BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80254_g1_i1 len=2171 path=[1:0-2170]

Length=2171
                                                                      Score     E

ref|XP_009627394.1|  PREDICTED: pectinesterase-like                     692   0.0      
ref|XP_009762125.1|  PREDICTED: pectinesterase-like                     692   0.0      
emb|CDP17031.1|  unnamed protein product                                636   0.0      
ref|XP_006352821.1|  PREDICTED: pectinesterase 4-like                   630   0.0      
ref|XP_004242306.1|  PREDICTED: pectinesterase 4-like                   628   0.0      
gb|EYU46877.1|  hypothetical protein MIMGU_mgv1a027033mg                618   0.0      
ref|XP_011079480.1|  PREDICTED: pectinesterase                          608   0.0      
ref|XP_009780443.1|  PREDICTED: pectinesterase 4-like                   599   0.0      
ref|XP_009600101.1|  PREDICTED: pectinesterase 4-like                   598   0.0      
ref|XP_009589773.1|  PREDICTED: pectinesterase-like                     576   0.0      
ref|XP_004229178.1|  PREDICTED: pectinesterase 4-like                   576   0.0      
ref|XP_010271093.1|  PREDICTED: pectinesterase-like                     568   0.0      
gb|EYU26212.1|  hypothetical protein MIMGU_mgv1a003546mg                535   1e-178   
ref|XP_002275000.1|  PREDICTED: pectinesterase                          534   3e-178   Vitis vinifera
ref|XP_009359792.1|  PREDICTED: pectinesterase-like                     533   3e-178   
emb|CBI26012.3|  unnamed protein product                                534   3e-178   
ref|XP_009369703.1|  PREDICTED: pectinesterase-like                     531   2e-177   
ref|XP_008390484.1|  PREDICTED: pectinesterase-like                     531   3e-177   
ref|XP_008223522.1|  PREDICTED: pectinesterase-like                     528   4e-176   
ref|XP_007222606.1|  hypothetical protein PRUPE_ppa003528mg             527   1e-175   
ref|XP_004229041.1|  PREDICTED: pectinesterase-like                     527   2e-175   
ref|XP_009800039.1|  PREDICTED: pectinesterase-like                     527   2e-175   
gb|EPS69324.1|  hypothetical protein M569_05439                         525   8e-175   
ref|XP_002275819.3|  PREDICTED: pectinesterase-like                     525   1e-174   Vitis vinifera
ref|XP_009623162.1|  PREDICTED: pectinesterase-like                     524   3e-174   
ref|XP_002303172.1|  hypothetical protein POPTR_0003s01580g             518   2e-172   Populus trichocarpa [western balsam poplar]
ref|XP_004149498.1|  PREDICTED: probable pectinesterase/pectinest...    518   3e-172   
ref|XP_006338009.1|  PREDICTED: putative pectinesterase/pectinest...    519   3e-172   
gb|KGN49779.1|  hypothetical protein Csa_5G119700                       518   4e-172   
ref|XP_003632385.1|  PREDICTED: pectinesterase-like                     514   2e-170   
ref|XP_011046142.1|  PREDICTED: pectinesterase-like                     513   2e-170   
ref|XP_002298186.1|  hypothetical protein POPTR_0001s21630g             509   4e-169   Populus trichocarpa [western balsam poplar]
ref|XP_008466374.1|  PREDICTED: pectinesterase-like isoform X1          508   2e-168   
ref|XP_010027125.1|  PREDICTED: pectinesterase-like                     508   2e-168   
ref|XP_010091418.1|  putative pectinesterase/pectinesterase inhib...    507   5e-168   
ref|XP_011008693.1|  PREDICTED: pectinesterase-like                     507   5e-168   
ref|XP_008466382.1|  PREDICTED: pectinesterase-like isoform X2          506   1e-167   
ref|XP_008466391.1|  PREDICTED: pectinesterase-like isoform X3          506   2e-167   
ref|XP_004151535.1|  PREDICTED: putative pectinesterase/pectinest...    505   4e-167   
ref|XP_004156120.1|  PREDICTED: putative pectinesterase/pectinest...    505   7e-167   
ref|XP_004149499.1|  PREDICTED: putative pectinesterase/pectinest...    504   1e-166   
ref|XP_002298185.1|  hypothetical protein POPTR_0001s21650g             503   2e-166   Populus trichocarpa [western balsam poplar]
ref|XP_011046152.1|  PREDICTED: pectinesterase-like                     502   5e-166   
ref|XP_010038523.1|  PREDICTED: pectinesterase-like                     496   8e-164   
emb|CAN67129.1|  hypothetical protein VITISV_040170                     518   8e-162   Vitis vinifera
ref|XP_002304074.1|  hypothetical protein POPTR_0003s01550g             490   1e-161   Populus trichocarpa [western balsam poplar]
ref|XP_008466403.1|  PREDICTED: pectinesterase-like                     489   5e-161   
ref|XP_007035986.1|  Plant invertase/pectin methylesterase inhibi...    489   1e-160   
ref|XP_004298254.1|  PREDICTED: putative pectinesterase/pectinest...    488   2e-160   
ref|XP_011007987.1|  PREDICTED: pectinesterase-like                     487   3e-160   
ref|XP_010694101.1|  PREDICTED: pectinesterase-like                     487   4e-160   
ref|XP_007051270.1|  Plant invertase/pectin methylesterase inhibi...    486   6e-160   
ref|XP_002528621.1|  Pectinesterase-4 precursor, putative               485   2e-159   Ricinus communis
ref|XP_002528620.1|  Pectinesterase-4 precursor, putative               484   3e-159   Ricinus communis
ref|XP_006851559.1|  hypothetical protein AMTR_s00040p00188020          484   5e-159   
ref|XP_009419138.1|  PREDICTED: pectinesterase-like                     482   2e-158   
ref|XP_010247575.1|  PREDICTED: probable pectinesterase/pectinest...    494   2e-158   
ref|XP_003535290.1|  PREDICTED: probable pectinesterase/pectinest...    473   1e-154   
ref|XP_003521616.1|  PREDICTED: pectinesterase 4-like                   472   2e-154   
gb|KHN14164.1|  Putative pectinesterase/pectinesterase inhibitor 28     472   3e-154   
ref|XP_003591317.1|  Pectinesterase                                     470   1e-153   
ref|XP_004494467.1|  PREDICTED: pectinesterase 4-like                   469   6e-153   
ref|XP_007163236.1|  hypothetical protein PHAVU_001G217400g             466   8e-152   
ref|XP_002519324.1|  Pectinesterase-3 precursor, putative               465   1e-151   Ricinus communis
ref|XP_004495868.1|  PREDICTED: probable pectinesterase/pectinest...    463   7e-151   
ref|XP_007163235.1|  hypothetical protein PHAVU_001G217300g             462   1e-150   
ref|XP_004495869.1|  PREDICTED: probable pectinesterase/pectinest...    462   1e-150   
gb|KDP43631.1|  hypothetical protein JCGZ_16918                         461   3e-150   
ref|XP_003519736.1|  PREDICTED: probable pectinesterase/pectinest...    459   2e-149   
gb|KHN00235.1|  Putative pectinesterase/pectinesterase inhibitor 21     459   4e-149   
ref|XP_009407600.1|  PREDICTED: pectinesterase-like                     456   4e-148   
gb|KHN00313.1|  Putative pectinesterase/pectinesterase inhibitor 21     452   1e-146   
ref|XP_010098738.1|  Pectinesterase 3                                   453   2e-146   
ref|XP_010273980.1|  PREDICTED: putative pectinesterase/pectinest...    452   3e-146   
ref|XP_003536855.1|  PREDICTED: probable pectinesterase/pectinest...    451   6e-146   
gb|KHN43418.1|  Putative pectinesterase/pectinesterase inhibitor 13     446   1e-145   
gb|KDP28007.1|  hypothetical protein JCGZ_19087                         449   2e-145   
gb|ABO80928.1|  Pectinesterase; Pectinesterase inhibitor                449   3e-145   Medicago truncatula
ref|XP_003626047.1|  Pectinesterase                                     449   3e-145   
ref|XP_003626051.1|  Pectinesterase                                     446   5e-144   
ref|XP_007145106.1|  hypothetical protein PHAVU_007G210300g             444   2e-143   
ref|XP_007145107.1|  hypothetical protein PHAVU_007G210400g             441   2e-142   
ref|XP_003518613.1|  PREDICTED: probable pectinesterase/pectinest...    440   6e-142   
ref|XP_008227793.1|  PREDICTED: pectinesterase                          439   2e-141   
ref|XP_007221469.1|  hypothetical protein PRUPE_ppa003369mg             439   3e-141   
ref|XP_007145105.1|  hypothetical protein PHAVU_007G210200g             436   1e-140   
ref|XP_010047427.1|  PREDICTED: putative pectinesterase/pectinest...    435   8e-140   
ref|XP_008343212.1|  PREDICTED: pectinesterase-like                     433   3e-139   
gb|KHG23523.1|  putative pectinesterase/pectinesterase inhibitor ...    432   4e-139   
ref|XP_003591319.1|  Pectinesterase                                     432   9e-139   
ref|XP_006652375.1|  PREDICTED: probable pectinesterase/pectinest...    432   9e-139   
ref|XP_003535291.1|  PREDICTED: probable pectinesterase/pectinest...    429   6e-138   
ref|XP_010523883.1|  PREDICTED: pectinesterase 5                        427   5e-137   
ref|XP_002516193.1|  Pectinesterase-1 precursor, putative               427   8e-137   Ricinus communis
ref|XP_002447958.1|  hypothetical protein SORBIDRAFT_06g018850          425   3e-136   Sorghum bicolor [broomcorn]
gb|EAY94388.1|  hypothetical protein OsI_16156                          426   3e-136   Oryza sativa Indica Group [Indian rice]
ref|XP_010939548.1|  PREDICTED: pectinesterase-like                     426   3e-136   
gb|EAY94391.1|  hypothetical protein OsI_16158                          425   4e-136   Oryza sativa Indica Group [Indian rice]
ref|NP_001052981.1|  Os04g0458900                                       425   5e-136   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67075.1|  OSIGBa0097P08.5                                        425   5e-136   Oryza sativa [red rice]
gb|ACF79975.1|  unknown                                                 424   7e-136   Zea mays [maize]
gb|EMS49616.1|  Putative pectinesterase/pectinesterase inhibitor 28     424   8e-136   
gb|EMT00807.1|  Putative pectinesterase/pectinesterase inhibitor 28     423   2e-135   
tpg|DAA37472.1|  TPA: hypothetical protein ZEAMMB73_350063              423   2e-135   
ref|XP_003579894.1|  PREDICTED: pectinesterase-like                     423   2e-135   
ref|XP_010656076.1|  PREDICTED: putative pectinesterase/pectinest...    424   3e-135   
ref|XP_009341542.1|  PREDICTED: pectinesterase-like                     421   2e-134   
ref|XP_002324181.2|  pectinesterase family protein                      421   4e-134   Populus trichocarpa [western balsam poplar]
ref|XP_008804471.1|  PREDICTED: pectinesterase-like                     419   9e-134   
ref|NP_182226.1|  pectinesterase 4                                      414   1e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010258716.1|  PREDICTED: putative pectinesterase/pectinest...    413   2e-131   
ref|XP_008242146.1|  PREDICTED: pectinesterase-like                     414   2e-131   
gb|KDP43632.1|  hypothetical protein JCGZ_16919                         411   3e-131   
ref|XP_009369731.1|  PREDICTED: putative pectinesterase/pectinest...    413   3e-131   
ref|XP_010544936.1|  PREDICTED: pectinesterase 5-like                   412   6e-131   
ref|XP_008668795.1|  PREDICTED: pectinesterase-like                     413   7e-131   
ref|XP_004975844.1|  PREDICTED: probable pectinesterase/pectinest...    411   8e-131   
ref|XP_007203102.1|  hypothetical protein PRUPE_ppa023802mg             412   1e-130   
gb|AAC27719.1|  flower-specific pectin methylesterase precursor         411   2e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011015792.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    410   3e-130   
gb|EYU28291.1|  hypothetical protein MIMGU_mgv1a003232mg                409   9e-130   
ref|XP_006381543.1|  hypothetical protein POPTR_0006s13690g             409   1e-129   
gb|AAV91509.1|  VGD1-like protein 1                                     409   2e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011005056.1|  PREDICTED: putative pectinesterase/pectinest...    408   3e-129   
gb|KHN23785.1|  Pectinesterase 4                                        405   4e-129   
ref|XP_008800480.1|  PREDICTED: probable pectinesterase/pectinest...    407   5e-129   
ref|XP_010939847.1|  PREDICTED: pectinesterase-like                     405   1e-128   
ref|XP_006828574.1|  hypothetical protein AMTR_s00129p00028250          406   1e-128   
ref|XP_009133794.1|  PREDICTED: pectinesterase 5                        406   2e-128   
gb|KDP33981.1|  hypothetical protein JCGZ_07552                         405   2e-128   
dbj|BAA89480.1|  pectin methylesterase                                  405   3e-128   Salix gilgiana
gb|ABC25451.1|  pollen development related protein                      404   5e-128   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_006296394.1|  hypothetical protein CARUB_v10025567mg             404   6e-128   
emb|CDX83347.1|  BnaA03g21590D                                          402   2e-127   
ref|XP_006661265.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    404   2e-127   
gb|EPS66234.1|  hypothetical protein M569_08543                         403   3e-127   
emb|CDY50913.1|  BnaC03g72420D                                          401   6e-127   
ref|XP_010932334.1|  PREDICTED: pectinesterase-like                     402   1e-126   
ref|XP_009359677.1|  PREDICTED: putative pectinesterase/pectinest...    402   1e-126   
ref|XP_010107091.1|  putative pectinesterase/pectinesterase inhib...    401   2e-126   
ref|XP_010098737.1|  Putative pectinesterase/pectinesterase inhib...    395   2e-126   
ref|XP_004142361.1|  PREDICTED: putative pectinesterase/pectinest...    400   3e-126   
ref|XP_008337792.1|  PREDICTED: probable pectinesterase/pectinest...    400   5e-126   
ref|XP_008391931.1|  PREDICTED: putative pectinesterase/pectinest...    400   5e-126   
ref|XP_010506728.1|  PREDICTED: pectinesterase 4                        399   6e-126   
ref|XP_009417804.1|  PREDICTED: pectinesterase-like                     399   7e-126   
ref|XP_006397894.1|  hypothetical protein EUTSA_v10001369mg             399   1e-125   
ref|NP_001105487.1|  pectin methylesterase1                             397   2e-125   Zea mays [maize]
emb|CAB58974.1|  pectin methylesterase                                  398   2e-125   Arabidopsis thaliana [mouse-ear cress]
emb|CDY37779.1|  BnaC04g00460D                                          398   2e-125   
ref|XP_010507936.1|  PREDICTED: pectinesterase 4-like isoform X2        397   3e-125   
gb|AES82263.2|  pectinesterase inhibitor domain protein                 397   3e-125   
gb|KHN23786.1|  Putative pectinesterase/pectinesterase inhibitor 21     392   3e-125   
ref|XP_010507935.1|  PREDICTED: pectinesterase 4-like isoform X1        397   5e-125   
ref|XP_008460558.1|  PREDICTED: putative pectinesterase/pectinest...    397   5e-125   
gb|AAV91508.1|  VANGUARD 1                                              397   6e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009414337.1|  PREDICTED: pectinesterase-like                     396   8e-125   
ref|NP_182227.1|  pectinesterase 5                                      397   8e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006295414.1|  hypothetical protein CARUB_v10024512mg             395   2e-124   
ref|XP_009142571.1|  PREDICTED: pectinesterase 5-like                   395   3e-124   
gb|ABO80933.1|  Pectinesterase; Pectinesterase inhibitor                396   3e-124   Medicago truncatula
ref|XP_010506727.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    395   4e-124   
ref|XP_009142468.1|  PREDICTED: pectinesterase 5-like                   395   4e-124   
ref|XP_003626045.1|  Photosystem I P700 chlorophyll a apoprotein        395   5e-124   
gb|KFK37472.1|  hypothetical protein AALP_AA4G261200                    394   7e-124   
ref|XP_009405157.1|  PREDICTED: putative pectinesterase/pectinest...    395   9e-124   
ref|XP_011078157.1|  PREDICTED: pectinesterase-like                     394   1e-123   
ref|XP_008450602.1|  PREDICTED: probable pectinesterase/pectinest...    393   1e-123   
ref|NP_001060715.1|  Os07g0691100                                       392   1e-123   Oryza sativa Japonica Group [Japonica rice]
emb|CDX80075.1|  BnaA05g00810D                                          393   1e-123   
ref|XP_003550590.1|  PREDICTED: putative pectinesterase/pectinest...    394   1e-123   
ref|XP_010922274.1|  PREDICTED: pectinesterase-like                     392   2e-123   
ref|XP_003609936.1|  Pectinesterase                                     393   2e-123   
ref|XP_008812392.1|  PREDICTED: pectinesterase-like                     393   3e-123   
ref|XP_003626056.1|  Pectinesterase                                     390   5e-123   
ref|XP_009386320.1|  PREDICTED: pectinesterase-like                     392   5e-123   
gb|KDP27834.1|  hypothetical protein JCGZ_18914                         391   6e-123   
ref|XP_006488977.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    389   8e-123   
ref|XP_010046221.1|  PREDICTED: probable pectinesterase/pectinest...    390   8e-123   
ref|XP_003578154.1|  PREDICTED: pectinesterase-like                     390   5e-122   
gb|EAZ41174.1|  hypothetical protein OsJ_25671                          388   7e-122   Oryza sativa Japonica Group [Japonica rice]
gb|KDP27833.1|  hypothetical protein JCGZ_18913                         388   9e-122   
ref|XP_004135775.1|  PREDICTED: putative pectinesterase/pectinest...    388   1e-121   
ref|XP_007012506.1|  Pectinesterase                                     388   1e-121   
ref|XP_008795810.1|  PREDICTED: putative pectinesterase/pectinest...    387   1e-121   
gb|EAZ05229.1|  hypothetical protein OsI_27427                          387   2e-121   Oryza sativa Indica Group [Indian rice]
ref|XP_002516960.1|  Pectinesterase precursor, putative                 387   3e-121   Ricinus communis
ref|XP_003626046.1|  Photosystem I P700 chlorophyll a apoprotein        387   3e-121   
ref|XP_004508050.1|  PREDICTED: putative pectinesterase/pectinest...    386   1e-120   
ref|XP_006841651.1|  hypothetical protein AMTR_s00003p00239700          385   2e-120   
emb|CBI37069.3|  unnamed protein product                                378   3e-120   
ref|XP_009402043.1|  PREDICTED: putative pectinesterase/pectinest...    383   4e-120   
ref|XP_002465396.1|  hypothetical protein SORBIDRAFT_01g037900          382   1e-119   Sorghum bicolor [broomcorn]
emb|CDY72195.1|  BnaCnng76410D                                          383   1e-119   
ref|XP_010687597.1|  PREDICTED: pectinesterase                          383   1e-119   
ref|XP_010039612.1|  PREDICTED: probable pectinesterase/pectinest...    382   3e-119   
ref|XP_006649944.1|  PREDICTED: probable pectinesterase/pectinest...    380   5e-119   
ref|XP_007227113.1|  hypothetical protein PRUPE_ppa026560mg             380   8e-119   
dbj|BAK06954.1|  predicted protein                                      379   1e-118   
ref|XP_010937248.1|  PREDICTED: pectinesterase-like                     379   1e-118   
ref|XP_010659656.1|  PREDICTED: putative pectinesterase/pectinest...    380   2e-118   
ref|XP_004289435.1|  PREDICTED: pectinesterase 4-like                   379   2e-118   
tpg|DAA44942.1|  TPA: hypothetical protein ZEAMMB73_754551              379   2e-118   
ref|XP_006659464.1|  PREDICTED: probable pectinesterase/pectinest...    380   2e-118   
gb|KFK32509.1|  hypothetical protein AALP_AA6G251800                    380   3e-118   
emb|CDY70135.1|  BnaCnng66900D                                          379   4e-118   
ref|XP_004984909.1|  PREDICTED: probable pectinesterase/pectinest...    378   4e-118   
ref|XP_008245480.1|  PREDICTED: probable pectinesterase/pectinest...    378   5e-118   
ref|XP_010551001.1|  PREDICTED: probable pectinesterase/pectinest...    381   7e-118   
ref|XP_009385286.1|  PREDICTED: putative pectinesterase/pectinest...    378   8e-118   
emb|CDY11406.1|  BnaA09g39720D                                          377   9e-118   
ref|XP_002314364.1|  putative pectinesterase family protein             377   1e-117   Populus trichocarpa [western balsam poplar]
gb|ABO80921.1|  Pectinesterase                                          369   1e-117   Medicago truncatula
ref|NP_001049858.1|  Os03g0300500                                       377   1e-117   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010417438.1|  PREDICTED: probable pectinesterase/pectinest...    378   1e-117   
ref|XP_003626052.1|  Pectinesterase                                     368   1e-117   
emb|CDX83235.1|  BnaA03g22710D                                          378   2e-117   
ref|XP_009133943.1|  PREDICTED: probable pectinesterase/pectinest...    377   2e-117   
ref|NP_195049.1|  putative pectinesterase/pectinesterase inhibito...    378   2e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002878962.1|  pectinesterase family protein                      378   2e-117   
ref|XP_009421439.1|  PREDICTED: putative pectinesterase/pectinest...    375   4e-117   
ref|XP_008245483.1|  PREDICTED: putative pectinesterase/pectinest...    376   4e-117   
ref|XP_007154534.1|  hypothetical protein PHAVU_003G126700g             377   5e-117   
ref|XP_010547008.1|  PREDICTED: probable pectinesterase/pectinest...    375   5e-117   
ref|XP_004229265.1|  PREDICTED: pectinesterase-like                     375   5e-117   
ref|XP_008458409.1|  PREDICTED: probable pectinesterase/pectinest...    375   7e-117   
ref|XP_010024084.1|  PREDICTED: putative pectinesterase/pectinest...    375   7e-117   
ref|XP_002512459.1|  Pectinesterase precursor, putative                 375   7e-117   Ricinus communis
emb|CDY38523.1|  BnaC03g26740D                                          376   8e-117   
emb|CBI39537.3|  unnamed protein product                                381   8e-117   
ref|XP_011006446.1|  PREDICTED: putative pectinesterase/pectinest...    375   9e-117   
ref|XP_004958780.1|  PREDICTED: probable pectinesterase/pectinest...    374   1e-116   
ref|XP_010472674.1|  PREDICTED: probable pectinesterase/pectinest...    375   2e-116   
ref|NP_850077.1|  probable pectinesterase/pectinesterase inhibito...    375   2e-116   Arabidopsis thaliana [mouse-ear cress]
gb|KDO39972.1|  hypothetical protein CISIN_1g039111mg                   375   2e-116   
ref|XP_006472135.1|  PREDICTED: probable pectinesterase/pectinest...    375   2e-116   
emb|CDO98832.1|  unnamed protein product                                374   3e-116   
ref|NP_001169525.1|  pectinesterase                                     375   3e-116   Zea mays [maize]
ref|XP_010437784.1|  PREDICTED: putative pectinesterase/pectinest...    375   3e-116   
ref|XP_006285466.1|  hypothetical protein CARUB_v10006885mg             375   4e-116   
ref|XP_010546739.1|  PREDICTED: probable pectinesterase/pectinest...    376   5e-116   
ref|XP_010431632.1|  PREDICTED: probable pectinesterase/pectinest...    378   6e-116   
ref|XP_004956918.1|  PREDICTED: putative pectinesterase/pectinest...    375   7e-116   
dbj|BAK05856.1|  predicted protein                                      374   7e-116   
ref|XP_003561714.1|  PREDICTED: probable pectinesterase/pectinest...    372   8e-116   
gb|KFK29934.1|  hypothetical protein AALP_AA7G197300                    373   1e-115   
emb|CDP19930.1|  unnamed protein product                                372   2e-115   
ref|XP_009116895.1|  PREDICTED: probable pectinesterase/pectinest...    372   2e-115   
ref|XP_010413301.1|  PREDICTED: probable pectinesterase/pectinest...    372   2e-115   
sp|P41510.1|PME_BRANA  RecName: Full=Probable pectinesterase/pect...    372   2e-115   Brassica napus [oilseed rape]
ref|NP_001132793.1|  pectinesterase                                     373   2e-115   Zea mays [maize]
ref|XP_006295415.1|  hypothetical protein CARUB_v10024513mg             372   3e-115   
ref|NP_001063246.1|  Os09g0433700                                       372   3e-115   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008783344.1|  PREDICTED: pectinesterase-like                     371   3e-115   
ref|XP_011093900.1|  PREDICTED: pectinesterase-like                     371   3e-115   
ref|XP_010932011.1|  PREDICTED: putative pectinesterase/pectinest...    371   3e-115   
gb|AAC14494.1|  putative pectinesterase                                 368   4e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010526019.1|  PREDICTED: putative pectinesterase/pectinest...    371   4e-115   
ref|XP_007224682.1|  hypothetical protein PRUPE_ppa025631mg             370   4e-115   
gb|AAP40488.1|  putative pectin methylesterase                          372   5e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006658993.1|  PREDICTED: probable pectinesterase/pectinest...    370   6e-115   
ref|XP_006412376.1|  hypothetical protein EUTSA_v10024699mg             371   7e-115   
tpg|DAA64233.1|  TPA: pectinesterase                                    370   7e-115   
ref|XP_007035646.1|  Plant invertase/pectin methylesterase inhibi...    374   7e-115   
ref|XP_008223240.1|  PREDICTED: putative pectinesterase/pectinest...    370   8e-115   
ref|XP_002867193.1|  pectinesterase family protein                      371   8e-115   
gb|EAZ44838.1|  hypothetical protein OsJ_29475                          373   1e-114   Oryza sativa Japonica Group [Japonica rice]
ref|NP_199729.1|  putative pectinesterase/pectinesterase inhibito...    369   1e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009762317.1|  PREDICTED: pectinesterase-like                     373   1e-114   
ref|XP_006342830.1|  PREDICTED: putative pectinesterase/pectinest...    368   2e-114   
ref|XP_006293116.1|  hypothetical protein CARUB_v10019418mg             369   2e-114   
ref|XP_006395088.1|  hypothetical protein EUTSA_v10003919mg             368   3e-114   
ref|XP_010447267.1|  PREDICTED: putative pectinesterase/pectinest...    369   3e-114   
ref|XP_010524549.1|  PREDICTED: putative pectinesterase/pectinest...    368   5e-114   
ref|XP_010512603.1|  PREDICTED: probable pectinesterase/pectinest...    368   5e-114   
ref|XP_009352343.1|  PREDICTED: putative pectinesterase/pectinest...    367   6e-114   
ref|XP_010432595.1|  PREDICTED: putative pectinesterase/pectinest...    368   8e-114   
ref|XP_009594458.1|  PREDICTED: pectinesterase                          370   8e-114   
ref|XP_007011069.1|  Root hair specific 12                              368   9e-114   
ref|XP_009761202.1|  PREDICTED: pectinesterase                          367   9e-114   
ref|XP_009775925.1|  PREDICTED: pectinesterase-like                     366   1e-113   
ref|XP_010547007.1|  PREDICTED: probable pectinesterase/pectinest...    367   1e-113   
ref|XP_004150503.1|  PREDICTED: putative pectinesterase/pectinest...    367   1e-113   
ref|XP_009599026.1|  PREDICTED: pectinesterase-like                     365   1e-113   
ref|XP_009385223.1|  PREDICTED: putative pectinesterase/pectinest...    366   2e-113   
ref|XP_011092100.1|  PREDICTED: probable pectinesterase/pectinest...    373   2e-113   
gb|KFK35400.1|  hypothetical protein AALP_AA5G280100                    367   2e-113   
ref|XP_008438906.1|  PREDICTED: pectinesterase-like                     365   3e-113   
ref|XP_009352341.1|  PREDICTED: probable pectinesterase/pectinest...    366   3e-113   
ref|XP_008223242.1|  PREDICTED: putative pectinesterase/pectinest...    365   4e-113   
ref|XP_010558804.1|  PREDICTED: probable pectinesterase/pectinest...    365   4e-113   
emb|CDO98834.1|  unnamed protein product                                365   5e-113   
ref|XP_010273808.1|  PREDICTED: pectinesterase 3                        365   6e-113   
ref|XP_003631952.1|  PREDICTED: putative pectinesterase/pectinest...    365   8e-113   
ref|XP_010105131.1|  Putative pectinesterase/pectinesterase inhib...    365   8e-113   
ref|NP_191776.1|  Probable pectinesterase/pectinesterase inhibito...    365   1e-112   
ref|XP_010526136.1|  PREDICTED: probable pectinesterase/pectinest...    364   2e-112   
ref|XP_006433461.1|  hypothetical protein CICLE_v10000415mg             368   2e-112   
ref|XP_008390623.1|  PREDICTED: probable pectinesterase/pectinest...    363   2e-112   
ref|XP_006433459.1|  hypothetical protein CICLE_v10000415mg             368   2e-112   
gb|KFK38146.1|  hypothetical protein AALP_AA3G075300                    363   2e-112   
emb|CDX93988.1|  BnaC04g21470D                                          363   2e-112   
ref|XP_006433460.1|  hypothetical protein CICLE_v10000415mg             368   2e-112   
ref|XP_006433462.1|  hypothetical protein CICLE_v10000415mg             367   3e-112   
ref|XP_007221831.1|  hypothetical protein PRUPE_ppa020185mg             363   3e-112   
gb|KDP23449.1|  hypothetical protein JCGZ_23282                         363   3e-112   
ref|XP_006408782.1|  hypothetical protein EUTSA_v10001934mg             364   4e-112   
ref|XP_007222393.1|  hypothetical protein PRUPE_ppa003441mg             363   4e-112   
ref|XP_009615584.1|  PREDICTED: pectinesterase-like                     362   5e-112   
ref|XP_006344696.1|  PREDICTED: putative pectinesterase/pectinest...    366   6e-112   
ref|XP_006281463.1|  hypothetical protein CARUB_v10027546mg             362   6e-112   
ref|XP_009138737.1|  PREDICTED: probable pectinesterase/pectinest...    362   6e-112   
ref|XP_009792453.1|  PREDICTED: pectinesterase-like                     362   7e-112   
dbj|BAO02509.1|  predicted pectin esterase ortholog                     362   7e-112   
ref|XP_009129764.1|  PREDICTED: probable pectinesterase/pectinest...    361   2e-111   
ref|XP_010315470.1|  PREDICTED: pectinesterase                          362   2e-111   
emb|CDY33925.1|  BnaA02g30620D                                          361   2e-111   
ref|XP_002461260.1|  hypothetical protein SORBIDRAFT_02g043780          361   2e-111   
ref|XP_004487827.1|  PREDICTED: pectinesterase/pectinesterase inh...    362   2e-111   
ref|XP_009352342.1|  PREDICTED: probable pectinesterase/pectinest...    361   2e-111   
ref|XP_002865716.1|  pectinesterase family protein                      360   3e-111   
ref|XP_003559753.1|  PREDICTED: pectinesterase-like                     360   5e-111   
emb|CDO98833.1|  unnamed protein product                                359   6e-111   
gb|AAV91510.1|  VGD1-like protein 2                                     360   6e-111   
sp|Q42608.1|PME_BRACM  RecName: Full=Pectinesterase/pectinesteras...    359   7e-111   
ref|XP_002462429.1|  hypothetical protein SORBIDRAFT_02g025460          361   7e-111   
ref|XP_007226432.1|  hypothetical protein PRUPE_ppa024011mg             359   8e-111   
ref|XP_008810219.1|  PREDICTED: putative pectinesterase/pectinest...    360   9e-111   
ref|XP_010094457.1|  Putative pectinesterase/pectinesterase inhib...    359   1e-110   
emb|CDX72395.1|  BnaC07g44170D                                          359   2e-110   
ref|XP_009620126.1|  PREDICTED: pectinesterase-like                     357   4e-110   
ref|XP_010268337.1|  PREDICTED: putative pectinesterase/pectinest...    359   4e-110   
ref|XP_010029513.1|  PREDICTED: pectinesterase 3-like                   357   5e-110   
ref|XP_006402403.1|  hypothetical protein EUTSA_v10005855mg             357   9e-110   
ref|XP_011101135.1|  PREDICTED: probable pectinesterase/pectinest...    356   1e-109   
ref|XP_006653811.1|  PREDICTED: probable pectinesterase/pectinest...    364   1e-109   
ref|XP_006290150.1|  hypothetical protein CARUB_v10003818mg             361   1e-109   
ref|XP_006299753.1|  hypothetical protein CARUB_v10015948mg             360   1e-109   
ref|XP_004162213.1|  PREDICTED: probable pectinesterase/pectinest...    356   2e-109   
ref|NP_198139.1|  putative pectinesterase/pectinesterase inhibito...    360   2e-109   
ref|XP_002884519.1|  pectinesterase family protein                      358   2e-109   
ref|XP_004134493.1|  PREDICTED: probable pectinesterase/pectinest...    355   3e-109   
ref|XP_008223241.1|  PREDICTED: putative pectinesterase/pectinest...    355   3e-109   
gb|ABK24761.1|  unknown                                                 355   3e-109   
ref|XP_006452912.1|  hypothetical protein CICLE_v10007819mg             355   4e-109   
emb|CDY46125.1|  BnaA03g52430D                                          356   5e-109   
gb|AAQ86797.1|  pectin methylesterase allergen WDL                      347   5e-109   
ref|XP_002878440.1|  hypothetical protein ARALYDRAFT_486726             355   6e-109   
ref|XP_010240510.1|  PREDICTED: probable pectinesterase/pectinest...    360   6e-109   
ref|XP_004239802.1|  PREDICTED: pectinesterase-like                     353   7e-109   
ref|XP_004508195.1|  PREDICTED: pectinesterase/pectinesterase inh...    354   8e-109   
ref|XP_009134836.1|  PREDICTED: probable pectinesterase/pectinest...    358   8e-109   
ref|XP_002447200.1|  hypothetical protein SORBIDRAFT_06g030310          359   1e-108   
emb|CDP21547.1|  unnamed protein product                                357   1e-108   
ref|XP_011071430.1|  PREDICTED: pectinesterase-like                     353   1e-108   
gb|EMT24232.1|  Putative pectinesterase/pectinesterase inhibitor 13     355   1e-108   
ref|NP_187212.1|  probable pectinesterase/pectinesterase inhibito...    356   2e-108   
ref|XP_009134835.1|  PREDICTED: probable pectinesterase/pectinest...    358   2e-108   
ref|XP_002872255.1|  pectinesterase family protein                      355   2e-108   
gb|EMT00224.1|  Putative pectinesterase/pectinesterase inhibitor 21     352   2e-108   
ref|XP_006408050.1|  hypothetical protein EUTSA_v10020314mg             353   4e-108   
ref|XP_011071429.1|  PREDICTED: pectinesterase-like                     351   4e-108   
ref|XP_007154304.1|  hypothetical protein PHAVU_003G107300g             352   5e-108   
gb|KHN02946.1|  Pectinesterase/pectinesterase inhibitor                 351   6e-108   
gb|KHG19164.1|  putative pectinesterase/pectinesterase inhibitor ...    351   6e-108   
ref|XP_010429701.1|  PREDICTED: probable pectinesterase/pectinest...    355   6e-108   
gb|EYU42197.1|  hypothetical protein MIMGU_mgv1a000814mg                362   7e-108   
ref|XP_010429777.1|  PREDICTED: probable pectinesterase/pectinest...    355   7e-108   
ref|XP_006474558.1|  PREDICTED: probable pectinesterase/pectinest...    352   7e-108   
ref|XP_011071427.1|  PREDICTED: pectinesterase-like                     351   8e-108   
ref|XP_004144445.1|  PREDICTED: pectinesterase 3-like                   352   9e-108   
ref|XP_010487229.1|  PREDICTED: pectinesterase 1-like                   352   9e-108   
ref|XP_009147301.1|  PREDICTED: probable pectinesterase/pectinest...    353   9e-108   
gb|KHG02742.1|  putative pectinesterase/pectinesterase inhibitor ...    351   1e-107   
ref|XP_009124640.1|  PREDICTED: probable pectinesterase/pectinest...    351   1e-107   
ref|XP_003550542.1|  PREDICTED: pectinesterase/pectinesterase inh...    351   1e-107   
ref|XP_009138175.1|  PREDICTED: putative pectinesterase/pectinest...    352   1e-107   
ref|XP_008351177.1|  PREDICTED: putative pectinesterase/pectinest...    351   1e-107   
ref|XP_006841646.1|  hypothetical protein AMTR_s00003p00238240          351   1e-107   
ref|XP_010029515.1|  PREDICTED: pectinesterase 3-like                   351   1e-107   
ref|XP_002515781.1|  Pectinesterase-3 precursor, putative               351   1e-107   
ref|XP_002273396.2|  PREDICTED: probable pectinesterase/pectinest...    350   1e-107   
ref|XP_010465322.1|  PREDICTED: pectinesterase 1-like                   351   1e-107   
ref|XP_003529556.1|  PREDICTED: pectinesterase/pectinesterase inh...    351   1e-107   
ref|XP_010501837.1|  PREDICTED: pectinesterase 1-like                   351   2e-107   
ref|XP_010667121.1|  PREDICTED: probable pectinesterase/pectinest...    351   2e-107   
ref|XP_006394934.1|  hypothetical protein EUTSA_v10003734mg             354   2e-107   
ref|XP_011071425.1|  PREDICTED: pectinesterase-like                     349   2e-107   
gb|EMS59431.1|  Putative pectinesterase/pectinesterase inhibitor 28     351   3e-107   
ref|XP_010440281.1|  PREDICTED: probable pectinesterase/pectinest...    350   3e-107   
ref|XP_007225707.1|  hypothetical protein PRUPE_ppa003569mg             350   3e-107   
gb|AFW59628.1|  pectinesterase                                          354   3e-107   
ref|XP_009773400.1|  PREDICTED: pectinesterase 1                        350   4e-107   
ref|XP_004298144.1|  PREDICTED: probable pectinesterase/pectinest...    349   4e-107   
ref|XP_008460354.1|  PREDICTED: pectinesterase 3                        350   4e-107   
dbj|BAC42986.1|  putative pectinesterase                                352   5e-107   
ref|NP_001145377.1|  uncharacterized protein LOC100278720               354   5e-107   
sp|P83948.1|PME3_CITSI  RecName: Full=Pectinesterase 3; Short=PE ...    350   5e-107   
ref|XP_011071421.1|  PREDICTED: pectinesterase-like                     348   5e-107   
ref|XP_009124869.1|  PREDICTED: probable pectinesterase/pectinest...    350   6e-107   
ref|XP_011071432.1|  PREDICTED: pectinesterase-like                     350   6e-107   
ref|XP_010464089.1|  PREDICTED: probable pectinesterase/pectinest...    353   6e-107   
ref|XP_009151177.1|  PREDICTED: putative pectinesterase/pectinest...    353   6e-107   
gb|EPS69059.1|  hypothetical protein M569_05708                         364   7e-107   
ref|XP_004229262.1|  PREDICTED: pectinesterase-like                     348   9e-107   
emb|CDY68790.1|  BnaAnng28400D                                          352   1e-106   
ref|XP_009606551.1|  PREDICTED: pectinesterase 3                        348   1e-106   
ref|XP_010276571.1|  PREDICTED: uncharacterized protein LOC104611288    357   1e-106   
gb|AFB77929.1|  pectin methylesterase                                   348   1e-106   
ref|XP_011071655.1|  PREDICTED: pectinesterase-like                     347   2e-106   
ref|XP_011071426.1|  PREDICTED: pectinesterase-like                     347   2e-106   
ref|XP_004229264.1|  PREDICTED: pectinesterase-like                     347   2e-106   
emb|CDX74137.1|  BnaA03g29100D                                          352   2e-106   
emb|CDX80613.1|  BnaC07g28310D                                          351   2e-106   
gb|KHG22352.1|  putative pectinesterase/pectinesterase inhibitor ...    347   2e-106   
emb|CDY27751.1|  BnaA05g31600D                                          349   2e-106   
ref|XP_010656074.1|  PREDICTED: pectinesterase-like                     348   2e-106   
gb|KHG08631.1|  Pectinesterase 3                                        347   3e-106   
ref|XP_003534836.1|  PREDICTED: pectinesterase/pectinesterase inh...    347   4e-106   
ref|XP_010940182.1|  PREDICTED: pectinesterase 3-like                   353   5e-106   
gb|EMS52976.1|  putative pectinesterase/pectinesterase inhibitor 21     358   6e-106   
ref|XP_009104375.1|  PREDICTED: probable pectinesterase/pectinest...    347   7e-106   
ref|XP_002304257.2|  pectinesterase family protein                      347   8e-106   
emb|CDO97788.1|  unnamed protein product                                348   8e-106   
ref|XP_008389982.1|  PREDICTED: pectinesterase                          345   9e-106   
ref|XP_008370617.1|  PREDICTED: pectinesterase                          347   1e-105   
ref|XP_002885032.1|  hypothetical protein ARALYDRAFT_318218             346   1e-105   
ref|XP_007136533.1|  hypothetical protein PHAVU_009G053000g             346   1e-105   
emb|CDY25098.1|  BnaC06g18400D                                          346   2e-105   
gb|EMT19669.1|  Putative pectinesterase/pectinesterase inhibitor 21     358   2e-105   
ref|XP_002318979.2|  hypothetical protein POPTR_0013s01500g             346   2e-105   
ref|XP_011048630.1|  PREDICTED: pectinesterase-like                     345   2e-105   
ref|XP_009771261.1|  PREDICTED: pectinesterase-like                     344   2e-105   
ref|XP_011076284.1|  PREDICTED: probable pectinesterase/pectinest...    345   3e-105   
ref|XP_009769268.1|  PREDICTED: pectinesterase-like                     344   3e-105   
ref|XP_009589961.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    344   3e-105   
gb|AFI23414.1|  pectin methylesterase                                   345   4e-105   
ref|XP_006828586.1|  hypothetical protein AMTR_s00129p00044320          344   4e-105   
ref|NP_001151322.1|  pectinesterase-1 precursor                         344   5e-105   
dbj|BAC42959.2|  putative pectin methylesterase                         344   5e-105   
ref|XP_006388348.1|  hypothetical protein POPTR_0214s00200g             344   6e-105   
ref|XP_004495690.1|  PREDICTED: probable pectinesterase/pectinest...    345   6e-105   
ref|XP_002882102.1|  pectinesterase family protein                      344   6e-105   
ref|XP_010543643.1|  PREDICTED: probable pectinesterase/pectinest...    344   7e-105   
gb|AFW03480.1|  pectin methylesterase 1                                 344   8e-105   
ref|XP_009766961.1|  PREDICTED: probable pectinesterase/pectinest...    343   9e-105   
ref|NP_001275859.1|  pectinesterase 1 precursor                         344   9e-105   
gb|AFW03475.1|  pectin methylesterase 1                                 343   1e-104   
emb|CDY34927.1|  BnaA01g32580D                                          343   1e-104   
ref|XP_002445591.1|  hypothetical protein SORBIDRAFT_07g022100          345   1e-104   
gb|ACN40984.1|  unknown                                                 344   1e-104   
ref|XP_011023718.1|  PREDICTED: probable pectinesterase/pectinest...    343   1e-104   
ref|XP_004231483.1|  PREDICTED: probable pectinesterase/pectinest...    343   2e-104   
sp|O04886.1|PME1_CITSI  RecName: Full=Pectinesterase 1; Short=PE ...    343   2e-104   
ref|XP_002316458.2|  pectinesterase family protein                      342   2e-104   
ref|XP_011031815.1|  PREDICTED: pectinesterase-like                     343   2e-104   
gb|KHN03341.1|  Pectinesterase/pectinesterase inhibitor                 342   2e-104   
emb|CAC01624.1|  putative pectin methylesterase                         342   2e-104   
ref|XP_006407898.1|  hypothetical protein EUTSA_v10020401mg             342   3e-104   
ref|XP_006828588.1|  hypothetical protein AMTR_s00129p00047530          341   3e-104   
dbj|BAK06157.1|  predicted protein                                      356   3e-104   
emb|CDY05188.1|  BnaC05g46150D                                          343   3e-104   
gb|KEH19215.1|  pectinesterase/pectinesterase inhibitor                 342   3e-104   
ref|XP_008388938.1|  PREDICTED: putative pectinesterase/pectinest...    343   4e-104   
ref|NP_187339.2|  probable pectinesterase/pectinesterase inhibito...    342   4e-104   
ref|XP_007139063.1|  hypothetical protein PHAVU_009G261700g             342   4e-104   
ref|XP_004289016.1|  PREDICTED: probable pectinesterase/pectinest...    342   5e-104   
gb|KFK37969.1|  hypothetical protein AALP_AA3G053300                    343   5e-104   
ref|XP_009135375.1|  PREDICTED: pectinesterase 1-like                   342   6e-104   
ref|XP_010316615.1|  PREDICTED: pectinesterase-like                     340   6e-104   
emb|CAB95025.1|  pectin methylesterase                                  341   6e-104   
ref|XP_010482197.1|  PREDICTED: probable pectinesterase/pectinest...    341   8e-104   
ref|XP_006297279.1|  hypothetical protein CARUB_v10013297mg             341   9e-104   
ref|XP_010442377.1|  PREDICTED: probable pectinesterase/pectinest...    340   1e-103   
ref|XP_007025998.1|  Pectinesterase/pectinesterase inhibitor, put...    340   1e-103   
ref|XP_004235526.1|  PREDICTED: pectinesterase 3                        340   1e-103   
gb|KFK26505.1|  hypothetical protein AALP_AA8G257900                    345   1e-103   
ref|XP_010674078.1|  PREDICTED: probable pectinesterase/pectinest...    351   2e-103   
ref|XP_008246353.1|  PREDICTED: putative pectinesterase/pectinest...    341   2e-103   
emb|CAC09455.2|  H0423H10.1                                             344   2e-103   
ref|XP_009774523.1|  PREDICTED: pectinesterase-like                     339   2e-103   
ref|XP_009398948.1|  PREDICTED: probable pectinesterase/pectinest...    339   2e-103   
gb|AAO85706.1|  pectin methyl-esterase                                  340   2e-103   
gb|KHN26433.1|  Putative pectinesterase/pectinesterase inhibitor 24     339   3e-103   
ref|XP_003629946.1|  Pectinesterase                                     333   3e-103   
ref|XP_004232737.1|  PREDICTED: pectinesterase-like                     338   4e-103   
ref|XP_006407095.1|  hypothetical protein EUTSA_v10022003mg             340   4e-103   
ref|XP_006342828.1|  PREDICTED: pectinesterase-like                     338   4e-103   
emb|CBI22967.3|  unnamed protein product                                355   4e-103   
ref|XP_002516186.1|  Pectinesterase-3 precursor, putative               340   4e-103   
ref|XP_004303759.1|  PREDICTED: pectinesterase 3-like                   339   5e-103   
gb|KEH32301.1|  pectinesterase/pectinesterase inhibitor                 339   5e-103   
ref|XP_009762395.1|  PREDICTED: pectinesterase/pectinesterase inh...    339   6e-103   
ref|XP_006578909.1|  PREDICTED: probable pectinesterase/pectinest...    339   6e-103   
ref|XP_010321856.1|  PREDICTED: pectinesterase                          338   6e-103   
ref|XP_003526361.1|  PREDICTED: putative pectinesterase/pectinest...    338   6e-103   
ref|XP_009111740.1|  PREDICTED: putative pectinesterase/pectinest...    342   7e-103   
gb|AFI23411.1|  pectin methylesterase                                   338   9e-103   
ref|XP_006367330.1|  PREDICTED: probable pectinesterase/pectinest...    338   1e-102   
gb|EYU45538.1|  hypothetical protein MIMGU_mgv1a003726mg                338   1e-102   



>ref|XP_009627394.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=572

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/550 (59%), Positives = 406/550 (74%), Gaps = 15/550 (3%)
 Frame = +1

Query  436   DASSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLE  615
             D  S   D         SV  FC+ AE+K+ CAKS+  VA N+SAT KD++ A+I+ T++
Sbjct  29    DGGSKDDDQSTKVQMKASVEEFCKPAEFKEACAKSLDSVAKNNSATMKDYLLASIQITVD  88

Query  616   EVHKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRAD  795
             EV KS ++V  T +   +DPYNHMA+EDCKE+LQ AI++LQAS S+VGDTELH+L  R  
Sbjct  89    EVKKSFEVVEKTSVNNESDPYNHMAVEDCKELLQYAIEELQASYSMVGDTELHSLNDRVS  148

Query  796   QLLNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNIT  975
             +LLNW+ AVY+YQ+ C + IE   YKSAIE GM+NATQLT+NAINI+A++S +L++FN++
Sbjct  149   ELLNWLGAVYSYQSMCVDAIEKPEYKSAIEKGMVNATQLTHNAINIVAKISTVLQSFNVS  208

Query  976   TTTDLLHKAADKnnnnnnnTTSRRLLQT-----DHFPEWFPIADRKLLAAQRRGNLRPNV  1140
                +L   A          T++RRLL+      D +P WFP+ADRKLLA  R   + P+ 
Sbjct  209   IPANLKSAAGS--------TSNRRLLEVNEIGHDSYPTWFPVADRKLLARHRF--VTPHA  258

Query  1141  VVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKT  1320
             VVAKDGSGQ+ T+  AL +YP  H+ KY++YVKAG+Y+E + + KK  NVF++G+GAGKT
Sbjct  259   VVAKDGSGQYNTVAAALAAYPENHRGKYIVYVKAGIYEEHIIISKKQPNVFIFGNGAGKT  318

Query  1321  IITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFD  1500
             IITG +N+  MKI T  TATFS LG GFVARGITFRNTAGPEGHQAVA R   DM+A+FD
Sbjct  319   IITGNRNFGLMKIPTQDTATFSVLGNGFVARGITFRNTAGPEGHQAVALRINGDMAAVFD  378

Query  1501  CSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITAD  1680
             CSIEGYQDTLYY  +RQFYRNCVISGTIDFIFG+G+A+IQNS+IIARKPL  QFNTITAD
Sbjct  379   CSIEGYQDTLYYQNHRQFYRNCVISGTIDFIFGRGSAVIQNSLIIARKPLAGQFNTITAD  438

Query  1681  GKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLG  1860
             GKE+A   GGVV QNCR+VPE  L P+RF++ TY GRPWKAYSTTV MES++GD + P G
Sbjct  439   GKEIALKPGGVVFQNCRVVPEVELFPVRFQLPTYLGRPWKAYSTTVFMESELGDFIRPEG  498

Query  1861  WKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWL  2040
             W  W GE FE+TC YYE+ N GPGA    RNR+FK F ++ P  A  +TAG W++ + WL
Sbjct  499   WMTWQGEAFEQTCHYYEFANRGPGALINNRNRSFKNFRLISPEEAAQYTAGPWINGDLWL  558

Query  2041  PATGVPFAIG  2070
               TG PF +G
Sbjct  559   RHTGAPFYLG  568



>ref|XP_009762125.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=572

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/550 (58%), Positives = 406/550 (74%), Gaps = 15/550 (3%)
 Frame = +1

Query  436   DASSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLE  615
             D SS   D         SV  FC+ AE+K+ CAKS+  VA N+SAT KD++  +I+ T++
Sbjct  29    DGSSKDDDQSTKVQLKASVEEFCKPAEFKEACAKSLDSVAKNNSATMKDYLLVSIQITVD  88

Query  616   EVHKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRAD  795
             EV KS ++V  T +   +DPYNHMA+EDCKE+LQ AI++LQ S S+VGDTELH+L  R  
Sbjct  89    EVKKSFEVVEKTSVNNESDPYNHMAVEDCKELLQYAIEELQVSYSMVGDTELHSLNDRVS  148

Query  796   QLLNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNIT  975
             +LLNW+ AVY+YQ+ C + IE   YKSAIE GM+NATQLT+NAINI+A+MS +L++FN++
Sbjct  149   ELLNWLGAVYSYQSMCVDAIEKPEYKSAIEKGMVNATQLTHNAINIVAKMSTILQSFNVS  208

Query  976   TTTDLLHKAADKnnnnnnnTTSRRLLQT-----DHFPEWFPIADRKLLAAQRRGNLRPNV  1140
               ++L   A          T++RRLL+      D +P WFP+ADRKLLA  R   + P+ 
Sbjct  209   IPSNLKSAAGS--------TSNRRLLEVNEIGHDSYPTWFPVADRKLLARHRF--VTPHA  258

Query  1141  VVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKT  1320
             VVAKDGSGQ+ T+  AL +YP  H+ KY++YVKAG+Y+E + + KK  NVF++G+GAG+T
Sbjct  259   VVAKDGSGQYNTVAAALAAYPENHRGKYIVYVKAGIYEEHIIISKKQPNVFIFGNGAGET  318

Query  1321  IITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFD  1500
             IITG +N+A MKI T  TATFS LG GFVARGITFRNTAGPEGHQAVA R   DM+A+FD
Sbjct  319   IITGNRNFALMKIPTQDTATFSVLGNGFVARGITFRNTAGPEGHQAVALRINGDMAAVFD  378

Query  1501  CSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITAD  1680
             CSIEGYQDTLYY  +RQFYRNCVISGT+DFIFG+G+A+IQNS+IIARKPL  QFNTITAD
Sbjct  379   CSIEGYQDTLYYQNHRQFYRNCVISGTVDFIFGRGSAVIQNSLIIARKPLAGQFNTITAD  438

Query  1681  GKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLG  1860
             GKE+A   GGVV QNCR+VPE  L P+RF++ TY GRPWKAYSTTV MES++GD + P G
Sbjct  439   GKEIALKPGGVVFQNCRVVPEVELFPVRFQLPTYLGRPWKAYSTTVFMESELGDFIRPEG  498

Query  1861  WKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWL  2040
             W  W GE FE+TC YYE+ N GPGA    RNR+FK F ++ P  A  +TA  W++ + WL
Sbjct  499   WMTWQGETFEQTCHYYEFANRGPGALINNRNRSFKNFRLISPEEAAQYTAAPWINGDMWL  558

Query  2041  PATGVPFAIG  2070
               TG PF +G
Sbjct  559   RHTGAPFYLG  568



>emb|CDP17031.1| unnamed protein product [Coffea canephora]
Length=569

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/547 (55%), Positives = 396/547 (72%), Gaps = 22/547 (4%)
 Frame = +1

Query  457   DHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQ  636
             ++ V+  SMKSVTTFC+   +KD CAKS+  VANN +A+ KD++ AA+ AT++EV K+ Q
Sbjct  35    NNNVAGSSMKSVTTFCESTNFKDACAKSVESVANNATASPKDYLMAALNATIQEVQKALQ  94

Query  637   LV--VNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNW  810
             +     +K++   DPYNH+A +DC+E+L  A+D+LQA+IS VGD+ELHTL  R D+LLNW
Sbjct  95    VANATGSKVDPKQDPYNHVAAQDCQELLGYAVDELQAAISTVGDSELHTLNDRVDELLNW  154

Query  811   MSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDL  990
             +SAVY+YQ+ C ++ +    +SA E+GM+NATQLT+NA++I+A +S LLK FNI+   ++
Sbjct  155   LSAVYSYQSDCLDEFDKPELRSAFENGMLNATQLTDNAVSIVASLSDLLKGFNISLG-NI  213

Query  991   LHKAADKnnnnnnnTTSRRLLQ-------TDHFPEWFPIADRKLLAAQRRGNLRPNVVVA  1149
             L  A             RRLLQ        + FP+WFP  DR+LLAA RR  + PN VVA
Sbjct  214   LPPAG-----------GRRLLQDNDVMGHEESFPQWFPAGDRRLLAAHRRAGVLPNAVVA  262

Query  1150  KDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIIT  1329
             KDGSGQFKTI+ AL +YP   + +YVIYVKAG+Y+E V V KK  NVF+YGDGA +TI+T
Sbjct  263   KDGSGQFKTISQALAAYPANLRGRYVIYVKAGIYEENVIVDKKQANVFIYGDGANRTIVT  322

Query  1330  GKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSI  1509
             G KN+  M I TS TATFS LG  F+ARG+TFRNTAGPEGHQAVA R   D++A+FDC +
Sbjct  323   GSKNFGIMHIQTSNTATFSVLGDRFMARGMTFRNTAGPEGHQAVALRIMGDLAAVFDCKM  382

Query  1510  EGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKE  1689
             EG+QDTLYY T+RQFYRNCVISGT+DFIFGKG+A+IQNS+II RK L +Q+NT+TADGKE
Sbjct  383   EGFQDTLYYQTHRQFYRNCVISGTVDFIFGKGSAVIQNSVIIVRKGLPNQYNTVTADGKE  442

Query  1690  LAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKI  1869
             L K + G+VLQNC+IV E AL P+RF+V  Y GRPWK ++ TV+M++ IGDL+ P G+  
Sbjct  443   LEKDRTGLVLQNCQIVAEDALFPVRFQVANYLGRPWKKFAKTVIMQTDIGDLIRPQGYIE  502

Query  1870  WDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPAT  2049
             W GE FEKTC Y E+ N GPGA    RN+ F +   +    A  +T   ++  + WL AT
Sbjct  503   WQGETFEKTCEYLEFANRGPGA-VAPRNKNFTRSRFIDGREASLYTVDSFVQGHRWLRAT  561

Query  2050  GVPFAIG  2070
             GVPF  G
Sbjct  562   GVPFTPG  568



>ref|XP_006352821.1| PREDICTED: pectinesterase 4-like [Solanum tuberosum]
Length=558

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/530 (57%), Positives = 388/530 (73%), Gaps = 18/530 (3%)
 Frame = +1

Query  487   SVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVV-NTKIEQ  663
             S+  FC+ AE++  C KS+  V+ N SAT KD++ A+++ T +E+ KS  +V   + I+ 
Sbjct  41    SIVEFCKPAEFEIACFKSLDAVSKNDSATMKDYLLASLQVTGDEIKKSLAVVEKGSPIDN  100

Query  664   STDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTC  843
              TDPYNHMA+EDCKE+LQ A+++L  S S+VGDT LH+L  R  +LLNW+ AVY+YQ+ C
Sbjct  101   KTDPYNHMAVEDCKELLQYAVEELHDSYSMVGDTALHSLGDRVSELLNWLGAVYSYQSMC  160

Query  844   TEQIESRL-YKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnnn  1020
              + I  +  YK A+E+GM NATQLT+NAINI+A++S +L+AFNI++T             
Sbjct  161   LDGIIDKPDYKEALENGMRNATQLTHNAINIVAKISTVLQAFNISSTI------------  208

Query  1021  nnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGALKSY  1200
               + ++ RRLL    +P WFP+ADRKLLA  R     P+ VVAKDGSGQ+ T+  AL +Y
Sbjct  209   TTSTSSHRRLLG---YPTWFPVADRKLLAGGRH-RAAPHAVVAKDGSGQYNTVAAALAAY  264

Query  1201  PPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKTAT  1380
             P  H+ KY++YVKAG+YDE V + KK  NVF+YGDGAGKTIITG +N+  M I T  TAT
Sbjct  265   PKNHRGKYIVYVKAGIYDEHVIISKKQPNVFIYGDGAGKTIITGHRNFGIMNIPTQDTAT  324

Query  1381  FSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYR  1560
             F+ LG GFVARGITFRNTAGP+GHQAVA R   DM+A+FDCSIEGYQDTLYY  +RQFYR
Sbjct  325   FAVLGNGFVARGITFRNTAGPQGHQAVALRINGDMAAVFDCSIEGYQDTLYYQNHRQFYR  384

Query  1561  NCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCRIVP  1740
             NCVISGTIDFIFG+G+A+IQNS+IIAR+PL  QFNTITADGKE+A   GG+V QNCRIVP
Sbjct  385   NCVISGTIDFIFGRGSAVIQNSLIIARRPLDSQFNTITADGKEIANKPGGLVFQNCRIVP  444

Query  1741  ETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYKN  1920
             E  L   RFK+ TY GRPWK Y+TTV MES++GD + P GW IW G++FE+TC YYE+ N
Sbjct  445   ERELFADRFKLATYLGRPWKPYATTVFMESELGDFIRPEGWMIWQGQSFERTCNYYEFAN  504

Query  1921  SGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
              GPGAN   RN++FK F ++ P+ A  +T   W++   WL  TG PF +G
Sbjct  505   RGPGANINNRNKSFKNFRLINPVEAVQYTVDRWINGYLWLRHTGAPFYLG  554



>ref|XP_004242306.1| PREDICTED: pectinesterase 4-like [Solanum lycopersicum]
Length=564

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/531 (56%), Positives = 388/531 (73%), Gaps = 18/531 (3%)
 Frame = +1

Query  487   SVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVV-NTKIEQ  663
             S+  FC+ AE++  C KS+  V+ N SAT KD++ A+++ T +E+ KS  +V     I+ 
Sbjct  45    SIVEFCKPAEFEIACFKSLDAVSKNDSATMKDYLLASLQVTGDEIKKSLAVVEKGNPIDN  104

Query  664   STDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTC  843
              TDPYNHMA+EDCKE+LQ A+++L  S S+VGDT LH+L  R  +LLNW+ AVY+YQ+ C
Sbjct  105   KTDPYNHMAVEDCKELLQYAVEELHDSYSMVGDTALHSLGDRVSELLNWLGAVYSYQSMC  164

Query  844   TEQIESRL-YKSAIEDGMINATQLTNNAINIIAEMSKLLK-AFNITTTTDLLHKAADKnn  1017
              + I  +  YK  +E+GM NATQLT+NAINI+A++S +L+ AFNI++T            
Sbjct  165   LDGIIDKPDYKQVLENGMRNATQLTHNAINIVAKISNVLQDAFNISSTI-----------  213

Query  1018  nnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGALKS  1197
                + ++ RRLL   ++P WFP+ADRKLLA   R    P+ VVAKDG+GQ+ T+  AL +
Sbjct  214   --PSTSSHRRLLA--NYPTWFPVADRKLLAGGGRHRAAPHAVVAKDGTGQYNTVAAALAA  269

Query  1198  YPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKTA  1377
             YP  H+ KY++YVKAG+Y+E V + KK  NVF+YGDGAGKTIITG +N+  MKI T  TA
Sbjct  270   YPKNHRGKYIVYVKAGIYEEQVIISKKQPNVFIYGDGAGKTIITGHRNFGIMKIPTQDTA  329

Query  1378  TFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFY  1557
             TF+ LG GFVARGITFRNTAGP+GHQAVA R   DM+A+FDCSIEGYQDTLYY  +RQFY
Sbjct  330   TFAVLGNGFVARGITFRNTAGPQGHQAVALRINGDMAAVFDCSIEGYQDTLYYQNHRQFY  389

Query  1558  RNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCRIV  1737
             RNCVISGTIDFIFG+G+A+IQNS+IIAR+PL  QFNTITADGKE+A   GG+V QNCRIV
Sbjct  390   RNCVISGTIDFIFGRGSAVIQNSLIIARRPLDSQFNTITADGKEIANKPGGLVFQNCRIV  449

Query  1738  PETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYK  1917
             PE  L   RFK+ +Y GRPWK Y+TTV MES++GD + P GW IW GE+FE+TC YYE+ 
Sbjct  450   PEMELFADRFKLASYLGRPWKPYATTVFMESELGDFIRPEGWMIWQGESFERTCNYYEFA  509

Query  1918  NSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             N GPGAN   RN++FK F ++ P+ A  +T   W++   WL  TG PF +G
Sbjct  510   NRGPGANINNRNKSFKNFRLINPLEAVQYTVDRWINGYLWLKHTGAPFYLG  560



>gb|EYU46877.1| hypothetical protein MIMGU_mgv1a027033mg [Erythranthe guttata]
Length=569

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/536 (55%), Positives = 386/536 (72%), Gaps = 9/536 (2%)
 Frame = +1

Query  472   TGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNT  651
             T SMK +T+ C+   YK+ CA S+   A N S+T  D+I A ++A L EV KS       
Sbjct  41    TNSMKMITSICELTSYKESCAHSLESTAKNTSSTATDYILAVVQAALTEVQKSLDTTAKV  100

Query  652   KIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAY  831
              ++++ D YN++A+EDCK++L  A++ LQASISVVGD ++HT++ RA +LL+WM+AVYA+
Sbjct  101   VVDKNADQYNYVAVEDCKDLLDYAVETLQASISVVGDNDMHTVEDRAHELLSWMTAVYAF  160

Query  832   QTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADK  1011
             QTTC +QI++  YKSAIE+GM+NATQLT+NA+NI+AE+S++L+ FNI  TT         
Sbjct  161   QTTCVDQIQNPEYKSAIENGMVNATQLTHNAVNIVAELSQVLQLFNIQQTT-----VNAT  215

Query  1012  nnnnnnnTTSRRLLQT-DHFPEWFPIADRKLLAAQRRGN-LRPNVVVAKDGSGQFKTITG  1185
             + +++  ++ RRLL T D +P W   ADRKLLA  +RGN +RPN VVAKDGSG FKTI  
Sbjct  216   STSSSGGSSHRRLLMTEDGYPTWVAAADRKLLA--KRGNAIRPNAVVAKDGSGHFKTINQ  273

Query  1186  ALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITT  1365
             AL SYP   K +Y+IYVKAGVYDE V V K   NVFM+GDG G++I+TGK N+  MKI T
Sbjct  274   ALASYPSNFKGRYIIYVKAGVYDEQVIVDKNKPNVFMFGDGIGRSIVTGKLNFGKMKIGT  333

Query  1366  SKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTY  1545
               TATF+   +GF+AR +TFRN AGPEGHQAVA+RS  D + +FDCS EG QDTLYY   
Sbjct  334   MHTATFANEAEGFIARSMTFRNEAGPEGHQAVAFRSLGDKAVLFDCSFEGSQDTLYYQFR  393

Query  1546  RQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQN  1725
             RQFYRNC I GT+DFIFGKG A+IQ+S I+ RKP+ +QFNT+TADG+E+ K   G+V+QN
Sbjct  394   RQFYRNCHIYGTVDFIFGKGDAVIQDSEIVVRKPMPNQFNTVTADGREIQKGSNGLVIQN  453

Query  1726  CRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMY  1905
             C IVP+  L P RF+  TY GRPW   + TVVM+S++GD + P GW++WDG N  KTC  
Sbjct  454   CLIVPDKYLFPTRFQTPTYLGRPWTPQALTVVMQSKLGDFIRPEGWRVWDGANNHKTCEM  513

Query  1906  YEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIGY  2073
             YEY N GPG+ T +R++AF  F VL   +A  +TAG +L    WLP TGVPF +G+
Sbjct  514   YEYANKGPGSRTDKRDKAFSHFRVLNTAQAVKYTAGQFLAGAQWLPQTGVPFRLGF  569



>ref|XP_011079480.1| PREDICTED: pectinesterase [Sesamum indicum]
Length=570

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/580 (52%), Positives = 407/580 (70%), Gaps = 13/580 (2%)
 Frame = +1

Query  343   MAGNNIAITLVSLIlvvgvvcgavlvlqgvDDASSGKGDHGVSTGSMKSVTTFCQYAEYK  522
             MA   IA++LVS++LV+GVV G V++++   + SS   +      SMK VT+ C+   YK
Sbjct  1     MAVGKIAVSLVSVMLVIGVVIGVVVMVK--SNGSSDSQESQTRMPSMKMVTSICELTNYK  58

Query  523   DVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQSTDPYNHMAIEDC  702
             + CA S+  VA N+SAT  D+I A +++TL EV KS +      + + TD  NH+A++DC
Sbjct  59    EACAGSLESVAKNNSATANDYILAVVESTLNEVKKSSEATSKVVVNKDTDELNHVAVQDC  118

Query  703   KEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTCTEQIESRLYKSAI  882
             K+ L  A+D LQ SIS+VG +++ TL+ RA +LL+WM+AVYA+ TTC +QIE+  YK+A+
Sbjct  119   KDFLDYAVDTLQKSISLVGGSDMETLEERAHELLSWMTAVYAFHTTCLDQIENPEYKAAV  178

Query  883   EDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnnnnnnnTTSRRLLQTD  1062
              +G  N+TQL++NA+NI+AE+ ++L  FN       +H+  +      + +  RRL+  +
Sbjct  179   ANGTHNSTQLSHNAVNIVAELPQILTLFNYQP----IHQ--NVTTVITSGSGRRRLMSAN  232

Query  1063  H---FPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIY  1233
             H   +P WF  A+RKLLA  +RG + PN VVAKDGSG+FKTI  A+ + P  +K +++IY
Sbjct  233   HHDEYPSWFGPAERKLLA--KRGGIIPNAVVAKDGSGRFKTIGAAIAACPDNNKGRFIIY  290

Query  1234  VKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKTATFSALGKGFVAR  1413
             VKAG+Y E V V KK  N+F+YGDG G+TI+ G KNY  M I T  TATF+    GF+AR
Sbjct  291   VKAGIYREQVIVTKKKTNIFIYGDGIGRTIVAGNKNYGIMNIGTMHTATFANEATGFIAR  350

Query  1414  GITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFI  1593
             GITF N AGP+GHQAVA+RS  DMSA+FDCS EG+QDTLYY   RQFYRNC I GTIDFI
Sbjct  351   GITFSNEAGPQGHQAVAFRSVGDMSAMFDCSFEGHQDTLYYQFLRQFYRNCRIYGTIDFI  410

Query  1594  FGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCRIVPETALNPLRFKV  1773
             FGKG A+IQ+S I+ R+PL  QFNT+TADG+E+ +   G+V+QNCRI+P+  L P+RF+V
Sbjct  411   FGKGDAVIQDSEIVVRRPLPKQFNTVTADGREIPRGSNGLVIQNCRIIPDKFLFPIRFQV  470

Query  1774  KTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRN  1953
              +Y GRPW   + TVVM+S++GD + P GWK+WDG N  K+C  YE+ N GPGA T RRN
Sbjct  471   PSYLGRPWTREALTVVMQSELGDFIRPEGWKLWDGSNNHKSCEMYEFGNRGPGARTDRRN  530

Query  1954  RAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIGY  2073
             R F KF VLGP +A  +T G++L  N WLP TGVPF +G+
Sbjct  531   REFSKFKVLGPNQAAKYTPGIFLAGNQWLPQTGVPFRLGF  570



>ref|XP_009780443.1| PREDICTED: pectinesterase 4-like [Nicotiana sylvestris]
Length=593

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/555 (53%), Positives = 380/555 (68%), Gaps = 32/555 (6%)
 Frame = +1

Query  481   MKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIE  660
             MK V  FCQ AE+KD CAKS+  VA N +AT  D++ AA + T+EEV K  Q    T + 
Sbjct  42    MKKVHEFCQAAEFKDSCAKSLESVAKNDTATINDYLMAAFQTTVEEVKKGLQEAGKTSVN  101

Query  661   QSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTT  840
             + +DPYNHMAIEDCKE+LQ A+++L+ ++S+VG+T+  +L      LLNW+SAVY+YQ+ 
Sbjct  102   KDSDPYNHMAIEDCKELLQRAVEELEDALSLVGETDTESLNEYTYDLLNWLSAVYSYQSM  161

Query  841   CTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnnn  1020
             C + I+    K+AI++G++NATQLTNNA+NI+A++S L  +FNI    +L++ +      
Sbjct  162   CVDAIDKPELKTAIQNGVVNATQLTNNALNIVAKISDLFPSFNIQIPDNLINSS------  215

Query  1021  nnnnTTSRRLLQT-----DHFPEWFPIADRKLLA--------------------AQRRGN  1125
              ++N+  RRLL+      D +P WFP+ADRKLL                         G 
Sbjct  216   -DSNSPHRRLLEANKIDQDGYPTWFPVADRKLLVKSGKGKGQGGGAAGAAPVLPPIGPGP  274

Query  1126  LRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGD  1305
             + P+ VVA+DGSG+FKT+T A+++YPP H+ +Y+IYVKAGVY+E V + KK  NVFMYGD
Sbjct  275   ITPHAVVARDGSGKFKTVTDAVRAYPPNHQGRYIIYVKAGVYNEQVLIDKKQTNVFMYGD  334

Query  1306  GAGKTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDM  1485
             GAGK+IIT  KN    K TTSKTAT +   +GF+ARGITFRNTAGPEG QAVA R   D 
Sbjct  335   GAGKSIITCDKNVKISKFTTSKTATVAVESEGFIARGITFRNTAGPEGEQAVALRINGDR  394

Query  1486  SAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFN  1665
             +A+FDCS+EG+QDTLYY ++RQFYRNCVISGT+DFIFG G+A+IQNS II RK    Q N
Sbjct  395   AAVFDCSMEGFQDTLYYQSHRQFYRNCVISGTVDFIFGMGSAVIQNSEIIVRKCGPKQKN  454

Query  1666  TITADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDL  1845
             T+TADG+EL     G+VLQNCRIVP+  L P+RF V++Y  RPWK  ST V +ES+IGD 
Sbjct  455   TVTADGRELPSEITGLVLQNCRIVPDKELFPVRFAVESYLARPWKQLSTNVFIESEIGDF  514

Query  1846  LSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLD  2025
             + P G+  WD   F +TC+ YEY N GPGA T  RN+ FK F VL P  A  +T G WL 
Sbjct  515   IRPEGYLKWDDHPFHQTCLVYEYANRGPGAATNLRNKLFKNFKVLSPQEATKYTVGAWLR  574

Query  2026  ANSWLPATGVPFAIG  2070
              N WLP T  PF +G
Sbjct  575   GNEWLPGTNAPFYLG  589



>ref|XP_009600101.1| PREDICTED: pectinesterase 4-like [Nicotiana tomentosiformis]
Length=600

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/559 (53%), Positives = 386/559 (69%), Gaps = 33/559 (6%)
 Frame = +1

Query  481   MKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIE  660
             MK V  FCQ AE+KD CAKS+  VA N SAT  D++ AA + T+EEV K  Q    T + 
Sbjct  42    MKKVHEFCQAAEFKDSCAKSLESVAKNDSATINDYLMAAFQTTVEEVKKGLQEAGKTSVN  101

Query  661   QSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTT  840
             + +DPYNHMAIEDCKE+LQ A+++L+ ++S+VG+T+  +L      LLNW+SAVY+YQ+ 
Sbjct  102   KESDPYNHMAIEDCKELLQRAVEELEDALSLVGETDTQSLNEYTYDLLNWLSAVYSYQSM  161

Query  841   CTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnnn  1020
             C + I+    K+AI++G++NATQLTNNA+NI+A++S L ++FNI    +L++ +     +
Sbjct  162   CVDAIDKPELKTAIQNGVVNATQLTNNALNIVAKISDLFQSFNIQIPDNLINNST----S  217

Query  1021  nnnnTTSRRLLQT-----DHFPEWFPIADRKLLAAQRRGN------------LRP-----  1134
             +++N+  RRLL+      D +P WFP+ADRKLLA   +G             + P     
Sbjct  218   SDSNSPHRRLLEANKIDQDGYPTWFPVADRKLLAKSGKGKGKGHGGAAGGAGVAPVLPPI  277

Query  1135  -------NVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVF  1293
                    + VVAKDGSG+FKT+T A+++YPP H+ +Y+IY+KAGVY+E V + KK  NVF
Sbjct  278   GPGPITPHAVVAKDGSGKFKTVTDAVRAYPPNHQGRYIIYIKAGVYNEQVLIDKKQTNVF  337

Query  1294  MYGDGAGKTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRS  1473
             MYGDGAGK+IIT  KN   +K TTSK+AT +   +GF+ARGITFRNTAGPEG QAVA R 
Sbjct  338   MYGDGAGKSIITCDKNVKILKFTTSKSATVAVESEGFIARGITFRNTAGPEGEQAVALRI  397

Query  1474  QSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLV  1653
               D +A+FDCS+EG+QDTLYY ++RQFYRNCVISGT+DFIFG G+A+IQNS II RK   
Sbjct  398   NGDRAAVFDCSMEGFQDTLYYQSHRQFYRNCVISGTVDFIFGMGSAVIQNSEIIVRKCGP  457

Query  1654  HQFNTITADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQ  1833
              Q NTITADG+EL     G+VLQNCRIVP+  L P+RF V++Y  RPWK  ST V MES+
Sbjct  458   TQKNTITADGRELQSEITGLVLQNCRIVPDKELFPVRFAVQSYLARPWKQLSTNVFMESE  517

Query  1834  IGDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAG  2013
             IGD + P G+  WD   F++TC+ YEY N GPGA T  R++ FK F VL P  A  +T G
Sbjct  518   IGDFIRPEGYLKWDDHPFDQTCLVYEYANRGPGAATNLRSKLFKNFKVLSPQEATKYTVG  577

Query  2014  LWLDANSWLPATGVPFAIG  2070
              WL  N WLP T  PF  G
Sbjct  578   AWLRGNEWLPGTNAPFYFG  596



>ref|XP_009589773.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=563

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/551 (52%), Positives = 375/551 (68%), Gaps = 29/551 (5%)
 Frame = +1

Query  445   SGKGDHGVSTG-SMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEV  621
             +G  D   ST   MK V  FCQ   +KD C +S+  VA+N SAT KD+I AA + T++E+
Sbjct  29    NGDNDDDKSTKVQMKKVDEFCQPTSFKDACVQSLDKVASNDSATIKDYIMAAFEYTVQEI  88

Query  622   HKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQL  801
              KS      T + +  DPYNHMAIEDCK +L+DAI++L++++ VV + ++ +L  +   +
Sbjct  89    KKSLHETGKTNVNKENDPYNHMAIEDCKVLLEDAIEELESTLKVVNENQIKSLNDKVYDI  148

Query  802   LNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTT  981
             LN++SAVY+YQ+ C + I    YKSAIE  ++N+TQLTNNAI+I+A++S  L++ +    
Sbjct  149   LNYVSAVYSYQSECIDSINKPEYKSAIEKYLVNSTQLTNNAIDIVAQISSALQSSDFQIP  208

Query  982   TDLLHKAADKnnnnnnnTTSRRLLQT------DHFPEWFPIADRKLLAAQRRGNLRPNVV  1143
               LL+               R+LL++      D++P WFP+ADRKLLA        P+ V
Sbjct  209   DGLLN---------------RKLLESNYQIGHDNYPTWFPVADRKLLA----NTPTPHAV  249

Query  1144  VAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTI  1323
             VAKDGSG+FKT++ A+K+YP KH+ KY++YVKAGVY+E V V KK  NVF++GDGAGKTI
Sbjct  250   VAKDGSGKFKTVSDAIKAYPQKHQGKYIVYVKAGVYNEQVLVDKKQPNVFIFGDGAGKTI  309

Query  1324  ITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDC  1503
             IT  KN   +K TT  +AT      GFVA+GITFRNTAGP+G QAVA R Q D SA+FDC
Sbjct  310   ITSDKNVGILKYTTMNSATLGVNAPGFVAKGITFRNTAGPKGQQAVALRIQGDQSAVFDC  369

Query  1504  SIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQ-FNTITAD  1680
             +IEGYQDTLYY   RQFYRNCVISGTIDFIFG+GTA+IQ+S II RKP   Q +NTITAD
Sbjct  370   NIEGYQDTLYYQNKRQFYRNCVISGTIDFIFGRGTAVIQDSTIILRKPGEGQKWNTITAD  429

Query  1681  GKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLG  1860
             G+E+     GV LQNC+IV E  L   +  V+ + GRPWKA ST VVMES+IG  + P G
Sbjct  430   GREVQSQPTGVALQNCKIVAEKELIGDKI-VENFLGRPWKALSTNVVMESEIGSFIKPEG  488

Query  1861  WKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAG-LWLDANSW  2037
             W IWD E++ +TC  YEY N GPGA T  RN+ FKKF VL   +A  +TAG +W     W
Sbjct  489   WMIWDKEHYHETCECYEYANKGPGAATNARNKVFKKFKVLNQQQATKYTAGAVWFQGKEW  548

Query  2038  LPATGVPFAIG  2070
             LPATG PF +G
Sbjct  549   LPATGAPFYLG  559



>ref|XP_004229178.1| PREDICTED: pectinesterase 4-like [Solanum lycopersicum]
Length=599

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/577 (51%), Positives = 371/577 (64%), Gaps = 45/577 (8%)
 Frame = +1

Query  445   SGKGDHGVSTG-SMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEV  621
             +G   H  ST   MK V  FCQ  E+KD CAKS+   A N SAT +D++ AA + TL+E+
Sbjct  29    NGDNKHDESTKVQMKKVHEFCQATEFKDQCAKSLESAAKNESATIQDYLTAAFRTTLDEL  88

Query  622   HKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQL  801
              K       TK+++  DPYNHMA++DCK MLQ  ++ L+ S+ ++G+T+  ++   +  L
Sbjct  89    KKGLDETGKTKVDKDADPYNHMAVDDCKLMLQWGVEKLEESVKLIGETDEESIHEYSVDL  148

Query  802   LNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTT  981
             LNW+  VY++QT C + IE   YKSAIE G++NATQLTNNAI+++A+MS +LK+FNI   
Sbjct  149   LNWIGGVYSFQTICIDAIEKPEYKSAIEKGLVNATQLTNNAISMVAKMSDVLKSFNIQIP  208

Query  982   TDLLHKAADKnnnnnnnTTSRRLLQTDH-----FPEWFPIADRKLLAAQR----------  1116
               LL   +         +  RRLL  +      +P WFP ADRKLL              
Sbjct  209   QGLLDGNS---------SPHRRLLDVNKVDGGGYPTWFPAADRKLLEKSSKGKGKGKGKG  259

Query  1117  ----------------RGNLRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGV  1248
                              G L P+ VVAKDGSG+FK++  A+K+YP  H+ +Y+IY+KAG 
Sbjct  260   KDGAPLGAGPALPPVGSGPLTPDAVVAKDGSGKFKSVVDAIKAYPANHQGRYIIYIKAGT  319

Query  1249  YDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFR  1428
             Y E V + K   NVFMYGDGAGKTII+  KN  + K+TT  +AT     +GF+A+GITFR
Sbjct  320   YVEQVLIEKNQPNVFMYGDGAGKTIISCDKNVMN-KVTTMNSATVGVNSEGFIAKGITFR  378

Query  1429  NTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGT  1608
             NTAGPEG QAVA R   D  A+FDCSIEG QDTLYY TYRQFYRNCVISGT+DFIFG GT
Sbjct  379   NTAGPEGQQAVALRISGDRGAVFDCSIEGNQDTLYYQTYRQFYRNCVISGTVDFIFGCGT  438

Query  1609  ALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFG  1788
             ALIQNS II R+P     NTITADGK+ A    GVVLQNC+IVPE +L   RFK + Y  
Sbjct  439   ALIQNSEIILRRPRQQSKNTITADGKDQADKNTGVVLQNCKIVPEQSLFEDRFKYEHYLM  498

Query  1789  RPWKAYSTTVVMESQIGDLLSPLGWKIW--DGEN-FEKTCMYYEYKNSGPGANTWRRNRA  1959
             RPWKAYST V MES+IGDL+ P G+ +W  D  N FE+TC  YEY N GPGANT  R++ 
Sbjct  499   RPWKAYSTNVYMESEIGDLIRPEGYLLWASDKPNLFEQTCEVYEYANRGPGANTNGRSKL  558

Query  1960  FKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             FKKF VL P  A  +TA  +L AN WLP T  PF  G
Sbjct  559   FKKFKVLSPQEATKYTAATFLQANEWLPGTSAPFYPG  595



>ref|XP_010271093.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=563

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/546 (52%), Positives = 376/546 (69%), Gaps = 19/546 (3%)
 Frame = +1

Query  445   SGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVH  624
             +G   +G  +  MK V + C    YKD C  S+S VANN SA   D++ AAIKAT  EV 
Sbjct  35    TGSEGNGSLSPKMKFVNSLCDSTSYKDNCLNSLSPVANNASAEPNDYLRAAIKATTIEVK  94

Query  625   KSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLL  804
             K+ ++     +  +T  Y+ M+IEDC+++LQ A+D+L AS S+VG+ E+H +  R  +L 
Sbjct  95    KALEMSGVIGMA-TTSSYDRMSIEDCQDLLQFAVDELDASFSMVGNPEMHPVDDRVAELK  153

Query  805   NWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTT  984
             NW+SAV +YQ TC + IE+   K+A+ +G++NATQLT+NA+ I++E++K+LKA ++    
Sbjct  154   NWLSAVVSYQETCLDGIENPELKTAMNNGLLNATQLTSNALAIVSEVAKILKALDV----  209

Query  985   DLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSG  1164
                H    K        T+RRLL  + +P WF  ADRKLLA+Q  G L PN VVAKDGSG
Sbjct  210   ---HLDGTK--------TNRRLLNVNGYPTWFSSADRKLLASQDNGRLTPNAVVAKDGSG  258

Query  1165  QFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNY  1344
             QFKTI  AL +YP K+  +YVIYVKAGVY+E + V K+  NVFMYGDG  KTIITG+KN 
Sbjct  259   QFKTIAAALAAYPKKNNGRYVIYVKAGVYEEYITVTKEQVNVFMYGDGPTKTIITGRKN-  317

Query  1345  AHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQD  1524
                 + T +TA+F+A+GKGF+A+ I F+NTAGPEGHQAVA R QSDMSA F+C ++GYQD
Sbjct  318   NRQGVPTFQTASFTAIGKGFIAKSIGFQNTAGPEGHQAVALRVQSDMSAFFNCRMDGYQD  377

Query  1525  TLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAK  1704
             TLY  T+RQFYRNCVI+GTIDFIFG  + +IQNS+II RKP+ +Q NT+TA G++    +
Sbjct  378   TLYVQTHRQFYRNCVITGTIDFIFGDSSTVIQNSLIIVRKPMDNQQNTVTAHGRKDKGER  437

Query  1705  GGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGEN  1884
              G+V+QNCRIVPE  L P RFK+++Y GRPWK YS TV+MES IGDL+ P GW  W G+ 
Sbjct  438   TGLVIQNCRIVPEEKLFPQRFKIRSYLGRPWKEYSRTVIMESTIGDLIQPEGWMPWSGDF  497

Query  1885  FEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIR-ARHFTAGLWLDANSWLPATGVPF  2061
                T  Y EY N GPGA T +R   +K F V+   R A  FTAG +L+ + WLP T  PF
Sbjct  498   ALDTLFYAEYGNRGPGAATGKRVN-WKGFKVITNKREALQFTAGPFLEGDKWLPGTTTPF  556

Query  2062  AIGYTK  2079
              +G T+
Sbjct  557   DLGLTQ  562



>gb|EYU26212.1| hypothetical protein MIMGU_mgv1a003546mg [Erythranthe guttata]
Length=579

 Score =   535 bits (1378),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 270/539 (50%), Positives = 360/539 (67%), Gaps = 12/539 (2%)
 Frame = +1

Query  478   SMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKI  657
             S K+V T C   +YK  CA S+S VANN SAT  DF+ AAI   ++EV  +  L  +T  
Sbjct  42    SSKAVFTVCGETDYKKTCADSLSTVANNESATPMDFLQAAINVAIQEVQAAMSLP-DTIG  100

Query  658   EQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQT  837
             + + DP   MA+EDCK++LQ A+ +LQAS S+VGD+ LHT+  R  +L NW+SAV +YQ 
Sbjct  101   KSANDPQQKMAVEDCKDLLQYAVAELQASFSMVGDSSLHTISDREAELKNWLSAVISYQQ  160

Query  838   TCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTD-LLHKAADKn  1014
             TC +   +   + AI DG++NATQLT+NA+ I+  +S++ +AFNI   ++ +L+  A  +
Sbjct  161   TCIDGFTTPELQKAISDGLLNATQLTDNALAIVTVISQIFQAFNINIPSNSILNSTAASS  220

Query  1015  nnnnnnTTSRRLLQTDH---FPEWFPIADRKLLAAQRRGNLRP--NVVVAKDGSGQFKTI  1179
                           T     FP W P  DRKLLA++  G  +P  N VVA+DGSG +KTI
Sbjct  221   GRLLEEDHDHDDDGTSSSSSFPAWLPAGDRKLLASKSGGGGQPAPNAVVAQDGSGGYKTI  280

Query  1180  TGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKI  1359
             + AL +YP  HK +YVIYVKAGVYDE V + K + NV+MYGDG  K+I+TGKK +    +
Sbjct  281   SAALAAYPKNHKGRYVIYVKAGVYDETVTITKDLVNVYMYGDGPRKSIVTGKKCFTD-GV  339

Query  1360  TTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYH  1539
             +T +TA F A+G GF+A+ + FRNTAGPEGHQAVA R QSDMSA ++C ++GYQDTLY  
Sbjct  340   STFQTAPFIAIGDGFIAKSMGFRNTAGPEGHQAVALRVQSDMSAFYNCRMDGYQDTLYAQ  399

Query  1540  TYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVL  1719
             T+RQFYRNCVISGT+DFIFG    +IQN +II RKP+ +Q NT+TA G+  +K   G+V+
Sbjct  400   THRQFYRNCVISGTVDFIFGDSAVVIQNCLIIVRKPMDNQQNTVTAQGRTQSKETTGIVI  459

Query  1720  QNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTC  1899
             QNCRIVPE  L PLRFK+ TY GRPWK YS T++MES + D + P GW  W G NF    
Sbjct  460   QNCRIVPEQKLEPLRFKIPTYLGRPWKKYSKTIIMESTLADFIQPAGWMPWSG-NFALDT  518

Query  1900  MYY-EYKNSGPGANTWRRNRAFKKFDVL-GPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             +YY EY N GPGA T +R + +K + V+     A  FTA  ++ A+ WL  TGVP+ +G
Sbjct  519   LYYREYANKGPGAPTDKRVK-WKGYSVITNRDDALQFTAAPFIQADQWLTTTGVPYFLG  576



>ref|XP_002275000.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=570

 Score =   534 bits (1375),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 274/547 (50%), Positives = 358/547 (65%), Gaps = 27/547 (5%)
 Frame = +1

Query  457   DHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQ  636
             D  V + + K+V   C   +YK  C  S   +ANNHSAT KDF+ AAI  T++EV ++  
Sbjct  40    DEKVLSTTTKAVAAICSPTDYKQQCISSFQTLANNHSATPKDFLMAAIDITMKEVKEAIG  99

Query  637   LVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMS  816
                +  +  ++     MA EDC+++LQ AI +LQAS S+VGD  +HT+  RA  L NW+S
Sbjct  100   KSESIGLAGNSSGRQKMATEDCQDLLQLAIGELQASFSMVGDAAMHTINDRAQDLKNWLS  159

Query  817   AVYAYQTTCTEQI-ESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLL  993
             AV +YQ +C +   E+   KSAI++G++NATQLT+NA+ I++E+S +L +FNI       
Sbjct  160   AVISYQQSCMDGFDETPEVKSAIQNGLLNATQLTSNALAIVSEISAILTSFNIPLN----  215

Query  994   HKAADKnnnnnnnTTSRRLLQ-----TDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDG  1158
                          T+S R LQ     +D +P WF  ADRKLL     G + PN VVA DG
Sbjct  216   ------------FTSSFRRLQEATEESDQYPSWFSAADRKLLGRVDNGKVTPNAVVALDG  263

Query  1159  SGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKK  1338
             SGQ+K+I  AL +YP     +YVIYVKAG+YDE + + K + N+FMYGDG  KT++TGKK
Sbjct  264   SGQYKSIGAALAAYPKNLNGRYVIYVKAGIYDEYITIEKNLVNIFMYGDGPRKTMVTGKK  323

Query  1339  NYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGY  1518
             ++    ITT KT+TFS +G GF+ + + FRNTAGPEGHQAVA R QSD SA F+C ++GY
Sbjct  324   SFLD-GITTYKTSTFSVIGNGFICKSMGFRNTAGPEGHQAVALRVQSDYSAFFNCRMDGY  382

Query  1519  QDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAK  1698
             QDTLY   +RQFYRNCVISGT+DFIFG  T LIQNS+II RKPL +Q NTITA G+   +
Sbjct  383   QDTLYVQAHRQFYRNCVISGTVDFIFGDSTTLIQNSLIIVRKPLDNQQNTITAHGRAEKR  442

Query  1699  AKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDG  1878
                G+V+QNCRIVPE  L P RFK  +Y GRPWKAYS TVVMES +GD + P GW  W G
Sbjct  443   ETTGLVIQNCRIVPEEKLFPTRFKTPSYLGRPWKAYSRTVVMESTMGDFIHPAGWLPWMG  502

Query  1879  ENFEKTCMYY-EYKNSGPGANTWRRNRAFKKFDVL-GPIRARHFTAGLWLDANSWLPATG  2052
              NF    +YY EY N GPGANT +R + +K + V+     A  FTAG ++  N WL  TG
Sbjct  503   -NFALDTLYYAEYANKGPGANTAQRVK-WKGYKVITNRNEALQFTAGPFIQGNEWLRLTG  560

Query  2053  VPFAIGY  2073
              P+ +G+
Sbjct  561   APYFLGF  567



>ref|XP_009359792.1| PREDICTED: pectinesterase-like [Pyrus x bretschneideri]
Length=567

 Score =   533 bits (1374),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 269/541 (50%), Positives = 359/541 (66%), Gaps = 27/541 (5%)
 Frame = +1

Query  478   SMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLE----EVHKSHQLVV  645
             S K+V   C   +YK+ C  S+  VA N SAT KD I AAI +T++     +  S  +  
Sbjct  41    SSKAVAAICDPTDYKEACIDSLGSVAKNDSATPKDLIQAAIDSTIKTMKSAIENSSSIAK  100

Query  646   NTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVY  825
             + K   ST     MA++DCK++L+ AI DLQAS S VGD+ +HT+  R ++L NW SAV 
Sbjct  101   SFKAINST---GKMAMDDCKDLLESAIADLQASFSFVGDSNMHTMHDREEELRNWFSAVI  157

Query  826   AYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAA  1005
             ++Q +C + I     +  ++D ++NATQLT+NA+ I + ++++L+ FNIT   DL     
Sbjct  158   SFQQSCLDGIPQEELQKLMKDSLLNATQLTSNALAIASSIAQILENFNITLNKDL-----  212

Query  1006  DKnnnnnnnTTSRRLLQT-----DHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQF  1170
                      ++SRRLL+      D +P WFP ADR+LLA Q  G ++PN VVAKDGSGQF
Sbjct  213   ------RPTSSSRRLLEQENDGHDQYPSWFPAADRRLLAKQDNGGVKPNAVVAKDGSGQF  266

Query  1171  KTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAH  1350
             KTI  AL +YP   + +Y+IYVKAGVY+E V V K   NVFMYGDG   T++TG K++A 
Sbjct  267   KTIGAALAAYPKGLQGRYIIYVKAGVYNEYVTVTKNQINVFMYGDGPRNTMVTGSKSFAD  326

Query  1351  MKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTL  1530
               ITT  TATFSA+G GF+A+G+ F+NTAG + HQAVA R QS+MSA F+C ++ YQDTL
Sbjct  327   -GITTQNTATFSAIGNGFLAKGMGFQNTAGAQKHQAVALRVQSEMSAFFNCRMDAYQDTL  385

Query  1531  YYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGG  1710
             Y  T+RQFYRNCVISGT+DFIFG    LIQNS+II RKP+ +Q NT+TA G+E  +    
Sbjct  386   YAQTHRQFYRNCVISGTVDFIFGDSPTLIQNSLIIVRKPMDNQKNTVTAQGREDRRENTA  445

Query  1711  VVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFE  1890
             +V+QNCRIVPE  L PLRFK+ +Y GRPWK Y+ TV+MES++GD + P GW  W G NF 
Sbjct  446   IVIQNCRIVPEEVLFPLRFKIPSYLGRPWKTYARTVIMESELGDFIQPAGWLPWSG-NFA  504

Query  1891  KTCMYY-EYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAI  2067
                +YY EY N GPGA T +R R +K + V+    A  FTAG +L A+ WL  +G+P+  
Sbjct  505   LDTLYYAEYGNRGPGAATNQRVR-WKGYHVINRNDALQFTAGPFLLADRWLKTSGIPYFA  563

Query  2068  G  2070
             G
Sbjct  564   G  564



>emb|CBI26012.3| unnamed protein product [Vitis vinifera]
Length=576

 Score =   534 bits (1375),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 277/556 (50%), Positives = 362/556 (65%), Gaps = 28/556 (5%)
 Frame = +1

Query  457   DHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQ  636
             D  V + + K+V   C   +YK  C  S   +ANNHSAT KDF+ AAI  T++EV ++  
Sbjct  40    DEKVLSTTTKAVAAICSPTDYKQQCISSFQTLANNHSATPKDFLMAAIDITMKEVKEAIG  99

Query  637   LVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMS  816
                +  +  ++     MA EDC+++LQ AI +LQAS S+VGD  +HT+  RA  L NW+S
Sbjct  100   KSESIGLAGNSSGRQKMATEDCQDLLQLAIGELQASFSMVGDAAMHTINDRAQDLKNWLS  159

Query  817   AVYAYQTTCTEQI-ESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLL  993
             AV +YQ +C +   E+   KSAI++G++NATQLT+NA+ I++E+S +L +FNI       
Sbjct  160   AVISYQQSCMDGFDETPEVKSAIQNGLLNATQLTSNALAIVSEISAILTSFNIPLN----  215

Query  994   HKAADKnnnnnnnTTSRRLLQ-----TDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDG  1158
                          T+S R LQ     +D +P WF  ADRKLL     G + PN VVA DG
Sbjct  216   ------------FTSSFRRLQEATEESDQYPSWFSAADRKLLGRVDNGKVTPNAVVALDG  263

Query  1159  SGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKK  1338
             SGQ+K+I  AL +YP     +YVIYVKAG+YDE + + K + N+FMYGDG  KT++TGKK
Sbjct  264   SGQYKSIGAALAAYPKNLNGRYVIYVKAGIYDEYITIEKNLVNIFMYGDGPRKTMVTGKK  323

Query  1339  NYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGY  1518
             ++    ITT KT+TFS +G GF+ + + FRNTAGPEGHQAVA R QSD SA F+C ++GY
Sbjct  324   SFLD-GITTYKTSTFSVIGNGFICKSMGFRNTAGPEGHQAVALRVQSDYSAFFNCRMDGY  382

Query  1519  QDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAK  1698
             QDTLY   +RQFYRNCVISGT+DFIFG  T LIQNS+II RKPL +Q NTITA G+   +
Sbjct  383   QDTLYVQAHRQFYRNCVISGTVDFIFGDSTTLIQNSLIIVRKPLDNQQNTITAHGRAEKR  442

Query  1699  AKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDG  1878
                G+V+QNCRIVPE  L P RFK  +Y GRPWKAYS TVVMES +GD + P GW  W G
Sbjct  443   ETTGLVIQNCRIVPEEKLFPTRFKTPSYLGRPWKAYSRTVVMESTMGDFIHPAGWLPWMG  502

Query  1879  ENFEKTCMYY-EYKNSGPGANTWRRNRAFKKFDVL-GPIRARHFTAGLWLDANSWLPATG  2052
              NF    +YY EY N GPGANT +R + +K + V+     A  FTAG ++  N WL  TG
Sbjct  503   -NFALDTLYYAEYANKGPGANTAQRVK-WKGYKVITNRNEALQFTAGPFIQGNEWLRLTG  560

Query  2053  VPFAIGYTK*VYVWMK  2100
              P+ +G+    Y +MK
Sbjct  561   APYFLGFRTICY-YMK  575



>ref|XP_009369703.1| PREDICTED: pectinesterase-like [Pyrus x bretschneideri]
Length=567

 Score =   531 bits (1368),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 267/541 (49%), Positives = 359/541 (66%), Gaps = 27/541 (5%)
 Frame = +1

Query  478   SMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLE----EVHKSHQLVV  645
             S K+V   C   +YK+ C  S+  VA N SAT KD I AAI +T++     +  S  +  
Sbjct  41    SSKAVAAICDPTDYKEACIDSLGSVAKNDSATPKDLIQAAIDSTIKTMKSAIENSSSIAK  100

Query  646   NTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVY  825
             + K   ST     MA++DCK++L+ AI DLQAS S VGD+ +HT+  R ++L NW SAV 
Sbjct  101   SFKAINST---GKMAMDDCKDLLESAIADLQASFSFVGDSNMHTMHDREEELRNWFSAVI  157

Query  826   AYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAA  1005
             ++Q +C + +     +  ++D ++NATQLT+NA+ I + ++++L+ FNIT   DL     
Sbjct  158   SFQQSCLDGLPQEELQKLMKDSLLNATQLTSNALAIASSIAQILENFNITLNKDL-----  212

Query  1006  DKnnnnnnnTTSRRLLQT-----DHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQF  1170
                      ++SRRLL+      D +P WFP ADR+LLA Q  G ++PN VVAKDGSGQF
Sbjct  213   ------RPTSSSRRLLEQENDGHDQYPSWFPAADRRLLAKQDNGGVKPNAVVAKDGSGQF  266

Query  1171  KTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAH  1350
             KTI  AL +YP   + +Y+IYVKAGVY+E V V K   NVFMYGDG   T++TG K++A 
Sbjct  267   KTIGAALAAYPKGLQGRYIIYVKAGVYNEYVTVTKNQINVFMYGDGPRNTMVTGSKSFAD  326

Query  1351  MKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTL  1530
               ITT  TATF+A+G GF+A+G+ F+NTAG + HQAVA R QS+MSA F+C ++ YQDTL
Sbjct  327   -GITTQNTATFAAIGNGFLAKGMGFQNTAGAQKHQAVALRVQSEMSAFFNCRMDAYQDTL  385

Query  1531  YYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGG  1710
             Y  T+RQFYRNCVISGT+DFIFG    LIQNS+II RKP+ +Q NT+TA G+E  +    
Sbjct  386   YAQTHRQFYRNCVISGTVDFIFGDSPTLIQNSLIIVRKPMDNQKNTVTAQGREDRRENTA  445

Query  1711  VVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFE  1890
             +V+QNCRIVPE  L PLRFK+ +Y GRPWK Y+ TV+MES++GD + P GW  W G NF 
Sbjct  446   IVIQNCRIVPEEVLFPLRFKIPSYLGRPWKTYARTVIMESELGDFIQPAGWLPWSG-NFA  504

Query  1891  KTCMYY-EYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAI  2067
                +YY EY N GPGA T +R R +K + V+    A  FTAG +L A+ WL  +G+P+  
Sbjct  505   LDTLYYAEYGNRGPGAATNQRVR-WKGYHVINRNDALQFTAGPFLLADRWLKTSGIPYFA  563

Query  2068  G  2070
             G
Sbjct  564   G  564



>ref|XP_008390484.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=566

 Score =   531 bits (1367),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 269/541 (50%), Positives = 360/541 (67%), Gaps = 28/541 (5%)
 Frame = +1

Query  478   SMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEV----HKSHQLVV  645
             S K+V   C   +YK+ C  S+  VA N SAT KD I AAI +T++ V      S+ +  
Sbjct  41    SSKAVAAICDPTDYKEACIDSLGSVAKNDSATPKDLIQAAIDSTIKTVKSAIENSNSIAK  100

Query  646   NTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVY  825
             + K   ST     MA++DCK++L+ AI DLQAS S VGD+ +HT+  R ++L NW SAV 
Sbjct  101   SFKAINST---GKMAMDDCKDLLESAIADLQASFSFVGDSNMHTMHDREEELRNWFSAVI  157

Query  826   AYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAA  1005
             ++Q +C + I     +  ++D ++NATQLT+NA+ I   ++++L+ FNIT   DL     
Sbjct  158   SFQQSCLDGIPQEELQKLMKDSLLNATQLTSNALAIATSIAQILENFNITLNKDL-----  212

Query  1006  DKnnnnnnnTTSRRLLQTDH-----FPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQF  1170
                      T+S R+L+ ++     +P WFP ADR+LLA Q  G ++PN VVAKDGSGQF
Sbjct  213   -------RPTSSSRILEQENDGHGQYPSWFPAADRRLLAKQDNGGVKPNAVVAKDGSGQF  265

Query  1171  KTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAH  1350
             KTI  AL +YP   + +Y+IYVKAGVY+E V V K   NVFMYGDG  KT++TG K++A 
Sbjct  266   KTIGAALAAYPKGLQGRYIIYVKAGVYNEYVTVTKNQVNVFMYGDGPRKTMVTGSKSFAD  325

Query  1351  MKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTL  1530
               ITT  TATF+A+G GF+A+G+ F+NTAG + HQAVA R QS+MSA F+C ++ YQDTL
Sbjct  326   -GITTQNTATFAAIGNGFLAKGMGFQNTAGAQKHQAVALRVQSEMSAFFNCRMDAYQDTL  384

Query  1531  YYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGG  1710
             Y  T+RQFYRNCVISGT+DFIFG    LIQNS+II RKP+ +Q NT+TA G+E  +    
Sbjct  385   YAQTHRQFYRNCVISGTVDFIFGDSPTLIQNSLIIVRKPMDNQKNTVTAQGREDRRENTA  444

Query  1711  VVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFE  1890
             +V+QNCRIVPE  L PLRFK+ +Y GRPWK Y+ TV+MES++GD + P GW  W G NF 
Sbjct  445   IVIQNCRIVPEEVLFPLRFKIPSYLGRPWKTYARTVIMESELGDFIQPAGWLPWSG-NFA  503

Query  1891  KTCMYY-EYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAI  2067
                +YY EY N GPGA T +R R +K + V+    A  FTAG +L A+ WL  TG+P+  
Sbjct  504   LDTLYYAEYGNRGPGAATNQRVR-WKGYHVINRNDAVQFTAGPFLLADRWLKTTGIPYFA  562

Query  2068  G  2070
             G
Sbjct  563   G  563



>ref|XP_008223522.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=568

 Score =   528 bits (1360),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 269/539 (50%), Positives = 360/539 (67%), Gaps = 22/539 (4%)
 Frame = +1

Query  478   SMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVN-TK  654
             S K+V   C+  +YK+ C  S+S VA N SAT KD I AAI +T+  V  +     N  K
Sbjct  41    SSKAVAAICEPTDYKEACINSLSKVAKNESATAKDLIQAAIDSTISTVKSAIDNSGNIAK  100

Query  655   IEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQ  834
                + +    MA++DCK++L+ AI DLQAS S VGD ++HT+  R D+L NW+SAV ++Q
Sbjct  101   SFSNLNSTGKMAMDDCKDLLESAIADLQASFSYVGDGDMHTMHDREDELKNWLSAVISFQ  160

Query  835   TTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKn  1014
              +C + I     +  ++DG++NATQLT+NA+ I + +S++L++FNIT   DL +      
Sbjct  161   QSCLDGIPQEELQKQMKDGLLNATQLTSNALAIASSISEILQSFNITLNKDLRNP-----  215

