK RVWLGTF+SAE AARAYDAAA  LRGPKAKTNFPL     P P HLPP+    
Sbjct  33   RDPWKKARVWLGTFDSAEDAARAYDAAACALRGPKAKTNFPLSTSSSPTPQHLPPF----  88

Query  793  FNQRPNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHP  614
               RP+A    +  + +         RPTSS  SSTVES +GPR P    A  +  R   
Sbjct  89   ---RPSATRFPLGHRGHQPP---PPTRPTSSSHSSTVESCNGPRLPAAAAATPIHLRTAH  142

Query  613  VSQ------PvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDA  452
            + +      P V    +       S    +D +   +S++R+PLPFDLNL P  E ++  
Sbjct  143  LGRQANPPPPRVLAGENDCHSDCGSSCSVVDDDADIASAYRQPLPFDLNLHPPPEDDLHV  202

Query  451  EAYEL  437
                L
Sbjct  203  TVLRL  207



>gb|KHN38250.1| Ethylene-responsive transcription factor 3 [Glycine soja]
Length=231

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 107/186 (58%), Gaps = 19/186 (10%)
 Frame = -2

Query  943  KTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRPNANDS  764
            K+RVWLGTF++AE AARAYDAAAR LRGPKAKTNFP      L P+        P     
Sbjct  56   KSRVWLGTFDTAEEAARAYDAAARTLRGPKAKTNFP-----PLSPFCYPHPTTDPFFYTG  110

Query  763  FVDQQMYMQEHPILS-QRPTSSGMSSTVESFSGPR--------PPRQQTAAALPSRRHPV  611
            F DQ  +   + + + QRPTSSGMSSTVESFSGPR             T     +RR+P 
Sbjct  111  FHDQHHHHNNNNLNNPQRPTSSGMSSTVESFSGPRPPTTTTTTTTTTATPFLTATRRYPR  170

Query  610  SQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAYELQC  431
            + P +  +       SSS V D   +NI SSSFR PLPFDLN   A+ ++  A   +L+ 
Sbjct  171  T-PPLVPEDCHSDCDSSSSVVDDGDDNIVSSSFRPPLPFDLN---ALPFDDAAADDDLR-  225

Query  430  CTALCL  413
             TALCL
Sbjct  226  RTALCL  231



>gb|ACU20209.1| unknown [Glycine max]
Length=178

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 61/100 (61%), Gaps = 9/100 (9%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDP KK RVWLGTF+SAE AARAYD AARNLRG KAKTNFP      L P+        P
Sbjct  43   RDPLKKARVWLGTFDSAEDAARAYDTAARNLRGSKAKTNFP------LSPFCYQHPTTDP  96

Query  778  NANDSFVDQQMYMQEHPILS---QRPTSSGMSSTVESFSG  668
                 F D Q     +       QRPTSSGMSSTVESFSG
Sbjct  97   FFYAGFHDHQNNSNNNNDNLNNPQRPTSSGMSSTVESFSG  136



>gb|KFK39353.1| hypothetical protein AALP_AA3G233300 [Arabis alpina]
Length=232

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 104/191 (54%), Gaps = 17/191 (9%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPA--PSHLPPYHNLQFNQ  785
            RDP KK+RVWLGTF+SAE AA+AYD AARNLRGPKAKTNFP+ +   S L  Y N   N 
Sbjct  39   RDPLKKSRVWLGTFDSAEEAAKAYDTAARNLRGPKAKTNFPIDSSPSSPLNNYQNQIHNP  98

Query  784  RPNAN---DSFVDQQMY-----MQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALP  629
            + N +   D F+D ++Y         P    RP SS MSSTV+S SG RP      A   
Sbjct  99   KQNQHSQIDPFMDHRLYSGGGGGGNFPEQISRPASSSMSSTVKSCSGSRPVTAAATATSS  158

Query  628  S---RRHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRK--PLPFDLNLPPAVEY  464
                +R+P + P          D  SS     D ++IASSS R+  P  FDLN PP    
Sbjct  159  VAMMKRYPRTPP--VAPEDCHSDCDSSSSVIDDGDDIASSSTRRKQPFQFDLNFPPLDCV  216

Query  463  NVDAEAYELQC  431
            ++ A   +L C
Sbjct  217  DLFAGNDDLHC  227



>gb|AHA93908.1| ethylene response factor 9, partial [Coffea arabica]
Length=158

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 78/112 (70%), Gaps = 16/112 (14%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAAR LRGPKAKTNFPLP+ S    +H  QF+   
Sbjct  49   RDPWKKTRVWLGTFDSAEDAARAYDAAARTLRGPKAKTNFPLPSTSSY--HHPHQFSNYQ  106

Query  778  NANDS---------FVDQ---QMYMQE-HPILS-QRPTSSGMSSTVESFSGP  665
            N N+          F+D    ++Y  E H IL  QRPTSS +SSTVESFSGP
Sbjct  107  NPNNPNFNNNDPAMFIDHPQNRLYHPEPHQILHPQRPTSSSLSSTVESFSGP  158



>ref|NP_188666.1| ethylene-responsive transcription factor 7 [Arabidopsis thaliana]
 sp|Q9LDE4.1|ERF83_ARATH RecName: Full=Ethylene-responsive transcription factor 7; Short=AtERF7; 
AltName: Full=Ethylene-responsive element-binding 
factor 7; Short=EREBP-7 [Arabidopsis thaliana]
 dbj|BAA96653.1| ERF transcription factor 7 [Arabidopsis thaliana]
 dbj|BAB02811.1| ethylene responsive element binding factor-like protein [Arabidopsis 
thaliana]
 gb|AAK59855.1| AT3g20310/MQC12_6 [Arabidopsis thaliana]
 gb|AAM16262.1| AT3g20310/MQC12_6 [Arabidopsis thaliana]
 gb|AAM61581.1| ethylene responsive element binding factor, putative [Arabidopsis 
thaliana]
 dbj|BAF00387.1| putative ethylene responsive element binding factor [Arabidopsis 
thaliana]
 gb|AEE76362.1| ethylene-responsive transcription factor 7 [Arabidopsis thaliana]
Length=244

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 119/202 (59%), Gaps = 20/202 (10%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLP-APSH----LPPYHNLQ  794
            RDP KK+RVWLGTF+SA  AARAYD AARNLRGPKAKTNFP+  +PS     L   HN  
Sbjct  43   RDPLKKSRVWLGTFDSAVDAARAYDTAARNLRGPKAKTNFPIDCSPSSPLQPLTYLHNQN  102

Query  793  FNQRP---NANDSFVDQQMYMQEH------PILSQRPTSSGMSSTVESFSGPRPPRQQTA  641
                P   N  D F+D ++Y   +        +  RP SS MSSTV+S SGPRP     A
Sbjct  103  LCSPPVIQNQIDPFMDHRLYGGGNFQEQQQQQIISRPASSSMSSTVKSCSGPRPMEAAAA  162

Query  640  AALPS------RRHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLP  479
            ++  +      +R+P + PV P+DCHSDCDSSSSV+DD D    +SS  + P  FDLN P
Sbjct  163  SSSVAKPLHAIKRYPRTPPVAPEDCHSDCDSSSSVIDDGDDIASSSSRRKTPFQFDLNFP  222

Query  478  PAVEYNVDAEAYELQCCTALCL  413
            P    ++ A   +   CT L L
Sbjct  223  PLDGVDLFAGGIDDLHCTDLRL  244



>gb|KCW66915.1| hypothetical protein EUGRSUZ_F00659 [Eucalyptus grandis]
Length=230

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 86/182 (47%), Gaps = 17/182 (9%)
 Frame = -2

Query  955  DPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRPN  776
            DP KK RVWLGTF SAE AARAYD AA   RG KAKTNFP    + L    + Q      
Sbjct  59   DPVKKARVWLGTFASAEEAARAYDLAAVRFRGSKAKTNFP----ASLYDRDDAQAQAPAR  114

Query  775  ANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPS------RRHP  614
                   ++   Q      QRPT S +SSTVESFSGPRPP    AAA         RR P
Sbjct  115  IRRHAAAREDPQQGRRAFPQRPTCSSLSSTVESFSGPRPPPSAAAAAPQQQPEKRYRRSP  174

Query  613  VSQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAYELQ  434
              +P           S          E       R PLPFDLNLPP+    VD +  +L+
Sbjct  175  PVEPEDCQSDCDSSSSVVDDCGGGVEEG------RGPLPFDLNLPPS-SGGVDLDGEDLR  227

Query  433  CC  428
             C
Sbjct  228  LC  229



>ref|XP_010046158.1| PREDICTED: ethylene-responsive transcription factor 3-like [Eucalyptus 
grandis]
 gb|KCW88736.1| hypothetical protein EUGRSUZ_A01091 [Eucalyptus grandis]
Length=225

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 106/187 (57%), Gaps = 12/187 (6%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLP-----PYHNLQ  794
            RDPWKK R+WLGTF+SAE AARAYD AA +LRGPKAKTNFPL   + LP     P   L 
Sbjct  46   RDPWKKARIWLGTFDSAEDAARAYDEAALSLRGPKAKTNFPLDPLTGLPQAAPSPAALLP  105

Query  793  FNQRPNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHP  614
              +          +    ++  +   RPTSS +SSTVES+SGPR      A A+P R   
Sbjct  106  RPRPRPRPRGRRRRGPPAEDFHV--NRPTSSSLSSTVESYSGPR--VSHPAPAVP-RVVA  160

Query  613  VSQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAYELQ  434
            V +    D       SSS + D  DC  +A S FR+ L FDLNLPP +E + D +  EL+
Sbjct  161  VPRAPPEDCRSDCDSSSSVIDDVDDCCVLAPSCFRRALQFDLNLPPPLE-DADLDGEELR  219

Query  433  CCTALCL  413
              TAL L
Sbjct  220  -ATALRL  225



>ref|XP_009630856.1| PREDICTED: ethylene-responsive transcription factor 3-like, partial 
[Nicotiana tomentosiformis]
Length=200

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 98/188 (52%), Gaps = 35/188 (19%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFP----LPAPSHLPPYHNLQF  791
            RDP KKT+VWLGTF++ E  ARAYD +AR +RGPKAKTNFP    +       PY + QF
Sbjct  42   RDPIKKTQVWLGTFDTVEDVARAYDDSARAIRGPKAKTNFPNLVAITTQQDNNPYGSNQF  101

Query  790  NQRPNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPV  611
               PN+                   RP SS M ST+ES SGPR    +        R  +
Sbjct  102  ELFPNS-------------------RPASSSMGSTLESSSGPRGSGNKLI------RMKI  136

Query  610  SQPvvpddchsdcdssssvvddmdCENIASSSF--RKPLPFDLNLPPAVEYNVDAEAYEL  437
            S PV+  +       SSS V D  C+   +S F  ++PLPFDLNL P  + ++DA+   +
Sbjct  137  SHPVLLPEDCRSDCDSSSSVVDDHCDIDQTSLFLPKQPLPFDLNLSPPSD-DIDADDLHV  195

Query  436  QCCTALCL  413
               T LCL
Sbjct  196  ---TDLCL  200



>ref|XP_006298403.1| hypothetical protein CARUB_v10014475mg [Capsella rubella]
 gb|EOA31301.1| hypothetical protein CARUB_v10014475mg [Capsella rubella]
Length=249

