BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80128_g1_i1 len=7515 path=[7493:0-7514]

Length=7515
                                                                      Score     E

ref|XP_011083322.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...   3175   0.0      
ref|XP_006445976.1|  hypothetical protein CICLE_v10017962mg            3011   0.0      
ref|XP_006494728.1|  PREDICTED: uncharacterized protein LOC102618132   2997   0.0      
ref|XP_011025254.1|  PREDICTED: uncharacterized protein LOC105126175   2993   0.0      
ref|XP_010651281.1|  PREDICTED: uncharacterized protein LOC100253550   2993   0.0      
ref|XP_011025255.1|  PREDICTED: uncharacterized protein LOC105126176   2962   0.0      
gb|EYU18010.1|  hypothetical protein MIMGU_mgv1a000034mg               2958   0.0      
ref|XP_007206846.1|  hypothetical protein PRUPE_ppa027071mg            2957   0.0      
ref|XP_002303872.2|  hypothetical protein POPTR_0003s22070g            2950   0.0      Populus trichocarpa [western balsam poplar]
gb|KDO64910.1|  hypothetical protein CISIN_1g037878mg                  2949   0.0      
ref|XP_010091993.1|  Long-chain-fatty-acid--AMP ligase FadD28          2944   0.0      
emb|CDP14089.1|  unnamed protein product                               2937   0.0      
ref|XP_011080317.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...   2935   0.0      
ref|XP_009374851.1|  PREDICTED: uncharacterized protein LOC103963721   2933   0.0      
ref|XP_007014908.1|  AMP-dependent synthetase and ligase family p...   2933   0.0      
ref|XP_006348564.1|  PREDICTED: uncharacterized protein LOC102582076   2927   0.0      
ref|XP_009364730.1|  PREDICTED: uncharacterized protein LOC103954620   2924   0.0      
ref|XP_008243597.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...   2917   0.0      
ref|XP_002513447.1|  conserved hypothetical protein                    2913   0.0      Ricinus communis
ref|XP_009790710.1|  PREDICTED: uncharacterized protein LOC104238130   2911   0.0      
ref|XP_010317976.1|  PREDICTED: uncharacterized protein LOC104646358   2910   0.0      
ref|XP_009588290.1|  PREDICTED: uncharacterized protein LOC104085877   2908   0.0      
ref|XP_010034281.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...   2900   0.0      
ref|XP_010031846.1|  PREDICTED: uncharacterized protein LOC104421554   2890   0.0      
gb|EYU46303.1|  hypothetical protein MIMGU_mgv1a021307mg               2881   0.0      
emb|CBI16432.3|  unnamed protein product                               2877   0.0      
ref|XP_008800677.1|  PREDICTED: uncharacterized protein LOC103714963   2868   0.0      
ref|XP_008449759.1|  PREDICTED: uncharacterized protein LOC103491...   2859   0.0      
ref|XP_010034280.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...   2857   0.0      
ref|XP_009364757.1|  PREDICTED: uncharacterized protein LOC103954644   2856   0.0      
ref|XP_010943571.1|  PREDICTED: uncharacterized protein LOC105061266   2853   0.0      
gb|KHN33325.1|  Long-chain-fatty-acid--AMP ligase FadD28               2842   0.0      
gb|KGN54114.1|  hypothetical protein Csa_4G286390                      2840   0.0      
gb|KCW51230.1|  hypothetical protein EUGRSUZ_J00810                    2832   0.0      
gb|KHN30113.1|  Long-chain-fatty-acid--AMP ligase FadD28               2820   0.0      
gb|KCW51237.1|  hypothetical protein EUGRSUZ_J00816                    2811   0.0      
ref|XP_008449760.1|  PREDICTED: uncharacterized protein LOC103491...   2794   0.0      
ref|XP_003597478.1|  Bifunctional protein aas                          2789   0.0      
emb|CAN80678.1|  hypothetical protein VITISV_022712                    2775   0.0      Vitis vinifera
ref|XP_009418249.1|  PREDICTED: uncharacterized protein LOC103998490   2774   0.0      
ref|XP_004487235.1|  PREDICTED: uncharacterized protein LOC101501314   2766   0.0      
gb|KCW51231.1|  hypothetical protein EUGRSUZ_J00812                    2749   0.0      
gb|AES67729.2|  AMP-binding enzyme                                     2739   0.0      
ref|XP_010227171.1|  PREDICTED: uncharacterized protein LOC100836614   2677   0.0      
ref|XP_006850079.1|  hypothetical protein AMTR_s00022p00216410         2588   0.0      
ref|XP_006386098.1|  hypothetical protein POPTR_0003s220801g           2263   0.0      
ref|XP_010315906.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...   1729   0.0      
gb|KHN25269.1|  Long-chain-fatty-acid--AMP ligase FadD28               1721   0.0      
ref|XP_007131980.1|  hypothetical protein PHAVU_011G056700g            1571   0.0      
ref|XP_007150400.1|  hypothetical protein PHAVU_005G150200g            1562   0.0      
ref|XP_004507120.1|  PREDICTED: uncharacterized protein LOC101499614   1535   0.0      
gb|KEH30270.1|  AMP-binding enzyme                                     1521   0.0      
gb|EEC77462.1|  hypothetical protein OsI_16281                         1481   0.0      Oryza sativa Indica Group [Indian rice]
gb|EPS72678.1|  hypothetical protein M569_02079                        1481   0.0      
ref|XP_004974067.1|  PREDICTED: uncharacterized protein LOC101754518   1461   0.0      
ref|XP_008669277.1|  PREDICTED: uncharacterized protein LOC103646324   1452   0.0      
tpg|DAA37344.1|  TPA: putative AMP-dependent synthetase and ligas...   1434   0.0      
emb|CAH66806.1|  OSIGBa0135C13.1                                       1426   0.0      Oryza sativa [red rice]
ref|NP_001173978.1|  Os04g0473900                                      1424   0.0      
emb|CAE02881.2|  OSJNBb0022F23.18                                      1422   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002448025.1|  hypothetical protein SORBIDRAFT_06g019820         1376   0.0      Sorghum bicolor [broomcorn]
emb|CDP14081.1|  unnamed protein product                               1335   0.0      
gb|EPS61869.1|  hypothetical protein M569_12923                        1310   0.0      
gb|EPS61871.1|  hypothetical protein M569_12922                        1184   0.0      
ref|XP_002970409.1|  hypothetical protein SELMODRAFT_410953            1113   0.0      
ref|XP_002978488.1|  hypothetical protein SELMODRAFT_108866            1070   0.0      
gb|KDP20198.1|  hypothetical protein JCGZ_07918                         577   0.0      
ref|XP_006386097.1|  hypothetical protein POPTR_0003s220802g            532   1e-167   
gb|EMS58940.1|  Allene oxide synthase-lipoxygenase protein              527   4e-165   
gb|EXX53363.1|  hypothetical protein RirG_244660                        479   1e-135   
emb|CDP14083.1|  unnamed protein product                                400   3e-122   
ref|XP_009845094.1|  hypothetical protein H257_17844                    374   7e-107   
ref|XP_009845095.1|  hypothetical protein, variant                      362   1e-103   
ref|XP_008616893.1|  hypothetical protein SDRG_12598                    359   3e-102   
ref|XP_004517015.1|  PREDICTED: uncharacterized protein LOC101494376    353   3e-101   
ref|XP_008871071.1|  hypothetical protein H310_07478                    342   2e-96    
ref|XP_002909646.1|  putative fatty-acid-CoA ligase, putative           332   6e-93    
ref|WP_036450920.1|  long-chain acyl-CoA synthetase                     330   7e-93    
ref|WP_020724738.1|  Long-chain-fatty-acid--CoA ligase                  338   7e-93    
emb|CCI45818.1|  unnamed protein product                                339   2e-92    
ref|WP_012393673.1|  long-chain acyl-CoA synthetase                     337   3e-92    
gb|AFK47604.1|  unknown                                                 312   6e-92    
ref|XP_009514487.1|  hypothetical protein PHYSODRAFT_469747             329   8e-92    
ref|WP_038581590.1|  long-chain acyl-CoA synthetase                     327   8e-92    
ref|WP_036455948.1|  long-chain acyl-CoA synthetase                     326   1e-91    
emb|CDM75951.1|  long-chain acyl-CoA synthetase                         335   2e-91    
ref|WP_036427282.1|  long-chain acyl-CoA synthetase                     326   2e-91    
ref|WP_038579250.1|  long-chain acyl-CoA synthetase                     334   2e-91    
ref|WP_015355244.1|  long-chain acyl-CoA synthetase                     332   2e-91    
ref|WP_025667239.1|  hypothetical protein                               336   4e-91    
ref|WP_020728309.1|  Long-chain-fatty-acid--CoA ligase                  332   8e-91    
ref|WP_020788067.1|  Long-chain-fatty-acid--CoA ligase                  332   9e-91    
ref|WP_036394663.1|  long-chain acyl-CoA synthetase                     330   4e-90    
ref|WP_015328289.1|  acyl-CoA synthetase (AMP-forming)/AMP-acid l...    319   9e-90    
ref|WP_011320792.1|  beta-ketoacyl synthase                             333   7e-89    
gb|ETR67816.1|  AMP-dependent synthetase and ligase                     316   8e-89    
gb|EPQ47290.1|  Long-chain-fatty-acid--CoA ligase                       325   9e-89    
gb|ETL44185.1|  hypothetical protein L916_05437                         320   2e-88    
gb|ETM50539.1|  hypothetical protein L914_05443                         319   2e-88    
ref|WP_038071981.1|  AMP-dependent synthetase                           315   2e-88    
ref|WP_012394783.1|  polyketide synthase                                334   2e-88    
gb|ETL97359.1|  hypothetical protein L917_05321                         318   3e-88    
ref|XP_008903130.1|  hypothetical protein PPTG_10236                    318   4e-88    
gb|ETK90786.1|  hypothetical protein L915_05492                         318   4e-88    
ref|WP_012409759.1|  AMP-dependent synthetase and ligase                314   4e-88    
gb|ETP48590.1|  hypothetical protein F442_05675                         317   8e-88    
ref|WP_030765902.1|  hypothetical protein                               312   9e-88    
ref|WP_039755014.1|  AMP-dependent synthetase                           312   1e-87    
ref|WP_036478874.1|  beta-ketoacyl synthase                             331   1e-87    
ref|WP_012831237.1|  thioester reductase domain-containing protein      323   2e-87    
ref|WP_036418848.1|  fatty acyl-AMP ligase                              311   2e-87    
ref|WP_030656773.1|  MULTISPECIES: hypothetical protein                 310   4e-87    
ref|WP_026723805.1|  AMP-dependent synthetase                           314   4e-87    
ref|WP_033336012.1|  AMP-dependent synthetase                           313   5e-87    
gb|ETM50540.1|  hypothetical protein, variant 1                         315   5e-87    
ref|WP_023370149.1|  long-chain acyl-CoA synthetase                     320   5e-87    
ref|WP_016876567.1|  hypothetical protein                               313   6e-87    
ref|WP_026724079.1|  AMP-dependent synthetase                           310   6e-87    
gb|ETL44186.1|  hypothetical protein, variant 1                         314   7e-87    
ref|WP_014397899.1|  AMP-dependent synthetase and ligase                309   7e-87    
gb|ETL97360.1|  hypothetical protein, variant 1                         314   9e-87    
gb|ETK90787.1|  hypothetical protein, variant 1                         313   1e-86    
ref|XP_008903136.1|  hypothetical protein, variant 1                    313   1e-86    
emb|CDM77165.1|  polyketide synthase and peptide synthetase             328   1e-86    
gb|EYU70387.1|  AMP-dependent synthetase                                309   1e-86    
ref|WP_034240913.1|  hypothetical protein                               328   1e-86    
ref|WP_037915584.1|  hypothetical protein                               308   2e-86    
ref|WP_016866913.1|  hypothetical protein                               327   2e-86    
ref|XP_002185164.1|  predicted protein                                  313   2e-86    Phaeodactylum tricornutum CCAP 1055/1
ref|WP_003919359.1|  fatty acyl-AMP ligase                              320   2e-86    
ref|WP_030031952.1|  hypothetical protein                               308   3e-86    
ref|WP_013321938.1|  beta-ketoacyl synthase                             327   3e-86    
gb|ETP48591.1|  hypothetical protein, variant 1                         312   3e-86    
ref|WP_035087278.1|  hypothetical protein                               327   4e-86    
ref|WP_027413623.1|  hypothetical protein                               327   4e-86    
ref|WP_026149071.1|  amino acid adenylation protein                     325   4e-86    
gb|ETW21740.1|  hypothetical protein MGAST_24130                        306   4e-86    
gb|ETM50541.1|  hypothetical protein, variant 2                         311   6e-86    
gb|ETL44187.1|  hypothetical protein, variant 2                         310   7e-86    
ref|WP_014396740.1|  long-chain-fatty-acid--CoA ligase                  326   1e-85    
ref|WP_009784043.1|  Beta-ketoacyl synthase                             306   1e-85    
ref|WP_012412907.1|  amino acid adenylation domain-containing pro...    323   1e-85    
ref|WP_017721460.1|  hypothetical protein                               310   1e-85    
ref|WP_030715083.1|  hypothetical protein                               305   2e-85    
ref|XP_008903131.1|  hypothetical protein, variant 2                    309   2e-85    
gb|ETK90788.1|  hypothetical protein, variant 2                         309   2e-85    
ref|WP_007167737.1|  fatty acyl-AMP ligase                              317   2e-85    
ref|WP_008185335.1|  AMP-forming acyl-CoA synthetase                    305   3e-85    
gb|ETL97361.1|  hypothetical protein, variant 2                         309   3e-85    
gb|KFA92020.1|  hypothetical protein Q664_18055                         318   3e-85    
ref|WP_002735558.1|  AMP-binding enzyme family protein                  309   3e-85    
ref|WP_019505670.1|  hypothetical protein                               305   3e-85    
ref|WP_015198212.1|  amino acid adenylation protein                     322   3e-85    
gb|ETP48595.1|  hypothetical protein, variant 5                         308   4e-85    
ref|WP_030388422.1|  hypothetical protein                               304   4e-85    
ref|WP_030832649.1|  MULTISPECIES: hypothetical protein                 304   4e-85    
ref|WP_026736727.1|  AMP-dependent synthetase                           305   4e-85    
ref|WP_023069135.1|  AMP-binding enzyme family protein                  304   5e-85    
gb|ETP48592.1|  hypothetical protein, variant 2                         308   5e-85    
ref|WP_017742670.1|  hypothetical protein                               308   6e-85    
ref|WP_038095405.1|  AMP-dependent synthetase                           308   7e-85    
ref|WP_012240871.1|  non-ribosomal peptide synthetase                   321   9e-85    
ref|WP_011316891.1|  amino acid adenylation                             322   1e-84    
ref|WP_012409835.1|  AMP-dependent synthetase and ligase                316   1e-84    
ref|WP_016876672.1|  hypothetical protein                               320   2e-84    
ref|WP_034423276.1|  hypothetical protein                               305   2e-84    
ref|WP_036391154.1|  hypothetical protein                               314   2e-84    
ref|WP_019489576.1|  hypothetical protein                               303   3e-84    
ref|WP_027842330.1|  amino acid adenylation protein                     318   4e-84    
ref|WP_015142042.1|  acyl-CoA synthetase                                302   4e-84    
ref|WP_015784850.1|  AMP-dependent synthetase and ligase                306   4e-84    
ref|WP_013376475.1|  non-ribosomal peptide synthase                     318   4e-84    
ref|WP_006528121.1|  acyl-CoA synthetase (AMP-forming)/AMP-acid l...    302   5e-84    
ref|WP_012408748.1|  AMP-dependent synthetase and ligase                301   6e-84    
gb|KFA94581.1|  peptide synthetase                                      318   6e-84    
gb|AFM29838.1|  AMP-dependent synthetase/ligase                         301   8e-84    
ref|WP_031349434.1|  fatty acyl-AMP ligase                              304   9e-84    
ref|WP_023885084.1|  fatty acyl-AMP ligase                              304   9e-84    
ref|WP_023864964.1|  fatty acyl-AMP ligase                              304   1e-83    
ref|WP_023371835.1|  fatty acyl-AMP ligase                              312   1e-83    
gb|AEH57210.1|  polyketide synthase                                     318   1e-83    
ref|WP_033714056.1|  fatty acyl-AMP ligase                              304   1e-83    
ref|WP_035114296.1|  AMP-dependent synthetase                           300   1e-83    
gb|ETB47619.1|  fatty acyl-AMP ligase                                   303   1e-83    
ref|WP_019504308.1|  hypothetical protein                               301   1e-83    
ref|WP_002787595.1|  polyketide synthase                                318   1e-83    
gb|ETB55621.1|  fatty acyl-AMP ligase                                   303   1e-83    
ref|WP_012596905.1|  AMP-dependent synthetase/ligase                    304   2e-83    
ref|WP_028380830.1|  thioester reductase                                311   2e-83    
ref|WP_036404407.1|  fatty acyl-AMP ligase                              311   2e-83    
ref|WP_019696186.1|  fatty acyl-AMP ligase                              301   2e-83    
ref|WP_036007854.1|  hypothetical protein                               302   2e-83    
ref|WP_002799844.1|  Putative fatty-acid--CoA ligase (Acyl-CoA sy...    300   2e-83    
ref|WP_015207404.1|  acyl-CoA synthetase (AMP-forming)/AMP-acid l...    300   3e-83    
ref|WP_016517173.1|  Beta-ketoacyl-acyl-carrier-protein synthase I      317   3e-83    
ref|WP_023876581.1|  fatty acyl-AMP ligase                              298   3e-83    
ref|WP_018503153.1|  AMP-dependent synthetase                           299   3e-83    
ref|WP_028400711.1|  hypothetical protein                               299   3e-83    
ref|WP_011612652.1|  AMP-dependent synthetase and ligase                299   3e-83    
gb|ETW95865.1|  hypothetical protein ETSY1_28805                        304   4e-83    
ref|WP_002775586.1|  polyketide synthase                                317   5e-83    
ref|WP_015130110.1|  Long-chain-fatty-acid--(acyl-carrier-protein...    298   5e-83    
ref|WP_002628883.1|  Long-chain-fatty-acid--CoA ligase                  315   6e-83    
ref|WP_020459508.1|  AMP-dependent synthetase                           298   6e-83    
ref|WP_019698967.1|  fatty acyl-AMP ligase                              301   7e-83    
ref|WP_036390108.1|  hypothetical protein                               298   7e-83    
ref|WP_031024953.1|  hypothetical protein                               300   7e-83    
gb|EWM19528.1|  non-ribosomal peptide synthetase                        298   8e-83    
ref|WP_015145342.1|  polyketide synthase family protein                 316   8e-83    
ref|WP_026723925.1|  amino acid adenylation protein                     314   9e-83    
ref|XP_009040711.1|  hypothetical protein AURANDRAFT_10632              296   9e-83    
ref|WP_017654183.1|  beta-ketoacyl synthase                             312   2e-82    
ref|WP_015188193.1|  amino acid adenylation domain protein              313   2e-82    
dbj|GAL95156.1|  malonyl CoA-acyl carrier protein transacylase          297   2e-82    
ref|WP_037657298.1|  fatty acyl-AMP ligase                              302   2e-82    
gb|EAZ89250.1|  Beta-ketoacyl synthase                                  296   2e-82    Cyanothece sp. CCY0110
ref|WP_035800266.1|  AMP-dependent synthetase                           296   3e-82    
gb|AAS98774.1|  JamA                                                    296   3e-82    Lyngbya majuscula
ref|WP_035082217.1|  hypothetical protein                               296   3e-82    
ref|WP_009456266.1|  MULTISPECIES: amino acid adenylation domain ...    312   3e-82    
ref|WP_038297123.1|  AMP-dependent synthetase, partial [                299   3e-82    
ref|WP_021836748.1|  Long-chain-fatty-acid--CoA ligase                  297   4e-82    
ref|WP_011486165.1|  AMP-dependent synthetase and ligase                296   4e-82    
ref|WP_009544274.1|  AMP-dependent synthetase                           305   4e-82    
ref|WP_015347655.1|  non-ribosomal peptide synthetase                   308   4e-82    
gb|AGH69810.1|  non-ribosomal peptide synthase                          313   4e-82    
ref|WP_012361639.1|  AMP-dependent synthetase                           305   4e-82    
ref|WP_017307786.1|  hypothetical protein                               312   4e-82    
ref|WP_008198038.1|  Putative fatty-acid--CoA ligase (Acyl-CoA sy...    298   5e-82    
ref|WP_014398523.1|  Linear gramicidin synthase subunit C               312   5e-82    
ref|WP_019506116.1|  hypothetical protein                               296   5e-82    
ref|WP_037909580.1|  hypothetical protein                               295   5e-82    
ref|WP_017317666.1|  hypothetical protein                               308   6e-82    
gb|AIE12089.1|  putative cis-AT type polyketide synthase module A5A     313   6e-82    
gb|AFV96135.1|  AMP-dependent synthetase/ligase                         296   6e-82    
ref|WP_013248691.1|  putative multi-domain non-ribosomal peptide ...    311   7e-82    
ref|WP_015122079.1|  acyl-CoA synthetase                                299   7e-82    
ref|WP_020741480.1|  hypothetical protein                               311   8e-82    
ref|WP_021833403.1|  Long-chain-fatty-acid--CoA ligase                  295   8e-82    
emb|CCQ64803.1|  Long-chain-fatty-acid--CoA ligase                      295   9e-82    
ref|WP_037583730.1|  beta-lactamase                                     312   1e-81    
ref|WP_006929449.1|  amino acid adenylation domain protein              312   1e-81    
gb|KDN76828.1|  hypothetical protein DF19_13905                         310   1e-81    
ref|WP_015250181.1|  amino acid adenylation enzyme/thioester redu...    312   1e-81    
ref|WP_013376561.1|  beta-lactamase                                     312   1e-81    
ref|WP_031355092.1|  fatty acyl-AMP ligase                              305   1e-81    
ref|WP_037730322.1|  hypothetical protein                               297   1e-81    