Query  1015  nnnnnnTTSRRLLQTDH-----FPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTI  1179
                   ++SRRLL+ ++     +P WF  ADR+LLA+Q  G +RPN VVAKDGSGQ+KTI
Sbjct  216   ------SSSRRLLEHNNDEQGQYPSWFRAADRRLLASQSNGQVRPNAVVAKDGSGQYKTI  269

Query  1180  TGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKI  1359
               AL +YP   K +Y+IYVKAG+Y+E + V K   NVFMYGDG  KT++TG K++A   I
Sbjct  270   GAALAAYPKGLKGRYIIYVKAGIYNEYITVTKDQVNVFMYGDGPRKTMVTGSKSWAD-GI  328

Query  1360  TTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYH  1539
             TT  TATF+A+G GF+A+ + F+NTAG + HQAVA R QS+MSA F+C ++ YQDTLY  
Sbjct  329   TTQNTATFAAIGSGFLAKAMGFQNTAGAQKHQAVALRVQSEMSAFFNCRMDAYQDTLYVQ  388

Query  1540  TYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVL  1719
             T+RQFYRNCVISGT+DFIFG    LIQN +II RKP+  Q NT+TA G++  +   G+V+
Sbjct  389   THRQFYRNCVISGTVDFIFGDSPTLIQNCLIIVRKPMDGQQNTVTAQGRQDKRETTGIVI  448

Query  1720  QNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTC  1899
             QNCRIVPE AL P RFK K+Y GRPWK YS  V+MES++GD + P GW  W G NF    
Sbjct  449   QNCRIVPEQALFPTRFKTKSYLGRPWKTYSRAVIMESELGDFIQPAGWLEWSG-NFALDT  507

Query  1900  MYY-EYKNSGPGANTWRRNRAFKKFDVL-GPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             +Y+ EY N GPGA T  R R +K F V+     A  FTAG +L  + WL  TGVP+  G
Sbjct  508   LYFAEYGNRGPGAVTNGRVR-WKGFHVIRNRNEALQFTAGPFLLGDQWLRNTGVPYFTG  565



>ref|XP_007222606.1| hypothetical protein PRUPE_ppa003528mg [Prunus persica]
 gb|EMJ23805.1| hypothetical protein PRUPE_ppa003528mg [Prunus persica]
Length=568

 Score =   527 bits (1357),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 269/539 (50%), Positives = 359/539 (67%), Gaps = 22/539 (4%)
 Frame = +1

Query  478   SMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVN-TK  654
             S K+V   C+  +YK+ C  S+S VA N SAT KD I AAI +T+  V  +     N  K
Sbjct  41    SSKAVAAICEPTDYKEACINSLSKVAKNESATAKDLIQAAIDSTISTVKSAIDNSGNIAK  100

Query  655   IEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQ  834
                + +    MA++DCK++L+ AI DLQAS S VGD ++HT+  R D+L NW+SAV ++Q
Sbjct  101   SFSNLNSTGKMAMDDCKDLLESAIADLQASFSYVGDGDMHTMHDREDELKNWLSAVISFQ  160

Query  835   TTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKn  1014
              +C + I     +  ++DG++NATQLT+NA+ I + +S++L++FNIT   DL +      
Sbjct  161   QSCLDGIPQEELQKQMKDGLLNATQLTSNALAIASSISEILQSFNITLNKDLRNP-----  215

Query  1015  nnnnnnTTSRRLLQTDH-----FPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTI  1179
                   ++SRRLL+ ++     +P WF  ADR+LLA+Q  G +RPN VVAKDGSGQ+KTI
Sbjct  216   ------SSSRRLLEHNNDEQGQYPSWFRAADRRLLASQSNGQVRPNAVVAKDGSGQYKTI  269

Query  1180  TGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKI  1359
               AL +YP   K +Y+IYVKAG+Y+E V V K   NVFMYGDG  KT++TG K++A   I
Sbjct  270   GAALAAYPKGLKGRYIIYVKAGIYNEYVTVTKDQVNVFMYGDGPRKTMVTGSKSWAD-GI  328

Query  1360  TTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYH  1539
             TT  TATF+A+G GF+A+ + F+NTAG + HQAVA R QS+MSA F+C ++ YQDTLY  
Sbjct  329   TTQNTATFAAIGSGFLAKAMGFQNTAGAQKHQAVALRVQSEMSAFFNCRMDAYQDTLYVQ  388

Query  1540  TYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVL  1719
             T+RQFYRNCVISGT+DFIFG    LIQN +II RKP+  Q NT+TA G++  +   G+V+
Sbjct  389   THRQFYRNCVISGTVDFIFGDSPTLIQNCLIIVRKPMDGQQNTVTAQGRQDKRETTGIVI  448

Query  1720  QNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTC  1899
             QNCRIVPE AL P RFK K+Y GRPWK YS  V+MES++GD + P GW  W G NF    
Sbjct  449   QNCRIVPEQALFPTRFKTKSYLGRPWKTYSRAVIMESELGDFIQPAGWLEWSG-NFALDT  507

Query  1900  MYY-EYKNSGPGANTWRRNRAFKKFDVL-GPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             +Y+ EY N GPGA T  R R +K F V+     A  FT G +L  + WL  TGVP+  G
Sbjct  508   LYFAEYGNRGPGAVTNGRVR-WKGFHVIRNRNEALQFTTGPFLLGDQWLRNTGVPYFTG  565



>ref|XP_004229041.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=585

 Score =   527 bits (1358),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 261/560 (47%), Positives = 354/560 (63%), Gaps = 23/560 (4%)
 Frame = +1

Query  433   DDASSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATL  612
             D + + + D  V + + KS+ + C   ++K  C  S+S +ANN SAT K+F+  AI+  +
Sbjct  32    DSSDNDEKDDKVLSTTSKSIASVCSQTDFKKSCVNSLSSMANNQSATPKEFLLKAIEVAI  91

Query  613   EEVHKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRA  792
             +EV             ++ DP   MA +DCKE+L+ AID+LQAS S VGD+ LHT+  R 
Sbjct  92    QEVRIGIDRSTYIGKAEAHDPLQKMATDDCKELLEYAIDELQASFSSVGDSSLHTIAERE  151

Query  793   DQLLNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNI  972
              +L NW+SAV++YQ TC +       +  I   ++NATQLT+N + ++  M+++L  FNI
Sbjct  152   TELKNWLSAVFSYQQTCIDGFTQPEIQKTISTSLLNATQLTDNVLAMVDAMTEILSKFNI  211

Query  973   TTTTDLLHKAADKnnnnnnnTTSRRLLQTDH-------------FPEWFPIADRKLLAAQ  1113
                    +K+A+          SRRLL+ +              +P W   +DRKLLA  
Sbjct  212   PIGKKTDNKSAE-------TAASRRLLENEDNDEQQASNTKSGGYPAWLSASDRKLLAFS  264

Query  1114  RRGNLRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVF  1293
               GN  PN VVAKDGSGQF TI  AL +YP   K +Y IYVKAG+YDE + V K   N+F
Sbjct  265   NNGNPAPNAVVAKDGSGQFNTIAAALAAYPKNLKGRYTIYVKAGIYDEYITVTKDQVNIF  324

Query  1294  MYGDGAGKTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRS  1473
             MYGDG  KTIITG K+ A   ++T ++A+FSA+G GF+ + + F+NTAGPEGHQAVA R 
Sbjct  325   MYGDGPRKTIITGHKS-ALAGVSTYQSASFSAIGNGFIGKSMGFQNTAGPEGHQAVALRV  383

Query  1474  QSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLV  1653
             QSDMSA ++C ++GYQDTLY  T+RQFYRNCV+SGT+DFIFG  +A++QN +IIARKP+ 
Sbjct  384   QSDMSAFYNCRMDGYQDTLYVQTHRQFYRNCVVSGTVDFIFGDSSAILQNCLIIARKPME  443

Query  1654  HQFNTITADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQ  1833
              Q NT+TA G+   +A  G+V+QNCRIVPE  L PLRFK+ T+ GRPWK Y+ TVVMES 
Sbjct  444   KQQNTVTAQGRTNIRATTGLVIQNCRIVPEQLLEPLRFKIPTFLGRPWKMYARTVVMEST  503

Query  1834  IGDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPI-RARHFTA  2010
             + D + P  W  WDG     TC+Y EY N GPGANT  R + +K F V+     A  +T 
Sbjct  504   LADFIQPAVWMPWDGNFALDTCVYAEYANRGPGANTNNRVK-WKGFKVITDRNEALQYTT  562

Query  2011  GLWLDANSWLPATGVPFAIG  2070
               ++  N WL +TG P  +G
Sbjct  563   TPFIQGNQWLQSTGAPHFLG  582



>ref|XP_009800039.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=586

 Score =   527 bits (1357),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 265/544 (49%), Positives = 348/544 (64%), Gaps = 25/544 (5%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQ  663
             KS+ + C   +YK  C  S+S +ANN SAT KDFI  AI+  ++EV    +   +    +
Sbjct  50    KSIASVCSQTDYKKACVNSLSSMANNQSATPKDFIEKAIEVAIQEVRAGMERSASIGKAE  109

Query  664   STDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTC  843
             + D    MA EDCK++L  AID+LQAS S VGD ELH +  R  +L NW+SAV +YQ TC
Sbjct  110   AHDSLQKMATEDCKDLLHFAIDELQASFSSVGDNELHNIADREIELKNWLSAVISYQQTC  169

Query  844   TEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnnnn  1023
              +       K+AI   ++NATQLT+N + I+A +S++L AFNI         +A      
Sbjct  170   MDGFTQPELKNAISTSLLNATQLTDNVLAIVATISEILSAFNIPIGNSSNTSSA------  223

Query  1024  nnnTTSRRLLQTDH------------FPEWFPIADRKLLAAQRRGNLR--PNVVVAKDGS  1161
                 TSRRLL+ ++            FP W P  DRKLLAA R  N +  PN VVAKDGS
Sbjct  224   -TTATSRRLLEANNDDEEAVHNTENGFPAWLPSGDRKLLAA-RNNNPQSPPNAVVAKDGS  281

Query  1162  GQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKN  1341
             GQ+ TI  AL +YP   K +YVIYVKAG+YDE + + K   N+FMYGDG  KTI+TGKK 
Sbjct  282   GQYNTIAAALAAYPKNLKGRYVIYVKAGIYDEYITITKDQVNIFMYGDGPRKTIVTGKK-  340

Query  1342  YAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQ  1521
                  +TT ++A+FSA+G GF+A+ + F+N AGPEGHQAVA R QSDMSA ++C ++GYQ
Sbjct  341   CNRDGVTTYQSASFSAVGNGFIAKSMGFQNIAGPEGHQAVALRVQSDMSAFYNCRMDGYQ  400

Query  1522  DTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKA  1701
             DTLY  T+RQFYRNCV+SGT+DFIFG   A++QN +IIARKP+ +Q NT+TA G+   + 
Sbjct  401   DTLYAQTHRQFYRNCVVSGTVDFIFGDAAAILQNCLIIARKPMDNQQNTVTAQGRTNIRE  460

Query  1702  KGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGE  1881
               G+++QNCRIVPE  L P+RFK+ +Y GRPWK YS TV+MES + D + P GW  W G 
Sbjct  461   TTGLIIQNCRIVPEQLLEPVRFKIPSYLGRPWKMYSRTVIMESTLADFIQPAGWMHWSGN  520

Query  1882  NFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPI-RARHFTAGLWLDANSWLPATGVP  2058
                 TC Y EY N GPGANT  R + +K F V+     A  FT   ++  N WL +TG P
Sbjct  521   FALDTCYYAEYGNRGPGANTNNRVK-WKGFKVITDRNEALQFTTAPFIQGNQWLGSTGSP  579

Query  2059  FAIG  2070
             + +G
Sbjct  580   YYLG  583



>gb|EPS69324.1| hypothetical protein M569_05439 [Genlisea aurea]
Length=569

 Score =   525 bits (1352),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 262/534 (49%), Positives = 350/534 (66%), Gaps = 20/534 (4%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQ  663
             K+V T C    ++  C  ++S + NN SAT KDF+ AAI A ++E+  +         + 
Sbjct  48    KNVATICAATTFQKSCVDTLSPIGNNASATPKDFLAAAINAAVKELQAAMARP-GEAAKG  106

Query  664   STDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTC  843
             +T P + MA+EDCK++ Q A+ DLQAS S VGD+++HT+  R  +L+NWMSAV +Y   C
Sbjct  107   ATHPIDKMAVEDCKDLFQSAVADLQASFSAVGDSQMHTVSDREAELMNWMSAVISYSQAC  166

Query  844   TEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnnnn  1023
              +  +S   +SA+ DG++NATQLT+NA+ I+  +S+LLK+FNI   T     AA      
Sbjct  167   ADGFDSPTIRSAVSDGILNATQLTDNALAIVGAISELLKSFNIPLNTTAGAGAA------  220

Query  1024  nnnTTSRRLLQ----TDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGAL  1191
                 TSRRLL+     D +P W P  DRKLLA+    + +PN VVAKDGSG++ TI+ AL
Sbjct  221   ----TSRRLLEGSADDDVYPLWMPAGDRKLLASGS--HPQPNAVVAKDGSGKYSTISAAL  274

Query  1192  KSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSK  1371
              +YP   K +YVIYVKAGVY E V+V KKM NV++YGDG  KTI+TG K+YA    +  +
Sbjct  275   AAYPANLKGRYVIYVKAGVYHEYVKVDKKMVNVYIYGDGPRKTIVTGSKSYAD-GYSVME  333

Query  1372  TATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQ  1551
             + TFS  G GF+A+ + F NTAGPEGHQAVA   Q D SA ++C ++GYQDTLY   + Q
Sbjct  334   SPTFSVAGNGFIAKSMGFTNTAGPEGHQAVALLVQGDRSAFYNCRMDGYQDTLYTLAHHQ  393

Query  1552  FYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCR  1731
             FYRNCVISGT+DFIFG  + LIQN +II RKP+  QFN +TA GKE      G+V+QNCR
Sbjct  394   FYRNCVISGTVDFIFGDASVLIQNCLIIVRKPMDGQFNAVTAQGKEFPHESTGIVIQNCR  453

Query  1732  IVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYE  1911
             IVPE  L PLRF++++Y GRPWK YSTT++MES +GD + P GW  W G     T  Y E
Sbjct  454   IVPEQKLEPLRFEIESYLGRPWKTYSTTIIMESTLGDFIRPEGWSPWSGSLHIDTLFYRE  513

Query  1912  YKNSGPGANTWRRNRAFKKFDVL-GPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             Y N GPGANT +R   +K + V+     A  +TA  ++  + WL ATG+PF +G
Sbjct  514   YANRGPGANTSKRVH-WKGYKVITNRNEALPWTANPFIQGSQWLKATGIPFFVG  566



>ref|XP_002275819.3| PREDICTED: pectinesterase-like [Vitis vinifera]
Length=582

 Score =   525 bits (1351),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 266/542 (49%), Positives = 354/542 (65%), Gaps = 35/542 (6%)
 Frame = +1

Query  472   TGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNT  651
             + SMK+V + C  A+YKD C +++S VA N SAT KD+I AA++ T++E+  S  L  + 
Sbjct  58    SSSMKAVASVCATADYKDACMQTLSPVAKNGSATPKDYIQAAVQVTMKEIKSSMNL--SE  115

Query  652   KIEQST-DPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYA  828
             K+ Q+T D    MA+ DCK++LQ AID+LQ S S VG+++L TL   + +++NW+SAV +
Sbjct  116   KLVQATNDSRTQMALGDCKDLLQFAIDELQESFSSVGESDLQTLDQLSTEIMNWLSAVVS  175

Query  829   YQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAAD  1008
             YQ TC + +    +++A++ G++NATQLT+NA+ I++++S++L  FN++   DL      
Sbjct  176   YQQTCLDGVIEPRFQTAMQKGLLNATQLTSNALAIVSDISQILTKFNVSL--DL------  227

Query  1009  KnnnnnnnTTSRRLLQT------DHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQF  1170
                       SRRLL        D +P WF   DRKLLA    G L PN +VAKDGSG F
Sbjct  228   -------KPNSRRLLGEIDVLGHDGYPTWFSATDRKLLALHDNGRLTPNAIVAKDGSGHF  280

Query  1171  KTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAH  1350
              TI  AL +YP   K +YVIYVKAG+Y E + V K   NV+MYGDG  KTI+TG K+Y  
Sbjct  281   TTIAAALAAYPKNLKGRYVIYVKAGIYREYITVTKDQVNVYMYGDGPRKTIVTGTKSYRD  340

Query  1351  MKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTL  1530
               ITT KTATFSA+GKGFVAR + F NTAGP+GHQAVA R QSDMSAIF+C ++GYQDTL
Sbjct  341   -GITTYKTATFSAIGKGFVARSMGFVNTAGPDGHQAVALRVQSDMSAIFNCRMDGYQDTL  399

Query  1531  YYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGG  1710
             Y   +RQFYRNCVISGTIDFIFG  T +IQNS+II R+P  +Q NT+TA GK   +   G
Sbjct  400   YIQAHRQFYRNCVISGTIDFIFGDSTTVIQNSLIIVRRPKDNQQNTVTAHGKAEKRETTG  459

Query  1711  VVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFE  1890
             +V+ NCRIVPE  L P RFK+ ++ GRPWK YS T++ME+ +GD + P GW  W G+   
Sbjct  460   LVIHNCRIVPEQKLFPDRFKIPSFLGRPWKPYSKTIIMETTLGDFIQPAGWMPWAGDFAL  519

Query  1891  KTCMYYEYKNSGPGAN-----TWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGV  2055
              T  Y EY N GPGAN     TW+  R  K  +      A  +T   ++  N WL    +
Sbjct  520   NTLFYAEYGNRGPGANTRSRVTWKGYRIIKTRN-----EALQYTVNSFIQGNLWLKQINI  574

Query  2056  PF  2061
             P+
Sbjct  575   PY  576



>ref|XP_009623162.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=584

 Score =   524 bits (1349),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 265/544 (49%), Positives = 349/544 (64%), Gaps = 26/544 (5%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQ  663
             KS+ + C   +YK  C  S+S +ANN SAT KDFI  AI+  ++EV    +   +    +
Sbjct  49    KSIASVCSQTDYKKACVNSLSSMANNQSATPKDFIEKAIEVAIQEVRAGMERSASIGKAE  108

Query  664   STDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTC  843
             + D    MA EDCK++L  AID+LQAS S VGD ELH +  R  +L NW+SAV +YQ TC
Sbjct  109   AHDSLQKMATEDCKDLLHFAIDELQASFSSVGDNELHKITDRETELKNWLSAVISYQQTC  168

Query  844   TEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnnnn  1023
              +       K+AI   ++NATQLT+N + I+A +S++L AFNI           + +  +
Sbjct  169   MDGFTQPELKNAISTSLLNATQLTDNVLAIVAAISEILSAFNIPI--------GNSSTIS  220

Query  1024  nnnTTSRRLLQTDH------------FPEWFPIADRKLLAAQRRGNLR--PNVVVAKDGS  1161
                TTSR LL+ ++            FP WFP  DRKLL A R  N +  PN VVAKDGS
Sbjct  221   ATTTTSRLLLEANNDDEEAVHNTENGFPSWFPSGDRKLLGA-RNSNSQSPPNAVVAKDGS  279

Query  1162  GQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKN  1341
             GQ+ TI  AL +YP   K +YVIYVKAG+YDE + V K   N+FMYGDG  KTI+TGKK 
Sbjct  280   GQYNTIAAALAAYPKNLKGRYVIYVKAGIYDEYITVAKDQVNIFMYGDGPRKTIVTGKK-  338

Query  1342  YAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQ  1521
                  +TT ++A+FSA+G GF+A+ + F+NTAGPEGHQAVA R QSDMSA ++C ++GYQ
Sbjct  339   CNRDGVTTYQSASFSAVGNGFIAKSLGFQNTAGPEGHQAVALRVQSDMSAFYNCRMDGYQ  398

Query  1522  DTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKA  1701
             DTLY  T+RQFYRNCV+SGT+DFIFG   A++QN +IIARKP+ +Q NT+TA G+   + 
Sbjct  399   DTLYAQTHRQFYRNCVVSGTVDFIFGDAAAILQNCLIIARKPMDNQQNTVTAQGRSNVRE  458

Query  1702  KGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGE  1881
               G+++QNCRIVPE  L P+RF + TY GRPWK YS +V+MES + D + P GW  W G 
Sbjct  459   TTGLIMQNCRIVPEQLLEPVRFNIPTYLGRPWKMYSRSVIMESTLADFIQPAGWMPWSGN  518

Query  1882  NFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPI-RARHFTAGLWLDANSWLPATGVP  2058
                 TC Y EY N GPGANT  R + +K F V+     A  FT   ++  N WL +TG P
Sbjct  519   FALDTCYYAEYGNRGPGANTNNRVK-WKGFKVITDRNEALQFTTAPFIQGNQWLGSTGSP  577

Query  2059  FAIG  2070
             + +G
Sbjct  578   YYLG  581



>ref|XP_002303172.1| hypothetical protein POPTR_0003s01580g [Populus trichocarpa]
 gb|EEE78151.1| hypothetical protein POPTR_0003s01580g [Populus trichocarpa]
Length=560

 Score =   518 bits (1335),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 274/579 (47%), Positives = 366/579 (63%), Gaps = 28/579 (5%)
 Frame = +1

Query  358   IAITLVSLIlvvgvvcgavlvlqgvDDASSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAK  537
             + I+ +SL L+VG V G   ++Q     S G+ + G  + SMK     CQ ++YK+ C K
Sbjct  5     VVISAISLFLIVGAVIGVAALVQPHQKGSDGENEAGNISASMKIANQLCQPSDYKEACTK  64

Query  538   SISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQ  717
             ++S V   +S   K+F+  AI A  + V KS        ++ S D    MA++DCKE+L 
Sbjct  65    TLSSV---NSTDPKEFVKHAILAASDAVTKSFNFSEELIVKASKDKREKMALDDCKELLD  121

Query  718   DAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTCTEQIESR-LYKSAIEDGM  894
              A+ +LQAS+S+VGD++LHT  +R  +L +W+SAV AYQ TC +  + +   K  I+ G 
Sbjct  122   YAVQELQASMSMVGDSDLHTTNNRVAELQSWLSAVLAYQETCVDGFDDKSTIKPIIQQGF  181

Query  895   INATQLTNNAINIIAEMSKLLKA----FNITTTTDLLHKAADKnnnnnnnTTSRRLLQTD  1062
             +NA+QLT+N + II+ +S  LK+    FNI +                    SRRLL  D
Sbjct  182   VNASQLTDNVLAIISGLSDFLKSMGLQFNIPSN-------------------SRRLLGED  222

Query  1063  HFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKA  1242
              FP WF  ADRKLLAAQ +G ++PN VVA+DGSGQFKTI+ A+ +YP K K +Y+IYVKA
Sbjct  223   GFPTWFSGADRKLLAAQDKGKVKPNAVVAQDGSGQFKTISAAIAAYPNKLKGRYIIYVKA  282

Query  1243  GVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKTATFSALGKGFVARGIT  1422
             G Y E V + KK  NVF+YGDG  KTI+TG K++A   + T KTATF A   GF+A+ I 
Sbjct  283   GTYREYVTIDKKKPNVFIYGDGPRKTIVTGSKSFAKDGLGTWKTATFVAEADGFIAKSIG  342

Query  1423  FRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGK  1602
             F+NTAGP+GHQAVA R  SDMSA  +C ++GYQDTL Y   RQFYRNCVISGT+DFIFG 
Sbjct  343   FQNTAGPDGHQAVALRVSSDMSAFLNCRMDGYQDTLLYQAKRQFYRNCVISGTVDFIFGY  402

Query  1603  GTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTY  1782
             G A+IQNS+I+ R+P  +Q N++TADG++   A  G+V+ NCRIVPE  L   RFK+ TY
Sbjct  403   GAAVIQNSLIVVRRPNANQQNSVTADGRKENHATTGLVIHNCRIVPEQKLVADRFKIPTY  462

Query  1783  FGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAF  1962
              GRPWK +S TVVMES++ D + P GW  W G     T  Y EY N G GANT +R   +
Sbjct  463   LGRPWKPFSRTVVMESELADFIQPAGWMPWAGSLHLDTLYYAEYANRGAGANTNKRVN-W  521

Query  1963  KKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIGYTK  2079
             K F V+    A  FTAG +L   +W+   GVP  +G  +
Sbjct  522   KTFHVINRNEALRFTAGQFLQGAAWIKNAGVPVLLGLKR  560



>ref|XP_004149498.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
 ref|XP_004171697.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
Length=560

 Score =   518 bits (1334),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 263/539 (49%), Positives = 352/539 (65%), Gaps = 26/539 (5%)
 Frame = +1

Query  481   MKSVTTFCQYAEYKDVCAKSISHVANNHSAT-TKDFIFAAIKATLEEVHKSHQLVVNTKI  657
             MK+V + C  A+Y+  C  ++  V NN S    K+FI AAI +T+EE+ K + L  N  +
Sbjct  36    MKAVASICSNADYQPECQTTLGSVGNNSSVEDPKEFIKAAITSTIEEMKKGYNLTDNLMV  95

Query  658   EQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQT  837
             E + +    M+++DCK++LQ AID+L AS S VGD +LHT + R   + NW++AV +YQ 
Sbjct  96    EAANNATIKMSVDDCKDLLQSAIDELHASYSTVGDPDLHTNEDRIADIKNWLTAVISYQQ  155

Query  838   TCTEQIES--RLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADK  1011
             +C + +E      K  ++DG+  A +LT+NA+ I+  +S +LK   +             
Sbjct  156   SCLDGLEEFDPQLKQKMQDGLDVAGKLTSNALAIVGAVSDILKELGLQLKVQ--------  207

Query  1012  nnnnnnnTTSRRLLQT-----DHFPEWFPIADRKLLAAQRRG-NLRPNVVVAKDGSGQFK  1173
                     + RRLL T     D FP W   +DRKLLAA+R G  ++PNVVVAKDGSGQ+K
Sbjct  208   -------PSGRRLLGTTEVDSDSFPTWLTGSDRKLLAAKRGGVRVKPNVVVAKDGSGQYK  260

Query  1174  TITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHM  1353
             TI  AL +YP   K +YVIYVKAGVY+E + V K MKN+FMYGDG  KTI+TG+K+    
Sbjct  261   TIGAALAAYPKALKGRYVIYVKAGVYNEPIIVTKDMKNIFMYGDGPRKTIVTGRKSNRD-  319

Query  1354  KITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLY  1533
              ITT  TA+F+A+G+GF+ + + F NTAGPEGHQAVA R QSD SA F+C ++GYQDTLY
Sbjct  320   GITTQNTASFAAIGEGFLCKSMGFTNTAGPEGHQAVALRVQSDRSAFFNCRMDGYQDTLY  379

Query  1534  YHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGV  1713
               T+RQFYRNCVISGT+DFIFG    +IQNS+II R+P+ +Q NT+TA+G+   K   G+
Sbjct  380   VQTHRQFYRNCVISGTVDFIFGDSNTIIQNSLIIVRRPMDNQQNTVTANGRADKKEISGL  439

Query  1714  VLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEK  1893
             V+ NCRIVPE  L   RFK+ T+ GRPWK Y+ TV+MES +GD + P G+  W G     
Sbjct  440   VIHNCRIVPEQKLFAERFKIPTFLGRPWKEYARTVIMESTLGDFIQPAGYMPWSGNFALA  499

Query  1894  TCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             TC Y+EY N GPGANT RR R +K   V+G   A  FTAG +L   +WLP TG P+ +G
Sbjct  500   TCSYFEYGNRGPGANTNRRVR-WKGVRVIGRNEAMQFTAGPFLLGKAWLPGTGGPYLLG  557



>ref|XP_006338009.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like 
[Solanum tuberosum]
Length=584

 Score =   519 bits (1336),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 256/559 (46%), Positives = 353/559 (63%), Gaps = 22/559 (4%)
 Frame = +1

Query  433   DDASSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATL  612
             D + + + D  V + + KS+ + C   ++K  C   +S +ANN SAT K+F+  AI+  +
Sbjct  32    DSSGNDEKDDKVLSTTSKSIASVCSQTDFKKSCVNCLSSMANNQSATPKEFLQKAIEVAI  91

Query  613   EEVHKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRA  792
             +EV    +   +    ++ D    MA +DCKE+L+ AID+LQAS S VGD+ +HT+  R 
Sbjct  92    QEVRIGIERSTSIGKAEAHDSLQKMATDDCKELLEYAIDELQASFSSVGDSSVHTIADRE  151

Query  793   DQLLNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNI  972
              +L NW+SAV++YQ TC +       + AI   ++NATQLT+N + ++  M+++L  FNI
Sbjct  152   TELKNWLSAVFSYQQTCIDGFTQPELQKAISTSLLNATQLTDNVLAMVDAMTEILSKFNI  211

Query  973   TTTTDLLHKAADKnnnnnnnTTSRRLLQTDH------------FPEWFPIADRKLLAAQR  1116
                      +A+          SRRLL+ +             +P W   +DRKLLAA  
Sbjct  212   PIGNKTDTTSAE-------TAASRRLLENEDIDKQEANNTNNGYPAWLSSSDRKLLAASN  264

Query  1117  RGNLRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFM  1296
              GN  PNVVVAKDGSGQF TI  AL +YP   K +Y IYVKAG+YDE + V K   NVFM
Sbjct  265   NGNPSPNVVVAKDGSGQFNTIAAALAAYPKNLKGRYTIYVKAGIYDEYIIVTKDQVNVFM  324

Query  1297  YGDGAGKTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQ  1476
             YGDG  KTI+TG K+ A   ++T ++A+FSA+G GF+ + + F+NTAGPEGHQAVA R Q
Sbjct  325   YGDGPRKTIVTGHKS-ALNGVSTYQSASFSAIGNGFIGKSMGFQNTAGPEGHQAVALRVQ  383

Query  1477  SDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVH  1656
             SDMSA ++C ++GYQDTLY  T+RQFYRNCV+SGT+DFIFG  + ++QN +IIARKP+  
Sbjct  384   SDMSAFYNCRMDGYQDTLYVQTHRQFYRNCVVSGTVDFIFGDSSTILQNCLIIARKPMEK  443

Query  1657  QFNTITADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQI  1836
             Q NT+ A G+   +A  G+V+QNCRIVPE  L PLRFK+ T+ GRPWK Y+ TV+MES +
Sbjct  444   QQNTVAAQGRTNIRATTGLVIQNCRIVPEQLLEPLRFKIPTFLGRPWKMYARTVIMESTL  503

Query  1837  GDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPI-RARHFTAG  2013
              D + P GW  WDG     TC+  EY N GPGANT  R + +K F V+     A  +T  
Sbjct  504   ADFIQPAGWMPWDGNFALDTCLCAEYANRGPGANTNNRVK-WKGFKVITDRNEALQYTTT  562

Query  2014  LWLDANSWLPATGVPFAIG  2070
              ++  N W+ +TG P  +G
Sbjct  563   PFIQGNQWVQSTGAPHFLG  581



>gb|KGN49779.1| hypothetical protein Csa_5G119700 [Cucumis sativus]
Length=566

 Score =   518 bits (1334),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 263/539 (49%), Positives = 352/539 (65%), Gaps = 26/539 (5%)
 Frame = +1

Query  481   MKSVTTFCQYAEYKDVCAKSISHVANNHSAT-TKDFIFAAIKATLEEVHKSHQLVVNTKI  657
             MK+V + C  A+Y+  C  ++  V NN S    K+FI AAI +T+EE+ K + L  N  +
Sbjct  42    MKAVASICSNADYQPECQTTLGSVGNNSSVEDPKEFIKAAITSTIEEMKKGYNLTDNLMV  101

Query  658   EQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQT  837
             E + +    M+++DCK++LQ AID+L AS S VGD +LHT + R   + NW++AV +YQ 
Sbjct  102   EAANNATIKMSVDDCKDLLQSAIDELHASYSTVGDPDLHTNEDRIADIKNWLTAVISYQQ  161

Query  838   TCTEQIES--RLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADK  1011
             +C + +E      K  ++DG+  A +LT+NA+ I+  +S +LK   +             
Sbjct  162   SCLDGLEEFDPQLKQKMQDGLDVAGKLTSNALAIVGAVSDILKELGLQLKVQ--------  213

Query  1012  nnnnnnnTTSRRLLQT-----DHFPEWFPIADRKLLAAQRRG-NLRPNVVVAKDGSGQFK  1173
                     + RRLL T     D FP W   +DRKLLAA+R G  ++PNVVVAKDGSGQ+K
Sbjct  214   -------PSGRRLLGTTEVDSDSFPTWLTGSDRKLLAAKRGGVRVKPNVVVAKDGSGQYK  266

Query  1174  TITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHM  1353
             TI  AL +YP   K +YVIYVKAGVY+E + V K MKN+FMYGDG  KTI+TG+K+    
Sbjct  267   TIGAALAAYPKALKGRYVIYVKAGVYNEPIIVTKDMKNIFMYGDGPRKTIVTGRKSNRD-  325

Query  1354  KITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLY  1533
              ITT  TA+F+A+G+GF+ + + F NTAGPEGHQAVA R QSD SA F+C ++GYQDTLY
Sbjct  326   GITTQNTASFAAIGEGFLCKSMGFTNTAGPEGHQAVALRVQSDRSAFFNCRMDGYQDTLY  385

Query  1534  YHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGV  1713
               T+RQFYRNCVISGT+DFIFG    +IQNS+II R+P+ +Q NT+TA+G+   K   G+
Sbjct  386   VQTHRQFYRNCVISGTVDFIFGDSNTIIQNSLIIVRRPMDNQQNTVTANGRADKKEISGL  445

Query  1714  VLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEK  1893
             V+ NCRIVPE  L   RFK+ T+ GRPWK Y+ TV+MES +GD + P G+  W G     
Sbjct  446   VIHNCRIVPEQKLFAERFKIPTFLGRPWKEYARTVIMESTLGDFIQPAGYMPWSGNFALA  505

Query  1894  TCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             TC Y+EY N GPGANT RR R +K   V+G   A  FTAG +L   +WLP TG P+ +G
Sbjct  506   TCSYFEYGNRGPGANTNRRVR-WKGVRVIGRNEAMQFTAGPFLLGKAWLPGTGGPYLLG  563



>ref|XP_003632385.1| PREDICTED: pectinesterase-like [Vitis vinifera]
Length=566

 Score =   514 bits (1323),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 266/555 (48%), Positives = 356/555 (64%), Gaps = 37/555 (7%)
 Frame = +1

Query  454   GDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVA-NNHSATTKDFIFAAIKATLEEVHKS  630
             GD  +S+ SMK+V + C  A+YKD C +++S V  N  SAT KD+I AA++ T++++  S
Sbjct  36    GDTNMSS-SMKAVASVCATADYKDACMQTLSPVPKNGSSATPKDYIQAAVQVTIKQIKSS  94

Query  631   HQLVVNTKIEQST-DPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLN  807
               L  + K+ Q+T D    MA+ DCK++LQ AID+LQ S S VG+++L TL   + +++N
Sbjct  95    MNL--SEKLFQATNDSRTQMALGDCKDLLQFAIDELQESFSSVGESDLQTLDQLSTEIMN  152

Query  808   WMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTD  987
             W+SA  +YQ TC + +    +++A++ G++NATQLT+NA+ I++++S++L  FN+    D
Sbjct  153   WLSAAVSYQQTCLDGVIEPRFQAAMQKGLLNATQLTSNALAIVSDLSQILTKFNVPL--D  210

Query  988   LLHKAADKnnnnnnnTTSRRLLQT------DHFPEWFPIADRKLLAAQRRGNLRPNVVVA  1149
             L                SRRLL        D +P WF   DRKLLA Q  G L PN +VA
Sbjct  211   L-------------KPNSRRLLGEIEVLGHDGYPTWFSATDRKLLALQDNGRLTPNAIVA  257

Query  1150  KDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIIT  1329
             KDGSG F TI  AL +YP   K +YVIYVKAG+Y E + V K   NV+MYGDG  KTI+T
Sbjct  258   KDGSGHFTTIAAALAAYPKNLKGRYVIYVKAGIYREYITVTKDHVNVYMYGDGPRKTIVT  317

Query  1330  GKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSI  1509
             G K Y    ITT KTATFSA+GKGFVAR + F NTAGP+GHQAVA R QSDMSA F+C +
Sbjct  318   GTKCYRD-GITTYKTATFSAIGKGFVARSMGFVNTAGPDGHQAVALRVQSDMSAFFNCRM  376

Query  1510  EGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKE  1689
             +GYQDTLY   +RQFYRNCVISGTIDFIFG  T +IQNS+II R+P   Q NT+TA GK 
Sbjct  377   DGYQDTLYVQAHRQFYRNCVISGTIDFIFGDSTTVIQNSLIIVRRPNDKQQNTVTAQGKT  436

Query  1690  LAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKI  1869
               +   G+V+ +CRIVPE  L P RFK+ ++ GRPWK YS T++ME+ +GD + P GW  
Sbjct  437   EKRETTGLVIHDCRIVPEQKLFPDRFKIPSFLGRPWKPYSKTIIMETTLGDFIQPAGWTP  496

Query  1870  WDGENFEKTCMYYEYKNSGPGAN-----TWRRNRAFKKFDVLGPIRARHFTAGLWLDANS  2034
             W G+    T +Y EY N GPGAN     TW+  R  K  +      A  +T   ++  N 
Sbjct  497   WAGKFVPNTLLYAEYGNLGPGANTHSRVTWKGYRIIKTRN-----EALQYTVNSFIQGNL  551

Query  2035  WLPATGVPFAIGYTK  2079
             WL    +P+  G  +
Sbjct  552   WLKQINIPYLPGLKR  566



>ref|XP_011046142.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=559

 Score =   513 bits (1321),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 264/552 (48%), Positives = 350/552 (63%), Gaps = 29/552 (5%)
 Frame = +1

Query  439   ASSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEE  618
             +  GK +  +S   MK  T  CQ +EYK+ C +++S V   +S   KDF+  AI A  + 
Sbjct  32    SDGGKKEESLSP-EMKIATQLCQPSEYKEACTETLSSV---NSTDPKDFVKQAILAASDA  87

Query  619   VHKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQ  798
             V KS     +  ++ S D    MA++DCKE+L  A+ +LQAS+S+VGD++LHT   R  +
Sbjct  88    VKKSFNFSEDLVVKASKDKREKMALDDCKELLDYAVQELQASMSLVGDSDLHTTNERVAE  147

Query  799   LLNWMSAVYAYQTTCTEQI-ESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKA----  963
             L +W+S+V+AYQ TC +   ++   K  IE G ++A+ LT+N + II+ +S  LK+    
Sbjct  148   LQSWLSSVFAYQETCVDGFSDNSTIKPTIEQGFVDASHLTDNVLAIISGLSGFLKSVGLQ  207

Query  964   FNITTTTDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVV  1143
             FNI +                    SRRLL  D FP WF  ADRKLLAAQ  G ++PN V
Sbjct  208   FNIPSN-------------------SRRLLAEDGFPTWFSGADRKLLAAQGNGKVKPNAV  248

Query  1144  VAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTI  1323
             VA+DGSGQFKTI+ A+ +YP   K +Y+IYVKAG+Y E V V KK  NVF+YGDG  KTI
Sbjct  249   VAQDGSGQFKTISAAIAAYPNNLKGRYIIYVKAGIYREYVTVDKKKPNVFIYGDGPRKTI  308

Query  1324  ITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDC  1503
             +TG K++A   + T KTATF A   GF+A+ + F+NTAGP+GHQAVA R  SDMSA  +C
Sbjct  309   VTGSKSFAKDGLGTWKTATFVAEADGFIAKSMGFQNTAGPDGHQAVALRVSSDMSAFLNC  368

Query  1504  SIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADG  1683
              ++GYQDTL Y   RQFYRNCVISGT+DFIFG G A+IQNS+I+ R+P  +Q N++TADG
Sbjct  369   RMDGYQDTLLYQAKRQFYRNCVISGTVDFIFGYGAAVIQNSLIVVRRPNDNQQNSVTADG  428

Query  1684  KELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGW  1863
             ++   A  G+V+ NCRIVPE  L   RFK+ TY GRPWK +S TVVMES++ D + P GW
Sbjct  429   RKEKHATTGLVIHNCRIVPEQKLVAERFKIPTYLGRPWKPFSRTVVMESELADFIQPAGW  488

Query  1864  KIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLP  2043
               W G     T  Y EY N G GANT +R   +K F V+    A  FTAG +L   SW+ 
Sbjct  489   MPWAGSIHLDTLYYAEYANRGAGANTNKRVN-WKTFHVINRNEALQFTAGQFLKGASWIK  547

Query  2044  ATGVPFAIGYTK  2079
               GVP  +G  +
Sbjct  548   NAGVPVLLGLKR  559



>ref|XP_002298186.1| hypothetical protein POPTR_0001s21630g [Populus trichocarpa]
 gb|EEE82991.1| hypothetical protein POPTR_0001s21630g [Populus trichocarpa]
Length=559

 Score =   509 bits (1312),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 263/552 (48%), Positives = 349/552 (63%), Gaps = 29/552 (5%)
 Frame = +1

Query  439   ASSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEE  618
             +  GK +  +S   MK  T  CQ +EYK+ C +++S V   +S   K+F+  AI A  + 
Sbjct  32    SDGGKKEENLSP-EMKIATQLCQPSEYKEACTETLSSV---NSTDPKEFVKQAILAASDA  87

Query  619   VHKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQ  798
             V KS     +  ++ S D    MA++DCKE+L  A+ +LQAS+S+VGD++LHT   R  +
Sbjct  88    VKKSFNFSEDLVVKASKDKREKMALDDCKELLDYAVQELQASMSLVGDSDLHTTNERVAE  147

Query  799   LLNWMSAVYAYQTTCTEQI-ESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKA----  963
             L +W+S+V AYQ TC +   ++   K  IE G ++A+ LT+N + II+ +S  LK+    
Sbjct  148   LQSWLSSVLAYQETCVDGFSDNSTIKPTIEQGFVDASHLTDNVLAIISGLSGFLKSVGLQ  207

Query  964   FNITTTTDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVV  1143
             FNI +                    SRRLL  D FP WF  ADRKLLAAQ  G ++PN V
Sbjct  208   FNIPSN-------------------SRRLLAEDGFPTWFSGADRKLLAAQGNGKVKPNAV  248

Query  1144  VAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTI  1323
             VA+DGSGQFKTI+ A+ +YP   K +Y+IYVKAG+Y E V V KK  NVF+YGDG  KTI
Sbjct  249   VAQDGSGQFKTISAAIAAYPNNLKGRYIIYVKAGIYREYVTVDKKKPNVFIYGDGPRKTI  308

Query  1324  ITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDC  1503
             +TG K++A   + T KTATF A   GF+A+ + F+NTAGP+GHQAVA R  SDMSA  +C
Sbjct  309   VTGSKSFAKDGLGTWKTATFVAEADGFIAKSMGFQNTAGPDGHQAVALRVSSDMSAFLNC  368

Query  1504  SIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADG  1683
              ++GYQDTL Y   RQFYRNCVISGT+DFIFG G A+IQNS+I+ R+P  +Q N++TADG
Sbjct  369   RMDGYQDTLLYQAKRQFYRNCVISGTVDFIFGYGAAVIQNSLIVVRRPNDNQQNSVTADG  428

Query  1684  KELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGW  1863
             ++   A  G+V+ NCRIVPE  L   RFK+ TY GRPWK +S TVVMES++ D + P GW
Sbjct  429   RKEKHATTGLVIHNCRIVPEQKLVAERFKIPTYLGRPWKPFSRTVVMESELADFIQPAGW  488

Query  1864  KIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLP  2043
               W G     T  Y EY N G GANT +R   +K F V+    A  FTAG +L   SW+ 
Sbjct  489   MPWAGSIHLDTLYYAEYANRGAGANTNKRVN-WKTFHVINRNEALQFTAGQFLKGASWIK  547

Query  2044  ATGVPFAIGYTK  2079
               GVP  +G  +
Sbjct  548   NAGVPVLLGLKR  559



>ref|XP_008466374.1| PREDICTED: pectinesterase-like isoform X1 [Cucumis melo]
Length=567

 Score =   508 bits (1309),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 258/539 (48%), Positives = 352/539 (65%), Gaps = 26/539 (5%)
 Frame = +1

Query  481   MKSVTTFCQYAEYKDVCAKSISHVANNHSAT-TKDFIFAAIKATLEEVHKSHQLVVNTKI  657
             MK+V+T C  A Y+  C  ++S+ A+N S+   K+++ AAI +T+EEV K + L     I
Sbjct  43    MKAVSTICANANYQQECQNTLSNAAHNASSDDPKEYVRAAILSTIEEVKKGYNLTDGFMI  102

Query  658   EQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQT  837
             E + +    M +EDC+++LQ AID LQAS S VG+ +LHT   R   + NW+++V +YQ 
Sbjct  103   EAANNRSIKMGVEDCRDLLQFAIDQLQASYSTVGEPDLHTNADRVADIKNWLTSVISYQQ  162

Query  838   TCTEQIES--RLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADK  1011
             +C + +E      K  ++DG+ +A +LT+NA+ I+  +S +L +F +             
Sbjct  163   SCLDGLEEFDPQLKQKMQDGLSDAGKLTSNALAIVDAVSDILASFGLQLKAQ--------  214

Query  1012  nnnnnnnTTSRRLLQT-----DHFPEWFPIADRKLLAAQRRG-NLRPNVVVAKDGSGQFK  1173
                     + RRLL T     D +P W   ADRKLLA++  G  ++PN VVAKDGSGQFK
Sbjct  215   -------PSGRRLLGTTEVGKDGYPTWLTGADRKLLASRGGGAKVKPNAVVAKDGSGQFK  267

Query  1174  TITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHM  1353
             TI+ AL +YP   + +YVIYVKAG+Y+E V + K MKN+FMYGDG  KTI+TG K+    
Sbjct  268   TISAALAAYPKALRGRYVIYVKAGIYNEYVHITKDMKNIFMYGDGPKKTIVTGNKS-NRG  326

Query  1354  KITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLY  1533
               TT  TATF A+G+GF+ + + F+NTAGPEGHQAVA R QSD SA F+C ++GYQDTLY
Sbjct  327   GFTTQDTATFIAIGEGFLCKSMGFQNTAGPEGHQAVALRVQSDRSAFFNCRMDGYQDTLY  386

Query  1534  YHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGV  1713
               T RQFYRNCVISGT+DFIFG  T +IQNS+II R+P+ +Q NT+TA+G+   K   G+
Sbjct  387   VQTQRQFYRNCVISGTVDFIFGDSTTIIQNSLIIVRRPMDNQQNTVTANGRADPKEVSGL  446

Query  1714  VLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEK  1893
             V+ NCRIVPE  L   RFK+ T+ GRPWK Y+ TV+MES +GD + P+G+  W G    +
Sbjct  447   VIHNCRIVPEQKLFAERFKIPTFLGRPWKQYARTVIMESTLGDFIQPVGYMPWSGNFALE  506

Query  1894  TCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             TC+Y EY N GPGA T RR R +K   V+G   A  FTAG +L   +WLP TG P+ +G
Sbjct  507   TCLYLEYGNRGPGAVTNRRVR-WKGVKVIGRNEAMQFTAGPFLQGRAWLPTTGGPYLLG  564



>ref|XP_010027125.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=567

 Score =   508 bits (1308),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 264/554 (48%), Positives = 359/554 (65%), Gaps = 33/554 (6%)
 Frame = +1

Query  445   SGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVH  624
             SG GD   ST   KSV   C  A+YK  C  S+S VA N SA+ K+ I AAI ATLEEV 
Sbjct  33    SGNGDQVSSTS--KSVAAICAPADYKQACVSSLSAVAKNESASPKELIQAAIAATLEEVK  90

Query  625   KSHQLVVNTKIEQS-TDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQL  801
              +  L  +  I +S T+    MA+EDC+++L+ A+D+LQ+S S+VGD++LHT+  R  +L
Sbjct  91    AA--LNKSGSIGKSATNSSQKMAVEDCQDLLKFAVDELQSSFSMVGDSDLHTVNDRVSEL  148

Query  802   LNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTT  981
              NW+SAV +YQ TC + +     +  + +GM+NAT+LT+NA+ I++ +S +L +F I   
Sbjct  149   QNWLSAVISYQQTCLDGVTQPDLQKQMSNGMLNATELTSNALAIVSAISGILTSFKIPFN  208

Query  982   TDLLHKAADKnnnnnnnTTSRRLLQ------TDHFPEWFPIADRKLLAAQRRGNLRPNVV  1143
                               +SRRLL+       D  P W+   DRKL+A Q +G + PN V
Sbjct  209   N---------------TASSRRLLEEADAEDADGHPSWWSREDRKLMARQAKGQVTPNAV  253

Query  1144  VAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTI  1323
             VAKDGSG + TI  AL +YP  +K +YVIYVKAGVY+E + V K   N+ MYGDG  KT+
Sbjct  254   VAKDGSGHYSTIAAALAAYPKNNKGRYVIYVKAGVYNEYITVTKDQVNILMYGDGPRKTM  313

Query  1324  ITGKKNYAHMKITTSKTATFSA--LGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIF  1497
             ITGKK      ++T ++A+F A  +G GF+ + + F+NTAGPEGHQAVA R QSDM+A F
Sbjct  314   ITGKK-CNRDGVSTFRSASFFAAVIGNGFIGKSMGFQNTAGPEGHQAVALRVQSDMAAFF  372

Query  1498  DCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITA  1677
             +C ++GYQDTLY   +RQFYRNCV+SGT+DFIFG   A+IQNS+I+ RKP+ +Q NT+TA
Sbjct  373   NCRMDGYQDTLYVQAHRQFYRNCVVSGTVDFIFGDAAAVIQNSLIVVRKPMDNQQNTVTA  432

Query  1678  DGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPL  1857
              G+       G+V+QNCRIVPE  L P+R ++ +Y GRPWK YS TV+MES IGDL+ P 
Sbjct  433   HGRTDKHETTGLVIQNCRIVPEQKLYPVRLQIPSYLGRPWKQYSRTVIMESTIGDLIQPA  492

Query  1858  GWKIWDGENFEKTCMYY-EYKNSGPGANTWRRNRAFKKFDVL-GPIRARHFTAGLWLDAN  2031
             G+  W G NF    +YY EY N GPGA T +R + +K F V+     A  FTA  ++  N
Sbjct  493   GYMPWSG-NFALDTLYYAEYANRGPGAATDKRVK-WKGFHVIKNRNEALQFTASPFIQGN  550

Query  2032  SWLPATGVPFAIGY  2073
              WL  TG+P+ +G+
Sbjct  551   QWLKPTGMPYLLGF  564



>ref|XP_010091418.1| putative pectinesterase/pectinesterase inhibitor 21 [Morus notabilis]
 gb|EXB44455.1| putative pectinesterase/pectinesterase inhibitor 21 [Morus notabilis]
Length=570

 Score =   507 bits (1306),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 256/550 (47%), Positives = 353/550 (64%), Gaps = 29/550 (5%)
 Frame = +1

Query  448   GKGDHGVSTG----SMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLE  615
             G G H  S      S   V + C   +YK  C +++S +++N +A  KD I AA++AT++
Sbjct  32    GNGKHEGSVAAPSTSKSMVESVCSNTDYKTACEQTLSPLSHNVTADYKDIIKAAVQATVD  91

Query  616   EVHKSHQLVVNTKIEQSTDPYNH--MAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHR  789
             +V KS  L  +  +E + +      MA+EDC ++L  AI  LQAS S+VGD+++HT+K R
Sbjct  92    QVSKSLNLSESLLVEANNNNSTRLKMALEDCNDLLSLAIGQLQASFSMVGDSDMHTIKDR  151

Query  790   ADQLLNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFN  969
             + +L +W+S+V +Y  TC + +E   ++  ++  + NAT LT+NA+ I++ +S++L AF 
Sbjct  152   SAELRSWLSSVISYAETCIDGVEEPKFQGQLKGTLQNATALTDNALAIVSTISEILSAFG  211

Query  970   ITTTTDLLHKAADKnnnnnnnTTSRRLLQ-----TDHFPEWFPIADRKLLAAQRRGNLRP  1134
             +      L+               RRLL       D  P WF  +DRKL+A    G ++P
Sbjct  212   LKLNPKALN--------------GRRLLSDTVIGNDGLPTWFSASDRKLMALHGNGRIKP  257

Query  1135  NVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAG  1314
             + VVAKDGSGQFKTI  AL +YP  H  +Y+IYVKAGVY+E + V K M N+FMYGDG  
Sbjct  258   HAVVAKDGSGQFKTIAAALAAYPKNHVGRYIIYVKAGVYNEYITVEKNMVNIFMYGDGPR  317

Query  1315  KTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAI  1494
             KTI+TG+K+Y     +T +TA+FS +G GFV +G+ F+NTAGPEGHQAVA R QS+MSA 
Sbjct  318   KTIVTGRKSYTG-GFSTFRTASFSVIGAGFVCKGMGFQNTAGPEGHQAVALRVQSEMSAF  376

Query  1495  FDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTIT  1674
             F+C ++GYQDTLY    RQFYRNCVISGTIDFIFG  T +IQNS++I R+P+ +Q N +T
Sbjct  377   FNCRMDGYQDTLYVQAGRQFYRNCVISGTIDFIFGDATVVIQNSLLIVRRPMDNQLNAVT  436

Query  1675  ADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSP  1854
             A G++      G+V+ NCRIVPE  L   RFK+ TY GRPWK +S TV+MES + D + P
Sbjct  437   AQGRKERHQPTGIVIHNCRIVPEQKLFADRFKIPTYLGRPWKEFSRTVIMESTLADFIQP  496

Query  1855  LGWKIWDGENFEKTCMYY-EYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDAN  2031
              GW  W G NF    +YY EY N GPGA T RR   ++ + V+G   A+ FT G +L+  
Sbjct  497   AGWFPWAG-NFALDTLYYAEYANRGPGARTNRRVH-WRGYHVIGRHEAQQFTVGQFLEGQ  554

Query  2032  SWLPATGVPF  2061
              WLPATG PF
Sbjct  555   RWLPATGAPF  564



>ref|XP_011008693.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   507 bits (1305),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 262/547 (48%), Positives = 345/547 (63%), Gaps = 28/547 (5%)
 Frame = +1

Query  454   GDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSH  633
             G  G  + SMK     CQ ++YK+ C K++S V   +S   K+F+  AI A  + V KS 
Sbjct  35    GKDGNISASMKIANQLCQPSDYKEACTKTLSSV---NSTDPKEFVKHAILAASDAVKKSF  91

Query  634   QLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWM  813
                    ++ S D    MA++DCKE+L  A+ +LQAS+S+VGD++LHT  +R  +L +W+
Sbjct  92    NFSEELIVKASQDKREKMALDDCKELLDYAVQELQASMSMVGDSDLHTTNNRVAELQSWL  151

Query  814   SAVYAYQTTCTEQIESR-LYKSAIEDGMINATQLTNNAINIIAEMSKLLKA----FNITT  978
             SAV AYQ TC +  + +   K  I+ G +NA+QLT+N + II+ +S  LK+    FNI +
Sbjct  152   SAVLAYQETCVDGFDDKSPIKPTIQQGFVNASQLTDNVLAIISGLSDYLKSMGLQFNIPS  211

Query  979   TTDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDG  1158
                                 SRRLL  D FP WF  ADRKLLAAQ  G ++PN VVA+DG
Sbjct  212   N-------------------SRRLLAEDGFPTWFSGADRKLLAAQGNGKVKPNAVVAQDG  252

Query  1159  SGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKK  1338
             SGQFKTI+ A+ +YP K K +Y+IYVKAG Y E V + KK  NVF+YGDG  KTI+TG K
Sbjct  253   SGQFKTISAAIAAYPNKLKGRYIIYVKAGTYREYVTIDKKKPNVFIYGDGPRKTIVTGSK  312

Query  1339  NYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGY  1518
             ++A   + T KTATF A   GF+A+ I F+NTAGP+G QAVA R   DMSA  +C ++GY
Sbjct  313   SFAKDGLGTWKTATFVAEADGFIAKSIGFQNTAGPDGPQAVALRVSPDMSAFLNCRMDGY  372

Query  1519  QDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAK  1698
             QDTL Y   RQFYRNCVISGT+DFIFG G A+IQNS+I+ R+P  +Q N++TADG++   
Sbjct  373   QDTLLYQAKRQFYRNCVISGTVDFIFGYGAAVIQNSLIVVRRPNDNQQNSVTADGRKENH  432

Query  1699  AKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDG  1878
             A  G+V+ NCRIVPE  L   RFK+ TY GRPWK +S TVVMES++ D + P GW  W G
Sbjct  433   ATTGLVIHNCRIVPEQKLVADRFKIPTYLGRPWKPFSRTVVMESELADFIQPAGWMPWAG  492

Query  1879  ENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVP  2058
                  T  Y EY N G GANT +R   +K F V+    A  FTAG +L   +W+   GVP
Sbjct  493   SLHLDTLYYAEYANRGAGANTNKRVN-WKTFHVINRNEALRFTAGQFLQGAAWIKNAGVP  551

Query  2059  FAIGYTK  2079
               +G  +
Sbjct  552   VLLGLKR  558



>ref|XP_008466382.1| PREDICTED: pectinesterase-like isoform X2 [Cucumis melo]
Length=565

 Score =   506 bits (1304),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 258/539 (48%), Positives = 352/539 (65%), Gaps = 26/539 (5%)
 Frame = +1

Query  481   MKSVTTFCQYAEYKDVCAKSISHVANNHSAT-TKDFIFAAIKATLEEVHKSHQLVVNTKI  657
             MK+V++ C   +Y+  C  ++ +V +N S    K+F+ AAI AT+EE+ K + L  N  +
Sbjct  41    MKAVSSICSNTDYQQECQTTLGNVGHNSSVDDPKEFLKAAITATIEEMKKGYNLTDNLMV  100

Query  658   EQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQT  837
             E + +    M ++DC+++LQ AID+L AS S VGD +LHT + R   + NW++AV +YQ 
Sbjct  101   EAANNASIKMTVDDCRDLLQSAIDELHASYSTVGDPDLHTNEDRVADIKNWLTAVISYQQ  160

Query  838   TCTEQIES--RLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADK  1011
             +C + +E      K  ++ G+  A +LT+NA+ I+  +S +LK+  +             
Sbjct  161   SCLDGLEEFDPQLKQKMQGGLDVAAKLTSNALAIVDAVSDILKSLGLQLKVQ--------  212

Query  1012  nnnnnnnTTSRRLLQT-----DHFPEWFPIADRKLLAAQRRG-NLRPNVVVAKDGSGQFK  1173
                     + RRLL T     D FP W   ADRKLLAA+R G  ++PN VVAKDGSGQ+K
Sbjct  213   -------PSGRRLLGTTEVDNDGFPTWLTGADRKLLAAKRGGVRVKPNAVVAKDGSGQYK  265

Query  1174  TITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHM  1353
             TI  AL +YP   K +YVIYVKAG+Y+E + V K MKNVFMYGDG  KTI+TG+K+    
Sbjct  266   TIAAALAAYPKALKGRYVIYVKAGIYNEYIIVTKDMKNVFMYGDGPRKTIVTGRKSNRD-  324

Query  1354  KITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLY  1533
              I T  TATF+A+G+GF+ + + F NTAGPEGHQAVA R QSD SA F+C ++GYQDTLY
Sbjct  325   GINTQNTATFAAIGEGFLCKSMGFTNTAGPEGHQAVALRVQSDRSAFFNCRMDGYQDTLY  384

Query  1534  YHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGV  1713
               T+RQFYRNCV+SGT+DFIFG    +IQNS+II R+P+ +Q NT+TA+G+   K   G+
Sbjct  385   VQTHRQFYRNCVVSGTVDFIFGDSNTIIQNSLIIVRRPMDNQQNTVTANGRADKKEISGL  444

Query  1714  VLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEK  1893
             V+ NCRIVPE  L   RFK+ T+ GRPWK Y+ TV+ME+ +GD + P G+  W G+    
Sbjct  445   VIHNCRIVPEQKLFAERFKIPTFLGRPWKEYARTVIMETTLGDFIQPAGYMPWSGDFALA  504

Query  1894  TCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             TC Y+EY N GPGANT RR R +K   V+G   A  FTAG +L   +WLPATG P+ +G
Sbjct  505   TCSYFEYGNRGPGANTKRRVR-WKGVRVIGRNEAMQFTAGPFLLGRAWLPATGGPYLLG  562



>ref|XP_008466391.1| PREDICTED: pectinesterase-like isoform X3 [Cucumis melo]
Length=565

 Score =   506 bits (1302),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 259/539 (48%), Positives = 351/539 (65%), Gaps = 26/539 (5%)
 Frame = +1

Query  481   MKSVTTFCQYAEYKDVCAKSISHVANNHSAT-TKDFIFAAIKATLEEVHKSHQLVVNTKI  657
             MK+V++ C   +Y+  C  ++ +V +N S    K+F+ AAI AT+EE+ K + L  N  +
Sbjct  41    MKAVSSICSNTDYQQECQTTLGNVGHNSSVDDPKEFLKAAITATIEEMKKGYNLTDNLMV  100

Query  658   EQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQT  837
             E + +    M ++DC+++LQ AID+L AS S VGD +LHT + R   + NW++AV +YQ 
Sbjct  101   EAANNASIKMTVDDCRDLLQSAIDELHASYSTVGDPDLHTNEDRVADIKNWLTAVISYQQ  160

Query  838   TCTEQIES--RLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADK  1011
             +C + +E      K  ++ G+  A +LT+NA+ I+  +S +LK+  +             
Sbjct  161   SCLDGLEEFDPQLKQKMQGGLDVAAKLTSNALAIVDAVSDILKSLGLQLKVQ--------  212

Query  1012  nnnnnnnTTSRRLLQT-----DHFPEWFPIADRKLLAAQRRG-NLRPNVVVAKDGSGQFK  1173
                     + RRLL T     D FP W   ADRKLLAA+R G  ++PN VVAKDGSGQ+K
Sbjct  213   -------PSGRRLLGTTEVDNDGFPTWLTGADRKLLAAKRGGVRVKPNAVVAKDGSGQYK  265

Query  1174  TITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHM  1353
             TI  AL +YP   K +YVIYVKAG+Y+E + V K MKNVFMYGDG  KTI+TG+K+    
Sbjct  266   TIAAALAAYPKALKGRYVIYVKAGIYNEYIIVTKDMKNVFMYGDGPRKTIVTGRKSNRD-  324

Query  1354  KITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLY  1533
              I T  TATF A+G+GF+ + + F+NTAGPEGHQAVA R QSD SA F+C ++GYQDTLY
Sbjct  325   GINTQNTATFVAIGEGFLCKSMGFQNTAGPEGHQAVALRVQSDRSAFFNCRMDGYQDTLY  384

Query  1534  YHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGV  1713
               T RQFYRNCVISGT+DFIFG  T +IQNS+II R+P+ +Q NT+TA+G+   K   G+
Sbjct  385   VQTQRQFYRNCVISGTVDFIFGDSTTIIQNSLIIVRRPMDNQQNTVTANGRADPKEVSGL  444

Query  1714  VLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEK  1893
             V+ NCRIVPE  L   RFK+ T+ GRPWK Y+ TV+MES +GD + P+G+  W G    +
Sbjct  445   VIHNCRIVPEQKLFAERFKIPTFLGRPWKQYARTVIMESTLGDFIQPVGYMPWSGNFALE  504

Query  1894  TCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             TC+Y EY N GPGA T RR R +K   V+G   A  FTAG +L   +WLP TG P+ +G
Sbjct  505   TCLYLEYGNRGPGAVTNRRVR-WKGVKVIGRNEAMQFTAGPFLQGRAWLPTTGGPYLLG  562



>ref|XP_004151535.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
Length=566

 Score =   505 bits (1300),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 256/539 (47%), Positives = 351/539 (65%), Gaps = 26/539 (5%)
 Frame = +1

Query  481   MKSVTTFCQYAEYKDVCAKSISHVANNHSAT-TKDFIFAAIKATLEEVHKSHQLVVNTKI  657
             MK+V+T C  A Y++ C  ++++ A+N S+   K+++ AAI AT++EV K + L     I
Sbjct  42    MKAVSTICSTANYQEECQNTLTNAAHNASSDDPKEYVKAAILATIDEVKKGYNLTDGFLI  101

Query  658   EQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQT  837
             E + +    M +EDC+++LQ AID LQAS S VG+ +LHT   R   + NW+++V +YQ 
Sbjct  102   EAANNRSIKMGVEDCRDLLQFAIDQLQASYSTVGEPDLHTNADRVADIKNWLTSVISYQQ  161

Query  838   TCTEQIES--RLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADK  1011
             +C + +E      +  ++DG+  A +LT+NA+ I+  +S +L +F +             
Sbjct  162   SCLDGLEEFDPQLRQKMQDGLNGAGKLTSNALAIVDAVSDILASFGL-------------  208

Query  1012  nnnnnnnTTSRRLLQT-----DHFPEWFPIADRKLLAAQRRG-NLRPNVVVAKDGSGQFK  1173
                     + RRLL T     D +P W   ADRKLLA++  G  ++PN VVAKDGSGQFK
Sbjct  209   --QLKAQPSGRRLLGTTEVDNDGYPTWLTGADRKLLASRGGGAKVKPNAVVAKDGSGQFK  266

Query  1174  TITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHM  1353
             TI+ AL +YP   + +YVIYVKAG+Y E V + K MKN+FMYGDG  KTI+TG K+    
Sbjct  267   TISAALAAYPKTLRGRYVIYVKAGIYKEYVHITKDMKNIFMYGDGPKKTIVTGNKS-NRG  325

Query  1354  KITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLY  1533
               TT  TATF A+G+GF+ + + F+NTAGPEGHQAVA R QSD SA F+C ++GYQDTLY
Sbjct  326   GFTTQDTATFIAIGEGFLCKSMGFQNTAGPEGHQAVALRVQSDRSAFFNCRMDGYQDTLY  385

Query  1534  YHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGV  1713
               T RQFYRNCVISGT+DFIFG  T +IQNS+II R+P+ +Q NT+TA+G+   K   G+
Sbjct  386   VQTQRQFYRNCVISGTVDFIFGDSTTVIQNSLIIVRRPMDNQQNTVTANGRADPKEVSGL  445

Query  1714  VLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEK  1893
             V+ NCRIVPE  L   RFK+ T+ GRPWK Y+ TV+MES +GD + P+G+  W G    +
Sbjct  446   VIHNCRIVPEQKLFAERFKIPTFLGRPWKEYARTVIMESTMGDFIQPVGYMPWSGNFALE  505

Query  1894  TCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             TC+Y EY N GPGA T RR R +K   V+G   A  FTAG +L   +WLP TG P+ +G
Sbjct  506   TCLYLEYGNRGPGAVTNRRVR-WKGVKVIGRNEAMQFTAGSFLQGKTWLPTTGGPYLLG  563



>ref|XP_004156120.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
Length=583

 Score =   505 bits (1300),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 256/541 (47%), Positives = 353/541 (65%), Gaps = 26/541 (5%)
 Frame = +1

Query  481   MKSVTTFCQYAEYKDVCAKSISHVANNHSAT-TKDFIFAAIKATLEEVHKSHQLVVNTKI  657
             MK+V+T C  A Y++ C  ++++ A+N S+   K+++ AAI AT++EV K + L     I
Sbjct  42    MKAVSTICSTANYQEECQNTLTNAAHNASSDDPKEYVKAAILATIDEVKKGYNLTDGFLI  101

Query  658   EQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQT  837
             E + +    M +EDC+++LQ AID LQAS S VG+ +LHT   R   + NW+++V +YQ 
Sbjct  102   EAANNRSIKMGVEDCRDLLQFAIDQLQASYSTVGEPDLHTNADRVADIKNWLTSVISYQQ  161

Query  838   TCTEQIES--RLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADK  1011
             +C + +E      +  ++DG+  A +LT+NA+ I+  +S +L +F +             
Sbjct  162   SCLDGLEEFDPQLRQKMQDGLNGAGKLTSNALAIVDAVSDILASFGL-------------  208

Query  1012  nnnnnnnTTSRRLLQT-----DHFPEWFPIADRKLLAAQRRG-NLRPNVVVAKDGSGQFK  1173
                     + RRLL T     D +P W   ADRKLLA++  G  ++PN VVAKDGSGQFK
Sbjct  209   --QLKAQPSGRRLLGTTEVDNDGYPTWLTGADRKLLASRGGGAKVKPNAVVAKDGSGQFK  266

Query  1174  TITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHM  1353
             TI+ AL +YP   + +YVIYVKAG+Y E V + K MKN+FMYGDG  KTI+TG K+    
Sbjct  267   TISAALAAYPKTLRGRYVIYVKAGIYKEYVHITKDMKNIFMYGDGPKKTIVTGNKS-NRG  325

Query  1354  KITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLY  1533
               TT  TATF A+G+GF+ + + F+NTAGPEGHQAVA R QSD SA F+C ++GYQDTLY
Sbjct  326   GFTTQDTATFIAIGEGFLCKSMGFQNTAGPEGHQAVALRVQSDRSAFFNCRMDGYQDTLY  385

Query  1534  YHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGV  1713
               T RQFYRNCVISGT+DFIFG  T +IQNS+II R+P+ +Q NT+TA+G+   K   G+
Sbjct  386   VQTQRQFYRNCVISGTVDFIFGDSTTVIQNSLIIVRRPMDNQQNTVTANGRADPKEVSGL  445

Query  1714  VLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEK  1893
             V+ NCRIVPE  L   RFK+ T+ GRPWK Y+ TV+MES +GD + P+G+  W G    +
Sbjct  446   VIHNCRIVPEQKLFAERFKIPTFLGRPWKEYARTVIMESTMGDFIQPVGYMPWSGNFALE  505

Query  1894  TCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIGY  2073
             TC+Y EY N GPGA T RR R +K   V+G   A  FTAG +L   +WLP TG P+ +G+
Sbjct  506   TCLYLEYGNRGPGAVTNRRVR-WKGVKVIGRNEAMQFTAGSFLQGKTWLPTTGGPYLLGH  564

Query  2074  T  2076
             +
Sbjct  565   S  565



>ref|XP_004149499.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004164099.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN49780.1| hypothetical protein Csa_5G125700 [Cucumis sativus]
Length=567

 Score =   504 bits (1297),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 264/555 (48%), Positives = 362/555 (65%), Gaps = 30/555 (5%)
 Frame = +1

Query  436   DASSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSAT-TKDFIFAAIKATL  612
             +AS+G G   VS   MK+V+  C   +Y+D C  ++ HVA N S+   KD+  AAI AT+
Sbjct  30    NASNG-GTEDVSP-KMKAVSAICSTTDYQDECKTTLDHVARNTSSNDPKDYAEAAILATI  87

Query  613   EEVHKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRA  792
              E+ K + L  +  +E ST+    M++EDCK++LQ AID+LQAS S VG+++LHT   R 
Sbjct  88    GEITKGYNLSDSLIVEASTNASIKMSVEDCKDLLQFAIDELQASYSAVGESDLHTDSDRV  147

Query  793   DQLLNWMSAVYAYQTTCTE---QIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKA  963
               + NW+SAV +YQ +C +   + + +L K  ++DG+  A +LT+NA+ I+  +S +L  
Sbjct  148   ADIKNWLSAVISYQQSCLDGLGEFDPQL-KQRMQDGLDVAGKLTSNALAIVTAVSNILDN  206

Query  964   FNITTTTDLLHKAADKnnnnnnnTTSRRLLQT-----DHFPEWFPIADRKLLAAQRRG-N  1125
             + +                     + RRLL T     D FP W   ADRKLLA+++RG  
Sbjct  207   YRLQLKVQ---------------PSGRRLLGTTVVDRDGFPTWLTGADRKLLASKQRGVR  251

Query  1126  LRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGD  1305
               PN VVAKDGSG++KTI  AL +YP   + +YVIYVKAG+YDE + + K MKNVFMYGD
Sbjct  252   PTPNAVVAKDGSGKYKTIAAALAAYPKVLRGRYVIYVKAGIYDEYITLTKDMKNVFMYGD  311

Query  1306  GAGKTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDM  1485
             G  KTI+TG+K+      TT  TA+F+A+G+GF+ + + F NTAGPEGHQAVA R QSD 
Sbjct  312   GPRKTIVTGRKSNRD-GFTTQNTASFAAIGEGFLCKSMGFTNTAGPEGHQAVALRVQSDR  370

Query  1486  SAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFN  1665
             SA F+C ++G+QDTLY  T+RQFYRNCV+SGT+DFIFG  + +IQNS+II R+P+ +Q N
Sbjct  371   SAFFNCRMDGHQDTLYVQTHRQFYRNCVVSGTVDFIFGDSSTVIQNSLIIVRRPMDNQQN  430

Query  1666  TITADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDL  1845
             T+TA G+   K   G+V+ NCRIVPE  L   RFK+ T+ GRPWK Y+ TV+MES +GD 
Sbjct  431   TVTAQGRAEQKEITGLVIHNCRIVPEQKLFAERFKIPTFLGRPWKQYARTVIMESTLGDF  490

Query  1846  LSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLD  2025
             + P G+  W G+   +TC+Y EY N GPGANT RR R +K   V+G   A  +TAG +L 
Sbjct  491   IQPAGYMPWSGDFALETCLYLEYGNRGPGANTNRRVR-WKGAKVIGRNEALQYTAGAFLL  549

Query  2026  ANSWLPATGVPFAIG  2070
               SWLP TG  + +G
Sbjct  550   GRSWLPTTGGLYYLG  564



>ref|XP_002298185.1| hypothetical protein POPTR_0001s21650g [Populus trichocarpa]
 gb|EEE82990.1| hypothetical protein POPTR_0001s21650g [Populus trichocarpa]
Length=558

 Score =   503 bits (1295),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 257/549 (47%), Positives = 343/549 (62%), Gaps = 22/549 (4%)
 Frame = +1

Query  442   SSGKGDHGVS-TGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEE  618
             S G  +H  S +  MK+V+T CQ   YK+ C  ++S V   +S   K+ I   I A  + 
Sbjct  29    SGGSVEHTESLSPQMKAVSTLCQPTYYKEACTNTLSAV---NSTDPKELIKGGILAISDS  85

Query  619   VHKSHQLVVNTKIEQSTD-PYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRAD  795
             + KS  L  +  ++ ++D P   MA+ DCKE+LQDA + LQ ++S VG  +L +L   AD
Sbjct  86    LKKSSNLTDDLVVKNNSDEPRAKMALNDCKELLQDASEQLQDTLSKVGGIDLQSLSDHAD  145

Query  796   QLLNWMSAVYAYQTTCTEQIE-SRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNI  972
                 W+S++ AYQ  C +  E +   K+ +++     +QLT+N +NI+A +S++L +  +
Sbjct  146   DYRTWLSSIIAYQEMCLDGFEENSPLKAQVQNSTDYGSQLTDNVLNILAGLSQVLGSLGL  205

Query  973   TTTTDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAK  1152
                                 +TSRRLLQ D +P W   ADRKLLA++  G  RPN VVA 
Sbjct  206   KFNAP---------------STSRRLLQADGYPSWMSAADRKLLASRGNGGARPNAVVAH  250

Query  1153  DGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITG  1332
             DGSG+FKTI  AL +YP   K +YVIYVKAG+Y E V V K   NVF+YGDGA +TI+TG
Sbjct  251   DGSGKFKTINAALAAYPKGLKGRYVIYVKAGIYREYVTVTKDKPNVFIYGDGARRTIVTG  310

Query  1333  KKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIE  1512
              KN+A   I T KTATF     GF+A+ + F NTAGP+GHQAVA R  SDMSA ++C ++
Sbjct  311   NKNFAKDGIGTWKTATFIVEANGFIAKNMGFSNTAGPDGHQAVAIRVNSDMSAFYNCRLD  370

Query  1513  GYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKEL  1692
             GYQDTL Y   RQFYRNCV+SGT+DF+FG G+ +IQNS+I+ R+P   QFNT+TADG++ 
Sbjct  371   GYQDTLCYQAGRQFYRNCVLSGTVDFLFGYGSVVIQNSMIVVRRPNPSQFNTVTADGRKE  430

Query  1693  AKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIW  1872
                 GG+V+ NCRIVPE  L P+RF +KTY GRPWKA+S TVVME+Q+ D + P GW  W
Sbjct  431   RGQPGGIVIHNCRIVPEQKLVPVRFNIKTYLGRPWKAFSRTVVMETQLADFIQPDGWAPW  490

Query  1873  DGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATG  2052
              G  F  T  Y EY N+GPGA T RR R +K    L    A  FTAG +L    W+  TG
Sbjct  491   SGNQFLDTLYYAEYANTGPGAATKRRVR-WKTLHFLRRNEALQFTAGAFLRGGQWIRNTG  549

Query  2053  VPFAIGYTK  2079
             VP  +G  +
Sbjct  550   VPALLGLRR  558



>ref|XP_011046152.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score =   502 bits (1292),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 258/549 (47%), Positives = 342/549 (62%), Gaps = 22/549 (4%)
 Frame = +1

Query  442   SSGKGDHGVS-TGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEE  618
             S G  +H  S +  MK+V T CQ   YK+ C  ++S V   +S   K+ I   I A  + 
Sbjct  29    SGGSVEHTESLSPQMKAVGTLCQPTYYKEACTNTLSAV---NSTDPKELIKGGILAISDS  85

Query  619   VHKSHQLVVNTKIEQSTD-PYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRAD  795
             + KS  L  +  ++ ++D P   MA+ DCKE+LQ+A + LQ ++S VG T+L +L   AD
Sbjct  86    LKKSSNLTDDLVVKNNSDEPRAKMALNDCKELLQNASERLQDTLSKVGGTDLQSLSDHAD  145

Query  796   QLLNWMSAVYAYQTTCTEQIE-SRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNI  972
                 W+S++ AYQ  C +  E +   K+ +++     +QLT+N +NI+A +S++L +  +
Sbjct  146   DYRTWLSSIIAYQEMCLDGFEENSPLKAQVQNSTDYGSQLTDNVLNILAGLSQVLGSLGL  205

Query  973   TTTTDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAK  1152
                                 +TSRRLLQ D +P W   ADRKLLA++  G  RPN VVA 
Sbjct  206   KFNVP---------------STSRRLLQADGYPSWMSAADRKLLASRGNGGARPNAVVAH  250

Query  1153  DGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITG  1332
             DGSG+FKTI  AL +YP   K +YVIYVKAG+Y E V V K   NVF+YGDGA +TI+TG
Sbjct  251   DGSGKFKTINAALAAYPKGLKGRYVIYVKAGIYREYVTVTKDKPNVFIYGDGARRTIVTG  310

Query  1333  KKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIE  1512
              KN+A   I T KTATF     GF+A+ + F NTAGP+GHQAVA R  SDMSA ++C + 
Sbjct  311   NKNFAKDGIGTWKTATFIVEADGFIAKNMGFSNTAGPDGHQAVAIRVNSDMSAFYNCRLN  370

Query  1513  GYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKEL  1692
             GYQDTL Y   RQFYRNCV+SGT+DF+FG G+ +IQNS+I+ R+P   QFNT+TADG++ 
Sbjct  371   GYQDTLCYQAGRQFYRNCVLSGTVDFLFGYGSVVIQNSMIVVRRPNPSQFNTVTADGRKE  430

Query  1693  AKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIW  1872
                 GG+V+ NCRIVPE  L P+RF +KTY GRPWKA+S TVVME+Q+ D + P GW  W
Sbjct  431   RGQPGGIVIHNCRIVPEQKLVPVRFNIKTYLGRPWKAFSRTVVMETQLADFIQPDGWAPW  490

Query  1873  DGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATG  2052
              G  F  T  Y EY NSGPGA T RR R +K    L    A  FTAG +L    W+  TG
Sbjct  491   SGNQFLDTLYYAEYANSGPGAATKRRVR-WKTLHFLRRNEALQFTAGAFLRGGQWIRKTG  549

Query  2053  VPFAIGYTK  2079
             VP  +G  +
Sbjct  550   VPALLGLRR  558



>ref|XP_010038523.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=557

 Score =   496 bits (1277),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 250/538 (46%), Positives = 346/538 (64%), Gaps = 34/538 (6%)
 Frame = +1

Query  481   MKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIE  660
             MK+V++ C   +YK++C KS++  A N +   K+ I AA+ A +++  K       +   
Sbjct  43    MKAVSSVCAPTDYKELCMKSLTSYAPNGTTDPKELIKAAVVA-IQDHMKGSLTFSQSLAT  101

Query  661   QSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTT  840
              +T+    M+++DCK++ Q AID LQA+ S VGD++LHT++ RA ++ NW+SAV +YQ +
Sbjct  102   NATEAKTKMSLDDCKDLYQYAIDVLQAAFSSVGDSDLHTMEDRAAEIQNWLSAVVSYQES  161

Query  841   CTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnnn  1020
             C + ++    ++ +++ ++NA+ LT+NA++I+  MS++L +FNI                
Sbjct  162   CLDNMDDLKLRTDLQNNVLNASHLTSNALSIVTGMSQVLASFNIKLN-------------  208

Query  1021  nnnnTTSRRLLQTDH---FPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGAL  1191
                 T SRRLL T     +P WF  ADRKLLA    G +RPN VVAKDGSGQ+KTI  AL
Sbjct  209   --LTTNSRRLLSTGQGGDYPSWFSAADRKLLAKVDNGRVRPNAVVAKDGSGQYKTIKAAL  266

Query  1192  KSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSK  1371
              +YP  H+ +YVIYVKAGVYDE +EV K   NVFMYGDG  KT++TG K+     + T +
Sbjct  267   AAYPKGHRGRYVIYVKAGVYDEYIEVTKDQVNVFMYGDGPRKTLVTGHKS-NRGGVPTMQ  325

Query  1372  TATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQ  1551
             +ATF+A+G GF+ + + F+NTAG  G QAVA R QSD SA F+C ++GYQDTLY  T RQ
Sbjct  326   SATFAAVGSGFLCKSMGFQNTAGYIGEQAVALRVQSDRSAFFNCRMDGYQDTLYVQTNRQ  385

Query  1552  FYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCR  1731
             FYRNCVISGT+DFIFG    +IQNS+II RKP   Q NTITA G++      G+V+ NCR
Sbjct  386   FYRNCVISGTVDFIFGDSPTVIQNSLIIVRKPGPGQQNTITAHGRKFNNENTGLVIHNCR  445

Query  1732  IVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYE  1911
             IVPE  L P RF +KTY GRPWK Y+ TV+MES +GD + P G+  W+G+N   TC Y E
Sbjct  446   IVPEQKLYPQRFAIKTYLGRPWKEYARTVIMESTLGDFIQPAGYLSWNGDN---TCTYAE  502

Query  1912  YKNSGPGANT-----WRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             Y N GPGA T     W+  R   + + LG      +TAG+++  N WL  TG  + +G
Sbjct  503   YGNRGPGARTNGRVKWKGVRVISRKEALG------YTAGVFIQGNQWLKYTGFKYMLG  554



>emb|CAN67129.1| hypothetical protein VITISV_040170 [Vitis vinifera]
Length=1542

 Score =   518 bits (1335),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 258/500 (52%), Positives = 340/500 (68%), Gaps = 25/500 (5%)
 Frame = +1

Query  472   TGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNT  651
             + SMK+V + C  A+YKD C +++S VA N SAT KD+I AA++ T++E+  S  L  + 
Sbjct  41    SSSMKAVASVCATADYKDACMQTLSPVAKNGSATPKDYIQAAVQVTMKEIKSSMNL--SE  98

Query  652   KIEQST-DPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYA  828
             K+ Q+T D    MA+ DCK++LQ AID+LQ S S VG+++L TL   + +++NW+SAV +
Sbjct  99    KLVQATNDSRTQMALGDCKDLLQFAIDELQESFSSVGESDLQTLDQLSTEIMNWLSAVVS  158

Query  829   YQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAAD  1008
             YQ TC + +    +++A++ G++NATQLT+NA+ I++++S++L  FN++   DL      
Sbjct  159   YQQTCLDGVIEPRFQTAMQKGLLNATQLTSNALAIVSDISQILTKFNVSL--DL------  210

Query  1009  KnnnnnnnTTSRRLLQT------DHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQF  1170
                       SRRLL        D +P WF   DRKLLA+   G L PN +VAKDGSG F
Sbjct  211   -------KPNSRRLLGEIDVLGHDGYPTWFSATDRKLLASHDNGRLTPNAIVAKDGSGHF  263

Query  1171  KTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAH  1350
              TI  AL +YP   K +YVIYVKAG+Y E + V K   NV+MYGDG  KTI+TG K+Y  
Sbjct  264   TTIAAALAAYPKNLKGRYVIYVKAGIYREYITVTKDQVNVYMYGDGPRKTIVTGTKSYRD  323

Query  1351  MKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTL  1530
               ITT KTATFSA+GKGFVAR + F NTAGP+GHQAVA R QSDMSAIF+C ++GYQDTL
Sbjct  324   -GITTYKTATFSAIGKGFVARSMGFVNTAGPDGHQAVALRVQSDMSAIFNCRMDGYQDTL  382

Query  1531  YYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGG  1710
             Y   +RQFYRNCVISGTIDFIFG  T +IQNS+II R+P  +Q NT+TA GK   +   G
Sbjct  383   YIQAHRQFYRNCVISGTIDFIFGDSTTVIQNSLIIVRRPKDNQQNTVTAHGKAEKRETTG  442

Query  1711  VVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFE  1890
             +V+ NCRIVPE  L P RFK+ ++ GRPWK YS T++ME+ +GD + P GW  W G+   
Sbjct  443   LVIHNCRIVPEQKLFPDRFKIPSFLGRPWKPYSKTIIMETTLGDFIQPAGWMPWAGDFAL  502

Query  1891  KTCMYYEYKNSGPGANTWRR  1950
              T  Y EY N GPGANT  R
Sbjct  503   NTLFYAEYGNRGPGANTRSR  522


 Score =   506 bits (1304),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 257/507 (51%), Positives = 339/507 (67%), Gaps = 27/507 (5%)
 Frame = +1

Query  454   GDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVA-NNHSATTKDFIFAAIKATLEEVHKS  630
             GD  +S+ SMK+V + C  A+YKD C +++S V  N  SAT KD+I AA++ T++++  S
Sbjct  566   GDTNMSS-SMKAVASVCATADYKDACMQTLSPVPKNGSSATPKDYIQAAVQVTIKQIKSS  624

Query  631   HQLVVNTKIEQST-DPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLN  807
               L  + K+ Q+T D    MA+ DCK++LQ AID+LQ S S VG+++L TL   + +++N
Sbjct  625   MNL--SEKLFQATNDSRTQMALGDCKDLLQFAIDELQESFSSVGESDLQTLDQLSTEIMN  682

Query  808   WMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTD  987
             W+SA  +YQ TC + +    +++A++ G++NATQLT+NA+ I++++S++L  FN+    D
Sbjct  683   WLSAAVSYQQTCLDGVIEPRFQNAMQKGLLNATQLTSNALAIVSDLSQILTKFNVPL--D  740

Query  988   LLHKAADKnnnnnnnTTSRRLLQT------DHFPEWFPIADRKLLAAQRRGNLRPNVVVA  1149
             L                SRRLL        D +P WF   DRKLLA Q  G L PN +VA
Sbjct  741   L-------------KPNSRRLLGEIEVLGHDGYPTWFSATDRKLLALQDNGRLTPNAIVA  787

Query  1150  KDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIIT  1329
             KDGSG F TI  AL +YP   K +YVIYVKAG+Y E + V K   NV+MYGDG  KTI+T
Sbjct  788   KDGSGHFTTIAAALAAYPKNLKGRYVIYVKAGIYREYITVTKDHVNVYMYGDGPRKTIVT  847

Query  1330  GKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSI  1509
             G K Y    ITT KTATFSA+GKGFVAR + F NTAGP+GHQAVA R QSDMSA F+C +
Sbjct  848   GTKCYRD-GITTYKTATFSAIGKGFVARSMGFVNTAGPDGHQAVALRVQSDMSAFFNCRM  906

Query  1510  EGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKE  1689
             +GYQDTLY   +RQFYRNCVISGTIDFIFG  T +IQNS+II R+P   Q NT+TA GK 
Sbjct  907   DGYQDTLYVQAHRQFYRNCVISGTIDFIFGDSTTVIQNSLIIVRRPNDKQQNTVTAQGKT  966

Query  1690  LAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKI  1869
               +   G+V+ +CRIVPE  L P RFK+ ++ GRPWK YS T++ME+ +GD + P GW  
Sbjct  967   EKRETTGLVIHDCRIVPEQKLFPDRFKIPSFLGRPWKPYSKTIIMETTLGDFIQPAGWTP  1026

Query  1870  WDGENFEKTCMYYEYKNSGPGANTWRR  1950
             W G+    T +Y EY N GPGANT  R
Sbjct  1027  WAGKFVPNTLLYAEYGNLGPGANTHSR  1053



>ref|XP_002304074.1| hypothetical protein POPTR_0003s01550g [Populus trichocarpa]
 ref|XP_006388629.1| hypothetical protein POPTR_0133s00210g [Populus trichocarpa]
 gb|EEE79053.1| hypothetical protein POPTR_0003s01550g [Populus trichocarpa]
 gb|ERP47543.1| hypothetical protein POPTR_0133s00210g [Populus trichocarpa]
Length=556

 Score =   490 bits (1262),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 248/550 (45%), Positives = 338/550 (61%), Gaps = 26/550 (5%)
 Frame = +1

Query  442   SSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEV  621
             S+G  D    +  MK+V+  CQ   YK+ C  ++S +   +S   K+ I   I A    +
Sbjct  29    SNGSNDTESLSPQMKAVSALCQPTYYKEACTNTLSAL---NSTDPKELIKGGILAISASL  85

Query  622   HKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQL  801
               S  +  +   +      + MA+ DCKE+LQ+A + L+ ++S VG+ +L +L +R D  
Sbjct  86    KNSFNVTDDLVAKTDNASRDKMALNDCKELLQNASESLEDTLSKVGEIDLLSLSNRTDDF  145

Query  802   LNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINAT----QLTNNAINIIAEMSKLLKAFN  969
               W+S++  YQ  C +  E+    S++ D +  +T    +LT+N +NI+A +S++L +  
Sbjct  146   RTWLSSIIGYQEMCLDGFEN---GSSLRDQVQKSTDYGSELTDNVLNILAGLSQVLNSLG  202

Query  970   ITTTTDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVA  1149
             +                    +TSR+LLQ D FP W   +DRKLLA++  G +RPN VVA
Sbjct  203   LKLNIP---------------STSRQLLQADGFPTWMSASDRKLLASRGNGGVRPNAVVA  247

Query  1150  KDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIIT  1329
             +DGSGQFKTI+ AL +YP   K +YVIYVKAG Y E V V K   NVF+YGDG+ KTI+T
Sbjct  248   QDGSGQFKTISAALAAYPKNLKGRYVIYVKAGTYREYVAVAKDQPNVFIYGDGSRKTIVT  307

Query  1330  GKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSI  1509
             G K++A   + T KTATF     GF+A+ I F NTAGP+GHQAVA R+ SDMSA ++C  
Sbjct  308   GNKSFAKDGLGTWKTATFIVEANGFIAKSIGFTNTAGPDGHQAVAIRANSDMSAFYNCRF  367

Query  1510  EGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKE  1689
             +GYQDT+ Y   RQFYRNCV+SGT+DF+FG G+A+IQNS+II R+P  +QFNT+TADG++
Sbjct  368   DGYQDTVLYQAGRQFYRNCVLSGTVDFLFGYGSAVIQNSLIIVRRPNPNQFNTVTADGRK  427

Query  1690  LAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKI  1869
                  GGVV+ NCRIVPE  L P R K+KTY GRPWKAYS TVVMES++ D + P GW  
Sbjct  428   ERGQPGGVVIHNCRIVPEQKLVPDRLKIKTYLGRPWKAYSRTVVMESKLADFIQPDGWAP  487

Query  1870  WDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPAT  2049
             W G  F  T  Y EY N+GPGA T RR R +K    L    A  FT G +L    W+   
Sbjct  488   WSGNEFLDTLYYAEYANAGPGAATNRRVR-WKTLHFLKRSEALQFTVGTFLQGGQWIKNN  546

Query  2050  GVPFAIGYTK  2079
             G+P  +G  K
Sbjct  547   GIPVLMGLRK  556



>ref|XP_008466403.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=567

 Score =   489 bits (1259),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 254/541 (47%), Positives = 353/541 (65%), Gaps = 30/541 (6%)
 Frame = +1

Query  481   MKSVTTFCQYAEYKDVCAKSISHVANNHSAT-TKDFIFAAIKATLEEVHKSHQLVVNTKI  657
             MK+++  C   +Y++ C  +++HVA N S+   KD+  AAI AT++E+ K + L  +  +
Sbjct  43    MKAISAICSTTDYQEECKNTLNHVAQNTSSNDPKDYAKAAILATIKEITKGYNLSDSLIV  102

Query  658   EQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQT  837
             E   +    M++EDC ++LQ AID+LQAS S VG+++LHT   R   + NW+SAV +YQ 
Sbjct  103   EAGNNASIKMSVEDCNDLLQFAIDELQASYSTVGESDLHTDADRIADIKNWLSAVVSYQQ  162

Query  838   TCTE---QIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAAD  1008
             +C +   + + +L K  ++DG+  A +LT+NA+ I+  +S +L  + +            
Sbjct  163   SCLDGLGEFDPQL-KQRMQDGLDVAGKLTSNALAILTAVSNILDNYGLQLKVQ-------  214

Query  1009  KnnnnnnnTTSRRLLQT-----DHFPEWFPIADRKLLAAQRRGNLRP--NVVVAKDGSGQ  1167
                      + RRLL T     D FP W   ADRKLLA+ ++G +RP  N VVAKDGSGQ
Sbjct  215   --------PSGRRLLGTTEVDSDGFPTWLTGADRKLLAS-KQGGVRPTPNAVVAKDGSGQ  265

Query  1168  FKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYA  1347
             +KTI  AL +YP   + +YVIYVKAG+YDE + V K MKNVFMYGDG  KTI+TG+K+  
Sbjct  266   YKTIAAALAAYPKALRGRYVIYVKAGIYDEYITVTKDMKNVFMYGDGPRKTIVTGRKSNR  325

Query  1348  HMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDT  1527
                 TT  TA+F+A+G+GF+ + + F NTAGP+GHQAVA R QSD SA F+C ++G+QDT
Sbjct  326   D-GFTTQNTASFAAIGEGFLCKSMGFTNTAGPQGHQAVALRVQSDRSAFFNCRMDGHQDT  384

Query  1528  LYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKG  1707
             LY  T+RQFYRNCVISGT+DFIFG  + +IQNS+II R+P+ +Q NT+TA G+   K   
Sbjct  385   LYVQTHRQFYRNCVISGTVDFIFGDSSTIIQNSLIIVRRPMDNQQNTVTAQGRAEQKEIT  444

Query  1708  GVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENF  1887
             G+V+ NCRIVPE  L   RFK+ T+ GRPWK Y+ TV+MES +GD + P G+  W G   
Sbjct  445   GLVIHNCRIVPEQKLFAERFKIPTFLGRPWKQYARTVIMESTLGDFIQPAGYMPWSGNFA  504

Query  1888  EKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAI  2067
              +TC+Y EY N GPGANT RR R +K   V+G   A  +TAG +L   +WLP TG  + +
Sbjct  505   LETCLYLEYGNRGPGANTNRRVR-WKGVKVIGRNEALQYTAGAFLLGRTWLPRTGGIYYL  563

Query  2068  G  2070
             G
Sbjct  564   G  564



>ref|XP_007035986.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
 gb|EOY06912.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
Length=597

 Score =   489 bits (1260),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 252/556 (45%), Positives = 358/556 (64%), Gaps = 23/556 (4%)
 Frame = +1

Query  436   DASSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLE  615
             + S+   +  V + + KSV   C   ++K  C  ++  VANN SA  KDFI AAI  TL+
Sbjct  48    NGSNDTTEKDVLSTTSKSVAAICSPTQFKQACVDTLGSVANNESAVPKDFIQAAIHVTLQ  107

Query  616   EVHKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRAD  795
             E+  +     +      +D    MA +DC E+LQ A+D+LQAS SVVGD++LH ++ R  
Sbjct  108   ELQAALNKSGSIFGSAVSDKTVKMAKDDCDELLQYAVDELQASFSVVGDSDLHNMEQREA  167

Query  796   QLLNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNIT  975
             ++ NW++AV ++Q +C +QI     +  + + ++NA+QLT+NA+ I+  +S+++ AFN+T
Sbjct  168   EIKNWLNAVISFQESCVDQIPQPQLQQQLSNCLLNASQLTSNALAIVNSISQIMSAFNLT  227

Query  976   TTTDLLHKAADKnnnnnnnTTSRRLL---QTDH---FPEWFPIADRKLLAAQRRGNLRPN  1137
             ++ +L     +           R+L+     DH   +P W    DRKLLA      L PN
Sbjct  228   SSLNLNLGGGN----------DRQLMDEPNPDHDTTYPSWVSSKDRKLLAGGNNAQLTPN  277

Query  1138  VVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGK  1317
              VVAKDGSGQ+KTI  ALK+YP   + +YVIYVKAG+Y+E + V K   NVFMYGDG  K
Sbjct  278   AVVAKDGSGQYKTIGDALKAYPKNLQGRYVIYVKAGIYNEYITVDKDKVNVFMYGDGPRK  337

Query  1318  TIITGKKNYAHMKITTSKTATF--SALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSA  1491
             T++TG+K+      TT+ TA+F  +A+G GF+A+ + F+NTAGPEGHQAVA R  SD + 
Sbjct  338   TMVTGRKSNRD-GYTTTDTASFFAAAIGDGFIAKAMGFQNTAGPEGHQAVALRVISDRAV  396

Query  1492  IFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTI  1671
              ++C ++GYQDTLY   +RQFYRNCVISGT+DFIFG    +IQNS++I RKP+ +Q N +
Sbjct  397   FYNCRMDGYQDTLYVQAHRQFYRNCVISGTVDFIFGDSNTIIQNSLLIVRKPMDNQQNIV  456

Query  1672  TADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLS  1851
             TA G++  +   G+V+QNCRIVP+ AL P+RFK+++Y GRPWK +S TV+MES IGD + 
Sbjct  457   TAHGRKFKQETTGLVIQNCRIVPDQALFPVRFKIRSYLGRPWKEHSRTVIMESTIGDFIQ  516

Query  1852  PLGWKIWDGENFEKTCMYY-EYKNSGPGANTWRRNRAFKKFDVL-GPIRARHFTAGLWLD  2025
             P GW  W G NF    +YY EY N GPGA T  R + +K + V+     A  FTAG +L 
Sbjct  517   PAGWLEWAG-NFALNTLYYAEYANRGPGAATNGRVK-WKGYKVITNRNEALQFTAGPFLQ  574

Query  2026  ANSWLPATGVPFAIGY  2073
               +WL  +GVPF +G+
Sbjct  575   GQTWLAESGVPFFLGF  590



>ref|XP_004298254.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Fragaria vesca subsp. vesca]
Length=577

 Score =   488 bits (1257),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 265/565 (47%), Positives = 357/565 (63%), Gaps = 40/565 (7%)
 Frame = +1

Query  439   ASSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEE  618
             ++  KG   +S+ S K+V   C+  +YK+ C  S++  A N SA+ KD I +A++ T+++
Sbjct  29    STRNKGKDKLSSSS-KAVIAMCEPTDYKEACVDSLAGAAKNQSASPKDLIRSAVEYTVQQ  87

Query  619   V----HKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKH  786
             V     KS  ++   K   ST     MA +DC E+L+ AI+ LQ S+  + D ++  +  
Sbjct  88    VKAAIEKSGIIIKEAKDVNST---GKMAFDDCNELLESAIESLQYSLLTLVDADMPKINE  144

Query  787   RADQLLNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAF  966
             +   L NW SA  ++Q +C + I     K  + + M NA QLT+NA+ I++ +S +L  F
Sbjct  145   KEADLKNWFSAAMSFQESCIDGIPYEDLKKQMSEAMQNAEQLTSNALAIVSSLSNILGNF  204

Query  967   NITTTTDLLHKAADKnnnnnnnTTSRRLL----QTDH---FPEWFPIADRKLLAAQRRGN  1125
             NI    +            NN +T+RRLL    +TD    FP WF  ADRKL+A Q + N
Sbjct  205   NIPLKPN------------NNPSTARRLLDVEMETDEHGTFPTWFSAADRKLIAKQNKKN  252

Query  1126  --------LRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKM  1281
                     ++PN VVAKDGSGQ+KTI  AL +YP   + +YVIYVKAG+Y+E V V K  
Sbjct  253   NNAGNGQAVKPNAVVAKDGSGQYKTIGAALAAYPKGFQGRYVIYVKAGIYNEYVTVAKNQ  312

Query  1282  KNVFMYGDGAGKTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAV  1461
              NVFMYGDG  +T++TG+K++A   ITT  TATF  +G GF+ARG+ F+NTAGPE HQAV
Sbjct  313   NNVFMYGDGPRETMVTGRKSFAD-GITTQDTATFIVVGHGFIARGMGFQNTAGPEKHQAV  371

Query  1462  AYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIAR  1641
             A R QSDMSA F+C ++GYQDTLY   YRQFYRNCVISGT+DFIFG  T +IQNS+II R
Sbjct  372   ALRVQSDMSAFFNCRMDGYQDTLYVQAYRQFYRNCVISGTVDFIFGDSTTVIQNSLIIVR  431

Query  1642  KPLVHQFNTITADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVV  1821
             KPL +Q NT+TA+G++  +   G+V+QNCRIVPE AL PLRF++ +Y GRPWK YS TV+
Sbjct  432   KPLANQKNTVTANGRKDQRESTGLVIQNCRIVPEEALFPLRFQIMSYLGRPWKMYSRTVI  491

Query  1822  MESQIGDLLSPLGWKIWDGENFEKTCMYY-EYKNSGPGANTWRRNRAFKKFDVLGPIR-A  1995
             MES+ GD + P GW  W G NF    +YY EY N GPGA T  R + +K F V+     A
Sbjct  492   MESEFGDFIQPAGWLEWQG-NFALDTLYYAEYANRGPGAVTTGRVK-WKGFHVITDRNVA  549

Query  1996  RHFTAGLWLDANSWLPATGVPFAIG  2070
               FT G +L    WL  TG P+ +G
Sbjct  550   LQFTPGNFLAGGLWLKGTGAPYFLG  574



>ref|XP_011007987.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=556

 Score =   487 bits (1253),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 243/547 (44%), Positives = 335/547 (61%), Gaps = 20/547 (4%)
 Frame = +1

Query  442   SSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEV  621
             S+G  D    +  MK+V+  CQ   YK+ C  ++S +   +S   K+ I   I A    +
Sbjct  29    SNGSNDAESLSPQMKAVSALCQPTYYKEACTNTLSAL---NSTDPKELIKGGILAISASL  85

Query  622   HKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQL  801
               S  +  +   +      + MA+ DCKE+LQ+A + ++ ++S VG+ +L +L +R D  
Sbjct  86    KNSFNVTDDLVAKTDNASRDKMALIDCKELLQNASESVEDTLSKVGEIDLLSLSNRTDDF  145

Query  802   LNWMSAVYAYQTTCTEQIES-RLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITT  978
               W+S++  YQ  C +  E+    +  ++      ++LT+N +NI+A +S++L +  +  
Sbjct  146   RTWLSSIIGYQEMCLDGFENGNSLRDQVQKSTDYGSELTDNVLNILAGLSQVLNSLGLKL  205

Query  979   TTDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDG  1158
                               +TSR+LLQ + FP W   +DRKLLA++  G +RPN VVA+DG
Sbjct  206   NVP---------------STSRQLLQANGFPTWMSASDRKLLASRGNGGVRPNAVVAQDG  250

Query  1159  SGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKK  1338
             SGQFKTI  AL +YP   K +YVIYVKAG Y E V V K   NVF+YGDG+ KTI+TG K
Sbjct  251   SGQFKTINAALAAYPKNLKGRYVIYVKAGTYREYVAVAKDQPNVFIYGDGSRKTIVTGNK  310

Query  1339  NYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGY  1518
             N+A   + T KTATF     GF+A+ I F NTAGP+GHQAVA R+ SDMSA ++C  +GY
Sbjct  311   NFAKDGLGTWKTATFIVEANGFIAKSIGFTNTAGPDGHQAVAIRTNSDMSAFYNCRFDGY  370

Query  1519  QDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAK  1698
             QDT+ Y   RQFYRNCV+SGT+DF+FG G+A+IQNS+II R+P  +QFNT+TADG++   
Sbjct  371   QDTVLYQAGRQFYRNCVLSGTVDFLFGYGSAVIQNSLIIVRRPNPNQFNTVTADGRKERG  430

Query  1699  AKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDG  1878
               GG+V+ NCRIVPE  L P R K+KTY GRPWKAYS TVVMES++ D + P GW  W G
Sbjct  431   QPGGLVIHNCRIVPEQKLVPDRLKIKTYLGRPWKAYSRTVVMESKLADFIQPDGWAPWSG  490

Query  1879  ENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVP  2058
               F  T  Y EY N+GPGA T RR R +K    L    A  FT G +L    W+ + G+P
Sbjct  491   NQFLDTLYYAEYANAGPGAATNRRVR-WKTLHFLKRSEALQFTVGAFLQGGQWIRSNGIP  549

Query  2059  FAIGYTK  2079
               +G  K
Sbjct  550   VLMGLRK  556



>ref|XP_010694101.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=569

 Score =   487 bits (1253),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 243/553 (44%), Positives = 348/553 (63%), Gaps = 29/553 (5%)
 Frame = +1

Query  442   SSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEV  621
             +S   +H   +   K++   C   +YKD C  S++ VANN SAT KD+I  AI +T++ V
Sbjct  31    TSNHPNHDPLSSKSKAIQAICGPTDYKDACVTSLNSVANNQSATLKDYIQVAISSTIDAV  90