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 88/209 (42%), Positives = 112/209 (54%), Gaps = 29/209 (14%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLP-APSHLPPYHN------  800
            RDP KK+RVWLGTF+SAE AARAYD AARNLRGPKAKTNFP+  +PS    YH+      
Sbjct  43   RDPLKKSRVWLGTFDSAEEAARAYDTAARNLRGPKAKTNFPIDCSPSSPLNYHHNQNQNQ  102

Query  799  ---------LQFNQRPNANDSFVDQQMY-----MQEHPILSQRPTSSGMSSTVESFSGPR  662
                        NQ  N  D F+D ++Y       +   +  RP SS MSSTV+S SGPR
Sbjct  103  NQNLCSAAAAPANQNQNQIDPFMDHRLYGGGNFQNQQQQIISRPASSSMSSTVKSCSGPR  162

Query  661  PPRQQTAAAL----PSRRHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRK--PL  500
            P    +++       ++R+P + P          D  SS     D ++IASSS R+  P 
Sbjct  163  PMEAASSSVAKPLHATKRYPRTPP--VAPEDCHSDCDSSSSVIDDGDDIASSSSRRKPPF  220

Query  499  PFDLNLPPAVEYNVDAEAYELQCCTALCL  413
             FDLN PP    ++ A A +   CT L L
Sbjct  221  QFDLNFPPLDGVDLFAGATDDLHCTDLRL  249



>ref|XP_007215910.1| hypothetical protein PRUPE_ppa010804mg [Prunus persica]
 gb|EMJ17109.1| hypothetical protein PRUPE_ppa010804mg [Prunus persica]
Length=235

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 118/204 (58%), Gaps = 41/204 (20%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPS---------HLPPY  806
            RDPWKKTRVWLGTF+SAE AARAYDAAAR+LRGPKAKTNFP P  +          LPP+
Sbjct  51   RDPWKKTRVWLGTFDSAEDAARAYDAAARSLRGPKAKTNFPPPTSAADYDINNNHRLPPH  110

Query  805  HNLQFNQRPNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPS  626
            H   ++     +D+  D         + + RPTSS +SSTVESFSGPRP  + T+ A   
Sbjct  111  HPSLYD-----DDTVCDV--------VQASRPTSSSLSSTVESFSGPRPQPRPTSDAQLQ  157

Query  625  RR--HPVSQPvvpddchsdcdssssvvddmdCENIASSSFRK--PLPFDLNLPPAVEYN-  461
            RR  HPV       D       SSS V D   + + +SSFR+  PLPFDLNLPP    + 
Sbjct  158  RRPVHPVP-----PDDCHSDCDSSSSVVDDGDDCVLTSSFRRVSPLPFDLNLPPPQMMDG  212

Query  460  --------VDAEAYELQCCTALCL  413
                    V  + ++LQ  TALCL
Sbjct  213  LDLFKSGEVCGDDHDLQ-ATALCL  235



>gb|ACM49844.1| ethylene responsive transcription factor 3b [Prunus salicina]
Length=235

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 118/204 (58%), Gaps = 41/204 (20%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPS---------HLPPY  806
            RDPWKKTRVWLGTF+SAE AARAYDAAAR+LRGPKAKTNFP P  +          LPP+
Sbjct  51   RDPWKKTRVWLGTFDSAEDAARAYDAAARSLRGPKAKTNFPPPTSAADYDINNNHRLPPH  110

Query  805  HNLQFNQRPNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRP-PRQQTAAALP  629
            H   ++     +D+  D         + + RPTSS +SSTVESFSGPRP PR  + A L 
Sbjct  111  HPSLYD-----DDTVCDV--------VQASRPTSSSLSSTVESFSGPRPQPRSNSDAQLQ  157

Query  628  SR-RHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRK--PLPFDLNLPP-----A  473
             R  HPV       D       SSS V D   + + + SFR+  PLPFDLNLPP      
Sbjct  158  RRPVHPVP-----PDDCHSDCDSSSSVVDDGDDCVLTPSFRRDSPLPFDLNLPPPPMMDG  212

Query  472  VEYNVDAEAY----ELQCCTALCL  413
            +++    E Y    +LQ  TALCL
Sbjct  213  LDFFKSGERYGDDHDLQ-ATALCL  235



>gb|KCW66914.1| hypothetical protein EUGRSUZ_F00659 [Eucalyptus grandis]
Length=237

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 84/170 (49%), Gaps = 13/170 (8%)
 Frame = -2

Query  955  DPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRPN  776
            DP KK RVWLGTF SAE AARAYD AA   RG KAKTNFP    + L    + Q      
Sbjct  59   DPVKKARVWLGTFASAEEAARAYDLAAVRFRGSKAKTNFP----ASLYDRDDAQAQAPAR  114

Query  775  ANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPS------RRHP  614
                   ++   Q      QRPT S +SSTVESFSGPRPP    AAA         RR P
Sbjct  115  IRRHAAAREDPQQGRRAFPQRPTCSSLSSTVESFSGPRPPPSAAAAAPQQQPEKRYRRSP  174

Query  613  VSQPvvpddchsdcdssssvvddmdCENIASSSF---RKPLPFDLNLPPA  473
              +P           S          E  +S+S+   R PLPFDLNLPP+
Sbjct  175  PVEPEDCQSDCDSSSSVVDDCGGGVEEGSSSTSWFRRRGPLPFDLNLPPS  224



>ref|XP_003616861.1| Ethylene responsive transcription factor [Medicago truncatula]
 gb|AES99819.1| ethylene response factor [Medicago truncatula]
Length=284

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 66/106 (62%), Gaps = 9/106 (8%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHL------PPYHNL  797
            RDPWKKTRVWLGT+++AE AA AYD+AA   R  KAKTNFP+  P H+            
Sbjct  67   RDPWKKTRVWLGTYDTAEQAALAYDSAAIKFRASKAKTNFPI--PEHILAAAAETAAVAA  124

Query  796  QFNQRPNANDSFVDQQMYMQEHPILSQR-PTSSGMSSTVESFSGPR  662
            Q  Q P A D+   + +   E  ++    PTSSGMSSTVESFSGPR
Sbjct  125  QNPQPPAAVDNRPAEVLKFVEPDVVQVNWPTSSGMSSTVESFSGPR  170



>ref|NP_001149587.1| ethylene-responsive transcription factor 3 [Zea mays]
 gb|ACG35955.1| ethylene-responsive transcription factor 3 [Zea mays]
Length=211

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 92/161 (57%), Gaps = 8/161 (5%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDP KK RVWLGTF+SAE AARAYDAAAR LRGPKA+TNFPLPA + L   H        
Sbjct  35   RDPAKKARVWLGTFDSAEDAARAYDAAARMLRGPKARTNFPLPAAAALHHPHMPAAAAAA  94

Query  778  NANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPVSQPv  599
                +       +   P ++ RP  S +SSTVESFSG RP                   +
Sbjct  95   APPYTTYPTATGVVSTPPVA-RPACSSLSSTVESFSGARPRPVLPPRF-------PPPSI  146

Query  598  vpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPP  476
               DC SDC SS+SVVDD   +  AS+S   PLPFDLNLPP
Sbjct  147  PDGDCRSDCGSSASVVDDDCTDAAASASCPFPLPFDLNLPP  187



>ref|XP_008229812.1| PREDICTED: ethylene-responsive transcription factor 3-like [Prunus 
mume]
Length=239

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 116/196 (59%), Gaps = 25/196 (13%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAAR+LRGPKAKTNFP P  +     +++  N R 
Sbjct  55   RDPWKKTRVWLGTFDSAEDAARAYDAAARSLRGPKAKTNFPPPTSAA---DYDINKNHRL  111

Query  778  NAND-SFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRR--HPVS  608
            + +  S  D         + + RPTSS +SSTVESFSGPRP  + T+ A   RR  HPV 
Sbjct  112  HPHHPSLYDDDTVCDV--VQASRPTSSSLSSTVESFSGPRPQPRPTSDAQLQRRPVHPVP  169

Query  607  QPvvpddchsdcdssssvvddmdCENIASSSFRK--PLPFDLNLPPAVEYN---------  461
                  +       SSS V D   + + +SSFR+  PLPFDLNLPP    +         
Sbjct  170  -----PEDCHSDCDSSSSVVDDCDDCVLTSSFRRVSPLPFDLNLPPPPMMDGLDLFKSGE  224

Query  460  VDAEAYELQCCTALCL  413
            V  + ++LQ  TALCL
Sbjct  225  VCGDDHDLQ-ATALCL  239



>ref|XP_010488002.1| PREDICTED: ethylene-responsive transcription factor 7-like [Camelina 
sativa]
Length=247

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 114/211 (54%), Gaps = 33/211 (16%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLP-APSHLPPYHNLQFNQR  782
            RDP KK+RVWLGTF+SAE AARAYDAAARNLRGPKAKTNFP+  +PS   P   L ++Q 
Sbjct  41   RDPLKKSRVWLGTFDSAEEAARAYDAAARNLRGPKAKTNFPIDCSPSS--PLQPLNYHQN  98

Query  781  PNAN------------DSFVDQQMYMQEH-------PILSQRPTSSGMSSTVESFSGPRP  659
             N N            D F+D ++Y   +         +  RP SS MSSTV+S SGPRP
Sbjct  99   QNRNQNLCSAANQNQIDPFMDHRLYGGGNFQDQHQQQQMISRPASSSMSSTVKSCSGPRP  158

Query  658  PRQQTAAA-------LPSRRHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRK--  506
              +  A++       +  +R+P + P          D  SS     D ++IASSS R+  
Sbjct  159  IAEAAASSSVAKPLHVIKKRYPRTPP--VAPEDCHSDCDSSSSVIDDGDDIASSSSRRKP  216

Query  505  PLPFDLNLPPAVEYNVDAEAYELQCCTALCL  413
            P  FDLN PP    ++   A +   CT L L
Sbjct  217  PFQFDLNFPPLDGVDLFPGATDDLHCTDLRL  247



>ref|XP_009395503.1| PREDICTED: ethylene-responsive transcription factor 3 [Musa acuminata 
subsp. malaccensis]
Length=212

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 96/183 (52%), Gaps = 17/183 (9%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKK RVWLGTF+SAE AARAYDAAA   RGPKAKTNFP    S            R 
Sbjct  38   RDPWKKARVWLGTFDSAEDAARAYDAAAIAFRGPKAKTNFPCSPSS----PPPPVPPFRS  93

Query  778  NANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPS------RR-  620
             ++  F     +    P   QRPT S +SSTVESFSGPR     TAAA P+      RR 
Sbjct  94   PSDARFAFGGRHPPPSPPPPQRPTCSSLSSTVESFSGPR----ITAAAAPTHVRASHRRR  149

Query  619  --HPVSQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEA  446
              +P  Q V+  +     D  SS     D     +S+  +PLPFDLNL P  + +  A A
Sbjct  150  QSNPPPQRVLVGEEDCHSDCGSSSSVVDDDNGDIASACPQPLPFDLNLLPPADDDFHAVA  209