gb|EAU65198.1|  beta-lactamase, putative                                311   2e-81    Stigmatella aurantiaca DW4/3-1
ref|WP_030007853.1|  AMP-binding protein                                305   2e-81    
ref|WP_010652566.1|  thioester reductase domain-containing protein      305   2e-81    
ref|WP_015155699.1|  amino acid adenylation protein                     310   2e-81    
ref|WP_031353841.1|  fatty acyl-AMP ligase                              305   2e-81    
ref|WP_016705909.1|  fatty acyl-AMP ligase                              305   2e-81    
gb|ETB23782.1|  fatty acyl-AMP ligase                                   305   2e-81    
ref|WP_018399776.1|  hypothetical protein                               311   2e-81    
gb|ETB00639.1|  fatty acyl-AMP ligase                                   305   2e-81    
ref|WP_002624887.1|  Long-chain-fatty-acid--CoA ligase                  309   3e-81    
ref|WP_011725891.1|  fatty acyl-AMP ligase                              305   3e-81    
ref|WP_015347486.1|  beta-ketoacyl synthase                             293   3e-81    
ref|WP_019349480.1|  hypothetical protein                               304   3e-81    
ref|WP_033384946.1|  hypothetical protein                               293   3e-81    
ref|WP_024637286.1|  MULTISPECIES: fatty acyl-AMP ligase                304   3e-81    
ref|WP_003874656.1|  fatty acyl-AMP ligase                              304   3e-81    
ref|WP_006541170.1|  AMP-dependent synthetase                           293   3e-81    
ref|WP_019733353.1|  fatty acyl-AMP ligase                              304   3e-81    
ref|WP_006510835.1|  acyl-CoA synthetase (AMP-forming)/AMP-acid l...    293   4e-81    
ref|WP_002774031.1|  Putative fatty-acid--CoA ligase (Acyl-CoA sy...    293   4e-81    
ref|WP_009978604.1|  fatty acyl-AMP ligase                              304   4e-81    
ref|WP_015207057.1|  amino acid adenylation enzyme/thioester redu...    309   4e-81    
ref|WP_015206076.1|  thioester reductase-like protein                   309   4e-81    
gb|ETB20964.1|  fatty acyl-AMP ligase                                   305   4e-81    
gb|ETB05939.1|  fatty acyl-AMP ligase                                   304   4e-81    
ref|WP_033711400.1|  MULTISPECIES: fatty acyl-AMP ligase                304   4e-81    
ref|WP_007772992.1|  fatty acyl-AMP ligase                              304   5e-81    
gb|ETA94945.1|  fatty acyl-AMP ligase                                   304   5e-81    
ref|WP_033720956.1|  fatty acyl-AMP ligase                              304   5e-81    
ref|WP_011554596.1|  non-ribosomal peptide synthase                     310   5e-81    
ref|WP_021832298.1|  Long-chain-fatty-acid--CoA ligase                  293   5e-81    
gb|KHD10068.1|  hypothetical protein OT06_19165                         296   5e-81    
ref|WP_008185347.1|  AMP-forming acyl-CoA synthetase                    293   6e-81    
ref|WP_015137685.1|  acyl-CoA synthetase                                293   6e-81    
ref|WP_015149446.1|  acyl-CoA synthetase                                305   7e-81    
gb|KBZ65521.1|  hypothetical protein K875_01539                         303   1e-80    
ref|WP_030921918.1|  hypothetical protein                               308   1e-80    
ref|WP_014394483.1|  long-chain-fatty-acid--CoA ligase                  292   1e-80    
ref|WP_015134285.1|  Long-chain-fatty-acid--CoA ligase, Glycine C...    303   1e-80    
ref|WP_019728934.1|  fatty acyl-AMP ligase                              302   2e-80    
ref|WP_037273597.1|  hypothetical protein                               290   2e-80    
ref|WP_015632579.1|  AMP-binding reductase                              302   2e-80    
ref|WP_039737052.1|  AMP-dependent synthetase                           303   2e-80    
gb|ETZ29123.1|  thioester reductase domain protein                      302   2e-80    
ref|WP_014712213.1|  fatty acyl-AMP ligase                              302   2e-80    
ref|WP_014380890.1|  fatty acyl-AMP ligase                              302   2e-80    
ref|WP_013374340.1|  beta-ketoacyl synthase                             295   2e-80    
ref|WP_028384105.1|  fatty acyl-AMP ligase                              291   2e-80    
ref|WP_038537300.1|  fatty acyl-AMP ligase                              302   2e-80    
ref|WP_015349899.1|  amino acid adenylation domain-containing pro...    308   2e-80    
ref|WP_026736179.1|  hypothetical protein                               307   2e-80    
ref|WP_010949910.1|  fatty acyl-AMP ligase                              302   3e-80    
ref|WP_036485290.1|  AMP-binding protein                                290   3e-80    
ref|WP_037824065.1|  hypothetical protein                               289   3e-80    
ref|WP_014942776.1|  fatty acyl-AMP ligase                              301   3e-80    
ref|WP_031093924.1|  hypothetical protein                               289   3e-80    
ref|WP_017653093.1|  hypothetical protein                               306   3e-80    
ref|WP_020823340.1|  MULTISPECIES: AMP-binding enzyme                   301   3e-80    
gb|ETB35526.1|  fatty acyl-AMP ligase                                   303   3e-80    
ref|WP_009952923.1|  fatty acyl-AMP ligase                              301   3e-80    
gb|EAU67722.1|  beta-ketoacyl synthase                                  295   3e-80    
gb|AIR74919.1|  long-chain-fatty-acid-CoA ligase                        293   3e-80    
ref|WP_036459557.1|  fatty acyl-AMP ligase                              301   4e-80    
ref|WP_014385618.1|  fatty acyl-AMP ligase                              301   4e-80    
ref|WP_006104100.1|  AMP-binding enzyme domain protein                  292   4e-80    
gb|AIR74910.1|  polyketide synthase                                     306   4e-80    
emb|CBD77732.1|  polyketide synthase                                    306   4e-80    
gb|EDX86329.1|  KR domain family                                        306   4e-80    
ref|WP_008259584.1|  AMP-binding protein                                301   4e-80    
ref|WP_002734016.1|  AMP-binding enzyme family protein                  290   5e-80    
ref|WP_037912834.1|  hypothetical protein                               291   5e-80    
ref|WP_037227886.1|  AMP-dependent synthetase                           287   5e-80    
ref|WP_007307067.1|  AMP-dependent synthetase and ligase                289   6e-80    
ref|WP_002804143.1|  Putative fatty-acid--CoA ligase (Acyl-CoA sy...    289   6e-80    
ref|WP_038017830.1|  hypothetical protein                               306   6e-80    
emb|CBD77754.1|  hypothetical protein                                   292   6e-80    
ref|WP_004091838.1|  amino acid adenylation domain-containing pro...    290   6e-80    
ref|WP_035114044.1|  AMP-dependent synthetase                           289   6e-80    
ref|WP_012307589.1|  AMP-binding protein                                300   7e-80    
ref|WP_017293948.1|  hypothetical protein                               306   7e-80    
ref|WP_014397015.1|  peptide synthetase                                 306   8e-80    
gb|AHF22854.1|  MarL                                                    305   8e-80    
ref|WP_014397014.1|  peptide synthetase                                 306   9e-80    
ref|WP_016083251.1|  amino acid adenylation domain-containing pro...    305   1e-79    
ref|WP_037628759.1|  MULTISPECIES: hypothetical protein                 288   1e-79    
ref|WP_027841975.1|  AMP-dependent synthetase                           290   1e-79    
ref|WP_013660134.1|  beta-ketoacyl synthase                             292   1e-79    
ref|WP_026081713.1|  amino acid adenylation protein                     304   1e-79    
ref|WP_002752267.1|  Putative fatty-acid--CoA ligase (Acyl-CoA sy...    288   2e-79    
ref|WP_013828191.1|  fatty-acid--CoA ligase                             288   2e-79    
ref|WP_008060639.1|  Acyl-CoA synthetase                                288   2e-79    
ref|WP_002631545.1|  Long-chain-fatty-acid--CoA ligase                  305   2e-79    
ref|WP_035857547.1|  AMP-dependent synthetase                           288   2e-79    
ref|WP_026087645.1|  hypothetical protein                               298   4e-79    
ref|WP_009545085.1|  Long-chain-fatty-acid--CoA ligase                  288   4e-79    
ref|WP_017744628.1|  hypothetical protein                               302   4e-79    
ref|WP_013374361.1|  beta-ketoacyl synthase                             290   4e-79    
ref|WP_039805207.1|  AMP-dependent synthetase                           286   4e-79    
ref|WP_015657927.1|  hypothetical protein                               302   4e-79    
ref|WP_002650603.1|  saframycin Mx1 synthetase B                        298   5e-79    
ref|WP_020565853.1|  hypothetical protein                               303   5e-79    
ref|WP_002636440.1|  peptide synthetase                                 302   5e-79    
ref|WP_002609384.1|  AMP-binding protein                                303   5e-79    
ref|WP_035277741.1|  hypothetical protein                               286   5e-79    
ref|WP_011554012.1|  peptide synthetase                                 302   6e-79    
ref|WP_006527639.1|  acyl-CoA synthetase (AMP-forming)/AMP-acid l...    298   7e-79    
gb|EAU67157.1|  beta-ketoacyl synthase                                  290   7e-79    
ref|WP_037751628.1|  hypothetical protein                               301   8e-79    
ref|WP_019506941.1|  hypothetical protein                               287   9e-79    
ref|WP_024968817.1|  AMP-dependent synthetase                           286   1e-78    
ref|WP_037583313.1|  AMP-dependent synthetase                           288   1e-78    
emb|CDP14082.1|  unnamed protein product                                270   1e-78    
ref|WP_013334465.1|  AMP-dependent synthetase and ligase                286   1e-78    
gb|AIW82280.1|  PuwC                                                    286   1e-78    
ref|WP_036228369.1|  beta-ketoacyl synthase                             288   1e-78    
gb|ETW96844.1|  hypothetical protein ETSY1_24975                        287   1e-78    
ref|WP_024545890.1|  AMP-binding protein                                296   1e-78    
ref|WP_026798330.1|  AMP-dependent synthetase                           285   1e-78    
ref|WP_006194132.1|  AMP-dependent synthetase and ligase                297   1e-78    
ref|WP_019142938.1|  hypothetical protein                               298   1e-78    
ref|WP_035367431.1|  hypothetical protein                               285   1e-78    
ref|WP_036288139.1|  hypothetical protein                               301   2e-78    
ref|WP_008056975.1|  MULTISPECIES: putative Long-chain-fatty-acid...    285   2e-78    
ref|WP_002630350.1|  Long-chain-fatty-acid--CoA ligase                  302   2e-78    
ref|WP_030367730.1|  fatty acyl-AMP ligase                              301   2e-78    
ref|WP_022605765.1|  polyketide synthase module                         301   2e-78    
ref|WP_003389552.1|  Long-chain-fatty-acid--CoA ligase                  301   2e-78    
ref|WP_021829289.1|  Long-chain-fatty-acid--CoA ligase                  286   2e-78    
ref|WP_024983402.1|  hypothetical protein                               301   2e-78    
ref|WP_034421520.1|  hypothetical protein                               284   2e-78    
ref|WP_006621722.1|  AMP-dependent synthetase and ligase                285   2e-78    
gb|EST35964.1|  hypothetical protein N566_16935                         300   3e-78    
ref|WP_006635040.1|  amino acid adenylation domain protein              301   3e-78    
ref|WP_031221599.1|  fatty acyl-AMP ligase                              300   3e-78    
ref|WP_036282221.1|  thioester reductase                                299   3e-78    
ref|WP_010996834.1|  AMP-dependent synthetase and ligase                296   3e-78    
ref|WP_036482391.1|  AMP-binding protein                                285   3e-78    
gb|ETM50543.1|  hypothetical protein, variant 4                         286   3e-78    
ref|WP_006976223.1|  non-ribosomal peptide synthase                     297   4e-78    
gb|ETL44189.1|  hypothetical protein, variant 4                         286   4e-78    
ref|WP_039369063.1|  hypothetical protein                               294   4e-78    
ref|WP_006621724.1|  MULTISPECIES: AMP-dependent synthetase and l...    284   4e-78    
gb|ETL97363.1|  hypothetical protein, variant 4                         286   4e-78    
ref|WP_036675886.1|  hypothetical protein                               298   4e-78    
ref|WP_039070517.1|  hypothetical protein                               300   4e-78    
ref|WP_010110588.1|  fatty acyl-AMP ligase                              285   4e-78    
ref|WP_017308473.1|  hypothetical protein                               300   4e-78    
ref|WP_037732059.1|  hypothetical protein                               295   5e-78    
ref|XP_008903133.1|  hypothetical protein, variant 4                    286   5e-78    
ref|XP_002291500.1|  hypothetical protein THAPSDRAFT_23150              290   5e-78    
ref|WP_036017536.1|  AMP-dependent synthetase                           283   6e-78    
gb|ETK90790.1|  hypothetical protein, variant 4                         285   6e-78    
ref|WP_013139882.1|  acyl-CoA synthase                                  284   6e-78    
ref|WP_023069367.1|  AMP-binding enzyme family protein                  283   6e-78    
gb|ETL92993.1|  hypothetical protein L917_08759                         295   7e-78    
ref|WP_014371060.1|  beta-lactamase                                     298   8e-78    
gb|EKU96352.1|  acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II    283   8e-78    
ref|WP_012374781.1|  Beta-ketoacyl synthase                             298   1e-77    
ref|WP_038746090.1|  fatty acyl-AMP ligase                              283   1e-77    
ref|WP_037826008.1|  fatty acyl-AMP ligase                              296   2e-77    
ref|WP_014651811.1|  beta-lactamase                                     297   2e-77    
gb|ETL39851.1|  hypothetical protein L916_08838                         294   2e-77    
gb|ETI46497.1|  hypothetical protein F443_09103                         293   2e-77    
gb|EWM62997.1|  non-ribosomal peptide synthetase                        294   2e-77    
ref|WP_011554405.1|  peptide synthetase                                 281   2e-77    
gb|AAY42393.1|  HctA                                                    282   3e-77    
gb|ETP16294.1|  hypothetical protein F441_09066                         293   3e-77    
gb|EWM24944.1|  beta-ketoacyl synthase                                  298   3e-77    
gb|ESA35633.1|  amp-dependent synthetase and ligase                     285   3e-77    
ref|WP_029098755.1|  hypothetical protein                               297   3e-77    
ref|WP_015954749.1|  AMP-dependent synthetase and ligase                282   3e-77    
ref|WP_002083338.1|  thioester reductase                                297   3e-77    
gb|ETM46276.1|  hypothetical protein L914_08795                         293   3e-77    
ref|WP_012307587.1|  AMP-binding protein                                281   3e-77    
ref|WP_021036244.1|  Tyrocidine synthase III                            297   4e-77    
ref|WP_010477119.1|  AMP-dependent synthetase and ligase                281   4e-77    
ref|WP_003275039.1|  thioester reductase                                297   4e-77    
gb|ETO75212.1|  hypothetical protein F444_09156                         293   4e-77    
ref|WP_026736231.1|  amino acid adenylation protein                     295   5e-77    
ref|WP_031931899.1|  hypothetical protein                               296   5e-77    
ref|WP_020164202.1|  hypothetical protein                               281   5e-77    
gb|ETK86433.1|  hypothetical protein L915_08920                         292   5e-77    
ref|WP_036290631.1|  hypothetical protein                               296   5e-77    
ref|WP_012171890.1|  fatty-acid--CoA ligase                             280   6e-77    
ref|WP_030006270.1|  beta-ketoacyl synthase                             296   6e-77    
ref|WP_015195252.1|  Long-chain-fatty-acid--CoA ligase, 6-deoxyer...    296   6e-77    
ref|WP_008681958.1|  protein containing AMP-dependent synthetase ...    296   6e-77    
ref|WP_012161351.1|  AMP-dependent synthetase and ligase                281   6e-77    
ref|WP_035174619.1|  beta-ketoacyl synthase                             295   6e-77    
ref|WP_011611715.1|  AMP-dependent synthetase                           290   6e-77    
ref|WP_010120699.1|  fatty acyl-AMP ligase                              281   6e-77    
ref|WP_013918860.1|  beta-lactamase                                     295   8e-77    
ref|WP_030007851.1|  AMP-binding protein                                280   9e-77    
ref|WP_014983701.1|  peptide synthetase                                 293   1e-76    
ref|WP_010092716.1|  fatty acyl-AMP ligase                              280   1e-76    
ref|WP_036310043.1|  hypothetical protein                               295   1e-76    
ref|WP_034413782.1|  hypothetical protein                               280   1e-76    
ref|WP_036494998.1|  AMP-dependent synthetase                           279   1e-76    
ref|WP_012306795.1|  polyketide synthase                                295   1e-76    
gb|AIE12090.1|  putative cis-AT type polyketide synthase module B4B     295   2e-76    
ref|WP_014274786.1|  probable acyl-CoA synthase                         279   2e-76    
ref|WP_013827422.1|  Beta-ketoacyl synthase                             294   2e-76    
ref|WP_014274788.1|  probable acyl-CoA synthase                         280   2e-76    
ref|WP_013700094.1|  fatty acyl-AMP ligase                              279   2e-76    
gb|ETW94617.1|  AMP-dependent synthetase and ligase                     279   2e-76    
ref|WP_018229724.1|  hypothetical protein                               279   2e-76    
ref|WP_024806379.1|  hypothetical protein                               294   2e-76    
ref|WP_006619381.1|  AMP-dependent synthetase and ligase                279   3e-76    
ref|WP_029226805.1|  beta-ketoacyl synthase                             291   3e-76    
ref|WP_035736018.1|  AMP-binding protein                                279   3e-76    
ref|WP_036568521.1|  hypothetical protein                               280   3e-76    
gb|KFA87385.1|  hypothetical protein Q664_47700                         278   4e-76    
ref|WP_013699854.1|  non-ribosomal peptide synthetase                   278   4e-76    
ref|WP_023398730.1|  amino acid adenylation domain protein              292   4e-76    
dbj|GAK54268.1|  amino acid adenylation                                 293   4e-76    
ref|WP_015213479.1|  Long-chain-fatty-acid--(acyl-carrier-protein...    293   5e-76    
ref|WP_008273862.1|  AMP-dependent synthetase                           286   6e-76    
emb|CEK11613.1|  putative Aspartate racemase                            293   8e-76    
ref|WP_006104264.1|  beta-ketoacyl synthase                             291   9e-76    
ref|WP_017744202.1|  hypothetical protein                               280   9e-76    
ref|XP_008905995.1|  hypothetical protein PPTG_11628                    288   1e-75    
ref|XP_005643306.1|  acetyl-CoA synthetase-like protein                 289   1e-75    
ref|WP_035060891.1|  hypothetical protein                               287   1e-75    
gb|ETP44350.1|  hypothetical protein F442_09034                         288   1e-75    
ref|WP_036033396.1|  hypothetical protein                               276   1e-75    
ref|WP_015178661.1|  amino acid adenylation domain protein              292   1e-75    
ref|WP_012599249.1|  beta-ketoacyl synthase                             292   1e-75    
ref|WP_015134287.1|  long-chain-fatty-acid--CoA ligase                  276   2e-75    
ref|WP_035467492.1|  hypothetical protein                               280   2e-75    
ref|WP_004623654.1|  amino acid adenylation domain protein [            291   2e-75    
ref|WP_023075730.1|  amp-dependent synthetase and ligase                276   2e-75    
ref|WP_012408707.1|  AMP-dependent synthetase and ligase                288   2e-75    
ref|WP_014443347.1|  putative NRPS                                      291   2e-75    
ref|WP_013766041.1|  thioester reductase domain-containing protein      286   3e-75    
gb|EWM29724.1|  polyketide synthase                                     289   3e-75    
ref|WP_003608274.1|  amino acid adenylation domain protein              291   3e-75    
ref|WP_023538915.1|  hypothetical protein                               290   3e-75    
ref|WP_036559004.1|  hypothetical protein                               273   4e-75    
ref|WP_030946422.1|  peptide synthetase                                 275   4e-75    
ref|WP_028778293.1|  hypothetical protein                               290   5e-75    
ref|WP_023067028.1|  acyl-CoA dehydrogenase, N-terminal domain pr...    286   5e-75    
ref|WP_011553652.1|  peptide synthetase                                 290   6e-75    
gb|KHD10678.1|  hypothetical protein OT06_15400                         286   7e-75    
ref|WP_036246951.1|  hypothetical protein                               290   7e-75    
ref|WP_006508582.1|  acyl-CoA synthetase (AMP-forming)/AMP-acid l...    275   7e-75    
ref|WP_009784048.1|  Beta-ketoacyl synthase                             275   8e-75    
ref|WP_034123665.1|  hypothetical protein                               274   8e-75    
ref|WP_031978397.1|  acyl-CoA synthetase                                275   9e-75    
ref|WP_027840653.1|  AMP-dependent synthetase                           273   1e-74    
ref|WP_019490343.1|  hypothetical protein                               288   1e-74    
emb|CEK12188.1|  AMP-dependent synthetase and ligase (fragment)         274   2e-74    
ref|WP_004711091.1|  hypothetical protein                               275   2e-74    
ref|WP_039249150.1|  acyl-CoA synthetase                                275   2e-74    