Query  622   HKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQL  801
              +S +   ++  +++ DP N MA  DCKE+LQ A D+LQ+ +    DT   +L +R + L
Sbjct  91    KQSIE-KSDSIGKEANDPLNKMAFADCKELLQLATDELQSLLRDTNDTNFSSLTNRENDL  149

Query  802   LNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTT  981
              NW+SA  +YQ +C + +E+   K  +  G+   +QLT+N + I++E S +L +F I + 
Sbjct  150   KNWLSATISYQQSCLDGVENSDLKEKMTKGLKITSQLTSNMLAIVSEFSPILSSFGINSN  209

Query  982   TDLLHKAADKnnnnnnnTTSRRLLQT---------DHFPEWFPIADRKLLAAQRRGNLRP  1134
               +                SRRLL           D +P W    DRKLL+     N  P
Sbjct  210   ASI---------------NSRRLLNINENVSKFGKDGYPNWISTEDRKLLSRININNPFP  254

Query  1135  NVVVAKDGSGQFKTITGALKSYPPKH-KAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGA  1311
             N +VA+DGSGQF+TI+ A+ +Y PK+ K +YVIYVKAG+Y+E V + K   N+FMYGDG 
Sbjct  255   NAIVAQDGSGQFRTISQAIAAYNPKNFKGRYVIYVKAGLYNEQVLITKDQVNIFMYGDGP  314

Query  1312  GKTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSA  1491
              KTI+TG+KN     ++T ++ATF+ +G GF+ + + F+NTAGPEGHQAVA R QSDMSA
Sbjct  315   RKTIVTGRKNNRD-GVSTYQSATFAVIGNGFIGKSMGFQNTAGPEGHQAVALRVQSDMSA  373

Query  1492  IFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTI  1671
              ++C ++GYQDTLY   +RQFYRNCV+SGT+DFIFG G  +IQNS+II RKPL +Q NT+
Sbjct  374   FYNCRMDGYQDTLYTQAHRQFYRNCVVSGTVDFIFGDGNVVIQNSLIIVRKPLDNQQNTV  433

Query  1672  TADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLS  1851
             TA GK+  +   G+V+ NCRIVPE  L P+R+++ T+ GRPWK YSTT++M+S + D + 
Sbjct  434   TAQGKKDRRETTGIVIHNCRIVPEQKLFPIRYQIPTFLGRPWKEYSTTIIMQSMLADFIQ  493

Query  1852  PLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVL-GPIRARHFTAGLWLDA  2028
             P+GW  W G     T  Y EY N GPGA+T RR R +K + V+     A  FT G ++  
Sbjct  494   PVGWMPWAGTFALDTLYYGEYGNRGPGADTSRRVR-WKGYHVITNRDEAIRFTVGRFIQG  552

Query  2029  NSWLPATGVPFAI  2067
               WLP + +P+ +
Sbjct  553   QQWLPFSSMPYLL  565



>ref|XP_007051270.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
 gb|EOX95427.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
Length=555

 Score =   486 bits (1251),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 255/534 (48%), Positives = 331/534 (62%), Gaps = 25/534 (5%)
 Frame = +1

Query  481   MKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIE  660
             MK+V+ FC   +Y++ C K++S V   +S   KD++  AI A+ E V K      +  ++
Sbjct  40    MKAVSNFCSSTDYQEACKKTLSSV---NSTDPKDYVAQAILASQEAVKKFFNYSDSLIVQ  96

Query  661   QSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTT  840
                D    MA++DCKEM+  AI  LQAS S VGD EL ++  R   L  W+SAV +YQ +
Sbjct  97    AKNDSRTKMALDDCKEMMDYAIQSLQASFSEVGDGELRSINDRIADLRTWLSAVISYQQS  156

Query  841   CTEQIESRL-YKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnn  1017
             C +  E        +  G+ +A++LT NA+ I+ ++S +L  F +               
Sbjct  157   CLDGFEPETTMHQTMTTGIADASELTANALAIVTKLSDILSKFGL---------------  201

Query  1018  nnnnnTTSRRLL--QTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGAL  1191
                   T+RRLL  + D +P WF  ADRKLLA     NLRPN VVAKDGSGQF+TI  AL
Sbjct  202   -QLAIPTARRLLSVEKDGYPSWFSAADRKLLARIDNRNLRPNAVVAKDGSGQFRTIAAAL  260

Query  1192  KSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSK  1371
              + P   K ++VIYVKAG+Y+E + V KK  N+ MYGDG  KTI+TG KN+     +T +
Sbjct  261   AAAPKNSKVRHVIYVKAGIYNEYITVDKKTTNILMYGDGPRKTIVTGHKNFVD-GTSTWQ  319

Query  1372  TATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQ  1551
             TATFSA+G GF+A+ + F+NTAGP+ HQAVA R QSD SA F+C ++GYQDTLY    RQ
Sbjct  320   TATFSAIGDGFIAKSMGFQNTAGPQKHQAVALRIQSDKSAFFNCRMDGYQDTLYNQANRQ  379

Query  1552  FYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCR  1731
             F+RNCVISGTIDFIFG    +IQNS+II R+P+ +Q NT+TA GK  A    G V+QNCR
Sbjct  380   FFRNCVISGTIDFIFGDSPTIIQNSLIIVRRPMDNQQNTVTAQGKTNAHENTGTVIQNCR  439

Query  1732  IVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYE  1911
             IVPE  L   RFK+ TY GRPWK YSTTV+MES +GD + P GW  W G NF  T  Y E
Sbjct  440   IVPEQKLFADRFKIPTYLGRPWKQYSTTVIMESTLGDFIQPAGWLPWAGSNFLNTLYYAE  499

Query  1912  YKNSGPGANTWRRNRAFKKFDVLGPIRARHFTA-GLWLDANSWLPATGVPFAIG  2070
             Y N GPGANT +R   +K +  +    A  FT     L   +WLPATG+PF  G
Sbjct  500   YNNRGPGANTAKRVN-WKGYHRIDRRTAMRFTVQSFLLGRENWLPATGIPFTAG  552



>ref|XP_002528621.1| Pectinesterase-4 precursor, putative [Ricinus communis]
 gb|EEF33779.1| Pectinesterase-4 precursor, putative [Ricinus communis]
Length=568

 Score =   485 bits (1248),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 256/544 (47%), Positives = 353/544 (65%), Gaps = 23/544 (4%)
 Frame = +1

Query  466   VSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVV  645
             VST S KSV   CQ  +YK+ C KS++ V +      K+++ AAI AT+E   KS  L  
Sbjct  42    VST-STKSVAQICQPTDYKEACEKSLNSVKDTKDP--KEYVKAAILATVEAATKSFNLSS  98

Query  646   NTKIE-QSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAV  822
             N  ++ ++ D    M++EDCK++LQDA+ +LQAS S VG++ ++T+  R  +L NW+SAV
Sbjct  99    NLIVDAKNADNDTRMSLEDCKDLLQDAVQELQASFSTVGESTVNTMDQRIAELQNWLSAV  158

Query  823   YAYQTTCTEQI--ESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLH  996
              +YQ TC EQ    +  YKS ++DGM++ATQLT+NA+ II  +S++L  F++    DL  
Sbjct  159   VSYQDTCLEQFGDPNSNYKSQMQDGMVDATQLTSNALAIINALSQMLSTFDLKF--DLTS  216

Query  997   KAADKnnnnnnnTTSRRLLQTDH--FPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQF  1170
             ++ D          SR+LL  D    P WF  A R+L+AA     ++PN+ VA+DGSG  
Sbjct  217   ESGDN---------SRKLLSVDETGVPIWFDGAKRRLMAADTSA-IKPNITVAQDGSGDV  266

Query  1171  KTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAH  1350
             KT+T A+   P K +  ++IYVKAG Y E   V KKM NVFMYGDG  KTIITG  +  H
Sbjct  267   KTVTEAIAKIPLKSENPFIIYVKAGTYKEYPIVEKKMLNVFMYGDGPKKTIITGSHS-NH  325

Query  1351  MKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTL  1530
                 T ++ATF+ALG GF+A+ + F NTAGPEGHQAVA R Q+D +A FDC+I+GYQDTL
Sbjct  326   TGWKTMRSATFAALGPGFMAKSMGFENTAGPEGHQAVALRVQADRAAFFDCNIDGYQDTL  385

Query  1531  YYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGG  1710
             Y   +RQFY  C ISGTIDFIFG  + +IQNS I+ RKP+ +Q NT+TA G+ +     G
Sbjct  386   YTQAHRQFYYGCSISGTIDFIFGDASVVIQNSKIVVRKPMKNQGNTVTAHGRTMKHETTG  445

Query  1711  VVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFE  1890
             ++LQNC+I+ E  L P R  VK+Y GRPWKAYS T+VMES+I D++ P GW  W+G+ + 
Sbjct  446   LILQNCQIIAEDLLFPERTVVKSYLGRPWKAYSRTIVMESEITDVIQPEGWLPWNGDLYL  505

Query  1891  KTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIR-ARHFTAGLWLDANSWLPATGVPFAI  2067
              T  Y EY N+G  + T +R + +K F V+   + A  FT G ++    WL  TG+PF +
Sbjct  506   DTLDYAEYANTGAASATDKRVK-WKGFHVITSKKEAEQFTVGPFIQGGEWLNGTGIPFKL  564

Query  2068  GYTK  2079
             G+TK
Sbjct  565   GFTK  568



>ref|XP_002528620.1| Pectinesterase-4 precursor, putative [Ricinus communis]
 gb|EEF33778.1| Pectinesterase-4 precursor, putative [Ricinus communis]
Length=557

 Score =   484 bits (1247),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 246/535 (46%), Positives = 335/535 (63%), Gaps = 21/535 (4%)
 Frame = +1

Query  481   MKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIE  660
             MK+VT  CQ   YK+ C +++S V   +S   K+ I A I A    + KS  L  +  ++
Sbjct  42    MKAVTQLCQPTNYKETCTQTLSGV---NSTDPKELIKAGILAISSSLTKSLNLSDDLVVK  98

Query  661   QSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTT  840
               ++P   +A+EDCK +L++A ++LQ +++ + D  L T+  +AD+   W+S++ +YQ  
Sbjct  99    AGSEPRTKLALEDCKTLLKEANEELQDTLAKMSDINLKTIADQADEFRIWLSSIISYQEL  158

Query  841   CTEQI-ESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnn  1017
             C +   +    KSA++      ++LT+N +NI+  +S +LK+F +               
Sbjct  159   CMDGFDQDNEVKSAVQKSTEFGSELTDNVLNILGGISDVLKSFGL--------------Q  204

Query  1018  nnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGALKS  1197
              N   + SRRLLQ D +P W   ADRKLLAA+    L PN VVA DGSG+FK+I  A+ S
Sbjct  205   FNLPGSNSRRLLQADGYPTWLSGADRKLLAARNNAKLPPNAVVALDGSGKFKSINDAINS  264

Query  1198  YPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKTA  1377
             YP  HK +YVIYVKAG+Y E V+V K   N++MYGDG  KTI+TGKK++    I T  TA
Sbjct  265   YPNGHKGRYVIYVKAGIYHEAVKVPKTHTNIYMYGDGPRKTIVTGKKSFTS-GINTWNTA  323

Query  1378  TFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFY  1557
             +F     GF+ + + F+NTAGP+GHQAVA R  SDMS   +C ++GYQDTL Y   RQFY
Sbjct  324   SFVVEADGFICKSMGFQNTAGPDGHQAVAIRVNSDMSVFHNCRMDGYQDTLLYQAKRQFY  383

Query  1558  RNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCRIV  1737
             RNCVISGTIDF+FG G A+IQNS+II RKP  +QFNT+TADG++      G+V+ NCRIV
Sbjct  384   RNCVISGTIDFLFGYGAAVIQNSLIIVRKPNPNQFNTVTADGRKERGQNTGLVIHNCRIV  443

Query  1738  PETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYK  1917
             PE  L P R   +TY GRPWK YS TVVME+Q+GDL+ P GW  W G  F  T  Y EY 
Sbjct  444   PEVKLAPQRLTTRTYLGRPWKQYSRTVVMETQLGDLIQPDGWMPWAGSQFLDTLYYAEYA  503

Query  1918  NSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWL-DANSWLPATGVPFAIGYTK  2079
             NSGPGANT RR + +K   +L    A+ FT G +L  A  W+   G PF +G+ +
Sbjct  504   NSGPGANTARRVK-WKTLHLLNRNEAQQFTVGRFLAGAGQWIGGAGAPFLLGFKR  557



>ref|XP_006851559.1| hypothetical protein AMTR_s00040p00188020 [Amborella trichopoda]
 gb|ERN13140.1| hypothetical protein AMTR_s00040p00188020 [Amborella trichopoda]
Length=586

 Score =   484 bits (1247),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 252/541 (47%), Positives = 346/541 (64%), Gaps = 37/541 (7%)
 Frame = +1

Query  478   SMKSVTTFCQYAEYKDVCAKSISH-VANNHSATT---KDFIFAAIKATLEEVHKSHQLVV  645
             +M+++TT C   ++K  C  S+S  V NN SAT    K+ I A++KAT+++V  + +L  
Sbjct  70    TMRAITTICGPTDHKQACIDSLSQIVGNNASATALEPKELIAASVKATIKQVTGALKLSD  129

Query  646   NTKIEQS--TDPYN-HMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMS  816
             + K   +  TD      AI DCK++L  AID+LQ S S +   ++ +L  RA QL  W+S
Sbjct  130   SMKATATNGTDGRRLEGAIADCKQLLSFAIDELQDSFSDISGNDMKSLPDRAYQLRVWLS  189

Query  817   AVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLH  996
             AV  Y  TC + ++    K+ + DG+ NAT +T+NA+ II E+SK+L +F I  +     
Sbjct  190   AVLTYHETCVDGLDHPELKATMRDGLANATVMTSNALAIITEISKILSSFQIPFSI----  245

Query  997   KAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKT  1176
                           SRRLL+T  FPEW    DR+LLA    G +RPN VVAKDGSGQ+K 
Sbjct  246   -------------PSRRLLETG-FPEWLNEGDRRLLAGG--GGVRPNAVVAKDGSGQYKK  289

Query  1177  ITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMK  1356
             I+ A+ + P   + +++IYVKAG+Y+E V + K   NVFMYGDGA KTI++G+ NY    
Sbjct  290   ISDAVAAIPENFQGRWIIYVKAGIYEEKVTIPKDANNVFMYGDGARKTIVSGRLNYVD-G  348

Query  1357  ITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYY  1536
              +T +TATF+ALG GF+ + + F NTAGPE HQAVA   +SDM+A F+C  +GYQDTLY 
Sbjct  349   TSTFQTATFTALGDGFLCKSMAFSNTAGPEKHQAVAVLVKSDMAAFFNCRFDGYQDTLYA  408

Query  1537  HTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVV  1716
             H++RQ YRNCV+SGTIDFIFG   A++QN  II R+P+ +Q N +TA G+   ++ GG++
Sbjct  409   HSHRQLYRNCVVSGTIDFIFGDSAAVLQNCKIIVRRPMDNQQNIVTASGRLDKRSTGGII  468

Query  1717  LQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKT  1896
             + NCRIVP+  L P R K +TY GRPWK Y+ T+VMES +GDL+ P GW  W+G+   KT
Sbjct  469   IHNCRIVPDKRLYPERLKFRTYLGRPWKEYARTIVMESTLGDLIQPDGWMPWEGDFALKT  528

Query  1897  CMYYEYKNSGPGANTWRR---NRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAI  2067
               Y EY N GPGA T RR   +R  K+ D L       FTAG +L A  WLP+TGVP+ +
Sbjct  529   LFYAEYGNKGPGAQTARRVKWSRVIKRSDAL------QFTAGPFLQARQWLPSTGVPYVL  582

Query  2068  G  2070
             G
Sbjct  583   G  583



>ref|XP_009419138.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=557

 Score =   482 bits (1241),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 256/568 (45%), Positives = 350/568 (62%), Gaps = 25/568 (4%)
 Frame = +1

Query  361   AITLVSLIlvvgvvcgavlvlqgvDDASSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKS  540
             A++ V L+  V  V   V+      DAS G G     T + KSV+ FC   +Y+  C ++
Sbjct  8     AVSAVLLVAAVIGVVATVVSSNHKTDASEGDGSL---TTTSKSVSAFCAKTDYQADCERT  64

Query  541   ISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQD  720
             I   A N S++ K+ I A+ +A ++E+  +  L  N  + ++ DP N  A   C+++L+D
Sbjct  65    IGS-AINGSSSPKEVIQASFQAAIDEIQAAFHLSNNVSL-KANDPMNKAAFNICRQLLED  122

Query  721   AIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTCTEQIESRLYKSAIEDGMIN  900
             A ++L A+ S   D  L  L  R D +  W+SAV +YQ TC + I     +S ++DG+  
Sbjct  123   ADEELNAAFSETHD--LQGLARRTDDIKTWLSAVISYQQTCLDGITEPELQSTMKDGLST  180

Query  901   ATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnnnnnnnTTSRRLLQTDH-FPEW  1077
             AT++T+NAI I+ E+S LLK+F I     +                SRRLL  +  +P W
Sbjct  181   ATKVTSNAIAIVDELSSLLKSFKIPINITM---------------GSRRLLVDEQGYPSW  225

Query  1078  FPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDE  1257
             F   DRKLLAAQ RG L PNVVVAKDGSG+FKTI  A+ + P  +  +YVIYVKAGVY E
Sbjct  226   FSGHDRKLLAAQARGQLTPNVVVAKDGSGKFKTINDAVNAMPKDYSGRYVIYVKAGVYKE  285

Query  1258  IVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTA  1437
              V VGK   NV MYGDG+ KT++TG KNY    + T  TATF+ALG+GF+A+ + F NTA
Sbjct  286   NVIVGKDKVNVLMYGDGSRKTVVTGSKNYVD-GVQTVDTATFAALGQGFIAKSMGFSNTA  344

Query  1438  GPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALI  1617
             G E HQAVA R QSDMSA F+C ++ YQDTLY   +RQFYRNCV+SGTIDFIFG  + ++
Sbjct  345   GAEKHQAVALRVQSDMSAFFNCRMDAYQDTLYVQAHRQFYRNCVVSGTIDFIFGDSSTIL  404

Query  1618  QNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPW  1797
             QN +++ R+P+ +Q N +TA G+  AK    +V+QNCRIVP+ +L P R K + Y GRPW
Sbjct  405   QNCLLVMRRPMDNQQNILTAHGRSQAKETTALVIQNCRIVPDKSLFPERLKFRNYLGRPW  464

Query  1798  KAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDV  1977
             KAYS T+VMES IGDL+ P GW  WDG NF  T  Y EY N GPGA T  R   +  + V
Sbjct  465   KAYSRTIVMESTIGDLIQPEGWMPWDGANFLDTLYYAEYNNRGPGAGTSGRVN-WPGYHV  523

Query  1978  LGPIRARHFTAGLWLDANSWLPATGVPF  2061
             +G   A+ +T    +  + W+  + + +
Sbjct  524   IGRTEAQKYTVESLIQGSKWIKFSNIRY  551



>ref|XP_010247575.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13 
[Nelumbo nucifera]
Length=922

 Score =   494 bits (1272),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 256/551 (46%), Positives = 347/551 (63%), Gaps = 32/551 (6%)
 Frame = +1

Query  463   GVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQL-  639
              +S+ +MK+V   C   +++D C K+++ VANN SAT +D++ AA +AT  EV  + +  
Sbjct  39    AMSSTAMKNVKAICALTDFEDACIKTLTPVANNKSATPEDYLKAAFEATNGEVEAALEKS  98

Query  640   -VVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMS  816
              V+    + S D    MA+EDCKE+LQ AIDDLQ++IS+ GD E +       +  NW+S
Sbjct  99    GVIGKDAQGSID---KMAVEDCKELLQFAIDDLQSAISMAGDPEKNKAADVTAEFKNWLS  155

Query  817   AVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLH  996
             AV +YQ +C +  E    K+++++G++NATQLT+NA+ II +MS +LKA NI    ++  
Sbjct  156   AVVSYQESCIDGFEHPELKNSMQNGLLNATQLTSNALTIIGQMSSILKALNINFDFNI--  213

Query  997   KAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKT  1176
                          + RRLL    +P WF   DRKLLA Q  G + PN VVAKDGSG +KT
Sbjct  214   ------------KSRRRLLDAQGYPTWFAPTDRKLLALQDNGRVAPNAVVAKDGSGHYKT  261

Query  1177  ITGALKSYPPKH--------KAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITG  1332
             I  AL +YP K          ++YVIYVKAG YDE + + K   N+ MYGDG   TIITG
Sbjct  262   IAEALAAYPKKKGSQKNDSSTSRYVIYVKAGTYDEYITITKDQTNILMYGDGPTSTIITG  321

Query  1333  KKNYAHMKITTSKTATF--SALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCS  1506
              K+     I+T +TA+F  + +G GF+ R + F NTAGPEGHQAVA R QSD +A F+C 
Sbjct  322   HKSNRE-GISTFQTASFFVAVIGDGFICRSMGFHNTAGPEGHQAVALRVQSDRAAFFNCR  380

Query  1507  IEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGK  1686
             ++GYQDTLY   +RQFY+NC ISGTIDFIFG  + +IQNS+II R+PL +Q NT+TA GK
Sbjct  381   MDGYQDTLYVQAHRQFYKNCAISGTIDFIFGDSSTVIQNSLIIVRRPLDNQQNTVTAQGK  440

Query  1687  ELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWK  1866
             +      G+VLQNC+IVPE  L   R K+ +Y GRPWK Y+ TV+MES IGD++ P GW 
Sbjct  441   KFKDESTGLVLQNCKIVPEQRLVAERLKIPSYLGRPWKEYAVTVIMESTIGDVIRPEGWM  500

Query  1867  IWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVL-GPIRARHFTAGLWLDANSWLP  2043
              W G+    T  Y EY N GPGANT  R + +K F V+     A  +T G ++  + WL 
Sbjct  501   PWAGDFALDTLFYAEYNNRGPGANTDHRVK-WKGFKVITKKDEALRYTVGPFIQGDEWLK  559

Query  2044  ATGVPFAIGYT  2076
              TG PF +G +
Sbjct  560   DTGSPFTLGLS  570



>ref|XP_003535290.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=574

 Score =   473 bits (1218),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 250/554 (45%), Positives = 344/554 (62%), Gaps = 24/554 (4%)
 Frame = +1

Query  442   SSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEV  621
             +S   D G  +   K+V   CQ ++ K  C+ ++S V  N S  T  ++   +K T++ V
Sbjct  36    NSESNDSGQVSTHTKAVQAVCQNSDDKKFCSDTLSSV--NTSDPTA-YVKTVLKKTMDGV  92

Query  622   HKSHQLVVNTKIEQS-TDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQ  798
              K+  L     +E S T+    MA+EDCK++L  AID+LQAS  +V D  ++ +      
Sbjct  93    IKAFNLSDTLTVEHSKTNSSVKMALEDCKDLLDFAIDELQASQVLVKDNNVNNINDGVSD  152

Query  799   LLNWMSAVYAYQTTCTEQIESRLYK---SAIEDGMINAT-QLTNNAINIIAEMSKLLKAF  966
             L NW+ AV AYQ +C +  ++   K   S ++ G +++  +LT  A+++I+  ++LL  F
Sbjct  153   LKNWIGAVVAYQQSCLDGFDTDAEKEVQSKLQTGGLDSMGKLTALALDVISSFAELLSGF  212

Query  967   NITTTTDLLHKAADKnnnnnnnTTSRRLLQTDH--FPEWFPIADRKLLAAQRRGN-LRPN  1137
             N+  TT +              ++SRRLL  D   +P W  + DRKLLA  ++G+ + PN
Sbjct  213   NLNLTTSV----------KPPTSSSRRLLDVDQDGYPSWISMPDRKLLADAKKGDSVPPN  262

Query  1138  VVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGK  1317
              VVAKDGSGQ+KT+  A+ SYP  HK +YVIYVKAGVYDE + V KK  N+ +YGDG  K
Sbjct  263   AVVAKDGSGQYKTVLDAINSYPKNHKGRYVIYVKAGVYDEYITVDKKKPNILIYGDGPTK  322

Query  1318  TIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIF  1497
             TIITG KN     + T +TATF+ + + F+A+ + F NTAG  GHQAVA R Q D SA F
Sbjct  323   TIITGSKNMKD-GVKTMRTATFATVAEDFIAKSMAFENTAGARGHQAVALRVQGDRSAFF  381

Query  1498  DCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITA  1677
             DC+I GYQDTLY H +RQFYRNC ISGT+DFIFG GT LIQ+S +I RKP  +Q N + A
Sbjct  382   DCAIHGYQDTLYAHAHRQFYRNCEISGTVDFIFGYGTTLIQSSKLIVRKPDPNQQNIVVA  441

Query  1678  DGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPL  1857
             DG +      GVVLQNC I+PE AL P + K ++Y  RPWKAYS  ++ME+ IGD + P 
Sbjct  442   DGTDQKNMPTGVVLQNCEIIPEAALVPDKMKFRSYLARPWKAYSRAILMENTIGDFIQPD  501

Query  1858  GWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSW  2037
             G+  W+G  +  TC + EY N+G GA+T RR +  +   VL    A  +TA  WL AN+W
Sbjct  502   GFLPWNGNLYLDTCFFAEYANTGMGADTQRRVKWSRG--VLNKADATKYTADQWLQANTW  559

Query  2038  LPATGVPFAIGYTK  2079
             LPATG+PF +G TK
Sbjct  560   LPATGIPFDLGLTK  573



>ref|XP_003521616.1| PREDICTED: pectinesterase 4-like [Glycine max]
Length=568

 Score =   472 bits (1215),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 247/555 (45%), Positives = 329/555 (59%), Gaps = 28/555 (5%)
 Frame = +1

Query  451   KGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKS  630
             KG+        K V   CQ  + K +C  ++S V    SA  K +I  A+KAT++ V ++
Sbjct  29    KGEDPAVESHQKYVGVICQNTDEKKLCHDTLSSVKGMDSADPKAYIATAVKATMDSVTRA  88

Query  631   HQLVVNTKIE-QSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLN  807
               +      E   +D    MA++DCK++LQ AI+ LQ S  +V +  +  + ++     N
Sbjct  89    FNMSDRLTTEYGGSDNGTKMALDDCKDLLQSAIESLQLSTDMVHNNNVQAVHNQQADFKN  148

Query  808   WMSAVYAYQTTCTEQI------ESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFN  969
             W+SAV +YQ  CTE        E ++ +      + N  +LT   ++I++ +S +L+ F 
Sbjct  149   WLSAVISYQQACTEGFDDAKDGEKKIKEQLQTQTLDNVQKLTGITLDIVSSLSHILEQFG  208

Query  970   ITTTTDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVA  1149
             +                 N    SRRLL  D FP WF   DRKLLA   R  ++PNVVVA
Sbjct  209   L---------------KFNLKPASRRLLSEDGFPTWFSAGDRKLLARGWRARIKPNVVVA  253

Query  1150  KDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIIT  1329
             KDGSGQF T+  A+ SYP  ++ +Y+IYVKAGVYDE + V K   N+ MYGDG  KTIIT
Sbjct  254   KDGSGQFNTVAQAIASYPKNNQGRYIIYVKAGVYDEYITVPKTAVNILMYGDGPAKTIIT  313

Query  1330  GKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSI  1509
             G+KNY    + T +TATF+   +GF+A+ +TF+NTAG EGHQAVA+R+Q D SA+  C I
Sbjct  314   GRKNYVE-GVKTMQTATFANTAEGFIAKAMTFQNTAGAEGHQAVAFRNQGDRSALVGCHI  372

Query  1510  EGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKE  1689
              GYQDTLY  T RQFYRNCVISGT+DFIFG    +IQ+S+II RKPL +QFNTITADG  
Sbjct  373   LGYQDTLYVQTNRQFYRNCVISGTVDFIFGTSPTVIQHSVIIVRKPLDNQFNTITADGTS  432

Query  1690  LAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKI  1869
             +     G+V+Q C I+PE  L P RF+VK+Y GRPWK +S T+VMES +GD L P GW  
Sbjct  433   MKNMDTGIVIQGCNIIPEAELFPTRFQVKSYLGRPWKQFSRTIVMESTVGDFLHPEGWCP  492

Query  1870  WDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANS-----  2034
             W GE+FE T  Y EY N GPGAN   R +      ++    A  FT   +L A S     
Sbjct  493   WAGEHFEDTLYYAEYNNDGPGANVNGRIKWKGYRGLISQQEAAQFTPAQFLQAGSNGGTD  552

Query  2035  WLPATGVPFAIGYTK  2079
             WL A  VP A+ + K
Sbjct  553   WLKALHVPHALNFMK  567



>gb|KHN14164.1| Putative pectinesterase/pectinesterase inhibitor 28 [Glycine 
soja]
Length=568

 Score =   472 bits (1214),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 247/555 (45%), Positives = 329/555 (59%), Gaps = 28/555 (5%)
 Frame = +1

Query  451   KGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKS  630
             KG+        K V   CQ  + K +C  ++S V    SA  K +I  A+KAT++ V ++
Sbjct  29    KGEDPAVESHQKYVGVICQNTDEKKLCHDTLSSVKGMDSADPKAYIATAVKATMDSVTRA  88

Query  631   HQLVVNTKIE-QSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLN  807
               +      E   +D    MA++DCK++LQ AI+ LQ S  +V +  +  + ++     N
Sbjct  89    FNMSDRLTTEYGGSDNGTKMALDDCKDLLQSAIESLQLSTDMVHNNNVQAVHNQQADFKN  148

Query  808   WMSAVYAYQTTCTEQI------ESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFN  969
             W+SAV +YQ  CTE        E ++ +      + N  +LT   ++I++ +S +L+ F 
Sbjct  149   WLSAVISYQQACTEGFDDAKDGEKKIKEQLQTQTLDNVQKLTGITLDIVSSLSHILEQFG  208

Query  970   ITTTTDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVA  1149
             +                 N    SRRLL  D FP WF   DRKLLA   R  ++PNVVVA
Sbjct  209   L---------------KFNLKPASRRLLSEDGFPTWFSAGDRKLLARGWRARIKPNVVVA  253

Query  1150  KDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIIT  1329
             KDGSGQF T+  A+ SYP  ++ +Y+IYVKAGVYDE + V K   N+ MYGDG  KTIIT
Sbjct  254   KDGSGQFNTVAQAIASYPKNNQGRYIIYVKAGVYDEYITVPKTAVNILMYGDGPAKTIIT  313

Query  1330  GKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSI  1509
             G+KNY    + T +TATF+   +GF+A+ +TF+NTAG EGHQAVA+R+Q D SA+  C I
Sbjct  314   GRKNYVE-GVKTMQTATFANTAEGFIAKAMTFQNTAGAEGHQAVAFRNQGDRSALVGCHI  372

Query  1510  EGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKE  1689
              GYQDTLY  T RQFYRNCVISGT+DFIFG    +IQ+S+II RKPL +QFNTITADG  
Sbjct  373   LGYQDTLYVQTNRQFYRNCVISGTVDFIFGTSPTVIQHSVIIVRKPLDNQFNTITADGTS  432

Query  1690  LAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKI  1869
             +     G+V+Q C I+PE  L P RF+VK+Y GRPWK +S T+VMES +GD L P GW  
Sbjct  433   MKNMDTGIVIQGCNIIPEAELFPTRFQVKSYLGRPWKQFSRTIVMESTVGDFLHPEGWCP  492

Query  1870  WDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANS-----  2034
             W GE+FE T  Y EY N GPGAN   R +      ++    A  FT   +L A S     
Sbjct  493   WAGEHFEDTLYYAEYNNDGPGANVNGRIKWKGYRGLISQQEAAQFTPAQFLQAGSNGGTD  552

Query  2035  WLPATGVPFAIGYTK  2079
             WL A  VP A+ + K
Sbjct  553   WLKALHVPHALNFLK  567



>ref|XP_003591317.1| Pectinesterase [Medicago truncatula]
 gb|AES61568.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=566

 Score =   470 bits (1210),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 254/565 (45%), Positives = 348/565 (62%), Gaps = 50/565 (9%)
 Frame = +1

Query  436   DASSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLE  615
             DA++G    G  T   K+VT  CQ ++    CA ++  V   +++   D+I A +K ++E
Sbjct  34    DANNG----GELTSHTKAVTAVCQNSDDHKFCADTLGSV---NTSDPNDYIKAVVKTSIE  86

Query  616   EVHKSHQL-----VVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGD-TELHT  777
              V K+  +     V N K  QST     MA++DCK++L+ AID+LQAS  +  D + +H 
Sbjct  87    SVIKAFNMTDKLAVENEKNNQST----KMALDDCKDLLEFAIDELQASSILAADNSSVHN  142

Query  778   LKHRADQLLNWMSAVYAYQTTCTE--------QIESRLYKSAIEDGMINATQLTNNAINI  933
             +  RA  L NW+ AV+AYQ +C +        Q++S+L   +++    +  +LT  A+++
Sbjct  143   VNDRAADLKNWLGAVFAYQQSCLDGFDTDGEKQVQSQLQTGSLD----HVGKLTALALDV  198

Query  934   IAEMSKLLKAFNITTTTDLLHKAADKnnnnnnnTTSRRLLQTDH--FPEWFPIADRKLLA  1107
             +  ++K+L A ++    DL  K            +SRRL + D    PEW   ADRKLLA
Sbjct  199   VTAITKVLAALDL----DLNVKP-----------SSRRLFEVDEDGNPEWMSGADRKLLA  243

Query  1108  AQRRG-NLRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMK  1284
                 G ++ PN VVAKDGSG+FKT+  A+ SYP  H+ +YVIYVKAGVYDE +++ K  K
Sbjct  244   DMSTGMSVTPNAVVAKDGSGKFKTVLDAINSYPKNHQGRYVIYVKAGVYDEYIQIDKTKK  303

Query  1285  NVFMYGDGAGKTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVA  1464
             N+ +YGDG  KTIITGKKN+    + T +TATFS + +GF+A+ + F NTAG   HQAVA
Sbjct  304   NILIYGDGPTKTIITGKKNFVD-GVKTIQTATFSTVAEGFIAKAMAFENTAGANKHQAVA  362

Query  1465  YRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARK  1644
              R Q D SA FDC+I GYQDTLY H +RQFYRNC ISGT+DFIFG  + +IQNS I+ RK
Sbjct  363   LRVQGDKSAFFDCAIRGYQDTLYAHAHRQFYRNCEISGTVDFIFGYASTVIQNSKIVVRK  422

Query  1645  PLVHQFNTITADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVM  1824
             P  +Q N I ADG        GVVLQNC I+PE AL P R KV+++  RPWKAYS  + M
Sbjct  423   PEANQQNIIVADGTVQKNMPTGVVLQNCEIMPEPALQPDRLKVRSFLARPWKAYSRAIFM  482

Query  1825  ESQIGDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHF  2004
             E+ IGDL+ P G+  W G  F  TC + EY N+GPG+N   R +  K   VL    A  +
Sbjct  483   ENTIGDLIQPDGFLPWAGTQFLDTCFFAEYANTGPGSNVQARVKWGKG--VLSKADATKY  540

Query  2005  TAGLWLDANSWLPATGVPFAIGYTK  2079
             TA  W++   WLPATG+PF +G+TK
Sbjct  541   TAAQWIEGGVWLPATGIPFDLGFTK  565



>ref|XP_004494467.1| PREDICTED: pectinesterase 4-like [Cicer arietinum]
Length=575

 Score =   469 bits (1206),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 253/561 (45%), Positives = 342/561 (61%), Gaps = 36/561 (6%)
 Frame = +1

Query  451   KGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKS  630
             KG+        +S+   C+ AE + +C +++S V    +A  K +I AA+KAT + V K+
Sbjct  29    KGEDPEIQTQQRSLRVICENAEDQKLCHETLSSVRGLDAADPKAYIAAAVKATTDSVIKA  88

Query  631   HQLVVNTKIE-QSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLN  807
               +      E  + D    MA++DCK++L+ A+D L+ S ++V D  + +L++++  + N
Sbjct  89    FNMSDRLTTEYGNKDSGVKMALDDCKDLLEFALDSLELSNNLVRDNNIQSLQYQSPDMRN  148

Query  808   WMSAVYAYQTTCTE------QIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFN  969
             W+SAV +YQ +C E      + E ++ +     G+    ++T  A++I++ +SK+L+ FN
Sbjct  149   WLSAVISYQQSCMEGFNSENEGEKKIKEQLQVQGLDRVQKITGVALDIVSGLSKILEQFN  208

Query  970   ITTTTDLLHKAADKnnnnnnnTTSRRLLQTD----HFPEWFPIADRKLLAAQR----RGN  1125
             +    DL                SRRLL  D     +P WF  +DRKLL   +    R  
Sbjct  209   LKF--DL-------------KPASRRLLAEDTDEEGYPTWFSASDRKLLGQLQGKGWRSR  253

Query  1126  LRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGD  1305
             + PNVVVAKDGSGQFKTI  A+ SYP  +K +Y+IYVKAGVYDE + V K+  N+ MYGD
Sbjct  254   VTPNVVVAKDGSGQFKTIKDAIASYPKGNKGRYIIYVKAGVYDEYITVPKEAVNILMYGD  313

Query  1306  GAGKTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDM  1485
             G  KTI+TG KN+A+  + T +TATF+    GF+ + +TF NTAGP+GHQAVA R+Q D 
Sbjct  314   GPQKTIVTGSKNFAN-GVKTMQTATFANTASGFIGKAMTFENTAGPDGHQAVALRNQGDT  372

Query  1486  SAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFN  1665
             SA   C I GYQDTLY  T RQFYRNCVISGTIDFIFG    LIQ+S+II RKP  +QFN
Sbjct  373   SAFVGCHILGYQDTLYVQTNRQFYRNCVISGTIDFIFGTSATLIQHSVIIVRKPNDNQFN  432

Query  1666  TITADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDL  1845
             T+TADG        G+V+Q+C IVPE AL P+RF++K+Y GRPWKAYS TVVMES IGD 
Sbjct  433   TVTADGTAEKNMATGIVIQDCEIVPEQALYPVRFQIKSYLGRPWKAYSKTVVMESTIGDF  492

Query  1846  LSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLD  2025
             L P GW  W G NFE T  Y EY N+GPGAN   R +      V+    A  FTA  +L 
Sbjct  493   LHPDGWFPWTGSNFENTLYYAEYANTGPGANVQGRIKWKGYHGVISKAEATQFTAAEFLK  552

Query  2026  AN-----SWLPATGVPFAIGY  2073
             A       WL A  VP  +G+
Sbjct  553   AGPKSGTDWLKALHVPHYLGF  573



>ref|XP_007163236.1| hypothetical protein PHAVU_001G217400g [Phaseolus vulgaris]
 gb|ESW35230.1| hypothetical protein PHAVU_001G217400g [Phaseolus vulgaris]
Length=572

 Score =   466 bits (1198),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 253/557 (45%), Positives = 335/557 (60%), Gaps = 33/557 (6%)
 Frame = +1

Query  457   DHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQ  636
             ++G+ T   KSV   CQ  + + +C  ++S V    +A  K +I  A+KAT++ V K+  
Sbjct  32    ENGIQT-HQKSVEIICQNTDDQKLCHDTLSSVKGLDTADPKAYIATAVKATMDSVIKALN  90

Query  637   LVVNTKIEQSTDPYN-HMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWM  813
             +      E  ++     MA++DCK++LQ AI  LQ S  +V +  +  +  +     NW+
Sbjct  91    MSDKLTTEHGSNANGTKMALDDCKDLLQSAIQSLQLSTDMVQNNNVQAVHDQTADFKNWL  150

Query  814   SAVYAYQTTCTEQIE-----SRLYKSAIEDGMINATQ-LTNNAINIIAEMSKLLKAFNIT  975
             SAV +YQ  C E  +      +  K  +  G ++  Q LT   ++I++ +S +L+ F + 
Sbjct  151   SAVISYQQACMEGFDDGNEGEKKIKEQLHTGSLDQVQKLTGITLDIVSSLSHILEKFGLK  210

Query  976   TTTDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAA-QRRG---NLRPNVV  1143
                 L  K A           SRRLL  D +P WF  +DRKLLA  +R+G   N+ PNVV
Sbjct  211   ----LNLKPA-----------SRRLLSKDGYPSWFSASDRKLLAQLERKGWRSNITPNVV  255

Query  1144  VAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTI  1323
             VA+DGSGQFKTI   L SYP   + +Y IYVKAGVYDE + V K   NV +YGDG  KTI
Sbjct  256   VAQDGSGQFKTIAEGLASYPSNFQGRYNIYVKAGVYDEYITVPKSAVNVLLYGDGPEKTI  315

Query  1324  ITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDC  1503
             +TG KN+    + T +TATF+   +GF+A+ +TF NTAGP+GHQAVA+R+Q DMSA+  C
Sbjct  316   VTGHKNFRD-GVKTMQTATFANTAQGFIAKAMTFENTAGPDGHQAVAFRNQGDMSAVIGC  374

Query  1504  SIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADG  1683
              I GYQDTLY  T RQFYRNCVISGTIDFIFG    +IQ+S+IIARKPL +QFNT+TADG
Sbjct  375   HILGYQDTLYVQTNRQFYRNCVISGTIDFIFGTSPTVIQHSVIIARKPLDNQFNTVTADG  434

Query  1684  KELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGW  1863
                     G+VLQ+C I+PE  L P+RF+ K+Y GRPWK YS TVVMES IGD L P GW
Sbjct  435   TSAKNMDTGIVLQDCEIIPEAELFPVRFQFKSYLGRPWKQYSRTVVMESNIGDFLHPEGW  494

Query  1864  KIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDAN----  2031
               W GENFE T  Y EY N+GPGA    R +      ++    A  FTAG +L A     
Sbjct  495   CPWIGENFEDTLYYAEYNNAGPGAAVNGRIKWKGYRGLISREEAAQFTAGQFLQAGPGSG  554

Query  2032  -SWLPATGVPFAIGYTK  2079
               WL A  VP  + + K
Sbjct  555   TDWLKALRVPHVLDFAK  571



>ref|XP_002519324.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF43188.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=570

 Score =   465 bits (1197),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 239/543 (44%), Positives = 336/543 (62%), Gaps = 22/543 (4%)
 Frame = +1

Query  457   DHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQ  636
             D+ + + +  +V  FC   ++K  C  S+  VA N SAT  DF+ AAI  T+E V  +  
Sbjct  41    DNKILSATSMAVAAFCNQTDHKHRCVDSVFSVARNQSATFNDFLKAAISYTIEHVKLAMD  100

Query  637   LVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMS  816
                 T  + + D    MA+EDC+E+LQ AI +LQ S+  V ++    +K R   L NW+S
Sbjct  101   TAA-TIGKDAKDSTQKMAVEDCQELLQFAIGELQDSLLTVKNSSFDAVKEREADLKNWLS  159

Query  817   AVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLH  996
             AV +Y+ TC + +        + DG++NAT+LT+NA+ I++ +S +  AF I +  +   
Sbjct  160   AVMSYKETCLDGLNDTNLHKPMSDGLVNATELTSNALAIVSAISDIGNAFRIPSNLN---  216

Query  997   KAADKnnnnnnnTTSRRLLQTDH----FPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSG  1164
                         + +RRL++ +     FP W P ADRKLL +    N++PN +VA+DGSG
Sbjct  217   -----------ASATRRLMEAEDDGFPFPTWMPNADRKLLGSATNANVKPNAIVAQDGSG  265

Query  1165  QFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNY  1344
             Q+KTI  AL +YP     +Y+I VKAGVYDE + + K   NVF+YGDG  KT +TG K  
Sbjct  266   QYKTIAAALAAYPKDLVGRYIINVKAGVYDEYITINKDQVNVFIYGDGPRKTTVTGDK-C  324

Query  1345  AHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQD  1524
                  +T KTA+FSA+G GF+A+ I F+NTAG +G QAVA R QSD +A+++C ++G+QD
Sbjct  325   NKKGFSTFKTASFSAVGDGFMAKSIGFQNTAGAKGGQAVALRIQSDRAALYNCRMDGHQD  384

Query  1525  TLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAK  1704
             TLY H +RQFYRNCVISGT+DFIFG  TA+IQNS+II R P   Q N +TA G+   +  
Sbjct  385   TLYQHAHRQFYRNCVISGTVDFIFGDATAVIQNSLIIIRTPDPGQRNAVTAHGRADKRES  444

Query  1705  GGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGEN  1884
              G+V+QNCRI+PE +L P+  +  +Y GRPWK Y+ TV+MES+IG ++ P GW  W G  
Sbjct  445   TGLVIQNCRILPEQSLFPVISEFPSYLGRPWKQYARTVIMESEIGSVIQPAGWLEWTGNL  504

Query  1885  FEKTCMYYEYKNSGPGANTWRRNRAFKKFDVL-GPIRARHFTAGLWLDANSWLPATGVPF  2061
             +  T  Y EY N GPGANT  R + +K + VL        FTAG +L  + WL ATG P+
Sbjct  505   YLDTLFYAEYGNRGPGANTNLRVK-WKGYHVLTDKSEVTQFTAGPFLQGDQWLQATGFPY  563

Query  2062  AIG  2070
              +G
Sbjct  564   LLG  566



>ref|XP_004495868.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=571

 Score =   463 bits (1192),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 248/554 (45%), Positives = 335/554 (60%), Gaps = 29/554 (5%)
 Frame = +1

Query  442   SSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEV  621
             S G  ++   +   K+VT  CQ ++    C  ++S V   +++  KD+I + +K T++ V
Sbjct  39    SDGTNNNNDLSAHNKAVTAVCQNSDDHKFCVDTLSAV---NTSDPKDYIKSVVKNTMDNV  95

Query  622   HKSHQLVVNTKIEQSTD-PYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQ  798
              K+  +     +E S +     MA++DCK++L+ AID+LQAS  +V D ++H +  RA +
Sbjct  96    IKAFNMSDRLTVENSKNISSTKMALDDCKDLLEFAIDELQASNIMVNDNDIHNVNDRASE  155

Query  799   LLNWMSAVYAYQTTCTEQI----ESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAF  966
             L NW+ AV AYQ +C +      E ++ +    D +    +LT  A+++++E+SK+L AF
Sbjct  156   LKNWLGAVIAYQQSCLDGFDTDGEKKIQEQLQTDSLDYVGKLTALALDVVSEISKVLIAF  215

Query  967   NITTTTDLLHKAADKnnnnnnnTTSRRLLQTDH--FPEWFPIADRKLLAAQRRGNL-RPN  1137
             N+    DL    A           SRRLL+ DH  +P W   ADR+LLA    G   +PN
Sbjct  216   NL----DLKVNPA-----------SRRLLEVDHDGYPTWMTAADRRLLADMDTGRTPKPN  260

Query  1138  VVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGK  1317
             VVVAKDGSGQF T+  A+ SYP  H+ +YVIYVKAG YDE + V KK K + M+GDG  K
Sbjct  261   VVVAKDGSGQFNTVLDAINSYPKDHEGRYVIYVKAGTYDEYITVDKKKKRILMFGDGPTK  320

Query  1318  TIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIF  1497
             TIITG KNY      T +TATFS + + FVA+ + F NTAG   HQAVA R Q D S  F
Sbjct  321   TIITGSKNYVD-GWKTMRTATFSTVAEDFVAKSMAFENTAGASKHQAVALRVQGDRSVFF  379

Query  1498  DCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITA  1677
             DC+I GYQDTLY H +RQFYRNC ISGTIDFIFG  T LIQ+S I+ RKP  +Q   + A
Sbjct  380   DCAIRGYQDTLYAHAHRQFYRNCEISGTIDFIFGYSTTLIQSSKILVRKPGPNQQTIVVA  439

Query  1678  DGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPL  1857
             DG +      GVV+QNC I+P+ +L   R  V++Y  RPWKAYS  + ME+ IGDL+ P 
Sbjct  440   DGTDQKNMPTGVVIQNCEIMPDASLEADRLTVRSYLARPWKAYSRAIFMENTIGDLIQPD  499

Query  1858  GWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSW  2037
             G+  W G  F  TC + EY N+G GAN+  R +      VL    A  +TA  WL    W
Sbjct  500   GYLPWSGTQFLDTCFFAEYANTGLGANSSARVKW--GHGVLTKEEAIKYTADQWLQGGVW  557

Query  2038  LPATGVPFAIGYTK  2079
             LPATGVPF +G+TK
Sbjct  558   LPATGVPFELGFTK  571



>ref|XP_007163235.1| hypothetical protein PHAVU_001G217300g [Phaseolus vulgaris]
 gb|ESW35229.1| hypothetical protein PHAVU_001G217300g [Phaseolus vulgaris]
Length=572

 Score =   462 bits (1190),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 252/555 (45%), Positives = 333/555 (60%), Gaps = 33/555 (6%)
 Frame = +1

Query  463   GVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLV  642
             G+ T + KSV   CQ  + + +C  ++S V    +A  K +I  A+KAT++ V K+  + 
Sbjct  34    GIQT-NQKSVEIICQNTDDQKLCHDTLSSVKGLDTADPKAYIATAVKATMDSVIKAFNMS  92

Query  643   VNTKIEQSTDPYN-HMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSA  819
                  E   +     MA++DCK++LQ AI  LQ S  +V +  +  +  +     NW+SA
Sbjct  93    DRLTTEHGDNASGTKMALDDCKDLLQSAIQSLQLSTDMVQNNNVQAVHDQTADFKNWLSA  152

Query  820   VYAYQTTCTEQIE-----SRLYKSAIEDGMINATQ-LTNNAINIIAEMSKLLKAFNITTT  981
             V +YQ  C E  +      +  K  +  G ++  Q LT   ++I++ +S +L+ F +   
Sbjct  153   VISYQQACMEGFDDGNEGEKKIKEQLHTGSLDQVQKLTAITLDIVSSLSHILEKFGLK--  210

Query  982   TDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAA-QRRG---NLRPNVVVA  1149
               L  K A           SRRLL  D +P WF  +DRKLLA  +R+G   ++ PNVVVA
Sbjct  211   --LNLKPA-----------SRRLLSKDGYPSWFSASDRKLLAQLERKGWRSSITPNVVVA  257

Query  1150  KDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIIT  1329
             +DGSGQFKTI   L SYP   + +Y IYVKAGVYDE + V K   NV +YGDG  KTI+T
Sbjct  258   QDGSGQFKTIAEGLASYPSNFQGRYNIYVKAGVYDEYITVPKSAVNVLLYGDGPEKTIVT  317

Query  1330  GKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSI  1509
             G KN+    + T +TATF+   +GF+A+ +TF NTAGP+GHQAVA+R+Q DMSA+  C I
Sbjct  318   GHKNFRD-GVKTMQTATFANTAQGFIAKAMTFENTAGPDGHQAVAFRNQGDMSAVIGCHI  376

Query  1510  EGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKE  1689
              GYQDTLY  T RQFYRNCVISGTIDFIFG    +IQ+S+IIARKPL +QFNT+TADG  
Sbjct  377   LGYQDTLYVQTNRQFYRNCVISGTIDFIFGTSPTVIQHSVIIARKPLDNQFNTVTADGTS  436

Query  1690  LAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKI  1869
                   G+VLQ+C I+PE  L P+RF+ K+Y GRPWK YS TVVMES IGD L P GW  
Sbjct  437   AKNMDTGIVLQDCEIIPEAELFPVRFQFKSYLGRPWKQYSRTVVMESNIGDFLHPEGWCP  496

Query  1870  WDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDAN-----S  2034
             W GENFE T  Y EY N+GPGA    R +      ++    A  FTAG +L A       
Sbjct  497   WIGENFEDTLYYAEYNNAGPGAAVNGRIKWKGYRGLISREEAAQFTAGQFLQAGLGSGTD  556

Query  2035  WLPATGVPFAIGYTK  2079
             WL A  VP  + + K
Sbjct  557   WLKALRVPHVLDFAK  571



>ref|XP_004495869.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=576

 Score =   462 bits (1190),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 248/554 (45%), Positives = 337/554 (61%), Gaps = 41/554 (7%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQ  663
             K++ + CQ  E   +C  +++ V   +S+    +  AA+ A+ + V  +  +     IE 
Sbjct  41    KNLKSICQVTENPQLCHDTLNSVKPANSSDPTAYFAAAVAASAKSVIGALNMSDRLTIEH  100

Query  664   -STDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTT  840
                +P  HMA++DCK++++ A+D L+AS ++V D  +  +  +     NW+SAV +YQ +
Sbjct  101   GDKNPGVHMALDDCKDLMEFALDSLEASANLVRDNHIQAIHDQIPDFRNWLSAVISYQQS  160

Query  841   CTEQIES---------RLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLL  993
             CTE  +S          L K+   D M    +LT   ++I+  M+ +L+ F++    DL 
Sbjct  161   CTEGFDSDTKGEDQVKELLKTESLDQM---EKLTGMTLDIVTSMTHILQTFDLKM--DL-  214

Query  994   HKAADKnnnnnnnTTSRRLLQTDHF-----PEWFPIADRKLLAAQRRG-NLRPNVVVAKD  1155
                         N  SRRLL  +       P WF I+DRKLL+    G N  PNVVVAKD
Sbjct  215   ------------NPASRRLLDVNELDNEGLPTWFSISDRKLLSKTNNGGNPPPNVVVAKD  262

Query  1156  GSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGK  1335
             GSG+FKT+  A+ SYP   K +Y+IYVKAGVYDE + + KK  N+ MYGDG  KTI+TG 
Sbjct  263   GSGKFKTVKEAIDSYPKDFKERYIIYVKAGVYDEYITIPKKSINILMYGDGPTKTIVTGH  322

Query  1336  KNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEG  1515
             KN+    + T +TATF+ +  GF+A+ + F NTAGPE HQAVA+R+Q DM+A FDC++ G
Sbjct  323   KNFVD-GVKTMQTATFANVANGFIAKSMAFENTAGPEKHQAVAFRNQGDMTAFFDCAMHG  381

Query  1516  YQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELA  1695
             YQDTLY  T RQFYRNC ISGT+DFIFG    LIQNS I+ RKP  +QFNT+TADG +  
Sbjct  382   YQDTLYVQTNRQFYRNCEISGTVDFIFGASPTLIQNSKIVIRKPGPNQFNTVTADGTKQR  441

Query  1696  KAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWD  1875
                 G+VLQNC IV E+AL P+RF+ K+Y GRPWK YS TVVMES IGDL+ P GW +WD
Sbjct  442   SMATGIVLQNCEIVAESALQPVRFEFKSYLGRPWKEYSKTVVMESNIGDLIQPEGWSVWD  501

Query  1876  GENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWL------DANSW  2037
             G  F  T  Y EY N+GPGA+  +R         +    A  FTAG +L       A+ W
Sbjct  502   GTQFLDTLYYAEYANTGPGADVSKRVNWKGYHPNINSNEAAQFTAGQFLRAGPTGKADDW  561

Query  2038  LPATGVPFAIGYTK  2079
             L ATG+P+ IG+TK
Sbjct  562   LKATGIPYTIGFTK  575



>gb|KDP43631.1| hypothetical protein JCGZ_16918 [Jatropha curcas]
Length=561

 Score =   461 bits (1186),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 251/551 (46%), Positives = 334/551 (61%), Gaps = 31/551 (6%)
 Frame = +1

Query  448   GKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHK  627
             G  D    + S K+V   CQ  +YK  C +S+S+V  N++   K+F+ AAI AT E   K
Sbjct  29    GHEDGAQISSSTKNVAQICQPTDYKKACEQSLSNV--NNTQDPKEFLKAAILATEEAAKK  86

Query  628   SHQLVVNTKIE-QSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLL  804
             S  L  +  ++  S+D    M++EDCKE+L DA+ +LQAS S VG+ + HT K R  +L 
Sbjct  87    SFNLSSDLLVKASSSDNDTRMSLEDCKELLDDAVQELQASFSEVGENQQHTTKRRVAELQ  146

Query  805   NWMSAVYAYQTTCTEQI--ESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITT  978
             NW+SAV +YQ TC +Q    +  YK+ +E+GM++A QLT+NA+ I+   S +L    +  
Sbjct  147   NWLSAVISYQQTCLDQFGDPNSQYKTEMEEGMVDAGQLTSNALAIVDAFSDILSTMGL--  204

Query  979   TTDLLHKAADKnnnnnnnTTSRRLLQTDH--FPEWFPIADRKLLAAQRRGNLRPNVVVAK  1152
                       K N   +N TSR+LL  D   +P W   + R+LLA      L+PNV VA 
Sbjct  205   ----------KVNFGGSNDTSRKLLSVDEDGYPSWLSASRRRLLAVDL-ATLKPNVTVAA  253

Query  1153  DGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITG  1332
             DGSG  KT+T  +   PPK+   + IYVKAG Y E   V KKM NVFMYGDG  KTIITG
Sbjct  254   DGSGDVKTVTEGIAKIPPKNVDPFYIYVKAGTYKEYPTVEKKMNNVFMYGDGPLKTIITG  313

Query  1333  ----KKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFD  1500
                 K  Y  M+     +ATF+ALG+GF A+ I F NTAGPEGHQAVA R Q+DM+A FD
Sbjct  314   DHSNKTGYKTMR-----SATFAALGEGFTAKSIAFENTAGPEGHQAVALRVQADMAAFFD  368

Query  1501  CSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITAD  1680
             C ++GYQDTLY  T+RQFY  C +SGTIDFIFG  + +IQ S I+ RKP+ +Q NT+TA 
Sbjct  369   CKMDGYQDTLYIQTHRQFYSKCSVSGTIDFIFGDASCIIQQSDIVVRKPMPNQLNTVTAH  428

Query  1681  GKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLG  1860
             G+       G+V Q+CRI+ E  L P    VK+Y GRPW+AYS TVVMES+I +++ P G
Sbjct  429   GRADKHETTGLVFQDCRIIAEDKLLPEATVVKSYMGRPWRAYSRTVVMESEITNVIQPEG  488

Query  1861  WKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIR-ARHFTAGLWLDANSW  2037
             W  W G+ +  T  Y EY N G GANT +R   +K F ++   + A+ FT   +L    W
Sbjct  489   WLPWTGDQYLDTLEYLEYANKGDGANTDKRVN-WKGFRIITDKKEAQQFTVEPFLQGTDW  547

Query  2038  LPATGVPFAIG  2070
             L   G P+  G
Sbjct  548   LNKIGEPYIAG  558



>ref|XP_003519736.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=573

 Score =   459 bits (1182),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 236/548 (43%), Positives = 333/548 (61%), Gaps = 32/548 (6%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQ  663
             KSV   C+  +   +C  ++S V ++  +  K +I A ++AT + V ++  +    K+E 
Sbjct  42    KSVKAMCEGTDDPKLCHDTLSTVKSSSVSDPKAYIAAGVEATAKSVIQALNMSDRLKVEH  101

Query  664   -STDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTT  840
                DP   MA++DCK++++ A+D +++S ++V +  +  L  ++  L NW+SA+ +YQ +
Sbjct  102   GDKDPGIKMALDDCKDLIEFALDSIESSANLVNEHNIQALHDQSPDLRNWLSAIISYQQS  161

Query  841   CTEQI------ESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKA  1002
             C +        E  + K    D +    +LT   ++I+  +SK+L++F++    +     
Sbjct  162   CMDGFNNGTNGEEEVKKQLHTDSLDQMGKLTGIVLDIVTNLSKILQSFDLKLDLN-----  216

Query  1003  ADKnnnnnnnTTSRRLLQTDH--FPEWFPIADRKLLAAQRRGNLRP-NVVVAKDGSGQFK  1173
                         SRRLL+ D   FP WF  ADR+LL    +G+  P N VVA DGSGQFK
Sbjct  217   ----------PASRRLLEVDAEGFPTWFSAADRRLLGKMNQGDAPPPNAVVALDGSGQFK  266

Query  1174  TITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHM  1353
             ++  A+ SYP   K +++IYVKAGVY+E + + KK +N+ +YGDG  KTIITG KN+   
Sbjct  267   SVKQAIDSYPKNFKGRFIIYVKAGVYNEYILIPKKSENIMIYGDGPTKTIITGNKNFID-  325

Query  1354  KITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLY  1533
              + T +TATF+    GF+A+ I F NTAG + HQAVA+R+Q DMSA+FDC++ GYQDTLY
Sbjct  326   GVKTMQTATFANTAPGFIAKSIAFENTAGAKKHQAVAFRNQGDMSAMFDCAMHGYQDTLY  385

Query  1534  YHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGV  1713
              H  RQFYRNC ISGTIDFIFG    LIQNS +I RKP  +QFNT+TADG +      G+
Sbjct  386   VHANRQFYRNCEISGTIDFIFGASATLIQNSRVIVRKPEANQFNTVTADGTKQKNMATGI  445

Query  1714  VLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEK  1893
             VLQNC I+PE AL P RF+ K+Y GRPWK ++ TVVMES IGD + P GW  WDG  +  
Sbjct  446   VLQNCEILPEQALFPSRFQTKSYLGRPWKEFARTVVMESNIGDFIQPEGWTPWDGNLYLD  505

Query  1894  TCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWL------DANSWLPATGV  2055
             T  Y EY N GPG+N   R +       +    A  FTA  +L      DA+ WL ATGV
Sbjct  506   TLYYAEYANVGPGSNVQGRVKWRGYHPNINKNEAAQFTAAQFLRGGPAGDADGWLKATGV  565

Query  2056  PFAIGYTK  2079
             P+ IG+TK
Sbjct  566   PYTIGFTK  573



>gb|KHN00235.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=573

 Score =   459 bits (1180),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 236/548 (43%), Positives = 333/548 (61%), Gaps = 32/548 (6%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQ  663
             KSV   C+  +   +C  ++S V ++  +  K +I A ++AT + V ++  +    K+E 
Sbjct  42    KSVKAMCEGTDDPKLCHDTLSTVKSSSVSDPKAYIAAGVEATAKSVIQALNMSDRLKVEH  101

Query  664   -STDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTT  840
                DP   MA++DCK++++ A+D +++S ++V +  +  L  ++  L NW+SA+ +YQ +
Sbjct  102   GDKDPGIKMALDDCKDLIEFALDSIESSANLVNEHNIQALHDQSPDLRNWLSAIISYQQS  161

Query  841   CTEQI------ESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKA  1002
             C +        E  + K    D +    +LT   ++I+  +SK+L++F++    +     
Sbjct  162   CMDGFNNGTNGEEEVKKQLHTDSLDQMGKLTGIVLDIVTNLSKILQSFDLKLDLN-----  216

Query  1003  ADKnnnnnnnTTSRRLLQTDH--FPEWFPIADRKLLAAQRRGNLRP-NVVVAKDGSGQFK  1173
                         SRRLL+ D   FP WF  ADR+LL    +G+  P N VVA DGSGQFK
Sbjct  217   ----------PASRRLLEVDAEGFPTWFSAADRRLLDKMNQGDAPPPNAVVALDGSGQFK  266

Query  1174  TITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHM  1353
             ++  A+ SYP   K +++IYVKAGVY+E + + KK +N+ +YGDG  KTIITG KN+   
Sbjct  267   SVKQAIDSYPKNFKGRFIIYVKAGVYNEYILIPKKSENIMIYGDGPTKTIITGNKNFID-  325

Query  1354  KITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLY  1533
              + T +TATF+    GF+A+ I F NTAG + HQAVA+R+Q DMSA+FDC++ GYQDTLY
Sbjct  326   GVKTMQTATFANTAPGFIAKSIAFENTAGAKKHQAVAFRNQGDMSAMFDCAMHGYQDTLY  385

Query  1534  YHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGV  1713
              H  RQFYRNC ISGTIDFIFG    LIQNS +I RKP  +QFNT+TADG +      G+
Sbjct  386   VHANRQFYRNCEISGTIDFIFGASATLIQNSRVIVRKPEANQFNTVTADGTKQKNMATGI  445

Query  1714  VLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEK  1893
             VLQNC I+PE AL P RF+ K+Y GRPWK ++ TVVMES IGD + P GW  WDG  +  
Sbjct  446   VLQNCEILPEQALFPSRFQTKSYLGRPWKEFARTVVMESNIGDFIQPEGWTPWDGNLYLD  505

Query  1894  TCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWL------DANSWLPATGV  2055
             T  Y EY N GPG+N   R +       +    A  FTA  +L      DA+ WL ATGV
Sbjct  506   TLYYAEYANVGPGSNVQGRVKWRGYHPNINKNEAAQFTAAQFLRGGPAGDADGWLKATGV  565

Query  2056  PFAIGYTK  2079
             P+ IG+TK
Sbjct  566   PYTIGFTK  573



>ref|XP_009407600.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=567

 Score =   456 bits (1173),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 238/544 (44%), Positives = 328/544 (60%), Gaps = 32/544 (6%)
 Frame = +1

Query  478   SMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKI  657
             S KSVT  C   +Y DVC +++S  A N SA+ K+ I A+  A ++E+  +  L  N  +
Sbjct  42    SSKSVTAICASTDYTDVCERTLSS-AINGSASPKEIIQASFMAAIKEIEAASHLSKNVSL  100

Query  658   EQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQT  837
               +TD  N    + C+ + +DA ++LQA+ S   D  L  L  R D +  W+SAV +YQ 
Sbjct  101   S-ATDSMNKDGFDICRRLFEDANEELQAAFSETHD--LDGLARRTDDIKCWLSAVISYQQ  157

Query  838   TCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnn  1017
             TC + I      S ++DG++ A+Q+T+NAI I+  +S L K F +               
Sbjct  158   TCLDSITQPDLHSTMKDGLVTASQVTSNAIAIVDGLSSLFKNFQVPINV-----------  206

Query  1018  nnnnnTTSRRLLQTDH----FPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITG  1185
                 N  SRRLL        +P WF   DRKLLAA  RG L+PN+VVA+DGSG +KTI  
Sbjct  207   ---TNIASRRLLSQGSDAKGYPTWFSAHDRKLLAASARGELKPNMVVAQDGSGDYKTINA  263

Query  1186  ALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITT  1365
             AL + P K+  +YVIYVKAG+Y E V V K   NVFMYGDG  KT++TG KN     + T
Sbjct  264   ALNAMPKKYTGRYVIYVKAGIYKENVLVTKDKVNVFMYGDGPRKTVVTGSKNNVD-GVQT  322

Query  1366  SKTATF--------SALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQ  1521
               TATF        +A G+GF+ + + F NTAGPE HQAVA R + DMSA F+C ++ +Q
Sbjct  323   MNTATFVLCNWHFPAAEGQGFIGKSMGFSNTAGPEKHQAVALRVKGDMSAFFNCRMDAFQ  382

Query  1522  DTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKA  1701
             DTLY   +RQFYRNCV+SGT+DFIFG  + ++QN +I+ R+P+ +Q NT+TA G+E  K 
Sbjct  383   DTLYVQAHRQFYRNCVVSGTVDFIFGDSSTILQNCLIVVRRPMDNQQNTVTAHGREEEKE  442

Query  1702  KGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGE  1881
             +  +V+QNCRIVP+  L P R K+ +Y GRPWKA S T++MES IGDL+ P GW  WDG+
Sbjct  443   ETALVIQNCRIVPDKRLFPDRLKIPSYLGRPWKARSRTIIMESTIGDLIKPEGWLPWDGD  502

Query  1882  NFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPF  2061
              F  T  Y EY N GPGA T  R   +  F V+    A+ +T    +  + W+  +G+P+
Sbjct  503   QFLNTLYYAEYGNRGPGAGTSGRVN-WPGFHVINRQTAQAYTVNSLIQGHRWIKYSGIPY  561

Query  2062  AIGY  2073
               G+
Sbjct  562   LGGF  565



>gb|KHN00313.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=574

 Score =   452 bits (1163),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 233/552 (42%), Positives = 336/552 (61%), Gaps = 40/552 (7%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQ  663
             KSV   C+  +   +C  ++  V + +S+  K +I A ++AT++ V ++  +    K+E 
Sbjct  42    KSVKAMCEGTDDPKLCHDTLITVNSTNSSDPKAYIAAGVEATVKSVIQALNMSDRLKVEH  101

Query  664   -STDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTT  840
                DP   MA++DCK++++ A+D +++S ++V +  +  L  ++    NW+SA+ +YQ +
Sbjct  102   GDKDPGIKMALDDCKDLIEFALDSIESSANLVNNHNIQALHDQSPDFRNWLSAIISYQQS  161

Query  841   CT----------EQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDL  990
             C           ++I+ +L+  +++       +LT   ++I+  +SK+L++F++    + 
Sbjct  162   CMDGFNNETNGEQEIKEQLHTGSLD----QMGKLTGIVLDIVTNLSKILQSFDLKLDLN-  216

Query  991   LHKAADKnnnnnnnTTSRRLLQTDH--FPEWFPIADRKLLAAQRRGNLRP-NVVVAKDGS  1161
                             SRRLL+ D   FP WF  ADR+LLA   +G   P N VVA DGS
Sbjct  217   --------------PASRRLLELDAEGFPTWFSAADRRLLAKMNQGGAPPPNAVVALDGS  262

Query  1162  GQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKN  1341
             GQFK++  A+ SYP   K +++IYVKAG+Y+E + + KK +N+ +YGDG  K+IITG KN
Sbjct  263   GQFKSVKQAIDSYPKNFKGRFIIYVKAGIYNEYITIPKKSENILIYGDGPTKSIITGNKN  322

Query  1342  YAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQ  1521
             +    + T +TATF+    GF+A+ I F NTAG + HQAVA+R+Q DMSA+FDC++ GYQ
Sbjct  323   FID-GVKTMQTATFANTAPGFIAKSIAFENTAGAKKHQAVAFRNQGDMSAMFDCAMHGYQ  381

Query  1522  DTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKA  1701
             DTLY    RQFYRNC ISGTIDFIFG    LIQNS II RKP  +QFNT+TADG +    
Sbjct  382   DTLYTQANRQFYRNCEISGTIDFIFGAAPTLIQNSRIIVRKPEANQFNTVTADGTKQKNM  441

Query  1702  KGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGE  1881
               G+VLQNC I+PE AL P RF+ K+Y GRPWK ++ TVVMES IGD + P GW  W G 
Sbjct  442   ATGIVLQNCEILPEQALFPTRFQTKSYLGRPWKDFARTVVMESNIGDFIQPEGWTPWSGN  501

Query  1882  NFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWL------DANSWLP  2043
              F  T  Y EY N GPG+N   R +       +    A  FTAG +L      +A+ WL 
Sbjct  502   LFLDTLYYAEYANVGPGSNVQGRVKWKGYHPNINKNEAEQFTAGQFLRGGPSGNADDWLK  561

Query  2044  ATGVPFAIGYTK  2079
             ATGVP+ IG+TK
Sbjct  562   ATGVPYTIGFTK  573



>ref|XP_010098738.1| Pectinesterase 3 [Morus notabilis]
 gb|EXB75641.1| Pectinesterase 3 [Morus notabilis]
Length=612

 Score =   453 bits (1165),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 260/592 (44%), Positives = 345/592 (58%), Gaps = 55/592 (9%)
 Frame = +1

Query  442   SSGKGDHGVSTGSM---KSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATL  612
             S+G G +  + GS+    +   FC  + YK+ C +S+  ++N  S T KD I A I++ +
Sbjct  24    SNGHGGNENNHGSLLFSAAAQVFCGPSSYKEACIRSLGSISNKPSVTPKDLIHATIQSII  83

Query  613   EEVHKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRA  792
                H S  L ++  I  ++   + M +EDCK++LQ A+D+L +  SVV +T L ++  R 
Sbjct  84    --THVSGALHMSGSIAANSSSSHKMWMEDCKDLLQFAVDELHSCFSVVEETHLKSIHERQ  141

Query  793   DQLLNWMSAVYAYQTTCTEQI-ESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFN  969
              +LLNW+SAV +YQ TC + I +S L    +  G+ +A QL +N + II  MS +  AF 
Sbjct  142   AELLNWLSAVVSYQHTCLDGIFDSDLKNKMLSTGLDSANQLASNTLAIITSMSSIFSAFK  201

Query  970   I--------------TTTTDL-----------------LHKAADKnnnnnnnTTSRRLLQ  1056
             I                  DL                 L  +    ++     TS+    
Sbjct  202   IPFKIGSGGIGGHSGGLNLDLGYGFSSHFGLDGGLRNALSGSPATPSSEPLEETSKEETS  261

Query  1057  TD-----HFPEWFPIADRKLLAAQRRGN--LRPNVVVAKDGSGQFKTITGALKSYPP--K  1209
             T+      +P WF  +DRKL  +    N  L PN +VAKDGSG FKTI  AL +YP   K
Sbjct  262   TNAGTGYKYPPWFSSSDRKLFESDNDANSYLTPNAIVAKDGSGNFKTIGEALAAYPKDKK  321

Query  1210  HKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKTATFSA  1389
              K +YVIYVKAG+Y E + V K   NVFMYGDG  KTIITG KN+    ++T +TATFSA
Sbjct  322   GKGRYVIYVKAGIYREYLAVTKDQVNVFMYGDGPRKTIITGSKNFRD-GVSTFRTATFSA  380

Query  1390  LGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCV  1569
             +G+ FVA+ I F+N AGPEGHQAVA R QSDMSA + C I+GYQDTLY  T+RQFYRNC+
Sbjct  381   IGERFVAKSIGFQNRAGPEGHQAVALRVQSDMSAFYHCRIDGYQDTLYVQTHRQFYRNCI  440

Query  1570  ISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCRIVPETA  1749
             ISGT+DFIFG    +IQNS+II RKP   Q N +TA G+       G+V+QNCRIVPE  
Sbjct  441   ISGTVDFIFGDAAVVIQNSLIIIRKPGPGQKNAVTAQGRVDKHQTTGIVIQNCRIVPEQK  500

Query  1750  LNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYKNSGP  1929
             L   R KV TY GRPWK YS TV+MES I DL+ P+GW  WDGE    T  Y EY N G 
Sbjct  501   LFEERLKVPTYLGRPWKQYSRTVIMESTIDDLIKPVGWLEWDGEFALDTLYYAEYANRGA  560

Query  1930  GANTWRRNRAFKKFDVLGPIRARH----FTAGLWLDANSWLPATGVPFAIGY  2073
             GA T +R + +K + V   IR R+    FTA  ++  + WL  TG P+ +G+
Sbjct  561   GAATEQRVK-WKGYKV---IRDRNEALQFTAANFIQGDVWLKNTGAPYFLGF  608



>ref|XP_010273980.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Nelumbo nucifera]
Length=599

 Score =   452 bits (1163),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 243/531 (46%), Positives = 329/531 (62%), Gaps = 14/531 (3%)
 Frame = +1

Query  490   VTTFCQYAEYKDVCAKSISHVANNHSATT--KDFIFAAIKATLEEVHKSHQLVVNTKIEQ  663
             +   C   +Y+ VC  S+  V  N++++T  KD + A+I  TL+EV          + E 
Sbjct  76    IKMICNPTDYQSVCESSLKKVLKNNASSTNPKDALRASIVVTLDEVENVLNQTSKFRFEN  135

Query  664   STDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTC  843
               +     A EDCK +LQDA ++LQ SIS V D ++  L  +AD L NW+SAV +YQ TC
Sbjct  136   KEE---QGAYEDCKLLLQDAKEELQDSISTVSDKDVEMLPSKADDLNNWLSAVISYQQTC  192

Query  844   TEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNIT--TTTDLLHKAADKnn  1017
              +       K+ ++  + N   LT+NA+ I+AE+S +L    ++      LL   +   +
Sbjct  193   IDGFPEGKSKTKMQKTLGNTKILTSNALAIVAEVSSILSTLQLSGGNKRRLLQATSTSTS  252

Query  1018  nnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGALKS  1197
             ++ + +TS   L  D  P W    DR++L A R  NL+PN VVAKDGSG FKTI+ AL  
Sbjct  253   SSTSTSTS---LGEDGLPNWMSHEDRRMLKA-RSVNLKPNAVVAKDGSGDFKTISDALAK  308

Query  1198  YPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKTA  1377
              P K+  +YVIYVKAGVYDE V V K M NV MYGDG+ K+I+TG KN+    I T +TA
Sbjct  309   IPKKYTGRYVIYVKAGVYDETVIVTKDMVNVTMYGDGSMKSIVTGSKNFVD-GIRTFQTA  367

Query  1378  TFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFY  1557
             TF+ALG+GF A  + FRNTAGPE HQAVA R Q+D S   +C +EGYQDTLY  T+RQFY
Sbjct  368   TFAALGEGFTAMAMGFRNTAGPEKHQAVALRVQADRSVFINCRMEGYQDTLYVQTHRQFY  427

Query  1558  RNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCRIV  1737
             R+CVI+GTIDFIFG  +A++QN +I+ RKPL +Q NT+TA G+   +    +V+QN RI+
Sbjct  428   RSCVIAGTIDFIFGDASAILQNCMIMVRKPLDNQQNTVTAQGRADKRETTALVIQNSRIL  487

Query  1738  PETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYK  1917
             P+  L P R K+K+Y GRPWK YS T++MES I D++ P GW  WDG+    T  Y EY 
Sbjct  488   PDDKLVPDRTKIKSYLGRPWKEYSRTIIMESTISDVIQPDGWLPWDGDFALNTLFYAEYN  547

Query  1918  NSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             N GPGA    R + +  F V+    A  FT G +L+ N W+ A+G PF  G
Sbjct  548   NRGPGAKLTARVK-WPGFKVIKKDEADKFTVGTFLETN-WIQASGAPFRQG  596



>ref|XP_003536855.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=574

 Score =   451 bits (1159),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 232/552 (42%), Positives = 336/552 (61%), Gaps = 40/552 (7%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQ  663
             KSV   C+  +   +C  ++  V + +S+  K +I A ++AT++ V ++  +    K+E 
Sbjct  42    KSVKAMCEGTDDPKLCHDTLITVNSTNSSDPKAYIAAGVEATVKSVIQALNMSDRLKVEH  101

Query  664   -STDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTT  840
                DP   MA++DCK++++ A+D +++S ++V +  +  L  ++    NW+SA+ +YQ +
Sbjct  102   GDKDPGIKMALDDCKDLIEFALDSIESSANLVNNHNIQALHDQSPDFRNWLSAIISYQQS  161

Query  841   CT----------EQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDL  990
             C           ++I+ +L+  +++       +LT   ++I+  +SK+L++F++    + 
Sbjct  162   CMDGFNNETNGEQEIKEQLHTGSLD----QMGKLTGIVLDIVTNLSKILQSFDLKLDLN-  216

Query  991   LHKAADKnnnnnnnTTSRRLLQTDH--FPEWFPIADRKLLAAQRRGNLRP-NVVVAKDGS  1161
                             SRRLL+ D   +P WF  ADR+LLA   +G   P N VVA DGS
Sbjct  217   --------------PASRRLLELDAEGYPTWFSAADRRLLAKMNQGGAPPPNAVVALDGS  262

Query  1162  GQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKN  1341
             GQFK++  A+ SYP   K +++IYVKAG+Y+E + + KK +N+ +YGDG  K+IITG KN
Sbjct  263   GQFKSVKQAIDSYPKNFKGRFIIYVKAGIYNEYITIPKKSENILIYGDGPTKSIITGNKN  322

Query  1342  YAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQ  1521
             +    + T +TATF+    GF+A+ I F NTAG + HQAVA+R+Q DMSA+FDC++ GYQ
Sbjct  323   FID-GVKTMQTATFANTAPGFIAKSIAFENTAGAKKHQAVAFRNQGDMSAMFDCAMHGYQ  381

Query  1522  DTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKA  1701
             DTLY    RQFYRNC ISGTIDFIFG    LIQNS II RKP  +QFNT+TADG +    
Sbjct  382   DTLYTQANRQFYRNCEISGTIDFIFGAAPTLIQNSRIIVRKPEANQFNTVTADGTKQKNM  441

Query  1702  KGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGE  1881
               G+VLQNC I+PE AL P RF+ K+Y GRPWK ++ TVVMES IGD + P GW  W G 
Sbjct  442   ATGIVLQNCEILPEQALFPTRFQTKSYLGRPWKDFARTVVMESNIGDFIQPEGWTPWSGN  501

Query  1882  NFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWL------DANSWLP  2043
              F  T  Y EY N GPG+N   R +       +    A  FTAG +L      +A+ WL 
Sbjct  502   LFLDTLYYAEYANVGPGSNVQGRVKWKGYHPNINKNEAEQFTAGQFLRGGPSGNADDWLK  561

Query  2044  ATGVPFAIGYTK  2079
             ATGVP+ IG+TK
Sbjct  562   ATGVPYTIGFTK  573



>gb|KHN43418.1| Putative pectinesterase/pectinesterase inhibitor 13 [Glycine 
soja]
Length=461

 Score =   446 bits (1146),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 227/476 (48%), Positives = 299/476 (63%), Gaps = 27/476 (6%)
 Frame = +1

Query  685   MAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTCTE-----  849
             MA++DCK++LQ AI+ LQ SI +V +  L  + ++     NW+SAV +YQ  C E     
Sbjct  1     MALDDCKDLLQSAIESLQLSIDMVHNNNLQAVHNQQADFKNWLSAVISYQQACMEGFDDG  60

Query  850   -QIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnnnnn  1026
              + E ++ +    + + N  +LT   ++I++ +S +L+ F +                 N
Sbjct  61    KEGEKKIKEQFHTETLDNVQKLTGITLDIVSGLSNILEKFGL---------------KFN  105

Query  1027  nnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGALKSYPP  1206
                 SRRLL  D  P WF  ADRKLL    R  ++PNVVVA+DG+GQFKT+  A+ SYP 
Sbjct  106   LKPASRRLLGKDGLPTWFSAADRKLLGRGWRSRVKPNVVVAQDGTGQFKTVADAIASYPK  165

Query  1207  KHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKTATFS  1386
              +K +Y+IYVKAGVYDE + V K  KN+ MYGDG  KTIITG+KN+    + T +TATF+
Sbjct  166   DNKGRYIIYVKAGVYDEYITVPKSSKNILMYGDGPAKTIITGRKNFVD-GVKTMQTATFA  224

Query  1387  ALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRNC  1566
                +GF+A+ +TF+NTAG EGHQAVA+R+Q DMSA+  C I GYQDTLY  T RQFYRNC
Sbjct  225   NTAEGFIAKAMTFQNTAGAEGHQAVAFRNQGDMSALVGCHILGYQDTLYVQTNRQFYRNC  284

Query  1567  VISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCRIVPET  1746
             VISGT+DFIFG  + +IQ+S+II RKPL +QFNT+TADG        G+V+Q C IVPE 
Sbjct  285   VISGTVDFIFGTSSTVIQHSVIIVRKPLDNQFNTVTADGTSQKNMATGIVIQGCNIVPEA  344

Query  1747  ALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYKNSG  1926
              L P RF+VK+Y GRPWK +S TVVMES +GD L P GW  W GE+FE T  Y EY N G
Sbjct  345   ELFPTRFQVKSYLGRPWKQFSRTVVMESTVGDFLHPEGWCPWAGEHFEDTLYYAEYNNDG  404

Query  1927  PGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANS-----WLPATGVPFAIGYTK  2079
             PGAN   R +      ++    A  FT   +L A +     WL A  VP A+ + K
Sbjct  405   PGANVNGRIKWKGYRGLISREEATQFTPAQFLQAGANGGSDWLKALRVPHALSFMK  460



>gb|KDP28007.1| hypothetical protein JCGZ_19087 [Jatropha curcas]
Length=568

 Score =   449 bits (1154),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 238/532 (45%), Positives = 332/532 (62%), Gaps = 19/532 (4%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQ  663
             K+V   C+  +YK  C  SI   A N SAT  DF+ AAI  T+  V  +     N   + 
Sbjct  49    KTVAAICKQTDYKHRCVVSICSTARNKSATPLDFVKAAINNTIHHVTLAKNNTANIIGKD  108

Query  664   STDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTC  843
               +    MA++DC ++LQ AID+LQAS+S V ++ + T++    +L NW+SAV +Y  TC
Sbjct  109   VKNSTQKMALDDCDDLLQYAIDELQASLSAVDNSSVDTIQDGQAELKNWLSAVMSYHHTC  168

Query  844   TEQI-ESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnnn  1020
              E    + L+K  ++  +IN+T LT+NA+ I++ +S +L AF +    +           
Sbjct  169   LEGFANTPLFKPMVQT-LINSTHLTSNALAIVSGISDILSAFGVPQNVN-----------  216

Query  1021  nnnnTTSRRLLQTDHF-PEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGALKS  1197
                N TSRRL+ + +  P W  I DRKLLA++   N+ PN +VA+DGSG++KTI  AL +
Sbjct  217   --ANQTSRRLMNSGYASPTWMSIGDRKLLASRNNANVEPNAIVAQDGSGRYKTIRAALAA  274

Query  1198  YPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKTA  1377
             YP     +YVIYVKAGVY+E V + K   NVFMYGDG  +TI+TG K+Y +  I T +TA
Sbjct  275   YPKNLTERYVIYVKAGVYNENVTIAKDKVNVFMYGDGPRRTIVTGNKSYKN-GIPTIRTA  333

Query  1378  TFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFY  1557
             +FSA+G GF+A+ + F+NTAG  GHQAVA R QSD +A+++C ++GY++TLY  T+RQFY
Sbjct  334   SFSAIGDGFMAKSMGFQNTAGAIGHQAVALRVQSDRAALYNCRMDGYRNTLYQQTHRQFY  393

Query  1558  RNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCRIV  1737
             RNC+ISGTID IFG   A++QNS+I+ RKP   Q NTITA  +       G+V+QNCRIV
Sbjct  394   RNCMISGTIDIIFGDAAAVVQNSLIVVRKPDPGQKNTITAHERADKHESTGLVIQNCRIV  453

Query  1738  PETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYK  1917
             P+  L P+  +  +Y GRP K YS TV+MESQIG  + P GW  W  + +  T  + EY 
Sbjct  454   PDQKLFPVSSQFPSYLGRPRKPYSRTVIMESQIGGFIEPAGWLEWICKLYLNTLYFAEYS  513

Query  1918  NSGPGANTWRRNRAFKKFDVLGPIR-ARHFTAGLWLDANSWLPATGVPFAIG  2070
             N G GANT  R   ++ + VL  I+ AR F A  ++ AN WL  TG P  +G
Sbjct  514   NRGEGANTSARVE-WEGYHVLTEIKQARRFRAARFIQANQWLRTTGFPCLLG  564



>gb|ABO80928.1| Pectinesterase; Pectinesterase inhibitor [Medicago truncatula]
 gb|AES82265.2| pectinesterase inhibitor domain protein [Medicago truncatula]
Length=576

 Score =   449 bits (1154),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 232/551 (42%), Positives = 323/551 (59%), Gaps = 37/551 (7%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQ  663
             +++   CQ ++ + +C +++S V    +A  K +I A++KA  + V K+  +      E 
Sbjct  40    RNLRIMCQNSQDQKLCHETLSSVHGADAADPKAYIAASVKAATDNVIKAFNMSERLTTEY  99

Query  664   STDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTC  843
               +    MA+ DCK+++Q A+D L  S   V D  +  +  +   + NW+SAV +Y+  C
Sbjct  100   GKENGAKMALNDCKDLMQFALDSLDLSTKCVHDNNIQAVHDQIADMRNWLSAVISYRQAC  159

Query  844   TEQI------ESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAA  1005
              E        E ++ +      + +  ++T  A++I+  +S +L+ FN+           
Sbjct  160   MEGFDDANDGEKKIKEQFHVQSLDSVQKVTAVALDIVTGLSDILQQFNLKFDV-------  212

Query  1006  DKnnnnnnnTTSRRLLQTD------HFPEWFPIADRKLLAAQRRGNLR----PNVVVAKD  1155
                        SRRLL ++       +P W   +DRKLLA  +R N R    PN VVAKD
Sbjct  213   --------KPASRRLLNSEVTVDDQGYPSWISSSDRKLLAKMQRKNWRANIMPNAVVAKD  264

Query  1156  GSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGK  1335
             GSGQFKTI  AL SYP  +K +YVIYVKAGVYDE + V K   N+ MYGDG  +TI+TG+
Sbjct  265   GSGQFKTIQAALASYPKGNKGRYVIYVKAGVYDEYITVPKDAVNILMYGDGPARTIVTGR  324

Query  1336  KNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEG  1515
             K++A   + T +TATF+    GF+ + +TF NTAGP+GHQAVA+R+Q DMSA+  C I G
Sbjct  325   KSFA-AGVKTMQTATFANTAMGFIGKAMTFENTAGPDGHQAVAFRNQGDMSALVGCHIVG  383

Query  1516  YQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELA  1695
             YQD+LY  + RQ+YRNC++SGT+DFIFG    LIQ+S II RKP   QFNTITADG +  
Sbjct  384   YQDSLYVQSNRQYYRNCLVSGTVDFIFGSSATLIQHSTIIVRKPGKGQFNTITADGSDTM  443

Query  1696  KAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWD  1875
                 G+V+Q+C I+PE AL P RF +++Y GRPWK  + TVVMES IGD + P GW IW 
Sbjct  444   NLNTGIVIQDCNIIPEAALFPERFTIRSYLGRPWKYLAKTVVMESTIGDFIHPDGWTIWQ  503

Query  1876  GENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDAN-----SWL  2040
             GE    TC Y EY N+GPGAN  RR +      V+    A  FTAG+WL A       WL
Sbjct  504   GEQNHNTCYYAEYANTGPGANVARRVKWKGYHGVISRAEANKFTAGIWLQAGPKSAAEWL  563

Query  2041  PATGVPFAIGY  2073
                 VP  +G+
Sbjct  564   NGLHVPHYLGF  574



>ref|XP_003626047.1| Pectinesterase [Medicago truncatula]
Length=597

 Score =   449 bits (1156),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 232/551 (42%), Positives = 323/551 (59%), Gaps = 37/551 (7%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQ  663
             +++   CQ ++ + +C +++S V    +A  K +I A++KA  + V K+  +      E 
Sbjct  40    RNLRIMCQNSQDQKLCHETLSSVHGADAADPKAYIAASVKAATDNVIKAFNMSERLTTEY  99

Query  664   STDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTC  843
               +    MA+ DCK+++Q A+D L  S   V D  +  +  +   + NW+SAV +Y+  C
Sbjct  100   GKENGAKMALNDCKDLMQFALDSLDLSTKCVHDNNIQAVHDQIADMRNWLSAVISYRQAC  159

Query  844   TEQI------ESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAA  1005
              E        E ++ +      + +  ++T  A++I+  +S +L+ FN+           
Sbjct  160   MEGFDDANDGEKKIKEQFHVQSLDSVQKVTAVALDIVTGLSDILQQFNLKFDV-------  212

Query  1006  DKnnnnnnnTTSRRLLQTD------HFPEWFPIADRKLLAAQRRGNLR----PNVVVAKD  1155
                        SRRLL ++       +P W   +DRKLLA  +R N R    PN VVAKD
Sbjct  213   --------KPASRRLLNSEVTVDDQGYPSWISSSDRKLLAKMQRKNWRANIMPNAVVAKD  264

Query  1156  GSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGK  1335
             GSGQFKTI  AL SYP  +K +YVIYVKAGVYDE + V K   N+ MYGDG  +TI+TG+
Sbjct  265   GSGQFKTIQAALASYPKGNKGRYVIYVKAGVYDEYITVPKDAVNILMYGDGPARTIVTGR  324

Query  1336  KNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEG  1515
             K++A   + T +TATF+    GF+ + +TF NTAGP+GHQAVA+R+Q DMSA+  C I G
Sbjct  325   KSFA-AGVKTMQTATFANTAMGFIGKAMTFENTAGPDGHQAVAFRNQGDMSALVGCHIVG  383

Query  1516  YQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELA  1695
             YQD+LY  + RQ+YRNC++SGT+DFIFG    LIQ+S II RKP   QFNTITADG +  
Sbjct  384   YQDSLYVQSNRQYYRNCLVSGTVDFIFGSSATLIQHSTIIVRKPGKGQFNTITADGSDTM  443

Query  1696  KAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWD  1875
                 G+V+Q+C I+PE AL P RF +++Y GRPWK  + TVVMES IGD + P GW IW 
Sbjct  444   NLNTGIVIQDCNIIPEAALFPERFTIRSYLGRPWKYLAKTVVMESTIGDFIHPDGWTIWQ  503

Query  1876  GENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDAN-----SWL  2040
             GE    TC Y EY N+GPGAN  RR +      V+    A  FTAG+WL A       WL
Sbjct  504   GEQNHNTCYYAEYANTGPGANVARRVKWKGYHGVISRAEANKFTAGIWLQAGPKSAAEWL  563

Query  2041  PATGVPFAIGY  2073
                 VP  +G+
Sbjct  564   NGLHVPHYLGF  574



>ref|XP_003626051.1| Pectinesterase [Medicago truncatula]
 gb|ABO80924.1| Pectinesterase; Pectinesterase inhibitor [Medicago truncatula]
 gb|AES82269.1| pectinesterase inhibitor domain protein [Medicago truncatula]
 gb|AES82270.2| pectinesterase inhibitor domain protein [Medicago truncatula]
Length=576

 Score =   446 bits (1146),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 240/551 (44%), Positives = 323/551 (59%), Gaps = 37/551 (7%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQ  663
             +S+   CQ A+ + +C +++S V    +A  K +I AA+KA  + V K+  +      E 
Sbjct  40    RSLQVMCQNADDQKLCHETLSSVRGADAADPKAYIAAAVKAATDNVIKAFNMSDRLTTEY  99

Query  664   STDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTC  843
               +    MA+ DCK+++Q A+D L  S   V D+ +  +  +   + NW+SAV +Y+  C
Sbjct  100   GKEDGTKMALNDCKDLMQFALDSLDLSTKCVHDSNIQAVHDQTADMRNWLSAVISYRQAC  159

Query  844   TEQI------ESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAA  1005
              E        E ++ +      + +  ++T  A++I+  +S +L+ FN+           
Sbjct  160   MEGFDDENDGEKKIKEQLDVQSLDSVQKVTAVALDIVTGLSDILQQFNL-----------  208

Query  1006  DKnnnnnnnTTSRRLLQTD------HFPEWFPIADRKLLAAQR----RGNLRPNVVVAKD  1155
                   +    SRRLL ++       +P W   +DRKLLA  +    R N+  N VVAKD
Sbjct  209   ----KFDIKPASRRLLNSEVTVDDQGYPSWISASDRKLLAKMKGNGWRANVGANAVVAKD  264

Query  1156  GSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGK  1335
             GSGQFKTI  A+ +YP  +K +Y IYVKAGVYDE + + K   N+ MYGDG GKTI+TG+
Sbjct  265   GSGQFKTIQAAIAAYPKGNKGRYTIYVKAGVYDEYITIPKDAVNILMYGDGPGKTIVTGR  324

Query  1336  KNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEG  1515
             KN A   + T +TATF+    GF+ + +TF NTAGP GHQAVA+R+Q DMSA+  C I G
Sbjct  325   KNGA-AGVKTMQTATFANTALGFIGKAMTFENTAGPAGHQAVAFRNQGDMSALVGCHILG  383

Query  1516  YQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELA  1695
             YQDTLY  T RQFYRNCVISGT+DFIFG    LIQ+S II R P  +QFNTITADG  + 
Sbjct  384   YQDTLYVQTNRQFYRNCVISGTVDFIFGTSATLIQDSTIIVRMPSPNQFNTITADGSYVN  443

Query  1696  KAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWD  1875
             K   G+V+Q C IVPE AL P RF +K+Y GRPWK  + TVVMES IGD + P GW  W 
Sbjct  444   KLNTGIVIQGCNIVPEAALFPQRFTIKSYLGRPWKVLAKTVVMESTIGDFIHPDGWTPWQ  503

Query  1876  GENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDAN-----SWL  2040
             GE+FE TC Y EY N+GPGAN  RR +       +    A  FTAGLWL A       WL
Sbjct  504   GEHFENTCYYAEYANTGPGANIARRIKWKGYHGAISRAEATKFTAGLWLQAGPKSAAEWL  563

Query  2041  PATGVPFAIGY  2073
                 VP  +G+
Sbjct  564   TGLNVPNYLGF  574



>ref|XP_007145106.1| hypothetical protein PHAVU_007G210300g [Phaseolus vulgaris]
 gb|ESW17100.1| hypothetical protein PHAVU_007G210300g [Phaseolus vulgaris]
Length=568

 Score =   444 bits (1142),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 235/557 (42%), Positives = 335/557 (60%), Gaps = 29/557 (5%)
 Frame = +1

Query  433   DDASSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATL  612
             DD  +   D G  T   K+V   CQ ++ K  C+ + + V   +S+    ++   ++ T+
Sbjct  32    DDPGTATDDGGKVTTHTKAVQAVCQNSDDKKFCSDTFTSV---NSSDPTAYVKTVVRNTM  88

Query  613   EEVHKSHQLVVNTKIEQS-TDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHR  789
             + V K+  L     I+ S ++    MA+EDCK++L+ AID+L+AS  +V +  ++ +  R
Sbjct  89    DGVIKAFNLSDTLTIQNSKSNSTVKMALEDCKDLLEFAIDELEASEILVKENNINNINDR  148

Query  790   ADQLLNWMSAVYAYQTTCTEQIES---RLYKSAIE-DGMINATQLTNNAINIIAEMSKLL  957
               +L NW+ AV AYQ +C +  +S   +  +S ++  G+ +  +LT  A+++++  +++L
Sbjct  149   VSELKNWIGAVVAYQQSCLDGFDSDKEKDMQSKLQTQGLDDVGKLTALALDVVSSFAEIL  208

Query  958   KAFNITTTTDLLHKAADKnnnnnnnTTSRRLL--QTDHFPEWFPIADRKLLA-AQRRGNL  1128
               FN+  TT                T+SRRLL  + D +P W  + DRKLLA A + G++
Sbjct  209   SDFNLDLTT---------------KTSSRRLLDLEQDGYPSWLSMPDRKLLADAGKGGSV  253

Query  1129  RPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDG  1308
              PNV+VAKDGSG +KT+  A+ SYP   + +Y+IYVKAG YDE + V KK  N+ +YGDG
Sbjct  254   TPNVIVAKDGSGDYKTVLDAINSYPKNQQGRYIIYVKAGTYDEYITVDKKKPNLLIYGDG  313

Query  1309  AGKTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMS  1488
               KTIITG KN       T ++ATF+ +G  F+A+ + F NTAG   HQAVA R Q D S
Sbjct  314   PTKTIITGNKNVVD-GFRTMRSATFATVGDDFIAKSMAFENTAGAVKHQAVALRVQGDRS  372

Query  1489  AIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNT  1668
               +DC++ GYQDTLY H +RQFYRNC ISGT+DFIFG GT LIQNS II RKP  +Q N 
Sbjct  373   VFYDCAMHGYQDTLYTHAHRQFYRNCEISGTVDFIFGYGTTLIQNSKIIVRKPDANQQNI  432

Query  1669  ITADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLL  1848
             I ADG +      G VLQNC IV    L P +   K+Y  RPWKAYS  + +E+ I D++
Sbjct  433   IVADGTDQKNMPTGAVLQNCEIVAAPELEPQKKTFKSYLARPWKAYSRAIFLENTISDVI  492

Query  1849  SPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDA  2028
              P G+  W+G  F  TC + EY+N+G GA+   R +  +   VL    A  FTA  WL A
Sbjct  493   QPDGYLPWNGNMFLDTCYFAEYQNTGAGADVKARVKWGRG--VLSKADASKFTADTWLQA  550

Query  2029  NSWLPATGVPFAIGYTK  2079
             N+WLPATGVPF +G +K
Sbjct  551   NTWLPATGVPFDLGLSK  567



>ref|XP_007145107.1| hypothetical protein PHAVU_007G210400g [Phaseolus vulgaris]
 gb|ESW17101.1| hypothetical protein PHAVU_007G210400g [Phaseolus vulgaris]
Length=567

 Score =   441 bits (1134),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 228/544 (42%), Positives = 331/544 (61%), Gaps = 29/544 (5%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQ  663
             K +   C+  E   +C +++S V  N S   K +I A ++AT++ V ++  +    K+E 
Sbjct  40    KRMKVMCEGTEDPQLCHETLSTVKGNTS-DPKVYIAAGVEATMKSVIQALNMSDKLKVEH  98

Query  664   S-TDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTT  840
                DP   MA++DCK+++Q A+D +++S+++V    +  +  ++    NW+SA+ +YQ +
Sbjct  99    GDKDPGIKMALDDCKDLIQYALDSIESSVNLVNSQNIQAMYDQSPDFRNWLSAIISYQES  158

Query  841   CTEQIES-----RLYKSAIEDGMINAT-QLTNNAINIIAEMSKLLKAFNITTTTDLLHKA  1002
             CT+ + +     +  K  +  G ++   +LT   ++I+  +S +L++F++    +     
Sbjct  159   CTDGLNNETNGEKEIKEKLNTGSLDEMGKLTGIVLDIVTNLSTVLESFDLKLNLN-----  213

Query  1003  ADKnnnnnnnTTSRRLLQTDH--FPEWFPIADRKLLAAQRRGNLRPNVVVA-KDGSGQFK  1173
                        +SRRLLQ D    P WF  ADRKLLA  ++G       V  KDGSG+FK
Sbjct  214   ----------PSSRRLLQVDSEGLPTWFSGADRKLLAQVQKGAAAAPNAVVAKDGSGKFK  263

Query  1174  TITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHM  1353
             +I  A+ +YP   + +YVIYVK GVYDE + + KK  N+ +YGDG GKT++TG+KN+   
Sbjct  264   SIKEAIDAYPANLQGRYVIYVKTGVYDESILIPKKSANILIYGDGPGKTVVTGRKNFVD-  322

Query  1354  KITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLY  1533
              + T +TATF+    GF+A+ +TF NTAG   HQAVA+R+Q DMSAIFDC+  GYQDTLY
Sbjct  323   GVKTMQTATFANTAPGFIAKSMTFENTAGAAKHQAVAFRNQGDMSAIFDCAFHGYQDTLY  382

Query  1534  YHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGV  1713
              H  RQFYRNC ISGTIDFIFG    +IQNS II R P+ +QFNT+TADG +L     G+
Sbjct  383   VHANRQFYRNCEISGTIDFIFGASATVIQNSKIIGRLPMANQFNTVTADGTKLKNMATGI  442

Query  1714  VLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEK  1893
             VLQNC IVPE AL P R K K+Y GRPWK ++ T+VMES IGD ++  GW +WDG  +  
Sbjct  443   VLQNCEIVPEQALFPSRLKTKSYLGRPWKQFARTIVMESTIGDFITAEGWNVWDGNLYLD  502

Query  1894  TCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDA--NSWLPATGVPFAI  2067
             T  Y EY N+G G+N   R +       +    A  FT G +L    + WL A+GVP+A+
Sbjct  503   TLYYAEYANTGAGSNIQGRVKWKGYRGNINKNEATQFTPGQFLRGGTDDWLKASGVPYAV  562

Query  2068  GYTK  2079
             G+ K
Sbjct  563   GFMK  566



>ref|XP_003518613.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor VGDH2-like 
[Glycine max]
Length=565

 Score =   440 bits (1131),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 232/542 (43%), Positives = 328/542 (61%), Gaps = 29/542 (5%)
 Frame = +1

Query  478   SMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKI  657
             S ++VT  CQ ++ + +C + +S   +++S   K++I   ++ +++ V K+  +     +
Sbjct  44    SNRAVTALCQGSDDQKLCHEVLS---SSNSTDPKEYIATVVRTSMDSVIKAFNMSDRLTV  100

Query  658   EQSTDPYN-HMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQ  834
             E         MA+EDCK++LQ AI DL+AS  +V ++ L  +  R  +L NW+ AV AYQ
Sbjct  101   EHGNSSAGMKMALEDCKDLLQSAIHDLEASGVLVKESSLQDVHQRTAELKNWLGAVVAYQ  160

Query  835   TTCTEQIESRLYKSAIED----GMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKA  1002
              +C +  ++   K   E      + N  +LT  A+++++ +S +L++ ++    +L  K 
Sbjct  161   QSCLDGFDTDGEKKVQEQLQSGSLDNVGKLTGLALDVVSGISHILQSLDL----NLALKP  216

Query  1003  ADKnnnnnnnTTSRRLLQTDH--FPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKT  1176
             A           SRRLL+ D   +P W   ADRKLLA    G + P+  VAKDGSGQF T
Sbjct  217   A-----------SRRLLEVDQEGYPTWVSAADRKLLAQLNDGAVLPHATVAKDGSGQFTT  265

Query  1177  ITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMK  1356
             +  A+ SYP KH+ +Y+IYVKAG+YDE + V KK  N+F+YGDG   TIITG+KN+ H  
Sbjct  266   VLDAINSYPKKHQGRYIIYVKAGIYDEYITVDKKKPNLFIYGDGPTNTIITGRKNF-HEG  324

Query  1357  ITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYY  1536
               T +TATFS + + F+A+ I F NTAG EGHQAVA R Q D S  FDC++ GYQDTLY 
Sbjct  325   TKTMRTATFSTVAEDFMAKSIAFENTAGAEGHQAVALRVQGDRSVFFDCAMRGYQDTLYA  384

Query  1537  HTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVV  1716
             H +RQFYRNC ISGTIDFIFG  T LIQNS I+ RKP+ +Q N + ADG        G+V
Sbjct  385   HAHRQFYRNCEISGTIDFIFGYSTTLIQNSKILVRKPMANQQNIVVADGTGQKNMPTGIV  444

Query  1717  LQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDG-ENFEK  1893
             L NC I+P+  L   R  VKTY  RPWKA+S  V +E+ IGDL+ P G+  W+  E   +
Sbjct  445   LHNCEIMPDPTLLADRLSVKTYLARPWKAFSRAVFIENVIGDLIQPDGYIPWNPIEPNTQ  504

Query  1894  TCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIGY  2073
              C + E+ N+GPG+    R +  K   ++    A  FTA  WL A++WLPA GVPF   +
Sbjct  505   DCYFAEFGNTGPGSVAQARAKFGK--GLISKQEAAQFTAEPWLQASTWLPAAGVPFDASF  562

Query  2074  TK  2079
             TK
Sbjct  563   TK  564



>ref|XP_008227793.1| PREDICTED: pectinesterase [Prunus mume]
Length=580

 Score =   439 bits (1130),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 228/550 (41%), Positives = 326/550 (59%), Gaps = 27/550 (5%)
 Frame = +1