Query  445  YEL  437
              L
Sbjct  210  LNL  212



>gb|AHL44126.1| EREB1 [Dendrobium catenatum]
Length=199

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 85/169 (50%), Gaps = 35/169 (21%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFP--LPAPSHLPPYHNLQFNQ  785
            RDP KKTRVWLGTF+SAE AARAYD AAR LRG KAKTNFP  +    H+    N QF  
Sbjct  45   RDPLKKTRVWLGTFDSAEDAARAYDVAARELRGSKAKTNFPPLIAGGIHV----NAQF--  98

Query  784  RPNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSG-----PRPPRQQTAAALPSRR  620
                                   RPTSS +SSTVESFSG     PRPP           R
Sbjct  99   --------------FPNPAPTPPRPTSSSLSSTVESFSGPRLSIPRPPSIHI-------R  137

Query  619  HPVSQ-PvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPP  476
             P +Q P+       DC S       +      +S +RKPLPFDLNL P
Sbjct  138  PPANQAPLRVLTGDEDCHSDCGSSSSVVDNGDVASEYRKPLPFDLNLLP  186



>ref|XP_009402848.1| PREDICTED: ethylene-responsive transcription factor 12-like [Musa 
acuminata subsp. malaccensis]
Length=172

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 44/62 (71%), Gaps = 5/62 (8%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPL-----PAPSHLPPYHNLQ  794
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KAKTNFP      P P HLPP   L 
Sbjct  26   RDPWKKTRVWLGTFDTPEEAALAYDRAARSLRGAKAKTNFPYHHTSAPPPLHLPPSATLD  85

Query  793  FN  788
             N
Sbjct  86   LN  87



>ref|XP_006842613.1| hypothetical protein AMTR_s00077p00176570 [Amborella trichopoda]
 gb|ERN04288.1| hypothetical protein AMTR_s00077p00176570 [Amborella trichopoda]
Length=205

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 95/187 (51%), Gaps = 47/187 (25%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPL-PAPSHLPPYHNLQFNQR  782
            RDPWKK+RVWLGTF++AEAAARAYDAAAR+LRGPKAKTNFPL   PS LP          
Sbjct  55   RDPWKKSRVWLGTFDTAEAAARAYDAAARSLRGPKAKTNFPLHHHPSSLP----------  104

Query  781  PNANDSFVDQQMYMQEHPILSQRPTSSGMSST---------VESFSGPRPPRQQTAAALP  629
                       +   + P+ S  P S+   +          VESFS PRPPR Q++ A P
Sbjct  105  ----------NIATTDAPLPSLLPPSNAAPAVSTSTTLSSTVESFSRPRPPRLQSSKA-P  153

Query  628  SRRHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPF-DLNLPPAVEYNVDA  452
            +    VSQ                   D D  +      R+PL F DLNLPP  E + + 
Sbjct  154  A----VSQ-----------AHQDPSHSDCDSSSSVVDDTRRPLLFIDLNLPPRDEEDEEL  198

Query  451  EAYELQC  431
            E+  L+ 
Sbjct  199  ESVALRL  205



>gb|ABB51576.1| putative ethylene responsive element binding factor [Brassica 
rapa subsp. pekinensis]
Length=139

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 60/101 (59%), Gaps = 12/101 (12%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPA----PSHLPPYHNLQF  791
            RDP KK+RVWLGTF+SA  AARAY AAARNLRG KAKTNFP+      P   P Y N   
Sbjct  39   RDPLKKSRVWLGTFDSAVEAARAYGAAARNLRGSKAKTNFPIDCSPSSPLQPPNYQNHHR  98

Query  790  NQRPNAN--DSFVDQQMYMQ------EHPILSQRPTSSGMS  692
            N  PN N  D F+D ++Y        E   +  RP SS +S
Sbjct  99   NLAPNQNQMDPFMDHRLYGGGGGSFPEQQQVISRPASSSLS  139



>ref|XP_010466214.1| PREDICTED: ethylene-responsive transcription factor 7-like [Camelina 
sativa]
Length=254

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 91/218 (42%), Positives = 113/218 (52%), Gaps = 40/218 (18%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPA--PSHLPP--YHN---  800
            RDP KK+RVWLGTF+SAE AARAYDAAARNLRGPKAKTNFP+     S L P  YH+   
Sbjct  41   RDPLKKSRVWLGTFDSAEEAARAYDAAARNLRGPKAKTNFPIDCSPSSPLQPINYHHQNQ  100

Query  799  -------------LQFNQRPNANDSFVDQQMYMQEH-------PILSQRPTSSGMSSTVE  680
                            NQ  N  D F+D ++Y   +         +  RP SS MSSTV+
Sbjct  101  NQNRNQNLCSAAAAAANQ--NQIDPFMDHRLYGGGNFQDQQQQQQMISRPASSSMSSTVK  158

Query  679  SFSGPRPPRQQTAAALP-------SRRHPVSQPvvpddchsdcdssssvvddmdCENIAS  521
            S SGPRP  +  A++          +R+P + P          D  SS     D ++IAS
Sbjct  159  SCSGPRPMAEAAASSSVAKPLHAIKKRYPRTPP--VAPEDCHSDCDSSSSVIDDGDDIAS  216

Query  520  SSFRK--PLPFDLNLPPAVEYNVDAEAYELQCCTALCL  413
            SS R+  P  FDLN PP    ++ A A +   CT L L
Sbjct  217  SSSRRKPPFQFDLNFPPLDGVDLFAGATDDLHCTDLRL  254



>ref|XP_008383896.1| PREDICTED: ethylene-responsive transcription factor 12 [Malus 
domestica]
Length=158

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHL  815
            RDPWKKTRVWLGTF++ E AA AYD AAR LRG KAKTNFP P PS +
Sbjct  31   RDPWKKTRVWLGTFDTPEEAALAYDGAARTLRGAKAKTNFPAPIPSGI  78



>ref|XP_008803496.1| PREDICTED: ethylene-responsive transcription factor 3-like [Phoenix 
dactylifera]
Length=227

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 95/189 (50%), Gaps = 20/189 (11%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNF------------PLPAPSHL  815
            RDPWKK+RVWLGTF+SAE AARAYDAAAR LRGPKAKTNF            P P+ + +
Sbjct  44   RDPWKKSRVWLGTFDSAEDAARAYDAAARALRGPKAKTNFPLPAGSPLPPPPPFPSSTAV  103

Query  814  PPYHNLQFNQRPNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPR---PPRQQT  644
             P     F      +            H     RPTSS +SSTVESFSGPR   PP    
Sbjct  104  APVAGFPFPHHHRHHHDPDSSPDLPPPH-----RPTSSSLSSTVESFSGPRLSAPPLPVR  158

Query  643  AAALPSRRHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEY  464
            + +   RR     P        DC S       +  +   +S+FR+PLPFDLNL P  + 
Sbjct  159  SNSHLRRRAKPPPPPRVLSGDQDCHSDCGSSSSVIDDGDIASAFRQPLPFDLNLLPPSDD  218

Query  463  NVDAEAYEL  437
            +  A    L
Sbjct  219  DFHATTLRL  227



>gb|ABU88496.1| putative ethylene responsive element binding factor [Prunus domestica]
Length=158

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHL  815
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KAKTNFP P P  L
Sbjct  14   RDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKAKTNFPAPVPGGL  61



>ref|XP_002865377.1| hypothetical protein ARALYDRAFT_494572 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41636.1| hypothetical protein ARALYDRAFT_494572 [Arabidopsis lyrata subsp. 
lyrata]
Length=199

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 49/82 (60%), Gaps = 7/82 (9%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDP KKTRVWLGTF++AE AARAYD AAR  RG KAKTNFPLP  S          +   
Sbjct  47   RDPGKKTRVWLGTFDTAEEAARAYDTAAREFRGSKAKTNFPLPGES-------TAISDGA  99

Query  778  NANDSFVDQQMYMQEHPILSQR  713
              NDS+V++        +  QR
Sbjct  100  GGNDSYVNRSALTAAREMTRQR  121



>ref|XP_008225132.1| PREDICTED: ethylene-responsive transcription factor 12 [Prunus 
mume]
 gb|ACM49843.1| ethylene responsive transcription factor 12 [Prunus salicina]
Length=172

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHL  815
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KAKTNFP P P  L
Sbjct  28   RDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKAKTNFPAPVPGGL  75



>ref|XP_007212159.1| hypothetical protein PRUPE_ppa012385mg [Prunus persica]
 gb|EMJ13358.1| hypothetical protein PRUPE_ppa012385mg [Prunus persica]
Length=172

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHL  815
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KAKTNFP P P  L
Sbjct  28   RDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKAKTNFPAPVPGGL  75



>ref|XP_009352875.1| PREDICTED: ethylene-responsive transcription factor 12 [Pyrus 
x bretschneideri]
Length=179

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHL  815
            RDPWKKTRVWLGTF++ E AA AYD AAR LRG KAKTNFP P PS +
Sbjct  31   RDPWKKTRVWLGTFDTPEEAALAYDGAARTLRGAKAKTNFPAPIPSGI  78



>ref|XP_008358678.1| PREDICTED: ethylene-responsive transcription factor 12-like [Malus 
domestica]
Length=179

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHL  815
            RDPWKKTRVWLGTF++ E AA AYD AAR LRG KAKTNFP P PS +
Sbjct  31   RDPWKKTRVWLGTFDTPEEAALAYDGAARTLRGAKAKTNFPAPIPSGI  78



>ref|XP_008371401.1| PREDICTED: ethylene-responsive transcription factor 12-like [Malus 
domestica]
Length=178

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHL  815
            RDPWKKTRVWLGTF++ E AA AYD AAR LRG KAKTNFP P PS +
Sbjct  31   RDPWKKTRVWLGTFDTPEEAALAYDGAARTLRGAKAKTNFPAPIPSGI  78



>ref|XP_009342721.1| PREDICTED: ethylene-responsive transcription factor 12-like [Pyrus 
x bretschneideri]
Length=178

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHL  815
            RDPWKKTRVWLGTF++ E AA AYD AAR LRG KAKTNFP P P  +
Sbjct  31   RDPWKKTRVWLGTFDTREEAALAYDGAARTLRGAKAKTNFPAPIPGGI  78



>ref|XP_004307758.1| PREDICTED: ethylene-responsive transcription factor 12-like [Fragaria 
vesca subsp. vesca]
Length=169

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 59/109 (54%), Gaps = 12/109 (11%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLP--------APSHLPPYH  803
            RDPWKKTRVWLGTF+S E AA AYD AAR LRG KAKTNF LP          + L    
Sbjct  29   RDPWKKTRVWLGTFDSPEEAALAYDDAARALRGNKAKTNFKLPPLTRGGGGGVADLSLNL  88

Query  802  NLQFNQRPNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPP  656
            N+   QR + +   V+         +L +   ++   S V S  GPRPP
Sbjct  89   NVSSAQRASHSGRLVE----FLRTGVLKKSENAAAGPSFVVSRVGPRPP  133



>ref|XP_001772402.1| predicted protein [Physcomitrella patens]
 gb|EDQ62873.1| predicted protein [Physcomitrella patens]
Length=95

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 43/56 (77%), Gaps = 1/56 (2%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQF  791
            RDPWKKTRVWLGTF++AE AARAYD+AAR LRG KAKTNF   APS      NL F
Sbjct  37   RDPWKKTRVWLGTFDTAEEAARAYDSAARALRGSKAKTNFAC-APSSDDQSTNLNF  91