>ref|XP_011083322.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105165858 
[Sesamum indicum]
Length=2307

 Score =  3175 bits (8231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1536/2303 (67%), Positives = 1860/2303 (81%), Gaps = 27/2303 (1%)
 Frame = +1

Query  313   GVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGMCES  492
             GV +DD F KLHPC P  TRI +VG GPSGLSAAYAL KLGYSNV VLEKHHS GGMCES
Sbjct  3     GVSIDDQFSKLHPCFPPHTRIAVVGGGPSGLSAAYALCKLGYSNVTVLEKHHSPGGMCES  62

Query  493   IDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDW-AYTDMRVAED  669
             ++IQGR YDLGGQVLAANSAP+IFHLA EVG E EEMDTHK AL+DS   A  +M + ED
Sbjct  63    LEIQGRIYDLGGQVLAANSAPSIFHLAGEVGVETEEMDTHKFALIDSSCGALKEMNLVED  122

Query  670   YISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTASGYG  849
             Y+SVI +TLKLQD  K + RIGV++VSEIA ++ PE+LK +G  SVPKSV YGYTASGYG
Sbjct  123   YVSVISLTLKLQDRAKESGRIGVHAVSEIAPELAPEYLKTEGFPSVPKSVIYGYTASGYG  182

Query  850   FIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNSSGV  1029
             ++QDMPYAYIHEF RTSMAGKIRRFKGGY S+WKKLSE +PI+  CNTEVLSI+R+SSG+
Sbjct  183   YVQDMPYAYIHEFTRTSMAGKIRRFKGGYMSLWKKLSERLPIEVCCNTEVLSIRRDSSGI  242

Query  1030  CVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDLFSK  1209
              V ++  NG ++  +FDKIIISGAFPF++G+TYRSPS    G   D +D S LEK+LFSK
Sbjct  243   KVKLQTVNGEVEGRDFDKIIISGAFPFNSGKTYRSPSMNAEGTVSDCIDTSELEKELFSK  302

Query  1210  VQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSYGNS  1389
             VQTI+YYT+VL+I GLEH+P GFYYF+ FM+DPA IGNPVAMQ+FY DTN+FLFWSYGNS
Sbjct  303   VQTIDYYTTVLKIKGLEHIPKGFYYFDEFMDDPATIGNPVAMQRFYGDTNIFLFWSYGNS  362

Query  1390  IDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQGQLN  1569
              DI G+EV +LA  A  +MGG+++ V+LQR FKYFPHVN QDMKDGFY+KLE  LQGQ N
Sbjct  363   ADIQGTEVTKLAMAAAKRMGGEMESVVLQRKFKYFPHVNSQDMKDGFYDKLEFLLQGQQN  422

Query  1570  TYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQLDE  1749
             TYYVGGLMAFELTERN+ Y++ L+RKHF++    P++PYVKRL  +K +  GL  KQL+E
Sbjct  423   TYYVGGLMAFELTERNSRYALELVRKHFSSYNPEPSYPYVKRLMTVKPNCRGLVSKQLNE  482

Query  1750  IPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKL  1929
              PGV+FP+LSSLD+YLR+WGT  VT+++TLYTW+NEKG V+ +RTYK++H NA  I +KL
Sbjct  483   SPGVQFPDLSSLDAYLRYWGTHIVTQSRTLYTWINEKGHVVAQRTYKQLHFNASEICEKL  542

Query  1930  LTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIAN  2109
             LT   P IK GD+VLL+Y+PGLDF+DAFFGCLRA V+P+P +PPDP QR GGQALLH++N
Sbjct  543   LTCHNPTIKTGDRVLLVYIPGLDFIDAFFGCLRAGVVPVPAVPPDPAQR-GGQALLHVSN  601

Query  2110  IAKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPDLPWLHTDSWVkkpklfk  2289
             IAK CN VAILST SYH+TV+  SA+NML  K   K S  WPDLPWLHTDSWVKK K+  
Sbjct  602   IAKACNAVAILSTVSYHITVKAASARNMLALKGNSKHSPCWPDLPWLHTDSWVKKAKISI  661

Query  2290  kpkD--EQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVS  2463
                   E+ +P + DLCFLQFTSGST DPKGVMITHGG+IHNVK+MR++YKSTS+T+LVS
Sbjct  662   SRSHTAERYEPSAHDLCFLQFTSGSTGDPKGVMITHGGLIHNVKMMRRKYKSTSKTVLVS  721

Query  2464  WLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFEL  2643
             WLPQYHDMGLIGGL T +VSGGS ILFSP+TF++NPLLWLQT+S +RATHSA PNFAFEL
Sbjct  722   WLPQYHDMGLIGGLFTSMVSGGSAILFSPLTFIRNPLLWLQTISTYRATHSAGPNFAFEL  781

Query  2644  LVRRLESSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENC  2823
             L RRLE++K +NFDLSSM FLM AAEPIR TT+++F++LTQ FGLS+EVMAPGYGLAENC
Sbjct  782   LNRRLETNKGQNFDLSSMVFLMVAAEPIRATTMRKFLDLTQPFGLSQEVMAPGYGLAENC  841

Query  2824  VFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISS  3003
             V+V  AYG+G  + VDWQ RVCCGYI Q +   V IKI+  ETG E+++ GKEGE+WISS
Sbjct  842   VYVCSAYGKGKEILVDWQDRVCCGYINQDDDADVHIKIVDLETGTEHENFGKEGELWISS  901

Query  3004  LSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAGKN  3183
              SAG+GYW  E+LSQKTF N++ S PGK+YIRTGDLGRIID KLFITGR KDLIIVAG+N
Sbjct  902   PSAGVGYWDKEDLSQKTFRNELNSQPGKKYIRTGDLGRIIDGKLFITGRIKDLIIVAGRN  961

Query  3184  IYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGKPL  3363
             IY+SD+EKTVE+S +L+RPGCCA +G+P+++L+SKGI     SD++GLVVIAEVR+ K +
Sbjct  962   IYSSDVEKTVENSCQLIRPGCCAAIGVPKEILLSKGIPISEVSDQVGLVVIAEVREVKSV  1021

Query  3364  PYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVIEEQM  3543
               + +  I T VAEEHGV +A+IV IKP++ISKTTSGKIKR+EC ++F+ GTLD++ +  
Sbjct  1022  LEEALRQIQTCVAEEHGVMVATIVLIKPKTISKTTSGKIKRFECNRKFVDGTLDIVYQLG  1081

Query  3544  NGERSL---------PRNDGIIVPANGKISKTDIVNFLKDLLSQQTGIPVSKISTGETLV  3696
              GE+ L         P+      P +  I++ DI+ FL +LLSQ TG+ ++ IS  E+LV
Sbjct  1082  TGEKLLIQTKQNESEPQGMRANPPTHSSITRRDIIKFLMELLSQMTGVSIANISITESLV  1141

Query  3697  SYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEKNHPM----LTNS  3864
             SYGV+SIGVVRAAQK+S F G+ +GAIDIF+ATCIDDLA+F +SLL+K+ P     L NS
Sbjct  1142  SYGVDSIGVVRAAQKLSDFLGVPVGAIDIFTATCIDDLANFSDSLLKKSRPQAAPGLPNS  1201

Query  3865  SETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPAYISVSMFKPLI----LANQ  4032
             ++    ++ +    S+  K++IWL+ LVALAYV  LL+ PAY+SVS F           +
Sbjct  1202  TKKNSKATAMVLEASSSHKLSIWLLQLVALAYVCFLLMFPAYLSVSTFTYWTSTGHAVQR  1261

Query  4033  SPWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPEISVWSVEFVKWWALY  4212
               WF Y I L CAP SWMLCIF TCIC   LG   LQPNY L+PE+S+WS EF+KWW LY
Sbjct  1262  GTWFGYLIILVCAPLSWMLCIFSTCICIAFLGTPFLQPNYALDPEVSIWSAEFIKWWTLY  1321

Query  4213  KAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDPLLVSIDEESVISEGA  4392
             KAQEISS+VLAVHLRGTVF+NYWF++LGAKIASSAL+DTVDITDP LVSI E++V++EGA
Sbjct  1322  KAQEISSRVLAVHLRGTVFINYWFRMLGAKIASSALLDTVDITDPFLVSIGEDAVLAEGA  1381

Query  4393  LIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLAQNKKAAAKISKPLNG  4572
             L+QSHE+KNG+LSFS +RIG+RSS+GPYA+LQ+G++V DG EVLA       K     N 
Sbjct  1382  LLQSHELKNGILSFSPIRIGRRSSVGPYALLQRGTVVEDGDEVLALTSGGEGKSEAMTNA  1441

Query  4573  -HKGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLNSLSAAIAYLVWIWLLQKPPSLHHFLF  4749
              +  KVT    +    N+  +  L  IY IG L SLSAA++Y +++WLLQKPP++ HF F
Sbjct  1442  DNMQKVTSIFSETXFKNYAPIRHLICIYAIGCLGSLSAAMSYFIYLWLLQKPPTMQHFAF  1501

Query  4750  ICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHGLILSVFTFMLNHFVSRK  4929
             I I+GAFHWFP+ I+ +T +F ++P S +SFA  +A  YT +G+IL  +T +L  ++ R 
Sbjct  1502  ISISGAFHWFPHTIVAYTVIFNTIPSSPISFAISIAMAYTTYGIILCCYTCLLKSYIVRN  1561

Query  4930  GDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWMGAKIGQHCSIRAINPVVEP  5109
              D  +   + W LHR+  ACHIRFA+ LSGTE FC+YL  +GAKIG+HCSIRAINPV +P
Sbjct  1562  EDMSRTPVKTWFLHRIVTACHIRFARFLSGTEAFCLYLRHLGAKIGEHCSIRAINPVSDP  1621

Query  5110  GLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQGLILPGSFIEKDVILGA  5289
              L+S+ADGVHLGDFSRI+PGY+ + GY+SG I+I++NSV+GSQ L+LPGS IEKDVILGA
Sbjct  1622  ELISLADGVHLGDFSRIIPGYYNSSGYLSGGIEIQDNSVVGSQSLVLPGSVIEKDVILGA  1681

Query  5290  LSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMDPKYKKVLGSLAANLAASTLK  5469
             LSVAP N VL+  G FVGS   VMV+N     DDRIEEMD KY+KVLG+LAAN A STLK
Sbjct  1682  LSVAPANRVLQSGGVFVGSPTPVMVKNTVQSFDDRIEEMDMKYRKVLGNLAANFAGSTLK  1741

Query  5470  LKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYPVIIRHSNCLSSDDDARLDPRG  5649
             +KSRYFHRIGAAGKGSLRLY+ +PGLPDH IF PG TY +I+RHSNCLSSDDDARLDPRG
Sbjct  1742  VKSRYFHRIGAAGKGSLRLYDHIPGLPDHTIFSPGKTYTIIMRHSNCLSSDDDARLDPRG  1801

Query  5650  AAIRILPHERtttttttplldltlktGKAFHARTIGDFATWLVCGAAAREEHVKHAPHIR  5829
             AAIRI  +    T   +PLLDLTLKTG AFHARTIGDFATWLVCGAAAREEHVKHAPHIR
Sbjct  1802  AAIRIFSN---ITAERSPLLDLTLKTGNAFHARTIGDFATWLVCGAAAREEHVKHAPHIR  1858

Query  5830  DAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKLRPFDEKIGEEYGEVEPRGIL  6009
             DAMWGSLRR +SYTELHYYSNICRLFRFKDGQEMYV+FKLRPFD+K GE+ G+VEP GIL
Sbjct  1859  DAMWGSLRRADSYTELHYYSNICRLFRFKDGQEMYVKFKLRPFDKKFGEDNGKVEPMGIL  1918

Query  6010  PPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQIQPIPDDERVRETLLDCTK  6189
             PPETGAIPRDE+DKRPLLFL++DF+ RV+SPD+VRYVLQLQ++ +PDDE  RE  LDCTK
Sbjct  1919  PPETGAIPRDESDKRPLLFLSDDFQRRVNSPDRVRYVLQLQMRSVPDDEIPREIALDCTK  1978

Query  6190  PWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEIDVIRATSCNQSASIDHGRSL  6369
             PWDE E P+ +VGEITIDQVLT++ESE LEFNPF RC E+DVIRA+SCNQSAS+DHGRS+
Sbjct  1979  PWDEGEFPHFDVGEITIDQVLTKEESEGLEFNPFLRCAEVDVIRASSCNQSASMDHGRSV  2038

Query  6370  VYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAKLENKDMPKATLARQWYVTLWL  6549
             VY ICQ+LRN+KPLPEAWR FLDQSDV +DLSGCP+AA LE     + TLAR WYVTLWL
Sbjct  2039  VYAICQHLRNKKPLPEAWRTFLDQSDVTVDLSGCPMAATLEKNVSKEVTLARPWYVTLWL  2098

Query  6550  MSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQWLLPLWWGGSGILAGLVCALS  6729
             +S QPFLQI LPYFL+G+VI+AP+N +FY +++ + Q  +LLP +W  SGILAGL+C LS
Sbjct  2099  ISAQPFLQIFLPYFLIGVVIFAPMNFIFYLNKIHKTQMHFLLPFFWLFSGILAGLLCVLS  2158

Query  6730  KWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYFMETATGTFLMGIWMRLMGSEVA  6909
             KW+LVGK+ +GK EPIWS  IF DT WQAIRT+ GEYFME A+G+FL  +WM+LMGSE+A
Sbjct  2159  KWILVGKRKEGKIEPIWSARIFTDTTWQAIRTLVGEYFMEMASGSFLFNVWMKLMGSEIA  2218

Query  6910  RD-GVYIDSMGATLNPDMVRIEEYGSVGREALLFGHIYEG-GGEVKYGRISVKNGGFVGS  7083
              D GVY+DSMGA LNP++V +EEYGSVGREALLFGHIYEG GG+VKYG+I V+ GGFVGS
Sbjct  2219  WDRGVYVDSMGAVLNPELVELEEYGSVGREALLFGHIYEGEGGQVKYGKIVVRKGGFVGS  2278

Query  7084  RAVAMPGATIDSGGSLGALSLAM  7152
             RAVAMPG T+ + GSLGALSLAM
Sbjct  2279  RAVAMPGVTVGTEGSLGALSLAM  2301



>ref|XP_006445976.1| hypothetical protein CICLE_v10017962mg [Citrus clementina]
 gb|ESR59216.1| hypothetical protein CICLE_v10017962mg [Citrus clementina]
Length=2309