Query  472   TGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNT  651
             T   K VT  C Y +++  C +S+  VA N+SA  KD++ AA+ +  EE  K+  +  + 
Sbjct  41    TAQQKMVTQICNYTDFQPECQRSLGPVAQNNSADYKDYVKAALLSISEEAKKALNMSESL  100

Query  652   KIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAY  831
              +E      +  ++E+CKEML++A+ +LQA  S VGD +LHT++ R  +L  W+ +V +Y
Sbjct  101   LVEARNGTSSKKSLEECKEMLKEAVAELQAVFSYVGDADLHTMEDRVMELKAWIGSVISY  160

Query  832   QTTCTEQI---ESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKA  1002
              TTC + I   ++++++ A++D + NA+ +T+NA+ I+ E+  +L  F +      L   
Sbjct  161   STTCLDIIGDDDNKIFE-ALKDPIGNASAITDNALAIVGEIGSILGLFGMKINDKALRNL  219

Query  1003  ADKnnnnnnnTTSRRLLQTD-----HFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQ  1167
                        T RRLL+ +       P WF  +DRKL+A Q  G LRP+ VVAKDGSG+
Sbjct  220   G----------TQRRLLEDELSSDGRSPSWFSASDRKLMALQDNGKLRPHAVVAKDGSGK  269

Query  1168  FKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYA  1347
             + +I  ALK+YP   + +Y+IYVKAGVY E V V KKM NV+MYGDG   T++TG+K+ A
Sbjct  270   YSSINAALKAYPYGQQGRYIIYVKAGVYQEYVTVDKKMTNVYMYGDGPRATLVTGQKSEA  329

Query  1348  HMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDT  1527
                   S + TF   G GF+ R + F NTAGP G  AVA R+  D  A F+C I GYQDT
Sbjct  330   GTGDKISTSGTFQVFGAGFIGRSMGFSNTAGPRGRPAVALRTVGDQIAFFNCRISGYQDT  389

Query  1528  LYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNT--ITADGKELAKA  1701
             LY    RQF+RNCVISG +D+IFG   A IQNS+II RK  + + N   ITA G++ +  
Sbjct  390   LYMQAGRQFFRNCVISGHVDYIFGDARAFIQNSLIIVRKSSIPEQNQVFITAPGRQYSHE  449

Query  1702  KGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGE  1881
              G +++ N RIVPE  L P RF+V+TY GRPWK Y+  V MES + D + P G+  WDG+
Sbjct  450   IGAIIIHNSRIVPEQKLLPTRFQVRTYLGRPWKPYARAVFMESTLADFIRPEGYSAWDGK  509

Query  1882  NFEKTCMYY-EYKNSGPGANTWRR---NRAFKKFDVLGPIRARHFTAGLWLDANSWLPAT  2049
                    ++ EYKN GPGAN  +R   N  F  +  +    A  FTAG  L A+ WL   
Sbjct  510   AGNTEHAFFGEYKNRGPGANLAKRAKWNGGF--YGEMDRATAEKFTAGPALLADRWLKFA  567

Query  2050  GVPFAIGYTK  2079
              +P+   + +
Sbjct  568   NIPYTPSFIR  577



>ref|XP_007221469.1| hypothetical protein PRUPE_ppa003369mg [Prunus persica]
 gb|EMJ22668.1| hypothetical protein PRUPE_ppa003369mg [Prunus persica]
Length=580

 Score =   439 bits (1128),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 227/542 (42%), Positives = 324/542 (60%), Gaps = 23/542 (4%)
 Frame = +1

Query  472   TGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNT  651
             T   K VT  C Y +++  C +S+  VA N+SA  KD++ AA+ +  EE  K+  +  + 
Sbjct  41    TAQQKMVTQICNYTDFQPECQRSLGPVAQNNSADYKDYVKAALLSISEEAKKALNMSESL  100

Query  652   KIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAY  831
              +E      +  ++E+CKEML++A+ +LQA  S VGD +LHT++ R  +L  W+ +V +Y
Sbjct  101   LVEARNGTSSKKSLEECKEMLKEAVAELQAVFSYVGDADLHTMEDRVMELKVWIGSVISY  160

Query  832   QTTCTEQI---ESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKA  1002
              TTC + I   ++++++ A++D + NA+ +T+NA+ I+ E+  +L  F +      L   
Sbjct  161   STTCLDIIGDDDNKIFE-ALKDPIGNASAITDNALAIVGEIGSILGLFGMKVNDKALRNL  219

Query  1003  ADKnnnnnnnTTSRRLLQTD-----HFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQ  1167
                        T RRLL+ +       P WF  +DRKL+A Q  G L+P+ VVAKDGSG+
Sbjct  220   G----------TQRRLLEDELSSDGRSPSWFSASDRKLMALQDNGKLKPHAVVAKDGSGK  269

Query  1168  FKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYA  1347
             + +I  ALK+YP   + +Y+IYVKAGVY E V V KKM NV+MYGDG   T++TG+K+ A
Sbjct  270   YSSINAALKAYPYGQQGRYIIYVKAGVYREYVTVDKKMTNVYMYGDGPRATLVTGQKSEA  329

Query  1348  HMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDT  1527
                   S + TF   G GF+ R + F NTAGPEG  AVA R+  D  A F+C I GYQDT
Sbjct  330   GTGDKISTSGTFQVFGAGFIGRSMGFSNTAGPEGRPAVALRTVGDQIAFFNCRISGYQDT  389

Query  1528  LYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNT--ITADGKELAKA  1701
             LY    RQF+RNCVISG +D+IFG   A IQNS+II RK  + + N   ITA G++ +  
Sbjct  390   LYMQAGRQFFRNCVISGHVDYIFGDARAFIQNSLIIVRKSSIPEQNQVFITAPGRQYSHE  449

Query  1702  KGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGE  1881
              G +++ N RIVPE  L P RF+V+TY GRPWK Y+  V MES + D + P G+  WDG+
Sbjct  450   IGAIIIHNSRIVPEQKLLPTRFQVRTYLGRPWKPYARVVFMESTLADFIRPEGYSAWDGK  509

Query  1882  NFEKTCMYY-EYKNSGPGANTWRRNRAFKKF-DVLGPIRARHFTAGLWLDANSWLPATGV  2055
                    ++ EYKN GPGAN  +R +    F   +    A  FTAG  L A+ WL    +
Sbjct  510   AGNTEHAFFGEYKNRGPGANLAKRAKWSGGFYGEMDRATAEKFTAGPALLADRWLKLANI  569

Query  2056  PF  2061
             P+
Sbjct  570   PY  571



>ref|XP_007145105.1| hypothetical protein PHAVU_007G210200g [Phaseolus vulgaris]
 gb|ESW17099.1| hypothetical protein PHAVU_007G210200g [Phaseolus vulgaris]
Length=560

 Score =   436 bits (1122),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 233/550 (42%), Positives = 333/550 (61%), Gaps = 38/550 (7%)
 Frame = +1

Query  469   STGSMKS----VTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQ  636
             STG +K+    VTT CQ ++ + +C   +S    ++S+  KD+I   +K++++ V K+  
Sbjct  35    STGDLKTTNRAVTTLCQGSDDEKLCHNVLS---TSNSSDPKDYIVTVVKSSMDSVIKAFN  91

Query  637   LVVNTKIEQSTDPYN-HMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWM  813
             +     +E         MA++DCK++LQ A+ DL+AS  +V ++ +  +  R  +L NW+
Sbjct  92    MSDKLTVEHGNSSEGMKMALDDCKDLLQSAMHDLEASGVMVKESSIEDVNDRTAELKNWL  151

Query  814   SAVYAYQTTCTEQI----ESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTT  981
              AV AYQ +C +      E ++ +    D + +  +LT  A+++++ +SK+L++ ++   
Sbjct  152   GAVVAYQLSCLDGFNTDGEKKVQEQLQADSLDSVGKLTGLALDVVSGISKILQSLDLNLA  211

Query  982   TDLLHKAADKnnnnnnnTTSRRLLQTDH--FPEWFPIADRKLLAAQRRGNLRPNVVVAKD  1155
                               ++RRLL+ D   +P W   ADR+LLA   +G + P+  VAKD
Sbjct  212   ---------------LKPSTRRLLELDQDGYPTWLSAADRRLLA---QGAV-PHATVAKD  252

Query  1156  GSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGK  1335
             GSGQFKTIT A+ SYP  H+ ++++YVKAGVYDE + V K   N+ +YGDG  KTIITG+
Sbjct  253   GSGQFKTITDAINSYPKNHQGRFIVYVKAGVYDEYILVDKNKVNLLIYGDGPTKTIITGR  312

Query  1336  KNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEG  1515
             KN+A     T +T+TFS +   F+A+ I F NTAG +GHQAVA R Q D S  FDC++ G
Sbjct  313   KNFAE-GTKTMRTSTFSTVADDFMAKSIAFENTAGAKGHQAVALRVQGDRSVFFDCAMRG  371

Query  1516  YQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELA  1695
             YQDTLY H +RQFYRNC ISGTIDFIFG  T LIQNS I  RKP  +Q N + ADG    
Sbjct  372   YQDTLYAHAHRQFYRNCEISGTIDFIFGYATTLIQNSKIFVRKPEANQQNIVVADGTGQK  431

Query  1696  KAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWD  1875
                 GVVLQNC I+P+ +L   R  VKTY  RPWKA+S  + +E+ IGDL+ P G+  W+
Sbjct  432   NMPTGVVLQNCEIMPDPSLAADRLTVKTYLARPWKAFSRAIFIENVIGDLIQPEGYIPWN  491

Query  1876  G--ENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPAT  2049
                E   K C + E+ NSGPG+N   R   F K  V+    A  +TA  WL A++WLPAT
Sbjct  492   PTVEPNTKDCFFGEFGNSGPGSNANAR-APFSK-GVISKQEAAKYTAEAWLQASAWLPAT  549

Query  2050  GVPFAIGYTK  2079
             G+PF  G+ K
Sbjct  550   GIPFDAGFVK  559



>ref|XP_010047427.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Eucalyptus grandis]
Length=590

 Score =   435 bits (1119),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 229/536 (43%), Positives = 321/536 (60%), Gaps = 24/536 (4%)
 Frame = +1

Query  478   SMKSVTTFCQYAEYKDVCAKSISHVANNHSATT--KDFIFAAIKATLEEVHKSHQLVVNT  651
             S K +   C   +Y+D C  +      +    T  KD +  AI AT +EV ++      T
Sbjct  71    SQKMIKMICSSTDYRDTCKSTFDKAVKSEKNLTQPKDLLKVAIGATFDEVKEAFD---KT  127

Query  652   KIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAY  831
             K  +   P    A EDCK++L+DA+++L +S+S +GD+ +     +   L NW+SA  +Y
Sbjct  128   KKFKFNSPQEKAAFEDCKQLLEDAVEELHSSVSNLGDS-IGKFSSKTPDLNNWLSAAISY  186

Query  832   QTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNIT-TTTDLLHKAAD  1008
             Q +C +       K+ ++  +  A +LT+N++ II+E+S  L  F I   T  LL K A 
Sbjct  187   QHSCVDGFPDGKLKTEMQKTLKIAKELTSNSLAIISEVSSFLTTFQIPGATRHLLEKEA-  245

Query  1009  KnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGA  1188
                      +    +  D  P W    +R++L  +R   L PNVVVAKDGSG+FKTI+ A
Sbjct  246   ---------SGLPAVGEDGLPSWMNQEERRILKGKRGVKLTPNVVVAKDGSGKFKTISEA  296

Query  1189  LKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTS  1368
             L + P K+  +YVIY+KAG+YDE + V KKM NV MYGDG+ KTI+TG KN+    + T 
Sbjct  297   LAALPEKYTGRYVIYIKAGIYDEYITVTKKMVNVTMYGDGSQKTIVTGNKNFVD-GVRTF  355

Query  1369  KTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYR  1548
             +TA+F+ALG GF+A+ + FRNTAGPE HQAVA R QSD +   +C  EGYQDTLY  T+R
Sbjct  356   QTASFAALGDGFMAQAMGFRNTAGPEKHQAVAIRVQSDRAIFLNCRFEGYQDTLYVQTHR  415

Query  1549  QFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNC  1728
             QFYR+CVI+GT+DFIFG  TA++QN +I+ RKPL +Q N +TA G+       G+VLQNC
Sbjct  416   QFYRSCVIAGTVDFIFGDATAILQNCLIVVRKPLDNQQNIVTAQGRVDGHETTGIVLQNC  475

Query  1729  RIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYY  1908
             RI  +  L P++ K +TY GRPWK +S T++MES I D + P G+  W+G+   KT  Y 
Sbjct  476   RITADKKLIPVKSKFQTYLGRPWKEFSRTIIMESSIEDFIDPAGFMPWEGDFALKTLYYA  535

Query  1909  EYKNSGPGANTWRRNR--AFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             E+ N GPGAN   R +   +KK   +    A  FT G +LD + W+   GVP   G
Sbjct  536   EFNNKGPGANINARVKWPGYKK---INKQEAAKFTVGTFLDGD-WIKGAGVPVHFG  587



>ref|XP_008343212.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=580

 Score =   433 bits (1114),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 229/548 (42%), Positives = 321/548 (59%), Gaps = 27/548 (5%)
 Frame = +1

Query  472   TGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNT  651
             T   K VT  C + +Y+  C KS+  V+ N++A  KD++ AA+ +  EE +K+     + 
Sbjct  41    TAQQKMVTQICNFTDYQQECQKSLGPVSQNNNAEFKDYVKAALMSISEEANKALNTSGSL  100

Query  652   KIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAY  831
              ++          +E+CK ML++A+ ++QA  S VGD ++HT++ R  +L  W+ +V +Y
Sbjct  101   LVDAKNGTSAKRTLEECKNMLKEAVAEVQAVSSYVGDADMHTMEDRVMELKAWIGSVISY  160

Query  832   QTTCTEQI---ESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKA  1002
              TTC + I   +  LY+ A++D + NA+  T+NA+ I+ E+S +L  F +      L+  
Sbjct  161   STTCLDIIGENDHNLYE-ALKDPIGNASASTDNALAIVGEISNVLGMFGVKVKDKALNGG  219

Query  1003  ADKnnnnnnnTTSRRLLQ----TDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQF  1170
                        T RRLLQ    +D  P WF  +DRKL+  Q  G LRP++VVAKDGSGQ+
Sbjct  220   G----------TQRRLLQNELSSDGIPTWFSASDRKLMGLQDNGRLRPHIVVAKDGSGQY  269

Query  1171  KTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAH  1350
             K+I  ALK+YP   + +Y+IYVKAGVY+E V V KKM NV+MYGDG   T++ G K+ A 
Sbjct  270   KSINDALKAYPYGQRGRYIIYVKAGVYNEYVYVDKKMINVYMYGDGPRSTVVXGSKSEAG  329

Query  1351  MKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTL  1530
                  S + TF   G GF+ R +   NTAGPE   AVA R+  D  A F+C I GYQDTL
Sbjct  330   TGDKISTSGTFQVFGPGFIGRSMGIINTAGPEARPAVALRTVGDQIAFFNCRISGYQDTL  389

Query  1531  YYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNT--ITADGKELAKAK  1704
             Y  + RQF+RNCVISG +D+IFG   A IQNS+II RK    Q N   ITA G++     
Sbjct  390   YMQSGRQFFRNCVISGHVDYIFGDARAYIQNSLIIVRKSTNPQQNQAFITAPGRQFKHEI  449

Query  1705  GGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGEN  1884
             G +++ NCRIVPE  L P RF+V+TY GRPWK YS  V MES + D + P G+  WDG+ 
Sbjct  450   GAIIIHNCRIVPEQKLVPTRFEVRTYLGRPWKPYSRAVFMESTLADFIRPEGYSAWDGKA  509

Query  1885  FEKTCMYY-EYKNSGPGANTWRRNR----AFKKFDVLGPIRARHFTAGLWLDANSWLPAT  2049
                   ++ E+KN GPGAN  +R R     F  +  +    A  FTA   L A+ WL   
Sbjct  510   GNTQHAFFGEFKNRGPGANLAKRARWSGDGF--YGEMNRATAVQFTAQPALLADRWLKFA  567

Query  2050  GVPFAIGY  2073
              +P+  G+
Sbjct  568   NIPYLPGF  575



>gb|KHG23523.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=557

 Score =   432 bits (1112),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 229/541 (42%), Positives = 318/541 (59%), Gaps = 25/541 (5%)
 Frame = +1

Query  463   GVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLV  642
             G  +  MK  T+ C    Y D C K+    A+ +S   K+F+   I A  EEV K     
Sbjct  34    GKLSPEMKVATSICSPTHYPDACHKTF---ASMNSTDPKEFVKKVIYAAEEEVKKFLNFS  90

Query  643   VNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAV  822
              +   E   +    MA+ DCK+M+Q AID L+A+ + V  ++LH +  R +    W+SAV
Sbjct  91    DSKIAEAKDNGLTKMALNDCKDMMQYAIDSLKATYADVDGSDLHNIGDRINDFRTWLSAV  150

Query  823   YAYQTTCTEQIE-SRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHK  999
              +YQ +C +  E    ++  +E+ ++ +++   NA+ I+ ++ ++L              
Sbjct  151   ISYQQSCLDGFEHDSSWRETMEEAIVASSEQAANALTIVTKLIEILT-------------  197

Query  1000  AADKnnnnnnnTTSRRLLQTD--HFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFK  1173
                K  +   +  +RRL   +  ++P WF   DRKL+A     NL+PN VVAKDGSGQFK
Sbjct  198   ---KLGSELASPNTRRLFSVEETNYPSWFSTTDRKLIAKIDNSNLKPNAVVAKDGSGQFK  254

Query  1174  TITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHM  1353
             TIT AL + P     +++IY+KAG+YDE + V K+  N+ M+GDG  +TI+ G+K     
Sbjct  255   TITEALAAAPKNSINRHIIYIKAGIYDEYITVDKQYTNILMFGDGPRRTIVAGRKGVKDG  314

Query  1354  K-ITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTL  1530
               ITT +TATFSA+G GF+A+ + F+N AGPE HQAVA R QSD SA F+C ++GYQDTL
Sbjct  315   GGITTWQTATFSAIGSGFIAKSMGFQNNAGPEKHQAVALRIQSDKSAFFNCRMDGYQDTL  374

Query  1531  YYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGG  1710
             Y H  RQF+RNCVISGT+DFIFG    +IQNS++I R+P+  Q N +TA GK       G
Sbjct  375   YNHANRQFFRNCVISGTVDFIFGDSPTVIQNSLLIVRRPMEGQSNMVTAQGKTRIDENTG  434

Query  1711  VVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFE  1890
              V+QNCRIVPE  L   RFK  TY GRPWK YSTT++MES +GD +   GW  +  +N E
Sbjct  435   TVIQNCRIVPEQKLFIDRFKFPTYLGRPWKPYSTTIIMESTLGDFIRREGWMPFATQNHE  494

Query  1891  KTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDA-NSWLPATGVPFAI  2067
              T  Y EY N GPGAN   R   +K +  +    A  FT   +L +  +WLP TGVPF  
Sbjct  495   DTLYYAEYNNRGPGANLDARVN-WKGYHKIDKATAMKFTVEAFLHSKENWLPLTGVPFTA  553

Query  2068  G  2070
             G
Sbjct  554   G  554



>ref|XP_003591319.1| Pectinesterase [Medicago truncatula]
 gb|AES61570.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=572

 Score =   432 bits (1111),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 235/550 (43%), Positives = 327/550 (59%), Gaps = 35/550 (6%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQ  663
             K+V T CQ  E + +C  ++  V   +S+    ++ AA++A+ + V  +  +     +E 
Sbjct  39    KNVQTMCQTTEDQKLCHDTLGSVKPANSSDPTAYLAAAVQASAQSVILALNMSDKLTVEH  98

Query  664   STD-PYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTT  840
               D P   MA++DCK+++Q A+D L++S ++V D  +  +  +     NW+SAV +YQ +
Sbjct  99    GKDKPGVKMALDDCKDLMQFALDSLESSANLVRDNNIQAIHDQTPDFRNWLSAVISYQQS  158

Query  841   CTEQI------ESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKA  1002
             C +        E ++ K    + +    +LT   ++I+  MS +L+ F++    DL    
Sbjct  159   CMDGFDNGTDGEDQVKKQLQTESLDQMEKLTGITLDIVTSMSNILQTFDLKL--DL----  212

Query  1003  ADKnnnnnnnTTSRRLLQTDH-----FPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQ  1167
                      N  SRRL++ +       P+WF  ADRKLLA    G   PN VVAKDGSG+
Sbjct  213   ---------NPASRRLMEANEIDDEGLPKWFSAADRKLLA-NAGGGPPPNAVVAKDGSGK  262

Query  1168  FKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYA  1347
             FKT+  A+ SYP   K +Y+IYVKAGVYDE + + K   N+ MYGDG  K+IITG KN+ 
Sbjct  263   FKTVKEAIDSYPKGFKGRYIIYVKAGVYDEYITIPKTSINILMYGDGPTKSIITGHKNFV  322

Query  1348  HMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDT  1527
                + T +TATF+ +  GF+A+ I F NTAGP  HQAVA+R+Q DMSA FDC++ G+QDT
Sbjct  323   D-GVKTMQTATFANVANGFIAKSIAFENTAGPAKHQAVAFRNQGDMSAFFDCAMHGFQDT  381

Query  1528  LYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKG  1707
             LY    RQFYRNC ISGTIDFIFG    LIQNS II RKP   QFNT+TADG +      
Sbjct  382   LYVQANRQFYRNCEISGTIDFIFGSSPTLIQNSRIIVRKPGPSQFNTVTADGTKQRNMAT  441

Query  1708  GVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENF  1887
             G+V+QNC IVP+  L P+R +VK+Y GRPWK ++ TV MES IGD+++P GW  W G  F
Sbjct  442   GIVIQNCEIVPDRDLFPVRNQVKSYLGRPWKDFAKTVFMESNIGDVIAPEGWTPWAGTQF  501

Query  1888  EKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWL------DANSWLPAT  2049
               T  Y E+ N+GPGAN   R +       +    A  FTA  +L       A+ WL AT
Sbjct  502   LDTLYYAEFANTGPGANLNARVKWKGYHPQISKNEATQFTAANFLKAGPGGKADDWLKAT  561

Query  2050  GVPFAIGYTK  2079
             G+P+AIG+ K
Sbjct  562   GIPYAIGFEK  571



>ref|XP_006652375.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58-like 
[Oryza brachyantha]
Length=568

 Score =   432 bits (1110),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 221/536 (41%), Positives = 316/536 (59%), Gaps = 21/536 (4%)
 Frame = +1

Query  478   SMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKI  657
             S KSV + C    YK+ C K+++  A+N +   ++   A  K  LE +  + +   +   
Sbjct  48    SGKSVKSLCAPTLYKESCEKTLT-TASNGTENPREVFTAVAKVALESIKSAVERSKDIGS  106

Query  658   EQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQT  837
              +S+DP    A EDCKE+L+D++DDL+  + + G  ++  L  R+D L +W++ V  +  
Sbjct  107   AKSSDPMTEGAREDCKELLEDSVDDLRGMVEMAGG-DVKVLFSRSDDLEHWLTGVMTFMD  165

Query  838   TCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnn  1017
             TC +       K+ ++  + NA++L++NA+ I   +  + K  ++    D+    +    
Sbjct  166   TCADGFTDEKLKADMQQVLRNASELSSNALAITNSLGAIFKKLDL----DMFKGDS----  217

Query  1018  nnnnnTTSRRLLQTDH----FPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITG  1185
                   T R LL        FP W    DRKLLA+  R   +PN VVAKDGSGQFK+I  
Sbjct  218   -----LTRRSLLAEQEMVGGFPSWMKAPDRKLLASGDRNRPQPNAVVAKDGSGQFKSIQE  272

Query  1186  ALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITT  1365
             A+ + P  H  +YVIYVK G+YDEIV V K   N+FMYGDG   + +TG+K++A   ITT
Sbjct  273   AVNAMPKGHPGRYVIYVKTGLYDEIVMVPKDKVNIFMYGDGPKSSRVTGRKSFAD-GITT  331

Query  1366  SKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTY  1545
              KTATFS    GF+ + + F NTAG E HQA   R Q D++A ++C  + +QDTLY H  
Sbjct  332   MKTATFSIEAAGFICKNMGFHNTAGAERHQAGGLRVQGDLAAFYNCRFDAFQDTLYVHAR  391

Query  1546  RQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQN  1725
             RQF+RNCVISGTIDFIFG   A+ QN +II R+P+ +Q N++TA G+     K G+V+QN
Sbjct  392   RQFFRNCVISGTIDFIFGNSAAVFQNCLIITRRPMDNQQNSVTAHGRTDPNMKSGLVIQN  451

Query  1726  CRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMY  1905
             CR+VP+  L P RFK+ +Y GRPWK YS  V+MES I D + P G+  W+G+    T  Y
Sbjct  452   CRLVPDQKLFPDRFKIPSYLGRPWKEYSRLVIMESTIADFIKPEGYMPWNGDFALNTLYY  511

Query  1906  YEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIGY  2073
              EY N GPGA T +R   +K F V+G   A  FT G ++D  +WL  TG P  +G+
Sbjct  512   AEYNNRGPGAGTSKRVN-WKGFRVIGQKEAEQFTTGPFVDGATWLKFTGTPHFLGF  566



>ref|XP_003535291.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor VGDH2-like 
[Glycine max]
Length=561

 Score =   429 bits (1104),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 236/557 (42%), Positives = 332/557 (60%), Gaps = 36/557 (6%)
 Frame = +1

Query  445   SGKGDHGVSTGSMKS----VTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATL  612
             S KG +  + G +KS    VT  CQ ++ K +C   +S   +++S   K++I   +++++
Sbjct  28    SPKGVNNSNGGEVKSTNRAVTALCQGSDDKKLCHDVLS---SSNSTDPKEYIATVVRSSM  84

Query  613   EEVHKSHQLVVNTKIEQSTDPYN-HMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHR  789
             + V K+  +     +E         MA+EDCK++LQ A+ DL+AS  +V ++ L  +  R
Sbjct  85    DSVIKALNMSDRLTVEHGNSSAGMKMALEDCKDLLQSAMHDLEASGVLVKESSLQDVHQR  144

Query  790   ADQLLNWMSAVYAYQTTCTEQIESRLYKSAIED----GMINATQLTNNAINIIAEMSKLL  957
               +L NW+ AV AYQ +C +  ++   K   E      + N  +LT  A+++++ ++ +L
Sbjct  145   TAELKNWLGAVVAYQQSCLDGFDTDGEKKVQEQLQSGSLDNVGKLTGLALDVVSGITHIL  204

Query  958   KAFNITTTTDLLHKAADKnnnnnnnTTSRRLLQTDH--FPEWFPIADRKLLAAQRRGNLR  1131
             ++ ++    DL  K A           SRRLL  D   FP W   ADRKLLA      + 
Sbjct  205   QSLDL----DLALKPA-----------SRRLLDVDDDGFPTWVSSADRKLLA---NDPVL  246

Query  1132  PNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGA  1311
             P+  VAKDGSGQF T+  A+ SYP  H+ +YVIYVKAG+YDE + V KK  N+ +YGDG 
Sbjct  247   PHATVAKDGSGQFHTVLDAINSYPKHHQGRYVIYVKAGIYDEYITVDKKKPNLLIYGDGP  306

Query  1312  GKTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSA  1491
              KTIITG+KN+ H    T +TATFS + + F+A+ I F NTAG EGHQAVA R Q D S 
Sbjct  307   SKTIITGRKNF-HEGTKTMRTATFSTVAEDFMAKSIAFENTAGAEGHQAVALRVQGDRSV  365

Query  1492  IFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTI  1671
              FDC++ GYQDTLY H +RQFYRNC ISGTIDFIFG  T LIQNS I+ RKP+ +Q N +
Sbjct  366   FFDCAMRGYQDTLYAHAHRQFYRNCEISGTIDFIFGYSTTLIQNSKILVRKPMPNQQNIV  425

Query  1672  TADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLS  1851
              ADG        GVVLQNC I+P+ +L   R  VKTY  RPWKA+S  V +E+ +GDL+ 
Sbjct  426   VADGTGQKNMPTGVVLQNCEIMPDASLFADRMIVKTYLARPWKAFSRAVFIENVMGDLIQ  485

Query  1852  PLGWKIWDG-ENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDA  2028
             P G+  W+  E   + C + E+ N+GPG+ T  R +  K   ++    A  FTA  WL  
Sbjct  486   PEGYIPWNPIEPNTQDCYFAEFGNTGPGSVTQARAKFAKG--LISKQEAAKFTAEPWLTT  543

Query  2029  NSWLPATGVPFAIGYTK  2079
             ++WLP+  VPF   +TK
Sbjct  544   STWLPSAAVPFDPSFTK  560



>ref|XP_010523883.1| PREDICTED: pectinesterase 5 [Tarenaya hassleriana]
Length=568

 Score =   427 bits (1098),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 231/545 (42%), Positives = 317/545 (58%), Gaps = 24/545 (4%)
 Frame = +1

Query  472   TGSMKSVTTFCQYAEYKDVCAKSISHV-ANNHSATTKDFIFAAIKATLEEVHKSHQLVVN  648
             T  MK+V   CQ    K  C K++     ++ +   K F+ A   A  +  + + Q   +
Sbjct  35    TPQMKAVQAICQSTTDKASCVKTLEPANTDDPNKLIKAFMLATQDALTKSYNFTGQTEAS  94

Query  649   TKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYA  828
                  +  P N   +E CK +   A++DL++ +  +G+ +L     + DQL  W++ V+ 
Sbjct  95    VSNSTANGPTNKAVLEYCKRVFTYALEDLKSVLEEMGE-DLEQTGSKLDQLKQWLTGVFV  153

Query  829   YQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAAD  1008
             YQ++C + IE    +  + +G+ ++  LT+NAI+I +          + T+   L  A +
Sbjct  154   YQSSCLDDIEDADLRKMMAEGIADSQILTSNAIDIFS---------TVVTSMAELGLAKN  204

Query  1009  KnnnnnnnTTSRRLLQTDH-----FPEWFPIADRKLLAAQRRGN----LRPNVVVAKDGS  1161
                +       RRLL+         P W   ADRKLLA   RG     +RP  VVAKDGS
Sbjct  205   GTISLPGAPAGRRLLEEAETAEGGIPTWMSGADRKLLAKAGRGGAAPRIRPTYVVAKDGS  264

Query  1162  GQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKN  1341
             GQFKT+  A+ + P K+  + +IY+KAGVY E V + K   N+FM+GDGA KTIIT  ++
Sbjct  265   GQFKTVGQAVNACPNKNPGRCIIYIKAGVYREQVIIPKSKNNIFMFGDGARKTIITYNRS  324

Query  1342  YA-HMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGY  1518
                    TTS + T     +GF+A+ I F+NTAGP GHQAVA R   D +AIF+C  +GY
Sbjct  325   VKLSPATTTSLSGTVQVESEGFMAKYIGFKNTAGPMGHQAVAIRVNGDRAAIFNCRFDGY  384

Query  1519  QDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELA-  1695
             QDTLY +  RQFYRNCV+SGT+DFIFGK   +IQNS+I+ RK    Q+NT+TADG E   
Sbjct  385   QDTLYVNNGRQFYRNCVVSGTVDFIFGKSATVIQNSLIVVRKGNPGQYNTVTADGNEKGF  444

Query  1696  KAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWD  1875
               K G+VLQNCRIVP+  L+P R KV +Y GRPWK +STT+VM ++IGDL+ P GW IW+
Sbjct  445   NVKIGIVLQNCRIVPDRKLSPERLKVASYLGRPWKKFSTTIVMNTEIGDLIRPEGWMIWE  504

Query  1876  GENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGV  2055
             GE+F K+C Y EY N GPGANT RR    K   V   +    FT   WL    WL ATGV
Sbjct  505   GESFHKSCKYIEYNNRGPGANTARRVNWAKVARVGSEVNG--FTVANWLGPVQWLQATGV  562

Query  2056  PFAIG  2070
             PF +G
Sbjct  563   PFTLG  567



>ref|XP_002516193.1| Pectinesterase-1 precursor, putative [Ricinus communis]
 gb|EEF46195.1| Pectinesterase-1 precursor, putative [Ricinus communis]
Length=593

 Score =   427 bits (1099),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 235/544 (43%), Positives = 321/544 (59%), Gaps = 19/544 (3%)
 Frame = +1

Query  445   SGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVA--NNHSATTKDFIFAAIKATLEE  618
             S K D+   +   K +   C    YK+ C  S+      +  SA  KD +  AI +T +E
Sbjct  65    SQKPDNSEVSHLGKVIDNVCNATTYKETCHTSLKKAVEKDPSSAHPKDVLKLAIGSTEDE  124

Query  619   VHKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQ  798
               +  + V + K E    P    A EDCKE++ DA ++L  SIS  G      LK+ AD 
Sbjct  125   FARILEKVKSFKFES---PREKAAFEDCKELIDDAKEELNKSISSAGGDTGKLLKNEAD-  180

Query  799   LLNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITT  978
             L NW+SAV +YQ TC +       KS +E     A +LT+N++ +++E++  L AF++  
Sbjct  181   LNNWLSAVMSYQQTCIDGFPEGKLKSDMEKTFKEAKELTSNSLAMVSELTAFLTAFSVP-  239

Query  979   TTDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDG  1158
                   K + +     +NT+S      D  P W    DR++L         PNV VAKDG
Sbjct  240   ------KPSRRLLAKESNTSS---FGEDGIPSWISPEDRRILKGSDGDKPTPNVTVAKDG  290

Query  1159  SGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKK  1338
             SGQFKTI+ AL + P K++ +YVIYVKAG+YDE V V K M NV +YGDG+ K+I+TG K
Sbjct  291   SGQFKTISDALAAMPEKYQGRYVIYVKAGIYDETVTVTKNMVNVTIYGDGSQKSIVTGSK  350

Query  1339  NYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGY  1518
             N+A   + T +TATF+ALG GF+A+ + FRNTAGP+ HQAVA R Q+D S   +C  EGY
Sbjct  351   NFAD-GVQTFRTATFAALGDGFIAKAMGFRNTAGPQKHQAVAVRVQADRSIFLNCRFEGY  409

Query  1519  QDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAK  1698
             QDTLY  T+RQFYR+CVISGTIDFIFG  TA+ QN +I+ RKP+ +Q N +TA G+  + 
Sbjct  410   QDTLYAQTHRQFYRSCVISGTIDFIFGDATAIFQNCLILVRKPMENQQNIVTAQGRIDSH  469

Query  1699  AKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDG  1878
                G+V+QNCRI P+  L P +  VK+Y GRPWK YS T+VMES I D + P GW  W+G
Sbjct  470   ETTGIVIQNCRIQPDKDLIPAKATVKSYLGRPWKDYSRTIVMESTIEDFIHPDGWLAWEG  529

Query  1879  ENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVP  2058
             E   KT  Y E+ N GPG+ T  R + +  + V+    A  +T   +L  + W+ A G P
Sbjct  530   EKGLKTLYYAEFNNKGPGSKTDARVK-WPGYHVIDQQEANKYTVKPFLQGD-WITAAGAP  587

Query  2059  FAIG  2070
                G
Sbjct  588   VHFG  591



>ref|XP_002447958.1| hypothetical protein SORBIDRAFT_06g018850 [Sorghum bicolor]
 gb|EES12286.1| hypothetical protein SORBIDRAFT_06g018850 [Sorghum bicolor]
Length=563

 Score =   425 bits (1093),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 228/545 (42%), Positives = 322/545 (59%), Gaps = 28/545 (5%)
 Frame = +1

Query  454   GDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSH  633
             GD  ++T S KSV + C    YKD C K++S  A N +   K+   +  K  LE V  + 
Sbjct  40    GDASLAT-SGKSVKSLCAPTLYKDSCEKTLSQ-ATNGTENPKEIFHSVAKVALESVKTAV  97

Query  634   QLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWM  813
             +   N    +++D     A EDCK++L+DA+DDL+  + + G  ++  L  R+D L  W+
Sbjct  98    EQSKNIGEAKASDKMTESAREDCKKLLEDAVDDLRGMLDMAG-GDIKVLFSRSDDLETWL  156

Query  814   SAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLL  993
             + V  +  TC +       ++ +   + NAT+L++NA+ I   +  +LK  ++    D+ 
Sbjct  157   TGVMTFMDTCIDGFVDEKLRADMHSVLRNATELSSNALAITNSLGGILKKLDL----DMF  212

Query  994   HKAADKnnnnnnnTTSRRLLQTDH----FPEWFPIADRKLLAAQRRGNL-RPNVVVAKDG  1158
              K            + RRLL ++     +P W    +RKLLAA   GN  +PN VVAKDG
Sbjct  213   KK-----------DSRRRLLSSEQDEKGWPVWMRSPERKLLAA---GNQPKPNAVVAKDG  258

Query  1159  SGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKK  1338
             SGQFK+I  A+ + P   + +YVIYVKAGVYDEIV + K   N+FMYGDG   T +TG+K
Sbjct  259   SGQFKSIQQAVDAMPKGQQGRYVIYVKAGVYDEIVMIAKDKVNIFMYGDGPKNTRVTGQK  318

Query  1339  NYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGY  1518
             ++A   ITT KTATFS    GF+ + + F NTAG   HQAVA R Q D++A ++C  + +
Sbjct  319   SFAD-GITTMKTATFSIEAAGFICKNMGFHNTAGAAKHQAVALRVQGDLAAFYNCRFDAF  377

Query  1519  QDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAK  1698
             QDTLY H  RQF+RNCVISGTIDFIFG   A+ QN +II R+P+ +Q N++TA G+    
Sbjct  378   QDTLYVHARRQFFRNCVISGTIDFIFGNSAAVFQNCLIITRRPMDNQQNSVTAHGRTDPN  437

Query  1699  AKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDG  1878
              K G+V+QNCR+VP+  L   RFK+ +Y GRPWK +S  V+MES I D + P G+  W+G
Sbjct  438   MKSGIVIQNCRLVPDQKLFADRFKIPSYLGRPWKEFSRLVIMESTIADFIKPEGYMPWNG  497

Query  1879  ENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVP  2058
             +   KT  Y EY N GPGA T +R   +  F V+    A  FTAG ++D   WL  TG P
Sbjct  498   DFGIKTLFYAEYNNRGPGAGTSKRVN-WPGFHVITRKDAEQFTAGPFIDGALWLKFTGTP  556

Query  2059  FAIGY  2073
               +G+
Sbjct  557   HILGF  561



>gb|EAY94388.1| hypothetical protein OsI_16156 [Oryza sativa Indica Group]
Length=568

 Score =   426 bits (1094),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 223/536 (42%), Positives = 313/536 (58%), Gaps = 21/536 (4%)
 Frame = +1

Query  478   SMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKI  657
             S KSV + C    YK+ C K+++  A + +   K+      K+ LE +  + +       
Sbjct  48    SGKSVESLCAPTLYKESCEKTLT-TATSGTENPKEVFSTVAKSALESIKSAVEKSKAIGE  106

Query  658   EQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQT  837
              +++D     A EDCK +L+D++DDL+  I + G  ++  L  R+D L +W++ V  +  
Sbjct  107   AKTSDSMTESAREDCKALLEDSVDDLRGMIEMAGG-DVKVLFSRSDDLEHWLTGVMTFMD  165

Query  838   TCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnn  1017
             TC +       K+ +   + NA++L++NA+ I             T T   + K  D + 
Sbjct  166   TCADGFADEKLKADMHSVLRNASELSSNALAI-------------TNTLGAIFKKLDLDM  212

Query  1018  nnnnnTTSRRLLQTDH----FPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITG  1185
                 N   R L+        FP W    DRKLLA+  R   +PN VVA+DGSGQFKTI  
Sbjct  213   FKGENPIHRSLIAEQETVGGFPSWMKAPDRKLLASGDRNRPQPNAVVAQDGSGQFKTIQE  272

Query  1186  ALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITT  1365
             A+ S P  H+ +YVIYVKAG+YDEIV V K   N+FMYGDG  ++ +TG+K++A   ITT
Sbjct  273   AVNSMPKGHQGRYVIYVKAGLYDEIVMVPKDKVNIFMYGDGPKRSRVTGRKSFAD-GITT  331

Query  1366  SKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTY  1545
              KTATFS    GF+ + + F NTAG E HQAVA R   D+ A ++C  + +QDTLY H  
Sbjct  332   MKTATFSVEAAGFICKNMGFHNTAGAERHQAVALRINGDLGAFYNCRFDAFQDTLYVHAR  391

Query  1546  RQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQN  1725
             RQF+RNCVISGTIDFIFG   A+ QN +II R+P+ +Q N++TA G+     K G+V+QN
Sbjct  392   RQFFRNCVISGTIDFIFGNSAAVFQNCLIITRRPMDNQQNSVTAHGRTDPNMKSGLVIQN  451

Query  1726  CRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMY  1905
             CR+VP+  L P RFK+ +Y GRPWK YS  V+MES I D + P G+  W+GE    T  Y
Sbjct  452   CRLVPDQKLFPDRFKIPSYLGRPWKEYSRLVIMESTIADFIKPEGYMPWNGEFALNTLYY  511

Query  1906  YEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIGY  2073
              E+ N GPGA T +R   +K F V+G   A  FTAG ++D  +WL  TG P  +G+
Sbjct  512   AEFNNRGPGAGTSKRVN-WKGFRVIGQKEAEQFTAGPFVDGGTWLKFTGTPHFLGF  566



>ref|XP_010939548.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=576

 Score =   426 bits (1094),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 233/567 (41%), Positives = 335/567 (59%), Gaps = 45/567 (8%)
 Frame = +1

Query  442   SSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEV  621
             SSG GD G+S+ S + V+ FCQ  +Y+D C +++S V+N  S    + I  AI AT + +
Sbjct  33    SSGGGDVGLSSTS-RYVSAFCQPTQYQDTCERTLSKVSN--STAPNEIIQMAINATKDAI  89

Query  622   HKSHQL---------VVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELH  774
                  +          +   + Q        A+ DCK++L+D ID L A+  +  + E  
Sbjct  90    RSKFDVPDKILKDIPSLAPNLPQRNLSMLQDALTDCKKLLEDTIDFLDATYVLSNNME--  147

Query  775   TLKHRADQLLNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKL  954
              L  R++ ++ WM+++    ++C + IE      A+   + N+T+L +NA+ ++A  SK+
Sbjct  148   DLVLRSNDVITWMTSMNLQVSSCLDGIEHPAVHQAMIKELGNSTELRSNALTMVARASKV  207

Query  955   LKAFNITTTTDLLHKAADKnnnnnnnTTSRRLLQTDH---------FPEWFPIADRKLLA  1107
              +AF I      L+  AD         + RRLL  D          +P W    DRKLLA
Sbjct  208   FQAFGIQ-----LNTGAD---------SRRRLLTHDETVYDRDSEGYPTWLSTTDRKLLA  253

Query  1108  AQRRGNLRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKN  1287
                +  ++PNVVVAKDGSG FKTI  ALK+ P  +  +YVIYVKAGVY+E V + KK  N
Sbjct  254   ---QDMVKPNVVVAKDGSGNFKTINDALKAMPAAYPGRYVIYVKAGVYNEKVLIDKKKIN  310

Query  1288  VFMYGDGAGKTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAY  1467
             +FMYGDG+ KTI+TG  NY    + T +TA+F+    GF+ + + FRNTAGPEGHQAVA+
Sbjct  311   IFMYGDGSKKTIVTGNANY-KAGVKTDQTASFAVQAPGFICKHMGFRNTAGPEGHQAVAF  369

Query  1468  RSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKP  1647
             R  +D++  F C  +GYQDTLY  + R F+RNCV+SGTIDFIFG G +++QN +II R+P
Sbjct  370   RINADLAVFFKCRFDGYQDTLYVQSGRHFFRNCVVSGTIDFIFGGGASVLQNCLIIVRRP  429

Query  1648  LVHQFNTITADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVME  1827
             + +QF+ +TA   +L      +V+ N RI P+  L P RF++KTY GRPWKAY+ TVVME
Sbjct  430   MDNQFSAVTAAAGDLPDENSAIVIHNSRIRPDQRLFPDRFRLKTYLGRPWKAYAKTVVME  489

Query  1828  SQIGDLLSPLGWKIWDGE-NFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHF  2004
             ++IGDL+ P GWK WDG+    KT  Y E++N GPGA+T  R R +  F V+    A+ F
Sbjct  490   TEIGDLIQPEGWKEWDGQPEHCKTAYYAEFQNRGPGADTRARVR-WPAFHVIQRQEAQKF  548

Query  2005  TAG--LWLDANSWLPATGVPFAIGYTK  2079
             T    L+     W+   G P   G+ +
Sbjct  549   TVSNLLYTHGGDWIALAGAPQIKGFRR  575



>gb|EAY94391.1| hypothetical protein OsI_16158 [Oryza sativa Indica Group]
Length=568

 Score =   425 bits (1093),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 222/536 (41%), Positives = 313/536 (58%), Gaps = 21/536 (4%)
 Frame = +1

Query  478   SMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKI  657
             S KSV + C    YK+ C K+++  A + +   K+      K+ LE +  + +       
Sbjct  48    SGKSVESLCAPTLYKESCEKTLT-TATSGTENPKEVFSTVAKSALESIKSAVEKSKAIGE  106

Query  658   EQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQT  837
              +++D     A EDCK +L+D++DDL+  + + G  ++  L  R+D+L +W++ V  +  
Sbjct  107   AKTSDSMTESAREDCKALLEDSVDDLRGMVEMAGG-DVKVLFSRSDELEHWLTGVMTFMD  165

Query  838   TCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnn  1017
             TC +       K+ +   + NA++L++NA+ I             T T   + K  D + 
Sbjct  166   TCADGFADEKLKADMHSVLRNASELSSNALAI-------------TNTLGAIFKKLDLDM  212

Query  1018  nnnnnTTSRRLLQTDH----FPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITG  1185
                 N   R L+        FP W    DRKLLA+  R   +PN VVA+DGSGQFKTI  
Sbjct  213   FKGENPIHRSLIAEQETVGGFPSWMKAPDRKLLASGDRNRPQPNAVVAQDGSGQFKTIQE  272

Query  1186  ALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITT  1365
             A+ S P  H+ +YVIYVKAG+YDEIV V K   N+FMYGDG  ++ +TG+K++A   ITT
Sbjct  273   AVNSMPKGHQGRYVIYVKAGLYDEIVMVPKDKVNIFMYGDGPKRSRVTGRKSFAD-GITT  331

Query  1366  SKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTY  1545
              KTATFS    GF+ + + F NTAG E HQAVA R   D+ A ++C  + +QDTLY H  
Sbjct  332   MKTATFSVEAAGFICKNMGFHNTAGAERHQAVALRINGDLGAFYNCRFDAFQDTLYVHAR  391

Query  1546  RQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQN  1725
             RQF+RNCVISGTIDFIFG   A+ QN +II R+P+ +Q N++TA G+     K G+V+QN
Sbjct  392   RQFFRNCVISGTIDFIFGNSAAVFQNCLIITRRPMDNQQNSVTAHGRTDPNMKSGLVIQN  451

Query  1726  CRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMY  1905
             CR+VP+  L P RFK+  Y GRPWK YS  V+MES I D + P G+  W+GE    T  Y
Sbjct  452   CRLVPDQKLFPDRFKIPAYLGRPWKEYSRLVIMESTIADFIKPEGYMPWNGEFALNTLYY  511

Query  1906  YEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIGY  2073
              E+ N GPGA T +R   +K F V+G   A  FTAG ++D  +WL  TG P  +G+
Sbjct  512   AEFNNRGPGAGTSKRVN-WKGFRVIGQKEAEQFTAGPFVDGGTWLKFTGTPHFLGF  566



>ref|NP_001052981.1| Os04g0458900 [Oryza sativa Japonica Group]
 emb|CAD40902.1| OSJNBa0036B21.20 [Oryza sativa Japonica Group]
 dbj|BAF14895.1| Os04g0458900 [Oryza sativa Japonica Group]
 gb|EAZ30965.1| hypothetical protein OsJ_15044 [Oryza sativa Japonica Group]
 dbj|BAH00497.1| unnamed protein product [Oryza sativa Japonica Group]
 emb|CBW45776.1| ORW1943Ba0077G13.4 [Oryza rufipogon]
Length=568

 Score =   425 bits (1092),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 222/536 (41%), Positives = 313/536 (58%), Gaps = 21/536 (4%)
 Frame = +1

Query  478   SMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKI  657
             S KSV + C    YK+ C K+++  A + +   K+      K+ LE +  + +       
Sbjct  48    SGKSVESLCAPTLYKESCEKTLT-TATSGTENPKEVFSTVAKSALESIKSAVEKSKAIGE  106

Query  658   EQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQT  837
              +++D     A EDCK +L+D++DDL+  + + G  ++  L  R+D L +W++ V  +  
Sbjct  107   AKTSDSMTESAREDCKALLEDSVDDLRGMVEMAGG-DVKVLFSRSDDLEHWLTGVMTFMD  165

Query  838   TCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnn  1017
             TC +       K+ +   + NA++L++NA+ I             T T   + K  D + 
Sbjct  166   TCADGFADEKLKADMHSVLRNASELSSNALAI-------------TNTLGAIFKKLDLDM  212

Query  1018  nnnnnTTSRRLLQTDH----FPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITG  1185
                 N   R L+        FP W    DRKLLA+  R   +PN VVA+DGSGQFKTI  
Sbjct  213   FKGENPIHRSLIAEQETVGGFPSWMKAPDRKLLASGDRNRPQPNAVVAQDGSGQFKTIQE  272

Query  1186  ALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITT  1365
             A+ S P  H+ +YVIYVKAG+YDEIV V K   N+FMYGDG  ++ +TG+K++A   ITT
Sbjct  273   AVNSMPKGHQGRYVIYVKAGLYDEIVMVPKDKVNIFMYGDGPKRSRVTGRKSFAD-GITT  331

Query  1366  SKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTY  1545
              KTATFS    GF+ + + F NTAG E HQAVA R   D+ A ++C  + +QDTLY H  
Sbjct  332   MKTATFSVEAAGFICKNMGFHNTAGAERHQAVALRINGDLGAFYNCRFDAFQDTLYVHAR  391

Query  1546  RQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQN  1725
             RQF+RNCVISGTIDFIFG   A+ QN +II R+P+ +Q N++TA G+     K G+V+QN
Sbjct  392   RQFFRNCVISGTIDFIFGNSAAVFQNCLIITRRPMDNQQNSVTAHGRTDPNMKSGLVIQN  451

Query  1726  CRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMY  1905
             CR+VP+  L P RFK+ +Y GRPWK YS  V+MES I D + P G+  W+GE    T  Y
Sbjct  452   CRLVPDQKLFPDRFKIPSYLGRPWKEYSRLVIMESTIADFIKPEGYMPWNGEFALNTLYY  511

Query  1906  YEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIGY  2073
              E+ N GPGA T +R   +K F V+G   A  FTAG ++D  +WL  TG P  +G+
Sbjct  512   AEFNNRGPGAGTSKRVN-WKGFRVIGQKEAEQFTAGPFVDGGTWLKFTGTPHFLGF  566



>emb|CAH67075.1| OSIGBa0097P08.5 [Oryza sativa Indica Group]
Length=568

 Score =   425 bits (1092),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 222/536 (41%), Positives = 313/536 (58%), Gaps = 21/536 (4%)
 Frame = +1

Query  478   SMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKI  657
             S KSV + C    YK+ C K+++  A + +   K+      K+ LE +  + +       
Sbjct  48    SGKSVESLCAPTLYKESCEKTLT-TATSGTENPKEVFSTVAKSALESIKSAVEKSKAIGE  106

Query  658   EQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQT  837
              +++D     A EDCK +L+D++DDL+  + + G  ++  L  R+D L +W++ V  +  
Sbjct  107   AKTSDSMTESAREDCKALLEDSVDDLRGMVEMAGG-DVKVLFSRSDDLEHWLTGVMTFMD  165

Query  838   TCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnn  1017
             TC +       K+ +   + NA++L++NA+ I             T T   + K  D + 
Sbjct  166   TCADGFADEKLKADMHSVLRNASELSSNALAI-------------TNTLGAIFKKLDLDM  212

Query  1018  nnnnnTTSRRLLQTDH----FPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITG  1185
                 N   R L+        FP W    DRKLLA+  R   +PN VVA+DGSGQFKTI  
Sbjct  213   FKGENPIHRSLIAEQETVGGFPSWMKAPDRKLLASGDRNRPQPNAVVAQDGSGQFKTIQE  272

Query  1186  ALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITT  1365
             A+ S P  H+ +YVIYVKAG+YDEIV V K   N+FMYGDG  ++ +TG+K++A   ITT
Sbjct  273   AVNSMPKGHQCRYVIYVKAGLYDEIVMVPKDKVNIFMYGDGPKRSRVTGRKSFAD-GITT  331

Query  1366  SKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTY  1545
              KTATFS    GF+ + + F NTAG E HQAVA R   D+ A ++C  + +QDTLY H  
Sbjct  332   MKTATFSVEAAGFICKNMGFHNTAGAERHQAVALRINGDLGAFYNCRFDAFQDTLYVHAR  391

Query  1546  RQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQN  1725
             RQF+RNCVISGTIDFIFG   A+ QN +II R+P+ +Q N++TA G+     K G+V+QN
Sbjct  392   RQFFRNCVISGTIDFIFGNSAAVFQNCLIITRRPMDNQQNSVTAHGRTDPNMKSGLVIQN  451

Query  1726  CRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMY  1905
             CR+VP+  L P RFK+ +Y GRPWK YS  V+MES I D + P G+  W+GE    T  Y
Sbjct  452   CRLVPDQKLFPDRFKIPSYLGRPWKEYSRLVIMESTIADFIKPEGYMPWNGEFALNTLYY  511

Query  1906  YEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIGY  2073
              E+ N GPGA T +R   +K F V+G   A  FTAG ++D  +WL  TG P  +G+
Sbjct  512   AEFNNRGPGAGTSKRVN-WKGFRVIGQKEAEQFTAGPFVDGGTWLKFTGTPHFLGF  566



>gb|ACF79975.1| unknown [Zea mays]
 gb|ACG46952.1| pectinesterase-1 precursor [Zea mays]
 gb|AFW58467.1| pectinesterase [Zea mays]
Length=563

 Score =   424 bits (1090),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 222/537 (41%), Positives = 319/537 (59%), Gaps = 27/537 (5%)
 Frame = +1

Query  478   SMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKI  657
             S KSV + C    YK+ C K++S  A N +   K+   +  K  LE V  + +   +   
Sbjct  47    SGKSVKSLCAPTLYKESCEKTLSQ-ATNGTENPKEVFHSVAKVALESVQTAVEQSKSIGE  105

Query  658   EQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQT  837
              +++D     A EDCK++L+DA DDL+  + + G  ++  L  R+D L  W++ V  +  
Sbjct  106   AKASDSMTESAREDCKKLLEDAADDLRGMLEMAGG-DIKVLFSRSDDLETWLTGVMTFMD  164

Query  838   TCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnn  1017
             TC +       K+ +   + NAT+L++NA+ I   +  +LK  ++   +           
Sbjct  165   TCVDGFVDEKLKADMHSVLRNATELSSNALAITNSLGGILKKMDLGMFS-----------  213

Query  1018  nnnnnTTSRRLLQTDH----FPEWFPIADRKLLAAQRRGNL-RPNVVVAKDGSGQFKTIT  1182
                   + RRLL ++     +P W    +RKLLA+   GN  +PN +VAKDGSGQFK+I 
Sbjct  214   ----KDSRRRLLSSEQDEKGWPVWMRSPERKLLAS---GNQPKPNAIVAKDGSGQFKSIQ  266

Query  1183  GALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKIT  1362
              A+ + P  H+ +YVIYVKAG+YDEIV V K   N+FMYGDG  ++ +TG+K++A   IT
Sbjct  267   QAVDAVPKGHQGRYVIYVKAGLYDEIVMVPKDKVNIFMYGDGPKQSRVTGRKSFAD-GIT  325

Query  1363  TSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHT  1542
             T KTATFS    GF+ + + F NTAG E HQAVA R Q D++A ++C  + +QDTLY H 
Sbjct  326   TMKTATFSVEASGFICKNMGFHNTAGAERHQAVALRVQGDLAAFYNCRFDAFQDTLYVHA  385

Query  1543  YRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQ  1722
              RQF+RNCV+SGTIDFIFG   A+ QN +II R+P+ +Q N++TA G+     K G+V+Q
Sbjct  386   RRQFFRNCVVSGTIDFIFGNSAAVFQNCLIITRRPMDNQQNSVTAHGRTDPNMKSGLVIQ  445

Query  1723  NCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCM  1902
             NCR+VP+  L P RFK+ +Y GRPWK +S  V+MES I D + P G+  W+G+   KT  
Sbjct  446   NCRLVPDQKLFPDRFKIPSYLGRPWKEFSRLVIMESTIADFVKPEGYMPWNGDFALKTLY  505

Query  1903  YYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIGY  2073
             Y EY N GPGA T +R   +  F V+G   A  FTAG ++D   WL  TG P  +G+
Sbjct  506   YAEYNNRGPGAGTSKRVN-WPGFHVIGRKEAEPFTAGPFIDGAMWLKYTGAPHILGF  561



>gb|EMS49616.1| Putative pectinesterase/pectinesterase inhibitor 28 [Triticum 
urartu]
Length=563

 Score =   424 bits (1090),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 224/543 (41%), Positives = 324/543 (60%), Gaps = 26/543 (5%)
 Frame = +1

Query  454   GDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSH  633
             G+  ++T S KSV + C    YK+ C K+++  A+N +   K+      K+ +E +  + 
Sbjct  42    GEANLAT-SGKSVKSLCAPTLYKESCEKTLTS-ASNGTENPKEVFATVAKSAMESIKSAV  99

Query  634   QLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWM  813
             +   +    +S+DP    A +DCKE+L+D++DDL+  + + G  ++  L  R D L +W+
Sbjct  100   ERSKSIGEVKSSDPLTEGARQDCKELLEDSVDDLKGMVEMAGG-DIKVLLSRTDDLEHWI  158

Query  814   SAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITT-TTDL  990
             + V  +  TC +       K+ ++  + NAT+L++NA+ I   +  + K  ++    TD 
Sbjct  159   TGVMTFIDTCADGFADEKLKADMQGILRNATELSSNALAITNSLGAIFKKLDLDVFKTD-  217

Query  991   LHKAADKnnnnnnnTTSRRLLQTDH--FPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSG  1164
                            + RRLL  +   +P W    +RKLLA+   G   PN VVAKDGSG
Sbjct  218   ---------------SRRRLLSAEESKYPAWMKAPERKLLASG--GLPAPNAVVAKDGSG  260

Query  1165  QFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNY  1344
             +FKTI  A+ S P  H  +YVIYVKAGVY+E+V V K   N+FMYGDG  ++ +TG K++
Sbjct  261   KFKTIQDAVNSMPKDHPGRYVIYVKAGVYEEMVMVPKDKVNIFMYGDGPKQSRVTGSKSF  320

Query  1345  AHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQD  1524
             A   ITT KTATFS    GF+ + + F NTAG E HQAVA R Q D+SA F+C  + +QD
Sbjct  321   AD-GITTMKTATFSIEAAGFICKNMGFHNTAGAEKHQAVALRVQGDLSAFFNCRFDAFQD  379

Query  1525  TLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAK  1704
             TLY H  RQF+RNCVISGTIDFIFG   A+ QN +II R+P+ +Q N++TA G+     K
Sbjct  380   TLYVHARRQFFRNCVISGTIDFIFGNSAAVFQNCLIITRRPMDNQQNSVTAHGRTDPNMK  439

Query  1705  GGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGEN  1884
              G+V+QNCR+VP+  L   RFK+ +Y GRPWK +S  V+MES I D + P G+  W+G+ 
Sbjct  440   SGLVIQNCRLVPDQKLFADRFKIPSYLGRPWKEFSRLVIMESMIADFIKPEGYMPWNGDF  499

Query  1885  FEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFA  2064
               KT  Y E+ N GPGA T +R   +  F V+G   A  FTAG ++D  +WL  TG+P  
Sbjct  500   ALKTLYYAEFGNRGPGAGTSKR-VTWPGFRVIGNKEAEQFTAGPFIDGATWLKFTGMPNY  558

Query  2065  IGY  2073
             +G+
Sbjct  559   LGF  561



>gb|EMT00807.1| Putative pectinesterase/pectinesterase inhibitor 28 [Aegilops 
tauschii]
Length=563

 Score =   423 bits (1088),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 221/535 (41%), Positives = 319/535 (60%), Gaps = 25/535 (5%)
 Frame = +1

Query  478   SMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKI  657
             S KSV + C    YK+ C K+++  A+N +   K+      K+ +E +  + +   +   
Sbjct  49    SGKSVKSLCAPTLYKESCEKTLTS-ASNGTENPKEVFATVAKSAMESIKSAVERSKSIGE  107

Query  658   EQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQT  837
              +S+DP    A +DCKE+L+D++DDL+  + + G  ++  L  R D L +W++ V  +  
Sbjct  108   AKSSDPLTEGARQDCKELLEDSVDDLKGMVEMAGG-DIKVLLGRTDDLEHWITGVMTFID  166

Query  838   TCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITT-TTDLLHKAADKn  1014
             TC +       K+ ++  + NAT+L++NA+ I   +  + K  ++    TD         
Sbjct  167   TCADGFADEKLKADMQGILRNATELSSNALAITNSLGAIFKKLDLDVFKTD---------  217

Query  1015  nnnnnnTTSRRLLQTDH--FPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGA  1188
                    + RRLL  +   +P W    +RKLLA+   G  +PN +VAKDGSG+FKTI  A
Sbjct  218   -------SRRRLLSAEESKYPAWMRAPERKLLASG--GLPQPNAIVAKDGSGKFKTIQDA  268

Query  1189  LKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTS  1368
             + S P  H  +YVIYVKAGVY+E+V V K   NVFMYGDG  ++ +TG K++A   ITT 
Sbjct  269   VNSMPKDHPGRYVIYVKAGVYEEMVMVPKDKANVFMYGDGPKQSRVTGSKSFAD-GITTM  327

Query  1369  KTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYR  1548
             KTATFS    GF+ + + F NTAG E HQAVA R Q D+SA F+C  + +QDTLY H  R
Sbjct  328   KTATFSIEAAGFICKNMGFHNTAGAEKHQAVALRVQGDLSAFFNCRFDAFQDTLYVHARR  387

Query  1549  QFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNC  1728
             QF+RNCVISGTIDFIFG   A+ QN +II R+P+ +Q N++TA G+     K G+V+QNC
Sbjct  388   QFFRNCVISGTIDFIFGNSAAVFQNCLIITRRPMDNQQNSVTAHGRTDPNMKSGLVIQNC  447

Query  1729  RIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYY  1908
             R+VP+  L   R K+ +Y GRPWK +S  V+MES I D + P G+  W+G+   KT  Y 
Sbjct  448   RLVPDQKLFADRLKIPSYLGRPWKEFSRLVIMESMIADFIKPEGYMPWNGDFGLKTLYYA  507

Query  1909  EYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIGY  2073
             E+ N GPGA T +R   +  F V+G   A  FTAG ++D  +WL  TG+P  +G+
Sbjct  508   EFGNRGPGAGTSKR-VTWPGFRVIGNKEAEQFTAGPFIDGATWLKFTGMPNYLGF  561



>tpg|DAA37472.1| TPA: hypothetical protein ZEAMMB73_350063 [Zea mays]
Length=562

 Score =   423 bits (1087),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 228/544 (42%), Positives = 322/544 (59%), Gaps = 27/544 (5%)
 Frame = +1

Query  454   GDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSH  633
             G+  ++T S KSV + C    YK+ C K++S  A N +   K+   +  K  LE V  + 
Sbjct  40    GEASIAT-SGKSVESLCAPTLYKESCEKTLSQ-ATNGTENPKEVFHSVAKVALESVKTAV  97

Query  634   QLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWM  813
             +        +++D     A EDCK++L+DA+DDL+  + + G  ++  L  R+D L  W+
Sbjct  98    EQSKTIGEAKASDSMTESAREDCKKLLEDAVDDLRGMLEMAGG-DIKVLISRSDDLETWL  156

Query  814   SAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLL  993
             + V  +  TC +       K+ +   + NAT+L++NA+ I   +  +LK  ++     + 
Sbjct  157   TGVMTFMDTCIDGFVDEKLKADMHTVLRNATELSSNALAITNSLGGILKKLDL----GMF  212

Query  994   HKAADKnnnnnnnTTSRRLLQTDH---FPEWFPIADRKLLAAQRRGNL-RPNVVVAKDGS  1161
              K            + RRLL       +P W    +RKLLAA   GN  +PN VVAKDGS
Sbjct  213   KK-----------DSRRRLLSEQDEKGWPVWMRSPERKLLAA---GNQPKPNAVVAKDGS  258

Query  1162  GQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKN  1341
             GQFKTI  A+ + P   + +YVIYVKAG+YDEIV V K   NVFMYGDG  ++ +TG+K+
Sbjct  259   GQFKTIQQAVDAMPKGQQGRYVIYVKAGLYDEIVMVPKDKVNVFMYGDGPKQSRVTGRKS  318

Query  1342  YAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQ  1521
             +A   ITT KTATFS    GF+ + + F NTAG E HQAVA R Q D++A ++C  + +Q
Sbjct  319   FAD-GITTMKTATFSVEASGFICKNMGFHNTAGAERHQAVALRVQGDLAAFYNCRFDAFQ  377

Query  1522  DTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKA  1701
             DTLY H  RQF+RNCVISGTIDFIFG   A+ QN +I+ R+P+ +Q N++TA G+     
Sbjct  378   DTLYVHARRQFFRNCVISGTIDFIFGNSAAVFQNCLIVTRRPMDNQQNSVTAHGRTDPNM  437

Query  1702  KGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGE  1881
             K G+V+QNCR+VP+  L P RFK+ +Y GRPWK +S  V+MES I D + P G+  W+G+
Sbjct  438   KSGLVIQNCRLVPDQKLFPDRFKIPSYLGRPWKEFSRLVIMESTIADFIKPEGYMPWNGD  497

Query  1882  NFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPF  2061
                KT  Y EY N GPGA T +R   +  F V+G   A  FTAG ++D   WL  TG P 
Sbjct  498   FGIKTLYYAEYNNRGPGAGTSKR-VTWPGFHVIGRKDAEQFTAGPFIDGGLWLKFTGTPH  556

Query  2062  AIGY  2073
              +G+
Sbjct  557   ILGF  560



>ref|XP_003579894.1| PREDICTED: pectinesterase-like [Brachypodium distachyon]
Length=563

 Score =   423 bits (1087),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 218/535 (41%), Positives = 320/535 (60%), Gaps = 24/535 (4%)
 Frame = +1

Query  478   SMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKI  657
             S KSV + C    YK+ C K+++  A+N +   K+      K  +E +  + +   +   
Sbjct  48    SGKSVKSLCAPTLYKESCEKTLTS-ASNGTENPKEVFSTVAKTAMESIKSAVERSKSIGE  106

Query  658   EQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQT  837
              +S+DP    A +DCKE+L+D++DDL+  + + G  ++  L  R+D L +W++ V  +  
Sbjct  107   AKSSDPLTEGARQDCKELLEDSVDDLKGMVEMAGG-DIKVLLSRSDDLEHWITGVMTFID  165

Query  838   TCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnn  1017
             TC +       K+ ++  + NAT+L++NA+ I   +  + K  ++    D+  K      
Sbjct  166   TCADGFADEKLKADMQGILRNATELSSNALAITTSLGAIFKKLDL----DVFKK------  215

Query  1018  nnnnnTTSRRLL---QTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGA  1188
                   +S RLL   +   FP+W    +RKLLA+   G   PN VVAKDGSG+FK+I  A
Sbjct  216   -----DSSHRLLSEKEEQKFPQWMKSPERKLLASG--GMPAPNAVVAKDGSGKFKSIQEA  268

Query  1189  LKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTS  1368
             + + P  H  +YVIYVK G+YDEIV + K   N+FMYGDG  ++ +TG+K++    ITT 
Sbjct  269   VNAMPKGHPGRYVIYVKTGLYDEIVMIPKDKVNIFMYGDGPKQSRVTGRKSFKD-GITTM  327

Query  1369  KTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYR  1548
             KTATFS    GF+ + + F NTAG + HQAVA R Q D++A ++C  + +QDTLY H  R
Sbjct  328   KTATFSIEAAGFICKNMGFHNTAGADHHQAVALRVQGDLAAFYNCRFDAFQDTLYVHARR  387

Query  1549  QFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNC  1728
             QF+RNCVISGTIDFIFG   A+ QN +II R+P+ +Q N++TA G+     K G+V+QNC
Sbjct  388   QFFRNCVISGTIDFIFGNSAAVFQNCLIITRRPMDNQQNSVTAHGRTDPNMKSGLVIQNC  447

Query  1729  RIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYY  1908
             R+VP+  L P RFK+ +Y GRPWK +S  V+MES I D + P G+  W+G+   KT  Y 
Sbjct  448   RLVPDQKLFPDRFKIPSYLGRPWKEFSRLVIMESTIADFVKPEGYMPWNGDFALKTLYYA  507

Query  1909  EYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIGY  2073
             EY N GPGA T +R   +  F V+G   A  FTAG ++D  +WL  TG P  +G+
Sbjct  508   EYANRGPGAGTSKRVN-WPGFRVIGQKEAEQFTAGPFVDGATWLKFTGTPHYLGF  561



>ref|XP_010656076.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Vitis vinifera]
Length=597

 Score =   424 bits (1089),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 226/524 (43%), Positives = 320/524 (61%), Gaps = 22/524 (4%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATT--KDFIFAAIKATLEEVHKSHQLVVNTKI  657
             K++ T C   +YK  C  S+S ++ ++S  +  KD +  AI A  + + K+    V  K 
Sbjct  80    KAIKTICSATDYKQTCENSLSKLSRSNSTLSQPKDLLKVAISAASDGLQKAFGKTVTFKF  139

Query  658   EQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQT  837
             +    P    A EDCK ++Q+A ++L+ASIS V  +  + L     +L NW+SAV +YQ 
Sbjct  140   DT---PEEKDAYEDCKVLMQNAKEELEASISQVSAS--NKLSSVTQELNNWLSAVMSYQA  194

Query  838   TCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnn  1017
             TC +       K+ +E    +A +LT+NA+ I+++++ +L +F++T     L        
Sbjct  195   TCIDGFPEGPLKTNMEKTFKSAKELTSNALAIVSKVTSILSSFDLTGANRHL--------  246

Query  1018  nnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGALKS  1197
                   +S   L  +  P W    DR++L   +  NL PN VVAKDGSG F TI+ AL +
Sbjct  247   --LAQESSGPSLANNGLPIWMTREDRRVLKP-KESNLTPNAVVAKDGSGNFTTISAALAA  303

Query  1198  YPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKTA  1377
              PPK+  +YVIYVK GVYDE V V +KM+NV MYG+G+ KTI+TG KN+    + T +TA
Sbjct  304   MPPKYPGRYVIYVKEGVYDETVTVERKMQNVTMYGEGSRKTIVTGNKNFVD-GVRTFQTA  362

Query  1378  TFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFY  1557
             +F ALG GFVA  + FRNTAGPE HQAVA R QSD S   +C ++GYQDT+Y  T+RQF+
Sbjct  363   SFVALGDGFVAVSMGFRNTAGPEKHQAVAIRVQSDRSIFLNCRMDGYQDTVYAQTHRQFF  422

Query  1558  RNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCRIV  1737
             R CVI+GTIDFIFG  +A+ QN +I  RKPL +Q N +TA G+   +   G+VLQNCRI+
Sbjct  423   RGCVITGTIDFIFGDASAIFQNCLITVRKPLDNQQNIVTAQGRTDKRETTGIVLQNCRIL  482

Query  1738  PETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYY-EY  1914
             P+  L P + +VK+Y GRPWK +S T+VMES I DL+ P GW  W+G NF  + +YY EY
Sbjct  483   PDQDLIPTKTQVKSYLGRPWKEFSRTIVMESTIEDLIQPQGWLPWEG-NFALSTLYYAEY  541

Query  1915  KNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPA  2046
              N GPGA    R + +  + V+    A  +T G ++  + WL A
Sbjct  542   NNKGPGAALSARVK-WPGYKVIEKEEAVKYTVGPFIQGDDWLKA  584



>ref|XP_009341542.1| PREDICTED: pectinesterase-like [Pyrus x bretschneideri]
Length=565

 Score =   421 bits (1081),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 228/531 (43%), Positives = 316/531 (60%), Gaps = 35/531 (7%)
 Frame = +1

Query  535   KSISHVANNHSATTKDFIFAAIKATLEEVHK----SHQLVVNTKIEQSTDPYNHMAIEDC  702
             KS+  V+ N++A  KD++ AA+ +  EE +K    S  L+V+ K   S        +E+C
Sbjct  47    KSLGPVSQNNNAKFKDYVKAALMSISEEANKALNTSESLLVDAKNGTSA----KRTLEEC  102

Query  703   KEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTCTEQI---ESRLYK  873
             K+ML++A+ ++QA  S VGD ++HT++ R  +L  W+ +V +Y TTC + I   +  LY+
Sbjct  103   KDMLKEAVAEVQAVSSYVGDADMHTMEDRVMELKAWIGSVISYSTTCLDIIGENDHNLYE  162

Query  874   SAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnnnnnnnTTSRRLL  1053
              A++D + N +  T+NA+ I+ E+S +L  F +      L+             T RRLL
Sbjct  163   -ALKDPIGNTSANTDNALAIVGEISNILGMFGVKVNDKALNGGG----------TQRRLL  211

Query  1054  Q----TDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGALKSYPPKHKAK  1221
             Q    +D  P WF ++DRKL+  Q  G LRP+VVVAKDGSGQ+K+I  ALK YP   + +
Sbjct  212   QNELRSDGIPTWFSVSDRKLMGLQDNGRLRPHVVVAKDGSGQYKSINDALKEYPYGQRGR  271

Query  1222  YVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKTATFSALGKG  1401
             Y+IYVKAGVY+E V V KKM NV+MYGDG   T+++G K+ A      S + TF   G G
Sbjct  272   YIIYVKAGVYNEYVYVDKKMINVYMYGDGPRSTVVSGSKSEAGTGDKISTSGTFQVFGPG  331

Query  1402  FVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGT  1581
             F+ R +   NTAGPE   AVA R+  D  A F+C I GYQDTLY  + RQF+RNCVISG 
Sbjct  332   FIGRSMGIINTAGPEARPAVALRTVGDQIAFFNCRISGYQDTLYMQSGRQFFRNCVISGH  391

Query  1582  IDFIFGKGTALIQNSIIIARKPLVHQFNT--ITADGKELAKAKGGVVLQNCRIVPETALN  1755
             +D+IFG   A IQNS+II RK    Q N   ITA G++     G +++ NCRIVPE  L 
Sbjct  392   VDYIFGDARAYIQNSLIIVRKSTNPQQNQAFITAPGRQFKHEIGAIIIHNCRIVPEQKLV  451

Query  1756  PLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYY-EYKNSGPG  1932
             P RF+V+TY GRPWK YS  VVMES + D + P G+  WDG+       ++ E+KN GPG
Sbjct  452   PTRFEVRTYLGRPWKPYSRAVVMESTLADFIRPEGYSAWDGKAGNTQHAFFGEFKNRGPG  511

Query  1933  ANTWRRNR----AFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIGY  2073
             AN  +R R     F  +  +    A  FTA   L A+ WL    +P+  G+
Sbjct  512   ANLAKRARWSGDGF--YGEMNRATAVQFTAQPALLADRWLKFANIPYLPGF  560



>ref|XP_002324181.2| pectinesterase family protein [Populus trichocarpa]
 gb|EEF02746.2| pectinesterase family protein [Populus trichocarpa]
Length=593

 Score =   421 bits (1081),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 224/533 (42%), Positives = 318/533 (60%), Gaps = 22/533 (4%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSIS-HVANNHS-ATTKDFIFAAIKATLEEVHKSHQLVVNTKI  657
             + + T C    Y++ C K++   V  + S A  K+ +  AIKA  EE+ K  +   + K 
Sbjct  77    RVIKTVCNATTYQETCQKTLEKEVEKDPSLAQPKNLLKIAIKAADEEIKKVLKKASSFKF  136

Query  658   EQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQT  837
             +   DP    A EDC E++++A ++L+ S++ VGD +L  L   A  L NW+SAV +YQ 
Sbjct  137   D---DPREKAAFEDCLELVENAKEELKDSVAHVGD-DLGKLAKNAPDLNNWLSAVMSYQQ  192

Query  838   TCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTD--LLHKAADK  1011
             TC +       KS +E     + +LT+N++ +++ ++  +K+F      +  LL K  + 
Sbjct  193   TCIDGFPEGKLKSDMEKTFKASKELTSNSLAMVSSLTSFMKSFPFPAALNRRLLAKEDNS  252

Query  1012  nnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGAL  1191
                          L  D  P W    DR++L    +   +PNV VAKDGSG FKTI+ AL
Sbjct  253   PA-----------LNKDDLPGWMSNEDRRILKGASKDKPKPNVTVAKDGSGDFKTISEAL  301

Query  1192  KSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSK  1371
              + P K++ +YVI+VK G+YDE V V KKM N+ +YGDG+ KTI+TG KN+A   + T +
Sbjct  302   AAMPAKYEGRYVIFVKQGIYDETVTVTKKMSNITIYGDGSQKTIVTGNKNFAD-GVQTFR  360

Query  1372  TATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQ  1551
             TATF+ LG GF+ + + FRNTAGPE HQAVA R Q+D +   +C  EGYQDTLY  T+RQ
Sbjct  361   TATFAVLGDGFLCKAMGFRNTAGPEKHQAVAIRVQADRAIFLNCRFEGYQDTLYAQTHRQ  420

Query  1552  FYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCR  1731
             FYR+CVI+GT+DFIFG  TA+ QN +I  RKPL +Q N ITA G+       G+VLQNCR
Sbjct  421   FYRSCVITGTVDFIFGDATAIFQNCLITVRKPLENQQNLITAQGRVDGHETTGIVLQNCR  480

Query  1732  IVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYE  1911
             I P+  L P++ K+++Y GRPWK +S T++MES IGD + P GW  W GE   KT  Y E
Sbjct  481   IEPDKDLVPVKTKIRSYLGRPWKEFSRTIIMESTIGDFIHPDGWLPWQGEFGLKTLYYAE  540

Query  1912  YKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             Y N G GA T  R + +  + ++    A  FTA  +   + W+ ATG P  +G
Sbjct  541   YNNKGAGAKTTARIK-WPGYHIINNEEAMKFTAEPFYQGD-WISATGSPIHLG  591



>ref|XP_008804471.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=576

 Score =   419 bits (1077),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 225/554 (41%), Positives = 335/554 (60%), Gaps = 32/554 (6%)
 Frame = +1

Query  439   ASSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEE  618
             ASSG GD   ST   K V+ FC+  +Y++ C  ++S V+N  S T  + I  AI AT + 
Sbjct  33    ASSGGGDAMSSTS--KYVSAFCEPTQYRETCESTLSKVSN--STTPNEMIQMAINATKDA  88

Query  619   VHKSHQLVVNTKIEQSTD------PYNHM-----AIEDCKEMLQDAIDDLQASISVVGDT  765
             +    +  V  KI+++        P  +M     A+ DCK++L+D ID L A+ ++    
Sbjct  89    IRA--RFDVPDKIQKNLPNLAPNLPQRNMSMLQDALTDCKKLLEDTIDFLDATYAL--SN  144

Query  766   ELHTLKHRADQLLNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEM  945
              +  L  R+  ++ WM+++    ++C + IE  +   A+   + N+TQL +NA+ ++A  
Sbjct  145   SMEDLVLRSTDVITWMTSMNLQVSSCLDGIEHPVVYEAMIKELGNSTQLRSNALTMVARA  204

Query  946   SKLLKAFNITTTTDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGN  1125
             SK+ ++  I      L+  AD       +  +     ++ +P+W   ADRKLLA +    
Sbjct  205   SKVFQSLGIQ-----LNTGADSRRRLLAHEEAGYERDSEGYPKWLSTADRKLLAQEL---  256

Query  1126  LRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGD  1305
             ++PNVVVAKDGSG FKTI  ALK+ P K+  +Y+IYVKAGVY+E + V K+  N+F+YGD
Sbjct  257   VKPNVVVAKDGSGNFKTINDALKAMPAKYTGRYIIYVKAGVYNEKILVDKQKTNLFIYGD  316

Query  1306  GAGKTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDM  1485
             G+ KTI+TG  +Y    + T +TATF+    GF+ + + FRNTAGPEGHQAVA+R  +D+
Sbjct  317   GSKKTIVTGHASYKS-GVKTDQTATFAVQAPGFICKNMGFRNTAGPEGHQAVAFRVNADL  375

Query  1486  SAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFN  1665
             + +F C  +GYQDTLY  + R F+RNCV+SGT+DFIFG G +++QN +I+ R+P+  QF 
Sbjct  376   AVLFRCRFDGYQDTLYVQSGRHFFRNCVVSGTVDFIFGGGASILQNCLILIRRPMDSQFT  435

Query  1666  TITADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDL  1845
              +TA   +       +V+ N RI P+T L P R K+K+Y GRPWKAY+ TVVME+ IGDL
Sbjct  436   AVTAAAGDHPDENSVIVIHNSRIRPDTKLFPDRLKIKSYLGRPWKAYAKTVVMETDIGDL  495

Query  1846  LSPLGWKIWDGE-NFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAG--L  2016
             + P GWK WDG+   EKT  Y E++N GPG+NT  R R +  + V+    A+ FT    L
Sbjct  496   IQPEGWKEWDGKPEHEKTAFYAEFQNRGPGSNTRGRVR-WPAYRVIKRQEAQKFTVSNLL  554

Query  2017  WLDANSWLPATGVP  2058
             +  +  W+   G P
Sbjct  555   YTQSGDWIALAGAP  568



>ref|NP_182226.1| pectinesterase 4 [Arabidopsis thaliana]
 sp|O80722.1|PME4_ARATH RecName: Full=Pectinesterase 4; Short=PE 4; AltName: Full=Pectin 
methylesterase 18; Short=AtPME18; AltName: Full=Pectin methylesterase 
4; Short=AtPME4; AltName: Full=VANGUARD1-like 
protein 1; Short=VGD1-like protein 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC34241.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAK96654.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AEC10790.1| pectinesterase 4 [Arabidopsis thaliana]
Length=588

 Score =   414 bits (1064),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 235/565 (42%), Positives = 321/565 (57%), Gaps = 33/565 (6%)
 Frame = +1

Query  454   GDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSH  633
             GD  +S   MK+V   CQ    K  C K++  V    S      I A + AT +E+ KS 
Sbjct  30    GDANLSP-QMKAVQGICQSTSDKASCVKTLEPV---KSEDPNKLIKAFMLATKDELTKSS  85

Query  634   QLVVNTKIE--QSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLN  807
                  T++    S  P N   ++ CK +   A++DL   I  +G+ +L  +  + DQL  
Sbjct  86    NFTGQTEVNMGSSISPNNKAVLDYCKRVFMYALEDLATIIEEMGE-DLSQIGSKIDQLKQ  144

Query  808   WMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINI----IAEMSKL------L  957
             W+  VY YQT C + IE    + AI +G+ N+  LT NAI+I    ++ M+K+      L
Sbjct  145   WLIGVYNYQTDCLDDIEEDDLRKAIGEGIANSKILTTNAIDIFHTVVSAMAKINNKVDDL  204

Query  958   KAFNITTTTDLLHKAADKnnnnnnnTTSRRLLQ---TDHFPEWFPIADRKLLA-------  1107
             K       T       D++   + +  +RRLL+       P W   ADRKL+A       
Sbjct  205   KNMTGGIPTPGAPPVVDESPVADPDGPARRLLEDIDETGIPTWVSGADRKLMAKAGRGRR  264

Query  1108  --AQRRGNLRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKM  1281
                     +R N VVAKDGSGQFKT+  A+ + P  ++ + +IY+KAG+Y E V + KK 
Sbjct  265   GGRGGGARVRTNFVVAKDGSGQFKTVQQAVDACPENNRGRCIIYIKAGLYREQVIIPKKK  324

Query  1282  KNVFMYGDGAGKTIITGKKNYAHMK-ITTSKTATFSALGKGFVARGITFRNTAGPEGHQA  1458
              N+FM+GDGA KT+I+  ++ A  +  TTS +AT     +GF+A+ + F+NTAGP GHQA
Sbjct  325   NNIFMFGDGARKTVISYNRSVALSRGTTTSLSATVQVESEGFMAKWMGFKNTAGPMGHQA  384

Query  1459  VAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIA  1638
              A R   D + IF+C  +GYQDTLY +  RQFYRNCV+SGT+DFIFGK   +IQN++I+ 
Sbjct  385   AAIRVNGDRAVIFNCRFDGYQDTLYVNNGRQFYRNCVVSGTVDFIFGKSATVIQNTLIVV  444

Query  1639  RKPLVHQFNTITADGKELAKA-KGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTT  1815
             RK    Q+NT+TADG EL    K G+VLQNCRIVP+  L P R  V TY GRPWK +STT
Sbjct  445   RKGSKGQYNTVTADGNELGLGMKIGIVLQNCRIVPDRKLTPERLTVATYLGRPWKKFSTT  504

Query  1816  VVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRA  1995
             V+M +++GDL+ P GWKIWDGE+F K+C Y EY N GPGA   RR    K       +  
Sbjct  505   VIMSTEMGDLIRPEGWKIWDGESFHKSCRYVEYNNRGPGAFANRRVNWAKVARSAAEVNG  564

Query  1996  RHFTAGLWLDANSWLPATGVPFAIG  2070
               FTA  WL   +W+    VP  IG
Sbjct  565   --FTAANWLGPINWIQEANVPVTIG  587



>ref|XP_010258716.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=580

 Score =   413 bits (1062),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 213/537 (40%), Positives = 321/537 (60%), Gaps = 18/537 (3%)
 Frame = +1

Query  478   SMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKS-HQLVVNTK  654
             SMK++   CQ  +YK+ C KS+S  A N +   KD +  A K   +++ ++ ++ VV  +
Sbjct  56    SMKAIKAICQPTDYKETCIKSLSSAAGN-TTDPKDLVKIAFKIATKQIKEAVNRSVVLKE  114

Query  655   IEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQ  834
             +E+  DP    A+ +C+E++  AID+L +S   +G  ++  +    + L  W+SA   YQ
Sbjct  115   LEK--DPRASKALANCRELMDYAIDELNSSFDELGSIDIDDIDDALENLKIWLSASLTYQ  172

Query  835   TTCTEQIESRLYKS--AIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAAD  1008
              TC +  ++    +  ++   +  A +LT N + ++ E++ +L +  + +   LL     
Sbjct  173   ETCLDGFQNTTGNAGESMRKALKTAGELTQNGLAMVTEVASILTSLQMPSKRRLLSSEQQ  232

Query  1009  KnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGA  1188
                              D FP W   A R+LLAA R  N++PN+ VAKDGSG++KTI+ A
Sbjct  233   SQCP---------FAMEDEFPTWTSAAKRRLLAASR-ANIKPNITVAKDGSGKYKTISEA  282

Query  1189  LKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTS  1368
             L+  P      +VI++KAGVY E V++ + M ++ + GDG  KT ITG KN+      T 
Sbjct  283   LRHVPKNSNETFVIHIKAGVYHEQVQINRSMTHLMIIGDGPTKTKITGNKNFVD-GTPTF  341

Query  1369  KTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYR  1548
             KTAT + +G GF+A+ I F N+AGPE HQAVA R QSDMS  ++C I+GYQDTLY HT+R
Sbjct  342   KTATVAVIGDGFMAKDIGFENSAGPEKHQAVALRVQSDMSIFYNCQIDGYQDTLYAHTHR  401

Query  1549  QFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNC  1728
             QFYRNC ISGTIDFIFG    ++Q   I+ RKPL +Q N +TA G++  +    ++LQ+C
Sbjct  402   QFYRNCTISGTIDFIFGNSAVVLQKCRIVVRKPLENQQNIVTAHGRKDRREPTAIILQSC  461

Query  1729  RIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYY  1908
             RIV +  L P+R   ++Y GRPWK YS T++M++ I DL++P GW  W G+   KTC Y 
Sbjct  462   RIVADPLLFPVRNTTRSYLGRPWKEYSRTIIMQTLIDDLINPDGWLPWSGDFALKTCFYA  521

Query  1909  EYKNSGPGANTWRRNR-AFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIGYT  2076
             EY N GPGA   +R +    K  ++ P +A+ FTAG ++  +SW+  TGVP+  G +
Sbjct  522   EYNNRGPGAVLTQRVKWRGIKTSIMTPEKAQQFTAGRFIRGDSWIKPTGVPYDSGLS  578



>ref|XP_008242146.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=596

 Score =   414 bits (1063),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 226/538 (42%), Positives = 315/538 (59%), Gaps = 36/538 (7%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVH----KSHQLVVNT  651
             K +   C   +YKD C   I    +  ++  K+FI  AI    +E      KS +L  N+
Sbjct  88    KIMKQMCGATDYKDKCESIIGKAKD--ASKPKEFIKTAISVASDEARIAYSKSSELTFNS  145

Query  652   KIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAY  831
                    P    A EDCK + +DA+D+L  +IS +G+T   + K R   L  W+SAV +Y
Sbjct  146   -------PEEKGAFEDCKVLFEDAMDELGDAISQIGNT-TASGKIRTGLLNTWLSAVISY  197

Query  832   QTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADK  1011
             Q TC +       KS +E  +  + + T+N++ +++    LL  F +  T  +       
Sbjct  198   QQTCVDGFPDGKLKSDLEKMLQASKEFTSNSLAMLS----LLSQFQLPVTAAV-------  246

Query  1012  nnnnnnnTTSRRLL--QTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITG  1185
                   +   RRLL    D FP W    +R++L         PNV VAKDGSG FKTI+ 
Sbjct  247   ------SGAKRRLLAQNKDRFPTWMSHEERRVLKKNDE-KPTPNVTVAKDGSGNFKTISE  299

Query  1186  ALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITT  1365
             AL + P K++ +Y+IYVK GVYDE V V KKM NV +YGDG+ K+IITG KN+A   + T
Sbjct  300   ALAAMPAKYEGRYIIYVKGGVYDETVIVTKKMPNVTIYGDGSQKSIITGNKNFAD-GVRT  358

Query  1366  SKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTY  1545
              +TA+F+ALG+GF+A+ + FRNTAGPE HQAVA R Q+D +   +C  EGYQDTLY  T+
Sbjct  359   FQTASFAALGEGFMAKSMGFRNTAGPEKHQAVAARVQADRAIFLNCRFEGYQDTLYAQTH  418

Query  1546  RQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQN  1725
             RQFY++CVISGT+DFIFG   A+ QN +I  RKP+ +Q N +TA G+   +   G+VLQN
Sbjct  419   RQFYKSCVISGTVDFIFGDAAAIFQNCLIYVRKPMENQQNIVTAQGRTDKQETTGIVLQN  478

Query  1726  CRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMY  1905
             C+I+P+  L P++ + KTY GRPWK +S T+VM+S I DL+ P GW  W G+   KT  Y
Sbjct  479   CKIMPDKDLEPVKSQFKTYLGRPWKEFSRTIVMDSTIEDLIHPDGWTPWQGDFALKTLYY  538

Query  1906  YEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIGYTK  2079
              EY N GPGA T  R + +  + V+    A  +T G +L  N+WL   GVP   G ++
Sbjct  539   AEYNNKGPGAKTDNRVK-WSGYKVIDKQEAMKYTVGPFLKGNAWLRVKGVPVRFGLSE  595



>gb|KDP43632.1| hypothetical protein JCGZ_16919 [Jatropha curcas]
Length=518

 Score =   411 bits (1056),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 222/536 (41%), Positives = 303/536 (57%), Gaps = 58/536 (11%)
 Frame = +1

Query  472   TGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNT  651
             T  MK+VT  CQ   YK+VC K++S     +S   K+ I A I A  + + KS  L    
Sbjct  38    TPQMKAVTQICQPTNYKEVCTKTLSTA---NSTDPKELIKAGILAISDSLSKSMNLSEGL  94

Query  652   KIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAY  831
               E   +P + +A+EDCK +L +A  +LQ  I+ + D+++  +  ++D    W+S++ AY
Sbjct  95    VKEAGNEPRSKLALEDCKILLNNASQELQDIITKMSDSDVKNITAQSDDFRIWLSSIIAY  154

Query  832   QTTCTEQIE-SRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAAD  1008
             Q  C +  +     K+ + +      +LT+N + I+A +S +LK+F +    DL      
Sbjct  155   QELCIDGFDHDNDLKAQVRNSTNYGNELTDNVLTILAGISDILKSFGLQL--DL------  206

Query  1009  KnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGA  1188
                      TSR+LL    +P W   +DR+LL  +  G + PN VVA DGSG+FK+I  A
Sbjct  207   ------PGGTSRKLLGAGGYPTWVSGSDRRLLQIRNAGGVTPNAVVALDGSGKFKSINAA  260

Query  1189  LKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTS  1368
             + S P   K ++VIYVK G+Y+E V + K   ++ MYG G                    
Sbjct  261   INSCPKDFKGRFVIYVKEGLYNEAVVIPKNSPSILMYGMG--------------------  300

Query  1369  KTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYR  1548
                               F+NTAGP+GHQAVA R  SDMS  ++C ++GYQDTL Y   R
Sbjct  301   ------------------FQNTAGPDGHQAVAIRVNSDMSIFYNCRMDGYQDTLLYQAKR  342

Query  1549  QFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNC  1728
             QFYRNCVISGTIDF+FG G A+IQNS+II RKP  +QFNT+TADGK+      G+V+ NC
Sbjct  343   QFYRNCVISGTIDFLFGYGAAVIQNSLIIVRKPNPNQFNTVTADGKKTKGENTGLVIHNC  402

Query  1729  RIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYY  1908
             RIVPE  L P R   +TY GRPWK +STTVVME+Q+GDL+ P GW  W G  F  T  Y 
Sbjct  403   RIVPEEKLVPTRLTTRTYLGRPWKEFSTTVVMETQLGDLIQPEGWMPWAGTLFLDTLYYA  462

Query  1909  EYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLD-ANSWLPATGVPFAIGY  2073
             EY NSGPGANT RR + +K F +L    A+ FT G +L  A  W+    VPF  G+
Sbjct  463   EYANSGPGANTARRVK-WKTFHLLNQAEAQKFTVGAFLPGAAQWVGGAQVPFLAGF  517



>ref|XP_009369731.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Pyrus x bretschneideri]
Length=594

 Score =   413 bits (1062),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 229/539 (42%), Positives = 315/539 (58%), Gaps = 36/539 (7%)
 Frame = +1

Query  472   TGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVH----KSHQL  639
             + S K +   C   +YKD C + I   AN  +     FI  AI AT +E      K+ +L
Sbjct  82    SNSKKILKEMCSVTDYKDKC-EGIIEKANGETKPMA-FIKTAISATSDEAKSVYSKTAEL  139

Query  640   VVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSA  819
               N+       P    A EDCKE+ +DA+++L  +IS VG +   + K R   L +W+SA
Sbjct  140   TFNS-------PEEKGAFEDCKELFEDAMEELGDAISQVG-SNTESGKVRIGVLNSWLSA  191

Query  820   VYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHK  999
             V +YQ TC +       KS +E  +  + + T+N++ +++    LL    +  T      
Sbjct  192   VISYQQTCIDGFPDGKLKSDLEKMLQTSKEFTSNSLAMLS----LLNQLQLPGT------  241

Query  1000  AADKnnnnnnnTTSRRLLQTD--HFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFK  1173
                         ++RRLL  D   FP W    DR++L    +  L PNV VAKDGSG +K
Sbjct  242   -------GAAAGSNRRLLSQDKGEFPTWMSHEDRRMLKKNDK-KLTPNVTVAKDGSGNYK  293

Query  1174  TITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHM  1353
             TI  AL+  P K++ +YVIYVK GVYDE V V KKM NV MYGDG+ K+IITG KN+A  
Sbjct  294   TINEALEKMPQKYEGRYVIYVKEGVYDETVTVTKKMPNVTMYGDGSQKSIITGNKNFAD-  352

Query  1354  KITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLY  1533
              + T +TA F+ALG+GF+A+ + FRNTAGPE  QAVA R Q+D +   +C  EGYQ+TLY
Sbjct  353   GVRTFQTAPFAALGEGFMAKSMGFRNTAGPEKRQAVAARVQADRAIFLNCRFEGYQETLY  412

Query  1534  YHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGV  1713
               T+RQFY++CVISGT+DFIFG    + QN +I  RKPL +Q NT+TA G+   +   G+
Sbjct  413   VQTHRQFYKSCVISGTVDFIFGDAATIFQNCLIYVRKPLENQQNTVTAQGRTDKRETTGI  472

Query  1714  VLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEK  1893
             VLQNC+I+P+  L P++ + KTY GRPWK +S T+VMES I DL+ P GW  W+G+   K
Sbjct  473   VLQNCQIMPDKDLEPVKSQFKTYLGRPWKEFSRTIVMESTIEDLIHPDGWTPWEGDFALK  532

Query  1894  TCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             T  Y EY N GPGA T  R + +  +  +    A  +T G +L  ++WL   GVP   G
Sbjct  533   TLYYAEYNNKGPGAKTDNRVK-WDGYKKINKEEAMQYTVGPFLKGHAWLKVEGVPVRFG  590



>ref|XP_010544936.1| PREDICTED: pectinesterase 5-like [Tarenaya hassleriana]
Length=571

 Score =   412 bits (1058),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 227/545 (42%), Positives = 308/545 (57%), Gaps = 23/545 (4%)
 Frame = +1

Query  472   TGSMKSVTTFCQYAEYKDVCAKSISHV-ANNHSATTKDFIFAAIKATLEEVHKSHQLVVN  648
             T  MK+V   CQ    K  C K++  V  ++ +   K F+ A   A L+  + + +    
Sbjct  37    TPQMKAVXAICQSTTDKASCVKTLEPVNTDDPNKLIKAFMLATQDAILKAYNFTGKAEGT  96

Query  649   TKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYA  828
                  +  P N   +E C  +   A++DL++ +  + D ++     + DQL  W++ V+ 
Sbjct  97    VGNNTANAPTNKAVLEYCMRVFSYALEDLKSILEEM-DDDMEQTGSKLDQLKQWLTGVFV  155

Query  829   YQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAAD  1008
             YQT+C + IE    +  + DG+ N+  LT+NAI+I + +        +T  T+L      
Sbjct  156   YQTSCLDDIEDAELRKIMADGIANSKILTSNAIDIFSTV--------LTAMTELGLAKNG  207

Query  1009  KnnnnnnnTTSRRLLQTDH-----FPEWFPIADRKLLAAQRRGNLRPNV----VVAKDGS  1161
               N     T  RRLL+        FP W P ADRKLLA   RG   P +    VVAKDGS
Sbjct  208   TINIPGITTPGRRLLEEAEAAEGGFPAWMPGADRKLLANAGRGGADPRIKATFVVAKDGS  267

Query  1162  GQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKN  1341
             GQFKT+  A+ + P K+  + +I++KAGVY E V + KK  N+FM+GDGA +TIIT  ++
Sbjct  268   GQFKTVAQAVNACPDKNPGRCIIHIKAGVYREQVIIPKKKNNIFMFGDGARRTIITYNRS  327

Query  1342  YA-HMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGY  1518
                    TTS + T     +GF+A+ I F+NTAGP GHQAVA R   D + +F+C  +GY
Sbjct  328   VKLSPATTTSLSGTVQVESEGFMAKYIGFKNTAGPMGHQAVAIRVNGDRAVLFNCRFDGY  387

Query  1519  QDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELA-  1695
             QDTLY +  RQFYRNCV+SGT+DFIFGK   +IQNS+I+ RK    Q NTITADG E   
Sbjct  388   QDTLYVNNGRQFYRNCVVSGTVDFIFGKSATVIQNSLIVVRKGNPGQLNTITADGNEKGT  447

Query  1696  KAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWD  1875
               K G+VLQNCRIVP+  L   R  V +Y GRPWK YSTT+VM S+IGD++ P GW IW 
Sbjct  448   NVKIGIVLQNCRIVPDKKLEAERLTVPSYLGRPWKQYSTTIVMNSEIGDVIRPEGWMIWQ  507

Query  1876  GENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGV  2055
             GENF K+C Y EY N GPGAN  +R    K       +    FT   WL    W+ A  V
Sbjct  508   GENFHKSCKYIEYNNRGPGANGAKRVNWAKVAKASSEVNG--FTVANWLAPIEWIQAADV  565

Query  2056  PFAIG  2070
             P  +G
Sbjct  566   PVQLG  570



>ref|XP_008668795.1| PREDICTED: pectinesterase-like [Zea mays]
 tpg|DAA35757.1| TPA: hypothetical protein ZEAMMB73_949898 [Zea mays]
Length=621

 Score =   413 bits (1062),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 234/598 (39%), Positives = 326/598 (55%), Gaps = 68/598 (11%)
 Frame = +1

Query  457   DHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQ  636
             +HG  + S+K ++T C    Y   C +S+  + N+ S   +D + AA K  L+EV  + Q
Sbjct  35    NHGGMSASVK-LSTVCASTLYPQKCEQSLKPIVNDTS-NPEDVLRAAFKVALDEVAAAFQ  92

Query  637   LVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMS  816
               V+   + + D     A+++CK++L DA +DL+    +        ++H  D L  W+S
Sbjct  93    RSVHIG-KDAQDNLTRNAMDECKKLLDDATEDLRGMARL---KPADVVRHVKD-LRVWVS  147

Query  817   AVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLL----KAFN-----  969
              V  Y  TC +  E    K A++  + N+T+L++NA+ I+  + +LL    KA N     
Sbjct  148   GVMTYVYTCADGFEKPELKEAMDKMLQNSTELSSNALAILTRLGELLPQEAKALNATLPG  207

Query  970   -----------------ITTTTDLLHKAADKnnnnnnnTTSRRLLQTDH-----------  1065
                              +T+    L    DK     +   +   L +DH           
Sbjct  208   AGHGRRLLGWQMGEAEEVTSGGRGLPAVNDKLGEIADVANANLKLLSDHAALRGRGVLTT  267

Query  1066  --------------------FPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITG  1185
                                 FP+W P + R+LL  Q  G  RPN VVA+DGSG FKTIT 
Sbjct  268   GLVGTFDEIQYGRSGVPPSDFPKWMPASQRRLL--QLPGFQRPNKVVAQDGSGDFKTITE  325

Query  1186  ALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITT  1365
             A+ + P   + ++VIYVKAG Y E V V K M N+FMYGDG  +T++TG K+       T
Sbjct  326   AIAAMPKTFEGRFVIYVKAGTYKEYVTVPKDMVNIFMYGDGPTRTVVTGDKSNTG-GFAT  384

Query  1366  SKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTY  1545
               T TFSA G GF+ + + F NTAGPEGHQAVA   Q DMS  F+C  EGYQDTLY H  
Sbjct  385   IATRTFSAEGNGFICKSMGFANTAGPEGHQAVAMHVQGDMSVFFNCRFEGYQDTLYVHAN  444

Query  1546  RQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQN  1725
             RQF+RNC + GT+DF+FG   AL+QN ++  RKP   Q N +TA G+       G+VLQ 
Sbjct  445   RQFFRNCEVLGTVDFVFGNSAALLQNCLLTVRKPGESQSNMVTAQGRTDPNMPTGIVLQG  504

Query  1726  CRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMY  1905
             CRIVPE AL P+R ++ +Y GRPWK Y+ TVVMES IGDL+ P GW  W G+   KT  Y
Sbjct  505   CRIVPEQALFPVRLQIPSYLGRPWKEYARTVVMESTIGDLIRPEGWAEWMGDLGLKTLYY  564

Query  1906  YEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIGYTK  2079
              EY N GPGA T +R  ++  + V+G   A HFTAG+++D  +WL +TG P  +G+T+
Sbjct  565   AEYANIGPGAGTSKR-VSWPGYRVIGQAEATHFTAGVFIDGMTWLQSTGTPNVMGFTR  621



>ref|XP_004975844.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58-like 
[Setaria italica]
Length=563

 Score =   411 bits (1056),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 224/550 (41%), Positives = 320/550 (58%), Gaps = 26/550 (5%)
 Frame = +1

Query  436   DASSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLE  615
             D+ +  G+  ++T S KSV + C    YK+ C K++S  A N +   KD   +  K  LE
Sbjct  34    DSFTVPGEASLAT-SGKSVQSLCAPTLYKESCEKTLSG-ATNGTENPKDVFHSVAKVALE  91

Query  616   EVHKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRAD  795
              V  + +        +S+D     A EDCK++L+DA+DDL+  + + G  ++  L  R+D
Sbjct  92    SVKSAMEQSKAIGEAKSSDSMTESAREDCKKLLEDAVDDLKGMLEMAGG-DIKVLFSRSD  150

Query  796   QLLNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNIT  975
              L  W++ V  +  TC +       K+ +   + NAT+L++NA+ I              
Sbjct  151   DLETWLTGVMTFMDTCIDGFVDEKLKADMHSVLRNATELSSNALAI--------------  196

Query  976   TTTDLLHKAADKnnnnnnnTTSRRLLQTDH---FPEWFPIADRKLLAAQRRGNL-RPNVV  1143
              T  L       + +     + RRLL       +P W    +RKL+AA   GN  +PN V
Sbjct  197   -TNSLGGLLKKLDLDMFKKDSRRRLLSEQDEQGYPVWMRSPERKLMAA---GNQPKPNAV  252

Query  1144  VAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTI  1323
             VA+DGSGQFK+I  A+ + P  +  +YVIYVKAG+Y+E+V + K   N+FMYGDG  KT 
Sbjct  253   VAQDGSGQFKSIQQAVDAMPKGNTGRYVIYVKAGLYNEMVMIPKDKVNIFMYGDGPKKTR  312

Query  1324  ITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDC  1503
             +TG+K++A   ITT KTATFS    GF+ + + F NTAG E HQAVA R Q D++A ++C
Sbjct  313   VTGRKSFAD-GITTMKTATFSIEASGFICKNMGFHNTAGAERHQAVALRVQGDLAAFYNC  371