>ref|XP_006449387.1| hypothetical protein CICLE_v10016982mg [Citrus clementina]
 ref|XP_006467752.1| PREDICTED: ethylene-responsive transcription factor 12-like [Citrus 
sinensis]
 gb|ACL78786.1| putative ethylene responsive element binding protein 1 [Citrus 
unshiu]
 gb|ESR62627.1| hypothetical protein CICLE_v10016982mg [Citrus clementina]
 gb|KDO77660.1| hypothetical protein CISIN_1g030994mg [Citrus sinensis]
Length=168

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLP  812
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KAKTNFP P  + LP
Sbjct  25   RDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKAKTNFPAPVTNSLP  73



>ref|XP_009147819.1| PREDICTED: ethylene-responsive transcription factor 3 [Brassica 
rapa]
Length=203

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 97/185 (52%), Gaps = 23/185 (12%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDP+KK+RVWLGTF+SA  AARAYDAAARNLRGPKAKTNFP+ +P   P           
Sbjct  39   RDPYKKSRVWLGTFDSAVDAARAYDAAARNLRGPKAKTNFPIESPPSPPRI---------  89

Query  778  NANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPVSQPv  599
               D F+D ++Y       +    SS + S+    S    P   TA     +R+P + P 
Sbjct  90   ---DPFMDHRLYAGASSRPTSSSMSSTVESSSGQRSSAAKPLSTTA-----KRYPRT-PP  140

Query  598  vpddchsdcdssssvvddmdCENIASSSFRK---PLPFDLNLPPAVEYNVDAEAYELQCC  428
            V  +       SSS V D   ++IASSS R+   P  FDLN PP  +  +     ++  C
Sbjct  141  VVPEDCHSDCGSSSSVIDDGDDDIASSSRRREPPPFKFDLNFPPLDDVGLIDGVDDI--C  198

Query  427  TALCL  413
            T L L
Sbjct  199  TDLRL  203



>ref|XP_010928245.1| PREDICTED: ethylene-responsive transcription factor 3-like [Elaeis 
guineensis]
Length=220

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 101/189 (53%), Gaps = 18/189 (10%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDP KKTRVWLGTF+SAE AARAYDAAA +LRG KAKTNFP P P    P   L  +  P
Sbjct  43   RDPAKKTRVWLGTFDSAEEAARAYDAAAISLRGCKAKTNFPTPCPPF--PAVPLPISSSP  100

Query  778  NANDSFVD--QQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSR-RHPVS  608
             A  +        Y ++     Q P SS  SSTVESFSG   PR+ +AA L S+ R   +
Sbjct  101  TAIAAAAAFPHTPYPRQRQPRPQWPASSSHSSTVESFSG---PRRSSAAPLRSQLRSQKA  157

Query  607  QPvvpddchsdcdssssvvddmdCE---NIASSSFRKPLPFDLN-LPPAVEYNVDAEAYE  440
             P        D  S       +  +   +IAS     PLPFDLN LPP  ++++  +   
Sbjct  158  DPPRVLPGEEDLHSDCGSSSSVVDDDLGDIASVYRHPPLPFDLNLLPPPDDHDLALD---  214

Query  439  LQCCTALCL  413
               CTAL L
Sbjct  215  ---CTALRL  220



>ref|XP_010111191.1| Ethylene-responsive transcription factor 12 [Morus notabilis]
 gb|EXC30582.1| Ethylene-responsive transcription factor 12 [Morus notabilis]
Length=183

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNL  797
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KAKTNFP P  + L    NL
Sbjct  30   RDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKAKTNFPAPVTAGLSLDLNL  83



>dbj|BAJ90918.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=210

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 58/99 (59%), Gaps = 9/99 (9%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSH--LPPYHNLQFNQ  785
            RDP KK RVWLGTF+SAE AARAYDAAAR LRGPKAKTNFPL  P H  LPP ++     
Sbjct  41   RDPAKKARVWLGTFDSAEDAARAYDAAARMLRGPKAKTNFPLSFPHHHQLPPSYSPYPVA  100

Query  784  RPNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSG  668
                                 + RP  S MSSTVESF G
Sbjct  101  AAA-------ATAVPTSVAAAAARPACSSMSSTVESFGG  132



>ref|XP_009394455.1| PREDICTED: ethylene-responsive transcription factor 9-like [Musa 
acuminata subsp. malaccensis]
Length=159

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPP  809
            RDPWKKTR WLGTF++AE AARAYD AAR+LRGPKAKTNF  P    +PP
Sbjct  32   RDPWKKTRKWLGTFDTAEEAARAYDEAARSLRGPKAKTNFGCPGDLGVPP  81



>ref|XP_010441914.1| PREDICTED: ethylene-responsive transcription factor 9-like [Camelina 
sativa]
Length=193

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 64/122 (52%), Gaps = 14/122 (11%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDP KKTRVWLGTF++AE AARAYD AAR  RG KAKTNFPLP  S      N   +   
Sbjct  42   RDPGKKTRVWLGTFDTAEEAARAYDTAAREFRGSKAKTNFPLPGESSASTMVNDGGD---  98

Query  778  NANDSFVD----QQMYMQEHPILSQRP--TSSGMSSTVESFSGPRPPRQQTAAALPSRRH  617
              N S+V+    ++M  Q  P   QR      G ++    F    P R     A  SR +
Sbjct  99   --NGSYVNRTAAREMTRQRFPFACQRERNVVDGYAAAGFFFD---PSRAAALRAELSRAY  153

Query  616  PV  611
            PV
Sbjct  154  PV  155



>ref|XP_009418395.1| PREDICTED: ethylene-responsive transcription factor 3-like [Musa 
acuminata subsp. malaccensis]
Length=124

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPP  809
            RDPWKKTR WLGTF++AE AARAYD AAR+LRGPKAKTNF  P    +PP
Sbjct  27   RDPWKKTRKWLGTFDTAEEAARAYDEAARSLRGPKAKTNFCRPGDLGIPP  76



>ref|XP_010272367.1| PREDICTED: ethylene-responsive transcription factor 12-like [Nelumbo 
nucifera]
Length=157

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPA  827
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KAKTNFP PA
Sbjct  24   RDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKAKTNFPAPA  67



>gb|KDP20998.1| hypothetical protein JCGZ_21469 [Jatropha curcas]
Length=163

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPA  827
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KAKTNFP PA
Sbjct  25   RDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKAKTNFPAPA  68



>ref|XP_002279760.1| PREDICTED: ethylene-responsive transcription factor 12 [Vitis 
vinifera]
Length=152

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPA  827
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KAKTNFP PA
Sbjct  25   RDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKAKTNFPAPA  68



>ref|XP_007025561.1| ERF domain protein 12 [Theobroma cacao]
 gb|EOY28183.1| ERF domain protein 12 [Theobroma cacao]
Length=172

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPA  827
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KAKTNFP PA
Sbjct  25   RDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKAKTNFPAPA  68



>gb|ADJ67437.1| ethylene response factor 8 [Actinidia deliciosa]
Length=157

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPS-HLPPYHNLQFNQR  782
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KAKTNFP P P   L    NL  +QR
Sbjct  25   RDPWKKTRVWLGTFDTPEEAAMAYDGAARSLRGAKAKTNFPQPHPLPELSLDLNLAADQR  84



>ref|XP_011096343.1| PREDICTED: ethylene-responsive transcription factor 12 [Sesamum 
indicum]
Length=150

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPA  827
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KAKTNFP PA
Sbjct  25   RDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKAKTNFPAPA  68



>ref|XP_011043423.1| PREDICTED: ethylene-responsive transcription factor 12-like [Populus 
euphratica]
Length=174

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 82/180 (46%), Gaps = 53/180 (29%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPL-PAPSHL---------PP  809
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KAKTNFP  P+ S L         P 
Sbjct  25   RDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKAKTNFPSPPSTSGLSFDLNLPSDPH  84

Query  808  YHNLQFNQRPN-ANDSFVDQQMYMQEHPILSQR----PTSSGMSSTVESFSGPRPPRQQT  644
            +H+L +N  P+  +  F     ++Q   + ++       ++  S +V    GP       
Sbjct  85   HHHLHWNSCPHLGSHRFGGFGEFLQTGVVFNEMNLHATEAAAASGSVAKNEGP-----GA  139

Query  643  AAALPSRRHPVSQPvvpddchsdcdssssvvddmdCENIASSSF----RKPLPFDLNLPP  476
             A  P+                              EN+A  SF    R+ LP DLN PP
Sbjct  140  VAGTPA-----------------------------PENVAPVSFLGIVRRGLPIDLNEPP  170



>gb|EYU28000.1| hypothetical protein MIMGU_mgv1a015643mg [Erythranthe guttata]
Length=150

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQR  782
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KAKTNFP  APS L    NL  + R
Sbjct  25   RDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKAKTNFP-AAPSGLSLDLNLPSDHR  82



>ref|NP_199234.1| ethylene-responsive transcription factor 9 [Arabidopsis thaliana]
 sp|Q9FE67.1|ERF80_ARATH RecName: Full=Ethylene-responsive transcription factor 9; Short=AtERF9; 
AltName: Full=Ethylene-responsive element-binding 
factor 9; Short=EREBP-9 [Arabidopsis thaliana]
 dbj|BAB10988.1| DNA binding protein EREBP-3-like protein [Arabidopsis thaliana]
 dbj|BAB18560.1| ERF domain protein 9 [Arabidopsis thaliana]
 gb|AAT44923.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana]
 gb|AAU95412.1| At5g44210 [Arabidopsis thaliana]
 gb|AAV43790.1| At5g44210 [Arabidopsis thaliana]
 gb|AED95075.1| ethylene-responsive transcription factor 9 [Arabidopsis thaliana]
Length=200

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 48/82 (59%), Gaps = 8/82 (10%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDP KKTRVWLGTF++AE AARAYD AAR  RG KAKTNFPLP  S              
Sbjct  49   RDPGKKTRVWLGTFDTAEEAARAYDTAAREFRGSKAKTNFPLPGESTTV--------NDG  100

Query  778  NANDSFVDQQMYMQEHPILSQR  713
              NDS+V++        +  QR
Sbjct  101  GENDSYVNRTTVTTAREMTRQR  122



>ref|XP_009780882.1| PREDICTED: ethylene-responsive transcription factor 3-like [Nicotiana 
sylvestris]
Length=201

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 105/188 (56%), Gaps = 35/188 (19%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFP----LPAPSHLPPYHNLQF  791
            RDP KKTRVWLGTF++AE AARAYD AAR LRGPKAKTNFP    +       PY + QF
Sbjct  43   RDPIKKTRVWLGTFDTAEDAARAYDDAARALRGPKAKTNFPNLAAITTQQDNNPYGSNQF  102

Query  790  NQRPNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPV  611
               PN+                   RP SS MSST+ES SGPR       +     R  +
Sbjct  103  ELFPNS-------------------RPASSSMSSTLESSSGPR------GSGNKLTRMKI  137