 Score =  3011 bits (7805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1470/2318 (63%), Positives = 1829/2318 (79%), Gaps = 52/2318 (2%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+ G  +DD F KLHPC+P  TRIGIVG GPSGLS AYAL KLGY NV +LEK+H+ GGM
Sbjct  1     MDPGKSIDDQFCKLHPCLPVNTRIGIVGGGPSGLSTAYALAKLGYRNVTLLEKYHTVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVD-SDWAYTDMRV  660
             CES++I+GR YDLGGQVLAANSAP IFHLAKE GAE+EEMD+HKLAL+D S   + D++V
Sbjct  61    CESVEIEGRIYDLGGQVLAANSAPVIFHLAKEAGAELEEMDSHKLALIDGSTGEFQDIKV  120

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             A+DY+SVI +TL+LQD+ K + RIGV++VS++ASD+TP +L+D+G KSVPKSVAYGYTAS
Sbjct  121   ADDYVSVISLTLELQDKAKESGRIGVHAVSDLASDLTPTYLEDRGFKSVPKSVAYGYTAS  180

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF+QDMPYAYIHEF RTSMAGKIRRFKGGYTS+W+KLS+ +P +  CN+EVL+I+R+S
Sbjct  181   GYGFVQDMPYAYIHEFTRTSMAGKIRRFKGGYTSLWQKLSKYLPTEVHCNSEVLAIRRDS  240

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
             + V VDV+H NG  + MEFDKIIISGAFP  NG+ YRSP+ K        MDM  LEK+L
Sbjct  241   TTVGVDVKHSNGECEVMEFDKIIISGAFPVKNGKFYRSPTSKPTESETQVMDMDELEKEL  300

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             FSKVQTI+YYT+VL+I GLEHLP+GFYYF  +M+DPA IG+ VAMQKF+ DT++FLFWSY
Sbjct  301   FSKVQTIDYYTTVLKITGLEHLPVGFYYFGEYMDDPATIGHLVAMQKFFADTDIFLFWSY  360

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GNS+DI G  V E+A K V  MGG ++ V+LQR FKYFPHVN +DMKDGFY++LE +LQG
Sbjct  361   GNSVDITGPTVTEVAIKTVENMGGVIENVVLQRRFKYFPHVNSKDMKDGFYDRLEYELQG  420

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
             Q NTYYVGGLMAFELTERN+SYSMAL+ KHFAN+   P FPYVK LFPL+S +    FK+
Sbjct  421   QRNTYYVGGLMAFELTERNSSYSMALMCKHFANNYSTPEFPYVKNLFPLQSDNWARNFKE  480

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             L+E+PGV+FPELSSLD YL+HWGT  +T+ KTL+TW+NE+G  +++RTY+E+  NA  IA
Sbjct  481   LEELPGVEFPELSSLDGYLKHWGTHRITQKKTLFTWINEEGVAVNQRTYEELDANASRIA  540

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
              KLLTS+KP IKPGD+VLL+YVPGLDFVDAFFGC+RA+V+P+P +PPDP QR GGQALL 
Sbjct  541   HKLLTSRKPVIKPGDRVLLVYVPGLDFVDAFFGCMRAKVLPVPVLPPDPLQR-GGQALLK  599

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKD-KSSNSWPDLPWLHTDSWVkkp  2277
             I NI+K C  VAILST  YH  VR+ S K+++    KD ++S  WP+LPWLHTDSWVK  
Sbjct  600   IENISKSCGAVAILSTIGYHSAVRVGSVKSLISLVGKDGQASAQWPNLPWLHTDSWVKNS  659

Query  2278  klfkkpkD---EQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSR  2448
             K           + QP  +DLCFLQFTSGST D KGVMITHGG+IHNVKLMRKRYKSTS+
Sbjct  660   KNLLAENVVCFTESQP--DDLCFLQFTSGSTGDAKGVMITHGGLIHNVKLMRKRYKSTSK  717

Query  2449  TILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPN  2628
             T+LVSWLPQYHDMGLIGGL T +V G + ILFSP+TF+KNPLLWL+TMSK+RATHSA PN
Sbjct  718   TVLVSWLPQYHDMGLIGGLFTAMVGGSTAILFSPLTFIKNPLLWLETMSKYRATHSAGPN  777

Query  2629  FAFELLVRRLESSKEE--NFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPG  2802
             FAFEL+VRRLESSK++  +FDLSSM FLM AAEP+RQTT+KRFVELT+ FGLS+ VMAPG
Sbjct  778   FAFELMVRRLESSKDKVRSFDLSSMKFLMVAAEPVRQTTVKRFVELTRPFGLSQGVMAPG  837

Query  2803  YGLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKE  2982
             YGLAENCVFVSCAYG+G P+ +DWQGRVCCGY+ Q + D VDI+I++PET +E  +PGKE
Sbjct  838   YGLAENCVFVSCAYGQGKPIILDWQGRVCCGYVDQNDPD-VDIRIVNPETSEEIGEPGKE  896

Query  2983  GEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDL  3162
             GE+WISS SAGIGYWG EELSQ TF N++ +  G++Y RTGDLGRIID K FITGR KDL
Sbjct  897   GEVWISSPSAGIGYWGREELSQITFRNELQNNRGRKYTRTGDLGRIIDGKFFITGRIKDL  956

Query  3163  IIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAE  3342
             IIVAG+N+Y++D+EKTVESS+E +RPGCCAV+G+PE+VL +KGI     SD++GLVVIAE
Sbjct  957   IIVAGRNVYSADVEKTVESSTEHIRPGCCAVIGVPEEVLSTKGISVSDGSDQVGLVVIAE  1016

Query  3343  VRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTL  3522
             VRDGKP+  DV+++I TRV EEHGV +AS+  IKPR++SKTTSGKIKR+EC K+F+ GTL
Sbjct  1017  VRDGKPVDKDVIENIKTRVVEEHGVTVASVKLIKPRTMSKTTSGKIKRFECLKQFVDGTL  1076

Query  3523  DVIEEQMNGERSL--------------PRNDGIIVP-ANGKISKTDIVNFLKDLLSQQTG  3657
             + + E +  +R L              PR   +  P A+ K+S  DIV FLK L+S+QTG
Sbjct  1077  NTVPEPLFTKRKLTRSFTTGTCKEGRTPRPQLVSSPVASKKMSNKDIVEFLKGLVSEQTG  1136

Query  3658  IPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLE  3837
             IP++K+S  ++LVSYG++SIGVVRAAQK+S F G+ +GA+DIF+ATCI DLA F E+L+ 
Sbjct  1137  IPITKVSATDSLVSYGIDSIGVVRAAQKLSDFLGVPVGAVDIFTATCIADLASFSENLVM  1196

Query  3838  KNHP-MLTNSSETKISSSGIPSV---VSTFDKITIWLIHLVALAYVSLLLIIPAYISVSM  4005
             K+ P ++T+SS T    +        VS   +  IW+  L+AL YVS++LI+PAY+SVS 
Sbjct  1197  KSQPQLMTDSSFTPEPETDFDEFDMEVSKARQCGIWIFQLLALVYVSVILILPAYLSVSA  1256

Query  4006  FKPLILANQS-----PWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPEI  4170
             F  L+ A Q+     PW  Y  SL  AP +W+LCIF TCI   + GN+ L+PNY LNPE+
Sbjct  1257  FTTLVSAPQTLLDERPWLNYMFSLTFAPLAWILCIFATCISITIFGNSFLRPNYTLNPEV  1316

Query  4171  SVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDPL  4350
             S+WS +FVKWWALYK  E+S KVLAV+LRGTVFLN+WF++LGAK+ SS L+DTVDITDP 
Sbjct  1317  SIWSADFVKWWALYKVHEVSCKVLAVYLRGTVFLNWWFEMLGAKLGSSVLLDTVDITDPS  1376

Query  4351  LVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLAQ  4530
             LV I + +VISEGALIQSHEVKNGVLSF  ++I ++ S+GPYAV+QKGS++G+ AEV   
Sbjct  1377  LVLIGDGAVISEGALIQSHEVKNGVLSFQPIKIARKVSVGPYAVIQKGSVIGEEAEVAPL  1436

Query  4531  NKKAAAK-ISKPLNGHKGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLNSLSAAIAYLVWI  4707
              K    K I K  N +       ++K N   H    Q  GIY++ +L++LSAAI Y ++I
Sbjct  1437  QKSEGGKPILKSTNAN------YVQKVNEAIH----QFIGIYIVSFLSTLSAAITYFLYI  1486

Query  4708  WLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHGLIL  4887
             WL QKP S  HF F+CI+GAFHW P+ II +  MF S+P +   FA   A  Y  HGL+L
Sbjct  1487  WLSQKPASPRHFAFLCISGAFHWLPFTIIAYATMFASVPANPAYFAISTAVAYLFHGLVL  1546

Query  4888  SVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWMGAKIG  5067
             S  T +L HF++ K +  +   + W+ HR+ +ACH+RFAKLLSGTE FC+YL  + AKIG
Sbjct  1547  SYLTCILTHFLAGKKEEKQTHLKAWLCHRITIACHLRFAKLLSGTEAFCIYLRLLSAKIG  1606

Query  5068  QHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQGLI  5247
             ++CSIRAINPV  P  V++  GVHLGDFSRI+PG++++ G+I G++++++NSVIGSQ L+
Sbjct  1607  RYCSIRAINPVSCPQQVTLGAGVHLGDFSRIIPGFYSSIGFIFGKVEVQDNSVIGSQSLV  1666

Query  5248  LPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMDPKYKKV  5427
             LP S + +DVILGALSVAP++SVL+  G ++GS++ VM++N    LDDRIEEMD KYKK+
Sbjct  1667  LPNSVVSRDVILGALSVAPMHSVLQRGGIYIGSQSPVMIKNTMHALDDRIEEMDMKYKKI  1726

Query  5428  LGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYPVIIRHSN  5607
             +G+L+ANLAA+TLK+KSRYFHRIG +G+G L +Y+ + GLPDHKIF PG  YPVI+RHSN
Sbjct  1727  VGNLSANLAATTLKVKSRYFHRIGVSGRGQLTIYDNIQGLPDHKIFHPGKCYPVIVRHSN  1786

Query  5608  CLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFATWLVCGA  5787
              LS+DDDAR+D RGAAIRI          T+ LLDLTLKTG AF+ARTIGDFATWLVCG 
Sbjct  1787  SLSADDDARIDARGAAIRIFSD---LNGNTSSLLDLTLKTGNAFYARTIGDFATWLVCGL  1843

Query  5788  AAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKLRPFDEK  5967
             AAREEHVK  PHIRDA+W SLR  +SY E+HYYSNICRLFRF DGQEMYV+FKLRP+DE 
Sbjct  1844  AAREEHVKRVPHIRDAVWKSLRLSDSYAEMHYYSNICRLFRFTDGQEMYVKFKLRPYDES  1903

Query  5968  IGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQIQPIP  6147
             IGE+ GEVEPRGILPPETGAIPRD+ND RPLLFLA++F+ RVSSP  VRY+ QLQI+PIP
Sbjct  1904  IGEDSGEVEPRGILPPETGAIPRDDNDTRPLLFLADEFQRRVSSPSGVRYIFQLQIRPIP  1963

Query  6148  DDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEIDVIRAT  6327
              DE +++  LDCTKPWDE E PYI+VG+I+IDQ L+ +ESE+LEFNP+ +CNEIDVI AT
Sbjct  1964  QDEAMQDIALDCTKPWDEAEYPYIDVGKISIDQNLSTEESEKLEFNPYLKCNEIDVIPAT  2023

Query  6328  SCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAKLENKDMP  6507
             + +QSASIDHGRSL+YEICQ+LRN +PLPE+WRIFL+QSDVK+DLSGCP+AA LE K   
Sbjct  2024  TSSQSASIDHGRSLIYEICQHLRNGEPLPESWRIFLEQSDVKVDLSGCPMAAALEEKTED  2083

Query  6508  KATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQWLLPLWW  6687
             K TL R WY TLW +  QP LQ VLPYFL+GLVI+ PL    +  E   +   WLLP++W
Sbjct  2084  KVTLERTWYQTLWSIFAQPLLQTVLPYFLIGLVIFTPLKWTLFLKENKILPLHWLLPMFW  2143

Query  6688  GGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYFMETATGTF  6867
               SGILA L CA +KWVLVGKK +G++  IWS+G+ MDT+WQA RT+ GEYF+E  +G+F
Sbjct  2144  VSSGILAALACAAAKWVLVGKKKEGESVEIWSKGVLMDTVWQAFRTLVGEYFVEMTSGSF  2203

Query  6868  LMGIWMRLMGSEVAR-DGVYIDSMGATLNPDMVRIE-EYGSVGREALLFGHIYEG-GGEV  7038
             L   WM+LMG+E+    G Y+DSMGA LNP+MV +E   G VG+EALLFGHIYEG GG+V
Sbjct  2204  LFVAWMKLMGAEIELGQGAYVDSMGAVLNPEMVEMEGNGGCVGKEALLFGHIYEGDGGKV  2263

Query  7039  KYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             K+G+I +  GGFVGSRA AMPG  I++GGSL +LSLAM
Sbjct  2264  KFGKIRIGEGGFVGSRAAAMPGVRIENGGSLSSLSLAM  2301



>ref|XP_006494728.1| PREDICTED: uncharacterized protein LOC102618132 [Citrus sinensis]
Length=2300

 Score =  2997 bits (7771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1466/2318 (63%), Positives = 1822/2318 (79%), Gaps = 61/2318 (3%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+ G  +DD F KLHPC+P  TRIGIVG GPSGLS AYAL KLGY NV +LEK+H+ GGM
Sbjct  1     MDPGKSIDDQFCKLHPCLPVNTRIGIVGGGPSGLSTAYALAKLGYRNVTLLEKYHTVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVD-SDWAYTDMRV  660
             CES++I+GR YDLGGQVLAANSAP IFHLAKE GAE+EEMD+HKLAL+D S   + D++V
Sbjct  61    CESVEIEGRIYDLGGQVLAANSAPVIFHLAKEAGAELEEMDSHKLALIDGSTGEFQDIKV  120

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             A+DY+S         D+ K + RIGV++VS++ASD+TP +L+D+G KSVPKSVAYGYTAS
Sbjct  121   ADDYVS---------DKAKESGRIGVHAVSDLASDLTPTYLEDRGFKSVPKSVAYGYTAS  171

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF+QDMPYAYIHEF RTSMAGKIRRFKGGYTS+W+KLS+ +P +  CN+EVL+I+R+S
Sbjct  172   GYGFVQDMPYAYIHEFTRTSMAGKIRRFKGGYTSLWQKLSKYLPTEVHCNSEVLAIRRDS  231

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
             + V VDV+H NG  + MEFDKIIISGAFP  NG+ YRSP+ K        MDM  LEK+L
Sbjct  232   TTVGVDVKHSNGECEVMEFDKIIISGAFPVKNGKFYRSPTSKPTESETQVMDMDELEKEL  291

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             FSKVQTI+YYT+VL+I GLEHLP+GFYYF  +M+DPA IG+PVAMQKF+ DT++FLFWSY
Sbjct  292   FSKVQTIDYYTTVLKITGLEHLPVGFYYFGEYMDDPATIGHPVAMQKFFADTDIFLFWSY  351

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GNS+DI G  V E+A K V  MGG ++ V+LQR FKYFPHVN +DMKDGFY++LE +LQG
Sbjct  352   GNSVDITGPTVTEVAIKTVENMGGVIENVVLQRRFKYFPHVNSKDMKDGFYDRLEYELQG  411

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
             Q NTYYVGGLMAFELTERN+SYSMAL+ KHFAN+   P FPYVK LFPL+S +    FK+
Sbjct  412   QRNTYYVGGLMAFELTERNSSYSMALMCKHFANNYSTPEFPYVKNLFPLQSDNWARNFKE  471

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             L+E+PGV+FPELSSLD YL+HWGT  +T+ KTL+TW+NE+G  +++ TY+E+  NA  IA
Sbjct  472   LEELPGVEFPELSSLDGYLKHWGTHRITQKKTLFTWINEEGVAVNQSTYEELDANASRIA  531

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
              KLLTS+KP IKPGD+VLL+YVPGLDFVDAFFGC+RA+V+P+P +PPDP QR GGQALL 
Sbjct  532   HKLLTSRKPVIKPGDRVLLVYVPGLDFVDAFFGCMRAKVLPVPVLPPDPLQR-GGQALLK  590

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKD-KSSNSWPDLPWLHTDSWVkkp  2277
             I NI+K C  VAILST  YH  VR+ S K+++    KD ++S  WP+LPWLHTDSWVK  
Sbjct  591   IENISKSCGAVAILSTIGYHSAVRVGSVKSLISLVGKDGQASAQWPNLPWLHTDSWVKNS  650

Query  2278  klfkkpkD---EQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSR  2448
             K           + QP  +DLCFLQFTSGST D KGVMITHGG+IHNVKLMRKRYKSTS+
Sbjct  651   KNLLAENVVCFTESQP--DDLCFLQFTSGSTGDAKGVMITHGGLIHNVKLMRKRYKSTSK  708

Query  2449  TILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPN  2628
             T+LVSWLPQYHDMGLIGGL T +V G + ILFSP+TF+KNPLLWL+TMSK+RATHSA PN
Sbjct  709   TVLVSWLPQYHDMGLIGGLFTAMVGGSTAILFSPLTFIKNPLLWLETMSKYRATHSAGPN  768

Query  2629  FAFELLVRRLESSKEE--NFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPG  2802
             FAFEL+VRRLESSK++  +FDLSSM FLM AAEP+RQTT+KRFVELT+ FGLS+ VMAPG
Sbjct  769   FAFELMVRRLESSKDKVRSFDLSSMKFLMVAAEPVRQTTVKRFVELTRPFGLSQGVMAPG  828

Query  2803  YGLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKE  2982
             YGLAENCVFVSCAYG+G P+ +DWQGRVCCGY+ Q + D VDI+I++PET +E  +PGKE
Sbjct  829   YGLAENCVFVSCAYGQGKPIILDWQGRVCCGYVDQNDPD-VDIRIVNPETSEEIGEPGKE  887

Query  2983  GEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDL  3162
             GE+WISS SAGIGYWG EELSQ TF N++ +  G++Y RTGDLGRIID K FITGR KDL
Sbjct  888   GEVWISSPSAGIGYWGREELSQITFRNELQNNRGRKYTRTGDLGRIIDGKFFITGRIKDL  947

Query  3163  IIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAE  3342
             IIVAG+N+Y++D+EKTVESS+E +RPGCCAV+G+PE+VL +KGI     SD++GLVVIAE
Sbjct  948   IIVAGRNVYSADVEKTVESSTEHIRPGCCAVIGVPEEVLSTKGISVSDGSDQVGLVVIAE  1007

Query  3343  VRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTL  3522
             VRDGKP+  DV+++I TRV EEHGV +AS+  IKPR++SKTTSGKIKR+EC K+F+ GTL
Sbjct  1008  VRDGKPVDKDVIENIKTRVVEEHGVTVASVKLIKPRTMSKTTSGKIKRFECLKQFVDGTL  1067