Query  1504  SIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADG  1683
               + +QDTLY H  RQF+RNCVISGTIDFIFG   A+ QN +II R+P+ +Q N++TA G
Sbjct  372   RFDAFQDTLYVHARRQFFRNCVISGTIDFIFGNSAAVFQNCLIITRRPMDNQQNSVTAHG  431

Query  1684  KELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGW  1863
             +     K G+V+QNCR+VP+  L P RFK+ +Y GRPWK +S  V+MES I D + P G+
Sbjct  432   RTDPNMKSGLVIQNCRLVPDQKLFPDRFKIPSYLGRPWKEFSRLVIMESTIADFIKPEGY  491

Query  1864  KIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLP  2043
               W+G+   KT  Y EY N GPGA T +R +      V+    A  FTAG ++D  +WL 
Sbjct  492   MPWNGDFGLKTLYYAEYNNRGPGAGTSQRVKWPGYRGVITRQEAEQFTAGPFIDGATWLK  551

Query  2044  ATGVPFAIGY  2073
              TG P  +G+
Sbjct  552   FTGTPNILGF  561



>ref|XP_007203102.1| hypothetical protein PRUPE_ppa023802mg [Prunus persica]
 gb|EMJ04301.1| hypothetical protein PRUPE_ppa023802mg [Prunus persica]
Length=596

 Score =   412 bits (1058),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 227/542 (42%), Positives = 315/542 (58%), Gaps = 36/542 (7%)
 Frame = +1

Query  472   TGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVH----KSHQL  639
             T   K +   C   +Y+D C   I       ++  K+FI  AI A  +E      KS +L
Sbjct  84    TKGEKIMKQMCGATDYEDKCESIIGKAKG--ASKPKEFIKTAISAASDEARIAYSKSSEL  141

Query  640   VVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSA  819
               N+       P    A EDCK + +DA+D+L  +IS +G+T   + K R   L  W+SA
Sbjct  142   TFNS-------PEEKGAFEDCKVLFEDAMDELGDAISQIGNT-TASGKIRTGLLNTWLSA  193

Query  820   VYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHK  999
             V +YQ TC +       KS +E  +  + + T+N++ +++    LL  F +  T  +   
Sbjct  194   VISYQQTCVDGFPDGKLKSDLEKMLQASKEFTSNSLAMLS----LLSQFQLPVTAAV---  246

Query  1000  AADKnnnnnnnTTSRRLL--QTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFK  1173
                       +   RRLL    D FP W    +R++L         PNV VAKDGSG FK
Sbjct  247   ----------SGAKRRLLAQNKDGFPTWMSHEERRVLKKNDE-KPTPNVTVAKDGSGNFK  295

Query  1174  TITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHM  1353
             TI+ AL + P K++ +Y+IYVK GVYDE V V KKM NV +YGDG+ K+IITG KN+A  
Sbjct  296   TISEALAAMPAKYEGRYIIYVKGGVYDETVIVTKKMPNVTIYGDGSQKSIITGNKNFAD-  354

Query  1354  KITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLY  1533
              + T +TA+F+ALG+GF+A+ + FRNTAGPE HQAVA R Q+D +   +C  EGYQDTLY
Sbjct  355   GVRTFQTASFAALGEGFMAKSMGFRNTAGPEKHQAVAARVQADRAIFLNCRFEGYQDTLY  414

Query  1534  YHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGV  1713
               T+RQFY++CVISGT+DFIFG   A+ QN +I  RKP+ +Q N +TA G+   +   G+
Sbjct  415   AQTHRQFYKSCVISGTVDFIFGDAAAIFQNCLIYVRKPMENQQNIVTAQGRTDKRETTGI  474

Query  1714  VLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEK  1893
             VLQNC+I+P+  L P++ + KTY GRPWK +S T+VM S I DL+ P GW  W G+   K
Sbjct  475   VLQNCKIMPDKDLEPVKSQFKTYLGRPWKEFSRTIVMGSTIEDLIHPDGWTPWQGDFALK  534

Query  1894  TCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIGY  2073
             T  Y EY N GPGA T  R + +  + V+    A  +T G +L  N+WL   GVP   G 
Sbjct  535   TLYYAEYNNKGPGAKTDNRVK-WSGYKVIDKQEAMKYTVGPFLKGNAWLRVKGVPVRFGL  593

Query  2074  TK  2079
             ++
Sbjct  594   SE  595



>gb|AAC27719.1| flower-specific pectin methylesterase precursor [Arabidopsis 
thaliana]
Length=586

 Score =   411 bits (1056),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 235/565 (42%), Positives = 322/565 (57%), Gaps = 35/565 (6%)
 Frame = +1

Query  454   GDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSH  633
             GD  +S   MK+V   CQ    K  C K++  V    S      I A + AT +E+ KS 
Sbjct  30    GDANLSP-QMKAVQGICQSTSDKASCVKTLEPV---KSEDPNKLIKAFMLATKDELTKSS  85

Query  634   QLVVNTKIE--QSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLN  807
                  T++    S  P N   ++ CK +   A++DL   I  +G+ +L  +  + DQL  
Sbjct  86    NFTGQTEVNMGSSISPNNKAVLDYCKRVFMYALEDLATIIEEMGE-DLSQIGSKIDQLKQ  144

Query  808   WMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINI----IAEMSKL------L  957
             W+  VY YQT C + IE    + AI +G+ N+  LT NAI+I    ++ M+K+      L
Sbjct  145   WLIGVYNYQTDCLDDIEEDDLRKAIGEGIANSKILTTNAIDIFHTVVSAMAKINNKVDDL  204

Query  958   KAFNITTTTDLLHKAADKnnnnnnnTTSRRLLQ---TDHFPEWFPIADRKLLA-------  1107
             K       T       D++   + +  +RRLL+       P W   ADRKL+A       
Sbjct  205   KNMTGGIPTPGAPPVVDESPVADPDGPARRLLEDIDETGIPTWVSGADRKLMAKAGRGRR  264

Query  1108  --AQRRGNLRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKM  1281
                     +R N VVAKDGSGQFKT+  A+ + P  ++ + +IY+KAG+Y E V + KK 
Sbjct  265   GGRGGGARVRTNFVVAKDGSGQFKTVQQAVDACPENNRGRCIIYIKAGLYREQVIIPKKK  324

Query  1282  KNVFMYGDGAGKTIITGKKNYAHMK-ITTSKTATFSALGKGFVARGITFRNTAGPEGHQA  1458
              N+FM+GDGA KT+I+  ++ A  +  TTS +AT  +  +GF+A+ + F+NTAGP GHQA
Sbjct  325   NNIFMFGDGARKTVISYNRSVALSRGTTTSLSATVES--EGFMAKWMGFKNTAGPMGHQA  382

Query  1459  VAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIA  1638
              A R   D + IF+C  +GYQDTLY +  RQFYRNCV+SGT+DFIFGK   +IQN++I+ 
Sbjct  383   AAIRVNGDRAVIFNCRFDGYQDTLYVNNGRQFYRNCVVSGTVDFIFGKSATVIQNTLIVV  442

Query  1639  RKPLVHQFNTITADGKELAKA-KGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTT  1815
             RK    Q+NT+TADG EL    K G+VLQNCRIVP+  L P R  V TY GRPWK +STT
Sbjct  443   RKGSKGQYNTVTADGNELGLGMKIGIVLQNCRIVPDRKLTPERLTVATYLGRPWKKFSTT  502

Query  1816  VVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRA  1995
             V+M +++GDL+ P GWKIWDGE+F K+C Y EY N GPGA   RR    K       +  
Sbjct  503   VIMSTEMGDLIRPEGWKIWDGESFHKSCRYVEYNNRGPGAFANRRVNWAKVARSAAEVNG  562

Query  1996  RHFTAGLWLDANSWLPATGVPFAIG  2070
               FTA  WL   +W+    VP  IG
Sbjct  563   --FTAANWLGPINWIQEANVPVTIG  585



>ref|XP_011015792.1| PREDICTED: LOW QUALITY PROTEIN: putative pectinesterase/pectinesterase 
inhibitor 45 [Populus euphratica]
Length=593

 Score =   410 bits (1055),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 219/533 (41%), Positives = 312/533 (59%), Gaps = 22/533 (4%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVA--NNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKI  657
             + + T C    Y++ C K++      +  SA  K+ +  AIKA  EE+ K  +   + K 
Sbjct  77    RVIKTVCNATTYQETCQKTLEKEVEKDPSSAQPKNLLKIAIKAADEEIKKVLKKASSFKF  136

Query  658   EQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQT  837
             +   DP    A EDC E++++A ++L+ S++ VGD +L  L   A  L NW+SAV +YQ 
Sbjct  137   D---DPREKAAFEDCLELVENAKEELKDSVAHVGD-DLGKLVKNAPDLNNWLSAVMSYQQ  192

Query  838   TCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTD--LLHKAADK  1011
             TC +       KS +E     + + T+N++ +++ ++  +K F      +  LL K  + 
Sbjct  193   TCIDGFPEGKLKSDMEKTFKASKEFTSNSLAMVSSLTSFMKNFPFPGALNRRLLAKEDNS  252

Query  1012  nnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGAL  1191
                          L  D  P W    DR++L    +   +PNV VAKDGSG FKTI+ AL
Sbjct  253   PA-----------LNKDDLPGWMSNEDRRILKGASKDKPKPNVTVAKDGSGDFKTISEAL  301

Query  1192  KSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSK  1371
              + P K++ +YVI+VK G+YDE V V KKM N+ +YGDG+ KTI+TG KN+A   + T +
Sbjct  302   AAMPAKYQGRYVIFVKQGIYDETVTVTKKMANITIYGDGSQKTIVTGNKNFAD-GVQTFR  360

Query  1372  TATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQ  1551
             TATF+  G GF+ + + FRNTAGPE HQAVA R Q+D +   +C  EGYQDTLY  T+RQ
Sbjct  361   TATFAVXGDGFLCKTMGFRNTAGPEKHQAVAIRVQADRAIFLNCRFEGYQDTLYAQTHRQ  420

Query  1552  FYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCR  1731
             FYR+CVI+GT+DFIFG   A+ QN +I  RKPL +Q N ITA G+       G+VLQNCR
Sbjct  421   FYRSCVITGTVDFIFGDAAAIFQNCLITVRKPLENQQNLITAQGRVDGHETTGIVLQNCR  480

Query  1732  IVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYE  1911
             I P+  L P++ K+++Y GRPWK +S T++MES IGD + P GW  W GE   KT  Y E
Sbjct  481   IEPDKDLVPVKTKIRSYLGRPWKEFSRTIIMESTIGDFIHPDGWLPWQGEFGLKTLYYAE  540

Query  1912  YKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             Y N G GA T  R + +  + ++    A   TA  +   + W+ ATG P  +G
Sbjct  541   YNNKGAGAKTTARIK-WPGYHIINNEEAMKLTAEPFYQGD-WISATGSPIHLG  591



>gb|EYU28291.1| hypothetical protein MIMGU_mgv1a003232mg [Erythranthe guttata]
Length=598

 Score =   409 bits (1052),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 223/537 (42%), Positives = 306/537 (57%), Gaps = 38/537 (7%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSI-SHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIE  660
             K+V T C   +YK  C  S+   V +NH+A  +D + A+      E+    +     K +
Sbjct  89    KAVKTVCASTDYKQTCEDSLLKAVKDNHTAQPQDILRASFAVAAAEIDDVIKKAAALKFD  148

Query  661   QSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTT  840
                DP+   A  DC  +L+DA ++L  SIS V   +L  +     ++ NW+SAV +YQ T
Sbjct  149   ---DPFKKAAFNDCMVLLKDAKEELNTSISSVTGKDLTKISTLKPEINNWLSAVLSYQQT  205

Query  841   CTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnnn  1020
             C +       K++++  +    +L +NA+ I++++S +  AF      D  H        
Sbjct  206   CIDGFPEGEEKTSMQKMLKTFRELGSNALAIVSQVSSIFSAFG-----DEAH--------  252

Query  1021  nnnnTTSRRLLQTD--HFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGALK  1194
                    R+L+  D   FP W     R+LL A       PNV VAKDGSG F TI+ AL 
Sbjct  253   -------RKLVSVDDGEFPTWVNNDLRRLLKAGGPNKFTPNVTVAKDGSGDFTTISKALG  305

Query  1195  SYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKT  1374
             + P K+  +YVIYVK GVYDE V V K+M+NV MYGDG+ K+IITGKKNY    + T +T
Sbjct  306   AMPKKYSGRYVIYVKEGVYDESVTVTKEMENVTMYGDGSQKSIITGKKNYVD-GVPTFQT  364

Query  1375  ATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQF  1554
             ATF+ALG GF+A+ + FRNTAGPE HQAVA R Q+D S   +C +EGYQDTLY  T+RQF
Sbjct  365   ATFAALGDGFMAQSLGFRNTAGPEKHQAVALRVQADRSIFVNCRMEGYQDTLYAQTHRQF  424

Query  1555  YRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCRI  1734
             YR+C I+GT+DFIFG   A+ QN +I  RKP+ +Q   +TA G+   +   G+V+QNCRI
Sbjct  425   YRSCYITGTVDFIFGDAAAVFQNCLIYVRKPMDNQQTIVTAQGRIDKRETTGIVIQNCRI  484

Query  1735  VPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEY  1914
             + +  L P + K ++Y GRPWK YS TVVME++IGD +   GW  W G+   KT  Y EY
Sbjct  485   LADDKLEPEKAKFRSYLGRPWKEYSRTVVMETEIGDFIEAEGWMEWSGDFALKTLFYAEY  544

Query  1915  KNSGPGANT-----WRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
              N G GA+T     W   +  KK D      A  F+ G +L   +WL    VP   G
Sbjct  545   NNKGAGASTTGRVKWPGCKVIKKED------AVKFSVGPFLQGETWLKNPDVPVRFG  595



>ref|XP_006381543.1| hypothetical protein POPTR_0006s13690g [Populus trichocarpa]
 gb|ERP59340.1| hypothetical protein POPTR_0006s13690g [Populus trichocarpa]
Length=595

 Score =   409 bits (1051),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 217/531 (41%), Positives = 316/531 (60%), Gaps = 18/531 (3%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISH--VANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKI  657
             + + T C    Y+D C  ++      +  S   KD +  AIKA  +E+ K  +   + K 
Sbjct  80    RVIKTVCNATTYQDTCQNTLEKGMRKDPSSVQPKDLLKIAIKAADKEIEKVLKKASSFKF  139

Query  658   EQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQT  837
             ++   P    A +DC E+++DA ++L+  I  VG+ ++  L   A  L NW+SAV +YQ 
Sbjct  140   DK---PREKAAFDDCLELIEDAKEELKHCIDRVGN-DIGKLTKNAPDLNNWLSAVMSYQQ  195

Query  838   TCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnn  1017
             TC +       KS +E     A +LT+N++ +++ ++  LK F+ + T +    A + N+
Sbjct  196   TCIDGFPEGKLKSDMEKTFKAARELTSNSLAMVSSLASFLKNFSFSGTLNRRLLAEEYNS  255

Query  1018  nnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGALKS  1197
              +         L  D  P W    DR++L    +   +P+V VAKDGSG FKTI+ AL +
Sbjct  256   PS---------LDKDGLPGWTSHEDRRILKGANQDKPKPHVTVAKDGSGDFKTISEALAA  306

Query  1198  YPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKTA  1377
              P K++ +YVI+VK G+YDE V V KKM N+ MYGDG+ KTI+TG KN+A   + T +TA
Sbjct  307   MPAKYEGRYVIFVKQGIYDETVTVTKKMVNITMYGDGSQKTIVTGNKNFAD-GVQTFRTA  365

Query  1378  TFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFY  1557
             TF+ LG+GF+ + + FRNTAGPE HQAVA R Q+D +   +C  EGYQDTLY  T+RQFY
Sbjct  366   TFAVLGEGFLCKAMGFRNTAGPEKHQAVAIRVQADRAIFLNCRFEGYQDTLYAQTHRQFY  425

Query  1558  RNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCRIV  1737
             R+CVI+GT+DFIFG   A+ QN +I  RKPL +Q N +TA G+       G+VLQNCRI 
Sbjct  426   RSCVITGTVDFIFGDAAAIFQNCLITVRKPLENQQNIVTAQGRIDGHETTGIVLQNCRIE  485

Query  1738  PETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYK  1917
             P+  L P++ K+++Y GRPWK +S TV+M+S IGD + P GW  W G+   KT  Y EY 
Sbjct  486   PDKGLVPVKTKIRSYLGRPWKEFSRTVIMDSTIGDFIHPDGWLPWQGDFGLKTLYYAEYN  545

Query  1918  NSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             N G GA T  R + ++ + ++    A  FT   +   + W+ ATG P  +G
Sbjct  546   NKGIGAQTNARIK-WRGYHIIKKEEAMKFTVETFYQVD-WISATGSPVRLG  594



>gb|AAV91509.1| VGD1-like protein 1 [Arabidopsis thaliana]
Length=588

 Score =   409 bits (1050),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 234/565 (41%), Positives = 321/565 (57%), Gaps = 33/565 (6%)
 Frame = +1

Query  454   GDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSH  633
             GD  +S   MK+V   C+    K  C K++  V    S      I A + AT +E+ KS 
Sbjct  30    GDANLSP-QMKAVQGICRSTSDKASCVKTLEPV---KSEDPNKLIKAFMLATKDELTKSS  85

Query  634   QLVVNTKIE--QSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLN  807
                  T++    S  P N   ++ CK +   A++DL   I  +G+ +L  +  + DQL  
Sbjct  86    NFTGQTEVNMGSSISPNNKAVLDYCKRVFMYALEDLATIIEEMGE-DLSQIGSKIDQLKQ  144

Query  808   WMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINI----IAEMSKL------L  957
             W+  VY YQT C + IE    + AI +G+ N+  LT NAI+I    ++ M+K+      L
Sbjct  145   WLIGVYNYQTDCLDDIEEDDLRKAIGEGIANSKILTTNAIDIFHTVVSAMAKINNKVDDL  204

Query  958   KAFNITTTTDLLHKAADKnnnnnnnTTSRRLLQ---TDHFPEWFPIADRKLLA-------  1107
             K       T       D++   + +  +RRLL+       P W   ADRKL+A       
Sbjct  205   KNMTGGIPTPGAPPVVDESPVADPDGPARRLLEDIDETGIPTWVSGADRKLMAKAGRGRR  264

Query  1108  --AQRRGNLRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKM  1281
                     +R N VVAKDGSGQFKT+  A+ + P  ++ + +IY+KAG+Y E V + KK 
Sbjct  265   GGRGGGARVRANFVVAKDGSGQFKTVQQAVDACPENNRGRCIIYIKAGLYREQVIIPKKN  324

Query  1282  KNVFMYGDGAGKTIITGKKNYAHMK-ITTSKTATFSALGKGFVARGITFRNTAGPEGHQA  1458
              N+FM+GDGA KT+I+  ++ A  +  TTS +AT     +GF+A+ + F+NTAGP GHQA
Sbjct  325   NNIFMFGDGARKTVISYNRSVALSRGTTTSLSATVQVESEGFMAKWMGFKNTAGPMGHQA  384

Query  1459  VAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIA  1638
              A R   D + IF+C  +GYQDTLY +  RQFYRNCV+SGT+DFIFGK   +IQN++I+ 
Sbjct  385   AAIRVNGDRAVIFNCRFDGYQDTLYVNNGRQFYRNCVVSGTVDFIFGKSATVIQNTLIVV  444

Query  1639  RKPLVHQFNTITADGKELAKA-KGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTT  1815
             RK    Q+NT+TADG EL    K G+VLQNCRIVP+  L P R  V TY GRPWK +STT
Sbjct  445   RKGSKGQYNTVTADGNELGLGMKIGIVLQNCRIVPDRKLTPERLTVATYLGRPWKKFSTT  504

Query  1816  VVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRA  1995
             V+M +++GDL+ P GWKIWDGE+F K+C Y EY N GPGA   RR    K       +  
Sbjct  505   VIMSTEMGDLIRPEGWKIWDGESFHKSCRYVEYNNRGPGAFANRRANWAKVARSAAEVSG  564

Query  1996  RHFTAGLWLDANSWLPATGVPFAIG  2070
               FTA  WL   +W+    VP  IG
Sbjct  565   --FTAANWLGPINWIQEANVPVTIG  587



>ref|XP_011005056.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Populus euphratica]
Length=595

 Score =   408 bits (1049),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 218/531 (41%), Positives = 317/531 (60%), Gaps = 18/531 (3%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVA--NNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKI  657
             + + T C    Y+D C  ++      +  S   KD +  AIKA  +E+ K  +   + K 
Sbjct  80    RVIKTVCNATTYQDTCQNTLEKGVGKDPSSVQPKDLLKIAIKAADKEIEKVLKKASSFKF  139

Query  658   EQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQT  837
             ++   P    A +DC E+++DA ++L+  I  VG+ ++  L   A  L NW+SAV +YQ 
Sbjct  140   DK---PREKAAFDDCLELIKDAKEELKHCIDRVGN-DIGKLTKNAPDLNNWLSAVMSYQQ  195

Query  838   TCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnn  1017
             TC +       KS +E     A +LT+N++ +++ ++  LK F+ + T +     AD+ N
Sbjct  196   TCIDGFPEGKLKSDMEKTFKPARELTSNSLAMVSSLASFLKNFSFSGTLNR-RLLADEYN  254

Query  1018  nnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGALKS  1197
             + +        L  D  P W    DR++L    +   +P+V VAKDGSG FKTI+ AL +
Sbjct  255   SPS--------LDKDGLPGWTSHEDRRILKGANQDKPKPHVTVAKDGSGDFKTISEALAA  306

Query  1198  YPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKTA  1377
              P K++ +YVI+VK G+YDE V V KKM N+ MYGDG+ KTI+TG KN+A   + T +TA
Sbjct  307   MPAKYEGRYVIFVKQGIYDETVTVTKKMVNITMYGDGSQKTIVTGNKNFAD-GVQTFRTA  365

Query  1378  TFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFY  1557
             TF+ LG+GF+ + + FRNTAGPE HQAVA R Q+D +   +C  EGYQDTLY  T+RQFY
Sbjct  366   TFAVLGEGFLCKAMGFRNTAGPEKHQAVAIRVQADRAIFLNCRFEGYQDTLYAQTHRQFY  425

Query  1558  RNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCRIV  1737
             R+CVI+GT+DFIFG   A+ QN +I  RKPL +Q N +TA G+       G+VLQNCRI 
Sbjct  426   RSCVITGTVDFIFGDAAAIFQNCLITVRKPLENQQNIVTAQGRIDRHETTGIVLQNCRIE  485

Query  1738  PETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYK  1917
             P+  L P++ K+++Y GRPWK +S T++MES IGD + P GW  W G+   KT  Y EY 
Sbjct  486   PDKDLVPVKTKIRSYLGRPWKEFSRTIIMESTIGDFIHPDGWLPWQGDFGLKTLYYAEYN  545

Query  1918  NSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             N G GA T  R + ++ + ++    A  FT   +   + W+ ATG P  +G
Sbjct  546   NKGIGAQTNARIK-WRGYHIIKKEEAMKFTVETFYQED-WISATGSPVRLG  594



>gb|KHN23785.1| Pectinesterase 4 [Glycine soja]
Length=520

 Score =   405 bits (1041),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 228/551 (41%), Positives = 326/551 (59%), Gaps = 47/551 (9%)
 Frame = +1

Query  451   KGDHGVSTGSMKS----VTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEE  618
             KG +  + G +KS    VT  CQ ++ K +C   +S   +++S   K++I   ++++++ 
Sbjct  8     KGVNNSNGGEVKSTNRAVTALCQGSDDKKLCHDVLS---SSNSTDPKEYIATVVRSSMDS  64

Query  619   VHKSHQLVVNTKIEQSTDPYN-HMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRAD  795
             V K+  +     +E         MA+EDCK++LQ A+ DL+AS  +V ++ L       D
Sbjct  65    VIKALNMSDRLTVEHGNSSAGMKMALEDCKDLLQSAMHDLEASGVLVKESSLQ------D  118

Query  796   QLLNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNIT  975
             Q     S +  + T   ++++ +L   +++    N  +LT  A+++++ ++ +L++ ++ 
Sbjct  119   Q-----SCLDGFDTDGEKKVQEQLQSGSLD----NVGKLTGLALDVVSGITHILQSLDL-  168

Query  976   TTTDLLHKAADKnnnnnnnTTSRRLLQTDH--FPEWFPIADRKLLAAQRRGNLRPNVVVA  1149
                DL  K A           SRRLL  D   FP W   ADRKLLA      + P+  VA
Sbjct  169   ---DLALKPA-----------SRRLLDVDDDGFPTWVSSADRKLLA---NDPVLPHATVA  211

Query  1150  KDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIIT  1329
             KDGSGQF T+  A+ SYP  H+ +YVIYVKAG+YDE + V KK  N+ +YGDG  KTIIT
Sbjct  212   KDGSGQFHTVLDAINSYPKHHQGRYVIYVKAGIYDEYITVDKKKPNLLIYGDGPSKTIIT  271

Query  1330  GKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSI  1509
             G+KN+ H    T +TATFS + + F+A+ I F NTAG EGHQAVA R Q D S  FDC++
Sbjct  272   GRKNF-HEGTKTMRTATFSTVAEDFMAKSIAFENTAGAEGHQAVALRVQGDRSVFFDCAM  330

Query  1510  EGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKE  1689
              GYQDTLY H +RQFYRNC ISGTIDFIFG  T LIQNS I+ RKP+ +Q N + ADG  
Sbjct  331   RGYQDTLYAHAHRQFYRNCEISGTIDFIFGYSTTLIQNSKILVRKPMPNQQNIVVADGTG  390

Query  1690  LAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKI  1869
                   GVVLQNC I+P+ +L   R  VKTY  RPWKA+S  V +E+ +GDL+ P G+  
Sbjct  391   QKNMPTGVVLQNCEIMPDASLFADRMIVKTYLARPWKAFSRAVFIENVMGDLIQPEGYIP  450

Query  1870  WDG-ENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPA  2046
             W+  E   + C + E+ N+GPG+ T  R +  K   ++    A  FTA  WL  ++WLP+
Sbjct  451   WNPIEPNTQDCYFAEFGNTGPGSVTQARAKFAKG--LISKQEAAKFTAEPWLTTSTWLPS  508

Query  2047  TGVPFAIGYTK  2079
               VPF   +TK
Sbjct  509   AAVPFDPSFTK  519



>ref|XP_008800480.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13 
[Phoenix dactylifera]
Length=570

 Score =   407 bits (1045),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 215/543 (40%), Positives = 308/543 (57%), Gaps = 31/543 (6%)
 Frame = +1

Query  463   GVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLV  642
             G    + KSV   C   +YK+ C  S++ + N  ++  KD + A++ A ++E+ KS    
Sbjct  48    GTIRSTTKSVKMLCATTDYKETCETSLTKIVNGSTSNPKDVLKASVVAVIDEISKSFS--  105

Query  643   VNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAV  822
               +++ ++ +     AI+DC EM QD+ +DL+ ++S + DT L  L  +A  L NW+SAV
Sbjct  106   -QSRVFKTNNSRVQDAIDDCWEMYQDSKEDLKKTLSKIIDTGLEDLPEQALSLKNWLSAV  164

Query  823   YAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKA  1002
             + YQ TC +       K+ +   M  + +LT+NA+ +I ++S  L   NI  +       
Sbjct  165   FFYQETCVDGFPEGELKNKMRSAMKTSKELTSNALAMIGQVSDFLTMLNIPGS-------  217

Query  1003  ADKnnnnnnnTTSRRLLQTDH-------FPEWFPIADRKLLAAQRRGNLRPNVVVAKDGS  1161
                         SRRLL  D        +P W    DR+LL       LRPNV VA+DGS
Sbjct  218   ------------SRRLLSVDEKPVMKRGYPSWVSEGDRRLLREYLNVKLRPNVTVAQDGS  265

Query  1162  GQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKN  1341
             G F+TI  A+   P K+  +YVIYVK G+Y+E V +  +   + MYGDG  KTI+TG KN
Sbjct  266   GDFRTINEAIDKVPLKYDGRYVIYVKEGIYNEAVNLTSRYVGITMYGDGPKKTIVTGNKN  325

Query  1342  YAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQ  1521
             +      TS TATF A G+GF+A  + FRNTAGPE HQAVA R QSD S   +C +EGYQ
Sbjct  326   FVD-GTKTSHTATFVASGEGFMAVDMGFRNTAGPEKHQAVALRVQSDRSIFINCRMEGYQ  384

Query  1522  DTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKA  1701
             DTLY  ++ QFYR CVI+GTIDF+FG  +A+ QN + + R+PL  Q N +TA G+  +  
Sbjct  385   DTLYAQSHLQFYRRCVITGTIDFVFGDASAVFQNCLFLLRRPLDKQKNIVTAHGRGYSHE  444

Query  1702  KGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGE  1881
               G V+Q+C I  + +L+ +  KV+ Y GRPWK YS T+ +E+QI   + P G+  WD E
Sbjct  445   NTGFVIQHCNIRADRSLHEVEDKVENYLGRPWKEYSRTIFIENQISSFIHPAGYLPWDQE  504

Query  1882  NFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPF  2061
                KT  Y EY N G G+N   R + +  F V+    A +FT   +L+   W+P  GVP 
Sbjct  505   FGLKTLYYAEYNNKGEGSNVTDRIK-WPGFHVIDRRMAENFTVANFLEGERWIPDRGVPS  563

Query  2062  AIG  2070
              +G
Sbjct  564   VMG  566



>ref|XP_010939847.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=570

 Score =   405 bits (1042),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 215/542 (40%), Positives = 310/542 (57%), Gaps = 36/542 (7%)
 Frame = +1

Query  463   GVSTGSMK----SVTTFCQYAEYKDVCAKSISHVANNHS-ATTKDFIFAAIKATLEEVHK  627
             G  TG+M+    SV   C   +YK+ C  S++ + N    ++ KD + AA+ A ++E+ K
Sbjct  43    GADTGTMRTTTRSVKLMCATTDYKETCETSLTGIVNTTGISSPKDVLRAAVVAVIDEISK  102

Query  628   SHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLN  807
             S      +++ ++ D     AI+DC+EM QD+ +DL+ ++S + DT L +L  +   L +
Sbjct  103   SFS---QSRLFKTNDSRVQDAIDDCREMYQDSEEDLKKTLSKIIDTSLESLPEQTLSLKS  159

Query  808   WMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTD  987
             W+SAV+ YQ TC +       K  +   M  + +LT+NA+ ++ ++S LL  F +  +  
Sbjct  160   WLSAVFFYQETCVDGFPDGELKDKMRSAMKTSKELTSNALAMMGQVSDLLMMFTVPES--  217

Query  988   LLHKAADKnnnnnnnTTSRRLLQTDH-------FPEWFPIADRKLLAAQRRGNLRPNVVV  1146
                               RRLL  D         P W    DR+LL       L PNV V
Sbjct  218   -----------------GRRLLSVDESPVMKRGCPSWVSQGDRRLLREHLNVKLLPNVTV  260

Query  1147  AKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTII  1326
             A+DGSG F+TI  A+   PPK+  +YVIYVK G+YDE V +  K  N+ MYGDG  KTI+
Sbjct  261   AQDGSGDFRTINEAIHKIPPKYDGRYVIYVKEGIYDEAVNLTSKYVNITMYGDGPKKTIV  320

Query  1327  TGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCS  1506
             TG KN+      TS TATF A G+GF+A  + FRNTAGP  HQAVA R QSD S   +C 
Sbjct  321   TGNKNFVD-GTKTSHTATFVASGEGFMAVDMGFRNTAGPRKHQAVALRVQSDRSIFINCR  379

Query  1507  IEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGK  1686
             +EGYQDTLY  ++RQFYR CVI+GTIDF+FG  +A+ QN + + R+PL +Q N +TA G+
Sbjct  380   MEGYQDTLYAQSHRQFYRGCVITGTIDFVFGDASAVFQNCLFLLRRPLDNQKNIVTAHGR  439

Query  1687  ELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWK  1866
                    G V+Q+C+I  + +L+ +  KV++Y GRPWK YS T+ ME+QI   + P G+ 
Sbjct  440   AYIHESTGFVIQHCKIKADRSLHKVEDKVESYLGRPWKEYSRTIFMENQISSFIHPAGYL  499

Query  1867  IWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPA  2046
              WD +   KT  Y EY N G G+N   R + +  F V+    A++FT   +L+   W+P 
Sbjct  500   PWDRDFALKTLYYAEYNNRGEGSNVKDRVK-WPGFHVIDRGTAKNFTVANFLEGERWIPD  558

Query  2047  TG  2052
              G
Sbjct  559   RG  560



>ref|XP_006828574.1| hypothetical protein AMTR_s00129p00028250 [Amborella trichopoda]
 gb|ERM95990.1| hypothetical protein AMTR_s00129p00028250 [Amborella trichopoda]
Length=592

 Score =   406 bits (1044),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 231/547 (42%), Positives = 309/547 (56%), Gaps = 40/547 (7%)
 Frame = +1

Query  478   SMKSVTTFCQYAEYKDVCAKSISHVANNHSATT--KDFIFAAIKATLEEVHKSHQLVVNT  651
             SMK++ + C   +Y++ C  S+S    ++S+ T  +D I AAIK   +EV K+       
Sbjct  69    SMKAIKSICSPTDYQEACVSSLSSAIKSNSSLTGPEDLIKAAIKVAKKEVIKAFDHASKL  128

Query  652   KIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAY  831
             + + +       A+ +CKE+L  A+D+L  + S V    L  L   +  L NW+SAV  Y
Sbjct  129   R-KNARSQMEKEALSNCKELLSYAMDELDETFSGVSVAGLKDLATVSQDLKNWLSAVLTY  187

Query  832   QTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADK  1011
             Q TC   +E    KS + + M  ATQLT+N++ II E S +L    +             
Sbjct  188   QETCLNGLEDSNAKSDMAEAMKMATQLTSNSLAIITEASSVLSILKVPGF----------  237

Query  1012  nnnnnnnTTSRRLLQTDH--------FPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQ  1167
                      SRRLL  ++        FP WFP  +R+LLA Q    + PNV VAKDGSG 
Sbjct  238   ---------SRRLLSKENHFSEGKGGFPSWFPAGERRLLAMQ---EMTPNVAVAKDGSGD  285

Query  1168  FKTITGALKSYPP--KHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKN  1341
             F+TIT AL   PP  +   +YVIY+KAGVYDE V V K+M NV MYGDG+ KTIITG KN
Sbjct  286   FRTITEALSKLPPAKERNGRYVIYIKAGVYDEQVTVTKEMVNVTMYGDGSRKTIITGSKN  345

Query  1342  YAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQ  1521
             +      T KTATF+A+G  F+A+ I FRNTAG   HQAVA R QSD +   +C ++G Q
Sbjct  346   FID-GTPTFKTATFAAIGDDFMAKAIGFRNTAGAAKHQAVALRVQSDRAVFLNCRMDGNQ  404

Query  1522  DTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKA  1701
             DTLY H +RQ+YR+CVI+GTIDFIFG   A+ QN  I+ R+PL +Q N ITA G+   + 
Sbjct  405   DTLYAHAHRQYYRSCVITGTIDFIFGNAAAVFQNCQIVVRQPLPNQQNIITAQGRTDKRE  464

Query  1702  KGGVVLQNCRIVPETAL--NPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWD  1875
               GVV+  C+I+P+  L       K ++Y GRPWK YS TV MES IG  + P GW  WD
Sbjct  465   TTGVVIHKCKILPDKKLVAGSSTAKTRSYLGRPWKQYSRTVYMESTIGGFIEPEGWMPWD  524

Query  1876  GENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVL-GPIRARHFTAGLWLDANSWLPATG  2052
             G+    T  Y EY N GPGA   +R   +K + VL     A  FT   ++    W+ ATG
Sbjct  525   GDFALDTLFYGEYMNQGPGATLTKRVN-WKGYRVLKSKEEAMAFTVDKFIQGGEWIKATG  583

Query  2053  VPFAIGY  2073
                 +G+
Sbjct  584   TAVRLGF  590



>ref|XP_009133794.1| PREDICTED: pectinesterase 5 [Brassica rapa]
Length=596

 Score =   406 bits (1044),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 231/565 (41%), Positives = 320/565 (57%), Gaps = 40/565 (7%)
 Frame = +1

Query  481   MKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTK--  654
             MK+V   CQ    K  C K++  V    S      I A + AT + + KS      T+  
Sbjct  38    MKAVQGICQGTSDKASCVKTLEPV---KSDDPNKLIKAFMLATQDALTKSSNFTGKTEGD  94

Query  655   IEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQ  834
             +  S  P N   +E CK++   A++DL   +  +GD +L+ +  + DQL  W++ VY YQ
Sbjct  95    LGSSISPNNKAVLEYCKKVFLYALEDLGTILEEMGD-DLNQIGSKIDQLKQWLTGVYNYQ  153

Query  835   TTCTEQIESRLYKSAIEDGMINATQLTNNAINI----IAEMSKL-LKAFNITTTTDLLHK  999
             T C + I+    +  I +G+ ++  LT NAI+I    ++ M+KL +K  +    T  +  
Sbjct  154   TDCLDDIQEDDLRKTIGEGIASSKILTGNAIDIFHTVVSAMAKLNVKVDDFKNMTSGVFS  213

Query  1000  AADKnnnnnnnTT--------------SRRLLQ---TDHFPEWFPIADRKLLA-------  1107
              +DK     N  T              SRRLL+       P W   ADRKL+A       
Sbjct  214   PSDKGAAPVNKETPPVVDTPVADPDGPSRRLLEDIDETGLPTWVSGADRKLMANAGRGRR  273

Query  1108  -AQRRGNLRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMK  1284
                    +R N VVAKDGSGQF ++  A+ + P K+  + +IY+KAG+Y E V + KK  
Sbjct  274   RGGGGARIRANFVVAKDGSGQFNSVQQAVNACPDKNPGRCIIYIKAGIYREQVIIPKKKN  333

Query  1285  NVFMYGDGAGKTIITGKKNYA-HMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAV  1461
             N+F++GDGA KT+IT  ++       TTS +AT     +GF+A+ I F+NTAGP GHQA 
Sbjct  334   NIFLFGDGARKTVITYNRSVGLSSGTTTSLSATVQVESEGFIAKYIGFKNTAGPNGHQAA  393

Query  1462  AYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIAR  1641
             A R   D + +F+C  +G+QDTLY +  RQFYRNCV+SGT+DFIFGK   +IQNS+I+ R
Sbjct  394   AIRVNGDRAVLFNCRFDGFQDTLYVNNGRQFYRNCVVSGTVDFIFGKSATVIQNSLIVVR  453

Query  1642  KPLVHQFNTITADGKELAKA-KGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTV  1818
             K    Q+NT+TADG E   A K G+VLQ+CRIVP+  L   RF V++Y GRPWK YSTTV
Sbjct  454   KGNKGQYNTVTADGNEKGLAMKIGIVLQHCRIVPDRKLAAERFTVESYLGRPWKQYSTTV  513

Query  1819  VMESQIGDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRAR  1998
             +M ++IGDL+ P GW++WDGENF K+C Y EY N GPGANT RR    K     G +   
Sbjct  514   IMNTEIGDLIRPEGWRVWDGENFHKSCRYVEYNNRGPGANTNRRVNWAKIARTAGEV--N  571

Query  1999  HFTAGLWLDANSWLPATGVPFAIGY  2073
              FT   WL   +W+    VP   G+
Sbjct  572   QFTVANWLSPANWIQQANVPVTFGF  596



>gb|KDP33981.1| hypothetical protein JCGZ_07552 [Jatropha curcas]
Length=590

 Score =   405 bits (1042),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 232/552 (42%), Positives = 322/552 (58%), Gaps = 44/552 (8%)
 Frame = +1

Query  469   STGSMKSVTT-------FCQYAEYKDVCAKSI-SHVANN-HSATTKDFIFAAIKATLEEV  621
             S GS K V          C   +YKD C  S+ S V  +  SA  K  +  AI+AT +E+
Sbjct  63    SKGSAKDVAQVDRVIRRICNGTDYKDTCVSSLESEVKKDPSSANPKAILRLAIEATDDEM  122

Query  622   HKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQL  801
                 +   + K E    P    A EDCK +++DA ++L+ S++  G  ++  L     +L
Sbjct  123   GVVLKKASSFKFES---PQEKAAFEDCKVLIKDAKEELKESLTHAG-VDIKKLAENEPEL  178

Query  802   LNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTT  981
              N +SAV +YQ TC +       KS +E     + +LT+N++ +++ ++  L     ++ 
Sbjct  179   NNLLSAVMSYQQTCIDGFPDGKLKSDMEKTFNASKELTSNSLAMVSSLTSFL-----SSF  233

Query  982   TDLLHKAADKnnnnnnnTTSRRLLQT---------DHFPEWFPIADRKLLAAQRRGNLRP  1134
              ++ H              SRRLL T         D  P W    DR++L A       P
Sbjct  234   GEINH--------------SRRLLATKPNLSSMDKDELPSWISNEDRRILKADDSDKPTP  279

Query  1135  NVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAG  1314
             NV+VAKDGSG+FKTI+ ALK+ P K+K +Y+IYVKAGVYDE+V V KKM+N+ MYGDG+ 
Sbjct  280   NVIVAKDGSGKFKTISEALKAMPKKYKGRYIIYVKAGVYDEVVTVEKKMENITMYGDGSQ  339

Query  1315  KTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAI  1494
             K+IITG KN+    + T +TA+F ALG GF+A+ I FRNTAGPE HQAVA R Q+D +  
Sbjct  340   KSIITGNKNFKD-GVQTFRTASFVALGNGFMAKAIGFRNTAGPEKHQAVAARVQADRTIF  398

Query  1495  FDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTIT  1674
              +C  EGYQDTLY  T+RQ+YR+CVI+GTIDFIFG   A++QN  I+ RKPL +Q N +T
Sbjct  399   LNCRFEGYQDTLYVQTHRQYYRSCVIAGTIDFIFGDAAAILQNCQIVIRKPLENQQNIVT  458

Query  1675  ADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSP  1854
             A G+       G+VLQNCRI P+ +L P + K K+Y GRPWK YS T+VMES I DL+ P
Sbjct  459   AQGRIDPHETTGIVLQNCRIQPDKSLVPDKAKFKSYLGRPWKEYSRTIVMESTIEDLIHP  518

Query  1855  LGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANS  2034
              GW  W+GE   KT  Y E+ N GPGA+T  R + +  + V+    A  +T   ++  + 
Sbjct  519   DGWLAWEGEKGLKTLYYAEFNNKGPGASTKARVK-WPGYHVIDKEEANKYTIEPFIQGD-  576

Query  2035  WLPATGVPFAIG  2070
             W+   G P   G
Sbjct  577   WINDMGAPVHFG  588



>dbj|BAA89480.1| pectin methylesterase [Salix gilgiana]
Length=596

 Score =   405 bits (1042),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 216/532 (41%), Positives = 315/532 (59%), Gaps = 19/532 (4%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVA---NNHSATTKDFIFAAIKATLEEVHKSHQLVVNTK  654
             + + T C    Y+D C  ++       +  S   KD +  AIKA  EE+ K  +   + K
Sbjct  80    RVIKTVCNATTYQDTCQNTLEKGVLGKDPSSVQPKDLLKIAIKAADEEIDKVIKKASSFK  139

Query  655   IEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQ  834
              ++   P    A +DC E+++DA ++L+ S+  +G+ ++  L   A  L NW+SAV +YQ
Sbjct  140   FDK---PREKAAFDDCLELIEDAKEELKNSVDCIGN-DIGKLASNAPDLSNWLSAVMSYQ  195

Query  835   TTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKn  1014
              TC +       KS +E       +LT+N++ +++ +   LK F+ + T +    A ++N
Sbjct  196   QTCIDGFPEGKLKSDMEKTFKATRELTSNSLAMVSSLVSFLKNFSFSGTLNRRLLAEEQN  255

Query  1015  nnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGALK  1194
             + +         L  D  P W    DR++L    +   +PNV VAKDGSG FKTI+ AL 
Sbjct  256   SPS---------LDKDGVPGWMSHEDRRILKGADKDKPKPNVSVAKDGSGDFKTISEALA  306

Query  1195  SYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKT  1374
             + P K++ +YVI+VK GVYDE V V KKM N+ MYGDG+ KTI+TG KN+A   + T +T
Sbjct  307   AMPAKYEGRYVIFVKQGVYDETVTVTKKMANITMYGDGSQKTIVTGNKNFAD-GVQTFRT  365

Query  1375  ATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQF  1554
             ATF+ LG GF+ + + FRNTAGPE HQAVA R Q+D +   +C  EGYQDTLY  T+RQF
Sbjct  366   ATFAVLGDGFLCKFMGFRNTAGPEKHQAVAIRVQADRAIFLNCRFEGYQDTLYAQTHRQF  425

Query  1555  YRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCRI  1734
             YR+CVI+GT+DFIFG  T++ QN +I  RKPL +Q N +TA G+       G+VLQ+CRI
Sbjct  426   YRSCVITGTVDFIFGDATSVFQNCLITVRKPLENQQNIVTAQGRIDGHETTGIVLQSCRI  485

Query  1735  VPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEY  1914
              P+  L P++ K+++Y GRPWK +S TV+M+S IGD + P GW  W G+   KT  Y EY
Sbjct  486   EPDKDLVPVKNKIRSYLGRPWKEFSRTVIMDSTIGDFIHPGGWLPWQGDFGLKTLYYAEY  545

Query  1915  KNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
              N G GA T  R + +  + ++    A  FT   +   + W+ A+G P  +G
Sbjct  546   SNKGGGAQTNARIK-WPGYHIIKKEEAMKFTIENFYQGD-WISASGSPVHLG  595



>gb|ABC25451.1| pollen development related protein [Brassica rapa subsp. chinensis]
Length=585

 Score =   404 bits (1039),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 229/566 (40%), Positives = 326/566 (58%), Gaps = 36/566 (6%)
 Frame = +1

Query  448   GKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHK  627
             G G         K+V + C  A  K  CAK++  V ++  +     I A + AT + V K
Sbjct  32    GAGGDKTLNSHQKAVESLCASATDKGSCAKTLDPVKSDDPSK---LIKAFMLATKDAVTK  88

Query  628   SHQLVVNTK--IEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQL  801
             S     +T+  + ++ +  +   ++ CK +L  A++DL+  +  +G+ +L     + DQL
Sbjct  89    STNFTASTEEGMGKNMNATSKAVLDYCKRVLMYALEDLETIVEEMGE-DLQQSGSKMDQL  147

Query  802   LNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTT  981
               W++ V+ YQT C + IE    +  + +G+ ++  L++NAI+I   ++  +   N+   
Sbjct  148   KQWLTGVFNYQTDCIDDIEESELRKVMGEGIAHSKILSSNAIDIFHALTTAMSQMNVKV-  206

Query  982   TDLLHKAADKnnnnnnnTTSRRLLQ---TDHFPEWFPIADRKLLA-AQRRG---------  1122
              D + K     N        R LL+       P+W    DRKL+A A R G         
Sbjct  207   -DDMKKG----NLGETPAPDRDLLEDLDQKGLPKWHSDKDRKLMAQAGRPGAPADEGIGE  261

Query  1123  ------NLRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMK  1284
                    ++P  VVAKDGSGQFKTI+ A+K+ P K+  + +IY+KAGVY E V + KK+ 
Sbjct  262   GGGGGGKIKPTHVVAKDGSGQFKTISEAVKACPEKNPGRCIIYIKAGVYKEQVTIPKKVN  321

Query  1285  NVFMYGDGAGKTIITGKKNYA-HMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAV  1461
             NVFM+GDGA +TIIT  ++       TTS + T     +GF+A+ I F+NTAGP GHQAV
Sbjct  322   NVFMFGDGATQTIITFDRSVGLSPGTTTSLSGTVQVESEGFMAKWIGFQNTAGPLGHQAV  381

Query  1462  AYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIAR  1641
             A+R   D + IF+C  +GYQDTLY +  RQFYRNCV+SGT+DFIFGK   +IQNS+I+ R
Sbjct  382   AFRVNGDRAVIFNCRFDGYQDTLYVNNGRQFYRNCVVSGTVDFIFGKSATVIQNSLIVIR  441

Query  1642  KPLVHQFNTITADGKELA-KAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTV  1818
             K    Q+NT+TADG E     K G+V+QNCRIVP+  L P R  V++Y GRPWK YSTTV
Sbjct  442   KGNKGQYNTVTADGNEKGLSMKIGIVIQNCRIVPDKKLAPERLTVESYLGRPWKQYSTTV  501

Query  1819  VMESQIGDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRR-NRAFKKFDVLGPIRA  1995
             V+ ++IGD++ P GW++WDGE+F KTC Y EY N GPGANT RR N A       G +  
Sbjct  502   VINTEIGDVIRPEGWRLWDGESFHKTCRYVEYNNRGPGANTNRRVNWAKVARSTAGEV--  559

Query  1996  RHFTAGLWLDANSWLPATGVPFAIGY  2073
               FT   WL   +W+    VP   G+
Sbjct  560   NQFTVANWLSPANWIQQANVPVTFGF  585



>ref|XP_006296394.1| hypothetical protein CARUB_v10025567mg [Capsella rubella]
 gb|EOA29292.1| hypothetical protein CARUB_v10025567mg [Capsella rubella]
Length=587

 Score =   404 bits (1039),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 233/564 (41%), Positives = 324/564 (57%), Gaps = 32/564 (6%)
 Frame = +1

Query  454   GDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSH  633
             GD  +S   MK+V   CQ    K  C K++  V    S      I A + AT + + KS 
Sbjct  30    GDTNLSP-QMKAVQGICQSTSDKASCVKTLEPV---KSEDPNKLIKAFLLATKDAITKSS  85

Query  634   QLVVNTK--IEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLN  807
                  T+  +  S  P N   ++ CK +   A++DL   I  +G+ +L+ +  + DQL  
Sbjct  86    NFTGKTEGNMGSSISPNNKAVLDYCKRVFMYALEDLATIIEEMGE-DLNQIGSKFDQLKQ  144

Query  808   WMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINI----IAEMSKL---LKAF  966
             W++ VY YQT C + IE +  +  IEDG++++  LT NAI+I    ++ M+KL   +  F
Sbjct  145   WITGVYNYQTDCLDDIEEKDLRKTIEDGIVDSKILTRNAIDIFHTVVSAMAKLNNKVDEF  204

Query  967   NITTTTDLLHKAA----DKnnnnnnnTTSRRLLQ---TDHFPEWFPIADRKLLAAQRRGN  1125
               TT    ++K A    D++   + +  +RRLL+       P W   ADRKL+A   RG 
Sbjct  205   KNTTGETPVNKGAPPVVDESPVADPDGPARRLLEDMDQTKIPTWVSGADRKLMARAGRGR  264

Query  1126  LRP-------NVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMK  1284
                         VVAKDGSGQFKT+  A+ + P K+  + +I++KAGVY E V + KK  
Sbjct  265   SGGGSGSIRATFVVAKDGSGQFKTVQAAVNACPEKNPGRCIIHIKAGVYREQVIIPKKKN  324

Query  1285  NVFMYGDGAGKTIITGKKNYA-HMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAV  1461
             N+FM+GDGA KT+IT  ++       TTS +AT     +GF+A+ I F+NTAGP GHQA 
Sbjct  325   NIFMFGDGARKTVITYNRSVGLSPGTTTSLSATVQVESEGFMAKWIGFKNTAGPLGHQAA  384

Query  1462  AYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIAR  1641
             A R   D + IF+C  +GYQDTLY +  RQFYRNCV+SGT+DFIFGK   +IQNS+I+ R
Sbjct  385   AIRVNGDRAVIFNCRFDGYQDTLYVNNGRQFYRNCVVSGTVDFIFGKSATVIQNSLIVVR  444

Query  1642  KPLVHQFNTITADGKELAKA-KGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTV  1818
             K    Q+NT+TADG E+  A K G+VLQNCRIVP+  L P R  V +Y GRPWK +STTV
Sbjct  445   KGSKGQYNTVTADGNEIGFAVKIGIVLQNCRIVPDRKLTPERLTVASYLGRPWKKFSTTV  504

Query  1819  VMESQIGDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRAR  1998
             ++ +++GDL+ P GW+IWDGE+F ++C Y EY N GPGA   RR    K           
Sbjct  505   IVNTEMGDLIRPEGWRIWDGESFHESCKYIEYNNRGPGAINNRRANWAKI--ARSAAEVN  562

Query  1999  HFTAGLWLDANSWLPATGVPFAIG  2070
              F    WL   +W+    VP  +G
Sbjct  563   DFAVPNWLGPINWIQEANVPVTLG  586



>emb|CDX83347.1| BnaA03g21590D [Brassica napus]
Length=567

 Score =   402 bits (1034),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 224/548 (41%), Positives = 312/548 (57%), Gaps = 35/548 (6%)
 Frame = +1

Query  481   MKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTK--  654
             MK+V   CQ    K  C K++  V    S      I A + AT + + KS      T+  
Sbjct  38    MKAVQGICQGTSDKASCVKTLEPV---KSDDPNKLIKAFMLATQDALTKSSNFTGKTEGD  94

Query  655   IEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQ  834
             +  S  P N   +E CK++   A++DL   +  +GD +L+ +  + DQL  W++ VY YQ
Sbjct  95    LGSSISPNNKAVLEYCKKVFLYALEDLGTILEEMGD-DLNQIGSKIDQLKQWLTGVYNYQ  153

Query  835   TTCTEQIESRLYKSAIEDGMINATQLTNNAINI----IAEMSKL-LKAFNITTTTDLLHK  999
             T C + I+    +  I +G+ ++  LT NAI+I    ++ M+KL +K  +    T  +  
Sbjct  154   TDCLDDIQEDDLRKTIGEGIASSKILTGNAIDIFHTVVSAMAKLNVKVDDFKNMTSGVFS  213

Query  1000  AADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLA--------AQRRGNLRPNVVVAKD  1155
              +DK                   P W   ADRKL+A              +R N VVAKD
Sbjct  214   PSDKGAAPT------------GLPTWVSGADRKLMANAGRGRRRGGGGARIRANFVVAKD  261

Query  1156  GSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGK  1335
             GSGQF ++  A+ + P K+  + +IY+KAG+Y E V + KK  N+F++GDGA KT+IT  
Sbjct  262   GSGQFNSVQQAVNACPDKNPGRCIIYIKAGIYREQVIIPKKKNNIFLFGDGARKTVITYN  321

Query  1336  KNYA-HMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIE  1512
             ++       TTS +AT     +GF+A+ I F+NTAGP GHQA A R   D + +F+C  +
Sbjct  322   RSVGLSSGTTTSLSATVQVESEGFIAKYIGFKNTAGPNGHQAAAIRVNGDRAVLFNCRFD  381

Query  1513  GYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKEL  1692
             G+QDTLY +  RQFYRNCV+SGT+DFIFGK   +IQNS+I+ RK    Q+NT+TADG E 
Sbjct  382   GFQDTLYVNNGRQFYRNCVVSGTVDFIFGKSATVIQNSLIVVRKGNKGQYNTVTADGNEK  441

Query  1693  AKA-KGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKI  1869
               A K G+VLQ+CRIVP+  L   RF V++Y GRPWK YSTTV+M ++IGDL+ P GW++
Sbjct  442   GLAMKIGIVLQHCRIVPDRKLAAERFTVESYLGRPWKQYSTTVIMNTEIGDLIRPEGWRV  501

Query  1870  WDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPAT  2049
             WDGENF K+C Y EY N GPGANT RR    K     G +    FT   WL   +W+   
Sbjct  502   WDGENFHKSCRYVEYNNRGPGANTNRRVNWAKIARTAGEV--NQFTVANWLSPANWIQQA  559

Query  2050  GVPFAIGY  2073
              VP   G+
Sbjct  560   NVPVTFGF  567



>ref|XP_006661265.1| PREDICTED: LOW QUALITY PROTEIN: putative pectinesterase/pectinesterase 
inhibitor 45-like [Oryza brachyantha]
Length=613

 Score =   404 bits (1037),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 232/588 (39%), Positives = 324/588 (55%), Gaps = 19/588 (3%)
 Frame = +1

Query  334   RRKM-AGNNIAITLVSLIlvvgvvcgavlvlqgvDDASSG-KGDHGVSTGS-------MK  486
             RR M A   ++I ++ +++    +  +    +  +  S G K   G  +GS        K
Sbjct  25    RRIMIAAGTVSIVIILIVMGAAAITYSGKNSEKEESGSKGSKAKPGGGSGSPADLRAVSK  84

Query  487   SVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQS  666
             S+   C   +++D C KSI   AN  +++ KD I       + +     Q      +  S
Sbjct  85    SIKVMCAQTDFQDACEKSIGKAANASASSPKDIIRPPAVGVIGDA--VSQAFDRADLIMS  142

Query  667   TDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTCT  846
             TDP    A+ DCKE+  DA+DDL  ++  +       L  +  QL  W+SAV A+Q TC 
Sbjct  143   TDPRVKAAVADCKELFDDAMDDLNRTLKGIDGAGKDGLAKQGFQLRVWLSAVIAHQETCI  202

Query  847   EQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnnnnn  1026
             +      +K+ ++D  IN  +LT+NA+ +I + S  L +  ++    LL    + +    
Sbjct  203   DGFPEDEFKAKVKDSFINGKELTSNALALIEKASTFLSSLKLSKRR-LLAGEDEDDGAAA  261

Query  1027  nnTTSRRLLQTDHFPEWFPIADRKLL-AAQRRGNLRPNVVVAKDGSGQFKTITGALKSYP  1203
                     L  D  PEW P  DR++L     + NL PNVVVAKDGSG+FKTI  AL + P
Sbjct  262   AEPQREPPLAKDGIPEWVPDGDRRVLKGGGFKNNLTPNVVVAKDGSGKFKTINEALAAMP  321

Query  1204  PKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKTATF  1383
               +  +YVIYVK GVY E V + KKM NV +YGDGA K+++TG KN+    ITT K+ATF
Sbjct  322   KTYTGRYVIYVKEGVYAEYVTITKKMANVTVYGDGARKSVVTGNKNFID-GITTFKSATF  380

Query  1384  SALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRN  1563
             +A G GF+A G+ F+NTAG E HQAVA   QSD S   +C ++G+QDTLY H+  QFYRN
Sbjct  381   TAQGDGFMAIGMGFQNTAGAEKHQAVALLVQSDKSVFLNCWMDGFQDTLYAHSKAQFYRN  440

Query  1564  CVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCRIVPE  1743
             CV+SGTIDFIFG   A+ QN II  R+PL +Q N  TA G+   +   G VLQ C    E
Sbjct  441   CVVSGTIDFIFGDAAAVFQNCIITLRRPLPNQQNIATAQGRADGREATGFVLQKCEFNAE  500

Query  1744  TALNPLRF-KVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYKN  1920
             TAL   +   ++ Y GRPW+ +S TVVMES+I  ++   G+  W+G+   KT  Y EY N
Sbjct  501   TALTDAKLPPIRNYLGRPWREFSRTVVMESEIPAIIDKAGYLPWNGDFALKTLYYAEYGN  560

Query  1921  SGPGANTWRRNR--AFKKFDVLGPIRARHFTAGLWLDANSWLPATGVP  2058
             +GPGA+T  R     +KK  V+    A  FT   +L A  W+  TG P
Sbjct  561   TGPGADTAGRVAWPGYKK--VISKADATKFTVENFLHAKPWIDPTGTP  606



>gb|EPS66234.1| hypothetical protein M569_08543 [Genlisea aurea]
Length=598

 Score =   403 bits (1035),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 215/531 (40%), Positives = 304/531 (57%), Gaps = 39/531 (7%)
 Frame = +1

Query  502   CQYAEYKDVCAKSI-SHVANNHSATTKDFIFAAIKATLEEV----HKSHQLVVNTKIEQS  666
             C   +YK  C  S+   V     A  +  + A++   L+EV    ++S ++  +T     
Sbjct  96    CSVVDYKKTCEGSLLKQVKGKDEAKPEAIVKASLSVALKEVGGAMNRSREIEFDT-----  150

Query  667   TDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTCT  846
               P+   A  DC  +L DA+++L ASIS +   E   L     ++ NW+SAV +YQ TC 
Sbjct  151   --PFKKAAFNDCLVLLNDAVEELNASISSI---EGGGLSSATPEIKNWLSAVLSYQQTCI  205

Query  847   EQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnnnnn  1026
             +       K  ++  +  + +L +NA+ ++ + S + KA   + +++             
Sbjct  206   DGFPDGAEKDKMQKLLNTSKELGSNALAVVTQASAIFKALRGSKSSE-------------  252

Query  1027  nnTTSRRLLQTDH---FPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGALKS  1197
                  RRLL +D     P+W     R++L + +     PN  VAKDG+G F TI  AL +
Sbjct  253   -----RRLLASDDGFVVPDWVDPESRRVLKS-KESKFTPNATVAKDGTGNFTTIAAALDA  306

Query  1198  YPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKTA  1377
              P K K +YVIY+K G+YDE V V KKM+N+ MYGDG+ K+IITG KNY    + T +TA
Sbjct  307   IPEKFKGRYVIYIKEGIYDESVVVSKKMQNITMYGDGSQKSIITGNKNYVD-GVPTYQTA  365

Query  1378  TFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFY  1557
             TF+ +G GF+ + + FRNTAGPE HQAVA R QSD S   +C +EGYQDTLY  T+RQFY
Sbjct  366   TFAVVGDGFLGQSLGFRNTAGPEKHQAVALRVQSDRSIFVNCRMEGYQDTLYAQTHRQFY  425

Query  1558  RNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCRIV  1737
             R+C I GT+DFIFG   A+ QN +I   KPL +Q N +TA G+   +   G+VLQNC+I+
Sbjct  426   RSCYIRGTVDFIFGDAAAVFQNCMIYVTKPLENQKNVVTAQGRIDKRQTTGIVLQNCKIL  485

Query  1738  PETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYK  1917
              +  L P++ + +TY GRPWK YS T+VMES+IGDL+SP GW  W G+   KT  Y EY 
Sbjct  486   ADDQLEPVKARFQTYLGRPWKEYSRTIVMESEIGDLISPAGWLEWSGDFALKTLFYGEYN  545

Query  1918  NSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             N GPG+ T  R + +  +  L    A  FTAG +L   +WL A  VP   G
Sbjct  546   NKGPGSGTSDRVK-WAGYKTLQRNDALRFTAGPFLQGETWLDAAVVPVRFG  595



>emb|CDY50913.1| BnaC03g72420D [Brassica napus]
Length=567

 Score =   401 bits (1031),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 224/548 (41%), Positives = 312/548 (57%), Gaps = 35/548 (6%)
 Frame = +1

Query  481   MKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIE  660
             MK+V   CQ    K  C K++  V    S      I A + AT + + KS      T+ E
Sbjct  38    MKAVQGICQGTSDKASCVKTLEPV---KSDDPNKLIKAFMLATQDALTKSSNFTGKTEGE  94

Query  661   --QSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQ  834
                S  P N   +E CK++   A++DL   +  +G+ +L+ +  + DQL  W++ VY YQ
Sbjct  95    LGSSISPNNKAVLEYCKKVFLYALEDLGTILEEMGE-DLNQIGSKIDQLKQWLTGVYNYQ  153

Query  835   TTCTEQIESRLYKSAIEDGMINATQLTNNAINI----IAEMSKL-LKAFNITTTTDLLHK  999
             T C + I+    +  I +G+ ++  LT NAI+I    ++ M+KL +K  +    T  +  
Sbjct  154   TDCLDDIQEEDLRKTIGEGIASSKILTGNAIDIFHTVVSAMAKLNVKVDDFKNMTSGVFS  213

Query  1000  AADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLA--------AQRRGNLRPNVVVAKD  1155
              +DK                   P W   ADRKL+A              +R N VVAKD
Sbjct  214   PSDKGAAPT------------GLPTWVSGADRKLMANAGRGRRRGGGGARIRANFVVAKD  261

Query  1156  GSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGK  1335
             GSGQF ++  A+ + P K+  + +IY+KAG+Y E V + KK  N+F++GDGA KT+IT  
Sbjct  262   GSGQFNSVQQAVNACPDKNPGRCIIYIKAGIYREQVIIPKKKNNIFLFGDGARKTVITYN  321

Query  1336  KNYA-HMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIE  1512
             ++       TTS + T     +GF+A+ I F+NTAGP GHQAVA R   D + +F+C  +
Sbjct  322   RSVGLSSGTTTSLSGTVQVESEGFIAKYIGFKNTAGPNGHQAVAIRVNGDRAVLFNCRFD  381

Query  1513  GYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKEL  1692
             G+QDTLY +  RQFYRNCVISGT+DFIFGK   +IQNS+I+ RK    Q+NT+TADG E 
Sbjct  382   GFQDTLYVNNGRQFYRNCVISGTVDFIFGKSATVIQNSLIVVRKGNKGQYNTVTADGNEK  441

Query  1693  AKA-KGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKI  1869
               A K G+VLQ+CRIVP+  L   R  V++Y GRPWK YSTTV+M ++IGDL+ P GW++
Sbjct  442   GLAMKIGIVLQHCRIVPDRKLAAERLTVESYLGRPWKQYSTTVIMNTEIGDLIRPEGWRV  501

Query  1870  WDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPAT  2049
             WDGENF K+C Y EY N GPGANT RR    K     G +    FT   WL   +W+   
Sbjct  502   WDGENFHKSCRYVEYNNRGPGANTNRRVNWAKIARTAGEV--NQFTVANWLSPVNWIQQA  559

Query  2050  GVPFAIGY  2073
              VP  +G+
Sbjct  560   NVPVTLGF  567



>ref|XP_010932334.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=602

 Score =   402 bits (1032),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 220/550 (40%), Positives = 314/550 (57%), Gaps = 50/550 (9%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQ  663
             +++   C   +YK+ C   ++   N  S   K  I A+I   ++EV K+      + + +
Sbjct  74    RAIKLVCGAVDYKEACESRMAKAVNTTSP--KALIRASISIVVDEVAKAFN---KSDLIK  128

Query  664   STDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKH---RADQLLNWMSAVYAYQ  834
             S DP    AIEDCKE+ +D+ D+L  ++   G+ + HTL+    ++ +L NW+SAV +YQ
Sbjct  129   SDDPMVQGAIEDCKELFRDSADELATAL---GNIDAHTLEQVPKQSSELRNWLSAVMSYQ  185

Query  835   TTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKn  1014
              TC +   +  +K  +++ M +A +LT+NA+ II E S  L +  I              
Sbjct  186   QTCIDGFPNGEWKDKMKEAMKSAKELTSNALAIIEEASHFLSSVKIPAGN----------  235

Query  1015  nnnnnnTTSRRLLQTDH---------FPEWFPIADRKLLAAQRRG---------NLRPNV  1140
                      RRLL             FP W    +R+ L  + +          NL+PNV
Sbjct  236   --------GRRLLAEGQEAAPHKDAGFPSWLSKEERRHLEEEGQDGQDGPRATKNLKPNV  287

Query  1141  VVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKT  1320
              VAKDGSG FKTI+ AL   P K++ +Y IYVK GVY+E V V KKM NV M+GDG+ KT
Sbjct  288   TVAKDGSGDFKTISEALARMPKKYEGRYFIYVKEGVYEETVVVDKKMVNVTMFGDGSRKT  347

Query  1321  IITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFD  1500
             I+TG KNY      T +TATF+ALG GF+   + FRNTAGPE HQAVA R Q+D +   +
Sbjct  348   IVTGSKNYVD-GTRTYQTATFAALGDGFMGIAMGFRNTAGPEKHQAVALRVQADRAVFLN  406

Query  1501  CSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITAD  1680
             C +EGYQDTLY   +RQFYR+C+I+GT+DFIFG   A+ QN I++ R+PL +Q N +TA 
Sbjct  407   CRMEGYQDTLYAQCHRQFYRSCIIAGTVDFIFGDAAAIFQNCILVVRRPLDNQQNIVTAQ  466

Query  1681  GKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLG  1860
             G+   +   G VL +CR   ++ L P + K+++Y GRPWK YS TV+MES IGD +   G
Sbjct  467   GRISPRETTGFVLHHCRFTADSKLVPDKDKIRSYLGRPWKEYSRTVIMESDIGDFIHKDG  526

Query  1861  WKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLG-PIRARHFTAGLWLDANSW  2037
             +  W+G+   KT  Y EYKN GPGA+T  R + +  F V+     A  FT  +++    W
Sbjct  527   YMPWEGDFALKTLFYAEYKNKGPGADTSARVQ-WPGFKVISNRTEAVGFTPEVFIQGRDW  585

Query  2038  LPATGVPFAI  2067
             +  TG P  +
Sbjct  586   IKRTGGPAPV  595



>ref|XP_009359677.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Pyrus x bretschneideri]
Length=599

 Score =   402 bits (1032),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 226/543 (42%), Positives = 313/543 (58%), Gaps = 40/543 (7%)
 Frame = +1

Query  466   VSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVH----KSH  633
             V +   K +   C  A+YKD C   I    +      K FI   I A  +E      K+ 
Sbjct  85    VPSNGQKILKEMCSVADYKDKCEGIIEKAKD--ETKPKAFIKTVISAASDEAKSAYSKTA  142

Query  634   QLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWM  813
             +L  N+       P    A EDCK +  DA ++L  ++S +G+  + + K     L +W+
Sbjct  143   ELTFNS-------PEEKGAFEDCKVLFDDAKEELGDAVSQLGNN-IESGKVHTGVLNSWL  194

Query  814   SAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLL  993
             SAV +YQ TC +       KS +E  +  + + T+N++ +++ +++L           L 
Sbjct  195   SAVISYQQTCVDGFPDGKLKSELEKMLQASKEFTSNSLAMLSLLNQL---------QPLG  245

Query  994   HKAADKnnnnnnnTTSRRLLQTDH--FPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQ  1167
              +AA          ++RRLL  D   FP W    DR++L       L PNV VAKDGSG 
Sbjct  246   AEAA--------AGSNRRLLSQDKSGFPTWMSHEDRRMLKKNDE-KLTPNVTVAKDGSGN  296

Query  1168  FKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYA  1347
             +KTI+ AL+  P K++ +YVIYVK GVYDE V V KKM N+ MYGDG+ K+IITG KN+A
Sbjct  297   YKTISEALEKIPEKYEGRYVIYVKEGVYDETVTVTKKMPNITMYGDGSQKSIITGNKNFA  356

Query  1348  HMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDT  1527
               K+   +TA F  LG+GF+A+ + FRNTAGPE HQAVA R Q+D +   +C  EGYQ T
Sbjct  357   D-KVRIFQTAPFVVLGEGFMAKSMGFRNTAGPEKHQAVAARVQADRTIFLNCRFEGYQST  415

Query  1528  LYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKG  1707
             LY  T+RQFY++CVISGT+DFIFG   A+ QN +I  RKPL +Q NT+TA  +   +   
Sbjct  416   LYAQTHRQFYKSCVISGTVDFIFGDAAAIFQNCLIYVRKPLENQQNTVTAQERTDKQETT  475

Query  1708  GVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENF  1887
             G+VLQNC+I+P+  L P++ + KTY GRP K +S T+VM+S I DL+ P GW  W+G+  
Sbjct  476   GIVLQNCKIMPDKDLEPVKSQFKTYLGRPSKEFSRTIVMDSTIEDLIHPDGWTQWEGDFA  535

Query  1888  EKTCMYYEYKNSGPGANTWRRNR--AFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPF  2061
              KT  Y EY N GPGA T  R +   +KK D      A H+TAG +L  ++WL   GVP 
Sbjct  536   LKTLYYAEYNNKGPGAKTDNRVKWDGYKKIDKQ---EAMHYTAGPFLKGHAWLMGVGVPV  592

Query  2062  AIG  2070
               G
Sbjct  593   RFG  595



>ref|XP_010107091.1| putative pectinesterase/pectinesterase inhibitor 13 [Morus notabilis]
 gb|EXC13612.1| putative pectinesterase/pectinesterase inhibitor 13 [Morus notabilis]
Length=607

 Score =   401 bits (1030),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 216/532 (41%), Positives = 307/532 (58%), Gaps = 16/532 (3%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQ  663
             K V   C   +Y++ C  ++    N  +A+ +D + AAI A  +E+ +      + K   
Sbjct  78    KIVKVICNATDYREKCEVALR---NQTAASPRDLLKAAIVAAKDELRRDFNKTSSLKF--  132

Query  664   STDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTC  843
                P    A EDC+ +++DA+D+L AS+S VG+    TL  +   L +W+SAV +YQ TC
Sbjct  133   -NSPQEKAAYEDCEGLVEDALDELDASVSTVGNNSPGTLSTKTPDLNSWLSAVISYQQTC  191

Query  844   TEQI-ESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHK------A  1002
              +   E    K+ +      + + T+N++ ++ E+S LL AF ++  T+L  +      A
Sbjct  192   VDGFPEGSKLKADLARLFKASKEFTSNSLALVTEISSLLSAFQLSGATELTARHLAEIAA  251

Query  1003  ADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTIT  1182
             A          ++   L    FP+W    DR++L       L PNV VAKDGSGQF TI 
Sbjct  252   APSPAREPTPVSNGPSLDDYGFPDWMEEDDRRMLKVDY-DKLTPNVTVAKDGSGQFTTIN  310

Query  1183  GALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKIT  1362
              A+ + P K+  +YVIYVK G+Y+E V V KKM NV MYGDG+ K+IITG KN+    + 
Sbjct  311   EAIVAIPAKYDGRYVIYVKEGIYEETVIVTKKMLNVTMYGDGSQKSIITGSKNFVD-GVR  369

Query  1363  TSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHT  1542
             T +TATF A G GF+ R + FRNTAGPE HQAVA R QSD +   +C  EGYQDTLY   
Sbjct  370   TFQTATFVAQGDGFIGRAMGFRNTAGPEKHQAVAARIQSDRAIFVNCRFEGYQDTLYAQA  429

Query  1543  YRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQ  1722
             +RQFYR+CVI+GT+DFIFG   ++ QN +I+ RKPL +Q N +TA G+   +   G+VL 
Sbjct  430   HRQFYRSCVIAGTVDFIFGDAASVFQNCMIVVRKPLDNQQNIVTAQGRTDKQQTTGIVLH  489

Query  1723  NCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCM  1902
             NCRI+ +  L P++ ++++Y GRPWK YS T+VMES I D++ P GW  W G+    T  
Sbjct  490   NCRILADRKLEPVKDRIRSYLGRPWKEYSRTIVMESTIHDVIHPDGWLPWQGDFALNTLY  549

Query  1903  YYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVP  2058
             Y EY N GPGA   +R        V+    A  +T   +L  + W+   GVP
Sbjct  550   YAEYNNKGPGAKVDKRVHWPGYKSVITREEALQYTVQNFLQGD-WVTVKGVP  600



>ref|XP_010098737.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXB75640.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=454

 Score =   395 bits (1016),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 217/474 (46%), Positives = 294/474 (62%), Gaps = 33/474 (7%)
 Frame = +1

Query  685   MAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTCTEQIESR  864
             M++EDCK+++Q A+D+L+ S SVVGD +LH +     +L+NW+SAV +YQ TC + I   
Sbjct  1     MSLEDCKDLMQFAVDELKDSFSVVGDGDLHAVHDEEAELMNWLSAVVSYQQTCLDGITDP  60

Query  865   LYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnnnnnnnTTSR  1044
               K  + DG++NA +LT+NA+ I++  S +L AF I       H        N+++  SR
Sbjct  61    DTKKEMSDGLVNAGELTSNALAIVSAFSDILGAFKIP-----FH-------FNSSSAFSR  108

Query  1045  RLLQTDH----FPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGALKSYPPKH  1212
             RLL+ +     +P WF  ADRKLL ++  GNL PN VVAKDGSGQ+K+I  AL +YP   
Sbjct  109   RLLEAEEDDKVYPSWFSAADRKLLGSRGGGNLAPNAVVAKDGSGQYKSIGEALAAYPKDL  168

Query  1213  KAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKTATFSAL  1392
             K +YVIYVKAGVYDE + V K   NVF+YGDG  KTI+TG+KN+    ++T KTAT S  
Sbjct  169   KGRYVIYVKAGVYDEYITVTKNQVNVFIYGDGPRKTIVTGRKNFRD-GVSTFKTATCSR-  226

Query  1393  GKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAI-----FDCSIEGYQDTLYYHTYRQFY  1557
                   + I  +    PE  ++         S +          +GYQDTLY   +RQFY
Sbjct  227   ------KRIHRQVNRIPEHGRSGGTPGGGGASTVGHGGLIQLQNDGYQDTLYVQAHRQFY  280

Query  1558  RNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCRIV  1737
             RNCVISGT+DFIFG  +A+IQN +II RKP   Q N +TA G+   +   G+V+QNCRIV
Sbjct  281   RNCVISGTVDFIFGDASAIIQNCLIIVRKPGEGQKNAVTAQGRADKRETTGIVIQNCRIV  340

Query  1738  PETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYY-EY  1914
             PE  L   RFK  TY GRPWK YS TV+ME+ +GDL+ P+GW  W+G NF    +YY EY
Sbjct  341   PEEKLFTERFKYPTYLGRPWKQYSRTVIMETTMGDLIQPVGWMEWNG-NFALDTLYYREY  399

Query  1915  KNSGPGANTWRRNRAFKKFDVLGPI-RARHFTAGLWLDANSWLPATGVPFAIGY  2073
              N GPGA T +R + ++ + V+     A HFT G ++  N WL  TG P+ +G+
Sbjct  400   ANRGPGAGTDKRVK-WRGYKVITDRNEALHFTPGPFIQGNLWLRYTGAPYFLGF  452



>ref|XP_004142361.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like 
[Cucumis sativus]
 ref|XP_004159078.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like 
[Cucumis sativus]
 gb|KGN52371.1| hypothetical protein Csa_5G630740 [Cucumis sativus]
Length=594

 Score =   400 bits (1028),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 219/534 (41%), Positives = 309/534 (58%), Gaps = 28/534 (5%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSIS---HVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTK  654
             K +T  C   +YK  C  ++    H   N S+  KD I  AI A   EV  + +      
Sbjct  82    KMITMICNSTDYKGKCESTLKDGVHTDPN-SSDPKDLIKLAISAAAHEVKSAVKKASGFN  140

Query  655   IEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRA-DQLLNWMSAVYAY  831
                   P    A EDCK +L+DAI++L+ S+S V    +  L  +    L NW+SAV +Y
Sbjct  141   F---ATPEEKGAFEDCKVLLEDAIEELEMSMSEVNKKNMGKLTAKTTPNLNNWLSAVMSY  197

Query  832   QTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADK  1011
               TC +       KS IE  +    +LT+N++ +I++++     F      ++   AA +
Sbjct  198   HETCVDGFPEGKMKSDIEKVVKAGKELTSNSLAMISQVASFFSTF------EMPEGAASR  251

Query  1012  nnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGN-LRPNVVVAKDGSGQFKTITGA  1188
                       RRL+ T+  P W     R++L     G   +PNVVVAKDGSG+FKTI  A
Sbjct  252   ----------RRLMTTNGVPTWMDRNQRRMLKGAAAGEKPKPNVVVAKDGSGEFKTINEA  301

Query  1189  LKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTS  1368
             L + P K+  +YVIYVK G+YDE V + KKM NV MYGDG+ K++I+G KN+    + T 
Sbjct  302   LAAMPAKYDGRYVIYVKEGIYDETVVITKKMVNVTMYGDGSQKSMISGSKNFVD-GVRTF  360

Query  1369  KTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYR  1548
             +TATF ALG+GF+ + I FRN AGPE HQAVA R Q+D +   +C  EGYQDTLY   +R
Sbjct  361   QTATFVALGEGFLGQAIGFRNIAGPEKHQAVAARVQADRAIFVNCRFEGYQDTLYTQAHR  420

Query  1549  QFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNC  1728
             QFYR+C+I+GTIDFIFG   A+ QN  ++ RKPL +Q N +TA G+       G+VLQNC
Sbjct  421   QFYRSCLITGTIDFIFGDAAAIFQNCNMMIRKPLDNQQNMVTAQGRTDKHETTGIVLQNC  480

Query  1729  RIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYY  1908
             +I+P+  L P++ + K+Y GRPWK +S T+VMES I D++ P GW  W+G+   KT  Y 
Sbjct  481   KILPDKTLEPVKSQFKSYLGRPWKEFSRTIVMESTIEDVIHPDGWMAWEGDFALKTLYYA  540

Query  1909  EYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             E+ N GPGA T  R + +  + V+    A  FT G +L+ + W+ +T  P  +G
Sbjct  541   EFNNKGPGAKTDARVK-WPGYKVIDKDEAAKFTIGTFLELD-WIESTSAPVHVG  592



>ref|XP_008337792.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13 
[Malus domestica]
Length=603

 Score =   400 bits (1028),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 224/542 (41%), Positives = 312/542 (58%), Gaps = 42/542 (8%)
 Frame = +1

Query  472   TGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVH----KSHQL  639
             +   K +   C  A+YK+ C   I    +      K FI  AI A  +E      K+ +L
Sbjct  91    SNGQKILKEMCSAADYKEKCEGIIEKARD--ETKPKAFIKTAISAASDEAKSAYSKTAEL  148

Query  640   VVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSA  819
               N+       P    A EDCK +  DA  +L  ++S +G++ + + K R   L +W+SA
Sbjct  149   TFNS-------PEEKGAFEDCKVLFDDAKGELGDAVSQLGNS-IESGKVRTGVLNSWLSA  200

Query  820   VYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKL-LKAFNITTTTDLLH  996
             V +YQ TC +       KS +E  +  + + T+N++ +++  ++L L      T ++   
Sbjct  201   VISYQQTCVDGFPDGKLKSDLEKMLQASKEFTSNSLAMLSLFNQLQLPGAEAATGSN---  257

Query  997   KAADKnnnnnnnTTSRRLLQTDH--FPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQF  1170
                            RRLL  D   FP W    DR++L       L PNV VAKDGSG +
Sbjct  258   ---------------RRLLSQDKSGFPTWMSHEDRRMLKKNDE-KLTPNVTVAKDGSGNY  301

Query  1171  KTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAH  1350
             KTI+ AL+  P K++ +YVIYVK GVYDE V V KKM NV MYGDG+ K+++TG KN+A 
Sbjct  302   KTISEALEKIPEKYEGRYVIYVKEGVYDETVTVTKKMPNVTMYGDGSQKSVVTGNKNFAD  361

Query  1351  MKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTL  1530
              K+   +TA F+ LG+GF+A+ + FRNTAGPE HQAVA R Q+D +   +C  EGYQ TL
Sbjct  362   -KVRIFQTAPFAVLGEGFMAKSMGFRNTAGPEKHQAVAARVQADRAIFLNCRFEGYQSTL  420

Query  1531  YYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGG  1710
             Y  T+RQFY++CVISGT+DFIFG   A+ QN +I  RKPL +Q NT+TA G+   +   G
Sbjct  421   YAQTHRQFYKSCVISGTVDFIFGDAAAIFQNCLIYVRKPLENQQNTVTAQGRTDKQETTG  480

Query  1711  VVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFE  1890
             +VLQNC+I+P+  L P++ + KTY GRP K +S T+VM+S I DL+ P GW  W+G+   
Sbjct  481   IVLQNCKIMPDKDLEPVKSQFKTYLGRPSKEFSRTIVMDSTIEDLIHPDGWTQWEGDFAL  540

Query  1891  KTCMYYEYKNSGPGANTWRRNR--AFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFA  2064
             KT  Y EY N GPGA T  R +   +KK D      A H+T G +L  ++WL   GVP  
Sbjct  541   KTLYYAEYNNKGPGAKTDNRVKWDGYKKIDKQ---EAMHYTVGPFLKGHAWLMGVGVPAR  597

Query  2065  IG  2070
              G
Sbjct  598   FG  599



>ref|XP_008391931.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Malus domestica]
Length=599

 Score =   400 bits (1027),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 221/535 (41%), Positives = 305/535 (57%), Gaps = 28/535 (5%)
 Frame = +1

Query  472   TGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNT  651
             + S K +   C   +YKD C   I     N       FI  AI AT +E    +      
Sbjct  87    SNSKKILKEMCSATDYKDKCEGIIEKX--NGETKPMAFIKTAISATSDEAKSVYXKTAEL  144

Query  652   KIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAY  831
                  + P    A EDCK + +DA+++L  +IS VG+    + K R   L +W+SAV +Y
Sbjct  145   TF---SSPEEKGAFEDCKGLFEDAMEELGDAISQVGNN-TESGKVRIGVLNSWLSAVISY  200

Query  832   QTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADK  1011
             Q TC +       KS +E  +  + + T+N++ +++    LL    + +T          
Sbjct  201   QQTCVDGFPDGKLKSDLEKMLQTSKEFTSNSLAMLS----LLNQLQLPST----------  246

Query  1012  nnnnnnnTTSRRLLQTDH--FPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITG  1185
                     ++RRLL  D   FP W    DR++L    +  L PNV VAKDGSG +KTI+ 
Sbjct  247   ---GAAAGSNRRLLSQDKSGFPNWMSHEDRRMLKKNDK-KLTPNVTVAKDGSGNYKTISE  302

Query  1186  ALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITT  1365
             AL+  P K++ +YVIYVK GVY E V V KKM NV MYGDG+ K+IITG KN A   + T
Sbjct  303   ALEKMPQKYEGRYVIYVKEGVYXETVTVTKKMPNVTMYGDGSQKSIITGNKNXAD-GVRT  361

Query  1366  SKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTY  1545
              +TA F+ALG+GF+A+ + FRNTAGPE  QAVA R Q+D +   +C  EGYQ+TLY  T+
Sbjct  362   FQTAPFAALGEGFMAKSMGFRNTAGPEKRQAVAARVQADRAIFLNCRFEGYQETLYAQTH  421

Query  1546  RQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQN  1725
             RQFY++C ISGT+DFIFG   A+ QN +I  RKPL +Q NT+TA G+   +   G+VLQN
Sbjct  422   RQFYKSCXISGTVDFIFGDAAAIFQNCLIYVRKPLENQQNTVTAQGRTDKRETTGIVLQN  481

Query  1726  CRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMY  1905
             C+I+P+  L P++ + KTY GRPWK +S T+VMES I DL+   GW  W+G+   KT  Y
Sbjct  482   CQIMPDKDLEPVKSQFKTYLGRPWKEFSRTIVMESTIEDLIHXDGWTPWEGDFALKTLYY  541

Query  1906  YEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
              EY N GPG  T  R + +  +  +    A  +T G +L  ++WL   GVP   G
Sbjct  542   AEYNNKGPGXKTDNRVK-WDGYKKINKEEAMQYTVGPFLKGHAWLKVEGVPVRFG  595



>ref|XP_010506728.1| PREDICTED: pectinesterase 4 [Camelina sativa]
Length=587

 Score =   399 bits (1025),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 229/564 (41%), Positives = 325/564 (58%), Gaps = 32/564 (6%)
 Frame = +1

Query  454   GDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSH  633
             GD  +S   MK+V   CQ    K  C K++  V    S      I A + AT + + KS 
Sbjct  30    GDTNLSP-QMKAVQGICQSTSDKASCVKTLEPV---KSEDPNKLIRAFMLATKDAITKSS  85

Query  634   QLVVNTK--IEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLN  807
                  T+  +  S  P N   +E CK +   A++DL   I  +G+ +L+ +  + DQL  
Sbjct  86    NFTDKTEGNMGSSISPNNKAVLEYCKRVFMYALEDLATIIEEMGE-DLNQIGSKFDQLKQ  144

Query  808   WMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINI----IAEMSKL---LKAF  966
             W++ VY YQT C + I     +  IE+G++++  LT NAI+I    ++ M+K+   +  F
Sbjct  145   WLTGVYNYQTDCLDDIAEDDLRKTIEEGILDSKILTRNAIDIFHTVVSAMAKINNKVDEF  204

Query  967   NITTTTDLLHKAA----DKnnnnnnnTTSRRLLQ---TDHFPEWFPIADRKLLAAQRRGN  1125
                T T  ++K A    D++   + +  +RRLL+       P W   ADRKL+A   RG 
Sbjct  205   KNATGTTPVNKGAPPVADESPVADPDGPARRLLEDMDQTGIPTWVSGADRKLMARAGRGR  264

Query  1126  LRP-------NVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMK  1284
                         VVAKDGSGQF T+  A+ + P K+  + +I++KAGVY E V + KK  
Sbjct  265   RGGGTGRIRATFVVAKDGSGQFNTVQAAVNACPEKNLGRCIIHIKAGVYREQVIIPKKKN  324

Query  1285  NVFMYGDGAGKTIITGKKNYA-HMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAV  1461
             N+FM+GDGA KT+IT  ++       TTS +AT     +GF+A+ + F+NTAGP GHQA 
Sbjct  325   NIFMFGDGARKTVITYNRSAGLSPGTTTSLSATVQVESEGFMAKWMGFKNTAGPMGHQAA  384

Query  1462  AYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIAR  1641
             A R   D + IF+C  +GYQDT Y +  R+FYRNCVISGT+DF+FGK   ++QNS+I+ R
Sbjct  385   AIRVNGDRAVIFNCRFDGYQDTFYVNNGREFYRNCVISGTVDFMFGKSATVVQNSLIVVR  444

Query  1642  KPLVHQFNTITADGKELAKA-KGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTV  1818
             K    Q+NT+TADG E+  A K G+VLQNCRIVP+  L P RF V +Y GRPWK +STTV
Sbjct  445   KGSKGQYNTVTADGNEIGFAVKIGIVLQNCRIVPDRKLTPERFTVASYLGRPWKKFSTTV  504

Query  1819  VMESQIGDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRAR  1998
             ++ +++GDL+ P GW+IWDGE++  TC Y EY N GPGANT RR    K     G +   
Sbjct  505   IVNTEMGDLIRPEGWRIWDGESYHTTCKYIEYNNRGPGANTNRRVNWAKIARSAGEVNG-  563

Query  1999  HFTAGLWLDANSWLPATGVPFAIG  2070
              F+   WL   +W+    +P  +G
Sbjct  564   -FSVVNWLGPINWIQEANIPVTLG  586



>ref|XP_009417804.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=594

 Score =   399 bits (1026),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 216/536 (40%), Positives = 307/536 (57%), Gaps = 34/536 (6%)
 Frame = +1

Query  487   SVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQS  666
             +V   C   +Y+  C  S++  AN+ S++ KD + AA+ + ++EV K+   V +    +S
Sbjct  81    AVQVICSPTDYRSACESSLTTYANS-SSSPKDLVRAAVSSLVDEVGKAFNRVDSI---ES  136

Query  667   TDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTCT  846
              DP    A++ CKEM Q A+D+L  ++  +    L+ L  +  +L NW+SAV AYQ TC 
Sbjct  137   DDPEVKSAVDSCKEMHQYAVDELARTLGTIDAHNLNQLPKQVHELKNWLSAVSAYQQTCI  196

Query  847   EQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnnnnn  1026
             +       KS ++  M  A QLT+NA+ ++  +   L           LH          
Sbjct  197   DGFPDGEMKSKMQTAMNTAKQLTSNALAVVGSLHSFLS----------LHIPG-------  239

Query  1027  nnTTSRRLL--------QTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTIT  1182
                 +RRLL        + D  P W    D ++L  +    L PNV VAKDGSG F TI+
Sbjct  240   ---LNRRLLAAKPEPAFREDGVPSWVSDGDHRILLGRAAKQLTPNVTVAKDGSGDFTTIS  296

Query  1183  GALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKIT  1362
              AL   P K++ +YVIYVKAGVY+E V V K M NV MYGDG+ KTI+TG KN+      
Sbjct  297   DALAKIPMKYEGRYVIYVKAGVYEEQVVVDKNMINVTMYGDGSRKTIVTGSKNFVD-GTK  355

Query  1363  TSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHT  1542
             T ++ATF+A+G GF+A  I F+NTAG   HQAVA R QSD +   +C +E YQDTLY H+
Sbjct  356   TFQSATFAAIGDGFMAVAIGFQNTAGAIKHQAVALRVQSDRAIFLNCRMEAYQDTLYTHS  415

Query  1543  YRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQ  1722
             +RQFYR C+I GT+DFIFG   A+ QN I+  R+PL +Q N + A G+++     G V+ 
Sbjct  416   HRQFYRGCLILGTVDFIFGDAAAVFQNCILTVRRPLDNQQNIVLAQGRDIRHESTGYVIH  475

Query  1723  NCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCM  1902
             NCRIVP+ +L P   K+ +Y GRPWK +S TV+MES IGD +SP G+  W+G+   KT  
Sbjct  476   NCRIVPDDSLVPDVAKISSYLGRPWKEFSHTVIMESDIGDFISPDGYMPWEGDFALKTLS  535

Query  1903  YYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             Y EY N G GA+T +R + +    V+    A  +T   ++  + W+  T  P  +G
Sbjct  536   YKEYNNKGGGADTSKRVK-WPGVKVISRDEANTYTTQAFIQGDDWITKTNTPVRLG  590



>ref|XP_006397894.1| hypothetical protein EUTSA_v10001369mg [Eutrema salsugineum]
 gb|ESQ39347.1| hypothetical protein EUTSA_v10001369mg [Eutrema salsugineum]
Length=592

 Score =   399 bits (1025),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 233/569 (41%), Positives = 325/569 (57%), Gaps = 37/569 (7%)
 Frame = +1

Query  454   GDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSH  633
             GD  +S   MK+V   CQ    K  C K++  V    S      I A + AT + + KS 
Sbjct  30    GDTPLSP-QMKAVQGICQATSDKAACVKTLEPV---KSDDPNKLIKAFMLATQDALTKSS  85

Query  634   QLVVNTK--IEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLN  807
                  T+  +  S  P N   ++ CK +   A++DL   +  +G+ +L+ +  + DQL  
Sbjct  86    NFTGKTEGNMGSSISPNNKAVLDYCKRVFMYALEDLGTIVEEMGE-DLNQIGSKIDQLKQ  144

Query  808   WMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINI----IAEMSKL-LKAFNI  972
             W++ VY YQT C + IE    +  I +G+ ++  LT+NAI+I    ++ M+KL LK    
Sbjct  145   WLTGVYNYQTDCLDDIEEDDLRKTIAEGIASSKILTSNAIDIFHTVVSAMAKLNLKVDEF  204

Query  973   TTTTD-LLHK-----------AADKnnnnnnnTTSRRLLQ---TDHFPEWFPIADRKLLA  1107
                T  ++ K           AAD++   + +  +RRLL+       P W   ADRKL+A
Sbjct  205   KNVTGGIMDKGAAAIGKGATPAADESPVADPDGPARRLLEDIDETGVPTWVSGADRKLMA  264

Query  1108  ------AQRRGNLRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEV  1269
                         +R N VVAKDGSGQFK++  A+ + P K+  + +I++KAG+Y E V +
Sbjct  265   NAGRGRRGGGARIRANFVVAKDGSGQFKSVQEAVNACPEKNPGRCIIHIKAGIYREQVII  324

Query  1270  GKKMKNVFMYGDGAGKTIITGKKNYA-HMKITTSKTATFSALGKGFVARGITFRNTAGPE  1446
              KK  N+FM+GDGA KT+IT  ++       TTS + T     +GF+A+ I F+NTAGP 
Sbjct  325   PKKKNNIFMFGDGARKTVITYNRSVKLSPGTTTSLSGTVQVESEGFMAKWIGFKNTAGPM  384

Query  1447  GHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNS  1626
             GHQAVA R   D + +F+C  +GYQDTLY +  RQ+YRNCV+SGT+DFIFGK   +IQNS
Sbjct  385   GHQAVAIRVNGDRAVVFNCRFDGYQDTLYVNNGRQYYRNCVVSGTVDFIFGKSATVIQNS  444

Query  1627  IIIARKPLVHQFNTITADGKELAKA-KGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKA  1803
             +I+ RK    QFNT+TADG E   A K G+VLQNCRIVP+  L   R  V++Y GRPWK 
Sbjct  445   LIVVRKGNKGQFNTVTADGNEKGLAMKIGIVLQNCRIVPDKKLAAERLTVESYLGRPWKQ  504

Query  1804  YSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLG  1983
             YSTTV++ ++IGD++ P GWKIWDGE+F KTC Y EY N GPGA T RR    K      
Sbjct  505   YSTTVIINTEIGDVIRPEGWKIWDGESFHKTCRYVEYNNRGPGAITNRRVNWVKIAKSAA  564

Query  1984  PIRARHFTAGLWLDANSWLPATGVPFAIG  2070
              +    FT   WL   +W+    VP  +G
Sbjct  565   EV--NDFTVANWLGPVNWIQEANVPVTLG  591



>ref|NP_001105487.1| pectin methylesterase1 [Zea mays]
 emb|CAA73733.1| pectin methylesterase-like protein [Zea mays]
Length=563

 Score =   397 bits (1020),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 205/476 (43%), Positives = 289/476 (61%), Gaps = 26/476 (5%)
 Frame = +1

Query  661   QSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTT  840
             Q +D     A EDCK++L+DA DDL+  + + G  ++  L  R+D L  W++ V  +  T
Sbjct  107   QGSDSMTESAREDCKKLLEDAADDLRGMLEMAG-GDIKVLFSRSDDLETWLTGVMTFMDT  165

Query  841   CTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnnn  1020
             C +       K+ +   + NAT+L++NA+ I   +  +LK  ++   +            
Sbjct  166   CVDGFVDEKLKADMHSVVRNATELSSNALAITNSLGGILKKMDLGMFS------------  213

Query  1021  nnnnTTSRRLLQTDH----FPEWFPIADRKLLAAQRRGNL-RPNVVVAKDGSGQFKTITG  1185
                  + RRLL ++     +P W    +RKLLA+   GN  +PN +VAKDGSGQFK+I  
Sbjct  214   ---KDSRRRLLSSEQDEKGWPVWMRSPERKLLAS---GNQPKPNAIVAKDGSGQFKSIQQ  267

Query  1186  ALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITT  1365
             A+ + P  H+ +YVIYVKAG+YDEIV V K   N+FMYGDG  ++ +TG+K++A   ITT
Sbjct  268   AVDAVPKGHQGRYVIYVKAGLYDEIVMVPKDKVNIFMYGDGPKQSRVTGRKSFAD-GITT  326

Query  1366  SKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTY  1545
              KTATFS    GF+ + + F NTAG E HQAVA R Q D++A ++C  + +QDTLY    
Sbjct  327   MKTATFSVEASGFICKNMGFHNTAGAERHQAVALRVQGDLAAFYNCRFDAFQDTLYVQPR  386

Query  1546  RQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQN  1725
             RQF+RNCV+SGTIDFIFG   A+ QN +II R+P+ +Q N++TA G      K G+V+QN
Sbjct  387   RQFFRNCVVSGTIDFIFGNSAAVFQNCLIITRRPMDNQQNSVTAHGPTDPNMKSGLVIQN  446

Query  1726  CRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMY  1905
             CR+VP+  L P RFK+ +Y GRPWK +S  V+MES I D + P G+  W+G+   KT  Y
Sbjct  447   CRLVPDQKLFPDRFKIPSYLGRPWKEFSRLVIMESTIADFVKPEGYMPWNGDFALKTLYY  506

Query  1906  YEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIGY  2073
              EY N GPGA T +R   +  F V+G   A  FTAG ++D   WL  TG P  +G+
Sbjct  507   AEYNNRGPGAGTSKRVN-WPGFHVIGRKEAEPFTAGPFIDGAMWLKYTGAPHILGF  561



>emb|CAB58974.1| pectin methylesterase [Arabidopsis thaliana]
Length=595

 Score =   398 bits (1023),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 231/572 (40%), Positives = 323/572 (56%), Gaps = 40/572 (7%)
 Frame = +1

Query  454   GDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSH  633
             GD  +S   MK+V   C+    K  C K++  V    S      I A + AT + + +S 
Sbjct  30    GDANLSP-QMKAVRGICEATSDKASCVKTLEPV---KSDDPNKLIKAFMLATRDAITQSS  85

Query  634   QLVVNTK--IEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLN  807
                  T+  +     P N   ++ CK++   A++DL   +  +G+ +L+ +  + DQL  
Sbjct  86    NFTGKTEENLGSGISPNNKAVLDYCKKVFMYALEDLSTIVEEMGE-DLNQIGSKIDQLKQ  144

Query  808   WMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINI----IAEMSKL-LKAFNI  972
             W++ VY YQT C + IE    +  I +G+ ++  LT+NAI+I    ++ M+KL LK  + 
Sbjct  145   WLTGVYNYQTDCLDDIEEDDLRKTIGEGIASSKILTSNAIDIFHTVVSAMAKLNLKVEDF  204

Query  973   TTTTDLLHKAADKnnnnnnnTT---------------SRRLLQ---TDHFPEWFPIADRK  1098
                T  +   +DK     N  T               +RRLL+       P W   ADRK
Sbjct  205   KNMTGGIFAPSDKGAAPVNKGTPPVADDSPVADPDGPARRLLEDIDETGIPTWVSGADRK  264

Query  1099  LLAAQRRGN------LRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEI  1260
             L+A   RG+      +R   VVAKDGSGQFKT+  A+ + P K+  + +I++KAG+Y E 
Sbjct  265   LMAKAGRGSNDGGARIRATFVVAKDGSGQFKTVQQAVNACPEKNPGRCIIHIKAGIYREQ  324

Query  1261  VEVGKKMKNVFMYGDGAGKTIITGKKNYA-HMKITTSKTATFSALGKGFVARGITFRNTA  1437
             V + KK  N+FM+GDGA KT+I+  ++       TTS + T     +GF+A+ I F+NTA
Sbjct  325   VIIPKKKNNIFMFGDGARKTVISYNRSVKLSPGTTTSLSGTVQVESEGFMAKWIGFKNTA  384

Query  1438  GPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALI  1617
             GP GHQAVA R   D + IF+C  +GYQDTLY +  RQFYRN V+SGT+DFIFGK   +I
Sbjct  385   GPMGHQAVAIRVNGDRAVIFNCRFDGYQDTLYVNNGRQFYRNIVVSGTVDFIFGKSATVI  444

Query  1618  QNSIIIARKPLVHQFNTITADGKELAKA-KGGVVLQNCRIVPETALNPLRFKVKTYFGRP  1794
             QNS+I+ RK    QFNT+TADG E   A K G+VLQNCRIVP+  L   R  V++Y GRP
Sbjct  445   QNSLIVVRKGNKGQFNTVTADGNEKGLAMKIGIVLQNCRIVPDKKLAAERLIVESYLGRP  504

Query  1795  WKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFD  1974
             WK +STTV++ S+IGD++ P GWKIWDGE+F K+C Y EY N GPGA T RR    K   
Sbjct  505   WKKFSTTVIINSEIGDVIRPEGWKIWDGESFHKSCRYVEYNNRGPGAITNRRVNWVKIAR  564

Query  1975  VLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
                 +    FT   WL   +W+    VP  +G
Sbjct  565   SAAEV--NDFTVANWLGPINWIQEANVPVTLG  594



>emb|CDY37779.1| BnaC04g00460D [Brassica napus]
Length=589

 Score =   398 bits (1022),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 229/557 (41%), Positives = 321/557 (58%), Gaps = 33/557 (6%)
 Frame = +1

Query  481   MKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTK--  654
             MK+V   CQ    K  C K++  V    S      I A + AT + + KS      T+  
Sbjct  38    MKAVQGICQATADKASCVKTLEPV---KSDDPNKLIKAFMLATQDALTKSSNFTDKTEGN  94

Query  655   IEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQ  834
             +  S  P N   ++ C+++   A++DL   +  +G+ +L+ + ++ DQL  W++ VY YQ
Sbjct  95    MGSSISPNNKAVLDYCRKVFMYALEDLGTILEEMGE-DLNQIGNKFDQLKQWLTGVYNYQ  153

Query  835   TTCTEQIESRLYKSAIEDGMINATQLTNNAINI----IAEMSKL---LKAF-NITTTTDL  990
             T C + I+    +  I +G+ ++  LT NAI+I    ++ M+K+   +  F N+T+    
Sbjct  154   TDCLDDIQEDDLRKTIAEGISSSKILTGNAIDIFHTVVSAMAKIDAKVDDFKNMTSGIFT  213

Query  991   LHKAADKnnnnnnnTT-------SRRLLQTDHFPEWFPIADRKLLA--------AQRRGN  1125
                 A+K      +T        SRRLL+    P W   ADRKL+A              
Sbjct  214   PSAPANKEAAPVVDTPVADPDGPSRRLLEDLGVPTWVSGADRKLMANAGRGRRGGGGAPR  273

Query  1126  LRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGD  1305
             +R   VVAKDGSGQFK+I  A+ + P K+  + +I++KAG+Y E V + KK  N+FM+GD
Sbjct  274   IRATYVVAKDGSGQFKSIQQAVNACPDKNAGRCIIHIKAGIYREQVIIPKKKNNIFMFGD  333

Query  1306  GAGKTIITGKKNY-AHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSD  1482
             GA KT+IT  ++       TTS + T     +GF+A+ I F+NTAGP GHQAVA R   D
Sbjct  334   GARKTVITYNRSVRLSSGTTTSTSGTVQVESEGFMAKWIGFKNTAGPNGHQAVAIRVNGD  393

Query  1483  MSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQF  1662
              + IF+C  +GYQDTLY +  RQFYRNCV+SGT+DFIFGK   +IQNS+I+ RK    Q+
Sbjct  394   RAVIFNCRFDGYQDTLYVNNGRQFYRNCVVSGTVDFIFGKSATVIQNSLIVIRKGNKGQY  453

Query  1663  NTITADGKELA-KAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIG  1839
             NT+TADG E     K G+V+QNCRIVP+  L P R  V++Y GRPWK YSTTVV+ ++IG
Sbjct  454   NTVTADGNEKGLSMKIGIVIQNCRIVPDKKLAPERLTVESYLGRPWKQYSTTVVINTEIG  513

Query  1840  DLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLW  2019
             D++ P GW++WDGE+F KTC Y EY N GPGANT RR    K     G I    FT   W
Sbjct  514   DVIRPEGWRLWDGESFHKTCRYVEYNNRGPGANTNRRVNWAKMARSAGEI--NQFTVANW  571

Query  2020  LDANSWLPATGVPFAIG  2070
             L   +W+    VP  +G
Sbjct  572   LAPVNWIQEANVPVTLG  588



>ref|XP_010507936.1| PREDICTED: pectinesterase 4-like isoform X2 [Camelina sativa]
Length=590