Query  610  SQPvvpddchsdcdssssvvddmdCENIASSSF--RKPLPFDLNLPPAVEYNVDAEAYEL  437
             +PV+P +       SSS V D  C+   +SSF  ++PLPFDLNLPP  + +VDA+   +
Sbjct  138  PRPVLPPEDCRSDCDSSSSVVDDRCDADQTSSFLPKQPLPFDLNLPPPSD-DVDADDLHV  196

Query  436  QCCTALCL  413
               TALCL
Sbjct  197  ---TALCL  201



>ref|XP_010928407.1| PREDICTED: ethylene-responsive transcription factor 3-like [Elaeis 
guineensis]
Length=220

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 92/177 (52%), Gaps = 3/177 (2%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAAR LRGPKAKTNFPL   S  PP H    +   
Sbjct  44   RDPWKKTRVWLGTFDSAEDAARAYDAAARALRGPKAKTNFPLGPGSPPPPGHPFPSSAAA  103

Query  778  NANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPR---PPRQQTAAALPSRRHPVS  608
                                QRPTSS +SSTVESFSGPR   PP     ++   R     
Sbjct  104  GGFPFHHHHDPASPPDLPPPQRPTSSSLSSTVESFSGPRLSAPPLPIRFSSHVRRAANPP  163

Query  607  QPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAYEL  437
             P        DC S       +  +   +S +R+PLPFDLNL P  + +  A    L
Sbjct  164  PPPRVLSGDQDCHSDCGSSSSVVDDGDIASVYRQPLPFDLNLFPPQDDDFHATVLHL  220



>gb|ADM77618.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
Length=211

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPL  833
            RDPWKKTR+WLGTF++AE AARAYD AARNLRGPKAKTNF  
Sbjct  49   RDPWKKTRLWLGTFDTAEEAARAYDNAARNLRGPKAKTNFAF  90



>gb|ADM77614.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77617.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77620.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77621.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77622.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77623.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77628.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77631.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77633.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77634.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77635.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77636.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77637.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77638.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77644.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77646.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77647.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77650.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77651.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77654.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77655.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77659.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77661.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
Length=211

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPL  833
            RDPWKKTR+WLGTF++AE AARAYD AARNLRGPKAKTNF  
Sbjct  49   RDPWKKTRLWLGTFDTAEEAARAYDNAARNLRGPKAKTNFAF  90



>gb|ABK21906.1| unknown [Picea sitchensis]
Length=211

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPL  833
            RDPWKKTR+WLGTF++AE AARAYD AARNLRGPKAKTNF  
Sbjct  49   RDPWKKTRLWLGTFDTAEEAARAYDNAARNLRGPKAKTNFAF  90



>gb|ADM77615.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77616.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77619.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77624.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77625.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77626.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77627.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77629.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77630.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77632.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77639.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77640.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77641.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77642.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77643.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77648.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77649.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77652.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77653.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77656.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77657.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77658.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
 gb|ADM77660.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
Length=211

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPL  833
            RDPWKKTR+WLGTF++AE AARAYD AARNLRGPKAKTNF  
Sbjct  49   RDPWKKTRLWLGTFDTAEEAARAYDNAARNLRGPKAKTNFAF  90



>ref|XP_010494425.1| PREDICTED: ethylene-responsive transcription factor 9-like [Camelina 
sativa]
Length=194

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 65/122 (53%), Gaps = 13/122 (11%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDP KKTRVWLGTF++AE AARAYD AAR  RG KAKTNFPLP  S       +  + R 
Sbjct  42   RDPGKKTRVWLGTFDTAEEAARAYDTAAREFRGSKAKTNFPLPGESSAST--TMVNDGRE  99

Query  778  NANDSFVD----QQMYMQEHPILSQRP--TSSGMSSTVESFSGPRPPRQQTAAALPSRRH  617
            N   S+V+    ++M  Q  P   QR      G ++    F    P R     A  SR +
Sbjct  100  NG--SYVNRTAAREMTRQRFPFACQRERKVVGGYAAAGFFFD---PSRAAALRAELSRAY  154

Query  616  PV  611
            PV
Sbjct  155  PV  156



>gb|ADM77645.1| ethylene-responsive element binding factor-like protein [Picea 
sitchensis]
Length=211

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPL  833
            RDPWKKTR+WLGTF++AE AARAYD AARNLRGPKAKTNF  
Sbjct  49   RDPWKKTRLWLGTFDTAEEAARAYDNAARNLRGPKAKTNFAF  90



>gb|AGS80331.1| ethylene response factor [Actinidia chinensis]
Length=157

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAP  824
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KAKTNFP P P
Sbjct  25   RDPWKKTRVWLGTFDTPEEAAMAYDGAARSLRGAKAKTNFPQPHP  69



>ref|XP_011082648.1| PREDICTED: ethylene-responsive transcription factor 14-like [Sesamum 
indicum]
Length=156

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNL  797
            RDPWKKTR WLGTF++AE AA AYD AARNLRG KAKTNF        PP  N+
Sbjct  43   RDPWKKTRKWLGTFDTAEEAALAYDEAARNLRGAKAKTNFMYVGGDAAPPAMNV  96



>emb|CDY22810.1| BnaA06g02670D [Brassica napus]
Length=203

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 97/185 (52%), Gaps = 23/185 (12%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDP+KK+RVWLGTF+SA  AARAYDAAARNLRGPKAKTNFP+ +P   P           
Sbjct  39   RDPYKKSRVWLGTFDSAVDAARAYDAAARNLRGPKAKTNFPIESPPSPPQI---------  89

Query  778  NANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPVSQPv  599
               D F+D ++Y       +    SS + S+    S    P   TA     +R+P + P 
Sbjct  90   ---DPFMDHRLYAGASSRPTSSSMSSTVESSSGQRSSVAKPLSTTA-----KRYPRT-PP  140

Query  598  vpddchsdcdssssvvddmdCENIASSSFRKPLP---FDLNLPPAVEYNVDAEAYELQCC  428
            V  +       SSS V D   ++IASSS R+  P   FDLN PP  +  +     ++  C
Sbjct  141  VVPEDCHSDCGSSSSVIDDGDDDIASSSRRREPPSFKFDLNFPPLDDVGLIDGVDDI--C  198

Query  427  TALCL  413
            T L L
Sbjct  199  TDLRL  203



>ref|XP_002977127.1| hypothetical protein SELMODRAFT_443461 [Selaginella moellendorffii]
 gb|EFJ21736.1| hypothetical protein SELMODRAFT_443461 [Selaginella moellendorffii]
Length=1386

 Score = 61.2 bits (147),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 47/100 (47%), Positives = 54/100 (54%), Gaps = 13/100 (13%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKK RVWLGTF++AE AARAYD AAR LRG KAKTNF   +PS  P           
Sbjct  38   RDPWKKVRVWLGTFDTAEEAARAYDNAARALRGAKAKTNFSTMSPSLYPGGAGGGGGGGG  97

Query  778  NANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRP  659
             A     D +              S+  SSTVES++ P P
Sbjct  98   GAGMGGGDDRQ-------------STSHSSTVESYNTPTP  124



>ref|XP_009593007.1| PREDICTED: ethylene-responsive transcription factor 12 [Nicotiana 
tomentosiformis]
Length=164

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 53/89 (60%), Gaps = 8/89 (9%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNF----PLPAPSHLPP----YH  803
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KA+TNF    PLP   +L P    +H
Sbjct  25   RDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKARTNFPAAPPLPFDLNLNPSADHHH  84

Query  802  NLQFNQRPNANDSFVDQQMYMQEHPILSQ  716
             L  +  P+A       +     HP+L  
Sbjct  85   RLTSSSSPSARRLMNIGEFLQVGHPVLKD  113



>ref|XP_006281207.1| hypothetical protein CARUB_v10027246mg [Capsella rubella]
 gb|EOA14105.1| hypothetical protein CARUB_v10027246mg [Capsella rubella]
Length=171

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 72/168 (43%), Gaps = 33/168 (20%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDP KKTRVWLGTF++AE AARAYD AAR  RG KAKTNFPLP  S              
Sbjct  32   RDPGKKTRVWLGTFDTAEEAARAYDKAAREFRGSKAKTNFPLPGESGAVTVTTTA-----  86

Query  778  NANDSFVDQQMYMQEHPILS--QRPTSSGMSSTVESFSGPRPP--RQQTAAALPSRRHPV  611
                    ++M  Q  P     +R    G ++    F   R    R++ +   P R  PV
Sbjct  87   --------REMTRQRFPFACHRERKVVGGYAAAGFCFDPSRAAALREELSRVYPVRFDPV  138

Query  610  SQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVE  467
            +                  +     E +     R+ L  DLNL P V+
Sbjct  139  N----------------IELSIGIREAVVKVEARRELNLDLNLAPPVD  170



>ref|XP_011027787.1| PREDICTED: ethylene-responsive transcription factor 12 [Populus 
euphratica]
Length=176

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 56/92 (61%), Gaps = 11/92 (12%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPL-PAPSHL---------PP  809
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KAKTNFP  P+ S L         P 
Sbjct  25   RDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKAKTNFPSPPSTSGLSLDLNLPSDPH  84

Query  808  YHNLQFNQRPNANDS-FVDQQMYMQEHPILSQ  716
            +H+L+++  P+     F     ++Q   +  +
Sbjct  85   HHHLRWSSSPHVGSHRFGGLGEFLQTGVVFKE  116



>ref|XP_002305780.1| ERF domain protein 12 [Populus trichocarpa]
 gb|EEE86291.1| ERF domain protein 12 [Populus trichocarpa]
Length=176

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 80/180 (44%), Gaps = 51/180 (28%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPL-PAPSHL---------PP  809
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KAKTNFP  P+ S L         P 
Sbjct  25   RDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKAKTNFPSPPSTSGLSLDLNLPSDPH  84

Query  808  YHNLQFNQRPNANDS-FVDQQMYMQEHPILSQR----PTSSGMSSTVESFSGPRPPRQQT  644
            +H+L++   P+     F     ++Q   +  +       ++  S  V    GP       
Sbjct  85   HHHLRWGSSPHVGSHRFGGLGEFLQTGVVFKEMNFNATEAAAASGPVVKIEGPGVGAVAG  144

Query  643  AAALPSRRHPVSQPvvpddchsdcdssssvvddmdCENIASSSF----RKPLPFDLNLPP  476
            A        PV                         EN+A +SF    R+ LP DLN PP
Sbjct  145  A--------PV------------------------PENVAPASFLGMVRRGLPIDLNEPP  172



>dbj|BAJ91227.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=199

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 93/175 (53%), Gaps = 29/175 (17%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDP KKT +WLGTF+SAE AARAYD+AAR+LRGP A+TNF   + +  PP          
Sbjct  38   RDPAKKTPIWLGTFDSAEDAARAYDSAARSLRGPTARTNFSPSSATPPPPRPPPPLPAAT  97

Query  778  NANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSG--PRPPRQQTAAALPSRRHPVSQ  605
             A  S                       SSTVES+SG  PR P    +AAL        +
Sbjct  98   PATSSH----------------------SSTVESWSGGGPRAPTVARSAALAG---TAEE  132

Query  604  PvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAYE  440
                +DC S C SSSSV+ +   ++ A+S  R PLPFDLN+PP  +  +DA A E
Sbjct  133  EEGEEDCRSYCGSSSSVLCEDGGDDAAAS--RSPLPFDLNMPPPQDGGLDAAAAE  185