Query  3523  DVIEEQMNGERSL--------------PRNDGIIVP-ANGKISKTDIVNFLKDLLSQQTG  3657
             + + E +  +R L              PR   +  P A+ K+S  DIV FLK L+S+QTG
Sbjct  1068  NTVPEPLFTKRKLTRSFTTGTCKEGRTPRPQLVSSPVASKKMSNKDIVEFLKGLVSEQTG  1127

Query  3658  IPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLE  3837
             IP++K+S  ++LVSYG++SIGVVRAAQK+S F G+ +GA+DIF+ATCI DLA F E+L+ 
Sbjct  1128  IPITKVSATDSLVSYGIDSIGVVRAAQKLSDFLGVPVGAVDIFTATCIADLASFSENLVM  1187

Query  3838  KNHP-MLTNSSETKISSSGIPSV---VSTFDKITIWLIHLVALAYVSLLLIIPAYISVSM  4005
             K+ P ++T+SS T    +        VS   +  IW+  L+AL YVS++LI+PAY+SVS 
Sbjct  1188  KSQPQLMTDSSFTPEPETDFDEFDMEVSKARQCGIWIFQLLALVYVSVMLILPAYLSVSA  1247

Query  4006  FKPLILANQS-----PWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPEI  4170
             F  L+ A Q+     PW  Y  SL  AP +W+LCIF TCI   + GN+ L+PNY LNPE+
Sbjct  1248  FTTLVSAPQTLLDERPWLNYMFSLTFAPLAWILCIFATCISITIFGNSFLRPNYTLNPEV  1307

Query  4171  SVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDPL  4350
             S+WS +FVKWWALYK  E+S KVLAV+LRGTVFLN+WF++LGAK+ SS L+DTVDITDP 
Sbjct  1308  SIWSADFVKWWALYKVHEVSCKVLAVYLRGTVFLNWWFEMLGAKLGSSVLLDTVDITDPS  1367

Query  4351  LVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLAQ  4530
             LV I + +VISEGALIQSHEVKNGVLSF  ++I ++ S+GPYAV+QKGS++G+ AEV   
Sbjct  1368  LVLIGDGAVISEGALIQSHEVKNGVLSFQPIKIARKVSVGPYAVIQKGSVIGEEAEVAPL  1427

Query  4531  NKKAAAK-ISKPLNGHKGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLNSLSAAIAYLVWI  4707
              K    K I K  N +       ++K N   H    Q  GIY++ +L++LSAAI Y ++I
Sbjct  1428  QKSEGGKPILKSTNAN------YVQKVNEAIH----QFIGIYIVSFLSTLSAAITYFLYI  1477

Query  4708  WLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHGLIL  4887
             WL QKP S  HF F+CI+GAFHW P+ II +  MF S+P +   FA   A  Y  HGL+L
Sbjct  1478  WLSQKPASPRHFAFLCISGAFHWLPFTIIAYATMFASVPANPAYFAISTAVAYLFHGLVL  1537

Query  4888  SVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWMGAKIG  5067
             S  T +L HF++ K +  +   + W+ HR+ +ACH+RFAKLLSGTE FC+YL  +GAKIG
Sbjct  1538  SYLTCILTHFLAGKKEEKQTHLKAWLCHRITIACHLRFAKLLSGTEAFCIYLRLLGAKIG  1597

Query  5068  QHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQGLI  5247
             ++CSIRAINPV  P  V++  GVHLGDFSRI+PG++++ G+I G++++++NSVIGSQ L+
Sbjct  1598  RYCSIRAINPVSCPQQVTLGAGVHLGDFSRIIPGFYSSIGFIFGKVEVQDNSVIGSQSLV  1657

Query  5248  LPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMDPKYKKV  5427
             LP S + +DVILGALSVAP++SVL+  G ++GS++ VM++N    LDDRIEEMD KYKK+
Sbjct  1658  LPNSVVSRDVILGALSVAPMHSVLQRGGIYIGSQSPVMIKNTMHALDDRIEEMDMKYKKI  1717

Query  5428  LGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYPVIIRHSN  5607
             +G+L+ANLAA+TLK+KSRYFHRIG +G+G L +Y+ + GLPDHKIF PG  YPVI+RHSN
Sbjct  1718  VGNLSANLAATTLKVKSRYFHRIGVSGRGQLTIYDNIQGLPDHKIFHPGKCYPVIVRHSN  1777

Query  5608  CLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFATWLVCGA  5787
              LS+DDDAR+D RGAAIRI          T+ LLDLTLKTG AF+ARTIGDFATWLVCG 
Sbjct  1778  SLSADDDARIDARGAAIRIFSD---LNGNTSSLLDLTLKTGNAFYARTIGDFATWLVCGL  1834

Query  5788  AAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKLRPFDEK  5967
             AAREEHVK  PHIRDA+W SLR  +SY E+HYYSNICRLFRF DGQEMYV+FKLRP+DE 
Sbjct  1835  AAREEHVKRVPHIRDAVWKSLRLSDSYAEMHYYSNICRLFRFTDGQEMYVKFKLRPYDES  1894

Query  5968  IGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQIQPIP  6147
             IGE+ GEVEPRGILPPETGAIPRD+ND RPLLFLA++F+ RVSSP  VRY+ QLQI+PIP
Sbjct  1895  IGEDSGEVEPRGILPPETGAIPRDDNDTRPLLFLADEFQRRVSSPSGVRYIFQLQIRPIP  1954

Query  6148  DDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEIDVIRAT  6327
              DE +++  LDCTKPWDE E PYI+VGEI+IDQ L+ +ESE+LEFNP+ +CNEIDVI AT
Sbjct  1955  QDEAMQDIALDCTKPWDEAEYPYIDVGEISIDQNLSTEESEKLEFNPYLKCNEIDVIPAT  2014

Query  6328  SCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAKLENKDMP  6507
             + +QSASIDHGRSL+YEICQ+LRN +PLPE+WRIFL+QSDVK+DLSGCP+AA LE K   
Sbjct  2015  TSSQSASIDHGRSLIYEICQHLRNGEPLPESWRIFLEQSDVKVDLSGCPMAAALEEKTED  2074

Query  6508  KATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQWLLPLWW  6687
             K TL R WY TLW +  QP LQ VLPYFL+GLVI+ PL    +  E   +   WLLP++W
Sbjct  2075  KVTLERTWYQTLWSIFAQPLLQTVLPYFLIGLVIFTPLKWTLFLKENKILPLHWLLPMFW  2134

Query  6688  GGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYFMETATGTF  6867
               SGILA L CA +KWVLVGKK +G++  IWS+G+ MDT+WQA RT+ GEYF+E  +G+F
Sbjct  2135  VSSGILAALACAAAKWVLVGKKKEGESVQIWSKGVLMDTVWQAFRTLVGEYFVEMTSGSF  2194

Query  6868  LMGIWMRLMGSEVAR-DGVYIDSMGATLNPDMVRIE-EYGSVGREALLFGHIYEG-GGEV  7038
             L   WM+LMG+E+    G Y+DSMGA LNP+MV +E   G VG+EALLFGHIYEG GG+V
Sbjct  2195  LFVAWMKLMGAEIELGQGAYVDSMGAVLNPEMVEMEGNGGCVGKEALLFGHIYEGDGGKV  2254

Query  7039  KYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             K+G+I +  GGFVGSRA AMPG  I++GGSL +LSLAM
Sbjct  2255  KFGKIRIGEGGFVGSRAAAMPGVRIENGGSLSSLSLAM  2292



>ref|XP_011025254.1| PREDICTED: uncharacterized protein LOC105126175 [Populus euphratica]
Length=2308

 Score =  2993 bits (7760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1464/2320 (63%), Positives = 1808/2320 (78%), Gaps = 57/2320 (2%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+  V ++D F+KLHPC+P  TRIGIVG GPSG+SAAYAL KLGY NV VLEKHH+ GGM
Sbjct  1     MDPLVSIEDQFVKLHPCLPVNTRIGIVGGGPSGISAAYALAKLGYQNVTVLEKHHTVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRV  660
             CES+DI+GR YDLGGQVLA NSAP IFHLAKEVG+E+EEMD+HKLA +DS    Y D++V
Sbjct  61    CESVDIEGRIYDLGGQVLANNSAPVIFHLAKEVGSELEEMDSHKLAHIDSSTGKYQDIKV  120

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             A+DY++VI +TL+LQD+ K ++RIGV++VSE+A+D+TP FL+ +G KSVPKSVAYGYTAS
Sbjct  121   ADDYVAVISLTLELQDKAKDSSRIGVHAVSELAADLTPTFLESRGFKSVPKSVAYGYTAS  180

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF+QDMPYAYIHEF RTSMAGKIRRFKGGYTS+W+K+SE++PI+  C T+VL+I+RNS
Sbjct  181   GYGFVQDMPYAYIHEFTRTSMAGKIRRFKGGYTSLWQKISESLPIEVNCKTDVLAIRRNS  240

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
               V VDV+  NG +Q MEFDKIIISG+FPF NG TYR P++K+     + MD+S +E+  
Sbjct  241   DSVRVDVKRNNGEIQEMEFDKIIISGSFPFRNGNTYRFPAEKSTESETEVMDLSEVERYF  300

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             F KVQTI+YYT+VL+I GLE +P+GFYYF  +M+DPA IG+PVAMQKFY DT++FLFWSY
Sbjct  301   FRKVQTIDYYTTVLKIKGLEDMPVGFYYFGEYMDDPATIGHPVAMQKFYADTDIFLFWSY  360

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GNS DI G  V ELAKK V+ MGG V++ +LQR FKYFPHV  Q+MKDGFY+KLE+++QG
Sbjct  361   GNSFDIKGPTVAELAKKVVMSMGGIVEEEVLQRRFKYFPHVGSQEMKDGFYDKLESEVQG  420

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
             Q NTYYVGGLMAFELTERN+SY+MALI KHFAN+ +VP FPYVK LF LKS       K+
Sbjct  421   QRNTYYVGGLMAFELTERNSSYAMALICKHFANNNLVPMFPYVKSLFSLKSDCWDRNPKE  480

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             L E   V+FP+LS+LD YLRHWGT  +T +KTLYTW+ E G V+ +RTY E+H  A  IA
Sbjct  481   LGE--EVEFPDLSTLDGYLRHWGTESMTRDKTLYTWIGEDGAVVSQRTYAELHAKASCIA  538

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
             +KLLTS+KP IKPGD+VLL+YVPGLDF+DAFFGCLRA+V+P+P +PPDP QRGG QALL 
Sbjct  539   RKLLTSRKPVIKPGDRVLLVYVPGLDFIDAFFGCLRAKVLPVPVLPPDPLQRGG-QALLK  597

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPDLPWLHTDSWVkkpk  2280
             I +IAK CN VAILST  YH  VR  S KN++    K+     WP+LPW+HTDSW+K  K
Sbjct  598   IESIAKSCNAVAILSTLLYHSAVRAGSVKNLISLAGKN---GKWPNLPWMHTDSWLKDSK  654

Query  2281  lfk---kpkDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRT  2451
             +        + + QP  +DLCFLQFTSGST D KGVMITHGG+IHNVKLM++ YKSTS+T
Sbjct  655   VLAPENIAYESESQP--DDLCFLQFTSGSTGDAKGVMITHGGLIHNVKLMKRIYKSTSKT  712

Query  2452  ILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNF  2631
             +LVSWLPQYHDMGLIGGL T LVSGGS ILFSP+TF+KNPLLWLQ MSK+ ATHSA PNF
Sbjct  713   VLVSWLPQYHDMGLIGGLFTALVSGGSAILFSPMTFIKNPLLWLQIMSKYHATHSAGPNF  772

Query  2632  AFELLVRRLESS---KEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPG  2802
             AFEL++RRLE +   K  NFDLSS+ FLM AA+P+RQ T+KRFVELT+ FGLS+EVMAPG
Sbjct  773   AFELVLRRLEHADKDKVRNFDLSSLIFLMVAADPVRQRTMKRFVELTRPFGLSQEVMAPG  832

Query  2803  YGLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKE  2982
             YGLAENCVFVSCAYGEG P+ VDWQGRVCCGY+  PN + +DI+I+ PE+ +E  + GKE
Sbjct  833   YGLAENCVFVSCAYGEGKPILVDWQGRVCCGYVG-PNGEDIDIRIVDPESNEELRESGKE  891

Query  2983  GEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDL  3162
             GEIWISS SAGIGYWG EELSQ+TF N + + PG++Y RTGDLGRIID K+FITGR KDL
Sbjct  892   GEIWISSPSAGIGYWGREELSQRTFRNVLQNHPGRKYTRTGDLGRIIDGKMFITGRIKDL  951

Query  3163  IIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAE  3342
             IIVAG+NIY++D+EKTVES+SEL+RPGCCAV+G+PE+VL SKGI    +SD++GLVVIAE
Sbjct  952   IIVAGRNIYSADVEKTVESASELLRPGCCAVIGVPEEVLSSKGISLPDSSDQVGLVVIAE  1011

Query  3343  VRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTL  3522
             VRD KP+  DV+++I +RVAEEHGV +ASI  IKPR+ISKTTSGKIKR+EC K F  GTL
Sbjct  1012  VRDAKPVDKDVVENIKSRVAEEHGVTVASIKLIKPRTISKTTSGKIKRFECLKHFTDGTL  1071

Query  3523  DVIEEQMNGERSL--------------PRNDGIIVP-ANGKISKTDIVNFLKDLLSQQTG  3657
             + + + +  +R L              PR+     P    K SK +IV FLK L+S+QTG
Sbjct  1072  NTVPDPIFAKRKLLRSFTTGTCKEGLTPRSRLATSPLPTAKFSKKEIVEFLKGLVSEQTG  1131

Query  3658  IPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLE  3837
             IP+  IS  E+LVSYG++SIGVVRAAQK+S F G+ +GA+DIF+ATCI DLA F E+L+ 
Sbjct  1132  IPIKNISATESLVSYGIDSIGVVRAAQKLSDFLGVPVGAVDIFTATCIADLASFSENLMM  1191

Query  3838  KNHPMLTNSS----ETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPAYISVSM  4005
             K+ P L NS     E  I S+   +  ST   I++W   L+AL YV  +L  PAY SVS 
Sbjct  1192  KSQPQLMNSQSYQPEPDIDSAEFDTETSTTRIISVWFFQLLALVYVCAMLSFPAYFSVSA  1251

Query  4006  FKPLI-----LANQSPWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPEI  4170
             F  L+     L  +   + Y I LA AP +W+L I  TCI    LGN+ L+PNY L PE+
Sbjct  1252  FTSLLSASHMLNEEFTLWNYLIPLALAPLAWILGIISTCISIAFLGNSFLKPNYALTPEV  1311

Query  4171  SVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDPL  4350
             S+WS+ FVKWWALYKAQEISSKV A HLRGTVFLNYWF++LGAKI SS L+DTVDITDP 
Sbjct  1312  SIWSIHFVKWWALYKAQEISSKVFAEHLRGTVFLNYWFEMLGAKIGSSVLLDTVDITDPS  1371

Query  4351  LVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLAQ  4530
             LVSI + +VI+EGAL+QSHEVKNG+LSF  +RIG+ SS+GPYAV+QKGS +G+ A+V   
Sbjct  1372  LVSIGDGAVIAEGALLQSHEVKNGILSFQAIRIGRNSSVGPYAVIQKGSTLGEEADVQPL  1431

Query  4531  NK----KAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLNSLSAAIAYL  4698
              K    KA  K SK  N  KG +             + +   GIYM+G L++LSAAI Y 
Sbjct  1432  QKTEGGKAVLKSSKAHNVQKGAMLF---------DKATYHFMGIYMVGLLSTLSAAIIYF  1482

Query  4699  VWIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHG  4878
             ++IWL Q P S+ HF F+CI+GAFHW P+ II +  M  ++P +  +FA  VA  Y AHG
Sbjct  1483  LYIWLSQNPASIQHFSFLCISGAFHWTPFTIIAYATMIANVPSNPATFAISVAIVYLAHG  1542

Query  4879  LILSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWMGA  5058
             LILS+ T  L HF+S K +  +   + W+ HR+ +ACH+RFAKLLSGTE FC+YL  +GA
Sbjct  1543  LILSLLTCTLTHFLSEKQEKRESHLKAWLRHRITIACHLRFAKLLSGTEAFCIYLRLLGA  1602

Query  5059  KIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQ  5238
              +G+HCSIRA+NPV +P L+++ DGVHLGDFSR++ G++++ G+  G+I++++NSV+GSQ
Sbjct  1603  SVGEHCSIRAVNPVSDPELITIGDGVHLGDFSRMIAGFYSSSGFTQGKIEVQDNSVVGSQ  1662

Query  5239  GLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMDPKY  5418
              L+LPGS ++KDVILGALSVAP NSVL+  G ++GS+  VM++N    LDDRIEEMD KY
Sbjct  1663  SLMLPGSVVQKDVILGALSVAPANSVLQQGGVYIGSQTPVMIKNTMHALDDRIEEMDYKY  1722

Query  5419  KKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYPVIIR  5598
             KK++G+LAANLAA+TLK+K+RYFHRIG +GKG L++Y+ L G PDHKIF  G +YP+++R
Sbjct  1723  KKIVGNLAANLAATTLKVKARYFHRIGVSGKGHLKIYDNLKGFPDHKIFRAGKSYPIVVR  1782

Query  5599  HSNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFATWLV  5778
             HSN LS+DDDAR+D RGAAIRIL       + ++ LLDLTLKTGKAF+AR+I DFATWLV
Sbjct  1783  HSNSLSADDDARIDARGAAIRIL--SDDNGSNSSSLLDLTLKTGKAFYARSIADFATWLV  1840

Query  5779  CGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKLRPF  5958
             CG  ARE+HVK APHIRDA+W SL   NS+ +LHYYSNICRLFRF DGQEMYV+FKLRP 
Sbjct  1841  CGLPAREQHVKRAPHIRDAVWMSLCNANSFADLHYYSNICRLFRFSDGQEMYVKFKLRPG  1900

Query  5959  DEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQIQ  6138
             DE I E+ G+VEP GILPPETGAIPR+E D RPLLFLAEDF+ RVSSP  VRY+ QLQI+
Sbjct  1901  DENISEDSGKVEPMGILPPETGAIPRNEKDTRPLLFLAEDFQSRVSSPGGVRYIFQLQIR  1960

Query  6139  PIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEIDVI  6318
             P+P D+   +  LDCTKPWDE E PYI++GEI IDQ LT  ESE LEFNP+ RC+E+DVI
Sbjct  1961  PVPHDDATCDIALDCTKPWDESEFPYIDIGEIHIDQNLTGAESEALEFNPYIRCHEVDVI  2020

Query  6319  RATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAKLENK  6498
             RATS +QSASIDHGRSL+YEICQ+LRN +PLPEAWRIF++QSDVK+DLSGCP+AA LE K
Sbjct  2021  RATSSSQSASIDHGRSLIYEICQHLRNGEPLPEAWRIFIEQSDVKVDLSGCPMAAALEKK  2080

Query  6499  DMPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQWLLP  6678
             D  KATLAR+WY TLW++  QP LQ  LP+FL+GL+I+APLN +    E  ++   WLLP
Sbjct  2081  DSGKATLARKWYQTLWVIFAQPLLQTFLPHFLMGLLIFAPLNWILLLKESKKVAMHWLLP  2140