 Score =   397 bits (1021),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 232/566 (41%), Positives = 324/566 (57%), Gaps = 35/566 (6%)
 Frame = +1

Query  454   GDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSH  633
             GD  +S   MK+V   CQ    K  C K++  V    S      I A + AT + + KS 
Sbjct  30    GDTNLSP-QMKAVQGICQSTTDKASCVKTLEPV---KSEDPNKLIRAFLLATKDAITKSS  85

Query  634   QLVVNT--KIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLN  807
                  T   +  S  P N   +E CK +   A++DL   I  +G+ +L+ +  + DQL  
Sbjct  86    NFTDKTAGNMGSSISPNNKAVLEYCKRVFMYALEDLATIIEEMGE-DLNQIGSKFDQLKQ  144

Query  808   WMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINI----IAEMSKL---LKAF  966
             W++ VY YQT C + I     +  IE+G++++  LT NAI+I    ++ M+K+   +  F
Sbjct  145   WLTGVYNYQTDCLDDIAEDDLRKTIEEGILDSKILTRNAIDIFHTVVSAMAKINNKVDEF  204

Query  967   NITTTTDLLHKAA----DKnnnnnnnTTSRRLLQ---TDHFPEWFPIADRKLLAAQRRGN  1125
                T T  ++K A    D++   + +  +RRLL+       P W   ADRKL+A   RG 
Sbjct  205   KNATGTTPVNKGAPPVADESPVADPDGPARRLLEDMDETGIPTWVSGADRKLMARAGRGR  264

Query  1126  LRP----------NVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGK  1275
              R             VVAKDGSGQF T+  A+ + P K+  + +I++KAGVY E V + K
Sbjct  265   GRRGGGGTGGIRATFVVAKDGSGQFNTVQAAVNACPEKNPGRCIIHIKAGVYREQVIIPK  324

Query  1276  KMKNVFMYGDGAGKTIITGKKNYA-HMKITTSKTATFSALGKGFVARGITFRNTAGPEGH  1452
             K  N+FM+GDGA KT+IT  ++       TTS +AT     +GF+A+ + F+NTAGP GH
Sbjct  325   KKNNIFMFGDGARKTVITYNRSAGLSPGTTTSLSATVQVESEGFMAKWMGFKNTAGPLGH  384

Query  1453  QAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSII  1632
             QA A R   D S IF+C  +GYQDT Y +  RQFYRNCVISGT+DF+FGK   ++QNS+I
Sbjct  385   QAAAIRVNGDRSVIFNCRFDGYQDTFYVNNGRQFYRNCVISGTVDFMFGKSATVVQNSLI  444

Query  1633  IARKPLVHQFNTITADGKELAKA-KGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYS  1809
             + RK    Q+NT+TADG E+  A K G+VLQNCRIVP+  L P RF V +Y GRPWK +S
Sbjct  445   VVRKGSKGQYNTVTADGNEIGFAVKIGIVLQNCRIVPDRKLTPERFTVASYLGRPWKKFS  504

Query  1810  TTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPI  1989
             TTV++ +++GDL+ P GW+IWDGE++  TC Y EY N GPGANT RR    K     G +
Sbjct  505   TTVIVNTEMGDLIRPEGWRIWDGESYHTTCRYIEYNNRGPGANTNRRVNWAKIARSAGEV  564

Query  1990  RARHFTAGLWLDANSWLPATGVPFAI  2067
                 F+   WL   +W+    VP  +
Sbjct  565   SG--FSVVNWLGPINWIQEARVPVTL  588



>gb|AES82263.2| pectinesterase inhibitor domain protein [Medicago truncatula]
Length=588

 Score =   397 bits (1021),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 230/563 (41%), Positives = 315/563 (56%), Gaps = 49/563 (9%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQ  663
             +++   CQ A+ + +C  ++S V    +A  K +I AA+KA  + V K+  +      E 
Sbjct  40    RNLRIMCQNAQDQKLCHDTLSSVRGADAADPKAYIAAAVKAATDNVIKAFNMSERLTTEY  99

Query  664   STDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTC  843
                    MA++DCK+++Q A+D L  S + V D  +  +  +   + NW+SAV +Y+  C
Sbjct  100   GKKNGAKMALDDCKDLMQFALDSLDLSNNCVRDNNIEAVHDQTADMRNWLSAVISYKQGC  159

Query  844   TEQI------ESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAA  1005
              E        E ++ +      + +  ++T  A++I+  +S +L+ FN+           
Sbjct  160   MEGFDDANDGEKKIKEQFHVQSLYSVQKVTAVALDIVTGLSDILQQFNLN----------  209

Query  1006  DKnnnnnnnTTSRRLLQTD------HFPEWFPIADRKLLA-AQRRG---NLRPNVVVAKD  1155
                   +    SRRLL ++       +P W   + RKLLA  QR+G   N+RPN VVA D
Sbjct  210   -----FDIKPPSRRLLNSEVTVDDQGYPSWISSSGRKLLAKMQRKGWRANIRPNAVVAND  264

Query  1156  GSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGK  1335
             GSGQFKTI  AL SYP  +K +YVIYVKAGVYDE + V K+  N+ MYGDG  KTI+TG+
Sbjct  265   GSGQFKTIQAALASYPKGNKDRYVIYVKAGVYDEYITVPKEAVNILMYGDGPAKTIVTGR  324

Query  1336  KNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEG  1515
             KN       T  TATFS    GF+ + +TF NTAGP G QAVA+R+  DMSA+  C I G
Sbjct  325   KN-QMAGTNTQNTATFSNTAMGFIGKAMTFENTAGPAGMQAVAFRNIGDMSALVGCHIVG  383

Query  1516  YQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLV--HQFNTITADGKE  1689
             YQDTLY  T RQFYRNCVISGTIDFIFG    LIQ+S II RK     +++N I ADG  
Sbjct  384   YQDTLYVQTNRQFYRNCVISGTIDFIFGTSATLIQSSTIIVRKGNYDHNEYNVIVADGSP  443

Query  1690  LAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKI  1869
             L     G+V+Q+C I+PE AL P +F V++Y GRPW+  S  V+MES IGD +   GW  
Sbjct  444   LVNMNTGIVIQDCNIIPEAALVPEKFTVRSYLGRPWQNESKAVIMESTIGDFIHQDGWTT  503

Query  1870  WDGE------NFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDAN  2031
             W  E      + E TC + EY N+GPGAN  RR +      V+    A  +TA +WLDA 
Sbjct  504   WPEEQNKPEKHHENTCYFAEYANTGPGANVARRVKWKGYKGVISRSEATKYTASIWLDAG  563

Query  2032  ---------SWLPATGVPFAIGY  2073
                       WL    VP  +G+
Sbjct  564   PKTAPKSAVEWLHDLHVPHYLGF  586



>gb|KHN23786.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=447

 Score =   392 bits (1008),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 190/350 (54%), Positives = 239/350 (68%), Gaps = 6/350 (2%)
 Frame = +1

Query  1039  SRRLLQTDH--FPEWFPIADRKLLAAQRRGN-LRPNVVVAKDGSGQFKTITGALKSYPPK  1209
             SRRLL  D   +P W  + DRKLLA  ++G+ + PN VVAKDGSGQ+KT+  A+ SYP  
Sbjct  100   SRRLLDVDQDGYPSWISMPDRKLLADAKKGDSVPPNAVVAKDGSGQYKTVLDAINSYPKN  159

Query  1210  HKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKTATFSA  1389
             HK +YVIYVKAGVYDE + V KK  N+ +YGDG  KTIITG KN     + T +TATF+ 
Sbjct  160   HKGRYVIYVKAGVYDEYITVDKKKPNILIYGDGPTKTIITGSKNMKD-GVKTMRTATFAT  218

Query  1390  LGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCV  1569
             + + F+A+ + F NTAG  GHQAVA R Q D SA FDC+I GYQDTLY H +RQFYRNC 
Sbjct  219   VAEDFIAKSMAFENTAGARGHQAVALRVQGDRSAFFDCAIHGYQDTLYAHAHRQFYRNCE  278

Query  1570  ISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCRIVPETA  1749
             ISGT+DFIFG GT LIQ+S +I RKP  +Q N + ADG +      GVVLQNC I+PE A
Sbjct  279   ISGTVDFIFGYGTTLIQSSKLIVRKPDPNQQNIVVADGTDQKNMPTGVVLQNCEIIPEAA  338

Query  1750  LNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYKNSGP  1929
             L P + K ++Y  RPWKAYS  ++ME+ IGD + P G+  W+G  +  TC + EY N+G 
Sbjct  339   LVPDKMKFRSYLARPWKAYSRAILMENTIGDFIQPDGFLPWNGNLYLDTCFFAEYANTGM  398

Query  1930  GANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIGYTK  2079
             GA+T RR +  +   VL    A  +TA  WL AN+WLPATG+PF +G TK
Sbjct  399   GADTQRRVKWSRG--VLNKADATKYTADQWLQANTWLPATGIPFDLGLTK  446



>ref|XP_010507935.1| PREDICTED: pectinesterase 4-like isoform X1 [Camelina sativa]
Length=590

 Score =   397 bits (1020),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 232/566 (41%), Positives = 324/566 (57%), Gaps = 35/566 (6%)
 Frame = +1

Query  454   GDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSH  633
             GD  +S   MK+V   CQ    K  C K++  V    S      I A + AT + + KS 
Sbjct  30    GDTNLSP-QMKAVQGICQSTTDKASCVKTLEPV---KSEDPNKLIRAFLLATKDAITKSS  85

Query  634   QLVVNT--KIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLN  807
                  T   +  S  P N   +E CK +   A++DL   I  +G+ +L+ +  + DQL  
Sbjct  86    NFTDKTAGNMGSSISPNNKAVLEYCKRVFMYALEDLATIIEEMGE-DLNQIGSKFDQLKQ  144

Query  808   WMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINI----IAEMSKL---LKAF  966
             W++ VY YQT C + I     +  IE+G++++  LT NAI+I    ++ M+K+   +  F
Sbjct  145   WITGVYNYQTDCLDDIAEDDLRKTIEEGILDSKILTRNAIDIFHTVVSAMAKINNKVDEF  204

Query  967   NITTTTDLLHKAA----DKnnnnnnnTTSRRLLQ---TDHFPEWFPIADRKLLAAQRRGN  1125
                T T  ++K A    D++   + +  +RRLL+       P W   ADRKL+A   RG 
Sbjct  205   KNATGTTPVNKGAPPVADESPVADPDGPARRLLEDMDETGIPTWVSGADRKLMARAGRGR  264

Query  1126  LRP----------NVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGK  1275
              R             VVAKDGSGQF T+  A+ + P K+  + +I++KAGVY E V + K
Sbjct  265   GRRGGGGTGGIRATFVVAKDGSGQFNTVQAAVNACPEKNPGRCIIHIKAGVYREQVIIPK  324

Query  1276  KMKNVFMYGDGAGKTIITGKKNYA-HMKITTSKTATFSALGKGFVARGITFRNTAGPEGH  1452
             K  N+FM+GDGA KT+IT  ++       TTS +AT     +GF+A+ + F+NTAGP GH
Sbjct  325   KKNNIFMFGDGARKTVITYNRSAGLSPGTTTSLSATVQVESEGFMAKWMGFKNTAGPLGH  384

Query  1453  QAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSII  1632
             QA A R   D S IF+C  +GYQDT Y +  RQFYRNCVISGT+DF+FGK   ++QNS+I
Sbjct  385   QAAAIRVNGDRSVIFNCRFDGYQDTFYVNNGRQFYRNCVISGTVDFMFGKSATVVQNSLI  444

Query  1633  IARKPLVHQFNTITADGKELAKA-KGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYS  1809
             + RK    Q+NT+TADG E+  A K G+VLQNCRIVP+  L P RF V +Y GRPWK +S
Sbjct  445   VVRKGSKGQYNTVTADGNEIGFAVKIGIVLQNCRIVPDRKLTPERFTVASYLGRPWKKFS  504

Query  1810  TTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPI  1989
             TTV++ +++GDL+ P GW+IWDGE++  TC Y EY N GPGANT RR    K     G +
Sbjct  505   TTVIVNTEMGDLIRPEGWRIWDGESYHTTCRYIEYNNRGPGANTNRRVNWAKIARSAGEV  564

Query  1990  RARHFTAGLWLDANSWLPATGVPFAI  2067
                 F+   WL   +W+    VP  +
Sbjct  565   SG--FSVVNWLGPINWIQEARVPVTL  588



>ref|XP_008460558.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Cucumis melo]
Length=595

 Score =   397 bits (1020),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 222/559 (40%), Positives = 315/559 (56%), Gaps = 43/559 (8%)
 Frame = +1

Query  454   GDHGVSTGSMKS---------------VTTFCQYAEYKDVCAKSIS---HVANNHSATTK  579
             GD G STG+ K                +T  C   +YK  C  ++    H   N S+  K
Sbjct  58    GDSGSSTGNSKKPLPPETKQVSRVEKMITMICNSTDYKGKCESTLKDGLHTDPN-SSDPK  116

Query  580   DFIFAAIKATLEEVHKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVG  759
             D I  AI A   EV  + +            P    A EDCK +L+DA+++L+ S+S V 
Sbjct  117   DLIKLAISAAAHEVKSAVKKASGFNF---ATPEEKGAFEDCKVLLEDAVEELEMSMSEVS  173

Query  760   DTELHTLKHRA-DQLLNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINII  936
                +  L  +    L NW+SAV +Y  TC +       KS +E  +    +LT+N++ +I
Sbjct  174   KKNMGKLTAKTTPDLNNWLSAVMSYHETCVDGFPEGKMKSEMEKVVKAGKELTSNSLAMI  233

Query  937   AEMSKLLKAFNITTTTDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQR  1116
             ++++     F      ++   AA +          RRL+ T   P W    +R++L    
Sbjct  234   SQVASFFSTF------EMPEGAASR----------RRLMATKGVPTWMNSNERRMLKGAA  277

Query  1117  RGN-LRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVF  1293
              G   +PNVVVAKDGSG+FKTI  AL + P K+  +YVIYVK G+YDE V + KKM NV 
Sbjct  278   AGEKPKPNVVVAKDGSGEFKTINEALAAMPAKYDGRYVIYVKEGIYDETVVITKKMVNVT  337

Query  1294  MYGDGAGKTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRS  1473
             MYGDG+ K++I+G KN+    + T +TATF ALG+GF+ + I FRN AGPE HQAVA R 
Sbjct  338   MYGDGSQKSMISGSKNFVD-GVRTFQTATFVALGEGFLGQAIGFRNIAGPEKHQAVAARV  396

Query  1474  QSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLV  1653
             Q+D +   +C  EGYQDTLY   +RQFYR+C+I+GTIDFIFG   A+ QN  ++ RKPL 
Sbjct  397   QADRAIFVNCRFEGYQDTLYAQAHRQFYRSCLITGTIDFIFGDAAAIFQNCNMMIRKPLD  456

Query  1654  HQFNTITADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQ  1833
             +Q N +TA G+       G+VLQNC+I+P+  L  ++ + K+Y GRPWK +S T+VMES+
Sbjct  457   NQQNIVTAQGRTDKHETTGIVLQNCKILPDKTLEAVKSQFKSYLGRPWKEFSRTIVMESK  516

Query  1834  IGDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAG  2013
             I D++ P GW  W G+   KT  Y E+ N GPGA T  R + +  + V+    A  FT G
Sbjct  517   IEDVIHPDGWMAWQGDFALKTLYYAEFNNQGPGAKTDARVK-WPGYKVIDKDEAAKFTIG  575

Query  2014  LWLDANSWLPATGVPFAIG  2070
              +L+ + W+ +T  P  +G
Sbjct  576   TFLELD-WIESTSAPVHVG  593



>gb|AAV91508.1| VANGUARD 1 [Arabidopsis thaliana]
Length=595

 Score =   397 bits (1019),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 230/572 (40%), Positives = 322/572 (56%), Gaps = 40/572 (7%)
 Frame = +1

Query  454   GDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSH  633
             GD  +S   MK+V   C+    K  C K++  V    S      I A + AT + + +S 
Sbjct  30    GDANLSP-QMKAVRGICEATSVKASCVKTLEPV---KSDDPNKLIKAFMLATRDAITQSS  85

Query  634   QLVVNTK--IEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLN  807
                  T+  +     P N   ++ CK++   A++DL   +  +G+ +L+ +    DQL  
Sbjct  86    NFTGKTEGNLGSGISPNNKAVLDYCKKVFMYALEDLSTIVEEMGE-DLNQIGSEIDQLKQ  144

Query  808   WMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINI----IAEMSKL-LKAFNI  972
             W++ VY YQT C + IE    +  I +G+ ++  LT+NAI+I    ++ M+KL LK  + 
Sbjct  145   WLTGVYNYQTDCLDDIEEDDLRKTIGEGIASSKILTSNAIDIFHTVVSAMAKLNLKVEDF  204

Query  973   TTTTDLLHKAADKnnnnnnnTT---------------SRRLLQ---TDHFPEWFPIADRK  1098
                T  +   +DK     N  T               +RRLL+       P W   ADRK
Sbjct  205   KNMTGGIFAPSDKGAAPVNKGTPPVADDSPVADPDGPARRLLEDIDETGIPTWVSGADRK  264

Query  1099  LLAAQRRGN------LRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEI  1260
             L+A   RG+      +R   VVAKDGSGQFKT+  A+ + P K+  + +I++KAG+Y E 
Sbjct  265   LMAKAGRGSNDGGARIRATFVVAKDGSGQFKTVQQAVNACPEKNPGRCIIHIKAGIYREQ  324

Query  1261  VEVGKKMKNVFMYGDGAGKTIITGKKNYA-HMKITTSKTATFSALGKGFVARGITFRNTA  1437
             V + KK  N+FM+GDGA KT+I+  ++       TTS + T     +GF+A+ I F+NTA
Sbjct  325   VIIPKKKNNIFMFGDGARKTVISYNRSVKLSPGTTTSLSGTVQVESEGFMAKWIGFKNTA  384

Query  1438  GPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALI  1617
             GP GHQAVA R   D + IF+C  +GYQDTLY +  RQFYRN V+SGT+DFIFGK   +I
Sbjct  385   GPMGHQAVAIRVNGDRAVIFNCRFDGYQDTLYVNNGRQFYRNIVVSGTVDFIFGKSATVI  444

Query  1618  QNSIIIARKPLVHQFNTITADGKELAKA-KGGVVLQNCRIVPETALNPLRFKVKTYFGRP  1794
             QNS+I+ RK    QFNT+TADG E   A K G+VLQNCRIVP+  L   R  V++Y GRP
Sbjct  445   QNSLIVVRKGNKGQFNTVTADGNEKGLAMKIGIVLQNCRIVPDKKLAAERLIVESYLGRP  504

Query  1795  WKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFD  1974
             WK +STTV++ S+IGD++ P GWKIWDGE+F ++C Y EY N GPGA T RR    K   
Sbjct  505   WKKFSTTVIINSEIGDVIRPEGWKIWDGESFHQSCRYVEYSNRGPGAITNRRVNWVKIAR  564

Query  1975  VLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
                 +    FT   WL   +W+    VP  +G
Sbjct  565   SAAEV--NDFTVANWLGPINWIQEANVPVTLG  594



>ref|XP_009414337.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=592

 Score =   396 bits (1018),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 218/551 (40%), Positives = 311/551 (56%), Gaps = 21/551 (4%)
 Frame = +1

Query  433   DDASSGKGDHGVSTGS----MKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAI  600
             D++S+   D G+ + S      ++   C   +YK  C  S+S   N+ S+  KD + AA+
Sbjct  54    DESSTSPSDGGLESTSHFRTTSAIEVICSPTDYKSSCESSLSKYVND-SSKPKDLVRAAV  112

Query  601   KATLEEVHKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTL  780
              A ++ V K+     + K   S DP    AI DCKEM Q A+D+L  ++S + +  L  L
Sbjct  113   LAVVDGVAKAFNRSDSIK---SDDPEVKAAIADCKEMHQYAVDELAKTLSHIDEHHLKQL  169

Query  781   KHRADQLLNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLK  960
               +  +L NW+SAV AYQ TC +       KS ++  M +A ++T+NA+ I+ ++S  L 
Sbjct  170   PKQIPELKNWLSAVVAYQQTCIDGFPEGKLKSKMQAAMKSAKEITSNALAIVGKISSFLT  229

Query  961   AFNITTTTDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNV  1140
                       L + A  +        +      D  P W    DR+LL       L PNV
Sbjct  230   ----------LIQVAGFSRRLLEEEPAEPEWYVDGNPSWVSHGDRRLLQTPATPELTPNV  279

Query  1141  VVAKDGSGQFKTITGALKSYPPKH-KAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGK  1317
              VAKDGSG F TI+GAL   P K    +YVIYVK GVY+E V V K   N+ MYGDG  K
Sbjct  280   TVAKDGSGDFTTISGALAKAPKKLLNGRYVIYVKEGVYEETVAVDKNTWNITMYGDGEQK  339

Query  1318  TIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIF  1497
             TI+TG KN+    + T  TATF+A+G GF+A  + F NTAG   HQAVA R Q+D +   
Sbjct  340   TIVTGSKNFID-GVKTYHTATFAAIGDGFMAVDMAFLNTAGANKHQAVALRVQADRAIFL  398

Query  1498  DCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITA  1677
              C +E YQDTLY H++RQFYR+C+ISGTIDFIFG  +A+ Q+  +  R+PL +Q N + A
Sbjct  399   RCRMEAYQDTLYAHSHRQFYRDCLISGTIDFIFGDASAVFQHCTLTVRRPLNNQQNIVLA  458

Query  1678  DGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPL  1857
              G+ + +   G V+QNCRIV   AL   + K+++Y GRPW+ +S T++MES+IGD + P 
Sbjct  459   QGRSVLQESTGFVIQNCRIVAIPALADAKPKLRSYLGRPWQEFSNTIIMESEIGDFIEPE  518

Query  1858  GWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSW  2037
             G+  W+G     T  Y EY N GPGA+T +R   +  F V+    A  +TA  ++  + W
Sbjct  519   GYTPWEGSFALDTLSYAEYNNKGPGADTSKRVH-WAGFKVISQEEASAYTASPFIQGDDW  577

Query  2038  LPATGVPFAIG  2070
             +   G P ++G
Sbjct  578   ISKMGAPVSLG  588



>ref|NP_182227.1| pectinesterase 5 [Arabidopsis thaliana]
 sp|Q5MFV8.2|PME5_ARATH RecName: Full=Pectinesterase 5; Short=PE 5; AltName: Full=Pectin 
methylesterase 5; Short=AtPME5; AltName: Full=Pectin methylesterase 
67; Short=AtPME67; AltName: Full=Protein VANGUARD 
1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC34240.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAM10316.1| At2g47040/F14M4.13 [Arabidopsis thaliana]
 gb|AAN64511.1| At2g47040/F14M4.13 [Arabidopsis thaliana]
 gb|AEC10791.1| invertase/pectin methylesterase inhibitor [Arabidopsis thaliana]
Length=595

 Score =   397 bits (1019),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 230/572 (40%), Positives = 321/572 (56%), Gaps = 40/572 (7%)
 Frame = +1

Query  454   GDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSH  633
             GD  +S   MK+V   C+    K  C K++  V    S      I A + AT + + +S 
Sbjct  30    GDANLSP-QMKAVRGICEATSDKASCVKTLEPV---KSDDPNKLIKAFMLATRDAITQSS  85

Query  634   QLVVNTK--IEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLN  807
                  T+  +     P N   ++ CK++   A++DL   +  +G+ +L+ +  + DQL  
Sbjct  86    NFTGKTEGNLGSGISPNNKAVLDYCKKVFMYALEDLSTIVEEMGE-DLNQIGSKIDQLKQ  144

Query  808   WMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINI----IAEMSKL-LKAFNI  972
             W++ VY YQT C + IE    +  I +G+ ++  LT+NAI+I    ++ M+KL LK  + 
Sbjct  145   WLTGVYNYQTDCLDDIEEDDLRKTIGEGIASSKILTSNAIDIFHTVVSAMAKLNLKVEDF  204

Query  973   TTTTDLLHKAADKnnnnnnnTT---------------SRRLLQ---TDHFPEWFPIADRK  1098
                T  +   +DK     N  T               +RRLL+       P W   ADRK
Sbjct  205   KNMTGGIFAPSDKGAAPVNKGTPPVADDSPVADPDGPARRLLEDIDETGIPTWVSGADRK  264

Query  1099  LLAAQRRGN------LRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEI  1260
             L+    RG+      +R   VVAKDGSGQFKT+  A+ + P K+  + +I++KAG+Y E 
Sbjct  265   LMTKAGRGSNDGGARIRATFVVAKDGSGQFKTVQQAVNACPEKNPGRCIIHIKAGIYREQ  324

Query  1261  VEVGKKMKNVFMYGDGAGKTIITGKKNYA-HMKITTSKTATFSALGKGFVARGITFRNTA  1437
             V + KK  N+FM+GDGA KT+I+  ++       TTS + T     +GF+A+ I F+NTA
Sbjct  325   VIIPKKKNNIFMFGDGARKTVISYNRSVKLSPGTTTSLSGTVQVESEGFMAKWIGFKNTA  384

Query  1438  GPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALI  1617
             GP GHQAVA R   D + IF+C  +GYQDTLY +  RQFYRN V+SGT+DFIFGK   +I
Sbjct  385   GPMGHQAVAIRVNGDRAVIFNCRFDGYQDTLYVNNGRQFYRNIVVSGTVDFIFGKSATVI  444

Query  1618  QNSIIIARKPLVHQFNTITADGKELAKA-KGGVVLQNCRIVPETALNPLRFKVKTYFGRP  1794
             QNS+I+ RK    QFNT+TADG E   A K G+VLQNCRIVP+  L   R  V++Y GRP
Sbjct  445   QNSLIVVRKGNKGQFNTVTADGNEKGLAMKIGIVLQNCRIVPDKKLAAERLIVESYLGRP  504

Query  1795  WKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFD  1974
             WK +STTV++ S+IGD++ P GWKIWDGE+F K+C Y EY N GPGA T RR    K   
Sbjct  505   WKKFSTTVIINSEIGDVIRPEGWKIWDGESFHKSCRYVEYNNRGPGAITNRRVNWVKI--  562

Query  1975  VLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
                      FT   WL   +W+    VP  +G
Sbjct  563   ARSAAEVNDFTVANWLGPINWIQEANVPVTLG  594



>ref|XP_006295414.1| hypothetical protein CARUB_v10024512mg [Capsella rubella]
 gb|EOA28312.1| hypothetical protein CARUB_v10024512mg [Capsella rubella]
Length=595

 Score =   395 bits (1016),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 231/572 (40%), Positives = 320/572 (56%), Gaps = 40/572 (7%)
 Frame = +1

Query  454   GDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSH  633
             GD  +S   MK+V   CQ    K  C K++  V    S      I A + AT + + KS 
Sbjct  30    GDSNLSP-QMKAVQGICQATADKASCVKTLEPV---KSDDPNKLIKAFMLATKDAITKSS  85

Query  634   QLVVNTK--IEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLN  807
                  T+  +  S  P N   ++ CK +   A++DL   +  +G+ +L+ +  + DQL  
Sbjct  86    NFTGKTEGNMGSSISPNNKAVLDYCKRVFLYALEDLSTIVEEMGE-DLNQIGSKIDQLKQ  144

Query  808   WMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINI----IAEMSKL-LKAFNI  972
             W++ VY YQT C + IE    +  I +G+ ++  LT+NAI+I    ++ M+KL +K    
Sbjct  145   WLTGVYNYQTDCLDDIEEEDLRKTIGEGIASSKILTSNAIDIFHTVVSAMAKLNIKVDEF  204

Query  973   TTTTDLLHKAADKnnnnnnnTT---------------SRRLLQ---TDHFPEWFPIADRK  1098
                T  L   ++K +   N  T               +RRLL+       P W    DRK
Sbjct  205   KNMTGGLFTPSNKGDAPVNKGTPPVADESPVADPDGPARRLLEDMDETGTPTWVSGGDRK  264

Query  1099  LLAAQRRGN------LRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEI  1260
             L+A   RG       +R   VVAKDGSGQFKT+  A+ + P K+  + +I++KAG+Y E 
Sbjct  265   LMAKAGRGGNDGAARIRETFVVAKDGSGQFKTVQQAVNACPDKNPGRCIIHIKAGIYKEQ  324

Query  1261  VEVGKKMKNVFMYGDGAGKTIITGKKNYAHMK-ITTSKTATFSALGKGFVARGITFRNTA  1437
             V + KK  N+FM+GDGA KT+IT  ++       TTS + T     +GF+A+ I F+NTA
Sbjct  325   VIIPKKKNNIFMFGDGARKTVITYNRSVKLTPGTTTSLSGTVQVESEGFMAKWIGFKNTA  384

Query  1438  GPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALI  1617
             GP GHQAVA R   D + IF+C  +GYQDTLY +  RQFYRN V+SGT+DFIFGK   +I
Sbjct  385   GPMGHQAVAIRVNGDRAVIFNCRFDGYQDTLYVNNGRQFYRNIVVSGTVDFIFGKSATVI  444

Query  1618  QNSIIIARKPLVHQFNTITADGKELAKA-KGGVVLQNCRIVPETALNPLRFKVKTYFGRP  1794
             QNS+I+ RK    QFNT+TADG E   A K G+VLQNCRIVP+  L   R  V +Y GRP
Sbjct  445   QNSLIVVRKGNKGQFNTVTADGNEKGLAMKIGIVLQNCRIVPDKKLAAERLTVPSYLGRP  504

Query  1795  WKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFD  1974
             WK +STTV+M +++GDL+ P GWKIWDGE+F K+C Y E+ N GPGA T RR    K   
Sbjct  505   WKKFSTTVIMNTEMGDLIRPEGWKIWDGESFHKSCRYVEFNNRGPGAITNRRVNWAKIAK  564

Query  1975  VLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
                 +    +T   WL   +W+    VP  +G
Sbjct  565   SAAEV--NDYTVANWLGPINWIQEANVPVTLG  594



>ref|XP_009142571.1| PREDICTED: pectinesterase 5-like [Brassica rapa]
Length=592

 Score =   395 bits (1015),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 231/560 (41%), Positives = 323/560 (58%), Gaps = 36/560 (6%)
 Frame = +1

Query  481   MKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTK--  654
             MK+V   CQ    K  C K++  V    S      I A + AT + + KS      T+  
Sbjct  38    MKAVQGICQATADKASCVKTLEPV---KSDDPNKLIKAFMLATQDALTKSSNFTDKTEGN  94

Query  655   IEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQ  834
             +  S  P N   ++ C+++   A++DL   +  +G+ +L+T+ ++ DQL  W++ VY YQ
Sbjct  95    MGSSISPNNKAVLDYCRKVFMYALEDLGTILEEMGE-DLNTIGNKFDQLKQWLTGVYNYQ  153

Query  835   TTCTEQIESRLYKSAIEDGMINATQLTNNAINI----IAEMSKL---LKAF-NITTTTDL  990
             T C + I+    +  I +G+ ++  LT NAI+I    ++ M+K+   +  F N+T+    
Sbjct  154   TDCLDDIQEDDLRKTIAEGISSSKILTGNAIDIFHTVVSAMAKIDAKVDDFKNMTSGIFT  213

Query  991   LHKAADKnnnnnnnTT-------SRRLLQT-DHF--PEWFPIADRKLLA--------AQR  1116
                 A+K      +T        SRRLL+  D    P W   ADRKL+A           
Sbjct  214   PSAPANKEAAPVVDTPVADPDGLSRRLLEDLDDLGVPTWVSGADRKLMANAGRGRRGGGG  273

Query  1117  RGNLRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFM  1296
                +R   VVAKDGSGQFK+I  A+ + P K+  + +I++KAG+Y E V + KK  N+FM
Sbjct  274   APRIRATYVVAKDGSGQFKSIQQAVNACPDKNAGRCIIHIKAGIYREQVIIPKKKNNIFM  333

Query  1297  YGDGAGKTIITGKKNYA-HMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRS  1473
             +GDGA KT+IT  ++       TTS + T     +GF+A+ I F+NTAGP GHQAVA R 
Sbjct  334   FGDGARKTVITYNRSVGLSSGTTTSTSGTVQVESEGFMAKWIGFKNTAGPNGHQAVAIRV  393

Query  1474  QSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLV  1653
               D + IF+C  +GYQDTLY +  RQFYRNCV+SGT+DFIFGK   +IQNS+I+ RK   
Sbjct  394   NGDRAVIFNCRFDGYQDTLYVNNGRQFYRNCVVSGTVDFIFGKSATVIQNSLIVIRKGNK  453

Query  1654  HQFNTITADGKELA-KAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMES  1830
              Q+NT+TADG E     K G+V+QNCRIVP+  L P R  V++Y GRPWK YSTTVV+ +
Sbjct  454   GQYNTVTADGNEKGLSMKIGIVIQNCRIVPDKKLAPERLTVESYLGRPWKQYSTTVVINT  513

Query  1831  QIGDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTA  2010
             +IGD++ P GW++WDGE+F KTC Y EY N GPGANT RR    K     G I    FT 
Sbjct  514   EIGDVIRPEGWRLWDGESFHKTCRYVEYNNRGPGANTNRRVNWAKVARSAGEI--NQFTV  571

Query  2011  GLWLDANSWLPATGVPFAIG  2070
               WL   +W+    VP  +G
Sbjct  572   ANWLAPVNWIQEANVPVTLG  591



>gb|ABO80933.1| Pectinesterase; Pectinesterase inhibitor [Medicago truncatula]
Length=620

 Score =   396 bits (1017),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 225/539 (42%), Positives = 308/539 (57%), Gaps = 40/539 (7%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQ  663
             +++   CQ A+ + +C  ++S V    +A  K +I AA+KA  + V K+  +      E 
Sbjct  40    RNLRIMCQNAQDQKLCHDTLSSVRGADAADPKAYIAAAVKAATDNVIKAFNMSERLTTEY  99

Query  664   STDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTC  843
                    MA++DCK+++Q A+D L  S + V D  +  +  +   + NW+SAV +Y+  C
Sbjct  100   GKKNGAKMALDDCKDLMQFALDSLDLSNNCVRDNNIEAVHDQTADMRNWLSAVISYKQGC  159

Query  844   TEQI------ESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAA  1005
              E        E ++ +      + +  ++T  A++I+  +S +L+ FN+           
Sbjct  160   MEGFDDANDGEKKIKEQFHVQSLYSVQKVTAVALDIVTGLSDILQQFNLN----------  209

Query  1006  DKnnnnnnnTTSRRLLQTD------HFPEWFPIADRKLLA-AQRRG---NLRPNVVVAKD  1155
                   +    SRRLL ++       +P W   + RKLLA  QR+G   N+RPN VVA D
Sbjct  210   -----FDIKPPSRRLLNSEVTVDDQGYPSWISSSGRKLLAKMQRKGWRANIRPNAVVAND  264

Query  1156  GSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGK  1335
             GSGQFKTI  AL SYP  +K +YVIYVKAGVYDE + V K+  N+ MYGDG  KTI+TG+
Sbjct  265   GSGQFKTIQAALASYPKGNKDRYVIYVKAGVYDEYITVPKEAVNILMYGDGPAKTIVTGR  324

Query  1336  KNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEG  1515
             KN       T  TATFS    GF+ + +TF NTAGP G QAVA+R+  DMSA+  C I G
Sbjct  325   KN-QMAGTNTQNTATFSNTAMGFIGKAMTFENTAGPAGMQAVAFRNIGDMSALVGCHIVG  383

Query  1516  YQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLV--HQFNTITADGKE  1689
             YQDTLY  T RQFYRNCVISGTIDFIFG    LIQ+S II RK     +++N I ADG  
Sbjct  384   YQDTLYVQTNRQFYRNCVISGTIDFIFGTSATLIQSSTIIVRKGNYDHNEYNVIVADGSP  443

Query  1690  LAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKI  1869
             L     G+V+Q+C I+PE AL P +F V++Y GRPW+  S  V+MES IGD +   GW  
Sbjct  444   LVNMNTGIVIQDCNIIPEAALVPEKFTVRSYLGRPWQNESKAVIMESTIGDFIHQDGWTT  503

Query  1870  WDGE------NFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDA  2028
             W  E      + E TC + EY N+GPGAN  RR +      V+    A  +TA +WLDA
Sbjct  504   WPEEQNKPEKHHENTCYFAEYANTGPGANVARRVKWKGYKGVISRSEATKYTASIWLDA  562



>ref|XP_010506727.1| PREDICTED: LOW QUALITY PROTEIN: pectinesterase 5-like [Camelina 
sativa]
Length=595

 Score =   395 bits (1014),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 237/572 (41%), Positives = 322/572 (56%), Gaps = 40/572 (7%)
 Frame = +1

Query  454   GDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSH  633
             GD  +S   MK+    CQ    K  C K++  V    S      I A + AT + + KS 
Sbjct  30    GDTNLSP-QMKAXQGICQSTSDKASCVKTLEPV---KSDDPNKLIKAFMLATQDAITKSS  85

Query  634   QLVVNTK--IEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLN  807
                  T+  +  S  P N   +  CK +   A++DL   +  +G+ +L+ +  + DQL  
Sbjct  86    NFTGKTEGNMGSSISPNNKAVLVYCKRVFMYALEDLSTIVEEMGE-DLNQIGSKIDQLKQ  144

Query  808   WMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINI----IAEMSKL------L  957
             W++ VY YQT C + IE    +  I +G+ ++  LT+NAI+I    ++ M+KL       
Sbjct  145   WLTGVYNYQTDCLDDIEEDDLRKTIGEGIASSKILTSNAIDIFHTVVSAMAKLNIKVDEF  204

Query  958   KAF--NITTTTDLLHKAADKnnnnnnnTT--------SRRLLQ---TDHFPEWFPIADRK  1098
             K F   I T +D     A+K     ++ +        +RRLL+       P W   ADRK
Sbjct  205   KNFTGGIFTPSDKGAAPANKGAPPVDDESPVADPDGPARRLLEDMDQTGTPTWVSGADRK  264

Query  1099  LLAAQRRGN------LRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEI  1260
             L+A   RG       +R   VVAKDGSGQFKT+  A+ + P K+  + +I++KAG+Y E 
Sbjct  265   LMAKAGRGGDGGAARIRATFVVAKDGSGQFKTVQQAVNACPEKNPGRCIIHIKAGIYKEQ  324

Query  1261  VEVGKKMKNVFMYGDGAGKTIITGKKNYA-HMKITTSKTATFSALGKGFVARGITFRNTA  1437
             V + KK  N+FM+GDGA KT+IT  ++       TTS + T     +GF+A+ I F+NTA
Sbjct  325   VIIPKKKNNIFMFGDGARKTVITYNRSVKLSPGTTTSLSGTVQVESEGFMAKWIGFKNTA  384

Query  1438  GPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALI  1617
             GP GHQAVA R   D + IF+C  +GYQDTLY +  RQFYRN V+SGT+DFIFGK   +I
Sbjct  385   GPMGHQAVAIRVNGDRAVIFNCRFDGYQDTLYVNNGRQFYRNIVVSGTVDFIFGKSATVI  444

Query  1618  QNSIIIARKPLVHQFNTITADGKELAKA-KGGVVLQNCRIVPETALNPLRFKVKTYFGRP  1794
             QNS+I+ RK    QFNT+TADG E   A K G+VLQNCRIVP+  L   R  V +Y GRP
Sbjct  445   QNSLIVVRKGNKGQFNTVTADGNEKGLAMKIGIVLQNCRIVPDKKLAAERLTVASYLGRP  504

Query  1795  WKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFD  1974
             WK YSTTV+M +++GDL+ P GWKIWDGENF K+C Y EY N GPGA T RR    K   
Sbjct  505   WKQYSTTVIMNTEMGDLIRPEGWKIWDGENFHKSCRYVEYNNRGPGAITNRRVDWVKIAR  564

Query  1975  VLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
               G +    FT   WL   +W+    VP  +G
Sbjct  565   SAGEV--NDFTVANWLGPINWIQEANVPVTLG  594



>ref|XP_009142468.1| PREDICTED: pectinesterase 5-like [Brassica rapa]
Length=596

 Score =   395 bits (1014),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 229/564 (41%), Positives = 308/564 (55%), Gaps = 40/564 (7%)
 Frame = +1

Query  481   MKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNT--K  654
             MK+V   CQ    K  C K++  V    S      I A I AT + + KS      T  K
Sbjct  38    MKAVQGICQATSDKASCVKTLEPV---KSDDPNKLIKAFILATQDAITKSSNFTGKTEGK  94

Query  655   IEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQ  834
             +  S  P N   ++ CK +   A++DL   I  +G+ +L+ +  + DQL  W++ VY YQ
Sbjct  95    LGSSISPNNKAVLDYCKRVFMYALEDLGTIIEEMGE-DLNQIGSKIDQLKQWLTGVYNYQ  153

Query  835   TTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNI------TTTTDLLH  996
             T C + IE    +  I +G+ N+  LT NAI+I   +   +   NI        T D   
Sbjct  154   TDCLDDIEEDDLRKTIGEGIANSKILTGNAIDIFHTVVSAMAKLNIKMDDFKNMTGDFFS  213

Query  997   KA------ADKnnnnnnnTT-------SRRLLQTDH---FPEWFPIADRKLLA-------  1107
              +       DK      +T        SRRLL+       P W    DRKL+A       
Sbjct  214   SSEKGAAPVDKKATPAVDTPVADPDGPSRRLLEDLDDLGIPRWVSGTDRKLMANAGRGEK  273

Query  1108  -AQRRGNLRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMK  1284
               +    ++   VVAKDGSGQFKT+  A+ + P K+  + +I++KAG+Y E V + KK  
Sbjct  274   GGEGGARMKATYVVAKDGSGQFKTVQQAVDACPQKNPGRCIIHIKAGIYKEQVVIPKKKN  333

Query  1285  NVFMYGDGAGKTIITGKKNYAHMK-ITTSKTATFSALGKGFVARGITFRNTAGPEGHQAV  1461
             N+FM+GDGA KTII+  ++       TTS + T     +GF+A+ I F+NTAGP GHQAV
Sbjct  334   NIFMFGDGARKTIISFNRSVKLTPGTTTSLSGTVQVESEGFMAKFIGFKNTAGPMGHQAV  393

Query  1462  AYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIAR  1641
             A R   D + +F+C  +GYQDTLY +  RQFYRN V+SGTIDFIFGKG  +IQNS+I+ R
Sbjct  394   AIRVNGDRAVLFNCRFDGYQDTLYANNGRQFYRNIVVSGTIDFIFGKGATVIQNSMIVVR  453

Query  1642  KPLVHQFNTITADGKELA-KAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTV  1818
             K   +QFNT+TADG E     K G+VLQNCRIV +  L   R  V +Y GRPWK YSTT 
Sbjct  454   KGNKNQFNTVTADGNEKGLSMKIGIVLQNCRIVADKKLQAERLTVASYLGRPWKKYSTTA  513

Query  1819  VMESQIGDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRAR  1998
             V+ S+IGD++ P GWKIWDGE+F KTC Y E+ N GPGANT +R    K       +   
Sbjct  514   VINSEIGDVIKPEGWKIWDGESFHKTCKYVEFNNRGPGANTNKRVDWVKIAKSASEV--N  571

Query  1999  HFTAGLWLDANSWLPATGVPFAIG  2070
              F+   WL    W+    VP  +G
Sbjct  572   QFSVANWLAPVEWIQEANVPVNLG  595



>ref|XP_003626045.1| Photosystem I P700 chlorophyll a apoprotein [Medicago truncatula]
Length=625

 Score =   395 bits (1016),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 225/539 (42%), Positives = 308/539 (57%), Gaps = 40/539 (7%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQ  663
             +++   CQ A+ + +C  ++S V    +A  K +I AA+KA  + V K+  +      E 
Sbjct  40    RNLRIMCQNAQDQKLCHDTLSSVRGADAADPKAYIAAAVKAATDNVIKAFNMSERLTTEY  99

Query  664   STDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTC  843
                    MA++DCK+++Q A+D L  S + V D  +  +  +   + NW+SAV +Y+  C
Sbjct  100   GKKNGAKMALDDCKDLMQFALDSLDLSNNCVRDNNIEAVHDQTADMRNWLSAVISYKQGC  159

Query  844   TEQI------ESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAA  1005
              E        E ++ +      + +  ++T  A++I+  +S +L+ FN+           
Sbjct  160   MEGFDDANDGEKKIKEQFHVQSLYSVQKVTAVALDIVTGLSDILQQFNLN----------  209

Query  1006  DKnnnnnnnTTSRRLLQTD------HFPEWFPIADRKLLA-AQRRG---NLRPNVVVAKD  1155
                   +    SRRLL ++       +P W   + RKLLA  QR+G   N+RPN VVA D
Sbjct  210   -----FDIKPPSRRLLNSEVTVDDQGYPSWISSSGRKLLAKMQRKGWRANIRPNAVVAND  264

Query  1156  GSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGK  1335
             GSGQFKTI  AL SYP  +K +YVIYVKAGVYDE + V K+  N+ MYGDG  KTI+TG+
Sbjct  265   GSGQFKTIQAALASYPKGNKDRYVIYVKAGVYDEYITVPKEAVNILMYGDGPAKTIVTGR  324

Query  1336  KNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEG  1515
             KN       T  TATFS    GF+ + +TF NTAGP G QAVA+R+  DMSA+  C I G
Sbjct  325   KN-QMAGTNTQNTATFSNTAMGFIGKAMTFENTAGPAGMQAVAFRNIGDMSALVGCHIVG  383

Query  1516  YQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLV--HQFNTITADGKE  1689
             YQDTLY  T RQFYRNCVISGTIDFIFG    LIQ+S II RK     +++N I ADG  
Sbjct  384   YQDTLYVQTNRQFYRNCVISGTIDFIFGTSATLIQSSTIIVRKGNYDHNEYNVIVADGSP  443

Query  1690  LAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKI  1869
             L     G+V+Q+C I+PE AL P +F V++Y GRPW+  S  V+MES IGD +   GW  
Sbjct  444   LVNMNTGIVIQDCNIIPEAALVPEKFTVRSYLGRPWQNESKAVIMESTIGDFIHQDGWTT  503

Query  1870  WDGE------NFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDA  2028
             W  E      + E TC + EY N+GPGAN  RR +      V+    A  +TA +WLDA
Sbjct  504   WPEEQNKPEKHHENTCYFAEYANTGPGANVARRVKWKGYKGVISRSEATKYTASIWLDA  562



>gb|KFK37472.1| hypothetical protein AALP_AA4G261200 [Arabis alpina]
Length=591

 Score =   394 bits (1012),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 236/568 (42%), Positives = 318/568 (56%), Gaps = 35/568 (6%)
 Frame = +1

Query  451   KGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKS  630
             KGD  +S   MK+V   CQ    K+ C K++  V    S      I A I A  +EV KS
Sbjct  30    KGDTNLSP-QMKAVQGICQATTDKNSCIKTLEPV---KSDDPNKLIKAFILAVQDEVTKS  85

Query  631   HQLVVNTKIEQSTD--PYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLL  804
                    +     D  P N   +E CK +   A+ DL      +G+ +L+ +  + DQL 
Sbjct  86    TNFTGKAEGNLGADISPNNKAVLEYCKRVFMYALQDLGTITEEMGE-DLNQVGSKLDQLK  144

Query  805   NWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINI----IAEMSKLLKAFN-  969
              W+  VY YQT CT+ IE    + +I +G+ ++  LT+NAI+I    ++ M+KL      
Sbjct  145   QWLIGVYNYQTDCTDDIEDGDLRKSIAEGIASSKILTSNAIDIFHTVVSAMAKLNSKVGD  204

Query  970   -ITTTTDLLHKAA--DKnnnnnnnTT-------SRRLLQ---TDHFPEWFPIADRKLLAA  1110
                 T D+   AA  +K      +T        SRRLL+       P W   ADRKL+A 
Sbjct  205   FKNMTGDIFKGAAPAEKGATPAVDTPVADPDGPSRRLLEDIDETGVPTWVSGADRKLMAQ  264

Query  1111  QRRGNLRPNV------VVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVG  1272
               RG            VVAKDGSGQFK++  A+ + P K+  + +I++KAG+Y E V + 
Sbjct  265   AGRGRRGGGARIRATYVVAKDGSGQFKSVQQAVNACPDKNPGRCIIHIKAGIYREQVIIP  324

Query  1273  KKMKNVFMYGDGAGKTIITGKKNYA-HMKITTSKTATFSALGKGFVARGITFRNTAGPEG  1449
             KK  N+F++GDGA KT+I+  ++       TTS + T     +GF+A+ I F+NTAGP G
Sbjct  325   KKKNNIFLFGDGARKTVISYNRSVKLSPGTTTSLSGTVQVESEGFMAKWIGFKNTAGPMG  384

Query  1450  HQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSI  1629
             HQAVA R   D + +F+C  +GYQDTLY +  RQFYRNCV+SGT+DFIFGK   +IQNS+
Sbjct  385   HQAVAIRVNGDRAVLFNCRFDGYQDTLYVNNGRQFYRNCVVSGTVDFIFGKSATVIQNSL  444

Query  1630  IIARKPLVHQFNTITADGKELAKA-KGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAY  1806
             I+ RK    QFNTITADG E   A K G+V+QNCRIVP+  L   R  V++Y GRPWK Y
Sbjct  445   IVVRKGNQGQFNTITADGNEKGLAMKIGIVIQNCRIVPDKKLAAQRLTVESYLGRPWKQY  504

Query  1807  STTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGP  1986
             STTV+M +++GDL+ P GW++WDGE F KTC Y EY N GPGA T RR    K       
Sbjct  505   STTVIMNTEMGDLIRPEGWRMWDGEGFHKTCRYVEYNNRGPGAITNRRVNWAKIARSANE  564

Query  1987  IRARHFTAGLWLDANSWLPATGVPFAIG  2070
             +    FT   WL    W+    VPF +G
Sbjct  565   V--NDFTVANWLGPIEWIQQANVPFTLG  590



>ref|XP_009405157.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Musa acuminata subsp. malaccensis]
Length=639

 Score =   395 bits (1015),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 210/537 (39%), Positives = 309/537 (58%), Gaps = 22/537 (4%)
 Frame = +1

Query  478   SMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKI  657
             S KSV   C   +Y+  C  S+S V  + ++  K  + AA+   L+EV K+     ++K+
Sbjct  116   SSKSVKMICSSTDYQRACESSMSKVVTSDTSDPKVLLKAAVTVVLDEVSKA---FAHSKL  172

Query  658   EQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQT  837
              +S D     A+EDC+++ +++  ++ A++  +  + +  L  R+  +  W+SAV  YQ 
Sbjct  173   LKSNDSRVRGAVEDCQQLYENSKAEINATLQSIVASGIDHLPSRSHDMRTWLSAVMTYQQ  232

Query  838   TCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnn  1017
             TC +       K+ + + M ++ +LT+NA+ +I + S  L   N+  +   L  A++++ 
Sbjct  233   TCIDGFPEGEVKTKMHEAMKSSKELTSNALAMIGQASSFLSLINLPGSNRRLLSASEEHE  292

Query  1018  nnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGALKS  1197
                +       L+ + +P W    DR++L    R  L PNV VAKDGSG++KTI+ AL +
Sbjct  293   AVTSG------LKKNGYPSWVGEDDRRMLKEHLRVKLTPNVTVAKDGSGKYKTISEALAA  346

Query  1198  YPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKTA  1377
              P KHK +YVIY+KAGVY+E V V KKM NV MYGDG+ +TI+TG +NY      T +TA
Sbjct  347   MPKKHKGRYVIYIKAGVYEETVNVTKKMANVTMYGDGSTRTIVTGSRNYID-GTRTFQTA  405

Query  1378  TFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFY  1557
             TF A+G  FVA  + FRNTAG   HQAVA R  SD S   +C +E YQDTLY HT RQFY
Sbjct  406   TFVAMGDRFVAMAMGFRNTAGAAKHQAVALRVVSDRSVFVNCRMEAYQDTLYAHTNRQFY  465

Query  1558  RNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCRIV  1737
             R CVI+GT+DFIFG  +A+ QN +++ R+PL +Q N ITA G+   +   G VL  CRI 
Sbjct  466   RGCVIAGTVDFIFGDASAVFQNCLLVVRRPLPNQQNIITAQGRLNRRETTGFVLHQCRIK  525

Query  1738  PETALNPLRF-KVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEY  1914
              +  LN      +++Y  RPWK +S T++MESQI   +   G+  W+G+    T  Y EY
Sbjct  526   ADNRLNDASLPPIRSYLARPWKEFSRTIIMESQIDGFIHAEGYMPWEGDFALSTLYYGEY  585

Query  1915  KNSGPGAN-----TWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
              N GPGAN     TW      KK +      A  +T   ++  +SW+PATG    +G
Sbjct  586   NNDGPGANASGRVTWPGVHVIKKEE------AERYTVENFIQGSSWIPATGSLVRLG  636



>ref|XP_011078157.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=590

 Score =   394 bits (1011),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 212/537 (39%), Positives = 301/537 (56%), Gaps = 33/537 (6%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCA----KSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNT  651
             K V T C   +Y+  C     KSI  V  + ++  ++ + AA  A  +E+ K+ +   + 
Sbjct  80    KVVKTVCATTDYQKTCEESLLKSIKSVNPSSTSLHENILRAAFSAASDEIDKAVKKASDL  139

Query  652   KIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAY  831
             K      P    A EDC E+L+DA ++L +S + +   ++  L     ++ NW+SAV  Y
Sbjct  140   KF---NGPLKKKAFEDCLELLEDAKEELNSSSAFIKGKDMGKLSSITPEINNWLSAVLTY  196

Query  832   QTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADK  1011
             Q TC +       K++++  +  + +  +NA+ I+AE+S  LK                 
Sbjct  197   QQTCIDGFPDGEEKTSMQKLLNTSKEHGSNALAIVAELSTTLKTVQ--------------  242

Query  1012  nnnnnnnTTSRRLLQTDH--FPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITG  1185
                     + R+LL  D   FP W    + +           PNV VAKDGSG F TI  
Sbjct  243   --------SQRKLLGMDEAGFPAWMGHHEYRRALKADATKFTPNVTVAKDGSGNFTTIAA  294

Query  1186  ALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITT  1365
             ALK+ P K+  +YVIY+K GVYDE V + KKM NV MYG G+ K+IITG KNY    + T
Sbjct  295   ALKAMPEKYTGRYVIYIKEGVYDENVIITKKMVNVTMYGVGSQKSIITGSKNYVD-GVPT  353

Query  1366  SKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTY  1545
              +TA+F+A+G GF+A+ + FRNTAGPE HQAVA R QSD S   +C +EGYQD+LY  T+
Sbjct  354   YQTASFAAIGDGFMAQSLGFRNTAGPEKHQAVALRVQSDRSIFLNCRMEGYQDSLYAQTH  413

Query  1546  RQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQN  1725
             RQFYR C I+GTIDFIFG   A+ QN +I  RKP+ +Q N +TA G+   +   G+VLQN
Sbjct  414   RQFYRGCYITGTIDFIFGNAAAVFQNCLIYVRKPMANQQNIVTAQGRTDKRQTTGIVLQN  473

Query  1726  CRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMY  1905
             CRI+    L P + K K+Y GRPWK YS T++ME++IGD +   GW  W+G+   KT  Y
Sbjct  474   CRILAADTLKPEKAKFKSYLGRPWKEYSRTIIMETEIGDFIQAEGWMEWEGDFALKTLYY  533

Query  1906  YEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIGYT  2076
              E+ N GPG++T  R + +  +  +    A  FT G +L   SW+    VP   G +
Sbjct  534   AEFNNKGPGSSTSGRVK-WPGYKTIKKEEALEFTVGPFLQGESWIKNADVPVRFGMS  589



>ref|XP_008450602.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=583

 Score =   393 bits (1010),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 210/556 (38%), Positives = 321/556 (58%), Gaps = 33/556 (6%)
 Frame = +1

Query  436   DASSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLE  615
             D ++G   H +S+ SMK++   CQ  +YK  C  S+    NN S+  ++ + A  KA ++
Sbjct  44    DPATGNKSHEISS-SMKAIKAICQPTDYKQECIASLKATGNN-SSDPQELVQAGFKAAMK  101

Query  616   EVHKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRAD  795
              +  +    V+ K +   DP    A+  CKE++  AID+L+ S++ +G+ ++  L     
Sbjct  102   LIQAAANKSVDLK-QLEKDPRTSKALAGCKELMDFAIDELKYSMNKLGEFDITKLDEMLI  160

Query  796   QLLNWMSAVYAYQTTCTEQIESRLYKSA--IEDGMINATQLTNNAINIIAEMSKLLKAFN  969
              +  W+SA   YQ TC +  ++    +A  ++  +  + +L++N + ++++ S +L    
Sbjct  161   DIRIWLSATITYQETCLDGFQNTTGNAAEKMKKALKTSMKLSSNGLAMVSQFSSMLTELQ  220

Query  970   ITTTTDLLHKAADKnnnnnnnTTSRRLLQT-----DHFPEWFPIADRKLLAAQRRGNLRP  1134
             I                     + RRLL+      D +P+W     R+LLAA  R  ++P
Sbjct  221   IP------------------GISRRRLLEIPVLGHDDYPDWANPGMRRLLAAGSR--VKP  260

Query  1135  NVVVAKDGSGQFKTITGALKSYPP-KHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGA  1311
             NVVVAKDGSGQF+TI  AL   P  K+ A YVI++KAGVY E +++ K + ++ + GDG 
Sbjct  261   NVVVAKDGSGQFRTIQAALDQVPKRKNNATYVIHIKAGVYQEYLQIKKTVTHLMLIGDGP  320

Query  1312  GKTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSA  1491
              KTIITG KN+      T KTAT +   + F+AR I F NTAGP+ HQAVA R Q+D + 
Sbjct  321   KKTIITGNKNFVD-GTPTFKTATVAVTAEHFMARDIGFENTAGPQKHQAVALRVQADKAV  379

Query  1492  IFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTI  1671
              ++C + GYQDTLY HT RQFYR+C +SGTIDFIFG   A+ Q    + RKPL +Q   +
Sbjct  380   FYNCEMHGYQDTLYVHTMRQFYRDCTVSGTIDFIFGDAAAIFQGCTFLVRKPLPNQQCIV  439

Query  1672  TADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLS  1851
             TA G++  +    +++QNC I  +  L P++ + +++ GRPWK YS T++MES IGDL+ 
Sbjct  440   TAHGRKERRQPSALIIQNCSIKADKDLAPVQKQFRSFLGRPWKEYSRTIIMESYIGDLIQ  499

Query  1852  PLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDAN  2031
             P GW  W G+   KTC Y EY N GPG+N  +R + ++    + P  A  FTAG ++  +
Sbjct  500   PEGWLPWAGDWGLKTCFYTEYNNYGPGSNKSKRVK-WRGIKTITPQHALDFTAGRFVMGD  558

Query  2032  SWLPATGVPFAIGYTK  2079
              W+  TGVP+  G T+
Sbjct  559   RWIKPTGVPYVSGMTR  574



>ref|NP_001060715.1| Os07g0691100 [Oryza sativa Japonica Group]
 dbj|BAC83510.1| putative pectin methylesterase [Oryza sativa Japonica Group]
 dbj|BAF22629.1| Os07g0691100 [Oryza sativa Japonica Group]
 dbj|BAG92656.1| unnamed protein product [Oryza sativa Japonica Group]
Length=566

 Score =   392 bits (1008),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 215/559 (38%), Positives = 307/559 (55%), Gaps = 45/559 (8%)
 Frame = +1

Query  436   DASSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLE  615
             +   GK D  +ST S+KSV  FCQ  +Y+  C + +   A N +++  D   A    T E
Sbjct  28    NGGGGKEDGELST-SVKSVKAFCQPTDYQQTCEEELGKAAGNGASSPTDLAKAMFAVTSE  86

Query  616   EVHKSHQLVVNTKIEQ-STDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRA  792
             ++ K+  +  ++ +E+   D     A+++CKE+L+ A+DDL+ S   +G  E+       
Sbjct  87    KISKA--ISESSTLEELKNDKRTSGALQNCKELLEYAVDDLKTSFEKLGGFEMTNFHKAV  144

Query  793   DQLLNWMSAVYAYQTTCTEQIESRLYKSA--IEDGMINATQLTNNAINIIAEMSKLLKAF  966
             D L  W+SA   YQ TC +   +    +A  ++  + ++ +LT + + ++ + S  L + 
Sbjct  145   DDLRTWLSAALTYQGTCLDGFLNTTTDAADKMKSALNSSQELTEDILAVVDQFSATLGSL  204

Query  967   NITTTTDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLL---AAQRRG--NLR  1131
             NI                       RRLL  D  P W     R+ L   A    G    +
Sbjct  205   NIG---------------------RRRLLADDGMPVWMSEGGRRQLLEAAGPEAGPVEFK  243

Query  1132  PNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGA  1311
             P+V VA DGSG  KTI  A+   PPK+K +Y IYVKAG Y+E V VG+   NV M GDG 
Sbjct  244   PDVTVAADGSGDVKTIGEAVAKVPPKNKERYTIYVKAGTYNEYVSVGRPATNVNMIGDGI  303

Query  1312  GKTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSA  1491
             GKTIITG KN+  M +TT  TAT  A+G GF  RGIT  NTAGPE HQAVA R+QSDM+ 
Sbjct  304   GKTIITGNKNF-KMNLTTKDTATMEAIGNGFFMRGITVENTAGPENHQAVALRAQSDMAV  362

Query  1492  IFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTI  1671
              + C  +GYQDTLY H  RQF+R+C +SGTIDFIFG    ++QN ++  RKP+ +Q N I
Sbjct  363   FYQCEFDGYQDTLYPHAQRQFFRDCTVSGTIDFIFGNSQVVLQNCLLQPRKPMDNQVNII  422

Query  1672  TADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLS  1851
             TA G+   ++ GG V+ NC + P   L     KVKTY  RPWK YS T+ ++++IG ++ 
Sbjct  423   TAQGRREKRSAGGTVIHNCTVAPHPDLEKFTDKVKTYLARPWKEYSRTIFVQNEIGAVVD  482

Query  1852  PLGWKIWDGENFEKTCMYY-EYKNSGPGANT-----WRRNRAFKKFDVLGPIRARHFTAG  2013
             P+GW  W+G NF    +YY E  N GPGA+      W+  ++    DV      + FT  
Sbjct  483   PVGWLEWNG-NFALDTLYYAEVDNHGPGADMSKRAKWKGVQSLTYQDV-----QKEFTVE  536

Query  2014  LWLDANSWLPATGVPFAIG  2070
              ++    ++P  GVP+  G
Sbjct  537   AFIQGQEFIPKFGVPYIPG  555



>emb|CDX80075.1| BnaA05g00810D [Brassica napus]
Length=592

 Score =   393 bits (1010),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 230/560 (41%), Positives = 321/560 (57%), Gaps = 36/560 (6%)
 Frame = +1

Query  481   MKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLV--VNTK  654
             MK+V   CQ    K  C K++  V    S      I A + AT + + KS          
Sbjct  38    MKAVQGICQATADKASCVKTLEPV---KSDDPNKLIKAFMLATQDALTKSSNFTDKAEGN  94

Query  655   IEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQ  834
             +  S  P N   ++ C+++   A++DL   +  +G+ +L+T+ ++ DQL  W++ VY YQ
Sbjct  95    MGSSISPNNKAVLDYCRKVFMYALEDLGTILEEMGE-DLNTIGNKFDQLKQWLTGVYNYQ  153

Query  835   TTCTEQIESRLYKSAIEDGMINATQLTNNAINI----IAEMSKL---LKAF-NITTTTDL  990
             T C + I+    +  I +G+ ++  LT NAI+I    ++ M+K+   +  F N+T+    
Sbjct  154   TDCLDDIQEDDLRKTIAEGISSSKILTGNAIDIFHTVVSAMAKIDAKVDDFKNMTSGIFT  213

Query  991   LHKAADKnnnnnnnTT-------SRRLLQT-DHF--PEWFPIADRKLLA--------AQR  1116
                 A+K      +T        SRRLL+  D    P W   ADRKL+A           
Sbjct  214   PSAPANKEAAPVVDTPVADPDGPSRRLLEDLDDLGVPTWVSGADRKLMANAGRGRRGGGG  273

Query  1117  RGNLRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFM  1296
                +R   VVAKDGSGQFK+I  A+ + P K+  + +I++KAG+Y E V + KK  N+FM
Sbjct  274   APRIRATYVVAKDGSGQFKSIQQAVNACPDKNAGRCIIHIKAGIYREQVIIPKKKNNIFM  333

Query  1297  YGDGAGKTIITGKKNYA-HMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRS  1473
             +GDGA KT+IT  ++       TTS + T     +GF+A+ I F+NTAGP GHQAVA R 
Sbjct  334   FGDGARKTVITYNRSVGLSSGTTTSTSGTVQVESEGFMAKWIGFKNTAGPNGHQAVAIRV  393

Query  1474  QSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLV  1653
               D + IF+C  +GYQDTLY +  RQFYRNCV+SGT+DFIFGK   +IQNS+I+ RK   
Sbjct  394   NGDRAVIFNCRFDGYQDTLYVNNGRQFYRNCVVSGTVDFIFGKSATVIQNSLIVIRKGNK  453

Query  1654  HQFNTITADGKELA-KAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMES  1830
              Q+NT+TADG E     K G+V+QNCRIVP+  L P R  V++Y GRPWK YSTTVV+ +
Sbjct  454   GQYNTVTADGNEKGLSMKIGIVIQNCRIVPDKKLAPERLTVESYLGRPWKQYSTTVVINT  513

Query  1831  QIGDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTA  2010
             +IGD++ P GW++WDGE+F KTC Y EY N GPGANT RR    K     G I    FT 
Sbjct  514   EIGDVIRPEGWRLWDGESFHKTCRYVEYNNRGPGANTNRRVNWAKVARSAGEI--NQFTV  571

Query  2011  GLWLDANSWLPATGVPFAIG  2070
               WL   +W+    VP  +G
Sbjct  572   ANWLAPVNWIQEANVPVTLG  591



>ref|XP_003550590.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like 
[Glycine max]
 gb|KHN17766.1| Putative pectinesterase/pectinesterase inhibitor 13 [Glycine 
soja]
Length=603

 Score =   394 bits (1011),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 212/540 (39%), Positives = 311/540 (58%), Gaps = 17/540 (3%)
 Frame = +1

Query  457   DHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATT--KDFIFAAIKATLEEVHKS  630
             DH V+   M  V   C  A+YK+ C   ++    +    T  KD + A +K   +EV K+
Sbjct  76    DHVVAHSKM--VKLVCSSADYKEKCEDPLNKAMEDDPKLTQPKDLLKAYVKFAEDEVSKA  133

Query  631   HQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNW  810
                 ++ K E   +     A EDCK++ +DA DD+  SIS +   E+  L  R     +W
Sbjct  134   FNKTISMKFENEQE---KGAFEDCKKLFEDAKDDIATSISELEKIEMKNLSQRTPDFNSW  190

Query  811   MSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDL  990
             +SAV ++Q  C +       K+ ++    ++ +  +N++ I+++++  L      +T   
Sbjct  191   LSAVISFQQNCVDGFPEGNTKTELQTLFNDSKEFVSNSLAILSQVASAL------STIQT  244

Query  991   LHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQF  1170
             L + +    + N+N+    L + D  P W    DR++L A       PNV VAKDGSG F
Sbjct  245   LARGSRSLLSENSNSPVASLDKADGLPSWMNHEDRRVLKAMD-NKPAPNVTVAKDGSGDF  303

Query  1171  KTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAH  1350
             KTI+  L + P   + +YVI+VK GVYDE V + KKM+N+ MYGDG+ K+IITG KN+  
Sbjct  304   KTISECLNAVPQNFEGRYVIFVKEGVYDETVTITKKMQNITMYGDGSQKSIITGNKNFRD  363

Query  1351  MKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTL  1530
               + T  TA+F   G GF+   + FRNTAGP+GHQAVA R Q+D +   +C  EGYQDTL
Sbjct  364   -GVRTFLTASFVVEGDGFIGLAMGFRNTAGPDGHQAVAARVQADRAVFANCRFEGYQDTL  422

Query  1531  YYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGG  1710
             Y   +RQFYR+C+++GTIDFIFG    + QN I++ RKPL +Q N +TA G+   +   G
Sbjct  423   YTQAHRQFYRSCIVTGTIDFIFGDAAVVFQNCIMVVRKPLENQQNMVTAQGRVDKQQVTG  482

Query  1711  VVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFE  1890
             +VLQ C I  + +L P + K+++Y GRPWK +S T+VMES+IGD + P GW  W+G+   
Sbjct  483   IVLQKCTIKADDSLVPEKDKIRSYLGRPWKEFSRTIVMESEIGDFIHPDGWTAWEGDFAL  542

Query  1891  KTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             KT  Y EY N+GPGA+T  R + +  + V+    A  FT G +L   +WL  TGVP   G
Sbjct  543   KTLYYAEYGNTGPGASTNARIK-WPGYQVINKDEASQFTVGSFLRG-TWLQNTGVPATQG  600



>ref|XP_010922274.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=574

 Score =   392 bits (1008),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 216/542 (40%), Positives = 312/542 (58%), Gaps = 39/542 (7%)
 Frame = +1

Query  478   SMKSVTTFCQYAEYKDVCAKSISHVANNHSATTK--DFIFAAIKATLEEVHKSHQLVVNT  651
             S+K++ T CQ  +YKD C K++S  ++N +   +  +  F+A    + +V    +L+   
Sbjct  50    SIKAIQTVCQPTDYKDACEKTLSSFSHNTTDHMELVNVAFSASMKYVTDVFDRSELLK--  107

Query  652   KIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAY  831
               E S DP +  A++ C+E+L+ A+DDL+ SI  +G+   +  +   + L  W+SA   Y
Sbjct  108   --EVSKDPASTEALQTCRELLEYAMDDLKKSIVQLGNVHKNLYEQAVEDLKVWLSAAITY  165

Query  832   QTTCTEQIE------SRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLL  993
             Q TC +  E      +   + AIE    N+TQ+T+NA+ ++ ++  L+++ NI++   LL
Sbjct  166   QDTCVDGFEGINTSAAETMRQAIE----NSTQITSNALAMVNQLDVLVRSLNISS---LL  218

Query  994   HKAADKnnnnnnnTTSRRLLQ---TDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSG  1164
                             R+LL     + FP W P A R+LL   R   + PNV VA+DG+G
Sbjct  219   R---------------RKLLSDAGANEFPSWMPAAQRRLLKV-RPAKIMPNVTVAQDGTG  262

Query  1165  QFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNY  1344
              F+TIT AL   P  + A +VIYVKAGVY E   V K M  V M GDG  KT ITG  + 
Sbjct  263   DFETITEALAQVPKDNNATFVIYVKAGVYKERFLVDKHMTKVTMIGDGPTKTKITGNVSV  322

Query  1345  AHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQD  1524
                +I+T KTAT +  G+ FV  G+ F NTAGPE HQAVA R  +D S  ++C ++GYQD
Sbjct  323   IAGEISTFKTATVAVAGEWFVGIGLGFENTAGPEKHQAVALRVNADRSVFYNCRMDGYQD  382

Query  1525  TLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAK  1704
             TLY H+ RQFYR+C I+GTIDFIFG    + QN +IIARKP+ +Q N +TA G++  +  
Sbjct  383   TLYAHSERQFYRDCTITGTIDFIFGDSATIFQNCMIIARKPMDNQQNIVTAQGRKERQGN  442

Query  1705  GGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGEN  1884
             G +VLQNC I  + A  P R  + TY GRPWK YS T++++SQ+ DL+ P GW  W G+ 
Sbjct  443   GAIVLQNCTITSDPAYYPHRKVLPTYLGRPWKPYSRTLILQSQLDDLIHPDGWLPWTGDV  502

Query  1885  FEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFA  2064
                TC Y E  N GPGA+  +R   +     L  + A+ +T   +L   +W+   GVPF 
Sbjct  503   GLDTCFYAELDNRGPGADLTKR-VTWPGIKNLTYVEAQEYTIENYLYGQTWISRAGVPFI  561

Query  2065  IG  2070
              G
Sbjct  562   PG  563



>ref|XP_003609936.1| Pectinesterase [Medicago truncatula]
 gb|AES92133.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=595

 Score =   393 bits (1010),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 218/557 (39%), Positives = 321/557 (58%), Gaps = 32/557 (6%)
 Frame = +1

Query  433   DDASSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSAT--TKDFIFAAIKA  606
             +D+S+  G   V+  S K V   C  A+YK+ C   ++            KD +   +K 
Sbjct  63    EDSSTANGSKHVAH-SEKVVKLVCSSADYKEKCEGPLNKAVEKDPKLQHPKDLLKVYLKT  121

Query  607   TLEEVHK----SHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELH  774
               +EV+K    ++    NTK E++       A EDCKEM+Q A DDL  SI  + + ++ 
Sbjct  122   VEDEVNKAFNKTNSFKFNTKEEKA-------AFEDCKEMIQYAKDDLATSIDQLSEADMK  174

Query  775   TLKHRADQLLNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKL  954
              L  +   L +W+SAV  +Q TC +       K+ ++     + +  +N++ I++++S  
Sbjct  175   KLASKTPDLNSWLSAVITFQETCVDGFPDGKLKTDLQKLFQGSREFVSNSLAIVSQVSTF  234

Query  955   LKAFNITTTTDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLL-AAQRRGNLR  1131
             L +        +L           ++ +    + ++  P W    +R++L AA  R   +
Sbjct  235   LSSLQTMGAPRML----------LSDNSPVASMDSEGIPSWIQSEERRVLKAADIRP--K  282

Query  1132  PNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGA  1311
             PNVVVAKDGSG F+TI+ AL + PP    +YVIYVK GVYDE+V +  KMK++ +YGDG+
Sbjct  283   PNVVVAKDGSGNFRTISAALAAIPPNFLGRYVIYVKEGVYDEVVTITDKMKDITIYGDGS  342

Query  1312  GKTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSA  1491
              K+IITG KN+    +TT  TA+F  LG+GF+   + FRNTAGPEGHQAVA R Q+D + 
Sbjct  343   QKSIITGSKNFRD-GVTTINTASFVVLGEGFLGLAMGFRNTAGPEGHQAVAARVQADRAV  401

Query  1492  IFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTI  1671
               +C  EG+QDTLY   +RQF+R+C+I+GTIDFIFG    + QN I++ +KP V Q N +
Sbjct  402   FANCRFEGFQDTLYTVAHRQFFRSCIITGTIDFIFGDAAVIFQNCILVVKKPSVGQSNAV  461

Query  1672  TADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLS  1851
             TA G+   K    +VL  C I  + AL P++  VK+Y GRPWK +S TVVMES IGD +S
Sbjct  462   TAQGRLDNKQNTAIVLHKCTIKADDALVPVKATVKSYLGRPWKQFSRTVVMESDIGDFIS  521

Query  1852  PLGWKIWDGENFEKTCMYY-EYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDA  2028
             P GW  W+G NF  + +YY EY N+GPGA+T  R + +  F V+    A  +T G +L  
Sbjct  522   PEGWSPWNG-NFALSTLYYAEYANTGPGASTTARVK-WPTFKVINKAEASKWTVGTYL-T  578

Query  2029  NSWLPATGVPFAIGYTK  2079
              +W+  +GVP  +G  K
Sbjct  579   GTWVQNSGVPSQLGLYK  595



>ref|XP_008812392.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=602

 Score =   393 bits (1009),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 214/543 (39%), Positives = 308/543 (57%), Gaps = 30/543 (6%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQ  663
             +++   C  A+YK+ C   ++ V N  S   K  I A+I   ++EV ++      +++ +
Sbjct  74    RAIKLICGAADYKEACESRMAKVVNTTSP--KALIRASISVVVDEVTEAFN---QSELFK  128

Query  664   STDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTC  843
             S DP    A+EDCKE+ + + D+L  ++  +    L  +  ++ +L NW+SAV +YQ TC
Sbjct  129   SDDPMVQGAVEDCKELFRFSDDELATALGSIDALALDQIPKQSSELRNWLSAVMSYQQTC  188

Query  844   TEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnnnn  1023
              +       K  +E+ M +A +LT NA+ II E S  L +  I   +      A+     
Sbjct  189   IDGFPDGELKDKMEEAMKSAKELTTNALAIIEEASDFLSSVKIPAGSRRRRLLAEGQEAA  248

Query  1024  nnnTTSRRLLQTDHFPEWFPIADRK-LLAAQRRG--------NLRPNVVVAKDGSGQFKT  1176
                      L  D  P W    +R+ L   ++ G        NL+PNV VAKDGSG FKT
Sbjct  249   ---------LHKDGLPSWLSKEERRHLEEGEQDGQGGPRATRNLQPNVTVAKDGSGDFKT  299

Query  1177  ITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMK  1356
             I+ AL   P K + +Y IYVK GVY+E V V KKM NV +YGDG+ KTI++G KNY    
Sbjct  300   ISEALAQMPKKFEGRYFIYVKEGVYEETVVVDKKMINVTIYGDGSRKTIVSGSKNYVD-G  358

Query  1357  ITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYY  1536
               T +TATF+ALG GF+A  + FRNTAGPE HQAVA R Q+D +   +C +EGYQDTLY 
Sbjct  359   TRTYQTATFAALGDGFMAIAMGFRNTAGPEKHQAVALRVQADRAVFLNCRMEGYQDTLYA  418

Query  1537  HTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVV  1716
               +RQFYR+C+I+GT+DFIFG   A+ QN +++ R+PL +Q N +TA G+   +   G V
Sbjct  419   QCHRQFYRSCIIAGTVDFIFGDAAAIFQNCVLVVRRPLDNQQNIVTAQGRTSPRETTGFV  478

Query  1717  LQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKT  1896
             L +CR   ++ L P + K+ +Y GRPWK YS TV+MES I D +   G+  W+G+   K 
Sbjct  479   LHHCRFTADSKLVPDKDKIPSYLGRPWKEYSRTVIMESDIEDFIHKDGYMPWNGDFALKK  538

Query  1897  CMYYEYKNSGPGANTWRRNRAFKKFDVLGP-IRARHFTAGLWLDANSWLPATG----VPF  2061
               Y EY N GPGA+T  R + +  F V+     A  FT  +++    W+  TG    VP 
Sbjct  539   LFYAEYNNKGPGADTSARVQ-WPGFKVISSRTEAAGFTPEVFIQGRDWIKRTGGAAPVPV  597

Query  2062  AIG  2070
              +G
Sbjct  598   HLG  600



>ref|XP_003626056.1| Pectinesterase [Medicago truncatula]
 gb|AES82274.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=554

 Score =   390 bits (1003),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 222/541 (41%), Positives = 314/541 (58%), Gaps = 35/541 (6%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQ  663
             K V + C+  +   +C   +  V    ++   D+I   +K  +E V  +   + N     
Sbjct  37    KVVKSLCKDTDDHKLCHDVLYPV---KTSNPIDYIDVVVKNLMESVENAFNDMSNKLSSM  93

Query  664   STDPYNH----MAIEDCKEMLQDAIDDLQASISVVGDTE-LHTLKHRADQLLNWMSAVYA  828
               +  N+    MA+EDCK+MLQ AI++L+AS  ++ ++  + ++ +R+ +L N   AV A
Sbjct  94    ENNESNNLGIKMALEDCKDMLQFAINELKASKVIITESSSIRSIHNRSVELKNLFGAVIA  153

Query  829   YQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAAD  1008
             YQ +C +       KS     M++    T+N ++ + +++ L               A D
Sbjct  154   YQQSCLDGFSDT--KSDNNKAMLHLQ--TDNYLDNVGKLTGL---------------ALD  194

Query  1009  KnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVV--AKDGSGQFKTIT  1182
               +  +++T  + L+  + +P WF + DRKL+A    G    +V+V  AKDGSGQ+KTI 
Sbjct  195   VVSEISHSTNVKSLVDNEGYPTWFSVDDRKLMAMGPIGATDNDVLVTVAKDGSGQYKTIV  254

Query  1183  GALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKIT  1362
              A+ +YP  H+ +Y+IY K+GVYDE + V K   NVFM+GDG  KTIITG K++    I 
Sbjct  255   DAINAYPNNHQGRYIIYTKSGVYDEYIFVDKDKPNVFMFGDGPTKTIITGSKSFLQ-GIK  313

Query  1363  TSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHT  1542
             T +TATFS + +GFVARGI F NTAGP GHQAVA R Q D SA +DC   GYQDTLY H 
Sbjct  314   TMRTATFSTVAEGFVARGIAFENTAGPRGHQAVAVRVQGDRSAFYDCIFRGYQDTLYVHA  373

Query  1543  YRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQ  1722
             +RQ+YRNC ISGT+DFIFG  + LIQ+S II R P  HQ NTI ADG E      G+V+Q
Sbjct  374   HRQYYRNCEISGTVDFIFGYSSTLIQDSKIILRMPYPHQNNTIVADGTEQKNMPTGIVVQ  433

Query  1723  NCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGE--NFEKT  1896
             NC I+ E  L   + KVK+Y  RPWK YS  V +E+ IGD++ P G+  W GE  N E +
Sbjct  434   NCVILAEAELLRNKLKVKSYLARPWKEYSRAVFIENVIGDVIQPEGYIPWTGEYPNIENS  493

Query  1897  CMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIGYT  2076
              M  E+ NSG GA   RR    K   ++    A  FTA  ++ AN+WLP TG+PF  G+ 
Sbjct  494   YM-AEFGNSGEGAGVERRVDWAKG--LISKEEAFQFTAAQFIQANTWLPITGIPFYNGFI  550

Query  2077  K  2079
             +
Sbjct  551   R  551



>ref|XP_009386320.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=594

 Score =   392 bits (1006),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 213/537 (40%), Positives = 300/537 (56%), Gaps = 34/537 (6%)
 Frame = +1

Query  487   SVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQS  666
             ++   C   +Y+  C  S+    N  S+  KD + AA+ A ++EV  +     + K   S
Sbjct  79    AIQVMCSSTDYESACQSSLKKFVN-ESSKPKDLVRAAVSALVDEVGMAFNKSDSIK---S  134

Query  667   TDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTCT  846
              DP    A+  CKEM + A++DL   +S +    L  L  +  +L NW+SAV A Q TC 
Sbjct  135   DDPSVKDAVGICKEMHRYAVNDLAKVLSTIDAHHLDKLPEQVHELKNWLSAVAASQQTCI  194

Query  847   EQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnnnnn  1026
             E       K+ ++  M +A Q+T+NA+ I+ +MS  L          LLH +        
Sbjct  195   EGFPEGDLKTKMQTAMTSAKQITSNALAIVGKMSSFLS---------LLHVSG-------  238

Query  1027  nnTTSRRLLQT---------DHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTI  1179
                  RRLL+          D  P W   +DR++L ++    L PNV VAKDGSG F TI
Sbjct  239   ---FHRRLLEAEPVEPAYHEDGAPSWVSDSDRRILLSKATKQLTPNVTVAKDGSGDFTTI  295

Query  1180  TGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKI  1359
             + AL   P  +  +YVI+VK GVY+E V V   M NV MYGDG+ KT++ G KN+    +
Sbjct  296   SDALAKIPKNYDGRYVIHVKEGVYEETVLVDNYMVNVTMYGDGSRKTVVAGSKNFID-GV  354

Query  1360  TTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYH  1539
              T  TATF+A+  GFVA  + F+NTAG   HQAVA R QSD +   +C +EGYQDTLY H
Sbjct  355   KTFNTATFAAVADGFVAIAMGFQNTAGAAKHQAVALRVQSDRAIFLNCRMEGYQDTLYAH  414

Query  1540  TYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVL  1719
             ++RQFYR C+ISGTIDFIFG  +A+ QN I+  R+PL +Q N + A G+ + +   G ++
Sbjct  415   SHRQFYRGCLISGTIDFIFGDASAVFQNCIMTVRRPLDNQQNIVLAQGRNIPQEDTGFIV  474

Query  1720  QNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTC  1899
             Q CR V + AL P   K+ +Y  RPW+ YS TV+MES IG  + P G+  W G+    T 
Sbjct  475   QKCRFVADDALVPDVAKIPSYLARPWQEYSHTVIMESDIGSFIHPDGYTPWSGDFALATL  534

Query  1900  MYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
              Y EY N GPGA+T +R   +  F V+G   A+ +T   ++  + W+P TG P  +G
Sbjct  535   SYREYNNKGPGADTSKRVN-WPGFKVIGQNEAKAYTIAPFIQGDDWIPKTGTPVRLG  590



>gb|KDP27834.1| hypothetical protein JCGZ_18914 [Jatropha curcas]
Length=569

 Score =   391 bits (1004),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 215/548 (39%), Positives = 308/548 (56%), Gaps = 26/548 (5%)
 Frame = +1

Query  436   DASSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLE  615
             D   G       T S KSV + CQ  +Y+++C KS+   A N +   K  + A  + T++
Sbjct  41    DHQDGSNPSAEITTSSKSVQSICQPTDYREICEKSLRKAAGNTTDPHK-LVQAGFQVTID  99

Query  616   EVHKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRAD  795
              + ++ Q     K E + DP    A+++CKE++ DAI DL+ S   VG  ++  +    +
Sbjct  100   ALQQALQNSSTLK-EVAKDPMAKQALDNCKELMDDAIHDLKVSFEEVGHFDVSKMDEYLE  158

Query  796   QLLNWMSAVYAYQTTCTEQIESRLYKSA--IEDGMINATQLTNNAINIIAEMSKLLKAFN  969
              L  W+SA   YQ TC +  ++    +   +++ +  ++QL++N + +I  +S +LK  N
Sbjct  159   NLKIWLSATITYQQTCLDGFDNTTGPAGAKMKEILTLSSQLSSNGLAMITGLSSMLKDLN  218

Query  970   ITTTTDLLHKAADKnnnnnnnTTSRRLLQTD-HFPEWFPIADRKLLAAQRRGNLRPNVVV  1146
             +                     T RRLL+ +  FP W     R+LLA Q    ++P++VV
Sbjct  219   LA------------------GLTGRRLLKDNSEFPSWLSHEKRRLLA-QTPDTVKPDIVV  259

Query  1147  AKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTII  1326
             AKDGSGQ+KTI  A+   P      +VIY+K G+Y E V + + + ++ M GDGA KT I
Sbjct  260   AKDGSGQYKTINEAVHKIPKNQNTTFVIYIKKGIYKEQVTISRSVTHIMMIGDGATKTRI  319

Query  1327  TGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCS  1506
             TG  NYA   + T +T+T S  G  F+A+ I F NTAG  GHQAVA R QSDMS  ++C 
Sbjct  320   TGDLNYA-AGVQTLQTSTVSVSGNHFIAKDIGFENTAGAIGHQAVALRVQSDMSIFYNCQ  378

Query  1507  IEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGK  1686
             ++GYQDTL+ HT+RQFYR+C I+GTIDFIFG   A+ QN  I+ RKPL +Q   +TA G+
Sbjct  379   MDGYQDTLFAHTHRQFYRDCTITGTIDFIFGDAAAVFQNCKIVVRKPLENQNCVVTAQGR  438

Query  1687  ELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWK  1866
               ++   G VLQNC I  +    P+RF+ K Y GRPWK YS TV M+ QI DL+ P GW 
Sbjct  439   NESREATGFVLQNCNITADPEYYPVRFENKAYLGRPWKEYSRTVYMQCQIDDLIDPKGWL  498

Query  1867  IWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPA  2046
              W G     T  Y EY+N GPG+ T  R   +K    L    A  FT   ++  + W+PA
Sbjct  499   PWMGSFALDTLSYSEYENRGPGSVTKDR-VTWKGIKKLSAQDAAAFTVAKFIGGDLWIPA  557

Query  2047  TGVPFAIG  2070
             TGV +A G
Sbjct  558   TGVSYASG  565



>ref|XP_006488977.1| PREDICTED: LOW QUALITY PROTEIN: putative pectinesterase/pectinesterase 
inhibitor 28-like, partial [Citrus sinensis]
Length=508

 Score =   389 bits (998),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 220/547 (40%), Positives = 302/547 (55%), Gaps = 80/547 (15%)
 Frame = +1

Query  445   SGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVH  624
             S K +    + + K+V   C   +Y+  C + +   A + +AT K FI AAIKA +  V 
Sbjct  34    SNKNESNAVSANSKAVAAVCASTDYRQQCIERVKPAAKSKTATLKKFIQAAIKAIINMVE  93

Query  625   KSHQ---LVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRAD  795
              +      +++TK     DP   MA EDC E++  A++DLQAS SV              
Sbjct  94    GAKNNSGFILDTK-----DPAQKMAKEDCDELMNFAVEDLQASFSVA-------------  135

Query  796   QLLNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNIT  975
                            CT+ +     K+    G+ NATQLT+NA  I++ +S +L  F   
Sbjct  136   ---------------CTDGVTQPELKNQTIGGLQNATQLTSNASAIVSAISGILNTF---  177

Query  976   TTTDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKD  1155
                                          H P+      R+LL A +        VVA+D
Sbjct  178   -----------------------------HIPQNMAATSRRLLHAHK-------TVVAQD  201

Query  1156  GSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGK  1335
             GS Q+KTI  AL +YP     +Y+ YVKAG YDE + V +K  NVFMYGDG  KTI TG+
Sbjct  202   GSWQYKTIGSALAAYPKNPNGRYITYVKAGSYDEYITVTRKQVNVFMYGDGPRKTIFTGR  261

Query  1336  KNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEG  1515
             KN    +I+T KTA+F  +G GF+ + I F+NTAGPEGH AVA R QSDMSA ++C ++G
Sbjct  262   KNNRE-RISTYKTASFLVVGNGFITKAIGFQNTAGPEGHHAVALRVQSDMSAFYNCRMDG  320

Query  1516  YQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELA  1695
             Y D LY  T+ Q Y NCVISGT+DFIFG  + +IQNS+IIARKP+ +  NT+TA G E  
Sbjct  321   YXDILYVQTHCQLYXNCVISGTVDFIFGDSSTVIQNSLIIARKPMDNPKNTVTAHGLEDR  380

Query  1696  KAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWD  1875
             +   G+++QNCRIVPE  L P+RFK+ TY GRPW  YS T++ME+ +GD + P GW  W 
Sbjct  381   RETTGLIIQNCRIVPEELLYPVRFKIPTYLGRPWNLYSRTIIMETTMGDFIQPAGWLEWQ  440

Query  1876  GENFEKTCMYY-EYKNSGPGANTWRRNRAFKKFDVL-GPIRARHFTAGLWLDANSWLPAT  2049
             G NF    +Y+ E+ N GPGA T +R   +K FD++     A  + AG ++  N+WL  T
Sbjct  441   G-NFPPDTLYHAEHANMGPGAATDKRVN-WKGFDLMTNRNEAPLYAAGTFIQGNAWLKDT  498

Query  2050  GVPFAIG  2070
             G  + +G
Sbjct  499   GGTYFLG  505



>ref|XP_010046221.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=572

 Score =   390 bits (1003),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 212/552 (38%), Positives = 314/552 (57%), Gaps = 31/552 (6%)
 Frame = +1

Query  445   SGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVH  624
             S +G+    + SMK++   CQ A+YK+ C KS+   A  +    K+ I A     ++++ 
Sbjct  38    SKQGETKEVSASMKAIEAMCQPADYKESCVKSL-ETAGPNVTDPKELIKAGFNVAMKKIS  96

Query  625   KSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLL  804
             ++ +  V  K E + DP    A+++CKE+++ AIDDLQ+S   +G  ++  +      L 
Sbjct  97    EAAEKSVTLK-ELAKDPRTSQALQNCKELMEYAIDDLQSSFDKLGGLDMSKVDDFLADLK  155

Query  805   NWMSAVYAYQTTCTEQIESRLYKSAIE-DGMINAT-QLTNNAINIIAEMSKLLKAFNITT  978
              W+ A   YQ TC +  E+    +  +    +NAT +LT+N + ++ E+S +L   N+  
Sbjct  156   TWLGASITYQETCLDGFENTTSDAGEKMRKALNATAELTSNGLAMVTEISSVLANLNLN-  214

Query  979   TTDLLHKAADKnnnnnnnTTSRRLLQTDH--------FPEWFPIADRKLLAAQRRGNLRP  1134
                               + +RRLLQ           FP W     R+LL A+   NL+P
Sbjct  215   ----------------FLSGNRRLLQDSEVQVLGHGEFPMWMDPVRRRLLQAKVGVNLKP  258

Query  1135  NVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAG  1314
             ++VVAKDGSG++KTIT ALK  P +    +V+YVK GVY E +   KKM  + + GDG  
Sbjct  259   DLVVAKDGSGKYKTITEALKDIPLRSNKTFVLYVKEGVYREQIIFDKKMWRLTLIGDGPT  318

Query  1315  KTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAI  1494
             KT I    NY    + T KTAT + LG+ F+A+ I F N AG   HQAVA R QSD S  
Sbjct  319   KTRIVYNSNYVD-GVNTFKTATVAVLGEQFLAKDIGFENDAGAIKHQAVALRVQSDFSVF  377

Query  1495  FDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTIT  1674
             ++C ++GYQDTLY H +RQFYR+C ISGTIDFIFG  +A+ QN  ++ RKPL +Q   +T
Sbjct  378   YNCHMDGYQDTLYTHAHRQFYRDCTISGTIDFIFGDASAIFQNCKMLVRKPLDNQQCIVT  437

Query  1675  ADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSP  1854
             A G++  +    ++LQNC I  + +  P++ K +++ GRPWK YS T++M+S I D++ P
Sbjct  438   AQGRKERRQPSAIILQNCTITADASYVPVKAKFRSFLGRPWKEYSRTIIMQSFIDDIIQP  497

Query  1855  LGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANS  2034
              GW  W G+   KTC Y E+ N GPG++   R + +K    + P  A  FT G +L  N+
Sbjct  498   EGWLPWMGDFGIKTCFYSEFGNRGPGSSMTGRVK-WKGIKTITPAHAVDFTVGTFLRGNT  556

Query  2035  WLPATGVPFAIG  2070
             WLP  GVPF+ G
Sbjct  557   WLPKFGVPFSAG  568



>ref|XP_003578154.1| PREDICTED: pectinesterase-like [Brachypodium distachyon]
Length=614

 Score =   390 bits (1001),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 211/529 (40%), Positives = 303/529 (57%), Gaps = 24/529 (5%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQ  663
             K++T  C+  +++  C +S+S  AN  + + KD +  A++   E + ++        +  
Sbjct  99    KTITILCKQTDFQVTCQESLSKAANASTTSPKDVVRTAVQVIGEAISQAFD---RADLIM  155

Query  664   STDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTC  843
             S DP    A+ DCKE  + A D+L  ++S  G     +L  +  QL  W+SAV A+Q TC
Sbjct  156   SNDPRVKAAVADCKEFFEYAKDELNRTLS--GMDAKDSLTKQGYQLRVWLSAVIAHQETC  213

Query  844   TEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnnnn  1023
              +      +++ ++D  +   +LT+NA+ +I + S  L    I     LL +  +     
Sbjct  214   IDGFPDGEFRTKVKDSFVKGKELTSNALALIEQASTFLAGIKIPEKRRLLAEEGEP----  269

Query  1024  nnnTTSRRLLQTDHFPEWFPIADRKLL-AAQRRGNLRPNVVVAKDGSGQFKTITGALKSY  1200
                     +L  D  PEW P ++R++L     +  + PNVVVAKDGSG+FKTI  AL + 
Sbjct  270   --------VLGDDGIPEWVPDSERRVLKGGGFKNTMTPNVVVAKDGSGKFKTINEALAAM  321

Query  1201  PPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKTAT  1380
             P  +  +YVIYVK GVY+E V + ++M NV +YGDGA K+I+TGKKN+    +TT KTAT
Sbjct  322   PKTYAGRYVIYVKEGVYEEYVVITRQMANVTVYGDGAKKSIVTGKKNFVD-GLTTFKTAT  380

Query  1381  FSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYR  1560
             F+ALG GF+A G+ F+NTAGPE HQAVA   QSD S   +C ++ +QDTLY H+  QFYR
Sbjct  381   FAALGDGFMAIGMAFQNTAGPEKHQAVALLVQSDKSIFLNCRMDAFQDTLYAHSQTQFYR  440

Query  1561  NCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCRIVP  1740
             NC+I+GTIDFIFG   A+ QN II  R+P+ +Q N  TA G+   +   G VLQ C +  
Sbjct  441   NCIITGTIDFIFGDAAAMFQNCIITFRRPMDNQQNIATAQGRADGREATGFVLQKCELNA  500

Query  1741  ETALN-PLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYK  1917
             E  L  P R  ++ Y GRPW+ +S T++MES+I  L+   G+  W G+   KT  Y EY 
Sbjct  501   EPPLTAPGRPPIRNYLGRPWREFSRTIIMESEIPALIDKAGYMPWAGDFGLKTLFYAEYG  560

Query  1918  NSGPGANTWRRNR--AFKKFDVLGPIRARHFTAGLWLDANSWLPATGVP  2058
             N GPGA+T  R     +KK   L    A  FT   +L A  W+  TG P
Sbjct  561   NKGPGADTAGRVNWPGYKK--ALSKDEATKFTLENFLHAQPWIDPTGTP  607



>gb|EAZ41174.1| hypothetical protein OsJ_25671 [Oryza sativa Japonica Group]
Length=570

 Score =   388 bits (997),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 216/563 (38%), Positives = 308/563 (55%), Gaps = 49/563 (9%)
 Frame = +1

Query  436   DASSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLE  615
             +   GK D  +ST S+KSV  FCQ  +Y+  C + +   A N +++  D   A    T E
Sbjct  28    NGGGGKEDGELST-SVKSVKAFCQPTDYQQTCEEELGKAAGNGASSPTDLAKAMFAVTSE  86

Query  616   EVHKSHQLVVNTKIEQ-STDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRA  792
             ++ K+  +  ++ +E+   D     A+++CKE+L+ A+DDL+ S   +G  E+       
Sbjct  87    KISKA--ISESSTLEELKNDKRTSGALQNCKELLEYAVDDLKTSFEKLGGFEMTNFHKAV  144

Query  793   DQLLNWMSAVYAYQTTCTEQIESRLYKSA--IEDGMINATQLTNNAINIIAEMSKLLKAF  966
             D L  W+SA   YQ TC +   +    +A  ++  + ++ +LT + + ++ + S  L + 
Sbjct  145   DDLRTWLSAALTYQGTCLDGFLNTTTDAADKMKSALNSSQELTEDILAVVDQFSATLGSL  204

Query  967   NITTTTDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLL---AAQRRG--NLR  1131
             NI                       RRLL  D  P W     R+ L   A    G    +
Sbjct  205   NIG---------------------RRRLLADDGMPVWMSEGGRRQLLEAAGPEAGPVEFK  243

Query  1132  PNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGA  1311
             P+V VA DGSG  KTI  A+   PPK+K +Y IYVKAG Y+E V VG+   NV M GDG 
Sbjct  244   PDVTVAADGSGDVKTIGEAVAKVPPKNKERYTIYVKAGTYNEYVSVGRPATNVNMIGDGI  303

Query  1312  GKTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSA  1491
             GKTIITG KN+  M +TT  TAT  A+G GF  RGIT  NTAGPE HQAVA R+QSDM+ 
Sbjct  304   GKTIITGNKNF-KMNLTTKDTATMEAIGNGFFMRGITVENTAGPENHQAVALRAQSDMAV  362

Query  1492  IFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTA----LIQNSIIIARKPLVHQ  1659
              + C  +GYQDTLY H  RQF+R+C +SGTIDFIFG   A    ++QN ++  RKP+ +Q
Sbjct  363   FYQCEFDGYQDTLYPHAQRQFFRDCTVSGTIDFIFGNSQASKIVVLQNCLLQPRKPMDNQ  422

Query  1660  FNTITADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIG  1839
              N ITA G+   ++ GG V+ NC + P   L     KVKTY  RPWK YS T+ ++++IG
Sbjct  423   VNIITAQGRREKRSAGGTVIHNCTVAPHPDLEKFTDKVKTYLARPWKEYSRTIFVQNEIG  482

Query  1840  DLLSPLGWKIWDGENFEKTCMYY-EYKNSGPGANT-----WRRNRAFKKFDVLGPIRARH  2001
              ++ P+GW  W+G NF    +YY E  N GPGA+      W+  ++    DV      + 
Sbjct  483   AVVDPVGWLEWNG-NFALDTLYYAEVDNHGPGADMSKRAKWKGVQSLTYQDV-----QKE  536

Query  2002  FTAGLWLDANSWLPATGVPFAIG  2070
             FT   ++    ++P  GVP+  G
Sbjct  537   FTVEAFIQGQEFIPKFGVPYIPG  559



>gb|KDP27833.1| hypothetical protein JCGZ_18913 [Jatropha curcas]
Length=569

 Score =   388 bits (996),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 213/538 (40%), Positives = 306/538 (57%), Gaps = 27/538 (5%)
 Frame = +1

Query  466   VSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVV  645
             +ST S KSV   CQ  +Y+++C KS+S  A N +   K  + A  + T++ + ++ Q   
Sbjct  52    ISTSS-KSVQAICQPTDYREICGKSLSKAAGNTTDPLK-LVQAGFQVTIDALQQALQNSS  109

Query  646   NTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVY  825
               K + + DP    A+++CKE++ DAI DL+ S   V   +++ +      L  W+SA  
Sbjct  110   TLK-DVAKDPMAKQALDNCKELMDDAIHDLKVSFEEVEHFDVNKMDEYLANLKTWLSATI  168

Query  826   AYQTTCTEQIESRLYKSA--IEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHK  999
              YQ TC +  ++    +   +++ +  ++QL++N + +I  +S  LK  N+         
Sbjct  169   TYQQTCLDGFDNTTGPAGAKMKEILTLSSQLSSNGLALITGLSSTLKDLNLA--------  220

Query  1000  AADKnnnnnnnTTSRRLLQTD-HFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKT  1176
                         T RRLL+ +  FP W     R+LLA Q    ++P++VVAKDGSGQ+KT
Sbjct  221   ----------GFTGRRLLKDNSEFPSWLSHEKRRLLA-QTPDTIKPDIVVAKDGSGQYKT  269

Query  1177  ITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMK  1356
             I  A+   P K    +VIY+K G+Y + V + + + ++ M GDGA KT ITG  NYA   
Sbjct  270   INEAVHKIPKKQNTTFVIYIKKGIYKQQVTISRSLSHIMMIGDGATKTKITGDLNYA-AG  328

Query  1357  ITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYY  1536
             + T KT+T S  G  F+A+ I F NTAG  GHQAVA R QSDMS  ++C ++GYQDTLY 
Sbjct  329   VQTFKTSTVSVSGSHFIAKDIGFENTAGAIGHQAVALRVQSDMSIFYNCQMDGYQDTLYA  388

Query  1537  HTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVV  1716
             HT+RQFYR+C I+GTIDFIFG   A+ QN  I+ RKPL +Q   +TA G+  ++   G V
Sbjct  389   HTHRQFYRDCTITGTIDFIFGDAAAVFQNCKIVVRKPLENQNCIVTAQGRNESREATGFV  448

Query  1717  LQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKT  1896
             LQNC I  +    P+RF+ K Y GRPWK YS TV M+ QI DL+ P GW  W G     T
Sbjct  449   LQNCNITADREYYPVRFENKAYLGRPWKEYSRTVYMQCQIDDLIDPKGWLPWMGSFALDT  508

Query  1897  CMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
               Y EY+N GPG+ T  R   +K    L    A  FT   ++  + W+P TG+ +A G
Sbjct  509   LSYSEYENRGPGSVTKDR-VTWKGIKKLSAQDADAFTVAKFIGGDLWIPDTGISYASG  565



>ref|XP_004135775.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004157292.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN66044.1| Pectinesterase [Cucumis sativus]
Length=583

 Score =   388 bits (997),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 210/557 (38%), Positives = 322/557 (58%), Gaps = 35/557 (6%)
 Frame = +1

Query  436   DASSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLE  615
             D ++G   H +S+ SMK++   CQ  +YK  C  S+    NN S+  K+ + A  KA ++
Sbjct  44    DPATGNKSHEISS-SMKAIKAICQPTDYKQECVASLKATGNN-SSDPKELVQAGFKAAMK  101

Query  616   EVHKS-HQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRA  792
              +  + ++ V   ++E+  DP    A+  CKE++  AID+L+ S++ +G+ ++  L    
Sbjct  102   LIQAAANKSVALNQLEK--DPRASKALAGCKELMDFAIDELKYSMNKLGEFDISKLDEML  159

Query  793   DQLLNWMSAVYAYQTTCTEQIESRLYKSA--IEDGMINATQLTNNAINIIAEMSKLLKAF  966
               +  W+SA   YQ TC +   +    +A  ++  +  + +L++N + +++++S +L   
Sbjct  160   IDIRIWLSATITYQETCLDGFANTTGNAAEKMKKALKTSMKLSSNGLAMVSQISSMLSEL  219

Query  967   NITTTTDLLHKAADKnnnnnnnTTSRRLLQT-----DHFPEWFPIADRKLLAAQRRGNLR  1131
              I                     + RRLL+      D +P+W     R+LLAA  +  ++
Sbjct  220   QIP------------------GISRRRLLEIPVLGHDDYPDWANPGMRRLLAAGSK--VK  259

Query  1132  PNVVVAKDGSGQFKTITGALKSYPP-KHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDG  1308
             PNVVVAKDGSGQFKTI  A+   P  K+ A YVI++KAGVY E V V K + ++ + GDG
Sbjct  260   PNVVVAKDGSGQFKTIQEAIDQVPKRKNNATYVIHIKAGVYQEYVLVKKTLTHLMLIGDG  319

Query  1309  AGKTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMS  1488
               KTIITG KN+      T KTAT +   + F+AR I F NTAGP+ HQAVA R Q+D +
Sbjct  320   PKKTIITGNKNFID-GTPTFKTATVAVTAEHFMARDIGFENTAGPQKHQAVALRVQADKA  378

Query  1489  AIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNT  1668
               ++C + GYQDTLY HT RQFYR+C +SGTIDFIFG   A+ Q+   + RKPL +Q   
Sbjct  379   VFYNCEMHGYQDTLYVHTMRQFYRDCTVSGTIDFIFGDAAAIFQSCTFLVRKPLPNQQCI  438