>ref|XP_007199249.1| hypothetical protein PRUPE_ppa022435mg [Prunus persica]
 gb|EMJ00448.1| hypothetical protein PRUPE_ppa022435mg [Prunus persica]
Length=181

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 43/57 (75%), Gaps = 3/57 (5%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFN  788
            RDPWKKTR WLGTF++AE AA AYD AAR+LRGPKAKTNF  PA S LP  H L   
Sbjct  63   RDPWKKTRKWLGTFDTAEEAALAYDEAARSLRGPKAKTNFGAPA-SALP--HTLVIG  116



>ref|XP_008778306.1| PREDICTED: ethylene-responsive transcription factor 12-like [Phoenix 
dactylifera]
Length=197

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPA  827
            RDPWKKTR WLGTF++AE AARAYD AARNLRGPKAKTNF   A
Sbjct  55   RDPWKKTRKWLGTFDTAEEAARAYDEAARNLRGPKAKTNFGYSA  98



>ref|XP_008235314.1| PREDICTED: ethylene-responsive transcription factor 8-like [Prunus 
mume]
Length=181

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 43/57 (75%), Gaps = 3/57 (5%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFN  788
            RDPWKKTR WLGTF++AE AA AYD AAR+LRGPKAKTNF  PA S LP  H L   
Sbjct  63   RDPWKKTRKWLGTFDTAEEAALAYDEAARSLRGPKAKTNFGAPA-SALP--HTLVIG  116



>gb|AHA93909.1| ethylene response factor 4, partial [Coffea arabica]
Length=165

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPA  827
            RDPWKKTR WLGTF++AE AA AYD AAR+LRGPKAKTNF  PA
Sbjct  52   RDPWKKTRRWLGTFDTAEEAALAYDEAARSLRGPKAKTNFGSPA  95



>ref|XP_007148135.1| hypothetical protein PHAVU_006G183200g [Phaseolus vulgaris]
 gb|ESW20129.1| hypothetical protein PHAVU_006G183200g [Phaseolus vulgaris]
Length=167

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 40/46 (87%), Gaps = 1/46 (2%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPS  821
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KAKTNFP PAP+
Sbjct  30   RDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKAKTNFP-PAPA  74



>emb|CDO99509.1| unnamed protein product [Coffea canephora]
Length=146

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLP  830
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KAKTNFP P
Sbjct  25   RDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKAKTNFPAP  67



>ref|XP_002509444.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
 gb|EEF50831.1| Ethylene-responsive transcription factor, putative [Ricinus communis]
Length=174

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLP  830
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KAKTNFP P
Sbjct  32   RDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKAKTNFPAP  74



>ref|XP_008802835.1| PREDICTED: ethylene-responsive transcription factor 11-like [Phoenix 
dactylifera]
Length=197

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPA  827
            RDPWKKTR WLGTF++AE AARAYD AARNLRGPKAKTNF   A
Sbjct  58   RDPWKKTRKWLGTFDTAEEAARAYDEAARNLRGPKAKTNFGYSA  101



>ref|XP_004295554.1| PREDICTED: ethylene-responsive transcription factor 12-like [Fragaria 
vesca subsp. vesca]
Length=169

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLP  830
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KAKTNFP P
Sbjct  27   RDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGNKAKTNFPAP  69



>ref|XP_003593626.1| Ethylene responsive transcription factor [Medicago truncatula]
 gb|AES63877.1| ethylene response factor [Medicago truncatula]
 gb|AFK37030.1| unknown [Medicago truncatula]
Length=172

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAP  824
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KAKTNFP PAP
Sbjct  31   RDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKAKTNFP-PAP  74



>ref|XP_006377396.1| ERF domain protein 12 [Populus trichocarpa]
 gb|ERP55193.1| ERF domain protein 12 [Populus trichocarpa]
Length=174

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLP  830
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KAKTNFP P
Sbjct  25   RDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKAKTNFPSP  67



>ref|XP_009392111.1| PREDICTED: ethylene-responsive transcription factor 3-like [Musa 
acuminata subsp. malaccensis]
Length=210

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 92/182 (51%), Gaps = 18/182 (10%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDP KKTRVWLGTF+SAE AARAYDAAA  LRG KAKTNFP      LP           
Sbjct  39   RDPCKKTRVWLGTFDSAEDAARAYDAAAVALRGTKAKTNFP-----SLPSAFPPAPLPAA  93

Query  778  NANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAA--------LPSR  623
             A+  F  Q  +        QRPTSS  SSTVESFSGPR P   +AAA        L  +
Sbjct  94   AAHFPFYHQHQHHPPP--PPQRPTSSSHSSTVESFSGPRHP---SAAAPIHMRPRILRKQ  148

Query  622  RHPVSQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPAVEYNVDAEAY  443
             +P   P V +          S    +D +    S  R+PL FDLNL P  E ++   A 
Sbjct  149  INPPPPPRVLNGDDDCHSDCGSSSSVVDDDGDIVSLCRQPLAFDLNLLPPSEDDLHDTAL  208

Query  442  EL  437
             L
Sbjct  209  RL  210



>ref|XP_010278126.1| PREDICTED: ethylene-responsive transcription factor 9-like [Nelumbo 
nucifera]
Length=175

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNF  839
            RDPWKKTR WLGTF++AE AARAYD AARNLRGPKAKTNF
Sbjct  47   RDPWKKTRKWLGTFDTAEEAARAYDEAARNLRGPKAKTNF  86



>ref|XP_010110221.1| Ethylene-responsive transcription factor 3 [Morus notabilis]
 gb|EXC25518.1| Ethylene-responsive transcription factor 3 [Morus notabilis]
Length=211

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 107/190 (56%), Gaps = 32/190 (17%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF+SAE AARAYDAAA +LRGPKAKTNFP P P               
Sbjct  46   RDPWKKTRVWLGTFDSAEEAARAYDAAAWSLRGPKAKTNFPNPNP---------------  90

Query  778  NANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPVSQPv  599
                +F D+++  +   I + RPTSS +SSTVESFSGPR   Q  A A     H     V
Sbjct  91   ----NFHDERVSSKIDVIQASRPTSSSLSSTVESFSGPRVSAQAPAPAPRP--HRRPVRV  144

Query  598  vpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPPA--------VEYNVDAEAY  443
            VP D       SSS + D   + + +SS  + LPFDLNLPP+            VD +  
Sbjct  145  VPPDDCHSDCDSSSSMVDDGDDCVLTSSSCRVLPFDLNLPPSRMMDDSDWCGGGVDDD--  202

Query  442  ELQCCTALCL  413
            EL+  TALCL
Sbjct  203  ELR-ATALCL  211



>ref|XP_010932878.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor 3-like [Elaeis guineensis]
Length=199

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPS  821
            RDPWKKTR WLGTF++AE AARAYD AARNLRGPKAKTNF   A +
Sbjct  56   RDPWKKTRKWLGTFDTAEEAARAYDEAARNLRGPKAKTNFGYSADA  101



>ref|XP_009614490.1| PREDICTED: ethylene-responsive transcription factor 4-like [Nicotiana 
tomentosiformis]
Length=288

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLP  812
            RDP KK+RVWLGTF++AE AA+AYD AAR  RGPKAKTNFPLP+ +  P
Sbjct  40   RDPGKKSRVWLGTFDTAEEAAKAYDTAAREFRGPKAKTNFPLPSENQCP  88



>ref|XP_003543033.1| PREDICTED: ethylene-responsive transcription factor 12 [Glycine 
max]
Length=163

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAP  824
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KAKTNFP PAP
Sbjct  28   RDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKAKTNFP-PAP  71



>gb|AHI87860.1| MYB5, partial [Dendrobium catenatum]
Length=185

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNF  839
            RDPWKKTR WLGTF++AE AARAYD AARNLRGPKAKTNF
Sbjct  58   RDPWKKTRKWLGTFDTAEEAARAYDEAARNLRGPKAKTNF  97



>emb|CDP03705.1| unnamed protein product [Coffea canephora]
Length=184

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPA  827
            RDPWKKTR WLGTF++AE AA AYD AAR+LRGPKAKTNF  PA
Sbjct  52   RDPWKKTRRWLGTFDTAEEAALAYDEAARSLRGPKAKTNFGSPA  95



>gb|AFK48691.1| unknown [Lotus japonicus]
Length=167

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAP  824
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KAKTNFP PAP
Sbjct  30   RDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKAKTNFP-PAP  73



>ref|XP_008442801.1| PREDICTED: ethylene-responsive transcription factor 12 [Cucumis 
melo]
Length=163

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPS  821
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KAKTNFP P P 
Sbjct  25   RDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGSKAKTNFPPPLPG  70



>ref|XP_004485812.1| PREDICTED: ethylene-responsive transcription factor 12-like [Cicer 
arietinum]
Length=173

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 84/170 (49%), Gaps = 41/170 (24%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQF---N  788
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KAKTNFP PAP       +L     +
Sbjct  32   RDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKAKTNFP-PAPVAAGLCLDLNAPSSD  90

Query  787  QR--PNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHP  614
             R  P  + SFV  + ++Q              +  ++ F+ P+PP     A L  RRH 
Sbjct  91   HRWPPVPSRSFVVTE-FLQ--------------TGVLKDFNTPQPPPVAAVAGL--RRH-  132

Query  613  VSQPvvpddchsdcdssssvvddmdCENIASSSF----RKPLPFDLNLPP  476
                           + S        E+ +++S+    R+ +P DLN PP
Sbjct  133  -------------DGAFSVSGGVQVAEHTSTASYLGLVRRGIPIDLNEPP  169



>ref|XP_010906034.1| PREDICTED: ethylene-responsive transcription factor 12-like [Elaeis 
guineensis]
Length=197

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPP  809
            RDPWKKTR WLGTF++AE AARAYD AARNLRGPKAKTNF     S   P
Sbjct  55   RDPWKKTRKWLGTFDTAEEAARAYDEAARNLRGPKAKTNFGYSGDSGEIP  104



>ref|XP_002456480.1| hypothetical protein SORBIDRAFT_03g037085 [Sorghum bicolor]
 gb|EES01600.1| hypothetical protein SORBIDRAFT_03g037085 [Sorghum bicolor]
Length=92

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFP  836
            RDPWKKTRVWLGTF++   AA AYD AAR LRG KAKTNFP
Sbjct  52   RDPWKKTRVWLGTFDTPAEAALAYDRAARTLRGAKAKTNFP  92



>ref|XP_009339319.1| PREDICTED: ethylene-responsive transcription factor 4-like [Pyrus 
x bretschneideri]
Length=170

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFN  788
            RDP KKTRVWLGTF++A  AARAYD AAR  RG KAKTNFP P+   L   + +  N
Sbjct  42   RDPGKKTRVWLGTFDTAVDAARAYDKAAREFRGGKAKTNFPTPSELQLDAVNIVNMN  98



>ref|XP_010260298.1| PREDICTED: ethylene-responsive transcription factor 12 [Nelumbo 
nucifera]
Length=159

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFP  836
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KAKTNFP
Sbjct  24   RDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKAKTNFP  64