Query  6679  LWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYFMETAT  6858
             L W  SG LA L C ++K +LVGKK +G+T  IWS G+FMDT+WQA RTV G+YFME  T
Sbjct  2141  LVWVSSGFLAALACVVAKRILVGKKKEGQTVHIWSIGVFMDTVWQAFRTVVGDYFMEMTT  2200

Query  6859  GTFLMGIWMRLMGSEVARD-GVYIDSMGATLNPDMVRIEEYGSVGREALLFGHIYEG-GG  7032
             G+    +W++LMGS++  D G Y+DSMGA LNP+MV IE  G VGR ALLFGHIYEG GG
Sbjct  2201  GSIFFLLWLKLMGSDIDLDQGAYVDSMGAALNPEMVEIERGGCVGRGALLFGHIYEGEGG  2260

Query  7033  EVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             +VK+GRI V  GGFVGSRA+AMPG  ++ GG+L ALSLAM
Sbjct  2261  KVKFGRIRVGEGGFVGSRAIAMPGVRVEIGGNLSALSLAM  2300



>ref|XP_010651281.1| PREDICTED: uncharacterized protein LOC100253550 [Vitis vinifera]
Length=2319

 Score =  2993 bits (7759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1467/2320 (63%), Positives = 1825/2320 (79%), Gaps = 46/2320 (2%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+S   ++D F KLHP +P +TRIGIVG GPSGLSAAYAL KLGYSNV VLEK+ + GGM
Sbjct  1     MDSRKSIEDQFSKLHPSLPVSTRIGIVGGGPSGLSAAYALAKLGYSNVTVLEKYQTVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRV  660
             CES +I+G  YDLGGQVLAANSAP IFH AKE+G+E+EEMD+HKL L+DS    + D++V
Sbjct  61    CESAEIEGNIYDLGGQVLAANSAPVIFHWAKEIGSELEEMDSHKLTLIDSSTGKHKDIKV  120

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             A+DY+SVI +TL+LQD+ K + RIGV++VSEIASD+TPEFL+ +G KSVPKSVA GYTAS
Sbjct  121   ADDYVSVISLTLELQDKAKDSGRIGVHAVSEIASDLTPEFLEARGFKSVPKSVACGYTAS  180

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF+QDMPYAYIHEF RTSMAGKIRRFKGGY + WKKLSE +PI+  CNTEVL+++R+S
Sbjct  181   GYGFVQDMPYAYIHEFTRTSMAGKIRRFKGGYMNFWKKLSEMLPIEVRCNTEVLAVRRSS  240

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
             +GV VDV++ NG ++ +EFD+IIISG+FPF NG+TYR+P   +A      MDM+ LEK L
Sbjct  241   AGVSVDVKNSNGEVEVIEFDEIIISGSFPFKNGKTYRAPPSSSAEPETGVMDMNELEKKL  300

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             FSKVQTI+YYT+VL+I GLEH+P+GFYYFE FM+DPA IG+PVAMQ+FY +T+VFLFWSY
Sbjct  301   FSKVQTIDYYTTVLKIKGLEHIPVGFYYFEEFMDDPATIGHPVAMQRFYNNTDVFLFWSY  360

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GNS+DI G  V ELA      MGG++++V+LQR FKYFPH++ QDMK+GFYEK+E++LQG
Sbjct  361   GNSVDIKGPTVTELAINTAKNMGGEIEEVVLQRRFKYFPHISSQDMKEGFYEKVESELQG  420

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
               NTYYVGGLMAFELTERNASY++AL+ KHFAND   PTFPYVKRLFPL+S   G   K 
Sbjct  421   MRNTYYVGGLMAFELTERNASYAVALVCKHFANDTPSPTFPYVKRLFPLQSDGWGGNPKI  480

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             LDE PGVKFP+++SLD YL+HWGT  V +NKTLYTW+NE+G V+ +RTY+E+H NA  IA
Sbjct  481   LDEFPGVKFPDIASLDGYLKHWGTHEVIQNKTLYTWINEEGVVVSQRTYRELHANASCIA  540

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
               LL +QKP  KPGD+VLL+Y+PGLDF+DAFFGCLRA+++P+P +PPDP QR GGQALL 
Sbjct  541   HNLLLNQKPLFKPGDRVLLVYIPGLDFIDAFFGCLRAKLLPVPVLPPDPLQR-GGQALLK  599

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSWVkkp  2277
             I NIAK CN +AILST  YH  V   S K+++ F     K+S  WP+LPWLHTDSW+K  
Sbjct  600   IENIAKSCNALAILSTIRYHAGVCAGSVKSLISFTGKNGKNSARWPNLPWLHTDSWIKYS  659

Query  2278  klfkkp-kDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTI  2454
             +   +    +Q +P  +DLCFLQFTSGST D KGVMITHGG+IHNVKLMR+RYKSTS+T+
Sbjct  660   RNLLQEDIADQSEPQPDDLCFLQFTSGSTGDAKGVMITHGGLIHNVKLMRRRYKSTSKTV  719

Query  2455  LVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFA  2634
             LVSWLPQYHDMGLIGGL + LVSGGS +LFSP++F+KNPLLWLQTMSK++ATHSA PNFA
Sbjct  720   LVSWLPQYHDMGLIGGLFSALVSGGSAVLFSPMSFIKNPLLWLQTMSKFQATHSAGPNFA  779

Query  2635  FELLVRRLESSKE--ENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYG  2808
             FEL+VRRLES K+   N++LSSM FLM AAEP+RQ TLKRFV+LT  FGL  EV+APGYG
Sbjct  780   FELVVRRLESGKDTVHNYNLSSMIFLMVAAEPVRQNTLKRFVKLTSPFGLCEEVLAPGYG  839

Query  2809  LAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGE  2988
             LAENCVFVSCAYGEG P+ VDWQ RVCCGY+   N D VDI+++ PETG+E ++ GKEGE
Sbjct  840   LAENCVFVSCAYGEGKPILVDWQERVCCGYVDTENAD-VDIRVVDPETGEEQEEVGKEGE  898

Query  2989  IWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLII  3168
             IWISS SAG+GYWG EELS KTF N++ + PG+RY RTGDLGRIID KLFITGR KDLII
Sbjct  899   IWISSPSAGVGYWGREELSGKTFRNELQNHPGRRYTRTGDLGRIIDGKLFITGRIKDLII  958

Query  3169  VAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVR  3348
             VAG+NIY +D+EKTVESSSEL+RPGCCAV+G+PE++L  KGI     SD++GLVVIAEVR
Sbjct  959   VAGRNIYAADVEKTVESSSELLRPGCCAVIGVPEEILSQKGISLPDHSDQVGLVVIAEVR  1018

Query  3349  DGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDV  3528
             DGK +  DV++ I   VAEEHGV +ASI  IKP++ISKTTSGKIKR++C ++F  GTL +
Sbjct  1019  DGKHVGKDVIEQIQAHVAEEHGVTVASIKLIKPKTISKTTSGKIKRFDCIRQFSDGTLSL  1078

Query  3529  IEEQMNGERSL--------------PRNDGIIVP-ANGKISKTDIVNFLKDLLSQQTGIP  3663
             + E +  ++ L              PR +    P  N ++SK DIV FLK L+S+QTGIP
Sbjct  1079  VPEPILSKKVLHRSFTTGTCREGNTPRPELNKYPLTNPRLSKEDIVEFLKGLVSEQTGIP  1138

Query  3664  VSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEKN  3843
             +  I   E+L SYG++SIGVVRAAQK+S F G+ +GA+D+F+ATCI DLA+F E+L+ K+
Sbjct  1139  IKNIFASESLSSYGIDSIGVVRAAQKLSDFLGVPVGAVDMFTATCIADLANFSENLVRKS  1198

Query  3844  H------PMLTNSSETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPAYISVSM  4005
             H      P      ET +S   +   ++   K+ IW   L+AL Y+S+LLIIPAY+SVS 
Sbjct  1199  HHQYMTAPSYVPEPETDLSE--LVMEIAPSHKLGIWFFQLLALIYISVLLIIPAYLSVSA  1256

Query  4006  FKPLI-----LANQSPWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPEI  4170
             F  L+     L + + W  Y ISLA AP +W+LCIF TCIC   LGN+ LQPNY L PEI
Sbjct  1257  FISLLSTCCNLIDGTSWLDYLISLAFAPLAWLLCIFSTCICIAYLGNSFLQPNYALTPEI  1316

Query  4171  SVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDPL  4350
             S+WS +FVKWW LYK QE++SKVLAVHLRGTVFL  WF++LGA+I SS L+DT+DITDP 
Sbjct  1317  SIWSKDFVKWWGLYKVQEVASKVLAVHLRGTVFLKCWFEMLGARIGSSVLLDTIDITDPS  1376

Query  4351  LVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLAQ  4530
             LVSI + +VI+EGALIQSHEVKNG+LSF  +RIG+  S+GPYA++QKGS++ +GAEV A 
Sbjct  1377  LVSIGDGAVIAEGALIQSHEVKNGILSFLPIRIGQNCSVGPYALIQKGSVLAEGAEVQAS  1436

Query  4531  NKKAAA----KISKPLNGHKGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLNSLSAAIAYL  4698
              K        + +K  N  KG V  +   RN     +++   GIYM+G+L+SL+AA+ Y 
Sbjct  1437  QKSEGGTSVFQSNKANNVPKGSVLPK-DSRN-AQIEAIYHFLGIYMVGFLSSLAAALFYF  1494

Query  4699  VWIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHG  4878
             +++WL + PPS  HF F+CI+GAFHWFP+ II +T MF+S  +S   FA  VA  Y AHG
Sbjct  1495  LYLWLSRSPPSFQHFTFLCISGAFHWFPFTIIAYTTMFSSASLSPPYFAISVAVAYLAHG  1554

Query  4879  LILSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWMGA  5058
             LILS  T  +  F++RK DT +   + W+ HR+ +ACH+RFAKLLSGTE  C+YL  +GA
Sbjct  1555  LILSFLTCTMTRFLARKPDTKQSHMKTWLRHRIMIACHLRFAKLLSGTEALCIYLRLLGA  1614

Query  5059  KIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQ  5238
             KIG HCSIRAINPV EP L+S+  GVH+GDFSRI+PG++++ G+  G+I + +NSV+GSQ
Sbjct  1615  KIGSHCSIRAINPVSEPELISIGAGVHMGDFSRIIPGFYSSSGFTCGQIKVEDNSVVGSQ  1674

Query  5239  GLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMDPKY  5418
              L+LPGS ++KDVILGALSVAP+NSVL+  G ++GS+  VM++N    LD RIEEMD KY
Sbjct  1675  SLVLPGSVLQKDVILGALSVAPMNSVLQRGGVYIGSQTPVMIKNTLHALDQRIEEMDVKY  1734

Query  5419  KKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYPVIIR  5598
             K+++G+LAANLA +T+K+KSRYFHRIG  GKG L++Y+ + G PDHKIF PG +YPV+IR
Sbjct  1735  KRIVGNLAANLAVTTMKVKSRYFHRIGVGGKGILKIYDNIKGFPDHKIFQPGKSYPVLIR  1794

Query  5599  HSNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFATWLV  5778
             HSN L++DDDAR+D RGAA+RILP E     + +PLLDLTLKTG AF+ARTI DFATWLV
Sbjct  1795  HSNSLAADDDARIDARGAALRILPDE---PGSDSPLLDLTLKTGNAFYARTIADFATWLV  1851

Query  5779  CGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKLRPF  5958
             CG AAREEHVK  P +RDA+W SLRR +S+ ELHYYSNICRLFRFKDGQEMYV+ KLRP+
Sbjct  1852  CGLAAREEHVKRIPRVRDAVWASLRRADSFAELHYYSNICRLFRFKDGQEMYVKLKLRPY  1911

Query  5959  DEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQIQ  6138
             DEK  E+ G++EP GILPPETGAIPRD+ D RPLLFLAEDF+ RV+S   VRYV Q+Q Q
Sbjct  1912  DEKFSEDSGKIEPIGILPPETGAIPRDDTDTRPLLFLAEDFQQRVNSAGGVRYVFQMQFQ  1971

Query  6139  PIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEIDVI  6318
             P+P DE   ++ LDCTKPWDE E P+I+VGEI +DQ+LT +ESE+LEFNPF +C+E+DVI
Sbjct  1972  PVPGDEATCDSALDCTKPWDENEFPHIDVGEIIVDQMLTREESEQLEFNPFLQCHEVDVI  2031

Query  6319  RATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAKLENK  6498
             RA+S +QSASIDHGRSL+YEICQ+LRNR+PLPEAWRIFL+QSD K+DLSGCP+AA L+ K
Sbjct  2032  RASSSSQSASIDHGRSLIYEICQHLRNREPLPEAWRIFLEQSDFKVDLSGCPMAAALQKK  2091

Query  6499  DMPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQWLLP  6678
             D+   TL+R WY TLW++  QP LQ VLPYF++GLV++APLN +FY     ++   WLLP
Sbjct  2092  DVQNVTLSRTWYQTLWVIFAQPLLQTVLPYFIMGLVVFAPLNWVFYWKNTKKLPLHWLLP  2151

Query  6679  LWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYFMETAT  6858
              +W  SG LA LVC ++KW LVGKK +G+T  IWSR +FMDTIWQA RT+ GEYFME  T
Sbjct  2152  FFWLSSGTLAALVCIVAKWGLVGKKKEGETALIWSRSVFMDTIWQAFRTLVGEYFMEMIT  2211

Query  6859  GTFLMGIWMRLMGSEVA-RDGVYIDSMGATLNPDMVRIEEYGSVGREALLFGHIYEG-GG  7032
             G+FL  +WMRLMGS +   +G Y+DSMGA LNP+MV IE  G VGREALLFGHIYEG GG
Sbjct  2212  GSFLFALWMRLMGSNIELNEGAYVDSMGAVLNPEMVEIERGGCVGREALLFGHIYEGEGG  2271

Query  7033  EVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             +VK+G+IS+  GGFVGSRAV MPG  +++GGSL  LSLAM
Sbjct  2272  KVKFGKISIGEGGFVGSRAVVMPGVRVETGGSLSDLSLAM  2311



>ref|XP_011025255.1| PREDICTED: uncharacterized protein LOC105126176 [Populus euphratica]
Length=2349

 Score =  2962 bits (7680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1456/2335 (62%), Positives = 1797/2335 (77%), Gaps = 66/2335 (3%)
 Frame = +1

Query  286   ICKEMEMESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKH  465
             I    +M+    ++D F+KLHPC+P  TRIGIVG GPSG+SAAYAL KLGY NV VLEKH
Sbjct  27    IASTEKMDPLTSIEDQFVKLHPCLPVNTRIGIVGGGPSGISAAYALAKLGYQNVTVLEKH  86

Query  466   HSAGGMCESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-  642
             H+ GGMCES+DI+GR YDLGGQVLA NSAP IFHLAKEVG+E+EEMD+HKLA +DS    
Sbjct  87    HTVGGMCESVDIEGRIYDLGGQVLAKNSAPVIFHLAKEVGSELEEMDSHKLAHIDSSTGK  146

Query  643   YTDMRVAEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVA  822
             Y D++VAEDY +VI +TL+LQD+ K + RIGV++VSE+A+D+TP +L+ +G KSVPKSVA
Sbjct  147   YQDIKVAEDYAAVISLTLELQDKAKDSGRIGVHAVSELAADLTPTYLESRGFKSVPKSVA  206

Query  823   YGYTASGYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVL  1002
             YGYTASGYGF+QDMPYAYIHEF RTSMAGKIRRFKGGYTS+W+K+SE++PIK  C T+VL
Sbjct  207   YGYTASGYGFVQDMPYAYIHEFTRTSMAGKIRRFKGGYTSLWQKISESLPIKVNCKTDVL  266

Query  1003  SIKRNSSGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMS  1182
             +I+RNS  V VDV+  NG +Q MEFDKIIISG+FPF NG TYR P++K+     + M++S
Sbjct  267   AIRRNSDNVRVDVKRNNGEIQEMEFDKIIISGSFPFRNGNTYRFPAEKSTESETEVMELS  326

Query  1183  TLEKDLFSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNV  1362
              +E+  F KVQTI+YYT+VL+I GLE +P+GFYYF  +M+DPA IG+PVAMQKFY DT++
Sbjct  327   EVERYFFRKVQTIDYYTTVLKIKGLEDMPVGFYYFGEYMDDPATIGHPVAMQKFYADTDI  386

Query  1363  FLFWSYGNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKL  1542
             FLFWSYGNS DI G  V ELAKK  + MG  V++ +LQR FKYFPHV  Q+MKDGFY+KL
Sbjct  387   FLFWSYGNSFDIKGPTVAELAKKVAMSMGANVEEEVLQRRFKYFPHVGSQEMKDGFYDKL  446

Query  1543  ETQLQGQLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSE  1722
             E+++QGQ NTYYVGGLMAFELTERN+SY+MALI KHFAN+ +VP FPYVK LF LKS   
Sbjct  447   ESEVQGQRNTYYVGGLMAFELTERNSSYAMALICKHFANNNLVPMFPYVKSLFSLKSDCW  506

Query  1723  GLAFKQLDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHT  1902
                 K+L E   V+FP+LS+LD YLRHWGT  +T +KTLYTW+ E G V+ +RTY E+H 
Sbjct  507   DRNPKELGE--EVEFPDLSTLDGYLRHWGTESMTRDKTLYTWIGEDGAVVSQRTYAELHA  564

Query  1903  NAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGG  2082
              A  IA KLLTS+KP IKPGD+VLL+YVPGLDF+DAFFGCLRA+V+P+P +PPDP QRGG
Sbjct  565   KASCIACKLLTSRKPVIKPGDRVLLVYVPGLDFIDAFFGCLRAKVLPVPVLPPDPLQRGG  624

Query  2083  GQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPDLPWLHTDS  2262
              QALL I +IAK CN VAILST  YH  VR  S KN++    K+     WP+LPW+HTDS
Sbjct  625   -QALLKIESIAKSCNAVAILSTLLYHSAVRAGSVKNLISLAGKN---GKWPNLPWMHTDS  680

Query  2263  WVkkpklfk---kpkDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRY  2433
             W+K  K+        + + QP  +DLCFLQFTSGST D KGVMITHGG+IHNVKLM++ Y
Sbjct  681   WLKDSKVLAPENIAYESESQP--DDLCFLQFTSGSTGDAKGVMITHGGLIHNVKLMKRIY  738

Query  2434  KSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATH  2613
             KSTS+T+LVSWLPQYHDMGLIGGL T LVSGGS ILFSP+TF+KNPLLWLQ MSK+ ATH
Sbjct  739   KSTSKTVLVSWLPQYHDMGLIGGLFTALVSGGSAILFSPMTFIKNPLLWLQIMSKYHATH  798

Query  2614  SAAPNFAFELLVRRLESS---KEENFDLSSMHFLMSAAE---------PIRQTTLKRFVE  2757
             SA PNFAFELL+RRLE +   K  NFDLSS+ FLM AAE         P+RQ TLK FVE
Sbjct  799   SAGPNFAFELLIRRLEHADKDKVRNFDLSSLIFLMVAAEQVRQRIAAEPVRQRTLKIFVE  858