Query  1669  ITADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLL  1848
             +TA G++  +    +++QNC   P   L P++ + +++ GRPWK YS T++MES IGDL+
Sbjct  439   VTAHGRKERRQPSALIIQNCSFKPHADLVPVQKQFRSFLGRPWKEYSRTIIMESYIGDLI  498

Query  1849  SPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDA  2028
              P GW  W G+   +TC Y EY N GPG++  +R + ++    + P  A  FT G +L  
Sbjct  499   QPEGWLPWAGDWGLRTCFYTEYNNYGPGSDKSKRVK-WRGIKNITPQHAVDFTPGRFLKG  557

Query  2029  NSWLPATGVPFAIGYTK  2079
             + W+  TGVP+  G T+
Sbjct  558   DRWIKPTGVPYVSGLTR  574



>ref|XP_007012506.1| Pectinesterase [Theobroma cacao]
 gb|EOY30125.1| Pectinesterase [Theobroma cacao]
Length=592

 Score =   388 bits (997),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 218/543 (40%), Positives = 311/543 (57%), Gaps = 40/543 (7%)
 Frame = +1

Query  478   SMKSVTTFCQYAEYKDVCAKSISHVANNH--SATTKDFIFAAIKATLEEVHKSHQLVVNT  651
             S K + T C    YK+ C  ++      H  +A  KD + ++I AT +E+ K+      T
Sbjct  75    SEKLINTICNGTSYKESCESTLKKAVKEHPNTAQPKDLLKSSISATADELDKAF-----T  129

Query  652   KIE--QSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVY  825
             K    Q   P    A   CKE++ +A ++L  +I  VGD +   L   + +L NW+SAV 
Sbjct  130   KASSFQFNSPGEKQAFNVCKEVMANAKEELATAIGKVGDKDTGKL-LSSGELNNWLSAVM  188

Query  826   AYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAA  1005
             +YQ TC +       K+ I+  + ++ +LT+N++ +  ++S      ++++  ++     
Sbjct  189   SYQETCIDSFADGKLKTDIKSTLNSSQELTSNSLAMARQLSS-----HVSSVMEM-----  238

Query  1006  DKnnnnnnnTTSRRLLQT-------DHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSG  1164
                        SR LL++       D  P W    +R+LL         PNV VAKDGSG
Sbjct  239   --------PAASRHLLESTSPSVDKDGLPNWLNHDERRLLKGADVEKPTPNVTVAKDGSG  290

Query  1165  QFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNY  1344
              F TI+ AL + P K+  +YVIYVKAG+Y+E V V KKM N+ +YGDG+ KTI+TG KNY
Sbjct  291   NFSTISEALAAMPQKYDGRYVIYVKAGIYEETVLVTKKMVNLTIYGDGSQKTIVTGNKNY  350

Query  1345  AHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQD  1524
                 + T  TATF A G GF+A+ + FRNTAGPE HQAVA R  +D +   +C  EGYQD
Sbjct  351   VD-GVPTYLTATFVASGDGFLAKAMGFRNTAGPEKHQAVAARVDADRAIFLNCRFEGYQD  409

Query  1525  TLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAK  1704
             TLY  T+RQFYR+CV++GTIDFIFG   A+ QN +I  RKP+ +Q N +TA G++     
Sbjct  410   TLYVQTHRQFYRSCVVAGTIDFIFGDAAAVFQNCLIYVRKPMDNQKNIVTAQGRKDKFET  469

Query  1705  GGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGEN  1884
              G+VLQNC+I+P+ +    + + K+Y GRPWK YS T+VMES I DL+ P GW  W+G N
Sbjct  470   TGIVLQNCKILPDDSFTSFKSQFKSYLGRPWKEYSRTIVMESLIEDLIDPAGWLEWEG-N  528

Query  1885  FEKTCMYY-EYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPF  2061
             F    +YY EY N+GPGA T  R + +    V+    A  FT   +L   +W+ ATG P 
Sbjct  529   FALNTLYYAEYNNNGPGAKTDARVK-WPGRKVINKDEAMKFTVETFLQG-TWIKATGAPV  586

Query  2062  AIG  2070
              +G
Sbjct  587   RMG  589



>ref|XP_008795810.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Phoenix dactylifera]
Length=572

 Score =   387 bits (995),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 211/541 (39%), Positives = 307/541 (57%), Gaps = 27/541 (5%)
 Frame = +1

Query  463   GVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLV  642
             G    S+K++   C+  +YKD C K++S +++N ++   + +  A  A+++ V  +    
Sbjct  43    GQPNTSIKAIKAVCEPTDYKDACEKTLSSMSHN-TSDPMELVNVAFNASMKYVTDAFDKS  101

Query  643   VNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAV  822
                K + S DP +  A+  C E+L+ A DDL+ SI  +G  + +  +   + L  W+SA 
Sbjct  102   ELLK-DVSKDPASAEALRTCSELLEYATDDLKKSIEQLGSVQTNRYEQAVEDLKVWLSAA  160

Query  823   YAYQTTCTEQIE--SRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLH  996
               YQ TC +  E  +     A+   + N+TQ+T+NA+ +I +   L+ +FNI++      
Sbjct  161   ITYQDTCVDGFEGINTSAAEAMHQAIKNSTQITSNALAMINQFDNLVGSFNISSHA----  216

Query  997   KAADKnnnnnnnTTSRRLL---QTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQ  1167
                            R+LL   + + FP W   A  + L       ++PNV VA+DG+G 
Sbjct  217   --------------GRKLLSGTRANEFPWWMSAAQERFLQPAP-AQIKPNVTVAQDGTGD  261

Query  1168  FKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYA  1347
             FKTI+ ALK  P ++   +VIYVKAGVY E V V K M +V M GDG  KT ITG  +  
Sbjct  262   FKTISEALKHVPKQNNDTFVIYVKAGVYKEGVLVDKHMTHVTMIGDGPTKTKITGDVHVI  321

Query  1348  HMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDT  1527
               KI+T KTAT +  G+ F   G+ F NTAGP+ HQAVA R  +D S  ++C ++GYQDT
Sbjct  322   QGKISTFKTATVAVAGEWFTGMGLGFENTAGPQNHQAVALRVNADRSVFYNCRMDGYQDT  381

Query  1528  LYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKG  1707
             LY H+ RQFYR+C I+GTIDFIFG    ++QN +II RKP+ +Q N +TA G+   +  G
Sbjct  382   LYAHSGRQFYRDCTITGTIDFIFGDSATMLQNCMIIVRKPMDNQQNIVTAHGRIDRQGNG  441

Query  1708  GVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENF  1887
              +V+QNC I  + A  P R K+ TY GRPWK YS T++++SQ+ DL+ P GW  W+G   
Sbjct  442   ALVIQNCTITSDPAYYPSRKKLPTYLGRPWKPYSRTLILQSQLDDLVHPDGWMPWNGNIG  501

Query  1888  EKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAI  2067
               TC Y E  N GPGAN  +R   +     L    A+ FT   +L   +W+P TGVPF  
Sbjct  502   LDTCFYAELDNRGPGANLTKR-VTWPGIKKLSYDEAQRFTVEHYLFGQTWIPRTGVPFIP  560

Query  2068  G  2070
             G
Sbjct  561   G  561



>gb|EAZ05229.1| hypothetical protein OsI_27427 [Oryza sativa Indica Group]
Length=570

 Score =   387 bits (994),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 216/563 (38%), Positives = 307/563 (55%), Gaps = 49/563 (9%)
 Frame = +1

Query  436   DASSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLE  615
             +   GK D  +ST S+KSV  FCQ  +Y+  C + +   A N +++  D   A    T E
Sbjct  28    NGGGGKEDGELST-SVKSVKAFCQPTDYQQTCEEELGKAAGNGASSPTDLAKAMFAVTSE  86

Query  616   EVHKSHQLVVNTKIEQ-STDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRA  792
             ++ K+  +  ++ +E+   D     A+++CKE+L+ A+DDL+ S   +G  E+       
Sbjct  87    KISKA--ISESSTLEELKNDKRTSGALQNCKELLEYAVDDLKTSFEKLGGFEMTNFHKAV  144

Query  793   DQLLNWMSAVYAYQTTCTEQIESRLYKSA--IEDGMINATQLTNNAINIIAEMSKLLKAF  966
             D L  W+SA   YQ TC +   +    +A  ++  + ++ +LT + + ++ + S  L + 
Sbjct  145   DDLRTWLSAALTYQGTCLDGFLNTTTDAADKMKSALNSSQELTEDILAVVDQFSATLGSL  204

Query  967   NITTTTDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLL---AAQRRG--NLR  1131
             NI                       RRLL  D  P W     R+ L   A    G    +
Sbjct  205   NIG---------------------RRRLLADDGMPVWMSEGGRRQLLEAAGPEAGPVEFK  243

Query  1132  PNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGA  1311
             P+V VA DGSG  KTI  A+   PPK+K +Y IYVKAG Y E V VG+   NV M GDG 
Sbjct  244   PDVTVAADGSGDVKTIGEAVAKVPPKNKERYTIYVKAGTYKEYVSVGRPATNVNMIGDGI  303

Query  1312  GKTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSA  1491
             GKTIITG KN+  M +TT  TAT  A+G GF  RGIT  NTAGPE HQAVA R+QSDM+ 
Sbjct  304   GKTIITGNKNF-KMNLTTKDTATMEAIGNGFFMRGITVENTAGPENHQAVALRAQSDMAV  362

Query  1492  IFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTA----LIQNSIIIARKPLVHQ  1659
              + C  +GYQDTLY H  RQF+R+C +SGTIDFIFG   A    ++QN ++  RKP+ +Q
Sbjct  363   FYQCEFDGYQDTLYPHAQRQFFRDCTVSGTIDFIFGNSQASKIVVLQNCLLQPRKPMDNQ  422

Query  1660  FNTITADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIG  1839
              N ITA G+   ++ GG V+ NC + P   L     KVKTY  RPWK YS T+ ++++IG
Sbjct  423   VNIITAQGRREKRSAGGTVIHNCTVAPHPDLEKFTDKVKTYLARPWKEYSRTIFVQNEIG  482

Query  1840  DLLSPLGWKIWDGENFEKTCMYY-EYKNSGPGANT-----WRRNRAFKKFDVLGPIRARH  2001
              ++ P+GW  W+G NF    +YY E  N GPGA+      W+  ++    DV      + 
Sbjct  483   AVVDPVGWLEWNG-NFALDTLYYAEVDNHGPGADMSKRAKWKGVQSLTYQDV-----QKE  536

Query  2002  FTAGLWLDANSWLPATGVPFAIG  2070
             FT   ++    ++P  GVP+  G
Sbjct  537   FTVEAFIQGQEFIPKFGVPYIPG  559



>ref|XP_002516960.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF45574.1| Pectinesterase precursor, putative [Ricinus communis]
Length=579

 Score =   387 bits (993),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 210/552 (38%), Positives = 308/552 (56%), Gaps = 27/552 (5%)
 Frame = +1

Query  436   DASSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLE  615
             ++S   G  G  + S KS+   CQ  +YK  C  S++  A N S   K  + A  +  ++
Sbjct  50    ESSPLSGSSGQLSTSTKSIQAICQPTDYKQTCEDSLNKAAGNTSDPHK-LVQAGFQVAID  108

Query  616   EVHKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRAD  795
              +  + +     K E + DP    A+++CKE++  AI DL+ S   VGD ++  L     
Sbjct  109   ALKVAIENSTTLK-EVAKDPMAKQALDNCKELMNTAISDLKTSFQQVGDFDISKLDEYVA  167

Query  796   QLLNWMSAVYAYQTTCTEQIESRLYKSA--IEDGMINATQLTNNAINIIAEMSKLLKAFN  969
              L  W+SA   YQ TC +  ++    +   +++ +  ++QLT+N + ++  +S +L+  +
Sbjct  168   NLKIWLSATITYQQTCLDGFDNTTGPAGQKMKEILSTSSQLTSNGLAMVTGLSSILQDLD  227

Query  970   ITTTTDLLHKAADKnnnnnnnTTSRRLLQ--TDHFPEWFPIADRKLLAAQRRGNLRPNVV  1143
             ++                    T R+LL    D+FP W   A R+LLA Q    ++PN+V
Sbjct  228   LS------------------GLTGRKLLAQGNDNFPSWLSPAKRRLLA-QTPATIKPNMV  268

Query  1144  VAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTI  1323
             VA+DGSGQ+KTI  A+K+ P    + +V+Y+K GVY E+V   + + ++ + GDG  KT 
Sbjct  269   VAQDGSGQYKTINEAIKNIPKSGNSTFVLYIKEGVYKEVVTFSRSLTHIMLIGDGPTKTK  328

Query  1324  ITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDC  1503
             ITG  ++A   +   KTAT S  G  F+A+ I F N+AG  GHQA+A + QSDMS  ++C
Sbjct  329   ITGDLSFAG-GVQIYKTATVSVSGSHFMAKDIGFENSAGATGHQAIALKVQSDMSVFYNC  387

Query  1504  SIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADG  1683
              I+GYQ+TL+ HTYRQFYR C I+GTIDFI G   A+ QN  ++ RKPL +Q  TITA G
Sbjct  388   QIDGYQNTLFSHTYRQFYRECTITGTIDFISGDAAAVFQNCKMVVRKPLENQRCTITAQG  447

Query  1684  KELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGW  1863
             +   +   G VLQNC I  E    P++    ++ GRPWK YS T+VM+S I D++ P GW
Sbjct  448   RNNTREPTGFVLQNCTITAEKDYLPVKLDSPSFLGRPWKPYSRTIVMQSSIDDIIDPKGW  507

Query  1864  KIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLP  2043
               W G     TC   EY N GPGA    R   +K    L P  A  FTAG +L+ +SW+ 
Sbjct  508   APWMGTFGIDTCSLSEYGNRGPGATLTSR-VTWKGIVKLSPQDAEAFTAGKFLEGDSWIA  566

Query  2044  ATGVPFAIGYTK  2079
             ATGVP+  G  K
Sbjct  567   ATGVPYTSGMMK  578



>ref|XP_003626046.1| Photosystem I P700 chlorophyll a apoprotein [Medicago truncatula]
Length=578

 Score =   387 bits (993),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 213/531 (40%), Positives = 299/531 (56%), Gaps = 58/531 (11%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQ  663
             +++   CQ A+ + +C +++S V    +A  K +I AA+KA  + V  +  +      E 
Sbjct  40    RNLRIMCQNAQDQKLCHETLSSVHGADAADPKAYIAAAVKAATDNVMNAFNMSERLTTEY  99

Query  664   STDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTC  843
               +    MA++DCK+++Q A+D L  S + + D  +  +  +   + NW+SAV +Y+  C
Sbjct  100   GKENGAKMALDDCKDLMQFALDSLDLSNNCLSDNNIQAVHDQTADMRNWLSAVISYRQAC  159

Query  844   TEQI------ESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAA  1005
              E        E ++ +      + +  ++T  A++I+  +S +L+ FN+      L    
Sbjct  160   MEGFDDANDGEKKIKEQFHVQSLDSVQKITAVALDIVTGLSDILQQFNLKFDIKPL----  215

Query  1006  DKnnnnnnnTTSRRLLQTD------HFPEWFPIADRKLLA-AQR---RGNLRPNVVVAKD  1155
                        SRRLL ++       +P W   +DRKLLA  QR   R N+RPN VVA D
Sbjct  216   -----------SRRLLNSEVTVDDQGYPSWISASDRKLLAKMQRKNWRANIRPNAVVAND  264

Query  1156  GSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGK  1335
             GSGQFKTI  AL SYP  +K +Y IYVKAGVYDE + V K   N+ MYGDG  +TI+TG+
Sbjct  265   GSGQFKTIQAALASYPKGNKGRYFIYVKAGVYDEYITVPKDAVNILMYGDGPARTIVTGR  324

Query  1336  KNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEG  1515
             KN+A     T +TATF+    GF+ + +TF NTAGP+GHQAVA+R+  DMSA+  C I G
Sbjct  325   KNFA-AGTKTMQTATFANTAIGFIGKAMTFENTAGPDGHQAVAFRNVGDMSALVGCHIVG  383

Query  1516  YQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELA  1695
             YQD+LY  + RQ+YRNC++SG                          QFNTITADG +  
Sbjct  384   YQDSLYVQSNRQYYRNCLVSG--------------------------QFNTITADGSDTM  417

Query  1696  KAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWD  1875
                 G+V+Q+C I+PE AL P RF +++Y GRPWK  + TVVMES IGD + P GW IW 
Sbjct  418   NLNTGIVIQDCNIIPEAALFPERFTIRSYLGRPWKYLAKTVVMESTIGDFIHPDGWTIWQ  477

Query  1876  GENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDA  2028
             GE    TC Y EY N+GPGAN  RR +      V+    A  FTAG+WL A
Sbjct  478   GEQNHNTCYYAEYANTGPGANVARRVKWKGYHGVISRAEANKFTAGIWLQA  528



>ref|XP_004508050.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like 
[Cicer arietinum]
Length=593

 Score =   386 bits (991),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 206/532 (39%), Positives = 312/532 (59%), Gaps = 23/532 (4%)
 Frame = +1

Query  478   SMKSVTTFCQYAEYKDVCAKSISHVANNHSATT--KDFIFAAIKATLEEVHKSHQLVVNT  651
             S K V   C  A+YK+ C   ++            KD +   +K   +EV+K+       
Sbjct  73    SEKIVKLVCSSADYKEKCEDPLNKAVEKDPKLQHPKDLLKVYVKIVEDEVNKAFNKTNTF  132

Query  652   KIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAY  831
             K E   +     A EDCK++ +DA +DLQASIS + + E   L  +   L +W+SAV ++
Sbjct  133   KFESEEE---KGAFEDCKQLFEDAKEDLQASISQLSEIEFKKLSSKTPDLNSWLSAVISF  189

Query  832   QTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADK  1011
             Q TC +       K+ +++  +++ +  +N++ I++++S  L          +L      
Sbjct  190   QQTCIDGFPEGKLKTDLQNLFVDSKEFVSNSLAIVSQVSTFLSTMQTFGRGRML------  243

Query  1012  nnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRP--NVVVAKDGSGQFKTITG  1185
                ++N+ +    L +D FP W    +R++L A    ++RP  NV VA+DG+G FKTI+ 
Sbjct  244   --LSDNSNSPVASLDSDGFPSWVHSEERRVLKA---SSIRPTPNVTVAQDGTGDFKTISE  298

Query  1186  ALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITT  1365
             AL + P  +  +YV+YVK GVYDE V + KKM+N+ MYGDG+ K+IITG KN+    + T
Sbjct  299   ALAAIPAIYPGRYVVYVKEGVYDETVTITKKMQNLTMYGDGSQKSIITGSKNFRD-GVRT  357

Query  1366  SKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTY  1545
               TA+F  LG+GF+   + FRNTAGP+GHQAVA R Q+D +   +C  EGYQDTLY  T+
Sbjct  358   FLTASFVVLGEGFLGLAMGFRNTAGPDGHQAVAARVQADRAVFANCRFEGYQDTLYTQTH  417

Query  1546  RQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQN  1725
             RQFYR+C++SGTIDFIFG    + QN I++ R+P+ +Q N +TA G+   +   G VL  
Sbjct  418   RQFYRSCIVSGTIDFIFGDAAVVFQNCIMVVRRPMDNQQNMVTAQGRMDKQQATGTVLHK  477

Query  1726  CRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMY  1905
             C+I  +  L P++  +K+Y GRPWK +S T+VMES+IGD + P GW  W G NF    +Y
Sbjct  478   CQIKADEKLVPVKDTIKSYLGRPWKEFSRTIVMESEIGDFIHPDGWTPWMG-NFALDTLY  536

Query  1906  Y-EYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVP  2058
             Y E+ N+GPGA+T  R + +  + V+    A  +T G +L   +W+  +GVP
Sbjct  537   YAEFNNTGPGASTSARVK-WPGYKVIDKEEASQYTVGAFLKG-AWVQTSGVP  586



>ref|XP_006841651.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
 gb|ERN03326.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
Length=591

 Score =   385 bits (989),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 212/539 (39%), Positives = 298/539 (55%), Gaps = 34/539 (6%)
 Frame = +1

Query  478   SMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHK-SHQLVVNTK  654
             SMK++ T CQ  +YK+ C  S++ VA +++   K+ +  + +  LE+V K + Q  +  +
Sbjct  65    SMKAIKTICQPTDYKEACVSSLTSVAGSNTTDPKELVKLSFEVALEKVKKVAGQSALLKE  124

Query  655   IEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQ  834
             +E+  DP    A+  C E++  AID+L+ SI  VG  +L  ++   + + +W+SA   YQ
Sbjct  125   VEK--DPGTRQALSICDEIMDYAIDELKNSIDQVGGFDLSNMEEIIENIRSWLSAAITYQ  182

Query  835   TTCTEQIESRLYKSA--IEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAAD  1008
              TC +  E+   K+   ++  M  AT+LT+N + I+ E+S +  +F I            
Sbjct  183   ETCVDAFENTTSKAGEQMKKVMKTATKLTSNTLAIVTELSDVFASFKIPNF---------  233

Query  1009  KnnnnnnnTTSRRLLQTDH--FPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTIT  1182
                       +RRLL T +  FPEW   + R+L          P+VVVA+DGSG   T+ 
Sbjct  234   ----------NRRLLSTSNEGFPEWVSQSKRRLFTEDTPAESIPDVVVAQDGSGNCTTVN  283

Query  1183  GALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKIT  1362
              AL   P      +VIYVK G+Y E V + K M NVFM GDG  K++IT   N+    + 
Sbjct  284   EALALVPAYGIKPFVIYVKEGIYKENVNIEKNMTNVFMIGDGPTKSVITAGLNFVD-GVK  342

Query  1363  TSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHT  1542
             T  TAT   +G GFVA+ + F N+AG E HQAVA R +SD S  ++C ++GYQDTLY HT
Sbjct  343   TFNTATVGVVGNGFVAKNMGFENSAGAEKHQAVALRVESDFSIFYNCQMDGYQDTLYAHT  402

Query  1543  YRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQ  1722
             +RQFYR C ISGTIDFIFG    + QN  I+ RKPL +Q NTITA G+   ++   ++L 
Sbjct  403   HRQFYRECTISGTIDFIFGNSAVVFQNCQIVVRKPLDNQQNTITAQGRTDRRSPTALILH  462

Query  1723  NCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCM  1902
             NC IV +    PLR  + TY GRPWK YS   +++S+I DL+ P GW  W G+    T  
Sbjct  463   NCSIVADPEYYPLRNTLPTYLGRPWKEYSRAFILQSEIDDLVQPAGWLPWAGDFALNTLF  522

Query  1903  YYEYKNSGPGANTWRRNRAFKKFDVLGPIRARH---FTAGLWLDANSWLPATGVPFAIG  2070
             Y EY N GPGA T  R     K+  L  I A H   FT   +L    W+    VPF  G
Sbjct  523   YSEYDNRGPGAATAER----VKWRGLKSITAEHAEKFTVARFLGGTEWIKNASVPFIPG  577



>emb|CBI37069.3| unnamed protein product [Vitis vinifera]
Length=401

 Score =   378 bits (970),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 191/358 (53%), Positives = 232/358 (65%), Gaps = 17/358 (5%)
 Frame = +1

Query  1039  SRRLLQT------DHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGALKSY  1200
             SRRLL        D +P WF   DRKLLA Q  G L PN +VAKDGSG F TI  AL +Y
Sbjct  50    SRRLLGEIEVLGHDGYPTWFSATDRKLLALQDNGRLTPNAIVAKDGSGHFTTIAAALAAY  109

Query  1201  PPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKTAT  1380
             P   K +YVIYVKAG+Y E + V K   NV+MYGDG  KTI+TG K Y    ITT KTAT
Sbjct  110   PKNLKGRYVIYVKAGIYREYITVTKDHVNVYMYGDGPRKTIVTGTKCYRD-GITTYKTAT  168

Query  1381  FSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYR  1560
             FSA+GKGFVAR + F NTAGP+GHQAVA R QSDMSA F+C ++GYQDTLY   +RQFYR
Sbjct  169   FSAIGKGFVARSMGFVNTAGPDGHQAVALRVQSDMSAFFNCRMDGYQDTLYVQAHRQFYR  228

Query  1561  NCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCRIVP  1740
             NCVISGTIDFIFG  T +IQNS+II R+P   Q NT+TA GK   +   G+V+ +CRIVP
Sbjct  229   NCVISGTIDFIFGDSTTVIQNSLIIVRRPNDKQQNTVTAQGKTEKRETTGLVIHDCRIVP  288

Query  1741  ETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYKN  1920
             E  L P RFK+ ++ GRPWK YS T++ME+ +GD + P GW  W G+    T +Y EY N
Sbjct  289   EQKLFPDRFKIPSFLGRPWKPYSKTIIMETTLGDFIQPAGWTPWAGKFVPNTLLYAEYGN  348

Query  1921  SGPGAN-----TWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIGYTK  2079
              GPGAN     TW+  R  K  +      A  +T   ++  N WL    +P+  G  +
Sbjct  349   LGPGANTHSRVTWKGYRIIKTRN-----EALQYTVNSFIQGNLWLKQINIPYLPGLKR  401



>ref|XP_009402043.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=559

 Score =   383 bits (984),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 216/538 (40%), Positives = 304/538 (57%), Gaps = 34/538 (6%)
 Frame = +1

Query  472   TGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKS--HQLVV  645
             + S K++  FC   +Y++ C  ++S  A N S   K+ +  A + T++++ ++  H  V+
Sbjct  40    SSSQKNIKDFCNPTDYQETCESTLSAAAGN-STDPKELVNLAFQITIDQIKEAFNHSTVL  98

Query  646   NTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVY  825
             +   E + +P    A+E+C+E+L  AIDDL++SI  +    L  L    D L  W+SA  
Sbjct  99    S---EAAKNPRTSDALENCRELLDYAIDDLRSSIDQLEGFSLIKLDKFLDDLKVWISASI  155

Query  826   AYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSK--LLKAFNITTTTDLLHK  999
              YQ TC +           E+   NA +    A+N  AEM+   L    N+  T D L+ 
Sbjct  156   TYQETCLD---------GFENTTTNAAESMRKALNSSAEMTSNILAIVINLDNTLDSLNL  206

Query  1000  AADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTI  1179
                          SR+LL  + +P W  +  R+LL       L+PNV VA+DG+G  KTI
Sbjct  207   G-----------ISRKLL-AEEYPSWVSLGKRRLLQLSP-AELKPNVTVAQDGTGDVKTI  253

Query  1180  TGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKI  1359
               AL   P K    +VIY+K GVY E V+V + + NV M GDG  KT ITG  NY     
Sbjct  254   NDALLRVPKKSNHTFVIYIKEGVYKEKVQVNRSLTNVIMVGDGTNKTKITGSLNYID-GT  312

Query  1360  TTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYH  1539
              T KTAT + +G GF+ + +   N+AG   HQAVA R QSD S  ++  I+GYQDTLY H
Sbjct  313   ATFKTATVAVIGDGFIGKDLWIENSAGAAKHQAVALRVQSDKSVFYNVRIDGYQDTLYVH  372

Query  1540  TYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVL  1719
             T RQFYR+C ISGTIDFIFG G A++QN +I+ARKP+ +Q N +TA G++  +    +VL
Sbjct  373   TKRQFYRDCNISGTIDFIFGDGAAVLQNCLILARKPMDNQQNIVTAQGRKDRRQATAIVL  432

Query  1720  QNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFE-KT  1896
              NC I  + A  P R K+ T+ GRPWK +S T V++SQ+ DL+ P GW  W  ENF   T
Sbjct  433   HNCTISADPAFFPFREKLPTFLGRPWKEFSRTFVLQSQLDDLIDPKGWLPW-FENFGLNT  491

Query  1897  CMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             C Y E  N GPGANT +R + +K    +G   A+ FT   ++  N+WLP +GVP+  G
Sbjct  492   CFYTELDNRGPGANTSQRVK-WKGVKTIGYAHAQKFTVEHFIQGNTWLPKSGVPYIPG  548



>ref|XP_002465396.1| hypothetical protein SORBIDRAFT_01g037900 [Sorghum bicolor]
 gb|EER92394.1| hypothetical protein SORBIDRAFT_01g037900 [Sorghum bicolor]
Length=568

 Score =   382 bits (982),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 220/556 (40%), Positives = 311/556 (56%), Gaps = 40/556 (7%)
 Frame = +1

Query  445   SGKGD---HGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLE  615
             SG GD    G  + S+KS+ +FCQ  +Y++ C K++   A N ++ T D   A  K T +
Sbjct  28    SGDGDSREEGEMSTSVKSIKSFCQPVDYRETCEKALRAAAGNATSPT-DLAKAIFKVTSD  86

Query  616   EVHKS--HQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHR  789
              + K+     V+N   E   DP    A+++C+E+L  AIDDL+ +   +G  E+   K  
Sbjct  87    RIEKAVRESAVLN---ELKNDPRTKGALDNCRELLDYAIDDLKTTFDRLGGFEMTNFKSA  143

Query  790   ADQLLNWMSAVYAYQTTCTEQIESRLYKSA--IEDGMINATQLTNNAINIIAEMSKLLKA  963
              D L  W+S+   YQ TC +  E+    +A  +   + ++ +LT N + ++ E S+ L  
Sbjct  144   VDDLRTWLSSALTYQETCLDGFENTTTAAAGKMRRALNSSQELTENILALVDEFSETLAN  203

Query  964   FNITTTTDLLHKAADKnnnnnnnTTSRRLLQTDH---FPEWFPIADRKL--LAAQRRGNL  1128
               I +     H               RRLL  DH    P W P A R+L  ++   +G  
Sbjct  204   LGIPS----FH---------------RRLL-ADHAGGVPSWMPDAKRRLRKVSPGDKG-F  242

Query  1129  RPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDG  1308
             +P+V VAKDGSG F+TI  AL   P K  A YV+YVKAG Y E V V + + N+ M GDG
Sbjct  243   KPDVTVAKDGSGDFRTINAALAKVPVKSAATYVMYVKAGTYREYVSVPRNVTNLVMVGDG  302

Query  1309  AGKTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMS  1488
             A KT+ITG K++  M ITT  TAT  ALG GF+ RGI   NTAG + HQAVA R QSDMS
Sbjct  303   ATKTVITGDKSFM-MNITTKDTATMEALGNGFLMRGIGVENTAGAKNHQAVALRVQSDMS  361

Query  1489  AIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNT  1668
             A ++C  +GYQDTLY HT RQ+YR CVI+GTIDFIFG    + QN +I  RK + +Q N 
Sbjct  362   AFYECRFDGYQDTLYTHTSRQYYRECVITGTIDFIFGNAQVVFQNCLIQVRKCMDNQQNI  421

Query  1669  ITADGKELAKAKGGVVLQNCRIV--PETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGD  1842
             +TA G++  ++ GG V+ NC I   PE   +    K++T+ GRPWK +S T+ ++S+IG 
Sbjct  422   VTAQGRKERRSAGGTVIHNCTIEPHPEFEKSAGDGKLRTFLGRPWKEHSRTLYIQSEIGG  481

Query  1843  LLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWL  2022
              + P GW  W G+    TC Y E +N G GA+T +R +     ++      + +T   ++
Sbjct  482   FIDPKGWLPWLGDFGLSTCYYAEVENRGAGADTSKRVKWRGVKNITYQHALQKYTVESFI  541

Query  2023  DANSWLPATGVPFAIG  2070
                 WLP  GVPF  G
Sbjct  542   QGQHWLPQLGVPFIPG  557



>emb|CDY72195.1| BnaCnng76410D [Brassica napus]
Length=577

 Score =   383 bits (983),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 219/530 (41%), Positives = 296/530 (56%), Gaps = 37/530 (7%)
 Frame = +1

Query  583   FIFAAIKATLEEVHKSHQLVVNT--KIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVV  756
              I A I AT + + KS      T  K+  S  P N   ++ CK +   A++DL   I  +
Sbjct  50    LIKAFILATQDAITKSSNFTGKTEGKLGSSISPNNKAVLDYCKRVFMYALEDLGTIIEEM  109

Query  757   GDTELHTLKHRADQLLNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINII  936
             G+ +L+ +  + DQL  W++ VY YQT C + IE    +  I +G+ N+  LT NAI+I 
Sbjct  110   GE-DLNQIGSKIDQLKQWLTGVYNYQTDCLDDIEEDDLRKTIGEGIANSKILTGNAIDIF  168

Query  937   AEMSKLLKAFNI------TTTTDLLHKA------ADKnnnnnnnTT-------SRRLLQT  1059
               +   +   NI        T D    +       DK    + +T        SRRLL+ 
Sbjct  169   HTVVSAMAKLNIKMDDFKNMTGDFFSSSEKGAPPVDKKATPSVDTPVADPDGPSRRLLED  228

Query  1060  DH---FPEWFPIADRKLLA--------AQRRGNLRPNVVVAKDGSGQFKTITGALKSYPP  1206
                   P W    DRKL+A         +    ++   VVAKDGSGQFKT+  A+ + P 
Sbjct  229   LDDLGIPRWVSGTDRKLMANAGRGEKGGEGGARIKATYVVAKDGSGQFKTVQQAVDACPQ  288

Query  1207  KHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMK-ITTSKTATF  1383
             K+  + +I++KAG+Y E V + KK  N+FM+GDGA KTII+  ++       TTS + T 
Sbjct  289   KNPGRCIIHIKAGIYKEQVVIPKKKNNIFMFGDGARKTIISFNRSVKLTPGTTTSLSGTV  348

Query  1384  SALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRN  1563
                 +GF+A+ I F+NTAGP GHQAVA R   D + +F+C  +GYQDTLY +  RQFYRN
Sbjct  349   QVESEGFMAKFIGFKNTAGPMGHQAVAIRVNGDRAVLFNCRFDGYQDTLYANNGRQFYRN  408

Query  1564  CVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELA-KAKGGVVLQNCRIVP  1740
              V+SGTIDFIFGKG  +IQNS+I+ RK   +QFNT+TADG E     K G+VLQNCRIV 
Sbjct  409   IVVSGTIDFIFGKGATVIQNSMIVVRKGNKNQFNTVTADGNEKGLSMKIGIVLQNCRIVA  468

Query  1741  ETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYKN  1920
             +  L   R  V +Y GRPWK YSTT V+ S+IGD++ P GWKIWDGE+F KTC Y E+ N
Sbjct  469   DKKLQAERLTVASYLGRPWKKYSTTAVINSEIGDVIKPEGWKIWDGESFHKTCKYVEFNN  528

Query  1921  SGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
              GPGANT +R    K       +    F+   WL    W+    VP  +G
Sbjct  529   RGPGANTNKRVDWVKIAKSASEV--NQFSVANWLAPVEWIQEANVPVNLG  576



>ref|XP_010687597.1| PREDICTED: pectinesterase [Beta vulgaris subsp. vulgaris]
Length=602

 Score =   383 bits (984),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 220/548 (40%), Positives = 311/548 (57%), Gaps = 37/548 (7%)
 Frame = +1

Query  439   ASSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVA----NNHSATTKDFIFAAIKA  606
             ASS       +  S K +   C   +YK  CA ++  V     +N S   +  + AAI A
Sbjct  63    ASSSPPQGEQTKTSSKIIELLCDPTDYKKKCADTLVKVVHTDTSNPSIAPRLIVKAAISA  122

Query  607   TLEEVHKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKH  786
               +EV K+       K ++S D     A E CK++ QD++D+L  S++  G  E      
Sbjct  123   AADEVVKAINKTEKFKFDKSHD---KAAYEVCKKVFQDSVDELAESLNHAGQ-EAKNYHD  178

Query  787   RADQLLNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAF  966
             +   L  W+SAVY+YQ TC +  +    K  I+D +  + +  +N++ ++A++S +L+ F
Sbjct  179   KISDLKTWLSAVYSYQETCIDAFDDGDMKKKIKDAVNASKEYVSNSLALVAQISTILEKF  238

Query  967   NITTTTDLLHKAADKnnnnnnnTTSRRLLQ--------TDHFPEWFPIADRKLLAAQRRG  1122
                        AA+++        +R LL+           FPEW    +RKL A +   
Sbjct  239   ----------AAAEESIK----PPARHLLEHGSSPPVDNQGFPEWVGHEERKL-AVKATT  283

Query  1123  NLRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYG  1302
             NL  N+ VAKDGSG F TI   LKS P     +  IY+K G Y+E V V KKMKN+ M+G
Sbjct  284   NLVANITVAKDGSGNFTTINDCLKSLPENRTERIYIYIKGGFYEEYVTVTKKMKNITMFG  343

Query  1303  DGAGKTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSD  1482
             +G+ K++ITG KN+    + T +TATF+ +G GFV   + F NTAGPE HQAVA R Q+D
Sbjct  344   EGSQKSVITGNKNFVD-GVRTYETATFAVMGDGFVGIALGFNNTAGPEKHQAVALRVQAD  402

Query  1483  MSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQF  1662
              S   +C +E YQDTLY  T+RQFYR+C ISGTIDFIFG  +A+ QN +II RKP+ +Q 
Sbjct  403   RSIFLNCRMEAYQDTLYAQTHRQFYRSCYISGTIDFIFGDASAIFQNCMIIVRKPMENQQ  462

Query  1663  NTITADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGD  1842
             N +TA G+       G++L NCRI P+  L P++ K KTY GRPWK YS T+VMES IG+
Sbjct  463   NIVTAQGRADKHENTGIILHNCRIYPDKDLFPVKHKYKTYLGRPWKQYSRTIVMESTIGE  522

Query  1843  LLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNR--AFKKFDVLGPIRARHFTAGL  2016
             L++P GW  W GE   KT  Y EY N GPG++T +R +   +KK   +    A++FT   
Sbjct  523   LIAPEGWMPWQGEFALKTLYYAEYNNHGPGSDTSKRVKWGGYKK--SISKQEAQNFTVTP  580

Query  2017  WLDANSWL  2040
             +L   SW+
Sbjct  581   FLQG-SWI  587



>ref|XP_010039612.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=579

 Score =   382 bits (980),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 213/543 (39%), Positives = 308/543 (57%), Gaps = 38/543 (7%)
 Frame = +1

Query  469   STGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVN  648
             ++ SMKS+ + C+  +Y++ C KS+S    N S   KD I    +  + +V  + +    
Sbjct  58    ASTSMKSIQSICEPTDYRETCVKSLSAAGGN-STDPKDLIRTGFQVAINQVKAAIENSTV  116

Query  649   TKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYA  828
              K + + DP +  A+E C+ +L+ +IDDLQ+S   +G  ++  L      L  W+S    
Sbjct  117   VK-DLAKDPRSKQALETCQHLLEYSIDDLQSSFERLGAFDVSNLDKYMADLHVWLSGAIT  175

Query  829   YQTTCTEQIESRLYKSA--IEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKA  1002
             +Q +C +  E+    +A  ++  +  + +LT+N + ++ E+S LL + NI          
Sbjct  176   FQESCLDGFENTTGAAAKKMKQILQGSRELTSNGLAMVTEISSLLGSLNIPDV-------  228

Query  1003  ADKnnnnnnnTTSRRLLQTDH-----FPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQ  1167
                         SRRLL  +      FP W     RKLLAA  + +++P+VVVA+DGSG+
Sbjct  229   ------------SRRLLTEEQDGIPEFPSWVDEGRRKLLAAAPK-DIKPDVVVAQDGSGK  275

Query  1168  FKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYA  1347
             +KTI  AL   P K+   +VIY+K GVY E V V KK  NV + GDG  KT+ITG  NY 
Sbjct  276   YKTIREALNEVPKKNNKTFVIYIKEGVYKEKVLVDKKTTNVMIIGDGPTKTVITGSLNYV  335

Query  1348  HMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDT  1527
                + T  TATF+A+G  F+A+ I F N+AG E HQAVA R QSDMS I++C ++ +QDT
Sbjct  336   D-GVQTCNTATFTAIGSYFIAKDIKFENSAGAEKHQAVALRVQSDMSVIYNCHMDAFQDT  394

Query  1528  LYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKG  1707
             LY H +RQFYR+C ISGTIDFIFG   A+ QN  +  +KPL +Q   +TA G+   ++  
Sbjct  395   LYAHAHRQFYRDCTISGTIDFIFGDALAVFQNCQMFVKKPLENQQCIVTASGRSERRSAS  454

Query  1708  GVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENF  1887
              +VLQNC I  + A  PLR   K Y GRPWK YS T++M+SQI DL+ P GW  W G   
Sbjct  455   AIVLQNCTISADPAYYPLRNINKAYLGRPWKDYSRTIIMQSQIDDLIQPQGWLAWMGNFA  514

Query  1888  EKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARH---FTAGLWLDA-NSWLPATGV  2055
               TC Y EY N G G+ T  R     K+  +  + A+H   FT   +    ++W+ ATGV
Sbjct  515   LNTCFYAEYGNRGAGSATTGR----AKWRGIKSMTAQHIVDFTPKAFFKGDDAWITATGV  570

Query  2056  PFA  2064
             P++
Sbjct  571   PYS  573



>ref|XP_006649944.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Oryza brachyantha]
Length=565

 Score =   380 bits (977),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 214/546 (39%), Positives = 294/546 (54%), Gaps = 31/546 (6%)
 Frame = +1

Query  451   KGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKS  630
             KGD  +ST S+KS+ +FCQ  +Y++ C  ++   A N S  T D   A  KAT E++ ++
Sbjct  34    KGDGELST-SVKSIKSFCQPVDYRETCESTLEASAGNASNPT-DLAKAIFKATSEKIEQA  91

Query  631   --HQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLL  804
                  V+N   +   D     A++DCKE+L  AIDDL+ +   +G  E+   KH  D L 
Sbjct  92    VRESTVLN---DLKNDQRTSGALKDCKELLDYAIDDLKTTFDKLGGFEMSNFKHAVDDLK  148

Query  805   NWMSAVYAYQTTCTEQIESRLYKSAIE---DGMINATQLTNNAINIIAEMSKLLKAFNIT  975
              W+S+   YQ TC +  E+     A E   + + ++ +LT N + ++ +    L   ++ 
Sbjct  149   TWLSSALTYQETCLDGFENATSTDASEKMKNALKSSQELTENILALVDQFGDTLANLDLP  208

Query  976   TTTDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRG-NLRPNVVVAK  1152
             +                    SRRLL  D  P W   A R+LL A       +P+V VA 
Sbjct  209   SF-------------------SRRLLGDDGLPGWISDAKRRLLQASPGAPEFKPDVTVAA  249

Query  1153  DGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITG  1332
             DGSG FKTI  AL   P K  A YV+YVKAG Y E V V + + N+ M GDGA KTIITG
Sbjct  250   DGSGDFKTINEALAKVPIKATATYVMYVKAGTYKEYVSVARNVTNLVMIGDGATKTIITG  309

Query  1333  KKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIE  1512
              K++  + ITT  TAT  A+G GF  RGI   NTAG + HQAVA R QSD S  + C  +
Sbjct  310   NKSF-MLNITTKDTATMEAIGNGFFMRGIGVENTAGAKNHQAVALRVQSDQSVFYQCQFD  368

Query  1513  GYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKEL  1692
             GYQDTLY HT RQ+YR C I+GTIDFIFG    + QN +I AR+ + +Q N +TA G++ 
Sbjct  369   GYQDTLYTHTSRQYYRECTITGTIDFIFGNAQVVFQNCLIQARRCMDNQQNIVTAQGRKE  428

Query  1693  AKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIW  1872
               + GG V+ NC I P         K +T+ GRPWK YS T+ ++S IG  + P GW  W
Sbjct  429   KHSAGGTVIHNCTIEPHADFKADAAKFRTFLGRPWKEYSRTLYIQSDIGGFIDPQGWLPW  488

Query  1873  DGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATG  2052
              G+    TC Y E +N G GA+  +R +      V      + +T   ++    W+P  G
Sbjct  489   LGDFGLNTCYYAEVENRGAGADMSKRAKWRGVKTVTYQQAQQKYTVERFIQGQQWIPKYG  548

Query  2053  VPFAIG  2070
             VPF  G
Sbjct  549   VPFIPG  554



>ref|XP_007227113.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
 gb|EMJ28312.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
Length=575

 Score =   380 bits (976),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 225/596 (38%), Positives = 334/596 (56%), Gaps = 45/596 (8%)
 Frame = +1

Query  343   MAGNN-----IAITLVSLIlvvgvvcgavlvlqgvDDASSGKGDHGVSTGSMKSVTTFCQ  507
             M G+N     IAI  VS + +V +V    + +         K + G +T S K++   CQ
Sbjct  1     MTGDNNKKKKIAIIAVSSLFLVAMVIAVTVGVTTSRSKGGSKSNDGQTTTSTKAIQAICQ  60

Query  508   YAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKI--EQSTDPYN  681
               +YK+ C KS+     N S   K+ I A  K  ++++H   +++ N+    E + DP  
Sbjct  61    PTDYKETCQKSLESAGVN-STEPKELIKAGFKVAMDKLH---EVIKNSTTLQELAKDPGA  116

Query  682   HMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTCTEQIES  861
             + A+E+CKE+L  AI DL AS   +G  ++  +   A+ L  W+SA   Y+ TC +  ++
Sbjct  117   NQALENCKELLDYAIGDLAASFDKLGPFDISKIDAYAEDLKIWLSAAMTYEQTCLDGFQN  176

Query  862   RLYKSAIE-DGMINATQ-LTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnnnnnnnT  1035
                 +  +   ++N+TQ LT+N + +++E++ +L +FN+                     
Sbjct  177   TTGDAGEKMKRLLNSTQELTSNGLAMVSEITSVLGSFNV-------------------KQ  217

Query  1036  TSRRLLQT-------DHFPEWFPI-ADRKLLAAQRR--GNLRPNVVVAKDGSGQFKTITG  1185
             + RRLL          + P+  P+  D++ +   R    +L+P+V VAKDGSGQ K+I  
Sbjct  218   SQRRLLAAGAGGDTKKNTPKIIPVWIDKRAMDVSRATPQSLKPDVTVAKDGSGQVKSIGE  277

Query  1186  ALKSYPPKHKAK-YVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKIT  1362
             A+K  P  +  K +VIYVK GVY+E V + K M NV M GDG  KT ITG KNYA     
Sbjct  278   AVKQIPKNNADKTFVIYVKEGVYNEHVMIDKFMTNVMMIGDGPTKTKITGNKNYAD-GTK  336

Query  1363  TSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHT  1542
             T +TAT + +G  FVA+ I F N+AG +GHQAVA R QSD+S  ++C ++GYQDTLY  T
Sbjct  337   TFQTATVAVVGDYFVAKDIGFENSAGAKGHQAVALRVQSDLSIFYNCQMDGYQDTLYTQT  396

Query  1543  YRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQ  1722
             +RQFYR+C ISGTIDFIFG    + QN  +I RKP+ +Q   +TA G+   +    +VLQ
Sbjct  397   HRQFYRDCTISGTIDFIFGDAAVVFQNCKMIVRKPMDNQACMVTAQGRMDRRQPTAMVLQ  456

Query  1723  NCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCM  1902
             NC I  +    P++ K K Y GRPWKA + T+VM+SQI D+++P GW  W G    K+C 
Sbjct  457   NCTISGDPEYIPVKDKSKAYLGRPWKALARTIVMQSQIDDIITPEGWMEWTGSTNHKSCW  516

Query  1903  YYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             + EY N GPG++  RR   +     L P  A  FTAG  ++ + W+  +GVP+  G
Sbjct  517   FGEYGNRGPGSDMTRR-VTWSGIKKLTPEHAVDFTAGRLMEGDRWIKPSGVPYVAG  571



>dbj|BAK06954.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=563

 Score =   379 bits (974),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 215/548 (39%), Positives = 302/548 (55%), Gaps = 29/548 (5%)
 Frame = +1

Query  442   SSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTK--DFIFAAIKATLE  615
             +S + D    T S+KS+ +FCQ  +YK  C K++   A N + TT+    IF A    +E
Sbjct  29    ASNEKDSNELTTSLKSIKSFCQPVDYKVACEKTLEETAGNATTTTELAKAIFKATSERIE  88

Query  616   EVHKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRAD  795
             +  +   L+ + K     DP    A+++CKE+L  AIDDL+ +   +G  E+   KH  D
Sbjct  89    KAVRESSLLNDLK----HDPRTSGALKNCKELLHYAIDDLKTTFDQLGGFEMTNFKHAMD  144

Query  796   QLLNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNIT  975
              L  W+S+   YQ +C +           ++   NA      A+N+  E+++     NI 
Sbjct  145   DLKTWLSSALTYQESCLD---------GFDNTTTNAAAKMRKALNVSQELTE-----NIL  190

Query  976   TTTDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLL-AAQRRGNLRPNVVVAK  1152
             +  D   +  D   N + +  SRRLL  D  P W   A R+LL  +    + +P+V VA 
Sbjct  191   SIVD---EFGDTIANLDLSIFSRRLLGHDGAPRWMSDAKRRLLEVSPSEPDFKPDVTVAA  247

Query  1153  DGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITG  1332
             DGSG F TI  AL   P K +  YV+YVK G Y E V V + + N+ M GDGA KT+ITG
Sbjct  248   DGSGDFTTINEALAKVPLKREDTYVMYVKEGTYKEYVSVPRNVSNLVMIGDGADKTVITG  307

Query  1333  KKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIE  1512
             +K++  M ITT  TAT  A+G GF  RGIT  NTAG + HQAVA R QSD S  ++C   
Sbjct  308   EKSFM-MNITTKDTATMEAIGNGFFMRGITVENTAGAKNHQAVALRVQSDQSVFYECQFH  366

Query  1513  GYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKEL  1692
             GYQDTLY HT RQ+YR+C +SGTIDFIFG    + QN +I  RK + +Q N ITA G++ 
Sbjct  367   GYQDTLYTHTSRQYYRDCTVSGTIDFIFGNAQVVFQNCLIQVRKCMENQQNIITAQGRKE  426

Query  1693  AKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIW  1872
               + GG+V+ NC I P         +++T+ GRPWK +S T+ ++S+IGD + P GW  W
Sbjct  427   RHSAGGIVIHNCTIEPHPEFKDHMGRLRTFLGRPWKEHSRTLYIQSEIGDFVDPEGWLPW  486

Query  1873  DGENFEKTCMYYEYKNSGPGANTWRRNRA-FKKFDVLGPIRARH-FTAGLWLDANSWLPA  2046
              GE    TC Y E +N GPGA+    NRA +K    +   +A   +T   ++    W+  
Sbjct  487   LGEFGLNTCYYAEVENRGPGADM--SNRATWKGVKHITYQQAEEKYTVERFIQGQLWISK  544

Query  2047  TGVPFAIG  2070
              GVPF  G
Sbjct  545   YGVPFIPG  552



>ref|XP_010937248.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=570

 Score =   379 bits (974),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 207/533 (39%), Positives = 295/533 (55%), Gaps = 32/533 (6%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQ  663
             K+V   C   +YK  C  S++  +N  ++  K+ + AA+ A ++E  +S      + + +
Sbjct  54    KAVKMLCAGTDYKQTCETSLTKFSNTTTSDPKELLKAAVVALIDEASRSFS---QSSVFK  110

Query  664   STDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTC  843
             S D     AI DC EM  D+ +DL  +++ + DT L  L  +   L NW+SAV+ YQ TC
Sbjct  111   SNDSRVQDAINDCWEMYYDSKEDLVKTLNRIIDTGLEHLPDQTLNLKNWLSAVHFYQETC  170

Query  844   TEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnnnn  1023
              +       K+ +   M    +LT+NA+ +I ++S LL    + +               
Sbjct  171   VDGFPEGELKNKMRSAMKATKELTSNALAMIGQVSDLLTMLGVPSW--------------  216

Query  1024  nnnTTSRRLLQTDH-------FPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTIT  1182
                  SRRLL  +H       +P W    DR+LL       L+PNV VAKDGSG F TI 
Sbjct  217   -----SRRLLSVEHRPVMKRGYPSWVSEGDRRLLKEHLNFKLKPNVTVAKDGSGDFGTIN  271

Query  1183  GALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKIT  1362
              A+++ P K+  +YVIYVK G+Y E V +  K  N+ MYGDG  KTI+TG KN+      
Sbjct  272   EAIRNMPLKYSGRYVIYVKEGIYKEAVNLTSKYVNITMYGDGPKKTIVTGSKNFKD-GTK  330

Query  1363  TSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHT  1542
             TS TATF A G+GF+A  + F NTAGPE  QAVA R QSD S   +C + GYQDTLY  +
Sbjct  331   TSHTATFVASGEGFMAIDMGFHNTAGPEKEQAVALRVQSDRSIFINCRMAGYQDTLYAQS  390

Query  1543  YRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQ  1722
             + QFYR CVI+GTIDF+FG  +A+ QN + + R+PL  Q N +TA G+  +    G V+Q
Sbjct  391   HFQFYRGCVITGTIDFVFGDASAVFQNCLFLLRRPLAKQRNIVTAHGRSYSHESTGFVIQ  450

Query  1723  NCRIVPETALNPLRF-KVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTC  1899
             +C+I  + +L      KV+ Y  RPWKAYS T+ ME+QI   + P G+  WDG+   KT 
Sbjct  451   HCKIKADRSLKKAEEQKVENYLARPWKAYSRTIFMENQISSYIHPAGYLPWDGDFALKTL  510

Query  1900  MYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVP  2058
              Y EY N+G G+N   R + +  F V+    A  FT   +++   W+P+ G P
Sbjct  511   YYAEYNNNGEGSNVKARVK-WPGFHVIDRKTAEKFTVANFIEGKRWIPSRGAP  562



>ref|XP_010659656.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=589

 Score =   380 bits (976),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 205/556 (37%), Positives = 304/556 (55%), Gaps = 40/556 (7%)
 Frame = +1

Query  445   SGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVH  624
             SG       + SMK++   CQ  +YKD C  S++  A N +   KD + AA  + +E + 
Sbjct  44    SGNAQKQEISSSMKAIQAICQPTDYKDACVNSLTSKAGN-TTDPKDLVQAAFASAMEHLS  102

Query  625   KSHQLVVNTKI--EQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQ  798
              + +   N+ +  E + DP    A+++C++++  AIDDL+ S + VGD +   + +    
Sbjct  103   AAAK---NSTLLQELNKDPRASQALQNCEDLVNYAIDDLKKSFNQVGDFDYSKMDNIIAD  159

Query  799   LLNWMSAVYAYQTTCTEQIESRLYKSA--IEDGMINATQLTNNAINIIAEMSKLLKAFNI  972
             +  W+SAV  YQ TC +  E+    +   +   +  + +L++N + I+ E+S +L    +
Sbjct  160   IKIWLSAVITYQETCLDGFENTTGDAGEKMRQILKTSMELSSNGLAIVGEVSSILSNLQL  219

Query  973   TTTTDLLHKAADKnnnnnnnTTSRRLLQTD----------HFPEWFPIADRKLLAAQRRG  1122
                                   +RRLL  D           FP W     RKLL A    
Sbjct  220   ANL-------------------NRRLLSDDPADPDNHIDDEFPYWSHSEGRKLLQANV-S  259

Query  1123  NLRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYG  1302
              L+PN+ VAKDGSG FKTI  A++  P      +++Y+K G+Y+E V++ K   N+ M G
Sbjct  260   ELKPNLTVAKDGSGDFKTINEAIRQLPKFSNQTFILYIKKGIYEEQVQINKTFTNLMMVG  319

Query  1303  DGAGKTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSD  1482
             DG  KT ITG  N+      T KTAT + LG GF+A+GI F N+AG   HQAVA R QSD
Sbjct  320   DGPTKTKITGSLNFVD-GTPTFKTATVAVLGDGFIAKGIGFENSAGAAKHQAVALRVQSD  378

Query  1483  MSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQF  1662
              S  ++C ++GYQDTLY HT RQFYR+C ISGTIDFIFG    + QN   + RKPL +Q 
Sbjct  379   RSIFYNCQMDGYQDTLYTHTKRQFYRDCTISGTIDFIFGDAAVIFQNCTFVVRKPLDNQQ  438

Query  1663  NTITADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGD  1842
               +TA G++  +    +++QN     +    P R ++K+Y GRPWK +S T++MES I D
Sbjct  439   CIVTAQGRKERRQPSAIIIQNSTFTADPEYYPYRNELKSYLGRPWKEFSRTIIMESYIED  498

Query  1843  LLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWL  2022
             L+ P GW  W G+   +TC Y E++N GPGA T  R + ++    + P  A  F  G +L
Sbjct  499   LIQPSGWLPWAGDFALRTCFYTEFRNRGPGAKTHDRVK-WRGIKTIKPSHAIDFAPGRFL  557

Query  2023  DANSWLPATGVPFAIG  2070
               + W+P+TGVP+  G
Sbjct  558   SGDRWIPSTGVPYNSG  573



>ref|XP_004289435.1| PREDICTED: pectinesterase 4-like [Fragaria vesca subsp. vesca]
Length=547

 Score =   379 bits (972),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 206/533 (39%), Positives = 287/533 (54%), Gaps = 42/533 (8%)
 Frame = +1

Query  481   MKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIE  660
             MK V   C Y ++   C +S+S VA N SA  KD++ AA+ +  ++   S  +  +  +E
Sbjct  44    MKLVIQMCNYTDHHTECQQSLSPVAQNSSAGVKDYMKAALLSISDQAQNSLNMTESLLVE  103

Query  661   QSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTT  840
                      +IE+C +++++A D+LQA +S V D EL T+  RA +L  W+ +V +Y  T
Sbjct  104   AKDGTRIKRSIEECNDLMKEARDELQALVSYVNDVELETMNDRALELRIWIGSVNSYAGT  163

Query  841   CTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnnn  1020
             C + I         +D  +N   +T N  N    M ++L+                    
Sbjct  164   CMDVIGD-------DDRKLNENAVTENGSNSRRLMGEILE--------------------  196

Query  1021  nnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGALKSY  1200
                       +  D +P W   AD KL+A Q  G + PNV+VA+DGSGQF+TI  AL++Y
Sbjct  197   --------EDIPKDEYPSWMSRADCKLMAKQDNGRIMPNVIVAQDGSGQFRTINEALRAY  248

Query  1201  PPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKTAT  1380
             P  ++ ++VIYVK GVY E V + K M N++MYGDG   T++TG K  A+     S + T
Sbjct  249   PKGNQGRFVIYVKQGVYKETVIIDKTMVNIYMYGDGPRATVVTGNKGEANTGDKISTSGT  308

Query  1381  FSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYR  1560
             F     GF+ R + F N AGPE   AVA R+  DM  IF+C I GYQDTLY +  RQF+R
Sbjct  309   FQVYASGFIGRSMGFTNGAGPEARPAVALRTSGDMIGIFNCRISGYQDTLYMNIGRQFFR  368

Query  1561  NCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNT--ITADGKELAKAKGGVVLQNCRI  1734
             NCVISG +D IFG    +IQNS+II RK  +   N   ITA G++     G  VL NCRI
Sbjct  369   NCVISGHVDCIFGDARVVIQNSLIIVRKSSMKNQNQAFITAPGQQTGHEVGATVLHNCRI  428

Query  1735  VPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYY-E  1911
             VPE AL P RF V+TY GRPWK Y+    +E  I D + P G   WDG +F     ++ E
Sbjct  429   VPEEALFPTRFAVRTYLGRPWKTYARAAFIECTIADFIRPEGVIAWDGNDFNTQHSFFGE  488

Query  1912  YKNSGPGANTWRRNRAFKKFDVLGPI---RARHFTAGLWLDANSWLPATGVPF  2061
             +KN GPGAN   R + + K    G +    A  FT    L  ++WL    +P+
Sbjct  489   FKNRGPGANIANRVK-WPKGGFTGEMDGNTAAKFTVDSMLLPDTWLKMATIPY  540



>tpg|DAA44942.1| TPA: hypothetical protein ZEAMMB73_754551 [Zea mays]
Length=566

 Score =   379 bits (973),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 210/549 (38%), Positives = 303/549 (55%), Gaps = 33/549 (6%)
 Frame = +1

Query  448   GKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHK  627
             G+ + G  + S+KS+ +FCQ  +Y++ C K++   A N ++ T +   A  K T + + K
Sbjct  32    GRAEEGEMSTSVKSIKSFCQPVDYRETCEKALEAAAGNATSPT-ELAKAIFKVTSDRIAK  90

Query  628   S--HQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQL  801
             +     ++N   E   D     A+ +C E+L  AIDDL+ +   +G  E+   K   D L
Sbjct  91    AVRESALLN---ELKHDRRTSGALHNCGELLDYAIDDLRTTFDRLGGFEMTNFKSAVDDL  147

Query  802   LNWMSAVYAYQTTCTEQIESRLYKSA--IEDGMINATQLTNNAINIIAEMSKLLKAFNIT  975
               W+S+   YQ TC +  E+    +A  +   + ++ +LT N + ++ E S+ L    + 
Sbjct  148   RTWLSSALTYQETCLDGFENTTTPAAGKMRKALNSSQELTENILALVDEFSETLANLGLP  207

Query  976   TTTDLLHKAADKnnnnnnnTTSRRLLQTDHF---PEWFPIADRKLL-AAQRRGNLRPNVV  1143
             +     H               RRLL  +H    P W P A R+LL  +      RP+V 
Sbjct  208   S----FH---------------RRLL-AEHARGAPSWMPDAKRRLLLVSPGEKGFRPDVT  247

Query  1144  VAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTI  1323
             VAKDGSG F+TI  AL   P K    YV+YVKAG Y E V V + + N+ M GDGA KT+
Sbjct  248   VAKDGSGDFRTINAALAKVPLKSATTYVMYVKAGKYREYVSVARNVTNLVMVGDGATKTV  307

Query  1324  ITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDC  1503
             ITG K++  M ITT  TAT  A+G GF+ RGI  +NTAG + HQAVA R QSDMSA ++C
Sbjct  308   ITGHKSFM-MNITTKDTATMEAIGNGFLMRGIGVKNTAGAKNHQAVALRVQSDMSAFYEC  366

Query  1504  SIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADG  1683
               +GYQDTLY HT RQ+YR+CVI+GTIDFIFG    + QN +I  RK + +Q N +TA G
Sbjct  367   RFDGYQDTLYTHTSRQYYRDCVITGTIDFIFGNAQVVFQNCLIQVRKCMDNQQNIVTAQG  426

Query  1684  KELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGW  1863
             ++  ++ GG V+ NC + P         + +T+ GRPWK +S T+ ++S+IG  + P GW
Sbjct  427   RKERRSVGGTVIHNCTVAPHPEFEKSVGRFRTFLGRPWKEHSRTLYIQSEIGGFIDPQGW  486

Query  1864  KIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLP  2043
               W G+    TC Y E +N GPGAN  RR +     ++      + +T   ++    WLP
Sbjct  487   LPWLGDFGLSTCYYAEVENHGPGANMTRRVKWRGIKNITYQHALQKYTVESFIQGQHWLP  546

Query  2044  ATGVPFAIG  2070
               GVPF  G
Sbjct  547   QLGVPFIPG  555



>ref|XP_006659464.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13-like 
[Oryza brachyantha]
Length=602

 Score =   380 bits (976),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 228/551 (41%), Positives = 305/551 (55%), Gaps = 43/551 (8%)
 Frame = +1

Query  472   TGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATT--KDFIFAAIKATLEEVHK----SH  633
             +G  K +   C   +Y+D C KS++ VA+N SA++  +D + A++ A  + V K    S 
Sbjct  74    SGVSKIIKAMCAQTDYRDTCEKSLAKVASNASASSSPRDIVRASVAAIGDAVEKAFDKSG  133

Query  634   QLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWM  813
             ++V       S DP    AI DCKE+ ++A DDL+ ++  +    +  L     QL  W+
Sbjct  134   EIV-------SDDPRVKAAIADCKEIYENARDDLERTLGGIDAGGVDGLTKGGYQLRVWL  186

Query  814   SAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLL  993
             SAV A Q TC +       K  + D M +  +LT+NA+ II + S  L A N+  ++   
Sbjct  187   SAVIADQETCIDGFPDGDLKDKMRDAMESGKELTSNALAIIGKASSFLAALNLPASSAAS  246

Query  994   HKAADKnnnnnnnTTSRRLL---------QTDHFPEWFPIADRKLLAAQRRGNLRPNVVV  1146
             H               RRLL         +    P W     R+LL  + +  L PNVVV
Sbjct  247   H---------------RRLLSFAFDEDTPRQPDVPLWVSRQQRRLLKGKFQNKLTPNVVV  291

Query  1147  AKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTII  1326
             AKDGSG+FKTI  AL + P K+  +YVIYVK GVYDE V + KKM NV MYGDGA KTII
Sbjct  292   AKDGSGKFKTINDALAAMPKKYTGRYVIYVKEGVYDEYVTITKKMANVTMYGDGAKKTII  351

Query  1327  TGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCS  1506
             TG +N+   + TT KTATFSA G GF+   + FRNTAG   HQAVA   QSD S   +C 
Sbjct  352   TGNRNFVDGR-TTYKTATFSAQGDGFMGIALGFRNTAGAAKHQAVALLVQSDKSIFLNCR  410

Query  1507  IEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGK  1686
             +EGYQDTLY H+  QFYRNCV+SGT+DFIFG   A+ QN ++  R+PL +Q NT TA G+
Sbjct  411   MEGYQDTLYAHSKTQFYRNCVVSGTVDFIFGDAAAVFQNCVLTLRRPLDNQQNTATAQGR  470

Query  1687  ELAKAKGGVVLQNCRIVPETAL-NPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGW  1863
                +   G VLQ+CR   E AL +  R  V++Y  RPW+ YS T++M+S I   +   G+
Sbjct  471   ADGREATGFVLQHCRFAAEPALKDASRPAVRSYLARPWREYSRTLIMDSDIPAFVDKAGY  530

Query  1864  KIWDGENFEKTCMYYEYKNSGPGANTWRRNR--AFKKFDVLGPIRARHFTAGLWLDANSW  2037
               W G+   +T  Y EY N G GA T  R     +KK  V+    A  FT   +L A  W
Sbjct  531   LPWSGDFGLRTLWYAEYGNKGAGAATAGRVSWPGYKK--VISKEEATKFTVQNFLHAEPW  588

Query  2038  LPATGVPFAIG  2070
             +  TG P   G
Sbjct  589   IKPTGTPVKYG  599



>gb|KFK32509.1| hypothetical protein AALP_AA6G251800 [Arabis alpina]
Length=604

 Score =   380 bits (975),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 217/532 (41%), Positives = 304/532 (57%), Gaps = 32/532 (6%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQ  663
             K + + C    YK  C K+  +      A         +K+ +E ++K   +V+   +  
Sbjct  98    KIIQSLCSSTLYKLTCEKTFKNRTEKSIALENPTTL--LKSAIEAINKDLDIVLEKLLSL  155

Query  664   STDPYNHM-AIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTT  840
              T+  +   AI  CK +++DA ++  AS++ V  TE++        L +W+SAV  YQ T
Sbjct  156   KTENQDDKDAIAQCKLLVEDAKEETLASMNKVNGTEVNNFAEIVPDLDSWLSAVMTYQET  215

Query  841   CTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnnn  1020
             C +  E    KS ++  + ++  LT+N++ +I       K+FN   ++ +          
Sbjct  216   CLDGFEEGSLKSEVKKSVNSSQVLTSNSLAMI-------KSFNANLSSVI----------  258

Query  1021  nnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGALKSY  1200
                   + RLL  D  P W    DR++L A     L+PN  VAKDGSG F TI  ALK+ 
Sbjct  259   ----KVTPRLL--DEIPSWVSNEDRRILRAVDIKALKPNATVAKDGSGNFTTINDALKAM  312

Query  1201  PPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKTAT  1380
             P K++ +Y+IYVK GVYDE V V KK  NV M GDG+ KTI+TG K++A  KI T  TAT
Sbjct  313   PEKYEGRYIIYVKQGVYDEYVTVDKKKANVTMVGDGSQKTIVTGNKSHAK-KIRTFLTAT  371

Query  1381  FSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYR  1560
             F A G+GF+A+ + FRNTAGPEGHQAVA R QSD S   +C  EGYQDTLY +T+RQ+YR
Sbjct  372   FVAQGEGFMAQSMGFRNTAGPEGHQAVAIRVQSDRSIFLNCRFEGYQDTLYAYTHRQYYR  431

Query  1561  NCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCRIVP  1740
             +CVI GTIDFIFG   A+ QN  I  RK L  Q NT++A G+       G V+QNC+I  
Sbjct  432   SCVIVGTIDFIFGDAAAIFQNCNIFIRKGLPGQKNTVSAQGRVDKFQTTGFVIQNCKITA  491

Query  1741  ETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYY-EYK  1917
                L P++ + K+Y GRPWK YS T+VMES I D++ P+GW  W   +F    +YY EYK
Sbjct  492   NEDLKPVKAEYKSYLGRPWKNYSRTIVMESTIEDVIDPVGWLRWQETDFAIDTLYYAEYK  551

Query  1918  NSGP-GANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             N GP G+ T R N  +  F V+    A ++T G +L  + W+ A+G P  +G
Sbjct  552   NKGPSGSTTSRVN--WPGFKVINKEEALNYTVGPFLQGD-WISASGSPVKLG  600



>emb|CDY70135.1| BnaCnng66900D [Brassica napus]
Length=574

 Score =   379 bits (972),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 219/556 (39%), Positives = 314/556 (56%), Gaps = 29/556 (5%)
 Frame = +1

Query  448   GKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHK  627
             G G         K+V + C  A  K  CAK++  V ++  +     I A + AT + V K
Sbjct  32    GAGGDKTLNSHQKAVESLCASATDKGSCAKTLDPVKSDDPSK---LIKAFMLATKDAVTK  88

Query  628   SHQLVVNTK--IEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQL  801
             S     +T+  + ++ +  +   ++ CK +L  A++DL+  +  +G+ +L     + DQL
Sbjct  89    SSDFTASTEEGMGKNMNATSKAVLDYCKRVLMYALEDLETIVEEMGE-DLQQSGSKMDQL  147

Query  802   LNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTT  981
               W++ V+ YQT C + IE    +  + +G+ ++  L++NAI+I   ++  +   N+   
Sbjct  148   KQWLTGVFNYQTDCIDDIEESELRKVMGEGIAHSKILSSNAIDIFHALTTAMSQMNV---  204

Query  982   TDLLHKAADKnnnnnnnTTS--RRLLQ---TDHFPEWFPIADRKLLAAQRR------GNL  1128
                  K  D  N N   T +  R LL+       P+W    DRKL+A   R      G +
Sbjct  205   -----KVDDMKNGNLGETPAPDRDLLEDLDQKGLPKWHSDKDRKLMAQAGRPGGGGGGKI  259

Query  1129  RPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDG  1308
             +P  VVAKDGSGQFKTI+ A+K+ P K+  + +IY+KAGVY E V + KK+ NVFM+GDG
Sbjct  260   KPTHVVAKDGSGQFKTISEAVKACPEKNPGRCIIYIKAGVYKEQVTIPKKVNNVFMFGDG  319

Query  1309  AGKTIITGKKNYA-HMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDM  1485
             A +TIIT  ++       TTS + T     +GF+A+ I F+NTAGP GHQAVA+R   D 
Sbjct  320   ATQTIITFDRSVGLSPGTTTSLSGTVQVESEGFMAKWIGFQNTAGPLGHQAVAFRVNGDR  379

Query  1486  SAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFN  1665
             + IF+C  +GYQDTLY +  RQFYRN V+SGT+DFIFGK   +IQNS+I+ RK    Q N
Sbjct  380   AVIFNCRFDGYQDTLYVNNGRQFYRNIVVSGTVDFIFGKSATVIQNSLILCRKGSPGQTN  439

Query  1666  TITADGKELAKA-KGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGD  1842
              +TADG E  KA K G+VL NCRI+ +  L   R  VK+Y GRPWK ++TT V+ ++IGD
Sbjct  440   HVTADGNEKGKAVKIGIVLHNCRIMADKELEADRLTVKSYLGRPWKPFATTAVIGTEIGD  499

Query  1843  LLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWL  2022
             L+ P+GW  W GE F  T  Y E+ N GPGANT  R    K       +    FT   WL
Sbjct  500   LIQPVGWNEWQGEKFHLTATYVEFNNRGPGANTAARVPWAKMAKSAAEV--ERFTVANWL  557

Query  2023  DANSWLPATGVPFAIG  2070
                +W+    VP  +G
Sbjct  558   TPANWIQEANVPVQLG  573



>ref|XP_004984909.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Setaria italica]
Length=564

 Score =   378 bits (971),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 208/548 (38%), Positives = 302/548 (55%), Gaps = 31/548 (6%)
 Frame = +1

Query  448   GKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHK  627
             GK D G  + S+KS+ +FCQ  +YK+ C +++   A N ++ T D      K T + + K
Sbjct  30    GKEDEGEMSTSVKSIKSFCQPVDYKETCERALEATAGNATSPT-DLAKVIFKVTSDRIEK  88

Query  628   S--HQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQL  801
             +     V+N   +   DP    A+ +CKE+L  AIDDL+ +   +G  E+   K   D L
Sbjct  89    AARESAVLN---DLKNDPRTSGALRNCKELLDYAIDDLKTTFDRLGGFEMTNFKAAVDDL  145

Query  802   LNWMSAVYAYQTTCTEQIESRLYKSA--IEDGMINATQLTNNAINIIAEMSKLLKAFNIT  975
               W+S+   YQ TC +  E+    +A  +   +  + +LT N + ++ E S+ L +  + 
Sbjct  146   KTWLSSALTYQETCLDGFENTTTDAAAKMRRALNTSQELTENILALVDEFSETLASLGLP  205

Query  976   TTTDLLHKAADKnnnnnnnTTSRRLLQTDH-FPEWFPI-ADRKLL-AAQRRGNLRPNVVV  1146
             +     H               RRLL  +   P W    A R++L A     + +P+V V
Sbjct  206   S----FH---------------RRLLAGNGGAPSWMTDDAKRRVLKATPGSPDFKPDVTV  246

Query  1147  AKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTII  1326
             A DGSG FKTI  AL   P K    YV+YVKAG Y E V V + + N+ + GDGA KT++
Sbjct  247   AADGSGDFKTINAALAKVPTKSATAYVMYVKAGTYKEYVSVPRNVTNLVVVGDGATKTVV  306

Query  1327  TGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCS  1506
             TG K++A M ITT  TAT   +G GF  RG+   NTAG   HQAVA R QSDMSA ++C 
Sbjct  307   TGSKSFA-MNITTKDTATMEVIGNGFQMRGVGVENTAGARNHQAVALRVQSDMSAFYECR  365

Query  1507  IEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGK  1686
              +GYQDTLY HT RQ+YR+CV++GTIDFIFG    + QN +I  RK + +Q N +TA G+
Sbjct  366   FDGYQDTLYTHTSRQYYRDCVVTGTIDFIFGNAQVVFQNCLIQVRKCMDNQQNIVTAQGR  425

Query  1687  ELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWK  1866
             +  ++ GG V+ NC + P         ++KTY GRPWK +S T+ ++S+IG  + P GW 
Sbjct  426   KERRSAGGTVIHNCTVEPHPEFESSAGRLKTYLGRPWKEHSRTLYIQSEIGGFVDPQGWL  485

Query  1867  IWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPA  2046
              W G+    TC Y E +N GPGA+T +R +     ++      + +T   ++   +WLP 
Sbjct  486   PWLGDFGLSTCYYAEVENHGPGADTSKRAKWKGVKNITYQQAQQKYTVERFIQGQTWLPK  545

Query  2047  TGVPFAIG  2070
              GVPF  G
Sbjct  546   LGVPFIPG  553



>ref|XP_008245480.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Prunus mume]
Length=575

 Score =   378 bits (971),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 217/547 (40%), Positives = 317/547 (58%), Gaps = 23/547 (4%)
 Frame = +1

Query  448   GKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHK  627
             GK     ++ S K++ + CQ  +YK  C  ++S VA+N +   K+ + A  +  ++++ +
Sbjct  41    GKSGGEQTSTSTKAIQSICQPTDYKKTCEDNLSKVASNVT-DPKELVKAGFQVAIDQLRE  99

Query  628   SHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLN  807
               +     K E + DP ++ A+++CKE+L+ AIDDL  S   +G  +   L    + L  
Sbjct  100   VIKNSTTLK-ELAKDPSSNQALQNCKELLEYAIDDLGDSFDKLGPFDFTKLDAYVEDLKV  158

Query  808   WMSAVYAYQTTCTEQIESRLYKSA--IEDGMINATQLTNNAINIIAEMSKLLKAFNITTT  981
             W+SA   Y+ TC +  E+    +   +   +  + +LT+N + +++E+S L KA NI T 
Sbjct  159   WLSAAMTYEQTCLDGFENTTGDAGEKMRQFLKTSQELTSNGLAMVSEVSTLFKALNIKTG  218

Query  982   TDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKL-LAAQRRGNLRPNVVVAKDG  1158
               LL  AA         T  +R  +    P W  I  RKL LA      L+P+VVV+K G
Sbjct  219   RRLLQAAA-------TATDEKRFQKAKIIPAW--IDHRKLDLATATPLTLKPDVVVSKKG  269

Query  1159  SGQFKTITGALKSYPPKHKAK-YVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGK  1335
              G++KTI  ALK  P  ++ K +VIYVK GVYDE V   K M NV + GDG  KT+ITG+
Sbjct  270   DGKYKTINEALKDIPKNNEVKVFVIYVKEGVYDEHVFFNKHMTNVMLIGDGPTKTVITGR  329

Query  1336  KNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEG  1515
             KNYA     T +TAT + +G  F+A+ I F NTAG  GHQAVA R QSD+S  ++C+++G
Sbjct  330   KNYAE-GTQTYQTATVAVVGDYFIAKDIGFENTAGAIGHQAVALRVQSDLSIFYNCNMDG  388

Query  1516  YQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELA  1695
             YQDTLY  T+RQFYR+C ISGTIDFIFG   A+ QN  +I RKPL +Q   +TA G+   
Sbjct  389   YQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAVFQNCKMIVRKPLENQACMVTAHGRLDR  448

Query  1696  KAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWD  1875
             ++   ++LQNC I  E+  +  +   K Y GRPWK+Y+  +VM+SQI D+++P GW  W 
Sbjct  449   RSPTALILQNCTISGESGYD--KELNKAYLGRPWKSYARAIVMQSQIDDVIAPEGWMDWT  506

Query  1876  GENFEKTCMYYEYKNSGPGANTWRRN--RAFKKFDVLGPIRARHFTAGLWLDANSWLPAT  2049
             G +   TC + E+ N G GA   +R   R  KK   L P  A  FTAG ++  + W+  +
Sbjct  507   GASNHNTCWFGEFGNRGVGAELSKRVTWRGMKK---LTPEHAADFTAGKFIFGDRWILPS  563

Query  2050  GVPFAIG  2070
             GVP+  G
Sbjct  564   GVPYVAG  570



>ref|XP_010551001.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=669

 Score =   381 bits (978),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 203/541 (38%), Positives = 303/541 (56%), Gaps = 35/541 (6%)
 Frame = +1

Query  472   TGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNT  651
             T S+K++   C   +YK  C  ++   ANN S    + +  A + T++++ ++      T
Sbjct  55    TASVKAIKEVCAPTDYKKTCEDTLRKNANNTSDPL-ELVKTAFEVTMKQIAEAAAKS-KT  112

Query  652   KIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAY  831
              IE   DP   MA++ CKE++  A D+L++S   +G  E H L      L  W+SA  ++
Sbjct  113   LIEIQKDPRTKMALDQCKELMDYAFDELKSSFDELGKFEFHKLDEALINLRIWLSAAISH  172

Query  832   QTTCTEQIESRLYKSA--IEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAA  1005
             +TTC E  E     +   ++  +  A QLT+N + I+ EMS  +    I+          
Sbjct  173   ETTCLEGFEQTQGNAGETMKKALKTAIQLTHNGLAIVTEMSDFVGQMQIS----------  222

Query  1006  DKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITG  1185
                        SRRLL ++ +P W     R+LLAA    +++P++VVA+DGSGQ+ TI  
Sbjct  223   --------GLNSRRLLSSNGYPSWVDARARRLLAATVT-DVKPDIVVAQDGSGQYATINE  273

Query  1186  ALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITT  1365
             AL+  P K    +V+++KAGVY E ++V K M ++   GDG  KTII+G K +    ITT
Sbjct  274   ALEHVPKKKNVTFVVHIKAGVYKEYIQVNKSMTDLVFIGDGPDKTIISGDKGFKD-GITT  332

Query  1366  SKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTY  1545
              +T T + +G  F+A+ I F NTAG   HQAVA R QSDMS  ++C  +GYQDTLY H++
Sbjct  333   YRTQTVAIVGDRFIAKDIGFENTAGAIKHQAVAVRVQSDMSVFYNCRFDGYQDTLYTHSH  392

Query  1546  RQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQN  1725
             RQF+R+C ISGTIDF+FG   A+ QN  ++ RKPL +Q   ITA G++  +   G V Q 
Sbjct  393   RQFFRDCTISGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRQDPREPTGFVFQG  452

Query  1726  CRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMY  1905
             C+I  E     ++   K Y GRPWKAYS T++M + I D + P GW+ W+G+    T  Y
Sbjct  453   CQIAGEPDYLSVKATSKAYLGRPWKAYSRTIIMNTFIPDFVQPQGWQPWNGDFGLSTLFY  512

Query  1906  YEYKNSGPGAN-----TWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
              E +N+GPG++     TW   +     D+L       FT   ++  +SW+PATGVP+  G
Sbjct  513   SEIQNTGPGSDVVNRVTWAGIKKLTNNDLL------QFTPAQFIQGDSWIPATGVPYTPG  566

Query  2071  Y  2073
             +
Sbjct  567   F  567



>ref|XP_009385286.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=576

 Score =   378 bits (970),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 211/544 (39%), Positives = 303/544 (56%), Gaps = 39/544 (7%)
 Frame = +1

Query  472   TGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTK--DFIFAAIKATLEEVHKSHQLVV  645
             T + K++   C+  +Y + C  S++  A N +   K  +  F +   +L E   +H  V+
Sbjct  59    TTTSKAIRAICRPTDYAEECQSSLAARAGNVTDPKKLVELSFTSAMDSLREAF-NHSSVL  117

Query  646   NTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVY  825
                 E + DP    A+E+CKE+L  AIDDL+ S++  G  ++  +    D L  W+SA  
Sbjct  118   Q---EAAKDPRTSEALENCKELLDYAIDDLKNSVARFGGVDMAKMSDVVDDLKVWLSATI  174

Query  826   AYQTTCTEQIESRLYKSA--IEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHK  999
              YQ TC +  ++    +A  +   + +++ LT+NA+ II  +S +L +F +++       
Sbjct  175   TYQQTCLDGFDNTTGDAADNMSKALNSSSALTSNALAIIDGISSVLASFQLSSL------  228

Query  1000  AADKnnnnnnnTTSRRLLQTDH-----FPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSG  1164
                           RRLL  D      FP W     RKLLA   + +++P+V VA+DGSG
Sbjct  229   -------------GRRLLSDDEGERGEFPSWVGNDKRKLLALSTK-DIKPDVTVAQDGSG  274

Query  1165  QFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNY  1344
             ++KTIT AL + P K  A +VIY+K GVY E V V + M NV M+GDG  KT ITG  NY
Sbjct  275   KYKTITQALSAVPKKGNATFVIYIKEGVYKENVMVDRSMTNVMMFGDGPTKTKITGSLNY  334

Query  1345  AHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQD  1524
                  +T KTAT + +G GF+ + +   NTAG   HQAVA R QSD S  + C ++GYQD
Sbjct  335   VD-GTSTFKTATLAVVGDGFIGKNLGVENTAGAAKHQAVALRVQSDKSVFYLCQMDGYQD  393

Query  1525  TLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAK  1704
             TLY HT RQFYR C ISGTIDF+FG    + QN +++ RKP+ +Q   +TA G++     
Sbjct  394   TLYTHTKRQFYRECTISGTIDFLFGDAAVVFQNCLMLVRKPMANQQCIVTAQGRKDRHEA  453

Query  1705  GGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGEN  1884
              G+VL NC I  +  L+       +Y GRPWK YS T++M+SQI  L++  GW+ W GE 
Sbjct  454   TGIVLHNCTISADPTLSSASTTTVSYLGRPWKEYSRTIIMQSQIDGLINEDGWQPWLGEF  513

Query  1885  FEKTCMYYEYKNSGPGANTWRRN--RAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVP  2058
               KTC Y E  N GPGA T +R   + +KK D+     A  +T   ++   +WLP TGVP
Sbjct  514   GLKTCFYTEIGNRGPGAATTKRVTWKGYKKVDL---THAHKYTVQQFIQGKTWLPKTGVP  570

Query  2059  FAIG  2070
             F  G
Sbjct  571   FTPG  574



>emb|CDY11406.1| BnaA09g39720D [Brassica napus]
Length=574

 Score =   377 bits (969),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 217/554 (39%), Positives = 311/554 (56%), Gaps = 25/554 (5%)
 Frame = +1

Query  448   GKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHK  627
             G G         K+V + C  A  K  CAK++  V ++  +     I A + AT + V K
Sbjct  32    GAGGDKTLNSHQKAVESLCASATDKGSCAKTLDPVKSDDPSK---LIKAFMLATKDAVTK  88

Query  628   SHQLVVNTK--IEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQL  801
             S     +T+  + ++ +  +   ++ CK +L  A++DL+  +  +G+ +L     + DQL
Sbjct  89    STNFTASTEEGMGKNMNATSKAVLDYCKRVLMYALEDLETIVEEMGE-DLQQSGSKMDQL  147

Query  802   LNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTT  981
               W++ V+ YQT C + IE    +  + +G+ ++  L++NAI+I   ++  +   N+   
Sbjct  148   KQWLTGVFNYQTDCIDDIEESELRKVMGEGIAHSKILSSNAIDIFHALTTAMSQMNVKV-  206

Query  982   TDLLHKAADKnnnnnnnTTSRRLLQ---TDHFPEWFPIADRKLLAAQRR------GNLRP  1134
              D + K     N        R LL+       P+W    DRKL+A   R      G ++P
Sbjct  207   -DDMKKG----NLGETPAPDRDLLEDLDQKGLPKWHSDKDRKLMAQAGRPGGGGGGKIKP  261

Query  1135  NVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAG  1314
               VVAKDGSGQFKTI+ A+K+ P K+  + +IY+KAGVY E V + KK+ NVFM+GDGA 
Sbjct  262   THVVAKDGSGQFKTISEAVKACPEKNPGRCIIYIKAGVYKEQVTIPKKVNNVFMFGDGAT  321

Query  1315  KTIITGKKNYA-HMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSA  1491
             +TIIT  ++       TTS + T     +GF+A+ I F+NTAGP GHQAVA+R   D + 
Sbjct  322   QTIITFDRSVGLSPGTTTSLSGTVQVESEGFMAKWIGFQNTAGPLGHQAVAFRVNGDRAV  381

Query  1492  IFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTI  1671
             IF+C  +GYQDTLY +  RQFYRN V+SGT+DFIFGK   +IQNS+I+ RK    Q N +
Sbjct  382   IFNCRFDGYQDTLYVNNGRQFYRNIVVSGTVDFIFGKSATVIQNSLILCRKGSPGQTNHV  441

Query  1672  TADGKELAKA-KGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLL  1848
             TADG E  KA K G+VL NCRI+ +  L   R  VK+Y GRPWK ++TT V+ ++IGDL+
Sbjct  442   TADGNEKGKAVKIGIVLHNCRIMADKELEADRLTVKSYLGRPWKPFATTAVIGTEIGDLI  501

Query  1849  SPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDA  2028
              P GW  W GE F  T  Y E+ N GPGANT  R    K       +    FT   WL  
Sbjct  502   QPTGWNEWQGEKFHLTATYVEFNNRGPGANTAARVPWAKMAKSAAEV--ERFTVANWLTP  559

Query  2029  NSWLPATGVPFAIG  2070
              +W+    VP  +G
Sbjct  560   ANWIQEANVPVQLG  573



>ref|XP_002314364.1| putative pectinesterase family protein [Populus trichocarpa]
 gb|EEF00535.1| putative pectinesterase family protein [Populus trichocarpa]
Length=571

 Score =   377 bits (968),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 209/546 (38%), Positives = 303/546 (55%), Gaps = 28/546 (5%)
 Frame = +1

Query  442   SSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEV  621
             SS KG   +ST S KS+   CQ  +Y++ C +S+S  A N +  +K  + A  K T+E +
Sbjct  47    SSPKGQ--ISTTS-KSIKAICQPTDYRETCEESLSKAAGNTTDPSK-LVQAGFKVTIEAL  102

Query  622   HKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQL  801
               +       K E + DP    A+++C+E++ DAI +L+ S  ++   +        + L
Sbjct  103   QNAINRSTTLK-ELAKDPMASQALDNCRELMDDAIAELEHSFDLIESFQASQFDEYVNNL  161

Query  802   LNWMSAVYAYQTTCTEQIESRLYKSA--IEDGMINATQLTNNAINIIAEMSKLLKAFNIT  975
               W+SA   YQ TC +  E+    +   +++ ++ ++QLT+N + ++  ++ +LK  NI 
Sbjct  162   KVWLSATITYQRTCLDGFENTTGSAGEKMKELLMASSQLTSNGLAMVDGVTSILKDLNIP  221

Query  976   TTTDLLHKAADKnnnnnnnTTSRRLLQTD-HFPEWFPIADRKLLAAQRRGNLRPNVVVAK  1152
                                 TSRRLL+ D  FP W     R LL  +    ++ + +VA+
Sbjct  222   ------------------GLTSRRLLEADDEFPSWVNGGKRMLLLKETPATIKADAIVAQ  263

Query  1153  DGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITG  1332
             DGSGQ+KTI  A++  P K    +VIY+K GVY E V + +   +V M GDG  KT ITG
Sbjct  264   DGSGQYKTIAEAIEKIPKKKNETFVIYIKEGVYKEQVSLARSHTHVLMIGDGPTKTKITG  323

Query  1333  KKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIE  1512
               NYA+  + T KTAT S  G  F+A+ I F N+AG  GHQAVA R Q+DMS  ++C I+
Sbjct  324   NLNYAN-GVQTFKTATVSISGDHFMAKDIGFENSAGAIGHQAVALRVQADMSVFYNCQID  382

Query  1513  GYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKEL  1692
             GYQDTLY HT RQFYR+C I+GTIDFIFG   A+ QN  ++ RKPL +Q   +TA G+  
Sbjct  383   GYQDTLYAHTKRQFYRDCTITGTIDFIFGDAIAVFQNCKLVVRKPLDNQQCIVTAQGRNE  442

Query  1693  AKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIW  1872
              +   G V+QNC I  +    P+R + K Y GRPW+  S T+VM+S I DL++P GW  W
Sbjct  443   TREPTGFVIQNCTITADPQYFPVRLQNKAYLGRPWRELSRTIVMQSHIDDLIAPEGWLPW  502

Query  1873  DGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATG  2052
              G     T  Y EY N G GA    R + +     L P  A  +TA  ++  + W+P TG
Sbjct  503   LGSFGLNTLFYSEYNNKGQGAVETNRVK-WAGIKKLTPEAADGYTAAKFIQGDEWIPQTG  561

Query  2053  VPFAIG  2070
             VP+  G
Sbjct  562   VPYTAG  567



>gb|ABO80921.1| Pectinesterase [Medicago truncatula]
Length=334

 Score =   369 bits (947),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 182/324 (56%), Positives = 217/324 (67%), Gaps = 6/324 (2%)
 Frame = +1

Query  1117  RGNLRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFM  1296
             R N+  N VVAKDGSGQFKTI  A+ +YP  +K +Y IYVKAGVYDE + + K   N+ M
Sbjct  10    RANVGANAVVAKDGSGQFKTIQAAIAAYPKGNKGRYTIYVKAGVYDEYITIPKDAVNILM  69

Query  1297  YGDGAGKTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQ  1476
             YGDG GKTI+TG+KN A   + T +TATF+    GF+ + +TF NTAGP GHQAVA+R+Q
Sbjct  70    YGDGPGKTIVTGRKNGA-AGVKTMQTATFANTALGFIGKAMTFENTAGPAGHQAVAFRNQ  128

Query  1477  SDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVH  1656
              DMSA+  C I GYQDTLY  T RQFYRNCVISGT+DFIFG    LIQ+S II R P  +
Sbjct  129   GDMSALVGCHILGYQDTLYVQTNRQFYRNCVISGTVDFIFGTSATLIQDSTIIVRMPSPN  188

Query  1657  QFNTITADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQI  1836
             QFNTITADG  + K   G+V+Q C IVPE AL P RF +K+Y GRPWK  + TVVMES I
Sbjct  189   QFNTITADGSYVNKLNTGIVIQGCNIVPEAALFPQRFTIKSYLGRPWKVLAKTVVMESTI  248

Query  1837  GDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGL  2016
             GD + P GW  W GE+FE TC Y EY N+GPGAN  RR +       +    A  FTAGL
Sbjct  249   GDFIHPDGWTPWQGEHFENTCYYAEYANTGPGANIARRIKWKGYHGAISRAEATKFTAGL  308

Query  2017  WLDAN-----SWLPATGVPFAIGY  2073
             WL A       WL    VP  +G+
Sbjct  309   WLQAGPKSAAEWLTGLNVPNYLGF  332



>ref|NP_001049858.1| Os03g0300500 [Oryza sativa Japonica Group]
 gb|ABF95479.1| Pectinesterase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11772.1| Os03g0300500 [Oryza sativa Japonica Group]
 gb|EAY89657.1| hypothetical protein OsI_11188 [Oryza sativa Indica Group]
 gb|EAZ26616.1| hypothetical protein OsJ_10519 [Oryza sativa Japonica Group]
Length=565

 Score =   377 bits (968),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 214/550 (39%), Positives = 296/550 (54%), Gaps = 31/550 (6%)
 Frame = +1

Query  439   ASSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEE  618
             +S+ K D  +ST S+KS+ +FCQ  +Y++ C  ++   A N +  T D   A  KAT E 
Sbjct  30    SSNAKEDGELST-SVKSIKSFCQPVDYRETCETTLEQTAGNATNPT-DLAKAIFKATSER  87

Query  619   VHKS--HQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRA  792
             + K+     V+N   +   DP    A++DC+E+L  AIDDL+ +   +G  +    K   
Sbjct  88    IEKAVRESAVLN---DLKNDPRTSDALKDCEELLDYAIDDLKTTFDKLGGFQTSNFKRAV  144

Query  793   DQLLNWMSAVYAYQTTCTEQIESRLYKSAIED---GMINATQLTNNAINIIAEMSKLLKA  963
             D +  W+S+   YQ TC +  E+     A E     + ++ +LT N + I+ + +  L  
Sbjct  145   DDVKTWLSSALTYQETCLDGFENSTSTEASEKMRKALKSSQELTENILAIVDQFADTLAN  204

Query  964   FNITTTTDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQR-RGNLRPNV  1140
              +IT                     SRRLL  D  P W   A R+LL A       +P+V
Sbjct  205   LDITGF-------------------SRRLLGDDGVPVWMSNAKRRLLEATPGSKEFKPDV  245

Query  1141  VVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKT  1320
              VA DGSG FKTI  AL   P K    YV+YVKAG Y E V V + + N+ M GDGA KT
Sbjct  246   TVAADGSGDFKTINEALAKVPVKSTGTYVMYVKAGTYKEYVSVARNVTNLVMIGDGATKT  305

Query  1321  IITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFD  1500
             IITG K++  + ITT  TAT  A+G GF  RGI   NTAG + HQAVA R QSD SA ++
Sbjct  306   IITGNKSFM-LNITTKDTATMEAIGNGFFMRGIGVENTAGSKNHQAVALRVQSDQSAFYE  364

Query  1501  CSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITAD  1680
             C  +G+QDTLY HT RQ+YR+C I+GTIDFIFG    ++QN  I  R+ + +Q N +TA 
Sbjct  365   CQFDGHQDTLYTHTSRQYYRDCTITGTIDFIFGNAQVVLQNCRIQVRRCMDNQQNIVTAQ  424

Query  1681  GKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLG  1860
             G++   + GG V+ NC I P         K KT+ GRPWK YS T+ ++S IG  + P G
Sbjct  425   GRKEKHSAGGTVIHNCTIEPHEDFKADAAKFKTFLGRPWKEYSRTLYIQSDIGGFIDPQG  484

Query  1861  WKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWL  2040
             W  W G+    TC Y E +N G GA+  +R +      V      + +T   ++   +WL
Sbjct  485   WLPWLGDFGLNTCYYAEVENRGDGADMSKRAKWRGVKTVTYQQAQQKYTVERFIQGQTWL  544

Query  2041  PATGVPFAIG  2070
             P  GVPF  G
Sbjct  545   PKFGVPFIPG  554



>ref|XP_010417438.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13 
[Camelina sativa]
Length=608

 Score =   378 bits (971),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 217/545 (40%), Positives = 308/545 (57%), Gaps = 39/545 (7%)
 Frame = +1

Query  448   GKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKD--FIFAAIKATLEEV  621
             G+GD        K + T C    YK  C +++ +      A      F+ +AI+A  E++
Sbjct  97    GQGD--------KIIETLCSSTIYKQTCEQTLKNRTEKGFALANPTTFLKSAIEAVNEDL  148

Query  622   HKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQL  801
                 + V++ K E   D     AI  CK ++++A ++  AS+  +  TE+++       L
Sbjct  149   DLVLEKVLSLKTENQDD---KDAIAQCKLLVEEAKEETAASLEKINITEVNSFAKVVPDL  205

Query  802   LNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTT  981
              +W+SAV +YQ TC +  E    KS ++  + ++  LT+N++ +I               
Sbjct  206   DSWLSAVISYQETCLDGFEEGSLKSEVKKSVNSSQILTSNSLAMI---------------  250

Query  982   TDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGS  1161
                  K+ D N +      +R LL  D  P W    DR++L A     L+PN  VAKDGS
Sbjct  251   -----KSIDANLSPVMKLATRHLL--DEIPSWVSNEDRRMLRAVDVKALKPNATVAKDGS  303

Query  1162  GQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKN  1341
             G F TI  AL + P K++ +Y+IY+K GVYDE V V KK  N+ M GDG+ KTI+TG K+
Sbjct  304   GNFTTINDALSAMPEKYEGRYIIYIKQGVYDESVIVDKKKANLTMVGDGSQKTIVTGNKS  363

Query  1342  YAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQ  1521
             +A  KI T  TATF A G+GF+A+ + FRNTAGPEGHQAVA R QSD S   +C  EGYQ
Sbjct  364   HAK-KIRTFLTATFVAQGEGFMAQSMGFRNTAGPEGHQAVAIRVQSDRSIFLNCRFEGYQ  422

Query  1522  DTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKA  1701
             DTLY +T+RQ+YR+CVI GTIDFIFG   A+ QN  I  RK L  Q NT+TA G+     
Sbjct  423   DTLYAYTHRQYYRSCVIIGTIDFIFGDAAAIFQNCNIFIRKGLPGQKNTVTAQGRVDKFQ  482

Query  1702  KGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGE  1881
               G V+ NC+I     L P++ + K+Y GRPWK YS T+VMES I D++ P+GW  W   
Sbjct  483   TTGFVVHNCKIAANEDLKPVKAEYKSYLGRPWKNYSRTIVMESTIEDVIDPVGWLRWQET  542

Query  1882  NFEKTCMYY-EYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVP  2058
             +F    +YY EYKN GP  +T  R + +  F V+    A ++T G +L  + W+ A+G P
Sbjct  543   DFAIDTLYYAEYKNKGPSGDTTSRVK-WPGFKVINKEEALNYTVGPFLQGD-WINASGSP  600

Query  2059  FAIGY  2073
               +G+
Sbjct  601   VKLGF  605



>ref|XP_003626052.1| Pectinesterase [Medicago truncatula]
Length=331

 Score =   368 bits (945),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 182/324 (56%), Positives = 217/324 (67%), Gaps = 6/324 (2%)
 Frame = +1

Query  1117  RGNLRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFM  1296
             R N+  N VVAKDGSGQFKTI  A+ +YP  +K +Y IYVKAGVYDE + + K   N+ M
Sbjct  7     RANVGANAVVAKDGSGQFKTIQAAIAAYPKGNKGRYTIYVKAGVYDEYITIPKDAVNILM  66

Query  1297  YGDGAGKTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQ  1476
             YGDG GKTI+TG+KN A   + T +TATF+    GF+ + +TF NTAGP GHQAVA+R+Q
Sbjct  67    YGDGPGKTIVTGRKNGA-AGVKTMQTATFANTALGFIGKAMTFENTAGPAGHQAVAFRNQ  125

Query  1477  SDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVH  1656
              DMSA+  C I GYQDTLY  T RQFYRNCVISGT+DFIFG    LIQ+S II R P  +
Sbjct  126   GDMSALVGCHILGYQDTLYVQTNRQFYRNCVISGTVDFIFGTSATLIQDSTIIVRMPSPN  185

Query  1657  QFNTITADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQI  1836
             QFNTITADG  + K   G+V+Q C IVPE AL P RF +K+Y GRPWK  + TVVMES I
Sbjct  186   QFNTITADGSYVNKLNTGIVIQGCNIVPEAALFPQRFTIKSYLGRPWKVLAKTVVMESTI  245

Query  1837  GDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGL  2016
             GD + P GW  W GE+FE TC Y EY N+GPGAN  RR +       +    A  FTAGL
Sbjct  246   GDFIHPDGWTPWQGEHFENTCYYAEYANTGPGANIARRIKWKGYHGAISRAEATKFTAGL  305

Query  2017  WLDAN-----SWLPATGVPFAIGY  2073
             WL A       WL    VP  +G+
Sbjct  306   WLQAGPKSAAEWLTGLNVPNYLGF  329



>emb|CDX83235.1| BnaA03g22710D [Brassica napus]
Length=603

 Score =   378 bits (970),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 220/536 (41%), Positives = 304/536 (57%), Gaps = 39/536 (7%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANN----HSATTKDFIFAAIKATLEEVHKSHQLVVNT  651
             K + T C    YK  C  ++ +         S TT  F+ AAI+A  E++ +  + V++ 
Sbjct  96    KIIETLCSTTLYKVSCENTLKNRTEKGLALESPTT--FLKAAIEAVNEDLDRVLEKVLSL  153

Query  652   KIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAY  831
             K E   D     AI  CK +++DA +++ AS+  V  TE++        L NW+SAV +Y
Sbjct  154   KTENQDD---KDAIAQCKLLVEDAKEEIVASLDKVNGTEINNFVKIVPDLDNWLSAVMSY  210

Query  832   QTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAF--NITTTTDLLHKAA  1005
             Q TC +  E    KS ++  + ++  LT+N++        L+K+F  NI+    L     
Sbjct  211   QETCIDGFEEGSLKSEVKKSVNSSQVLTSNSL-------ALIKSFDANISPVEKL-----  258

Query  1006  DKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITG  1185
                        +R LL  D  P W    DR++L A     L PN  VAKDGSG F TI  
Sbjct  259   ----------ATRHLL--DQVPSWVTNEDRRMLRAVDVETLNPNATVAKDGSGNFTTIND  306

Query  1186  ALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITT  1365
             ALK+ P K++ +Y+IYVK GVYDE V V KK  N+ M GDG+ KTI+TG K++A  KI T
Sbjct  307   ALKAMPEKYEGRYIIYVKQGVYDESVTVDKKKANLTMVGDGSQKTIVTGNKSHAK-KIRT  365

Query  1366  SKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTY  1545
               TATF A G+GF+A+ + FRNTAGP+ HQAVA R QSD S   +C  EG+QDTLY +T+
Sbjct  366   FLTATFVAQGEGFMAQSMGFRNTAGPDEHQAVAIRVQSDRSVFLNCRFEGFQDTLYAYTH  425

Query  1546  RQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQN  1725
             RQ+YR+CVI GTIDFIFG   A+ QN  I  RK L  Q NT++A G+       G V+  
Sbjct  426   RQYYRSCVIVGTIDFIFGDAAAIFQNCNIFIRKGLSGQKNTVSAQGRVDKFQTTGFVIHK  485

Query  1726  CRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMY  1905
             C+I     L P++ + K+Y GRPWK YS TVVMES I D++ P+GW  W+  +F    +Y
Sbjct  486   CKITANEDLKPVKAEYKSYLGRPWKNYSRTVVMESTIEDVIDPIGWLRWEETDFAIDTLY  545

Query  1906  Y-EYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             Y EYKN GP  +T  R   +  F V+    A ++T G +L  + W+ A G P  +G
Sbjct  546   YAEYKNKGPSGDTASR-VTWPGFKVINKEEALNYTVGPFLQGD-WINALGSPVKLG  599



>ref|XP_009133943.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13 
[Brassica rapa]
Length=603

 Score =   377 bits (969),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 220/536 (41%), Positives = 305/536 (57%), Gaps = 39/536 (7%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANN----HSATTKDFIFAAIKATLEEVHKSHQLVVNT  651
             K + T C    YK  C  ++ +         S TT  F+ AAI+A  E++ +  + V++ 
Sbjct  96    KIIETLCSTTLYKVSCENTLKNSTEKGFALESPTT--FLKAAIEAVNEDLDRVLEKVLSL  153

Query  652   KIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAY  831
             K E   D     AI  CK +++DA +++ AS+  V  TE++ +      L NW+SAV +Y
Sbjct  154   KTENQDD---KDAIAQCKLLVEDAKEEIVASLDKVNGTEINNVVKIVPDLDNWLSAVMSY  210

Query  832   QTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAF--NITTTTDLLHKAA  1005
             Q TC +  E    KS ++  + ++  LT+N++        L+K+F  NI+    L     
Sbjct  211   QETCIDGFEEGNLKSEVKKSVNSSQVLTSNSL-------ALIKSFDANISPVEKL-----  258

Query  1006  DKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITG  1185
                        +R LL  D  P W    DR++L A     L PN  VAKDGSG F TI  
Sbjct  259   ----------ATRHLL--DQVPSWVTNEDRRMLRAVDVETLNPNATVAKDGSGNFTTIND  306

Query  1186  ALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITT  1365
             ALK+ P K++ +Y+IYVK GVYDE V V KK  N+ M GDG+ KTI+TG K++A  KI T
Sbjct  307   ALKAMPEKYEGRYIIYVKQGVYDESVTVDKKKANLTMVGDGSQKTIVTGNKSHAK-KIRT  365