>ref|XP_004146616.1| PREDICTED: ethylene-responsive transcription factor 12-like [Cucumis 
sativus]
 gb|KGN64698.1| hypothetical protein Csa_1G075030 [Cucumis sativus]
Length=164

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPS  821
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KAKTNFP P P 
Sbjct  25   RDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGSKAKTNFPPPLPG  70



>ref|XP_008643722.1| PREDICTED: ethylene-responsive transcription factor 3 isoform 
X1 [Zea mays]
 gb|AFW70550.1| putative AP2/EREBP transcription factor superfamily protein [Zea 
mays]
 gb|AIB05697.1| AP2-EREBP transcription factor, partial [Zea mays]
Length=211

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 92/161 (57%), Gaps = 9/161 (6%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDP KK RVWLGTF+SAE AARAYDAAAR LRGPKA+TNFPLPA + L  +H        
Sbjct  35   RDPAKKARVWLGTFDSAEDAARAYDAAARMLRGPKARTNFPLPAAAALHHHHMPAAAAAA  94

Query  778  NANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPVSQPv  599
                +       +   P+   RP  S +SSTVESFSG RP                   +
Sbjct  95   APPYTTYPTATGVSTPPV--ARPACSSLSSTVESFSGARPRPVLPP-------RFPPPSI  145

Query  598  vpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLPP  476
               DC SDC SS+SVVDD   +  AS+S   PLPFDLNLPP
Sbjct  146  PDGDCRSDCGSSASVVDDDCTDAAASASCPFPLPFDLNLPP  186



>ref|XP_003545996.1| PREDICTED: ethylene-responsive transcription factor 12-like [Glycine 
max]
Length=172

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAP  824
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KAKTNFP PAP
Sbjct  31   RDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKAKTNFP-PAP  74



>emb|CBI28872.3| unnamed protein product [Vitis vinifera]
Length=82

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFP  836
            RDPWKKTRVWLGTF+SAE AARAYDAAAR+LRGPKAKTNFP
Sbjct  36   RDPWKKTRVWLGTFDSAEDAARAYDAAARSLRGPKAKTNFP  76



>ref|XP_004493753.1| PREDICTED: ethylene-responsive transcription factor 3-like [Cicer 
arietinum]
Length=143

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNF  839
            RDPWKKTR WLGTF++AE AARAYD AARNLRGP+AKTNF
Sbjct  47   RDPWKKTRKWLGTFDTAEEAARAYDEAARNLRGPRAKTNF  86



>dbj|BAJ72664.1| ethylene response factor 3 [Nicotiana benthamiana]
Length=227

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLP  812
            RDP KK+RVWLGTF++AE AA+AYD AAR  RGPKAKTNFPLP  +  P
Sbjct  43   RDPGKKSRVWLGTFDTAEEAAKAYDTAAREFRGPKAKTNFPLPTENQSP  91



>ref|XP_009340673.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor 4 [Pyrus x bretschneideri]
Length=189

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFN  788
            RDP KKTRVWLGTF++AE AA AYD AAR  RG KAKTNFP P   HL   +    N
Sbjct  42   RDPGKKTRVWLGTFDTAEEAACAYDKAAREFRGGKAKTNFPTPTELHLDAVNIANMN  98



>dbj|BAL68167.1| ethylene response factor #116 [Nicotiana tabacum]
Length=163

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 54/88 (61%), Gaps = 7/88 (8%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPL--PAPSHLPPYHNLQFNQ  785
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KA+TNFP   P P  L    ++  + 
Sbjct  25   RDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKARTNFPAAPPLPFDLNLNPSVDHHH  84

Query  784  RPNANDSFVDQQMYMQE-----HPILSQ  716
            R  ++ S   + M + E     HP+L  
Sbjct  85   RLTSSSSSARRLMNIGEFLQVGHPVLKD  112



>ref|XP_008788768.1| PREDICTED: ethylene-responsive transcription factor 3-like [Phoenix 
dactylifera]
Length=220

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 95/188 (51%), Gaps = 16/188 (9%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDP KKTRVWLGT++SAE AARAYDAAA +LRG KAKTNFP P P    P   L  +  P
Sbjct  43   RDPAKKTRVWLGTYDSAEEAARAYDAAAISLRGCKAKTNFPTPCPPF--PAAPLPISSSP  100

Query  778  NANDSFVD--QQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRRHPVSQ  605
             A  +        Y ++     Q P SS  SSTVESFSGPR  R   A  +   R   + 
Sbjct  101  TAAAAAAAFPHTPYPRQRRPPPQWPASSSHSSTVESFSGPR--RSSAAPLMSQLRSQKAD  158

Query  604  PvvpddchsdcdssssvvddmdCE---NIASSSFRKPLPFDLN-LPPAVEYNVDAEAYEL  437
            P           S       +  +   +IAS     PLPFDLN LPP  + ++  +    
Sbjct  159  PPRVLAGEEALHSDCGSSSSVVDDDLGDIASVYRHPPLPFDLNLLPPPDDKDLGLD----  214

Query  436  QCCTALCL  413
              CTAL L
Sbjct  215  --CTALRL  220



>ref|XP_009123936.1| PREDICTED: ethylene-responsive transcription factor 9 [Brassica 
rapa]
Length=193

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPS  821
            RDP KKTRVWLGTF++AE AARAYD AAR  RG KAKTNFPLP  S
Sbjct  47   RDPGKKTRVWLGTFDTAEEAARAYDTAAREFRGSKAKTNFPLPGES  92



>emb|CDX96955.1| BnaC02g30930D [Brassica napus]
Length=193

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPS  821
            RDP KKTRVWLGTF++AE AARAYD AAR  RG KAKTNFPLP  S
Sbjct  47   RDPGKKTRVWLGTFDTAEEAARAYDTAAREFRGSKAKTNFPLPGES  92



>gb|ADE41150.1| AP2 domain class transcription factor [Malus domestica]
Length=230

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFN  788
            RDP KKTRVWLGTF++AE AA AYD AAR  RG KAKTNFP P   HL   +    N
Sbjct  42   RDPGKKTRVWLGTFDTAEEAACAYDKAAREFRGGKAKTNFPTPTELHLDAVNIANMN  98



>gb|AIL90392.1| ethylene responsive element binding factor [Daucus carota]
Length=197

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPL  833
            RDPWKKTRVWLGTF+SAE AARAYDAAAR+LRGPKAKTNFP+
Sbjct  42   RDPWKKTRVWLGTFDSAEDAARAYDAAARSLRGPKAKTNFPI  83



>emb|CDY14914.1| BnaA02g22560D [Brassica napus]
Length=193

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPS  821
            RDP KKTRVWLGTF++AE AARAYD AAR  RG KAKTNFPLP  S
Sbjct  47   RDPGKKTRVWLGTFDTAEEAARAYDTAAREFRGSKAKTNFPLPGES  92



>ref|XP_004951621.1| PREDICTED: ethylene-responsive transcription factor 3-like [Setaria 
italica]
Length=199

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 89/167 (53%), Gaps = 33/167 (20%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPL-------PAPSHLPPYHN  800
            RDP KK RVWLGTF+SAE AARAYDAAAR LRGPKAKTNFPL         P+   PY  
Sbjct  33   RDPAKKARVWLGTFDSAEDAARAYDAAARMLRGPKAKTNFPLPAAAHHHHMPAAYTPYTT  92

Query  799  LQFNQRPNANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPRPPRQQTAAALPSRR  620
               +  P A                    P  S +SSTVESF+G R              
Sbjct  93   PGVSTPPVA-------------------MPACSSLSSTVESFNGARQRPVLPP-------  126

Query  619  HPVSQPvvpddchsdcdssssvvddmdCENIASSSFRKPLPFDLNLP  479
             P   P+  DDC SDC SS+SVVDD   +  AS S R PLPFDLNLP
Sbjct  127  RPPPPPIPDDDCRSDCGSSASVVDDDCTDAAASPSCRLPLPFDLNLP  173



>ref|XP_007211989.1| hypothetical protein PRUPE_ppa010982mg [Prunus persica]
 gb|EMJ13188.1| hypothetical protein PRUPE_ppa010982mg [Prunus persica]
Length=228

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNL  797
            RDP KKTRVWLGTF++AE AARAYD AAR  RG KAKTNFP PA   L    N+
Sbjct  42   RDPGKKTRVWLGTFDTAEEAARAYDKAAREFRGAKAKTNFPTPAELQLEAAANI  95



>ref|XP_003616864.1| Ethylene responsive transcription factor 3a [Medicago truncatula]
 gb|AES99822.1| AP2 domain class transcription factor [Medicago truncatula]
Length=284

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 60/103 (58%), Gaps = 5/103 (5%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKK RVWLGTF++AE AA AYD+AA   R  KAKTNFP+P    L         Q P
Sbjct  62   RDPWKKARVWLGTFDTAEEAAHAYDSAAIKFRASKAKTNFPIP-EHILAAETAAAAAQNP  120

Query  778  N----ANDSFVDQQMYMQEHPILSQRPTSSGMSSTVESFSGPR  662
                  ++   +   +++   +    PTSS MSSTVES SGPR
Sbjct  121  QPLVAVDNRRAEVLKFVEPEVVQVNWPTSSSMSSTVESLSGPR  163



>tpg|DAA57264.1| TPA: putative AP2/EREBP transcription factor superfamily protein 
[Zea mays]
 gb|AIB05752.1| AP2-EREBP transcription factor, partial [Zea mays]
Length=186

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFP  836
            RDPWKKTRVWLGTF++   AA AYD AAR LRG KAKTNFP
Sbjct  45   RDPWKKTRVWLGTFDTPVEAALAYDCAARTLRGAKAKTNFP  85



>ref|XP_009356864.1| PREDICTED: ethylene-responsive transcription factor 4-like [Pyrus 
x bretschneideri]
Length=166

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFN  788
            RDP KKTRVWLGTF++A  AARAYD AAR  RG KAKTNFP P+   L   + +  N
Sbjct  42   RDPGKKTRVWLGTFDTAVDAARAYDKAAREFRGGKAKTNFPTPSELQLDAVNIVNMN  98



>ref|XP_002890772.1| ATERF12/ERF12 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67031.1| ATERF12/ERF12 [Arabidopsis lyrata subsp. lyrata]
Length=183

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 40/52 (77%), Gaps = 3/52 (6%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAP---SHLP  812
            RDPWKKTRVWLGTF++ E AA AYD AAR LRG KAKTNFP P     +HLP
Sbjct  28   RDPWKKTRVWLGTFDTPEEAALAYDGAARFLRGIKAKTNFPSPLSLDLNHLP  79



>emb|CDX94610.1| BnaC07g10480D [Brassica napus]
Length=166

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLP  830
            RDPWKKTRVWLGTF++ E AA AYD AAR LRG KAKTNFP P
Sbjct  28   RDPWKKTRVWLGTFDTPEEAALAYDGAARFLRGIKAKTNFPSP  70



>ref|XP_004970252.1| PREDICTED: ethylene-responsive transcription factor 12-like [Setaria 
italica]
Length=184

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFP  836
            RDPWKKTRVWLGTF++   AA AYD AAR LRG KAKTNFP
Sbjct  48   RDPWKKTRVWLGTFDTPVEAALAYDRAARTLRGAKAKTNFP  88