Query  2758  LTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKI  2937
             LT+ FGLS+EVMAPGYG+AENCVFVSCAYGEG P+ VDWQGRVCCGY+ +PN + +DI+I
Sbjct  859   LTRPFGLSQEVMAPGYGMAENCVFVSCAYGEGKPILVDWQGRVCCGYV-EPNGEDIDIRI  917

Query  2938  ISPETGKENDDPGKEGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGR  3117
             + PE+ +E  + GKEGEIWISS SAGIGYWG EELSQ TF N + + PG++YIRTGDLGR
Sbjct  918   VDPESNEELKESGKEGEIWISSPSAGIGYWGREELSQSTFRNVLQNHPGRKYIRTGDLGR  977

Query  3118  IIDSKLFITGRTKDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGIL  3297
             IID K+FITGR KDLII AG+NIY +D+EKTVES+SE +RPGCCAV G+PE+VL SKGI 
Sbjct  978   IIDGKVFITGRIKDLIIAAGRNIYCTDVEKTVESASEHLRPGCCAVFGVPEEVLSSKGIS  1037

Query  3298  TQRASDELGLVVIAEVRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGK  3477
                 SD++GLVVIAEVRD K +  DV+++I +RVAEEHGV +ASI  IKPR+ISKTTSGK
Sbjct  1038  LTDCSDQVGLVVIAEVRDAKHVNKDVVENIRSRVAEEHGVTVASIKLIKPRTISKTTSGK  1097

Query  3478  IKRYECAKRFISGTLDVIEEQMNGERSL--------------PRNDGIIVP-ANGKISKT  3612
             IKR+EC K F  GTL+ + + +  +R L              PR+     P    K SK 
Sbjct  1098  IKRFECLKHFTDGTLNTVPDPIFAKRKLLRSFTTGTCKEGLTPRSRLATSPLPTAKFSKK  1157

Query  3613  DIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSA  3792
             +IV FLK L+S+QTGIP+  I+  E+LVSYG++SIGVVRAAQK+S + G+ +GA+DIF+A
Sbjct  1158  EIVEFLKGLVSEQTGIPIKNITATESLVSYGIDSIGVVRAAQKLSDYLGVPVGAVDIFTA  1217

Query  3793  TCIDDLADFVESLLEKNHPMLTNS----SETKISSSGIPSVVSTFDKITIWLIHLVALAY  3960
             TCI DLA F E+L  K+ P L NS    SE  I S+   +  ST   I +W   L+AL Y
Sbjct  1218  TCIADLASFSENLAMKSQPQLMNSQSYQSEPDIDSAEFDTEPSTTRIIGVWFFQLLALVY  1277

Query  3961  VSLLLIIPAYISVSMFKPLI-----LANQSPWFFYFISLACAPFSWMLCIFLTCICTRLL  4125
             V  +L  PAY SVS F  L+     L  + P + Y I LA AP +W+L I  TCI    L
Sbjct  1278  VCAMLSFPAYFSVSAFTSLLSASHMLNEEFPLWNYLIPLALAPLAWILGIISTCISIAFL  1337

Query  4126  GNALLQPNYVLNPEISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKI  4305
             GN+ L+PNY L PE+S+WS+ FVKWWALYKAQEISSKV A HLRGTVFLNYWF++LGAKI
Sbjct  1338  GNSFLKPNYALTPEVSIWSIHFVKWWALYKAQEISSKVFAEHLRGTVFLNYWFEMLGAKI  1397

Query  4306  ASSALIDTVDITDPLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVL  4485
              SS L+DTVDITDP LVSI + +VI+EGAL+QSHEVKNG+LSF  +RIG+ SS+GPYAV+
Sbjct  1398  GSSVLLDTVDITDPSLVSIGDGAVIAEGALLQSHEVKNGILSFQAIRIGRNSSVGPYAVI  1457

Query  4486  QKGSIVGDGAEVLAQNK----KAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQLFGIY  4653
             QKGS +G+ A+V    K    KA  K SK  N  KG +          +  + +   GIY
Sbjct  1458  QKGSTLGEEADVQPLQKTEGGKAVLKSSKAHNVQKGAML---------SDKATYHFMGIY  1508

Query  4654  MIGYLNSLSAAIAYLVWIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVST  4833
             M+G L++LSAAI Y ++IWL Q P S+ HF F+CI+GAFHW P+ II +  M  ++P + 
Sbjct  1509  MVGLLSTLSAAIIYFLYIWLSQNPASIQHFSFLCISGAFHWTPFTIIAYATMIANVPSNP  1568

Query  4834  LSFAGMVAAGYTAHGLILSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLL  5013
              +FA  VA  Y AHGLILS+ T  L  F++ K +  +   + W+ HR+ +ACH+RFAKLL
Sbjct  1569  ATFAISVAIVYLAHGLILSLLTCTLTRFLAEKQEKRESHMKAWLRHRITIACHLRFAKLL  1628

Query  5014  SGTELFCVYLHWMGAKIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYI  5193
             SGTE FC+YL  +GA +G+HCSIRA+NPV +P L+++ DGVHLGDFSR++ G++++ G+ 
Sbjct  1629  SGTEAFCIYLRLLGASVGEHCSIRAVNPVSDPELITIGDGVHLGDFSRMIAGFYSSSGFT  1688

Query  5194  SGRIDIRENSVIGSQGLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQ  5373
              G+I++++NSV+GSQ LILPGS ++KDVILGALSVAP NSVL   G ++GS+  VM++N 
Sbjct  1689  KGKIEVQDNSVVGSQSLILPGSVVQKDVILGALSVAPANSVLRQGGVYIGSQTPVMIKNT  1748

Query  5374  TLPLDDRIEEMDPKYKKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPD  5553
                LDDRIEEMD KYKK++G+LAANLAA+TLK+K+RYFHRIG +GKG L++Y+ L G PD
Sbjct  1749  MHALDDRIEEMDYKYKKIVGNLAANLAATTLKVKARYFHRIGVSGKGHLKIYDNLKGFPD  1808

Query  5554  HKIFGPGATYPVIIRHSNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGK  5733
             HKIF  G +YP+++RHSN LS+DDDAR+D RGAAIRIL       + ++ LLDLTLKTGK
Sbjct  1809  HKIFRAGKSYPIVVRHSNSLSADDDARIDARGAAIRIL--SDDNGSNSSSLLDLTLKTGK  1866

Query  5734  AFHARTIGDFATWLVCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRF  5913
             AF+AR+I DFATWLVCG  ARE+HVK APHIRDA+W SL   NS+ +LHYYSNICRLFRF
Sbjct  1867  AFYARSIADFATWLVCGLPAREQHVKRAPHIRDAVWMSLCNANSFADLHYYSNICRLFRF  1926

Query  5914  KDGQEMYVRFKLRPFDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRV  6093
              DGQEMYV+FKLRP DE I E+ G+VEP GILPPETGAIPR+E D RPLLFLAEDF+ RV
Sbjct  1927  SDGQEMYVKFKLRPGDENISEDSGKVEPMGILPPETGAIPRNEKDTRPLLFLAEDFQSRV  1986

Query  6094  SSPDKVRYVLQLQIQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEE  6273
             SSP  +RY+ QLQI+P+P D+   +  L+CTKPWDE E PYI++GEI IDQ LT  ESE 
Sbjct  1987  SSPGGIRYIFQLQIRPVPHDDATCDIALNCTKPWDESEFPYIDIGEIHIDQNLTGAESEA  2046

Query  6274  LEFNPFFRCNEIDVIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVK  6453
             LEFNP+ RC+E+DVIRATS +QSASIDHGRSL+YEICQ+LRN +PLPEAW+IF++QSDVK
Sbjct  2047  LEFNPYIRCHEVDVIRATSSSQSASIDHGRSLIYEICQHLRNGEPLPEAWKIFIEQSDVK  2106

Query  6454  LDLSGCPLAAKLENKDMPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLF  6633
             +DLSGCP+AA L  KD  KATLAR WY T W++  QP LQ  LP+FL+GL+I+APLN + 
Sbjct  2107  VDLSGCPMAASLGKKDSGKATLARTWYQTSWVIFAQPLLQTFLPHFLMGLLIFAPLNWIL  2166

Query  6634  YTHEMTQIQKQWLLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQ  6813
                E   +   WLLPL W  SG+LA L C ++KW+LVGKK +G+T  IWS G+FMDT+WQ
Sbjct  2167  LLKESKNVAMHWLLPLVWVSSGVLAALACVVAKWILVGKKKEGQTVHIWSIGVFMDTVWQ  2226

Query  6814  AIRTVTGEYFMETATGTFLMGIWMRLMGSEVARD-GVYIDSMGATLNPDMVRIEEYGSVG  6990
             A RTV G+YF+E   G+ L  +W++LMGS++  D G Y+DSMGA LNP+MV+IE  G VG
Sbjct  2227  AFRTVVGDYFIEMTRGSILFLLWLKLMGSDIDLDQGAYVDSMGAALNPEMVKIERGGCVG  2286

Query  6991  REALLFGHIYEG-GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             REALLFGHIYEG GG+VK+GRI V  GGFVGSRA+AMPG  ++ GG+L ALSLAM
Sbjct  2287  REALLFGHIYEGEGGKVKFGRIRVGEGGFVGSRAIAMPGVRVEIGGNLSALSLAM  2341



>gb|EYU18010.1| hypothetical protein MIMGU_mgv1a000034mg [Erythranthe guttata]
Length=2249

 Score =  2958 bits (7669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1463/2298 (64%), Positives = 1797/2298 (78%), Gaps = 81/2298 (4%)
 Frame = +1

Query  322   VDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGMCESIDI  501
             VDD F K+HPC P  TRI I+GAGPSGLSAAYAL KLGYS+V V EKHHS GGMCES+ I
Sbjct  6     VDDKFSKMHPCFPPRTRIAIIGAGPSGLSAAYALCKLGYSDVTVFEKHHSPGGMCESVQI  65

Query  502   QGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDS-DWAYTDMRVAEDYIS  678
             +                        EVGAE EEMDTHK AL++S + A T+M++ EDY+S
Sbjct  66    E------------------------EVGAETEEMDTHKFALINSSNGALTEMKLVEDYVS  101

Query  679   VIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTASGYGFIQ  858
             +I +TLKLQD+ K + RIGV++VSEIASD+TP++LK++G  SVPKSV YGYTASGYG++Q
Sbjct  102   MISLTLKLQDKAKESGRIGVHAVSEIASDLTPDYLKNQGFPSVPKSVIYGYTASGYGYVQ  161

Query  859   DMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNSSGVCVD  1038
             DMPYAYIHEF RTSMAGKI+RF+GGYTS+W KLS+ +PI+F  NTEVLS+KRNSS + V+
Sbjct  162   DMPYAYIHEFTRTSMAGKIQRFEGGYTSLWNKLSQRLPIQFCSNTEVLSVKRNSSEIKVE  221

Query  1039  VRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCD-KMDMSTLEKDLFSKVQ  1215
              +  NG +++ EFDKIIISGAFPF +G TYRSPS  T+    + ++D+S LEK+LFSKV+
Sbjct  222   FKTENGGVKSREFDKIIISGAFPFISGNTYRSPSPNTSDTANNNRIDLSELEKELFSKVK  281

Query  1216  TIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSYGNSID  1395
             TI+YYT+VL I G EH+P GFYYF+ FM DP+ IGNPVAMQ+FY DT++FLFWSYGNS +
Sbjct  282   TIDYYTTVLNIKGFEHIPKGFYYFDEFMNDPSTIGNPVAMQRFYGDTDIFLFWSYGNSAN  341

Query  1396  ILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQGQLNTY  1575
             I   EV ELA  AV +MGG+V++VILQR FKYFPHV  +DMK+G+Y+KLE  LQGQ NTY
Sbjct  342   IQEHEVAELAISAVKRMGGEVERVILQRKFKYFPHVKSEDMKEGYYDKLEFLLQGQRNTY  401

Query  1576  YVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEG-LAFKQLDEI  1752
             +VGGLMAFELTERNASY+  L+RKHF+ND   P++PYVKRL  LK ++ G +  +QLDE 
Sbjct  402   FVGGLMAFELTERNASYAFDLVRKHFSNDNQEPSYPYVKRLLTLKPNNGGSVVPRQLDES  461

Query  1753  PGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLL  1932
             PGV+FPELS+LD+YL+HWGT  VT++KTLYTW+NEKG ++ +RTYKE+++NA  I++KL 
Sbjct  462   PGVQFPELSTLDAYLKHWGTHSVTQSKTLYTWINEKGQIVAQRTYKELNSNASKISEKLT  521

Query  1933  TSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANI  2112
             +   P IK GD+VLL+Y+PGLDF+DAFFGCLRARVIP+P IPPDP Q+ G QALLHI+NI
Sbjct  522   SCNNPTIKTGDRVLLVYIPGLDFIDAFFGCLRARVIPVPAIPPDPLQKTGQQALLHISNI  581

Query  2113  AKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPDLPWLHTDSWVkkpklfkk  2292
             +K CN VAILST SYH+ V+  SA+NML  K KDK++  WPDLPWLHTDSWVKK ++  +
Sbjct  582   SKACNAVAILSTVSYHIAVKASSARNMLSLKGKDKNTPRWPDLPWLHTDSWVKKSRITMQ  641

Query  2293  p--kDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSW  2466
                  ++ + L  DLCFLQFTSGST +PKGVMITHGG+IHNVK MR +YKSTS T+LVSW
Sbjct  642   NGYNVDKYESLPRDLCFLQFTSGSTGEPKGVMITHGGIIHNVKTMRSQYKSTSNTVLVSW  701

Query  2467  LPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELL  2646
             LPQYHDMGLIGGL T +VSGGS ILFSP  F++NPLLWLQT++ +RATHSA PNFAFELL
Sbjct  702   LPQYHDMGLIGGLFTSMVSGGSAILFSPTVFIRNPLLWLQTITTYRATHSAGPNFAFELL  761

Query  2647  VRRLES-SKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENC  2823
             +RRLE+  K + FDLSSM FLM AAEPIR  T++RF+ LTQ FGL R  MAPGYGLAENC
Sbjct  762   IRRLEADEKGQKFDLSSMVFLMVAAEPIRAETMRRFLLLTQPFGLDRGAMAPGYGLAENC  821

Query  2824  VFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISS  3003
             V+V  AYGEG  + VDW  RVCCGYI   N D V IKI+  ETG+E +   KEGEIWISS
Sbjct  822   VYVCSAYGEGEEMLVDWNERVCCGYIDN-NDDEVQIKIVDQETGEECEKSEKEGEIWISS  880

Query  3004  LSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAGKN  3183
              S+G+GYW  EEL++ TFEN + S  G++YIRTGDLGRI+D KLF+TGR KDLIIV+G+N
Sbjct  881   PSSGVGYWDNEELTKTTFENKLNSAHGRKYIRTGDLGRIVDGKLFVTGRIKDLIIVSGRN  940

Query  3184  IYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKG-ILTQRASDELGLVVIAEVRDGKP  3360
             IY+SDIEKTVE+S +LVRPGCCA +G+P+++L+SKG I     SD +GLVVIAEVR+   
Sbjct  941   IYSSDIEKTVENSCQLVRPGCCAAIGVPKEILLSKGNIPFPETSDHVGLVVIAEVREAVK  1000

Query  3361  LPY-DVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVIEE  3537
               + + +  I   VAEEHG+ ++S++ IKPR+ISKTTSGKIKRYEC ++F +GT DV+  
Sbjct  1001  SGFKEAVKRIQACVAEEHGIIVSSVILIKPRTISKTTSGKIKRYECLQKFKNGTFDVVH-  1059

Query  3538  QMNGERSLPRNDGIIVPANGKISKTDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSI  3717
             Q NG                    +DIVNFL +LLSQ TGI  +KIST E+LVSYGV+SI
Sbjct  1060  QSNG-------------------TSDIVNFLIELLSQMTGISTAKISTNESLVSYGVDSI  1100

Query  3718  GVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEKNHPMLTNSSETKISSSGIP  3897
             GVVRAAQK+S F G+ +GAIDIF+ATCIDDLA F ++LL+K+ P    S++TK   + +P
Sbjct  1101  GVVRAAQKLSDFLGVPVGAIDIFTATCIDDLAKFSDNLLKKSRP---KSAKTK---AKVP  1154

Query  3898  SVVSTFD------KITIWLIHLVALAYVSLLLIIPAYISVSMFKPLILANQSPWFFYFIS  4059
             S  +TF       K+ IW + ++ALAYV  LLI PAY+S+S F       ++    Y IS
Sbjct  1155  STKTTFSEASSSRKLQIWFMQILALAYVCFLLIFPAYLSISAFTYSYKPQKNTCTAYLIS  1214

Query  4060  LACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPEISVWSVEFVKWWALYKAQEISSKV  4239
             L CAP SWMLC+F TCI    LG   LQ NY L PE+S+WS EFVKWWAL+KA+E+SSKV
Sbjct  1215  LFCAPLSWMLCLFSTCISISFLGTPFLQTNYALFPEVSIWSTEFVKWWALHKAEEVSSKV  1274

Query  4240  LAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDPLLVSIDEESVISEGALIQSHEVKN  4419
             LAVHLRGTVFLNYWF++LGAK+ASSALIDT+DITDP LVSI E++V++EGALIQSHEVKN
Sbjct  1275  LAVHLRGTVFLNYWFRMLGAKVASSALIDTIDITDPFLVSIGEDAVLAEGALIQSHEVKN  1334

Query  4420  GVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLAQNKKAAAKISKPLNGHKGKVTRRI  4599
             GVLSF  +RIG RSS+GPYA+LQKG  V DG EVLA   + +   S   +  KGK+ ++I
Sbjct  1335  GVLSFYPMRIGSRSSVGPYALLQKGVEVHDGDEVLALTTEVST--SDVDHFQKGKMGKQI  1392

Query  4600  RKRNHGNHNSVFQLFGIYMIGYLNSLSAAIAYLVWIWLLQKPPSLHHFLFICIAGAFHWF  4779
               +N GN+  V    GIY IG+L SLSAA++Y  +++++QKPP +HHF FI ++GAFHW 
Sbjct  1393  ISKNCGNYAMVIHFLGIYTIGFLGSLSAAVSYFAYLYIMQKPPIMHHFAFISVSGAFHWL  1452

Query  4780  PYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHGLILSVFTFMLNHFVSRKGDTDKMTREK  4959
             PY I+ +  +  S P + ++FA  +A  YT +GL+LS FT  L  ++ +  D  +    K
Sbjct  1453  PYTIVAYIVILDSAPSNPIAFAISIATAYTIYGLVLSFFTCFLKSYLEKNQDLSEKPFRK  1512

Query  4960  WILHRMNVACHIRFAKLLSGTELFCVYLHWMGAKIGQHCSIRAINPVVEPGLVSVADGVH  5139
             W++HR+  +CH+RFAK +SGTE FC YL  MGAKIG HCSIRAINP+++P LVS+ADGV 
Sbjct  1513  WLIHRILTSCHVRFAKFISGTEAFCFYLRQMGAKIGNHCSIRAINPILDPELVSLADGVD  1572