Query  1366  SKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTY  1545
               TATF A G+GF+A+ + FRNTAGP+ HQAVA R QSD S   +C  EG+QDTLY +T+
Sbjct  366   FLTATFVAQGEGFMAQSMGFRNTAGPDEHQAVAIRVQSDRSVFLNCRFEGFQDTLYAYTH  425

Query  1546  RQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQN  1725
             RQ+YR+CVI GTIDFIFG   A+ QN  I  RK L  Q NT++A G+       G V+  
Sbjct  426   RQYYRSCVIVGTIDFIFGDAAAIFQNCNIFIRKGLSGQKNTVSAQGRVDKFQTTGFVIHK  485

Query  1726  CRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMY  1905
             C+I     L P++ + K+Y GRPWK YS TVVMES I D++ P+GW  W+  +F    +Y
Sbjct  486   CKITANEDLKPVKAEYKSYLGRPWKNYSRTVVMESTIEDVIDPVGWLRWEETDFAIDTLY  545

Query  1906  Y-EYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             Y EYKN GP  +T  R   +  F V+    A ++T G +L  + W+ A G P  +G
Sbjct  546   YAEYKNKGPSGDTASR-VTWPGFKVINKEEALNYTVGPFLQGD-WINALGSPVKLG  599



>ref|NP_195049.1| putative pectinesterase/pectinesterase inhibitor 45 [Arabidopsis 
thaliana]
 sp|Q9SMY6.1|PME45_ARATH RecName: Full=Putative pectinesterase/pectinesterase inhibitor 
45; Includes: RecName: Full=Pectinesterase inhibitor 45; AltName: 
Full=Pectin methylesterase inhibitor 45; Includes: RecName: 
Full=Pectinesterase 45; Short=PE 45; AltName: Full=Pectin 
methylesterase 45; Short=AtPME45 [Arabidopsis thaliana]
 emb|CAB36797.1| pectinesterase-like protein [Arabidopsis thaliana]
 emb|CAB80040.1| pectinesterase-like protein [Arabidopsis thaliana]
 gb|AEE86193.1| putative pectinesterase/pectinesterase inhibitor 45 [Arabidopsis 
thaliana]
Length=609

 Score =   378 bits (970),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 211/532 (40%), Positives = 295/532 (55%), Gaps = 22/532 (4%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATT--KDFIFAAIKATLEEVHKSHQLVVNTKI  657
             K + T C    YK  C  ++ +     +  T  +  + +AI A  +++ +  + V++ K 
Sbjct  93    KIIQTLCNSTLYKPTCQNTLKNETKKDTPQTDPRSLLKSAIVAVNDDLDQVFKRVLSLKT  152

Query  658   EQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQT  837
             E   D     AI  CK ++ +A ++L  S+  + D+E++        L +W+SAV +YQ 
Sbjct  153   ENKDD---KDAIAQCKLLVDEAKEELGTSMKRINDSEVNNFAKIVPDLDSWLSAVMSYQE  209

Query  838   TCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnn  1017
             TC +  E    K+ I     ++  LT+N++ +I  +   L +     T  LL   +    
Sbjct  210   TCVDGFEEGKLKTEIRKNFNSSQVLTSNSLAMIKSLDGYLSSVPKVKTRLLLEARSSAK-  268

Query  1018  nnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGALKS  1197
                         +TDH   W    +R++L A     L+PN  VAKDGSG F TI  ALK+
Sbjct  269   ------------ETDHITSWLSNKERRMLKAVDVKALKPNATVAKDGSGNFTTINAALKA  316

Query  1198  YPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKTA  1377
              P K++ +Y IY+K G+YDE V + KK  NV M GDG+ KTI+TG K++A  KI T  TA
Sbjct  317   MPAKYQGRYTIYIKHGIYDESVIIDKKKPNVTMVGDGSQKTIVTGNKSHAK-KIRTFLTA  375

Query  1378  TFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFY  1557
             TF A G+GF+A+ + FRNTAGPEGHQAVA R QSD S   +C  EGYQDTLY +T+RQ+Y
Sbjct  376   TFVAQGEGFMAQSMGFRNTAGPEGHQAVAIRVQSDRSVFLNCRFEGYQDTLYAYTHRQYY  435

Query  1558  RNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCRIV  1737
             R+CVI GT+DFIFG   A+ QN  I  RK L  Q NT+TA G+       G V+ NC + 
Sbjct  436   RSCVIIGTVDFIFGDAAAIFQNCDIFIRKGLPGQKNTVTAQGRVDKFQTTGFVIHNCTVA  495

Query  1738  PETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFE-KTCMYYEY  1914
             P   L P++ + K+Y GRPWK +S TVVMES I D++ P+GW  W   +F   T  Y EY
Sbjct  496   PNEDLKPVKAQFKSYLGRPWKPHSRTVVMESTIEDVIDPVGWLRWQETDFAIDTLSYAEY  555

Query  1915  KNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             KN GP   T  R + +  F VL    A  FT G +L    W+ A G P  +G
Sbjct  556   KNDGPSGATAARVK-WPGFRVLNKEEAMKFTVGPFLQG-EWIQAIGSPVKLG  605



>ref|XP_002878962.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55221.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=619

 Score =   378 bits (970),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 214/547 (39%), Positives = 311/547 (57%), Gaps = 39/547 (7%)
 Frame = +1

Query  439   ASSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTK--DFIFAAIKATL  612
             A  G+GD        K + T C    YK  C +++ +      A      F+ +AI+A  
Sbjct  105   AKPGQGD--------KIIQTICGSTLYKRACEETLKNRTEKGFALANPTSFLKSAIEAVN  156

Query  613   EEVHKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRA  792
             E++ +  + V++ K E   D     AI  CK +++DA ++  AS++ +  TE+++     
Sbjct  157   EDLDRVLEKVLSLKTENQDD---RDAIAQCKLLVEDAKEETAASLNKINGTEVNSFAKVV  213

Query  793   DQLLNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNI  972
               L +W+SAV +YQ TC +  E    KS ++  + ++  LT+N++ +I        +F++
Sbjct  214   PDLESWLSAVMSYQETCLDGFEEGTLKSEVKKSVNSSQVLTSNSLAMIT-------SFDV  266

Query  973   TTTTDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAK  1152
               +  +                +R LL  D  P W    DR++L A     L+PN  VAK
Sbjct  267   NLSPVM-------------KVATRHLL--DDIPSWVSNEDRRMLRAVDVKALKPNATVAK  311

Query  1153  DGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITG  1332
             DGSG F TI  AL++ P K++ +Y+IYVK G+YDE V V KK  N+ M GDG+ KTI+TG
Sbjct  312   DGSGNFTTINDALRAMPEKYEGRYIIYVKQGIYDESVTVDKKKANLTMVGDGSQKTIVTG  371

Query  1333  KKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIE  1512
              K++A  KI T  TATF A G+GF+A+ + FRNTAGPEGHQAVA R QSD S   +C  E
Sbjct  372   NKSHAK-KIRTFLTATFVAQGEGFMAQSMGFRNTAGPEGHQAVAIRVQSDRSIFLNCRFE  430

Query  1513  GYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKEL  1692
             GYQDTLY +T+RQ+YR+CVI GTIDFIFG   A+ QN  I  RK L  Q NT+TA G+  
Sbjct  431   GYQDTLYAYTHRQYYRSCVIVGTIDFIFGDAAAIFQNCNIFIRKGLPGQKNTVTAQGRVD  490

Query  1693  AKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIW  1872
                  G V+ NC+I     L P++ + K+Y GRPWK YS T++MES+I +++ P+GW  W
Sbjct  491   KFQTTGFVVHNCKIAANEDLKPVKEEYKSYLGRPWKNYSRTIIMESKIENVIDPVGWLRW  550

Query  1873  DGENFEKTCMYY-EYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPAT  2049
                +F    +YY EY N G   +T  R + +  F V+    A +FT G +L  + W+ A+
Sbjct  551   QETDFAIDTLYYAEYNNKGSSGDTTSRVK-WPGFKVINKEEALNFTVGPFLQGD-WISAS  608

Query  2050  GVPFAIG  2070
             G P  +G
Sbjct  609   GSPVKLG  615



>ref|XP_009421439.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=556

 Score =   375 bits (964),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 211/543 (39%), Positives = 304/543 (56%), Gaps = 33/543 (6%)
 Frame = +1

Query  445   SGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVH  624
             S   D  +ST S+K+V  FC+  +YK+ C  ++S VA    A  K+ +  A   T++ ++
Sbjct  32    SQSADPQLST-SVKNVQDFCRPTDYKETCENTLSSVAG-PDADPKELLNLAFNITVKHIN  89

Query  625   KS--HQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQ  798
              +  H  V++   E + DP    A+E+C+E+L  AIDDL+ S+  +GD  +  L    D 
Sbjct  90    DAIDHSTVLS---EAAKDPSTSEALENCRELLDYAIDDLRRSVDRLGDFSVANLDKFLDD  146

Query  799   LLNWMSAVYAYQTTCTEQIESRLYKS--AIEDGMINATQLTNNAINIIAEMSKLLKAFNI  972
             L  W+SA   YQ TC +  E     +  ++   + ++++LT+N + I+      L + N+
Sbjct  147   LKIWLSATITYQETCVDGFEGTTTNAGESMRKMLNSSSELTSNILAIVNNFDDTLSSLNL  206

Query  973   TTTTDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAK  1152
                                   +R+LL  + +P +     R+LLA     +L+PNVVVA+
Sbjct  207   PI--------------------NRKLL-AEGYPSYVTPGKRRLLATST-ADLKPNVVVAQ  244

Query  1153  DGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITG  1332
             DGSG  KTI  A+   P K    ++I++K G Y E V V K   NV + GDG  KT ITG
Sbjct  245   DGSGDVKTIGEAISRVPNKGADIFIIHIKEGEYKEKVHVNKSATNVMLIGDGPTKTKITG  304

Query  1333  KKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIE  1512
               NY      T  TAT + +G GFVA+ +   N+AG E HQAVA R QSDMS  ++C I+
Sbjct  305   SLNYVD-GTRTFDTATVAVVGDGFVAKDLWIENSAGAEKHQAVALRVQSDMSVFYNCRID  363

Query  1513  GYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKEL  1692
             GYQDTLY HT+RQFYR+C ISGTIDFIFG   ++ QN +I+ARKPL +Q N +TA G+++
Sbjct  364   GYQDTLYVHTHRQFYRDCTISGTIDFIFGDSASIFQNCLILARKPLDNQQNIVTAQGRKM  423

Query  1693  AKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIW  1872
              +    ++L NC I  + A    R K+ T+ GRPWK YS T +++SQI DL+ P GW  W
Sbjct  424   RQQASAIILHNCTISADPAYYDFRTKLPTFLGRPWKMYSRTFILQSQIDDLIHPDGWLPW  483

Query  1873  DGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATG  2052
              G+    TC Y E  N GPGA+  +R   +K    +    A+ F+   +L    WLP TG
Sbjct  484   FGDFGLNTCFYTEVDNRGPGADKSKR-VTWKGVKNIDYAHAKKFSVQQFLHGGKWLPRTG  542

Query  2053  VPF  2061
             VPF
Sbjct  543   VPF  545



>ref|XP_008245483.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score =   376 bits (965),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 215/555 (39%), Positives = 316/555 (57%), Gaps = 40/555 (7%)
 Frame = +1

Query  451   KGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKS  630
             K + G +T S K++   CQ  +YK+ C KS+     N S   K+ I A  K  ++   K 
Sbjct  42    KSNDGQTTTSTKAIQAICQPTDYKETCQKSLESAGVN-STEPKELIKAGFKVAMD---KL  97

Query  631   HQLVVNTKI--EQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLL  804
             H+++ N+    E + DP  + A+E+CKE+L  AI DL AS   +G  ++  +   A+ L 
Sbjct  98    HEVIKNSTTLQELAKDPGANQALENCKELLDYAIGDLAASFDKLGPFDISKIDAYAEDLK  157

Query  805   NWMSAVYAYQTTCTEQIESRLYKSAIE-DGMINATQ-LTNNAINIIAEMSKLLKAFNITT  978
              W+SA   Y+ TC +  ++    +  +   ++N+TQ LT+N + +++E++ +L +FN+  
Sbjct  158   IWLSAAMTYEQTCLDGFQNTTGDAGEKMKRLLNSTQELTSNGLAMVSEITSVLGSFNV--  215

Query  979   TTDLLHKAADKnnnnnnnTTSRRLLQT-------DHFPEWFPI-ADRKLLAAQRR--GNL  1128
                                + RRLL          + P+  P+  D++ +   R    +L
Sbjct  216   -----------------KQSQRRLLAAGAGGGTKKNTPKVIPVWIDKRTMDVARATPQSL  258

Query  1129  RPNVVVAKDGSGQFKTITGALKSYPPKHKAK-YVIYVKAGVYDEIVEVGKKMKNVFMYGD  1305
             +P+V VAKDGSGQ K+I  A+K  P  +  K +VIYVK GVY+E V + K M NV M GD
Sbjct  259   KPDVTVAKDGSGQVKSIGEAVKQIPKNNADKTFVIYVKEGVYNEYVMIDKFMTNVMMIGD  318

Query  1306  GAGKTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDM  1485
             G  KT ITG KNYA     T +TAT + +G  FVA+ I F N+AG +GHQAVA R QSD+
Sbjct  319   GPTKTKITGNKNYAD-GTKTFQTATVAVVGDYFVAKDIGFENSAGAKGHQAVALRVQSDL  377

Query  1486  SAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFN  1665
             S  ++C ++GYQDTLY  T+RQFYR+C ISGTIDFIFG    + QN  +I RKP+ +Q  
Sbjct  378   SIFYNCQMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAVVFQNCKMIVRKPMDNQAC  437

Query  1666  TITADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDL  1845
              +TA G+   +    +VLQNC I  +     ++ K K Y GRPWKA + T+VM+SQI D+
Sbjct  438   MVTAQGRMDRRQPTAMVLQNCTISGDPEYILVKDKSKAYLGRPWKALARTIVMQSQIDDI  497

Query  1846  LSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLD  2025
             ++P GW  W G    K+C + EY N GPG++  RR   +     L P  A  FTAG  ++
Sbjct  498   ITPEGWMEWTGSTNHKSCWFGEYGNRGPGSDMTRR-VTWSGIKKLTPEHAVDFTAGRLME  556

Query  2026  ANSWLPATGVPFAIG  2070
              + W+  +GVP+  G
Sbjct  557   GDKWIKPSGVPYVAG  571



>ref|XP_007154534.1| hypothetical protein PHAVU_003G126700g [Phaseolus vulgaris]
 gb|ESW26528.1| hypothetical protein PHAVU_003G126700g [Phaseolus vulgaris]
Length=605

 Score =   377 bits (967),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 206/534 (39%), Positives = 306/534 (57%), Gaps = 15/534 (3%)
 Frame = +1

Query  478   SMKSVTTFCQYAEYKDVCAKSISHVANNHS--ATTKDFIFAAIKATLEEVHKSHQLVVNT  651
             S K V   C  A++KD C   ++    +    +  KD +   +K   EE+ K+     + 
Sbjct  83    SEKIVQVVCSSADFKDRCEAPLNKAMQDDPKLSEPKDLLKIYVKLAEEELSKAFNSTKSV  142

Query  652   KIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAY  831
             K +   +     A EDC+++ +DA DD+  SIS +  TEL  +  +   L +W+SAV ++
Sbjct  143   KFDSEEE---KGAFEDCQKLFEDAKDDIATSISELSKTELKNISDKTPDLNSWLSAVISF  199

Query  832   QTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADK  1011
             Q TC +       K+ + + M ++ +  +N++ I+++++  L      +T   +   +  
Sbjct  200   QQTCMDGFPEGNIKTELHNLMNDSKEFVSNSLAILSQVASAL------STLQNIDAPSHG  253

Query  1012  nnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGAL  1191
              +  ++N+ +  L +TD FP W    DR++L A       PNV VAKDGSG FKTI+  L
Sbjct  254   RSLLSSNSPAATLDKTDGFPSWINQEDRRILKAVDN-KPAPNVTVAKDGSGNFKTISECL  312

Query  1192  KSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSK  1371
              + P  ++ +YVIYVK G+YDE V + K M+N+ MYGDG+ KTI+TG KN+    +    
Sbjct  313   NAVPQNYEGRYVIYVKEGIYDEPVMITKNMQNITMYGDGSQKTIVTGNKNFRD-GVRVFL  371

Query  1372  TATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQ  1551
             TA+F   G GF    + FRNTAGP G QAVA R QSD S   +C  EGYQ TL+   +RQ
Sbjct  372   TASFVVEGDGFTGMAMGFRNTAGPGGSQAVAARVQSDRSVFANCRFEGYQSTLFTQAHRQ  431

Query  1552  FYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCR  1731
             FYR+C+++GT+DFIFG    ++QN I+I RKP   Q NT+TA G+E  +   G+VLQ C 
Sbjct  432   FYRSCIVTGTVDFIFGDAAVVLQNCILIIRKPDDSQQNTVTAQGREDKQQATGIVLQKCT  491

Query  1732  IVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYE  1911
             I  +  L  ++ KV++Y GRPWK YS TVVMES+I D++ P GW  W G+   KT  Y E
Sbjct  492   IKADDELLTVKDKVRSYLGRPWKLYSRTVVMESEISDIIHPDGWTAWIGDFALKTLYYAE  551

Query  1912  YKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIGY  2073
             Y N+G G++T  R + +  + V+    A  FT G +L   SW+  TGVP   G+
Sbjct  552   YGNTGAGSSTNARIK-WPGYRVINKEEATMFTPGSFLRG-SWVQGTGVPSTQGF  603



>ref|XP_010547008.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X2 [Tarenaya hassleriana]
Length=570

 Score =   375 bits (964),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 215/546 (39%), Positives = 302/546 (55%), Gaps = 32/546 (6%)
 Frame = +1

Query  454   GDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHK--  627
             GD  + T + K+V   C+  +YK+ C  S+   A+ +S    D I      T+  +H+  
Sbjct  43    GDSQIKT-TTKAVQAVCEPTDYKETCVHSL-MAASPNSTQPLDLIRLGFNLTINSIHQGI  100

Query  628   ---SHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQ  798
                +H+L    K     DP    A++ C+E++ DAIDDL+          L+  +   + 
Sbjct  101   KKAAHEL----KARAEKDPETKGALDLCQELMIDAIDDLKKCFDKFDGFNLNEAEEFVED  156

Query  799   LLNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINAT--QLTNNAINIIAEMSKLLKAFNI  972
             L  W+S   A+Q TC +  E      A E   I  T  +LT+N + +++ +S LL  FNI
Sbjct  157   LRVWLSGSIAFQQTCMDTFEEIKSDLAQEMAKIFKTSKELTSNGLAMVSGLSMLLPQFNI  216

Query  973   TTTTDLLHKAADKnnnnnnnTTSRRLLQT-DHFPEWFPIADRKLLAAQRRGNLRPNVVVA  1149
             T     L   A            R+LL T D FP W     RKL+AA +   ++PN VVA
Sbjct  217   TGVRGDLGSYA------------RKLLSTEDGFPTWMRPEARKLMAA-KGTKVKPNAVVA  263

Query  1150  KDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIIT  1329
              DGSGQFK+I  ALK+ P K+K  +VIY+K G+Y E V+V K M  V   GDG  KT IT
Sbjct  264   LDGSGQFKSINAALKTVPMKNKFPFVIYIKQGIYKEKVDVTKTMSYVTFIGDGPTKTRIT  323

Query  1330  GKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSI  1509
             G  N+   K+ T +TAT +  G+ F A+ I F NTAGP+GHQAVA R  +D +   +C I
Sbjct  324   GNLNFGMGKVKTYQTATVAVNGEHFTAKDIGFENTAGPKGHQAVALRVSADYAVFHNCQI  383

Query  1510  EGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKE  1689
             +GYQDTLY H++RQFYR+C ISGTID+IFG   +  QN  ++ RKP+  Q   +TA G+ 
Sbjct  384   DGYQDTLYAHSHRQFYRDCTISGTIDYIFGDAKSFFQNCNMVVRKPMGGQSCMVTAQGRT  443

Query  1690  LAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKI  1869
               +   G+VL NCRI  + A  P++   K Y GRPWK +S T++M + I D++ P GW  
Sbjct  444   DKRETTGIVLHNCRITGDPAYIPVKKTNKAYLGRPWKQFSRTIIMRTTIEDIIDPKGWLE  503

Query  1870  WDGENFEKTCMYYEYKNSGPGANTWRRNR--AFKKFDVLGPIRARHFTAGLWLDANSWLP  2043
             W+G     T  Y E++N GPG+N   R +    KKF    P +A  FTAG +L   +W+P
Sbjct  504   WNGNFALDTLEYAEFENKGPGSNQATRVKWPGIKKFT---PRQAGEFTAGKFLQGGTWIP  560

Query  2044  ATGVPF  2061
              T VP+
Sbjct  561   QTQVPY  566



>ref|XP_004229265.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=548

 Score =   375 bits (962),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 213/549 (39%), Positives = 308/549 (56%), Gaps = 40/549 (7%)
 Frame = +1

Query  436   DASSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLE  615
             D   G  + G+ST S KSV   CQ  +YK+ C KS++   N  ++  K+ I  A ++T+ 
Sbjct  33    DGGDGASNGGIST-STKSVQAMCQPTDYKEACEKSLASAKN--TSDPKELIKVAFESTIT  89

Query  616   EVHKSHQLVVNTKI--EQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHR  789
             ++  +   + NT +  + + DP    A+  C  +L  +IDDL+ S   VG  +++ +K  
Sbjct  90    DIKNA---IKNTDLIKDAANDPRTKEALNTCDGLLDVSIDDLRRSFDKVGTFDINKIKDY  146

Query  790   ADQLLNWMSAVYAYQTTCTEQIESRLYKSA--IEDGMINATQLTNNAINIIAEMSKLLKA  963
              D L  W+SA   YQ TC +  ++    +   ++  +  A +LT+N + +I     +L  
Sbjct  147   TDDLKTWISASITYQETCLDAFQNTSGDTGEKMKKLLKTAGELTSNGLAMITSFGDMLTN  206

Query  964   FNITTTTDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVV  1143
              NI                      SRRLL  D +  +     R+LL      N +PN V
Sbjct  207   MNIPGI-------------------SRRLL-ADDYTSFVEDGSRRLLQVS---NTKPNAV  243

Query  1144  VAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTI  1323
             VA DGSGQFKTI  ALK  PPK+   YVI +KAG Y E+V++ + + NV   G+G  KT 
Sbjct  244   VALDGSGQFKTIKEALKGVPPKNIQPYVILIKAGEYKEMVDIPRGVTNVVFIGEGPTKTK  303

Query  1324  ITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDC  1503
             ITG KNYA     T  T+T +  G GFVA+ I F NTAG   HQAVA R  +D +  ++C
Sbjct  304   ITGNKNYAD-GTATFHTSTVAVNGDGFVAKDIGFENTAGAMKHQAVALRVSADKTVFYNC  362

Query  1504  SIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADG  1683
             +I+GYQDTLY H+YRQFY++C ISGTIDFIFG  +A+ QN  +I RKP  +Q   +TA G
Sbjct  363   NIDGYQDTLYTHSYRQFYKDCSISGTIDFIFGDASAVFQNCKMIVRKPGANQACMVTAQG  422

Query  1684  KELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGW  1863
             ++  +  G ++L+NC I  E A    +  +K Y GRPWK YS T++M+SQI   + P GW
Sbjct  423   RKDHRGVGAIILRNCEISAEPAFINTQPPIKAYLGRPWKEYSRTIIMQSQIDAFIDPEGW  482

Query  1864  KIWDGENFEKTCMYY-EYKNSGPGANTWRRNR--AFKKFDVLGPIRARHFTAGLWLDANS  2034
               W+G NF    +YY EY+N GPGANT RR +   +KK   + P  A  +   +++D +S
Sbjct  483   APWNG-NFALNTLYYAEYQNRGPGANTDRRVKWAGYKK--SISPQEAEKYAPNIFIDQDS  539

Query  2035  WLPATGVPF  2061
             W+  TG+ +
Sbjct  540   WIKKTGISY  548



>ref|XP_008458409.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=575

 Score =   375 bits (963),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 204/550 (37%), Positives = 304/550 (55%), Gaps = 32/550 (6%)
 Frame = +1

Query  448   GKGDHGVST-----GSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATL  612
             G+GD G  T      S K++   CQ  +YK+ C KS+   A N +   K+ +    K   
Sbjct  47    GEGDQGSKTTPEISSSTKAIQAICQPTDYKETCEKSLMAEAGN-TTDPKELVKVGFKIAT  105

Query  613   EEVHKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRA  792
               ++++ +     + E S DP  + A+++C+E+L+ AIDDL  S   +G  ++  L    
Sbjct  106   RSLNEAIRNSTTLQ-ELSKDPRTNQALQNCRELLEYAIDDLNESFERIGTFQMSKLDEFV  164

Query  793   DQLLNWMSAVYAYQTTCTEQIESRLYKSA--IEDGMINATQLTNNAINIIAEMSKLLKAF  966
               L  W+S    Y+ TC +  E+    +   +++ + +A ++T N + I+ E+S +L + 
Sbjct  165   ADLKIWLSGALTYEQTCLDGFENTTGDAGTRMQEFLKSAQEMTTNGLGIVNELSTILGSL  224

Query  967   NITTTTDLLHKAADKnnnnnnnTTSRRLLQTD--HFPEWFPIADRKLLAAQRRGNLRPNV  1140
              I                     T RRLL+ D    P W     R+L+ A   G ++P++
Sbjct  225   QIP------------------GMTGRRLLEDDDHEMPSWISDGKRRLMQAGAAG-MKPDL  265

Query  1141  VVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKT  1320
             +VA+DGSG++KTI  AL   P K    +VIYVKAG+Y EIV + K M ++ MYGDG  KT
Sbjct  266   IVAQDGSGKYKTINAALADVPLKSNKTFVIYVKAGIYKEIVVIPKHMTHLTMYGDGPTKT  325

Query  1321  IITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFD  1500
             ++TG  N+    I T KTATFSA+G  F AR + F NTAG   HQAVA R QSD S  ++
Sbjct  326   VVTGSLNFID-GIQTFKTATFSAIGANFYARDMGFENTAGSAKHQAVALRVQSDRSIFYN  384

Query  1501  CSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITAD  1680
             C I+GYQDTLY H +RQFYR+C ISGTIDF+FG      QN  ++ RKP+ +Q   +TA 
Sbjct  385   CQIDGYQDTLYAHAHRQFYRDCTISGTIDFVFGNAATNFQNCKLVVRKPMDNQQCIVTAH  444

Query  1681  GKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLG  1860
             G+   K    ++ Q C  + + A  P +   K Y GRPWK YS T+++ SQI D++ P G
Sbjct  445   GRMNRKEPTALIFQGCHFMGDPAYLPFKSINKAYLGRPWKQYSRTIIIGSQIDDIIQPEG  504

Query  1861  WKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWL  2040
             W  W G+    T  Y E +N GPGA   +R + ++    + P  A  FT   ++D ++W+
Sbjct  505   WLPWMGDFGLNTLFYAEVQNKGPGAVETKRVK-WRGIKHITPQHAADFTPRRFIDGDAWI  563

Query  2041  PATGVPFAIG  2070
             PA G+P++ G
Sbjct  564   PAKGIPYSSG  573



>ref|XP_010024084.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Eucalyptus grandis]
Length=575

 Score =   375 bits (963),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 205/542 (38%), Positives = 305/542 (56%), Gaps = 33/542 (6%)
 Frame = +1

Query  472   TGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNT  651
             + S+K++   CQ  +YK+ C +S+     N +A  K+ I A+ KA ++ + ++ +     
Sbjct  54    SASIKAIEGICQPTDYKEACVRSLREAGAN-TADPKELIKASFKAAMKHIAEAAKKSTVL  112

Query  652   KIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAY  831
             K E    P    A+ +CK+++  AI+DL+ S   +G+ E   L      L  W+SAV  Y
Sbjct  113   K-ELEKTPRAQQALSNCKKLMGFAINDLERSFDKLGELEFSKLDDALADLKVWLSAVVTY  171

Query  832   QTTCTEQIESRLYKSA--IEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAA  1005
             Q TC +  ++    +   + + + ++ +LT+N + ++ E+S  L   N+T          
Sbjct  172   QDTCLDGFQNTTGNAGHKMREALKSSEELTSNVLAMVDEISLALAKMNLTNF--------  223

Query  1006  DKnnnnnnnTTSRRLLQTDH-------FPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSG  1164
                        +R+LL  D+       F  W     RKLL+ +    L+PN+VVAKDGSG
Sbjct  224   -----------NRKLLSDDNVIGHGDDFSMWATSLKRKLLS-KTVAKLKPNLVVAKDGSG  271

Query  1165  QFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNY  1344
             +F+TI  ALK  P   +  +V+++KAGVY E V   +KM NV + GDG  KT I+  KNY
Sbjct  272   RFRTINEALKHIPLNSRKTFVLHIKAGVYKEQVVFDEKMTNVMLVGDGPTKTRISFNKNY  331

Query  1345  AHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQD  1524
             A    TT KTAT S  G  F+AR I F N+AG   HQAVA   +SDM+   +C ++GYQD
Sbjct  332   AD-GTTTFKTATVSVFGDNFIARDIGFENSAGAIKHQAVALMVRSDMAIFHNCHMDGYQD  390

Query  1525  TLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAK  1704
             TLY H+ RQFYR+C I+GTIDF+ G   A+ QN  ++ RKPL +Q   +TA G+   +  
Sbjct  391   TLYAHSKRQFYRDCTITGTIDFVLGDAAAVFQNCKMLIRKPLDNQQCIVTAQGRSKRREA  450

Query  1705  GGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGEN  1884
               ++LQNC I  + +  P + ++ +Y GRPWKAYS T++MES I D++ P GW  W G+ 
Sbjct  451   SALILQNCTITADPSYTPFKGQILSYLGRPWKAYSRTIIMESYIDDIIQPKGWMPWLGDF  510

Query  1885  FEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFA  2064
                TC Y EYKN GPGA+T RR + +K    + P  A  FTAG ++  + W+   GVP+ 
Sbjct  511   GLNTCFYAEYKNRGPGASTARRVK-WKGIKKITPQHAVEFTAGRFMKGDRWIRTAGVPYV  569

Query  2065  IG  2070
              G
Sbjct  570   AG  571



>ref|XP_002512459.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF49911.1| Pectinesterase precursor, putative [Ricinus communis]
Length=582

 Score =   375 bits (964),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 202/552 (37%), Positives = 306/552 (55%), Gaps = 43/552 (8%)
 Frame = +1

Query  472   TGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNT  651
             + SMK++ T CQ   YK  C +S++  A N +   K+ I  A K   +++  + +  + T
Sbjct  57    SASMKAIKTLCQPTYYKQTCERSLAKSAGN-TTDPKELIKIAFKLAEKQIDSASKKSL-T  114

Query  652   KIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAY  831
              +E   DP    A+  CKE++  +I++L++S+  V D +   L      +  W+SA   Y
Sbjct  115   LLELEKDPRTRGALNSCKELMTMSINELRSSLEKVADFDFSQLDELMADIKTWLSAAITY  174

Query  832   QTTCTEQIESRLYKSA--IEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAA  1005
             + TC +  E+    +   ++  +  A ++++N ++I++ +S +L    I           
Sbjct  175   EETCLDAFENTTTNAGEKMKKALKTAMEMSSNGLDIVSGISSVLTDLQIPGV--------  226

Query  1006  DKnnnnnnnTTSRRLLQTD-----------HFPEWFPIADRKLLAAQRRGNLRPNVVVAK  1152
                        SRRLLQ D            FP W     R+LL+A    N++P++VVAK
Sbjct  227   -----------SRRLLQDDIPVAGHGDISQAFPAWIDPGTRRLLSAPP-SNIKPDLVVAK  274

Query  1153  DGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITG  1332
             DGSG +KTI  AL   P K    +V+Y+K G+Y+E VE  + M N+ + GDG  KT ITG
Sbjct  275   DGSGDYKTILEALPQIPKKSNETFVLYIKEGIYEEYVEFNRSMTNLVVIGDGPDKTRITG  334

Query  1333  KKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIE  1512
              KN+    I T +TAT + +G  FVAR I F N+AG   HQAVA R  SD +  ++CS++
Sbjct  335   SKNFVD-GINTYRTATVAVIGDNFVARNIGFENSAGAIKHQAVALRVSSDYAVFYNCSMD  393

Query  1513  GYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKEL  1692
             GYQDTLY H  RQFYR+C +SGTIDF+FG    + QN   + RKPL +Q   +TA G++ 
Sbjct  394   GYQDTLYTHAKRQFYRDCTVSGTIDFVFGDAPVVFQNCTFLVRKPLENQQCIVTAQGRKA  453

Query  1693  AKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIW  1872
              +    +++QN  I     L P++ + K+Y GRPWK +S T++ME+ I DL+ P GW  W
Sbjct  454   RRQPSAIIIQNSTITAHPELEPVKDQYKSYLGRPWKEFSRTIIMETFIDDLIQPEGWSPW  513

Query  1873  DGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARH---FTAGLWLDANSWLP  2043
              G    KTC Y EY N GPG++   +NR   K++ + P+  +H   FT G +L  +SW+ 
Sbjct  514   FGSFGLKTCWYGEYNNYGPGSDM--KNRV--KWNGIKPVSRQHAIDFTPGRFLRGDSWIK  569

Query  2044  ATGVPFAIGYTK  2079
              TGVP+A   T+
Sbjct  570   PTGVPYAPYLTR  581



>emb|CDY38523.1| BnaC03g26740D [Brassica napus]
Length=603

 Score =   376 bits (965),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 216/534 (40%), Positives = 303/534 (57%), Gaps = 35/534 (7%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANN----HSATTKDFIFAAIKATLEEVHKSHQLVVNT  651
             K + T C    YK  C  ++ +         S TT  F+ AAI+A  E++ +  + V++ 
Sbjct  96    KIIETLCSTTLYKVSCENTLKNRTEKGFAVESPTT--FLKAAIEAVNEDLDRVLEKVLSL  153

Query  652   KIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAY  831
             K E   D     AI  CK +++DA +++ AS++ V  TE++        L NW+SAV +Y
Sbjct  154   KTENQDD---KDAIAQCKLLVEDAKEEIVASLNKVNGTEINNFVKIVPDLDNWLSAVMSY  210

Query  832   QTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADK  1011
             Q TC +  E    KS ++  + ++  LT+N++ +I                    K+ D 
Sbjct  211   QETCIDGFEEGNLKSEVKKTVNSSQVLTSNSLALI--------------------KSFDA  250

Query  1012  nnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGAL  1191
             N +      +R LL  D  P W    DR++L A     L PN  VAKDGSG F TI  AL
Sbjct  251   NISPVEKVATRHLL--DQIPSWVTNEDRRMLRAVDVETLNPNATVAKDGSGNFTTINDAL  308

Query  1192  KSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSK  1371
             K+ P K++ +Y+IYVK GVYDE V V KK  N+ M GDG+ KTI+TG K++A  KI T  
Sbjct  309   KAMPEKYEGRYIIYVKQGVYDESVTVDKKKANLTMVGDGSQKTIVTGNKSHAK-KIRTFL  367

Query  1372  TATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQ  1551
             TATF A G+GF+A+ + FRNTAGP+ HQAVA R QSD S   +C  EG+QDTLY +T+RQ
Sbjct  368   TATFVAQGEGFMAQSMGFRNTAGPDEHQAVAIRVQSDRSVFLNCRFEGFQDTLYAYTHRQ  427

Query  1552  FYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCR  1731
             +YR+CVI GT+DFIFG   A+ QN  I  RK L  Q NT++A G+       G V+  C+
Sbjct  428   YYRSCVIVGTVDFIFGDAAAIFQNCNIFIRKGLSGQKNTVSAQGRVDKFQTTGFVIHKCK  487

Query  1732  IVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYY-  1908
             I     L P++ + K+Y GRPWK YS T+VMES I D++ P+GW  W+  +F    +YY 
Sbjct  488   ITANEDLKPVKAEYKSYLGRPWKNYSRTIVMESTIEDVIDPIGWLRWEETDFAIDTLYYA  547

Query  1909  EYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             EYKN GP  +T  R   +  F V+    A ++T G +L  + W+ A G P  +G
Sbjct  548   EYKNKGPSGDTASR-VTWPGFKVINKEEALNYTVGPFLQGD-WINALGSPVKLG  599



>emb|CBI39537.3| unnamed protein product [Vitis vinifera]
Length=769

 Score =   381 bits (978),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 206/555 (37%), Positives = 304/555 (55%), Gaps = 38/555 (7%)
 Frame = +1

Query  445   SGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVH  624
             SG       + SMK++   CQ  +YKD C  S++  A N +   KD + AA  + +E  H
Sbjct  44    SGNAQKQEISSSMKAIQAICQPTDYKDACVNSLTSKAGN-TTDPKDLVQAAFASAME--H  100

Query  625   KSHQLVVNTKIEQ-STDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQL  801
              S     +T +++ + DP    A+++C++++  AIDDL+ S + VGD +   + +    +
Sbjct  101   LSAAAKNSTLLQELNKDPRASQALQNCEDLVNYAIDDLKKSFNQVGDFDYSKMDNIIADI  160

Query  802   LNWMSAVYAYQTTCTEQIESRLYKSA--IEDGMINATQLTNNAINIIAEMSKLLKAFNIT  975
               W+SAV  YQ TC +  E+    +   +   +  + +L++N + I+ E+S +L    + 
Sbjct  161   KIWLSAVITYQETCLDGFENTTGDAGEKMRQILKTSMELSSNGLAIVGEVSSILSNLQLA  220

Query  976   TTTDLLHKAADKnnnnnnnTTSRRLLQTD----------HFPEWFPIADRKLLAAQRRGN  1125
                                  +RRLL  D           FP W     RKLL A     
Sbjct  221   NL-------------------NRRLLSDDPADPDNHIDDEFPYWSHSEGRKLLQANV-SE  260

Query  1126  LRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGD  1305
             L+PN+ VAKDGSG FKTI  A++  P      +++Y+K G+Y+E V++ K   N+ M GD
Sbjct  261   LKPNLTVAKDGSGDFKTINEAIRQLPKFSNQTFILYIKKGIYEEQVQINKTFTNLMMVGD  320

Query  1306  GAGKTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDM  1485
             G  KT ITG  N+      T KTAT + LG GF+A+GI F N+AG   HQAVA R QSD 
Sbjct  321   GPTKTKITGSLNFVD-GTPTFKTATVAVLGDGFIAKGIGFENSAGAAKHQAVALRVQSDR  379

Query  1486  SAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFN  1665
             S  ++C ++GYQDTLY HT RQFYR+C ISGTIDFIFG    + QN   + RKPL +Q  
Sbjct  380   SIFYNCQMDGYQDTLYTHTKRQFYRDCTISGTIDFIFGDAAVIFQNCTFVVRKPLDNQQC  439

Query  1666  TITADGKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDL  1845
              +TA G++  +    +++QN     +    P R ++K+Y GRPWK +S T++MES I DL
Sbjct  440   IVTAQGRKERRQPSAIIIQNSTFTADPEYYPYRNELKSYLGRPWKEFSRTIIMESYIEDL  499

Query  1846  LSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLD  2025
             + P GW  W G+   +TC Y E++N GPGA T  R + ++    + P  A  F  G +L 
Sbjct  500   IQPSGWLPWAGDFALRTCFYTEFRNRGPGAKTHDRVK-WRGIKTIKPSHAIDFAPGRFLS  558

Query  2026  ANSWLPATGVPFAIG  2070
              + W+P+TGVP+  G
Sbjct  559   GDRWIPSTGVPYNSG  573



>ref|XP_011006446.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
 ref|XP_011010878.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
Length=571

 Score =   375 bits (962),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 207/546 (38%), Positives = 304/546 (56%), Gaps = 28/546 (5%)
 Frame = +1

Query  442   SSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEV  621
             SS KG   +ST S KS+   CQ  +Y++ C +S+S  A N +  +K  + A  K T+E +
Sbjct  47    SSPKGQ--ISTTS-KSIKAICQPTDYRETCEESLSKAAGNTTDPSK-LVQAGFKVTIEAL  102

Query  622   HKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQL  801
               +       K E + DP    A+++C+E++ DAI +L+ S  ++   +        + L
Sbjct  103   QNAINRSTTLK-ELAKDPMASQALDNCRELMDDAIAELEHSFDLIESFQASQFDEYVNNL  161

Query  802   LNWMSAVYAYQTTCTEQIESRLYKSA--IEDGMINATQLTNNAINIIAEMSKLLKAFNIT  975
               W+SA   YQ TC +  ++    +   +++ ++ ++QLT+N + ++  ++ +LK  NI 
Sbjct  162   KVWLSATITYQRTCLDGFDNTTGSAGEKMKELLMASSQLTSNGLAMVDGVTSILKDLNIP  221

Query  976   TTTDLLHKAADKnnnnnnnTTSRRLLQTD-HFPEWFPIADRKLLAAQRRGNLRPNVVVAK  1152
                                 TSRRLL+ D  FP W     R LL  +    ++ + +VA+
Sbjct  222   ------------------GLTSRRLLEADDEFPSWVNGGKRMLLLKETPATIKADAIVAQ  263

Query  1153  DGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITG  1332
             DGSGQ+KTI  A++  P K+   +V+Y+K GVY E V + +   +V M GDG  KT ITG
Sbjct  264   DGSGQYKTIAEAIEKIPKKNNETFVLYIKEGVYKEQVSLARSHTHVLMIGDGPTKTKITG  323

Query  1333  KKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIE  1512
               NYA+  + T KTAT S  G  F+A+ I F N+AG  GHQAVA R Q+DMS  ++C I+
Sbjct  324   NLNYAN-GVQTFKTATVSISGDHFMAKDIGFENSAGAIGHQAVALRVQADMSVFYNCQID  382

Query  1513  GYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKEL  1692
             GYQDTLY HT RQFYR+C I+GTIDFIFG   A+ QN  ++ RKPL +Q   +TA G+  
Sbjct  383   GYQDTLYAHTKRQFYRDCTITGTIDFIFGDAIAVFQNCKLVVRKPLENQQCIVTAQGRNE  442

Query  1693  AKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIW  1872
              +   G V+QNC I  +    P+R + K Y GRPW+  S T+VM+S I DL++P GW  W
Sbjct  443   TREPTGFVIQNCTITADPKYFPVRLQNKAYLGRPWRELSRTIVMQSHIDDLIAPEGWLPW  502

Query  1873  DGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATG  2052
              G     T  Y EY N G GA    R + +     L P  A  +TA  ++  + W+P TG
Sbjct  503   LGNFGLNTLFYSEYDNKGQGAVETNRVK-WAGIKKLTPEAADGYTAAKFIQGDEWIPQTG  561

Query  2053  VPFAIG  2070
             VP+  G
Sbjct  562   VPYTAG  567



>ref|XP_004958780.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Setaria italica]
Length=565

 Score =   374 bits (961),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 220/553 (40%), Positives = 294/553 (53%), Gaps = 34/553 (6%)
 Frame = +1

Query  433   DDASSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTK--DFIFAAIKA  606
             + +S G+GD  +S  S+KSV  FCQ  +Y+  C   +S  A N S+ T+    IF     
Sbjct  29    NSSSKGEGDDNLSM-SVKSVKAFCQPTDYQQTCEAELSKAAGNASSPTELAKVIFGV---  84

Query  607   TLEEVHKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKH  786
             T +++HK+      T  E   D     A+++CKEML+ AIDDL++S   +G  E+   K 
Sbjct  85    TSDKIHKAISESA-TLTELKNDKRTSGALQNCKEMLEYAIDDLKSSFDKLGGFEMTNFKK  143

Query  787   RADQLLNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAF  966
               D L  W+SA   YQ TC              DG +NAT    +A        K+  A 
Sbjct  144   AVDDLKTWLSAALTYQDTCL-------------DGFMNATTTEASA--------KMQNAL  182

Query  967   NITT--TTDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFP-IADRKLL-AAQRRGNLRP  1134
             N +   T D+L      ++     +  RRLL  D  P W P  A R LL A+      +P
Sbjct  183   NASQELTEDILAVVDQFSDTLGGLSIGRRLLGDDGAPAWMPDAASRHLLEASPESPEFKP  242

Query  1135  NVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAG  1314
             NV VA DGSG  KTI  AL   PPK+ A YV+YVKAG Y E V V +   NV   GDGA 
Sbjct  243   NVTVAADGSGDVKTIKEALDKVPPKNAAMYVVYVKAGTYKEYVSVARPQTNVAFIGDGAD  302

Query  1315  KTIITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAI  1494
             KTIITG KN+  M +TT  TAT  A+G GF  +G+   NTAG E HQAVA R QSD +  
Sbjct  303   KTIITGNKNF-KMNLTTKDTATMEAIGNGFFMKGVRVENTAGAENHQAVALRVQSDQAVF  361

Query  1495  FDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTIT  1674
             + C+ +GYQDTLY H  RQF+R+C ++GTIDFIFG    ++QN +I  RKP+ +Q N IT
Sbjct  362   YQCTFDGYQDTLYTHAQRQFFRDCTVTGTIDFIFGNSQVVLQNCLIQPRKPMDNQANIIT  421

Query  1675  ADGKELAKAKGGVVLQNCRIVPETALNP-LRFKVKTYFGRPWKAYSTTVVMESQIGDLLS  1851
             A G+   ++ GG VL NC I P          K+ TY  RPWK YS T+ +++ IG  + 
Sbjct  422   AQGRRDKRSVGGTVLHNCTIEPHPDFKADAGGKIPTYLARPWKEYSRTLYIQNDIGGFID  481

Query  1852  PLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDAN  2031
             P GW  W+G+   +T  Y E  N G GA+  +R +      V      + FT   ++   
Sbjct  482   PKGWLEWNGDFGLQTLFYAEVDNRGAGADMSKRAKWGGIKTVTYEEAQKEFTVETFIQGQ  541

Query  2032  SWLPATGVPFAIG  2070
              ++P  GVPF  G
Sbjct  542   QFIPKFGVPFIPG  554



>ref|XP_010472674.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13 
[Camelina sativa]
Length=608

 Score =   375 bits (964),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 211/530 (40%), Positives = 301/530 (57%), Gaps = 31/530 (6%)
 Frame = +1

Query  490   VTTFCQYAEYKDVCAKSISHVANNHSATTKD--FIFAAIKATLEEVHKSHQLVVNTKIEQ  663
             + T C    YK  C K++ +      A      F+ +AI+A  E++    + V++ K E 
Sbjct  103   IETLCSSTLYKQTCEKTLKNRTEKGFALANPTTFLKSAIEAVNEDLDLVLEKVLSLKTEN  162

Query  664   STDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTC  843
               D     AI  CK ++++A ++  AS+  +  TE+++       L +W+SAV +YQ TC
Sbjct  163   QDD---KDAIAQCKLLVEEAKEETAASLEKINITEVNSFAKVVPDLDSWLSAVISYQETC  219

Query  844   TEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnnnn  1023
              +  E    KS ++  + ++  L +N++ +I                    K+ D + + 
Sbjct  220   LDGFEEGSLKSEVKKSVNSSQILASNSLAMI--------------------KSFDASLSP  259

Query  1024  nnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGALKSYP  1203
                  +R LL  D  P W    DR++L A     L+PN  VAKDGSG F TI  AL + P
Sbjct  260   VMKLATRHLL--DEIPSWVSNEDRRMLRAVDVKALKPNATVAKDGSGNFTTINDALSAMP  317

Query  1204  PKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKTATF  1383
              K++ +Y+IY+K GVYDE V V KK  N+ M GDG+ KTI+TG K++A  KI T  TATF
Sbjct  318   EKYEGRYIIYIKQGVYDESVIVDKKKANLTMVGDGSQKTIVTGNKSHAK-KIRTFLTATF  376

Query  1384  SALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRN  1563
              A G+GF+A+ + FRNTAGPEGHQAVA R QSD S   +C  EGYQDTLY +T+RQ+YR+
Sbjct  377   VAQGEGFMAQSMGFRNTAGPEGHQAVAIRVQSDRSIFLNCRFEGYQDTLYAYTHRQYYRS  436

Query  1564  CVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCRIVPE  1743
             CVI GT+DFIFG   A+ QN  I  RK L  Q NT+TA G+       G V+ NC+I   
Sbjct  437   CVIVGTVDFIFGDAAAIFQNCNIFIRKGLPGQKNTVTAQGRVDKFQTTGFVVHNCKIAAN  496

Query  1744  TALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYY-EYKN  1920
               L P++ + K+Y GRPWK YS T+VMES I D++ P+GW  W   +F    +YY EYKN
Sbjct  497   EDLKPVKAEYKSYLGRPWKNYSRTIVMESTIEDVIDPVGWLRWQETDFAIDTLYYAEYKN  556

Query  1921  SGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
              GP  +T  R + +  F V+    A ++T G +L  + W+ A+G P  +G
Sbjct  557   KGPSGDTTSRVK-WPGFKVINKEEALNYTVGPFLQGD-WINASGSPVKLG  604



>ref|NP_850077.1| probable pectinesterase/pectinesterase inhibitor 13 [Arabidopsis 
thaliana]
 sp|Q7Y201.2|PME13_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
13; Includes: RecName: Full=Pectinesterase inhibitor 13; AltName: 
Full=Pectin methylesterase inhibitor 13; Includes: RecName: 
Full=Pectinesterase 13; Short=PE 13; AltName: Full=Pectin 
methylesterase 13; Short=AtPME13 [Arabidopsis thaliana]
 gb|AEC07840.1| probable pectinesterase/pectinesterase inhibitor 13 [Arabidopsis 
thaliana]
Length=614

 Score =   375 bits (964),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 213/544 (39%), Positives = 312/544 (57%), Gaps = 39/544 (7%)
 Frame = +1

Query  448   GKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSA--TTKDFIFAAIKATLEEV  621
             G+GD        K + T C    Y  +C K++ +  +   A      F+ +AI+A  E++
Sbjct  103   GQGD--------KIIQTLCSSTLYMQICEKTLKNRTDKGFALDNPTTFLKSAIEAVNEDL  154

Query  622   HKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQL  801
                 + V++ K E   D     AIE CK +++DA ++  AS++ +  TE+++ +     L
Sbjct  155   DLVLEKVLSLKTENQDD---KDAIEQCKLLVEDAKEETVASLNKINVTEVNSFEKVVPDL  211

Query  802   LNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTT  981
              +W+SAV +YQ TC +  E    KS ++  + ++  LT+N++ +I   ++     N++  
Sbjct  212   ESWLSAVMSYQETCLDGFEEGNLKSEVKTSVNSSQVLTSNSLALIKTFTE-----NLSPV  266

Query  982   TDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGS  1161
               ++                R LL  D  P W    DR++L A     L+PN  VAKDGS
Sbjct  267   MKVVE---------------RHLL--DDIPSWVSNDDRRMLRAVDVKALKPNATVAKDGS  309

Query  1162  GQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKN  1341
             G F TI  AL++ P K++ +Y+IYVK G+YDE V V KK  N+ M GDG+ KTI+TG K+
Sbjct  310   GDFTTINDALRAMPEKYEGRYIIYVKQGIYDEYVTVDKKKANLTMVGDGSQKTIVTGNKS  369

Query  1342  YAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQ  1521
             +A  KI T  TATF A G+GF+A+ + FRNTAGPEGHQAVA R QSD S   +C  EGYQ
Sbjct  370   HAK-KIRTFLTATFVAQGEGFMAQSMGFRNTAGPEGHQAVAIRVQSDRSIFLNCRFEGYQ  428

Query  1522  DTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKA  1701
             DTLY +T+RQ+YR+CVI GTIDFIFG   A+ QN  I  RK L  Q NT+TA G+     
Sbjct  429   DTLYAYTHRQYYRSCVIVGTIDFIFGDAAAIFQNCNIFIRKGLPGQKNTVTAQGRVDKFQ  488

Query  1702  KGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGE  1881
               G V+ NC+I     L P++ + K+Y GRPWK YS T++MES+I +++ P+GW  W   
Sbjct  489   TTGFVVHNCKIAANEDLKPVKEEYKSYLGRPWKNYSRTIIMESKIENVIDPVGWLRWQET  548

Query  1882  NFEKTCMYY-EYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVP  2058
             +F    +YY EY N G   +T  R + +  F V+    A ++T G +L  + W+ A+G P
Sbjct  549   DFAIDTLYYAEYNNKGSSGDTTSRVK-WPGFKVINKEEALNYTVGPFLQGD-WISASGSP  606

Query  2059  FAIG  2070
               +G
Sbjct  607   VKLG  610



>gb|KDO39972.1| hypothetical protein CISIN_1g039111mg [Citrus sinensis]
Length=595

 Score =   375 bits (962),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 210/553 (38%), Positives = 312/553 (56%), Gaps = 24/553 (4%)
 Frame = +1

Query  460   HGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQL  639
             H   + SMK++ T CQ  +Y+  C +S+   + N +   K+ I AA +   + V  + + 
Sbjct  49    HDQVSASMKAIKTVCQPTDYQKQCVESLQTESGN-TTDPKELIRAAFQVAKKHVAAAAKR  107

Query  640   VVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLN----  807
                 K +   DP   +A+EDC E++ +AI+DLQ S   +G ++    +++   ++N    
Sbjct  108   SRTLK-QLEKDPRASLALEDCNELMDEAIEDLQRSFEELGKSDRQA-RYKMGPMINNLKT  165

Query  808   WMSAVYAYQTTCTEQIESRLYKSAIE--DGMINATQLTNNAINIIAEMSKLLKAFNITTT  981
             W+S+   YQ TC +  E+   ++ ++  + +  + +LT NAI +++++S +L   +I   
Sbjct  166   WLSSTITYQETCLDGFENTTGEAGVKMREILKTSIELTINAIAMVSKISSILGNLDINRE  225

Query  982   TDL---LHKAADKnnnnnnnTTSRRLLQ-TDHFPEWFPIADRKLLAAQRRGNLRPNVVVA  1149
              +L    H+   +NN          +L+  D +P W    +RKLL    +   +P+VVVA
Sbjct  226   INLGSSHHRGLIENNAKVLGHGGIHVLEHGDLYPSWLGPRNRKLLGLIDQAQFKPDVVVA  285

Query  1150  KDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIIT  1329
             KDGSG   TI  AL   P K      IY+K G+Y E V + + M  VFM GDG  KT IT
Sbjct  286   KDGSGNCTTINEALNFIPKKSNKTTTIYIKEGIYQEKVYLNRSMARVFMIGDGMYKTRIT  345

Query  1330  GKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSI  1509
             G  NY      T  TAT S LG+ F+A+ I F N+AGPE HQAVA R  +DMS  ++CS+
Sbjct  346   GNLNYVD-GTPTMHTATVSVLGEFFMAKNIGFENSAGPEKHQAVALRVDADMSIFYNCSM  404

Query  1510  EGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKE  1689
             +GYQDTLY H  RQ+YR+C I+GTIDFIFG G+A  QN  II RKPL +Q   +TA G+ 
Sbjct  405   DGYQDTLYTHAKRQYYRDCTITGTIDFIFGDGSAFFQNCKIIVRKPLDNQHCIVTAQGRN  464

Query  1690  LAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKI  1869
             +      +V+QN  I+ +    P+R K+K+Y GRPW+ +S TV+ME+ I DL+ P GW  
Sbjct  465   VTHQPTAIVIQNSSIIADHVYWPVRNKIKSYLGRPWRIHSRTVIMETFIDDLIQPQGWLP  524

Query  1870  WDGENFEKTCMYYEYKNSGPGAN-----TWRRNRAFKKFDVLGPIRARHFTAGLWLDANS  2034
             W+GE    TC Y EY N GPGAN     TW+  ++  + +      A  FTAG + D + 
Sbjct  525   WEGEFGIHTCFYAEYGNYGPGANKTGRVTWQGVKSIDRLE-----EAFEFTAGKFFDGDD  579

Query  2035  WLPATGVPFAIGY  2073
             W+   GVP+  G+
Sbjct  580   WIKPRGVPYVSGF  592



>ref|XP_006472135.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Citrus sinensis]
Length=599

 Score =   375 bits (962),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 210/553 (38%), Positives = 312/553 (56%), Gaps = 24/553 (4%)
 Frame = +1

Query  460   HGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQL  639
             H   + SMK++ T CQ  +Y+  C +S+   + N +   K+ I AA +   + V  + + 
Sbjct  53    HDQVSASMKAIKTVCQPTDYQKQCVESLQTESGN-TTDPKELIRAAFQVAKKHVAAAAKR  111

Query  640   VVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLN----  807
                 K +   DP   +A+EDC E++ +AI+DLQ S   +G ++ H  +++   ++N    
Sbjct  112   SRTLK-QLEKDPRASLALEDCNELMDEAIEDLQRSFEELGKSD-HQARYKMGPMINNLKT  169

Query  808   WMSAVYAYQTTCTEQIESRLYKSAIE--DGMINATQLTNNAINIIAEMSKLLKAFNITTT  981
             W+S+   YQ TC +   +   ++ ++  + +  + +LT NAI +++++S +L   +I   
Sbjct  170   WLSSTITYQETCLDGFANTTGEAGVKMREILKTSIELTINAIAMVSKISSILGNLDINRE  229

Query  982   TDL---LHKAADKnnnnnnnTTSRRLLQ-TDHFPEWFPIADRKLLAAQRRGNLRPNVVVA  1149
              +L    H+   +NN          +L+  D +P W    +RKLL    +   +P+VVVA
Sbjct  230   INLGSSHHRGLIENNAKVLGHGGIHVLEHGDLYPSWLGPRNRKLLGLIDQAQFKPDVVVA  289

Query  1150  KDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIIT  1329
             KDGSG   TI  AL   P K      IY+K G+Y E V + + M  VFM GDG  KT IT
Sbjct  290   KDGSGNCTTINEALNFIPKKSNKTTTIYIKEGIYQEKVYLNRSMARVFMIGDGMYKTRIT  349

Query  1330  GKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSI  1509
             G  NY      T  TAT S LG+ F+A+ I F N+AGPE HQAVA R  +DMS  ++CS+
Sbjct  350   GNLNYVD-GTPTMHTATVSILGEFFMAKNIGFENSAGPEKHQAVALRVDADMSIFYNCSM  408

Query  1510  EGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKE  1689
             +GYQDTLY H  RQ+YR+C I+GTIDFIFG G+A  QN  II RKPL +Q   +TA G+ 
Sbjct  409   DGYQDTLYTHAKRQYYRDCTITGTIDFIFGDGSAFFQNCKIIVRKPLDNQHCIVTAQGRN  468

Query  1690  LAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKI  1869
             +      +V+QN  I+ +    P+R K+K+Y GRPW+ +S TV+ME+ I DL+ P GW  
Sbjct  469   VTHQPTAIVIQNSSIIADHVYWPVRNKIKSYLGRPWRIHSRTVIMETFIDDLIQPQGWLP  528

Query  1870  WDGENFEKTCMYYEYKNSGPGAN-----TWRRNRAFKKFDVLGPIRARHFTAGLWLDANS  2034
             W+GE    TC Y EY N GPGAN     TW+  ++  + +      A  FTAG + D + 
Sbjct  529   WEGEFGIHTCFYAEYGNYGPGANKTGRVTWQGVKSIDRLE-----EAFEFTAGKFFDGDD  583

Query  2035  WLPATGVPFAIGY  2073
             W+   GVP+  G+
Sbjct  584   WIKPRGVPYVSGF  596



>emb|CDO98832.1| unnamed protein product [Coffea canephora]
Length=569

 Score =   374 bits (959),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 200/550 (36%), Positives = 315/550 (57%), Gaps = 32/550 (6%)
 Frame = +1

Query  433   DDASSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATL  612
             + A+SG G   VST S KSV + C++ +YK  C +S+S   N  ++  ++ I  A  A +
Sbjct  37    ETATSGGGSDQVSTSS-KSVESVCKHVDYKQTCEQSLSGAKN--TSDPRELIKLAFTAAV  93

Query  613   EEVHKSHQLVVNTKIEQST--DPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKH  786
             + +     ++ N+ + Q+   DP  H A+E CK  L  +I+DLQ S   VG  +++ +  
Sbjct  94    DNIAS---VIQNSTLLQNAAKDPRTHQALETCKYALNTSIEDLQRSFETVGTFDINKIDD  150

Query  787   RADQLLNWMSAVYAYQTTCTEQIESRLYKSA--IEDGMINATQLTNNAINIIAEMSKLLK  960
                 L  W+SA   +Q TC +  E+    +   ++  +  A +LT+N + ++ ++S++L 
Sbjct  151   YVADLKTWLSAAGTFQETCLDAFENTTGDTGEQMKKLLKTAGELTSNGLAMVTDISEVLT  210

Query  961   AFNITTTTDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNV  1140
              FNI                       RRL+ +   P++     RKL+AA    +L+PN 
Sbjct  211   NFNI-------------------QGFKRRLMSSSVEPDFVDATARKLMAAST-ASLKPNA  250

Query  1141  VVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKT  1320
             VVA+DGSGQFK+I  A+ + P K+   +VI++KAG+Y E V + K +  + + G+G  KT
Sbjct  251   VVAQDGSGQFKSIMAAVNTVPKKNNQTFVIFIKAGIYKEYVTLPKHVNGIVLVGEGPTKT  310

Query  1321  IITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFD  1500
              ITG KN+    + T +T T S  G   + + +   N+AG   HQAVA R   D + +++
Sbjct  311   KITGNKNFVD-GVGTFQTPTLSVNGDATILKDLGIENSAGAVKHQAVALRVSGDRTIVYN  369

Query  1501  CSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITAD  1680
             C I+ YQDTLY HTYRQ+YRNC ISGTIDFIFG  +A+ Q+  ++ RKP+ +Q   +TA 
Sbjct  370   CQIDAYQDTLYTHTYRQYYRNCTISGTIDFIFGDASAVFQDCKMVVRKPMENQGCMVTAQ  429

Query  1681  GKELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLG  1860
             G++  +  G +VLQNC+IV + A   ++  +K Y GRPWK +S T++M++ I   ++P G
Sbjct  430   GRKERRGIGAIVLQNCQIVADPAFLAVQPPIKAYLGRPWKEFSRTIIMQTSIDGFIAPEG  489

Query  1861  WKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWL  2040
             W  W G     TC Y EY N GPGA+T +R + +K    + P  A+ FT G ++  ++W+
Sbjct  490   WSPWMGNFGMDTCYYAEYNNRGPGADTSKRVQ-WKGIKKITPQIAQSFTPGAYIQGDAWI  548

Query  2041  PATGVPFAIG  2070
              A+GVP+A G
Sbjct  549   TASGVPYAPG  558



>ref|NP_001169525.1| pectinesterase [Zea mays]
 gb|ACN34013.1| unknown [Zea mays]
 tpg|DAA40126.1| TPA: pectinesterase [Zea mays]
Length=630

 Score =   375 bits (964),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 216/529 (41%), Positives = 306/529 (58%), Gaps = 15/529 (3%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQ  663
             KS+   C   +Y D C KS+   AN  S++ KD I +A++   + + ++        +  
Sbjct  106   KSIKAMCSQTDYTDACEKSLGKAANASSSSPKDIIRSAVEVIGDAIGQAFD---RADLIL  162

Query  664   STDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTC  843
             S DP    A+ DCKE+  DA DDL +++  V D +   +  +  QL  W+SAV A   TC
Sbjct  163   SNDPLVKGAVADCKEVFADAKDDLNSTLMGVDDKD--GIAKQGYQLRIWLSAVIANMETC  220

Query  844   TEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnnnn  1023
              +      +K+ +++      +LT+NA+ +I + S LL A    +   LL    ++    
Sbjct  221   IDGFPDEEFKTKVKESFTEGKELTSNALALIEKGSSLLSALKGVSKRRLLE---EEQGAA  277

Query  1024  nnnTTSRRLLQTDHFPEWFPIADRKLL-AAQRRGNLRPNVVVAKDGSGQFKTITGALKSY  1200
                + +   L  D  PEW P  +R++L     +  L PNVVVAKDGSG+FKTI  AL + 
Sbjct  278   AAASQAGPALDKDGIPEWVPDGERRVLKGGGFKNTLTPNVVVAKDGSGKFKTINEALSAM  337

Query  1201  PPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKTAT  1380
             P  +  +YVI VK GVY+E V + K MKNV + GDG+ K+I+TGKK++A   ITT KTAT
Sbjct  338   PKTYDGRYVIQVKEGVYEEYVTITKTMKNVTLLGDGSKKSIVTGKKSFAD-GITTFKTAT  396

Query  1381  FSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYR  1560
             F+A G GF+A G+ F+NTAG E HQAVA   QSD S   +C ++G+QDTLY H+  QFYR
Sbjct  397   FTAQGDGFMAIGMGFQNTAGAEKHQAVALLVQSDKSIFLNCKMDGFQDTLYAHSKAQFYR  456

Query  1561  NCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCRIVP  1740
             NC+ISGT+DFIFG   A+ QN I++ R+P+ +Q N +TA G+  A+   G VLQ C    
Sbjct  457   NCIISGTVDFIFGDAAAVFQNCILVLRRPMDNQQNIVTAQGRADAREATGFVLQKCEFQA  516

Query  1741  ETAL-NPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYK  1917
             E AL +  R  ++ Y GRPW+  S TVVMES++ D +   G+  W+G+   KT  Y E+ 
Sbjct  517   EAALRDAKRPAIRNYLGRPWRECSRTVVMESELPDFIDKAGYLPWNGDFGLKTLWYAEFG  576

Query  1918  NSGPGANTWRRNR--AFKKFDVLGPIRARHFTAGLWLDANSWLPATGVP  2058
             N+GPGA+T  R     FKK  V+    A  FT   +L A  W+  TG P
Sbjct  577   NTGPGASTAGRVSWPGFKK--VISKADATKFTVENFLHAQPWIDPTGTP  623



>ref|XP_010437784.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45 
[Camelina sativa]
Length=609

 Score =   375 bits (962),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 214/533 (40%), Positives = 299/533 (56%), Gaps = 24/533 (5%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATT--KDFIFAAIKATLEEVHKSHQLVVNTKI  657
             K + T C    YK VC K++ +     +  +  +  + +AI A  E++ +  + V++ K 
Sbjct  93    KIIQTLCHSTLYKPVCEKTLKNGTKKDTPLSDPRRLLESAIVAVNEDLDRVFKKVLSLKT  152

Query  658   EQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQT  837
             E   D     AI  CK ++ +A ++L  S   + DTE++     A  L +W+SAV +YQ 
Sbjct  153   ENKDD---KDAIAQCKLLVDEAKEELGTSAKRINDTEVNNFAKVAPYLDSWLSAVMSYQE  209

Query  838   TCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnn  1017
             +C +  E    K+ I     ++  LT+N++ +I  +   L +     T  LL        
Sbjct  210   SCVDGFEEGKLKTEIRKNFNSSQVLTSNSLAMIKSLDGYLTSVPKVKTRHLLE-------  262

Query  1018  nnnnnTTSRRL-LQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGALK  1194
                    SR L +QTDH   W    +R++L A     L+PN  VAKDGSG+F TI  ALK
Sbjct  263   -------SRSLAVQTDHTTSWLSKKERRMLKAVDVKALKPNATVAKDGSGKFTTINDALK  315

Query  1195  SYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKT  1374
             + P K++ +Y+IYVK GVYDE V V KK  NV M GDG+ KTI+TG K++A  KI T  T
Sbjct  316   AMPAKYQGRYIIYVKHGVYDESVIVDKKKANVTMIGDGSQKTIVTGNKSHAK-KIQTFLT  374

Query  1375  ATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQF  1554
             ATF A G+GF+A+ + FRNTAGPEGHQAVA R QSD S   +C  EGYQDTL+ +T+RQ+
Sbjct  375   ATFVAQGEGFMAQSMGFRNTAGPEGHQAVAIRVQSDRSVFLNCRFEGYQDTLHAYTHRQY  434

Query  1555  YRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCRI  1734
             Y++CVI GT+DFIFG   A+ QN  I  RK    Q NT+TA G+       G V+ NC I
Sbjct  435   YKSCVIVGTVDFIFGDAAAIFQNCDIFIRKGSPGQKNTVTAQGRVDKFQTTGFVIHNCTI  494

Query  1735  VPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYY-E  1911
              P   L P + + K+Y GRPWK +S TVVMES I D++ P+GW  W   ++    ++Y E
Sbjct  495   APNEDLKPAKAQFKSYLGRPWKKHSRTVVMESTIEDVIDPVGWLRWQETDYAVDTLFYAE  554

Query  1912  YKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             YKN GP   T  R + +  F V+    A  +T G +L    W+   G P   G
Sbjct  555   YKNDGPSGATASRVK-WPGFRVIKKEEAMKYTVGPFLQGE-WINGIGSPVKFG  605



>ref|XP_006285466.1| hypothetical protein CARUB_v10006885mg [Capsella rubella]
 gb|EOA18364.1| hypothetical protein CARUB_v10006885mg [Capsella rubella]
Length=623

 Score =   375 bits (962),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 219/535 (41%), Positives = 296/535 (55%), Gaps = 26/535 (5%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATT--KDFIFAAIKATLEEVHKSHQLVVNTKI  657
             K + T C    YK VC K++ +     +  +  +  + +AI A  E++ +  + VV+ K 
Sbjct  105   KIIQTLCNSTLYKPVCEKTLKNGTKTDTPLSDPRGLLKSAIVAVNEDLDRVFKKVVSLKT  164

Query  658   EQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQT  837
             E+  D     AI  CK ++ +A ++L  S+  + DTE +        L +W+SAV +YQ 
Sbjct  165   EKKDD---KDAIAQCKLLVDEAKEELGTSVKRINDTEANNFGKVVPDLDSWLSAVMSYQE  221

Query  838   TCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnn  1017
             TC +  E    K+ I     ++  LT+N++ +I  +   L       T  LL        
Sbjct  222   TCVDGFEDGKLKTEIRKSFNSSQVLTSNSLAMIKSIDGYLSPVPKLKTRHLLE-------  274

Query  1018  nnnnnTTSRR--LLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGAL  1191
                    SRR   ++ DH   W    +R++L A     L+PN  VAKDGSG F TI  AL
Sbjct  275   -------SRRSSAVEKDHSTSWLSNKERRMLKAVDVKALKPNATVAKDGSGNFTTINDAL  327

Query  1192  KSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSK  1371
             K+ P K+K +Y+IYVK GVYDE V V KK  NV M GDG+ KTI+TG K++A  KI T  
Sbjct  328   KAMPAKYKGRYIIYVKHGVYDESVIVDKKKANVTMIGDGSQKTIVTGNKSHAK-KIRTFL  386

Query  1372  TATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQ  1551
             TATF A G+GF+A+ + FRNTAGPEGHQAVA R QSD S   +C  EGYQDTLY +T+RQ
Sbjct  387   TATFVAQGEGFMAQSMGFRNTAGPEGHQAVAIRVQSDRSVFLNCRFEGYQDTLYAYTHRQ  446

Query  1552  FYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCR  1731
             +YR+CVI GT+DFIFG   A+ QN  I  RK L  Q NT+TA G+       G V+ NC 
Sbjct  447   YYRSCVIVGTVDFIFGDAAAIFQNCDIFIRKGLPGQKNTVTAQGRVDKFQTTGFVIHNCT  506

Query  1732  IVPETALNPL-RFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYY  1908
             I P   L P  + + K+Y GRPWK  S TVVMES I D++ P+GW  W   +F    ++Y
Sbjct  507   IAPNEDLKPAKKTEFKSYLGRPWKKQSRTVVMESTIEDVIDPVGWLRWQETDFAVDTLFY  566

Query  1909  -EYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
              EYKN GP   T  R + +  F VL    A  +T G +L    W+   G P   G
Sbjct  567   GEYKNDGPSGATASRVK-WPGFRVLKKEEAMKYTVGPFLQG-EWIHEIGSPVKFG  619



>ref|XP_010546739.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=666

 Score =   376 bits (965),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 201/553 (36%), Positives = 307/553 (56%), Gaps = 38/553 (7%)
 Frame = +1

Query  433   DDASSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATL  612
             D+A    G +G  T S+K++   C   +YK  C ++++  A N +    + +  A   T+
Sbjct  42    DNADKKTGGNGEITASVKAIKEVCAPTDYKKTCEETLTKNAKN-TTDPMELVKTAFDVTM  100

Query  613   EEVHKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRA  792
             +++ ++ +    T +E   DP   MA++ C+E++  AID+L++S   +G  E H L    
Sbjct  101   KQIAEAAK-KSQTLVELQKDPRTKMALDQCRELMNYAIDELKSSFEELGKFEFHKLDEAL  159

Query  793   DQLLNWMSAVYAYQTTCTEQIESRLYKSA--IEDGMINATQLTNNAINIIAEMSKLLKAF  966
               L  W+SA  +++TTC E  E     +   ++  +  A QLT+N + +++EMS  +   
Sbjct  160   INLRIWLSAAISHETTCLEGFEQTQGNAGETMKKALKTAIQLTHNGLAMVSEMSNFVGQL  219

Query  967   NITTTTDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVV  1146
             +I                      SRRLL +D +P W     R LLAA     ++P++VV
Sbjct  220   DIP------------------GLNSRRLLSSD-YPSWVGPRSRHLLAATE---VKPDIVV  257

Query  1147  AKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTII  1326
             A+DGSGQ+KTI  AL + P K  + +V+++KAG+Y E ++V + M N+   GDG  KTII
Sbjct  258   AQDGSGQYKTINEALDNIPKKRNSTFVVHIKAGLYKEYIQVNRSMTNLVFIGDGPDKTII  317

Query  1327  TGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCS  1506
             +G K +    ITT +T T + +G  F+A+ I F NTAG   HQAVA R QSDM+   +C 
Sbjct  318   SGDKGFKD-GITTFRTQTVAIIGDNFIAKNIGFENTAGAIKHQAVAVRVQSDMAVFHNCR  376

Query  1507  IEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGK  1686
              +GYQDTLY H++RQF+R+C ISGTIDF+FG    + QN  ++ RKPL +Q   ITA G+
Sbjct  377   FDGYQDTLYTHSHRQFFRDCTISGTIDFLFGDSATVFQNCTLLVRKPLPNQACPITAHGR  436

Query  1687  ELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWK  1866
             +  +   G V Q CRI  E     ++   K Y GRPWK YS T++M + I D + P GW+
Sbjct  437   QDPREPTGFVFQGCRIEGEPDYLAVKASSKAYLGRPWKEYSRTIIMNTFIPDFVQPQGWQ  496

Query  1867  IWDGENFEKTCMYYEYKNSGPGAN-----TWRRNRAFKKFDVLGPIRARHFTAGLWLDAN  2031
              W+ +   KT  Y E +N+GPG++     TW   +     D+        FT   ++  +
Sbjct  497   PWNADFGLKTLFYSEIQNTGPGSDLASRVTWAGIKKLTSKDI------DQFTPAKFIQGD  550

Query  2032  SWLPATGVPFAIG  2070
             SW+PATGVP+  G
Sbjct  551   SWIPATGVPYTPG  563



>ref|XP_010431632.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13 
[Camelina sativa]
Length=744

 Score =   378 bits (970),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 217/544 (40%), Positives = 306/544 (56%), Gaps = 39/544 (7%)
 Frame = +1

Query  448   GKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSA--TTKDFIFAAIKATLEEV  621
             G+GD        K + T C    YK  C K++ +      A      F+ +AI+A  E++
Sbjct  233   GQGD--------KIIETLCSSTLYKQTCEKTLKNRTEKGFALDNPTTFLTSAIEAVSEDL  284

Query  622   HKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQL  801
                 + V++ K E   D     AI  CK ++++A ++  AS+  +  TE+ +       L
Sbjct  285   DLVLEKVLSLKTENQDD---KDAIAQCKLLVEEAKEETAASLKKINITEVDSFAKVVPDL  341

Query  802   LNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTT  981
              +W+SAV +YQ TC +  E    KS +++ + ++  LT+N++ +I               
Sbjct  342   DSWLSAVISYQETCLDGFEEGSLKSEVKNSVNSSQILTSNSLAMI---------------  386

Query  982   TDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGS  1161
                  K+ D + +      +R LL  D  P W    DR++L A     L+PN  VAKDGS
Sbjct  387   -----KSFDASLSPVMKLATRHLL--DEIPSWVSNEDRRMLRAVDVKALKPNATVAKDGS  439

Query  1162  GQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKN  1341
             G F TI  AL + P K++ +Y+IY+K GVYDE V V KK  N+ M GDG+ KTI+TG K+
Sbjct  440   GNFTTINDALSAMPEKYEGRYIIYIKQGVYDESVIVDKKKANLTMVGDGSQKTIVTGNKS  499

Query  1342  YAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQ  1521
              A  KI T  TATF A G+GF+A+ + FRNTAGPEGHQAVA R QSD S   +C  EGYQ
Sbjct  500   NAK-KIRTFLTATFVAQGEGFMAQSMGFRNTAGPEGHQAVAIRVQSDRSIFLNCRFEGYQ  558

Query  1522  DTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKA  1701
             DTLY +T+RQ+YR+CVI GTIDFIFG   A+ QN  I  RK L  Q NT+TA G+     
Sbjct  559   DTLYAYTHRQYYRSCVIIGTIDFIFGDAAAIFQNCNIFIRKGLPGQKNTVTAQGRVDKFQ  618

Query  1702  KGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGE  1881
               G V+ NC+I     L P++ + K+Y GRPWK YS T+VMES I D++ P+GW  W   
Sbjct  619   TTGFVVHNCKIAANEDLKPVKAEYKSYLGRPWKNYSRTIVMESTIEDVIDPVGWLRWQET  678

Query  1882  NFEKTCMYY-EYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVP  2058
             +F    +YY EYKN GP  +T  R + +  F V+    A ++T G +L  + W+ A+G P
Sbjct  679   DFAIDTLYYAEYKNKGPSGDTTSRVK-WPGFKVINREEALNYTVGPFLQGD-WINASGSP  736

Query  2059  FAIG  2070
               +G
Sbjct  737   VKLG  740


 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 67/139 (48%), Gaps = 13/139 (9%)
 Frame = +1

Query  448  GKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANN--HSATTKDFIFAAIKATLEEV  621
            G+GD        K + T C    YK  C +++ +        A    F+ +AI+A  E++
Sbjct  98   GQGD--------KIIETLCSSTIYKQTCEQTLKNRTEKGFALANPTTFLKSAIEAVNEDL  149

Query  622  HKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQL  801
                + V++ K E   D     AI  CK ++++A ++  AS+  +  TE+++       L
Sbjct  150  DLVLEKVLSLKTENQDD---KDAIAQCKLLVEEAKEETAASLKKINITEVNSFAKVVPDL  206

Query  802  LNWMSAVYAYQTTCTEQIE  858
             +W+SAV +YQ TC +  E
Sbjct  207  DSWLSAVISYQETCLDGFE  225



>ref|XP_004956918.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 45-like 
[Setaria italica]
Length=634

 Score =   375 bits (962),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 218/529 (41%), Positives = 304/529 (57%), Gaps = 17/529 (3%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQLVVNTKIEQ  663
             KS+   C   +Y D C KS+   A  ++ + KD + AA++   + + ++ +      +  
Sbjct  112   KSIKAMCSQTDYTDACEKSLGKAATANATSPKDIVRAAVEVIGDAIGQAFE---RADLIM  168

Query  664   STDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQTTC  843
             S DP    A+ DCKE+  DA DDL  ++  V   +   +     QL  W+SAV A+  TC
Sbjct  169   SNDPRVKAAVADCKEIFGDAKDDLNRTVKGVDAKD--GIAKDGYQLRIWLSAVIAHMETC  226

Query  844   TEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnnnn  1023
              +      +K  ++D   N  +LT+NA+ +I + S +L A   ++   LL  A D+    
Sbjct  227   IDGFPDDDFKVKVKDSFTNGKELTSNALALIEKGSSILSAIKGSSKRRLL--AEDEGAPA  284

Query  1024  nnnTTSRRLLQTDHFPEWFPIADRKLL-AAQRRGNLRPNVVVAKDGSGQFKTITGALKSY  1200
                + +   L  D  PEW P  +R++L     +  L PNVVVAKDGSG+FKTI  AL + 
Sbjct  285   ---SRAEPALDEDGIPEWVPDGERRVLKGGGFKSTLTPNVVVAKDGSGKFKTINEALAAM  341

Query  1201  PPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKTAT  1380
             P  +  +YVI VK GVY+E V + K M NV + GDG+ K+I+TGKKN+    ITT KTAT
Sbjct  342   PKSNNGRYVIQVKEGVYEEYVTITKAMVNVTLLGDGSKKSIVTGKKNFVD-GITTFKTAT  400

Query  1381  FSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYR  1560
             F+A G GF+A G+ F+NTAGPE HQAVA   QSD S   +C ++G+QDTLY H+  QFYR
Sbjct  401   FTAQGDGFMAIGMGFQNTAGPEKHQAVALLVQSDKSIFLNCRMDGFQDTLYAHSKAQFYR  460

Query  1561  NCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCRIVP  1740
             NCVISGT+DFIFG   A+ QN I++ R+P+ +Q N  TA G+  A+   G VLQ C    
Sbjct  461   NCVISGTVDFIFGDAAAVFQNCILVLRRPMDNQQNIATAQGRADAREATGFVLQKCEFQA  520

Query  1741  ETAL-NPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYK  1917
             ETAL +  R  +K Y GRPW+  S T+VMES++ D +   G+  W G+   KT  Y EY 
Sbjct  521   ETALRDAARPPIKNYLGRPWRECSRTLVMESELPDFIDKAGYMPWQGDFALKTLWYAEYG  580

Query  1918  NSGPGANTWRRNR--AFKKFDVLGPIRARHFTAGLWLDANSWLPATGVP  2058
             N+GPGA+T  R     +KK  V+    A  FT   +L A  W+  TG P
Sbjct  581   NTGPGADTAGRVNWPGYKK--VISKADAAKFTVENFLRAQPWIDPTGTP  627



>dbj|BAK05856.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=608

 Score =   374 bits (959),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 211/538 (39%), Positives = 302/538 (56%), Gaps = 17/538 (3%)
 Frame = +1

Query  457   DHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHKSHQ  636
             D G      K++T  CQ  +Y+ VC +S++  AN   ++    +  A++   E + ++  
Sbjct  77    DGGDLKAVKKTITLMCQQVDYQGVCEESLTRCANASESSPMGVVRLAVRVIGEALAQAFD  136

Query  637   LVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMS  816
                 T +  S +P+   AI DCKE    A ++L  ++   G     ++  +  QL  W+S
Sbjct  137   ---RTDLILSDEPHVKAAIADCKEFFLYAKEELNRTLG--GMDAKDSITKQGYQLRIWLS  191

Query  817   AVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLH  996
             AV A+Q TC +      +K  +++  I   +LT+NA+ +I + + LL    +     L+ 
Sbjct  192   AVIAHQETCIDGFPDGEFKDKVKESFIKGKELTSNALALIEKAATLLAGLKLPQRRLLVE  251

Query  997   KAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLL-AAQRRGNLRPNVVVAKDGSGQFK  1173
             +             +  +L  D  PEW P ++R++L     +G ++ NVVVAKDGSGQFK
Sbjct  252   EEG-----AAPPRRAEPVLGEDGIPEWVPESERRVLKGGGFKGEVKANVVVAKDGSGQFK  306

Query  1174  TITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHM  1353
             TI  AL + P K+  +YVI VK GVY+E V +  +M NV + GDG+ KTIITGKKN+   
Sbjct  307   TINEALNAMPKKYDGRYVIQVKEGVYEEYVTITGQMPNVTLNGDGSKKTIITGKKNFVD-  365

Query  1354  KITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLY  1533
               TT K+ATF+A G GF+A G+ F NTAG + HQAVA    SD S   +C ++G+QDTLY
Sbjct  366   GTTTFKSATFTAQGDGFMAIGVGFENTAGADKHQAVALLVLSDKSIFLNCKMDGFQDTLY  425

Query  1534  YHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGV  1713
              H+  QFYRNCVISGTIDFIFG   A+ QN II  R+PL +Q N +TA G+  A+   G 
Sbjct  426   AHSKAQFYRNCVISGTIDFIFGDAAAVFQNCIITLRRPLDNQQNIVTAQGRADAREATGF  485

Query  1714  VLQNCRIVPETALN-PLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFE  1890
             VLQ C I  E  L  P +  +K Y GRPW+  S T++MES I  L+   G+  W+G+   
Sbjct  486   VLQKCEITAEPGLTAPGKPPIKNYLGRPWRECSRTIIMESDIPALIDKAGYLPWNGDFAL  545

Query  1891  KTCMYYEYKNSGPGANTWRRN--RAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVP  2058
             KT  Y EY N GPGA+T  R     +KK   +    A  FT G ++ A +W+  TG P
Sbjct  546   KTLFYAEYGNKGPGADTAGRVNWEGYKK--TISKDDATKFTLGNFIHAQAWIDPTGTP  601



>ref|XP_003561714.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brachypodium distachyon]
Length=561

 Score =   372 bits (955),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 204/549 (37%), Positives = 297/549 (54%), Gaps = 30/549 (5%)
 Frame = +1

Query  439   ASSGKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTK--DFIFAAIKATL  612
              S  K D  +ST S+KS+ +FC+  +YK+ C  ++   A N ++TT+    IF A    +
Sbjct  30    GSDDKSDQELST-SVKSIKSFCEPVDYKEACESTLEKTAGNATSTTELAKAIFKATSERI  88

Query  613   EEVHKSHQLVVNTKIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRA  792
             E+  +   ++   K +Q T      A+ +CKE+L  A+DDL+ +   +G  E+   KH  
Sbjct  89    EQAVRESSVLNELKHDQRT----AGALNNCKELLNYAMDDLKTTFEQLGGFEMTNFKHAL  144

Query  793   DQLLNWMSAVYAYQTTCTEQIESRLYKSAIE-DGMINATQ-LTNNAINIIAEMSKLLKAF  966
             D L  W+S+   YQ TC +  E+    +A +    +NA+Q LT N ++I+ E    L   
Sbjct  145   DDLKTWLSSALTYQETCVDGFENTTTDAAAKMKKALNASQELTENILSIVDEFGDTLANL  204

Query  967   NITTTTDLLHKAADKnnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQ-RRGNLRPNVV  1143
              +                      SRRLL  D  P W     R+LL A+      +P++ 
Sbjct  205   ELPNL-------------------SRRLLGDDGVPGWMSDTKRRLLQAKPSEPEFKPDIT  245

Query  1144  VAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTI  1323
             VA DGSG +KTI  AL   P K    +V+Y+KAG Y E V V + + N+ M GDGA KTI
Sbjct  246   VASDGSGDYKTINEALAKVPLKSADTFVMYIKAGTYKEYVSVARNVTNLVMIGDGASKTI  305

Query  1324  ITGKKNYAHMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDC  1503
             ITG K++  + ITT  T+T  A+G GF  RGI   NTAG + HQAVA R QSD S  ++C
Sbjct  306   ITGDKSFM-LNITTKDTSTMEAIGNGFFMRGIGVENTAGAKNHQAVALRVQSDQSVFYEC  364

Query  1504  SIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADG  1683
               +GYQDTLY HT RQ+YR+C ++GTIDFIFG    + QN +I  R+ + +Q N ITA G
Sbjct  365   QFDGYQDTLYTHTSRQYYRDCTVTGTIDFIFGNAQVVFQNCLIQVRRCMDNQQNIITAQG  424

Query  1684  KELAKAKGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGW  1863
             ++   + GG V+ NC I P         +++T+ GRPWK YS T+ ++S+IG  + P GW
Sbjct  425   RKEKHSAGGTVILNCTIEPHPEFKEHAGRLRTFLGRPWKEYSRTLYIQSEIGGFIDPQGW  484

Query  1864  KIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLP  2043
               W G+    TC Y E  N GPG++  +R +      V      + +T   ++   +W+P
Sbjct  485   LPWLGDFGLNTCYYAEVDNHGPGSDMSKRAKWRGVKTVTYQQAQQKYTIEKFIQGQTWIP  544

Query  2044  ATGVPFAIG  2070
               GVP+  G
Sbjct  545   KYGVPYIPG  553



>gb|KFK29934.1| hypothetical protein AALP_AA7G197300 [Arabis alpina]
Length=612

 Score =   373 bits (958),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 215/533 (40%), Positives = 296/533 (56%), Gaps = 22/533 (4%)
 Frame = +1

Query  484   KSVTTFCQYAEYKDVCAKSISHVANNH--SATTKDFIFAAIKATLEEVHKSHQLVVNTKI  657
             K + T C    YK  C K++         S+  +  + ++I A  E++ K  + V+  K 
Sbjct  94    KIIQTLCNSTLYKPTCEKTLKTGTKTDIPSSDPRSLLKSSIIAVNEDLSKVFEKVLALKT  153

Query  658   EQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAYQT  837
             +   D     AI  CK ++ +A ++L +S+  + DTE++        L +W+SAV +YQ 
Sbjct  154   DNKDD---KDAIAQCKLLVDEAKEELDSSVKRINDTEVNNFAKTVPDLDSWLSAVMSYQE  210

Query  838   TCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADKnn  1017
             TC +  E    K+ I     ++  LT+N++ +I    K L A+        L  +  K  
Sbjct  211   TCVDGFEEGKLKTEIRKNFNSSQMLTSNSLAMI----KSLDAY--------LSSSVPKVK  258

Query  1018  nnnnnTTSRR-LLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGALK  1194
               +   ++R  ++ TDH   W    DR++L A     L+PN  VAKDGSG F TI  ALK
Sbjct  259   ARHLLESTRSSVMDTDHVTSWLSNKDRRMLKAVDVKALKPNATVAKDGSGNFTTINDALK  318

Query  1195  SYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSKT  1374
             + P K++ +Y IY+K GVYDE V V KK  NV M GDG+ KTI+TG K+ A  K+ T  T
Sbjct  319   AMPAKYQGRYTIYIKQGVYDESVIVDKKKANVTMVGDGSQKTIVTGNKSNAK-KLRTFLT  377

Query  1375  ATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQF  1554
             ATF A G+GF+A  + FRNTAGPEGHQAVA R QSD S   +C  EG+QDTLY +T+RQ+
Sbjct  378   ATFVAQGEGFMAHSMGFRNTAGPEGHQAVAIRVQSDRSVFLNCRFEGHQDTLYAYTHRQY  437

Query  1555  YRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCRI  1734
             YR+CVI GTIDFIFG   A+ QN  I  RK L  Q NT+TA G+       G V+ NC I
Sbjct  438   YRSCVIIGTIDFIFGDAAAIFQNCDIFIRKGLPGQKNTVTAQGRVDKFQTTGFVIHNCTI  497

Query  1735  VPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFE-KTCMYYE  1911
              P   L P + + K+Y GRPWK++S TVVMES I D++ P+GW  W   +F   T  Y E
Sbjct  498   APNEDLKPAKAEFKSYLGRPWKSHSRTVVMESTIEDVIDPVGWLRWQETDFAINTLSYAE  557

Query  1912  YKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             YKN GP   T  R + +  F V+    A  +T G +L    W+   G P   G
Sbjct  558   YKNDGPRGATGSRVK-WPGFRVINKEEAMKYTVGPFLQG-EWIHEIGSPVKFG  608



>emb|CDP19930.1| unnamed protein product [Coffea canephora]
Length=592

 Score =   372 bits (955),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 206/534 (39%), Positives = 302/534 (57%), Gaps = 25/534 (5%)
 Frame = +1

Query  478   SMKSVTTFCQYAEYKDVCAKSISHV--ANNHSATTKDFIFAAIKATLEEVHKSHQLVVNT  651
             + K+V T C   +YK  C  ++     AN  +   KD + A++ A    +  + ++  + 
Sbjct  78    AQKAVKTICASTDYKQTCEDNLFKAVKANASALQPKDLLKASMTAISRGIDLAMKIGSSV  137

Query  652   KIEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQLLNWMSAVYAY  831
               +   DP   +A + C  +L DA ++L +SIS + D         A  L NW+SAV +Y
Sbjct  138   HFD---DPKTKIAFDFCMTLLGDAKEELNSSISSIDDKT-----SNAGDLNNWLSAVMSY  189

Query  832   QTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTTTDLLHKAADK  1011
             Q +C +   +   KS +E  + ++ +LT+N++ +++ +S+L      +    LL K +  
Sbjct  190   QQSCIDGYPNGTIKSQLESTLKSSKELTSNSLAMVS-LSQLASFHGTSIKRRLLTKGSGI  248

Query  1012  nnnnnnnTTSRRLLQTDHFPEWFPIADRKLLAAQRRGNLRPNVVVAKDGSGQFKTITGAL  1191
              +           L  +  P W    +R+ +         PN  VAKDGSG + TI  AL
Sbjct  249   PS-----------LDEEGLPRWLNDQERRRILKDNTTFQHPNATVAKDGSGNYTTINAAL  297

Query  1192  KSYPPKHKAKYVIYVKAGVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYAHMKITTSK  1371
              + P  +  +YVIYVKAGVY+E V V KKM NV +YGDG+ K+I+TG KNY    + T  
Sbjct  298   AAIPSNYTGRYVIYVKAGVYEETVTVTKKMVNVTIYGDGSQKSIVTGSKNYVD-GVPTFL  356

Query  1372  TATFSALGKGFVARGITFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQ  1551
             TATFSALG GF+A+ I FRNTAGPE HQAVA R QSD +   +C +EGYQDTLY  T+RQ
Sbjct  357   TATFSALGDGFMAQSIGFRNTAGPEKHQAVALRVQSDRAIFVNCRMEGYQDTLYAQTHRQ  416

Query  1552  FYRNCVISGTIDFIFGKGTALIQNSIIIARKPLVHQFNTITADGKELAKAKGGVVLQNCR  1731
             +YR+C I+GT+DFIFG   A+ QN +I  RKP+ +Q N +TA G+   +   G+VLQ CR
Sbjct  417   YYRSCYITGTVDFIFGDAAAVFQNCMIYVRKPMDNQQNIVTAQGRVDKRETTGIVLQGCR  476

Query  1732  IVPETALNPLRFKVKTYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYY-  1908
             I+ + +L+P++ + K+Y GRPWK YS T++ME++IGD +   G+  W G NF    +YY 
Sbjct  477   ILADASLSPVKSQFKSYLGRPWKEYSRTIIMETEIGDFIHGDGYMPWQG-NFALNTLYYA  535

Query  1909  EYKNSGPGANTWRRNRAFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
             EY N GPGA T  R +      ++    A  +T G ++    WL    VP   G
Sbjct  536   EYNNKGPGAQTSARVKWPGYKGLIKRDEALKYTVGPFIQGEGWLKVDNVPVHFG  589



>ref|XP_009116895.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor [Brassica 
rapa]
Length=584

 Score =   372 bits (954),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 218/564 (39%), Positives = 312/564 (55%), Gaps = 35/564 (6%)
 Frame = +1

Query  448   GKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHK  627
             G G         K+V + C  A  K  CAK++  V ++  +     I A + AT + V K
Sbjct  32    GAGGDKTLNSHQKAVESLCASATDKGSCAKTLDPVKSDDPSK---LIKAFMLATKDAVTK  88

Query  628   SHQLVVNTK--IEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQL  801
             S     +T+  + ++ +  +   ++ CK +L  A++DL+  +  +G+ +L     + DQL
Sbjct  89    STNFTASTEEGMGKNMNATSKAVLDYCKRVLMYALEDLETIVEEMGE-DLQQSGSKMDQL  147

Query  802   LNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTT  981
               W++ V+ YQT C + IE    +  + +G+ ++  L++NAI+I   ++  +   N+   
Sbjct  148   KQWLTGVFNYQTDCIDDIEESELRKVMGEGIAHSKILSSNAIDIFHALTTAMSQMNVKV-  206

Query  982   TDLLHKAADKnnnnnnnTTSRRLLQ---TDHFPEWFPIADRKLLA-AQRRG---------  1122
              D + K     N        R LL+       P+W    DRKL+A A R G         
Sbjct  207   -DDMKKG----NLGETPAPDRDLLEDLDQKGLPKWHSDKDRKLMAQAGRPGAPADEGIGE  261

Query  1123  ------NLRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMK  1284
                    ++P  VVAKDGSGQFKTI+ A+K+ P K+  + +IY+KAGVY E V + KK+ 
Sbjct  262   GGGGGGKIKPTHVVAKDGSGQFKTISEAVKACPEKNPGRCIIYIKAGVYKEQVTIPKKVN  321

Query  1285  NVFMYGDGAGKTIITGKKNYA-HMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAV  1461
             NVFM+GDGA +TIIT  ++       TTS + T     +GF+A+ I F+NTAGP GHQAV
Sbjct  322   NVFMFGDGATQTIITFDRSVGLSPGTTTSLSGTVQVESEGFMAKWIGFQNTAGPLGHQAV  381

Query  1462  AYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIAR  1641
             A+R   D + IF+C  +GYQDTLY +  RQFYRN V+SGT+DFIFGK   +IQNS+I+ R
Sbjct  382   AFRVNGDRAVIFNCRFDGYQDTLYVNNGRQFYRNIVVSGTVDFIFGKSATVIQNSLILCR  441

Query  1642  KPLVHQFNTITADGKELAKA-KGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTV  1818
             K    Q N +TADG E  KA K G+VL NCRI+ +  L   R  VK+Y GRPWK ++TT 
Sbjct  442   KGSPGQTNHVTADGNEKGKAVKIGIVLHNCRIMADKELEADRLTVKSYLGRPWKPFATTA  501

Query  1819  VMESQIGDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRAR  1998
             V+ ++IGDL+ P GW  W GE F  T  Y E+ N GPGANT  R    K       +   
Sbjct  502   VIGTEIGDLIQPTGWNEWQGEKFHLTATYVEFNNRGPGANTAARVPWAKMAKSAAEV--E  559

Query  1999  HFTAGLWLDANSWLPATGVPFAIG  2070
              FT   WL   +W+    VP  +G
Sbjct  560   RFTVANWLTPANWIQEANVPVQLG  583



>ref|XP_010413301.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor VGDH2 
[Camelina sativa]
Length=596

 Score =   372 bits (955),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 223/578 (39%), Positives = 319/578 (55%), Gaps = 52/578 (9%)
 Frame = +1

Query  454   GDHGVSTGSM----KSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEV  621
             G +G S G +    K+V T CQ    +  CAK++  V ++  +     I A + AT E +
Sbjct  31    GSNGDSNGPINSHQKAVQTICQSTTDQGSCAKTLEPVKSDDPS---KLIKAFMMATKEAI  87

Query  622   HKSHQLVVNTK--IEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRAD  795
              KS     +T+  +  +  P N   ++ CK +L  A++DL+  +  +G+ +L     + D
Sbjct  88    TKSSNFTDSTEGGLGANISPTNKAVLDYCKRVLMYALEDLETIVEEMGE-DLQQSGSKID  146

Query  796   QLLNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINI----IAEMS----K  951
             QL  W++ V+ YQT C + IE    K  + +G+ N+  LT+NAI+I    +  MS    K
Sbjct  147   QLKQWLTGVFNYQTDCLDDIEEAELKKIMGEGIANSKVLTSNAIDIFHSVVTAMSQMGVK  206

Query  952   LLKAFNITTTTDLLHKAADKnnnnnnnTTSRRLLQ-TDH--FPEWFPIADRKLLAAQRRG  1122
             L    N+T         A           +RRLL+ TD    P WF   DRKL+A   RG
Sbjct  207   LDDMKNVTVGGIGAGAGA-------GAAPARRLLEDTDEKGLPNWFADKDRKLMANAGRG  259

Query  1123  NLRPNV--------------------VVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKA  1242
                                       VVA+DGSGQFKTI+ A+ + P K+  + +I++KA
Sbjct  260   APAGGAAGDDGIGEGGGGGGKIKATHVVAQDGSGQFKTISEAVNACPDKNPGRCIIHIKA  319

Query  1243  GVYDEIVEVGKKMKNVFMYGDGAGKTIITGKKNYA-HMKITTSKTATFSALGKGFVARGI  1419
             G Y+E+V + KK KN+FM+GDGA KTIIT  K+   +  +TTS +AT     +GF+A+ I
Sbjct  320   GTYNEMVRIPKKKKNIFMFGDGATKTIITNNKSVKLNPGMTTSLSATVQVESEGFMAKWI  379

Query  1420  TFRNTAGPEGHQAVAYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFG  1599
              F+NTAGP GHQAVA R   D + IF+C  + YQDTLY +  RQFYRN V+SGT+DFIFG
Sbjct  380   GFKNTAGPLGHQAVALRVNGDRAVIFNCRFDAYQDTLYVNNGRQFYRNIVVSGTVDFIFG  439

Query  1600  KGTALIQNSIIIARKPLVHQFNTITADGKELAKA-KGGVVLQNCRIVPETALNPLRFKVK  1776
             K   +IQNS+I+ RK    QFN +TADG E   A K G+VL NCRI+P+  L   +  +K
Sbjct  440   KSATVIQNSLILVRKGTPGQFNYVTADGNEKGAAVKIGIVLHNCRIMPDKELEAEKLTIK  499

Query  1777  TYFGRPWKAYSTTVVMESQIGDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNR  1956
             +Y GRPWK ++TTV++ +++GDL+ P+GW  W GE    T  Y E+ N GPGAN  +R  
Sbjct  500   SYLGRPWKKFATTVIIGTEMGDLIQPVGWTEWKGEQNHLTAKYIEFNNRGPGANPSQRLE  559

Query  1957  AFKKFDVLGPIRARHFTAGLWLDANSWLPATGVPFAIG  2070
               K       + A  +T   W+   +W+    VP  +G
Sbjct  560   WIKIAKNAAEVEA--YTVANWVGPANWIQEANVPVQLG  595



>sp|P41510.1|PME_BRANA RecName: Full=Probable pectinesterase/pectinesterase inhibitor; 
Includes: RecName: Full=Pectinesterase inhibitor; AltName: 
Full=Pectin methylesterase inhibitor; Includes: RecName: Full=Pectinesterase; 
Short=PE; AltName: Full=Pectin methylesterase; 
Flags: Precursor [Brassica napus]
 emb|CAA39658.1| Bp19 [Brassica napus]
Length=584

 Score =   372 bits (954),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 218/564 (39%), Positives = 312/564 (55%), Gaps = 35/564 (6%)
 Frame = +1

Query  448   GKGDHGVSTGSMKSVTTFCQYAEYKDVCAKSISHVANNHSATTKDFIFAAIKATLEEVHK  627
             G G         K+V + C  A  K  CAK++  V ++  +     I A + AT + V K
Sbjct  32    GAGGDKTLNSHQKAVESLCASATDKGSCAKTLDPVKSDDPSK---LIKAFMLATKDAVTK  88

Query  628   SHQLVVNTK--IEQSTDPYNHMAIEDCKEMLQDAIDDLQASISVVGDTELHTLKHRADQL  801
             S     +T+  + ++ +  +   ++ CK +L  A++DL+  +  +G+ +L     + DQL
Sbjct  89    STNFTASTEEGMGKNINATSKAVLDYCKRVLMYALEDLETIVEEMGE-DLQQSGSKMDQL  147

Query  802   LNWMSAVYAYQTTCTEQIESRLYKSAIEDGMINATQLTNNAINIIAEMSKLLKAFNITTT  981
               W++ V+ YQT C + IE    +  + +G+ ++  L++NAI+I   ++  +   N+   
Sbjct  148   KQWLTGVFNYQTDCIDDIEESELRKVMGEGIAHSKILSSNAIDIFHALTTAMSQMNVKV-  206

Query  982   TDLLHKAADKnnnnnnnTTSRRLLQ---TDHFPEWFPIADRKLLA-AQRRG---------  1122
              D + K     N        R LL+       P+W    DRKL+A A R G         
Sbjct  207   -DDMKKG----NLGETPAPDRDLLEDLDQKGLPKWHSDKDRKLMAQAGRPGAPADEGIGE  261

Query  1123  ------NLRPNVVVAKDGSGQFKTITGALKSYPPKHKAKYVIYVKAGVYDEIVEVGKKMK  1284
                    ++P  VVAKDGSGQFKTI+ A+K+ P K+  + +IY+KAGVY E V + KK+ 
Sbjct  262   GGGGGGKIKPTHVVAKDGSGQFKTISEAVKACPEKNPGRCIIYIKAGVYKEQVTIPKKVN  321

Query  1285  NVFMYGDGAGKTIITGKKNYA-HMKITTSKTATFSALGKGFVARGITFRNTAGPEGHQAV  1461
             NVFM+GDGA +TIIT  ++       TTS + T     +GF+A+ I F+NTAGP GHQAV
Sbjct  322   NVFMFGDGATQTIITFDRSVGLSPGTTTSLSGTVQVESEGFMAKWIGFQNTAGPLGHQAV  381

Query  1462  AYRSQSDMSAIFDCSIEGYQDTLYYHTYRQFYRNCVISGTIDFIFGKGTALIQNSIIIAR  1641
             A+R   D + IF+C  +GYQDTLY +  RQFYRN V+SGT+DFIFGK   +IQNS+I+ R
Sbjct  382   AFRVNGDRAVIFNCRFDGYQDTLYVNNGRQFYRNIVVSGTVDFIFGKSATVIQNSLILCR  441

Query  1642  KPLVHQFNTITADGKELAKA-KGGVVLQNCRIVPETALNPLRFKVKTYFGRPWKAYSTTV  1818
             K    Q N +TADG E  KA K G+VL NCRI+ +  L   R  VK+Y GRPWK ++TT 
Sbjct  442   KGSPGQTNHVTADGNEKGKAVKIGIVLHNCRIMADKELEADRLTVKSYLGRPWKPFATTA  501

Query  1819  VMESQIGDLLSPLGWKIWDGENFEKTCMYYEYKNSGPGANTWRRNRAFKKFDVLGPIRAR  1998
             V+ ++IGDL+ P GW  W GE F  T  Y E+ N GPGANT  R    K       +   
Sbjct  502   VIGTEIGDLIQPTGWNEWQGEKFHLTATYVEFNNRGPGANTAARVPWAKMAKSAAEV--E  559

Query  1999  HFTAGLWLDANSWLPATGVPFAIG  2070
              FT   WL   +W+    VP  +G
Sbjct  560   RFTVANWLTPANWIQEANVPVQLG  583



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6598084230844