>ref|XP_006367798.1| PREDICTED: ethylene-responsive transcription factor 4-like [Solanum 
tuberosum]
Length=224

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPA  827
            RDP KK+RVWLGTF++AE AA+AYD AAR  RGPKAKTNFP PA
Sbjct  40   RDPGKKSRVWLGTFDTAEEAAKAYDTAAREFRGPKAKTNFPFPA  83



>ref|XP_009397201.1| PREDICTED: ethylene-responsive transcription factor 12-like [Musa 
acuminata subsp. malaccensis]
Length=169

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFP  836
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KAKTNFP
Sbjct  26   RDPWKKTRVWLGTFDTPEEAALAYDRAARSLRGAKAKTNFP  66



>ref|XP_003567200.2| PREDICTED: ethylene-responsive transcription factor 12-like [Brachypodium 
distachyon]
Length=174

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFP  836
            RDPWKKTRVWLGTF++   AA AYD AAR LRG KAKTNFP
Sbjct  45   RDPWKKTRVWLGTFDTPVEAALAYDRAARTLRGAKAKTNFP  85



>gb|KFK44706.1| hypothetical protein AALP_AA1G292500 [Arabis alpina]
Length=182

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 44/70 (63%), Gaps = 8/70 (11%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPPYHNLQFNQRP  779
            RDPWKKTRVWLGTF++ E AA AYD AAR LRG KAKTNFP P         +L  N  P
Sbjct  29   RDPWKKTRVWLGTFDTPEEAALAYDGAARFLRGIKAKTNFPSPL--------SLDLNHIP  80

Query  778  NANDSFVDQQ  749
            +A      QQ
Sbjct  81   SAAAGGNQQQ  90



>ref|XP_001770627.1| predicted protein [Physcomitrella patens]
 gb|EDQ64610.1| predicted protein [Physcomitrella patens]
Length=300

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPS  821
            RDPWKKTRVWLGTF++AE AARAYD+AAR LRG KAKTNF  P PS
Sbjct  40   RDPWKKTRVWLGTFDTAEEAARAYDSAARALRGTKAKTNFSPPPPS  85



>dbj|BAJ72663.1| ethylene response factor 3b [Nicotiana tabacum]
Length=227

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPA  827
            RDP KK+RVWLGTF++AE AA+AYD AAR  RGPKAKTNFPLP+
Sbjct  43   RDPGKKSRVWLGTFDTAEEAAKAYDTAAREFRGPKAKTNFPLPS  86



>ref|XP_010478205.1| PREDICTED: ethylene-responsive transcription factor 12 [Camelina 
sativa]
Length=193

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLP  830
            RDPWKKTRVWLGTF++ E AA AYD AAR LRG KAKTNFP P
Sbjct  28   RDPWKKTRVWLGTFDTPEEAALAYDGAARFLRGIKAKTNFPSP  70



>ref|XP_009772525.1| PREDICTED: ethylene-responsive transcription factor 4 [Nicotiana 
sylvestris]
 sp|Q9LW49.1|ERF4_NICSY RecName: Full=Ethylene-responsive transcription factor 4; AltName: 
Full=Ethylene-responsive element-binding factor 3; Short=EREBP-3; 
AltName: Full=Ethylene-responsive element-binding 
factor 4 homolog; AltName: Full=NsERF3 [Nicotiana sylvestris]
 dbj|BAA97123.1| ethylene-responsive element binding factor [Nicotiana sylvestris]
Length=227

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPA  827
            RDP KK+RVWLGTF++AE AA+AYD AAR  RGPKAKTNFPLP+
Sbjct  43   RDPGKKSRVWLGTFDTAEEAAKAYDTAAREFRGPKAKTNFPLPS  86



>ref|XP_002992124.1| hypothetical protein SELMODRAFT_430375 [Selaginella moellendorffii]
 gb|EFJ06779.1| hypothetical protein SELMODRAFT_430375 [Selaginella moellendorffii]
Length=1440

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLP  812
            RDPWKK RVWLGTF++AE AARAYD AAR LRG KAKTNF   +PS  P
Sbjct  38   RDPWKKVRVWLGTFDTAEEAARAYDNAARALRGTKAKTNFSTMSPSLYP  86



>ref|XP_010499360.1| PREDICTED: ethylene-responsive transcription factor 12-like [Camelina 
sativa]
Length=190

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLP  830
            RDPWKKTRVWLGTF++ E AA AYD AAR LRG KAKTNFP P
Sbjct  28   RDPWKKTRVWLGTFDTPEEAALAYDGAARFLRGIKAKTNFPSP  70



>emb|CDM84527.1| unnamed protein product [Triticum aestivum]
Length=174

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFP  836
            RDPWKKTRVWLGTF++   AA AYD AAR LRG KAKTNFP
Sbjct  48   RDPWKKTRVWLGTFDTPVEAALAYDRAARTLRGAKAKTNFP  88



>emb|CDY30806.1| BnaC05g21820D [Brassica napus]
Length=183

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLP  830
            RDPWKKTRVWLGTF++ E AA AYD AAR LRG KAKTNFP P
Sbjct  28   RDPWKKTRVWLGTFDTPEEAALAYDGAARFLRGIKAKTNFPSP  70



>ref|NP_174158.1| ethylene-responsive transcription factor 12 [Arabidopsis thaliana]
 sp|Q94ID6.1|ERF81_ARATH RecName: Full=Ethylene-responsive transcription factor 12; Short=AtERF12; 
AltName: Full=Ethylene-responsive element-binding 
factor 12; Short=EREBP-12 [Arabidopsis thaliana]
 dbj|BAB62912.1| ERF domain protein12 [Arabidopsis thaliana]
 gb|AAM20649.1| ethylene responsive element binding factor, putative [Arabidopsis 
thaliana]
 gb|AAO00964.1| ethylene responsive element binding factor, putative [Arabidopsis 
thaliana]
 gb|AEE30962.1| ethylene-responsive transcription factor 12 [Arabidopsis thaliana]
Length=189

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLP  830
            RDPWKKTRVWLGTF++ E AA AYD AAR LRG KAKTNFP P
Sbjct  28   RDPWKKTRVWLGTFDTPEEAALAYDGAARFLRGIKAKTNFPSP  70



>ref|XP_006306124.1| hypothetical protein CARUB_v10011585mg [Capsella rubella]
 gb|EOA39022.1| hypothetical protein CARUB_v10011585mg [Capsella rubella]
Length=191

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLP  830
            RDPWKKTRVWLGTF++ E AA AYD AAR LRG KAKTNFP P
Sbjct  28   RDPWKKTRVWLGTFDTPEEAALAYDGAARFLRGIKAKTNFPSP  70



>gb|KDP20136.1| hypothetical protein JCGZ_05905 [Jatropha curcas]
Length=211

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLP  830
            RDP KK+RVWLGTF++AE AA AYD AAR  RGPKAKTNFPLP
Sbjct  46   RDPGKKSRVWLGTFDTAEEAATAYDKAAREFRGPKAKTNFPLP  88



>ref|XP_009788087.1| PREDICTED: ethylene-responsive transcription factor 12 [Nicotiana 
sylvestris]
Length=164

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 52/89 (58%), Gaps = 8/89 (9%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNF----PLPAPSHLPP----YH  803
            RDPWKKTRVWLGTF++ E AA AYD AAR+LRG KA+TNF    PLP   +L P    +H
Sbjct  25   RDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKARTNFPAAPPLPFDLNLNPSVDHHH  84

Query  802  NLQFNQRPNANDSFVDQQMYMQEHPILSQ  716
             L  +   +A       +     HP+L  
Sbjct  85   RLTSSSSSSARRLMNIGEFLQVGHPVLKD  113



>ref|XP_009618026.1| PREDICTED: ethylene-responsive transcription factor 4-like [Nicotiana 
tomentosiformis]
Length=173

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPA  827
            RDPWKK+R WLGTF++AE AA AYD AAR+LRGP+AKTNF L A
Sbjct  50   RDPWKKSRRWLGTFDTAEEAALAYDEAARSLRGPRAKTNFGLAA  93



>ref|XP_006415666.1| hypothetical protein EUTSA_v10009947mg [Eutrema salsugineum]
 gb|ESQ34019.1| hypothetical protein EUTSA_v10009947mg [Eutrema salsugineum]
Length=191

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLP  830
            RDPWKKTRVWLGTF++ E AA AYD AAR LRG KAKTNFP P
Sbjct  28   RDPWKKTRVWLGTFDTPEEAALAYDGAARFLRGIKAKTNFPSP  70



>emb|CDY15674.1| BnaA07g08450D [Brassica napus]
Length=178

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLP  830
            RDPWKKTRVWLGTF++ E AA AYD AAR LRG KAKTNFP P
Sbjct  28   RDPWKKTRVWLGTFDTPEEAALAYDGAARFLRGIKAKTNFPSP  70



>ref|XP_008674936.1| PREDICTED: ethylene-responsive transcription factor 12-like [Zea 
mays]
Length=271

 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFP  836
            RDPWKKTRVWLGTF++   AA AYD AAR LRG KAKTNFP
Sbjct  130  RDPWKKTRVWLGTFDTPVEAALAYDCAARTLRGAKAKTNFP  170



>ref|XP_004291503.1| PREDICTED: ethylene-responsive transcription factor 4-like [Fragaria 
vesca subsp. vesca]
Length=250

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSH  818
            RDP KKTRVWLGTF++AE AARAYD AAR  RG KAKTNFP PA  H
Sbjct  38   RDPGKKTRVWLGTFDTAEEAARAYDKAAREYRGGKAKTNFPTPAELH  84



>ref|XP_009102914.1| PREDICTED: ethylene-responsive transcription factor 12-like [Brassica 
rapa]
Length=178

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLP  830
            RDPWKKTRVWLGTF++ E AA AYD AAR LRG KAKTNFP P
Sbjct  28   RDPWKKTRVWLGTFDTPEEAALAYDGAARFLRGIKAKTNFPSP  70



>ref|XP_009788813.1| PREDICTED: ethylene-responsive transcription factor 9-like [Nicotiana 
sylvestris]
 dbj|BAL68165.1| ethylene response factor #74 [Nicotiana tabacum]
Length=173

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHLPP  809
            RDPWKK+R WLGTF++AE AA AYD AAR+LRGP+AKTNF L   + + P
Sbjct  48   RDPWKKSRRWLGTFDTAEEAALAYDEAARSLRGPRAKTNFGLDGLAAIGP  97



>gb|AFW90611.1| ethylene-responsive element binding protein [Solanum tuberosum]
Length=230

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHL  815
            RDP KK+RVWLGTF++AE AA+AYD AAR+ RGPKAKTNFP PA  ++
Sbjct  40   RDPGKKSRVWLGTFDTAEEAAKAYDTAARDFRGPKAKTNFPFPAEINI  87



>ref|XP_008349999.1| PREDICTED: ethylene-responsive transcription factor 4-like [Malus 
domestica]
Length=254

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  958  RDPWKKTRVWLGTFNSaeaaaraydaaARNLRGPKAKTNFPLPAPSHL  815
            RDP KKTRVWLGTF++AE AA AYD AAR  RG KAKTNFP P   HL
Sbjct  42   RDPGKKTRVWLGTFDTAEEAACAYDKAAREFRGGKAKTNFPTPTELHL  89



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2060434175780