Query  5140  LGDFSRIVPGYHTT-GGYISGRIDIRENSVIGSQGLILPGSFIEKDVILGALSVAPLNSV  5316
             LGDFSR++PGY+T+  GY SG I++++N+VIGSQ LILPGS +EK VILGALSVAP N +
Sbjct  1573  LGDFSRLIPGYYTSKNGYFSGGIEVQDNAVIGSQALILPGSVLEKYVILGALSVAPANRI  1632

Query  5317  LECCGTFVGSENLVMVRNQTLPLDDRIEEMDPKYKKVLGSLAANLAASTLKLKSRYFHRI  5496
             L   G +VGS    MV+N T   DDRIEEMD KY+KVLG+LAANLAA+TLK+KSRYFHRI
Sbjct  1633  LHSGGVYVGSPFPSMVKNTTQSFDDRIEEMDTKYRKVLGNLAANLAATTLKVKSRYFHRI  1692

Query  5497  GAAGKGSLRLYNVLP-GLPDHKIFGPGATYPVIIRHSNCLSSDDDARLDPRGAAIRILPH  5673
             GAAGKG L+LY+ LP  LP H+IF  G  Y +I+RHSNCLSSDDDARLDPRGAAIRI   
Sbjct  1693  GAAGKGFLKLYDHLPKNLPHHRIFSTGKEYSIILRHSNCLSSDDDARLDPRGAAIRITTE  1752

Query  5674  ERtttttttplldltlktGKAFHARTIGDFATWLVCGAAAREEHVKHAPHIRDAMWGSLR  5853
             + +     T         G AFHARTIGDFATWLVCGAAAREEHVKH PHIRDAMWGSLR
Sbjct  1753  DNSPLLDLTLKT------GNAFHARTIGDFATWLVCGAAAREEHVKHYPHIRDAMWGSLR  1806

Query  5854  RPNSYTELHYYSNICRLFRFKDGQEMYVRFKLRPFDEKIGEEYGEVEPRGILPPETGAIP  6033
             R +SYTELHYYSNI RLFRF+DGQEMYVRFKLRPFD+ I EE G+VEP G+LPPETGAIP
Sbjct  1807  RADSYTELHYYSNITRLFRFEDGQEMYVRFKLRPFDKNISEENGKVEPTGVLPPETGAIP  1866

Query  6034  RDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQIQPIPDDERVRETLLDCTKPWDEKEVP  6213
             RDENDKRPLLFLA+DFK RV S DKVRYVLQLQI+PI +DER RE  LDCT+PW+E E P
Sbjct  1867  RDENDKRPLLFLADDFKKRVDSSDKVRYVLQLQIRPITNDEREREIALDCTRPWNETEFP  1926

Query  6214  YIEVGEITIDQVLTEKESEELEFNPFFRCNEIDVIRATSCNQSASIDHGRSLVYEICQYL  6393
             + +VGEITI+++LT++ESEELEFNPF RC+EIDVIRA+SC++SAS+DHGRSLVY ICQ+L
Sbjct  1927  HFDVGEITIERILTKEESEELEFNPFLRCHEIDVIRASSCSESASMDHGRSLVYSICQHL  1986

Query  6394  RNRKPLPEAWRIFLDQSDVKLDLSGCPLAA-KLENK-DMPKATLARQWYVTLWLMSGQPF  6567
             RN+KPLP+AWR FL+QSDVK+DLSGCP+AA KLE   D    TLAR WYVTLW+MS QPF
Sbjct  1987  RNKKPLPQAWRAFLNQSDVKIDLSGCPMAAQKLEKSVDTEVVTLARPWYVTLWMMSAQPF  2046

Query  6568  LQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQK-QWLLPLWWGGSGILAGLVCALSKWVLV  6744
             LQI LPYFL+GLVI+ P+  +F+ +++++ +   +LLPL+W  SG+L+GLVCA+ KW+LV
Sbjct  2047  LQIFLPYFLMGLVIFPPMKFIFHQNKISKTEHMHFLLPLFWICSGVLSGLVCAICKWILV  2106

Query  6745  GKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYFMETATGTFLMGIWMRLMGSEVARDGVY  6924
             GKK +G+ EPIWS GIFMDTIWQA+RT+ G+YFME   GTF+  +WM LMGSEV R G Y
Sbjct  2107  GKKKEGENEPIWSVGIFMDTIWQAVRTLAGDYFMEMTGGTFIFNVWMNLMGSEVDR-GAY  2165

Query  6925  IDSMGATLNPDMVRIEEYGSVGREALLFGHIYEG-GGEVKYGRISVKNGGFVGSRAVAMP  7101
             +D+MGA LNP++V+IEE GSV REALLFGHIYEG GG+VKYG+I VK GGFVGSRAVAMP
Sbjct  2166  VDTMGAVLNPELVKIEENGSVEREALLFGHIYEGEGGKVKYGKIVVKKGGFVGSRAVAMP  2225

Query  7102  GATIDSGGS-LGALSLAM  7152
             G T+  GG  LGALSLAM
Sbjct  2226  GVTVGGGGGCLGALSLAM  2243



>ref|XP_007206846.1| hypothetical protein PRUPE_ppa027071mg [Prunus persica]
 gb|EMJ08045.1| hypothetical protein PRUPE_ppa027071mg [Prunus persica]
Length=2302

 Score =  2957 bits (7665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1443/2317 (62%), Positives = 1805/2317 (78%), Gaps = 57/2317 (2%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+ G  ++D F +LHPC+P  TRIGIVGAGPSGLSAAYAL+KLGYSNV VLEK+H+ GGM
Sbjct  1     MDPGKSIEDQFSRLHPCLPMNTRIGIVGAGPSGLSAAYALVKLGYSNVTVLEKYHTVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRV  660
             CES++I+G  YDLGGQVLAANSAP IFHLAKE G+E+EEMD+HKLAL+D+    Y D++V
Sbjct  61    CESVEIEGNIYDLGGQVLAANSAPVIFHLAKETGSELEEMDSHKLALIDNTTGEYQDIKV  120

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             A+DY+SVI +TL+LQD+  ++ RIGV++VSE ASD+TP +L+  G KSVPKSVAYGYTAS
Sbjct  121   ADDYVSVISLTLELQDKAASSGRIGVHAVSEYASDLTPVYLEHHGFKSVPKSVAYGYTAS  180

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYG+IQDMPYAYIHEF RTSMAGKIRRFKGGYTS+WKK+SE++PI   CNTEVL I+R+S
Sbjct  181   GYGYIQDMPYAYIHEFTRTSMAGKIRRFKGGYTSLWKKISESLPI-VHCNTEVLEIRRHS  239

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
               V VD++  +G ++ MEFDKIIISG+FP  NGRTYRS     A    + M+M  +EK+L
Sbjct  240   DCVSVDLKSCDGEVKVMEFDKIIISGSFPLKNGRTYRSLPSHPAEHKSEVMEMGDVEKEL  299

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             FSKVQTI+YYT+VL+I G+EH+PMGFYYF+ ++ +PA IG+PVAMQ+F+ DT++FLFWSY
Sbjct  300   FSKVQTIDYYTTVLKIKGIEHMPMGFYYFDEYISNPATIGHPVAMQRFFADTDIFLFWSY  359

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GNS++I G  V +LA  A   +GG+VK+V+LQR FKYFPHV  Q+M DGFYEKLE+QLQG
Sbjct  360   GNSVNITGPTVTKLAIDAAKLIGGEVKEVVLQRRFKYFPHVGSQEMMDGFYEKLESQLQG  419

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
               NTYYVGGLMAFELTERN+SY+M L+ KHFAND  +P FPY K LF L+    G + K 
Sbjct  420   FKNTYYVGGLMAFELTERNSSYAMGLVCKHFANDNSMPNFPYAKSLFALQQQWGG-SPKS  478

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             + E+P V+FP L SLD YL+HWG   VT+NK LYTW++E+G+V+ +RTY E+H NA  IA
Sbjct  479   MAELPEVEFPNLPSLDGYLKHWGAHRVTQNKLLYTWISEEGEVVSQRTYAELHANASCIA  538

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
             QKLL+ +KP IKPGD+VLL++VPGLDFVDAFFGCLRA+V+P+P +PPDP QRGG QALL 
Sbjct  539   QKLLSCRKPVIKPGDRVLLVHVPGLDFVDAFFGCLRAKVLPVPVLPPDPLQRGG-QALLK  597

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNM--LFGKSKDKSSNSWPDLPWLHTDSWVkk  2274
             I NIAK C  VAILST SYH  V+  S KNM  L GK++ KS   WP+LPWLHTDSW+K 
Sbjct  598   IENIAKSCGAVAILSTISYHWAVQAGSVKNMISLTGKNQ-KSKARWPNLPWLHTDSWIKN  656

Query  2275  pklfkkp-kDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRT  2451
              K        ++ +P  +D+CFLQFTSGST D KGVMITHGG+IHNVKLMRKRYKSTS+T
Sbjct  657   SKNVVVEGIADEFEPQGDDVCFLQFTSGSTGDAKGVMITHGGLIHNVKLMRKRYKSTSKT  716

Query  2452  ILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNF  2631
             +LVSWLPQYHDMGLIGGL T LVSGG+ ILFSP+TF++NPLLWLQ MSK++ATHSA PNF
Sbjct  717   VLVSWLPQYHDMGLIGGLFTALVSGGTAILFSPLTFIRNPLLWLQIMSKYQATHSAGPNF  776

Query  2632  AFELLVRRLESSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGL  2811
             AFEL+VRRLES  +  FDLSSM FLM AAEP+RQ T+KRFVELT  FGLS+EVMAPGYGL
Sbjct  777   AFELVVRRLESDNKRKFDLSSMTFLMVAAEPVRQKTVKRFVELTHPFGLSQEVMAPGYGL  836

Query  2812  AENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEI  2991
             AENCVFVSCAYGEG P+ VDWQGRVCCGY+  P+ + V+I+I+ PE+G+E  + GKEGEI
Sbjct  837   AENCVFVSCAYGEGKPIMVDWQGRVCCGYV-NPDDEDVNIRIVDPESGEELKEAGKEGEI  895

Query  2992  WISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIV  3171
             WISS SAGIGYWG EELSQKT+ N +   PG+ Y RTGDLGR+ID KLFITGR KDLIIV
Sbjct  896   WISSPSAGIGYWGREELSQKTYRNKLPDHPGRNYTRTGDLGRVIDRKLFITGRIKDLIIV  955

Query  3172  AGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRD  3351
             AG+NIY++D+EKTVES+SELVRPGCCAV+ +P ++L +KGI    +SD++GLVVIAEVRD
Sbjct  956   AGRNIYSADVEKTVESASELVRPGCCAVIPVPVEILSTKGITVSDSSDQVGLVVIAEVRD  1015

Query  3352  GKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVI  3531
             GKP+  DV++ I  RVAEEHGV +AS+  I+P++ISKTTSGKIKR+EC ++F  GTL+V+
Sbjct  1016  GKPVGKDVVEQIQARVAEEHGVSVASVKMIRPKTISKTTSGKIKRFECLQQFTDGTLNVV  1075

Query  3532  EEQMNGERSLPRN-------DGII---------VPANGKISKTDIVNFLKDLLSQQTGIP  3663
              E +  +R L R+       +GI           P + K+S  +IV+FLK L+S+QTGI 
Sbjct  1076  PEPIITQRRLLRSFTTGTCKEGITPRPQLVRSSPPPSPKLSNKEIVDFLKRLVSEQTGIS  1135

Query  3664  VSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEKN  3843
             ++KIS  E+LVSYG++SIGVVRAAQK+S F GI +GA+DIF+ATCI DLA F E+L+  +
Sbjct  1136  INKISNTESLVSYGIDSIGVVRAAQKLSDFLGIPVGAVDIFTATCIADLASFSENLVMNS  1195

Query  3844  HP-MLTNSSETKISSSGIPSV-----VSTFDKITIWLIHLVALAYVSLLLIIPAYISVSM  4005
              P +LT  S      +GI S      +     + I L  L+AL YV+L+L IPAY+SVS 
Sbjct  1196  QPQLLTTPSNVPQPDTGIDSAELVMEIPETHHLVISLFQLLALIYVALMLSIPAYLSVSA  1255

Query  4006  FKPLILANQS-----PWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPEI  4170
             F     A  +     P+  Y   L  AP +W+ CI  TC+    LGN+ L+PNY LN E+
Sbjct  1256  FMSCASATHTLVEGIPYLDYLTLLTFAPLAWIFCILSTCVSIAFLGNSFLKPNYALNAEV  1315

Query  4171  SVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDPL  4350
             S+WS++FVKWWALYKA E++SKV+A HLRGTVFL YWF++LGA+I SS L+DTVDITDP 
Sbjct  1316  SIWSMDFVKWWALYKAHEVASKVMAEHLRGTVFLKYWFEMLGARIGSSVLLDTVDITDPS  1375

Query  4351  LVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLAQ  4530
             LVSI + +VI+EGALIQSHEVKNGVLSF  +RIG+ SS+GPY+V+QKG+I+G+  EV+A 
Sbjct  1376  LVSIGDGAVIAEGALIQSHEVKNGVLSFLPIRIGQHSSVGPYSVVQKGTILGEEDEVMAL  1435

Query  4531  NKKAAAKISKPLNGHKGKVTRRIRKRNHGNHN-SVFQLFGIYMIGYLNSLSAAIAYLVWI  4707
              K  +  +              ++ +N  N N +++Q  GIY++G L +LSA++ YLV+I
Sbjct  1436  QKCGSKSV--------------VKAKNLQNVNEAIYQFIGIYIVGLLGTLSASVVYLVYI  1481

Query  4708  WLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHGLIL  4887
             W+ QKP S   F F CI GAFHW PY II +  MF+ +P + +  +  +A  Y ++GL+L
Sbjct  1482  WMSQKPLSPQEFAFSCIFGAFHWMPYTIIAYAIMFSDVPSNIIYLSISMAVAYLSYGLVL  1541

Query  4888  SVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWMGAKIG  5067
             S  T  L HF+S K D        W+ HR+ +ACH+RFAKLLSGTE FC+YL  +GAK+G
Sbjct  1542  SFLTSALTHFISSKQDKKTSHFRTWLCHRITIACHLRFAKLLSGTEAFCMYLRLLGAKVG  1601

Query  5068  QHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQGLI  5247
             +HCSIRAINP+ +P L+S+  GVHLGDFSRI+ G+++  G+ISG+I++++NSV+GS+ ++
Sbjct  1602  KHCSIRAINPISDPKLISLGSGVHLGDFSRIIAGFYSFNGFISGKIEVQDNSVVGSESVV  1661

Query  5248  LPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMDPKYKKV  5427
             LPGS I++DVILGALSVAP+NSVL+  G ++GS+  +M++N    LDDRIEEMD KYKK+
Sbjct  1662  LPGSVIQQDVILGALSVAPVNSVLQAGGVYIGSQIPIMIKNTMHSLDDRIEEMDIKYKKI  1721

Query  5428  LGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYPVIIRHSN  5607
             +G+LAANLAA+TLK++SRYFHRIG +GKG L++Y+ + GLPDHKIF PG +YPVIIRHSN
Sbjct  1722  VGNLAANLAATTLKVESRYFHRIGVSGKGYLKIYDNIKGLPDHKIFCPGKSYPVIIRHSN  1781

Query  5608  CLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFATWLVCGA  5787
              LS+DDDAR+D RGAAIRIL  E    T  + L DLTLKTGKAF+ARTI DFATWLVCG 
Sbjct  1782  SLSADDDARIDARGAAIRILSDE----TNDSALFDLTLKTGKAFYARTIADFATWLVCGL  1837

Query  5788  AAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKLRPFDEK  5967
             AAREE+VK APH+RDA+W SLR  NSY ELHYYSNICRLFRF DGQEMYV+FKLRP DE 
Sbjct  1838  AAREEYVKRAPHVRDAVWTSLRHANSYAELHYYSNICRLFRFTDGQEMYVKFKLRPSDEN  1897

Query  5968  IGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQIQPIP  6147
             I EE G+VEP GILPP+TGAIPRD+ D RPLLFLA+DFK RV+    VRYV QLQ++P+P
Sbjct  1898  ISEEAGKVEPIGILPPDTGAIPRDDKDTRPLLFLAKDFKSRVNDQGGVRYVFQLQVRPVP  1957

Query  6148  DDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEIDVIRAT  6327
              DE  R+  LDCTKPW++ E PYI+VGEI I+Q+L+ +ESE+L+FNPF +C+E+DVIRA+
Sbjct  1958  HDESARDIALDCTKPWNDAEFPYIDVGEININQMLSAEESEQLDFNPFLQCHEVDVIRAS  2017

Query  6328  SCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAKLENKDMP  6507
             SC+QSASIDHGRSL+YEICQ+LRN +PLPEAW+IFL QSDVK+DLSGCP+AA L+  D  
Sbjct  2018  SCSQSASIDHGRSLIYEICQHLRNGEPLPEAWKIFLQQSDVKVDLSGCPMAAALKKNDAH  2077

Query  6508  KATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQWLLPLWW  6687
             K TL R  + TLW    QP LQIVLP+FLLGLVIYAPLN   Y  +  ++   WL PL+W
Sbjct  2078  KVTLERTLFQTLWATFAQPLLQIVLPHFLLGLVIYAPLNWTLYLKDAQKLPLHWLFPLFW  2137

Query  6688  GGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYFMETATGTF  6867
               SG LAGL C ++KW+LVGKK +G+   IWS G+F+DT WQA RT+ G YFME  +G+ 
Sbjct  2138  VSSGCLAGLACVVAKWLLVGKKKEGEAVHIWSIGVFLDTTWQAFRTLVGSYFMEMTSGSI  2197

Query  6868  LMGIWMRLMGSEVARD-GVYIDSMGATLNPDMVRIEEYGSVGREALLFGHIYEGG-GEVK  7041
                +WM+LMGSE+  D G Y+DSMGA LNP+MV IE  G VGR+ALLFGHIYEG  G+VK
Sbjct  2198  FFVLWMKLMGSEIELDQGAYVDSMGALLNPEMVEIERGGCVGRDALLFGHIYEGDEGKVK  2257

Query  7042  YGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             +G+IS+   GFVGSRA+AMPG  ++SGG L ALSLAM
Sbjct  2258  FGKISIGEDGFVGSRAIAMPGVRVESGGCLSALSLAM  2294



>ref|XP_002303872.2| hypothetical protein POPTR_0003s22070g [Populus trichocarpa]
 gb|EEE78851.2| hypothetical protein POPTR_0003s22070g [Populus trichocarpa]
Length=2265

 Score =  2950 bits (7647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1443/2304 (63%), Positives = 1778/2304 (77%), Gaps = 68/2304 (3%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+  V ++D F+KLHPC+P  TRIGIVG GPSG+SAAYAL KLGY NV VLEKHH+ GGM
Sbjct  1     MDPLVSIEDQFVKLHPCLPVNTRIGIVGGGPSGISAAYALAKLGYQNVTVLEKHHTVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRV  660
             CES+DI+                        EVG+E+EEMD+HKLA +DS    Y D++V
Sbjct  61    CESVDIE------------------------EVGSELEEMDSHKLAHIDSSTGKYQDIKV  96

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             A+DY++V+ +TL+LQD+ K + RIGV++VSE+A D+TP +L+ +G KSVPKSVAYGYTAS
Sbjct  97    ADDYVAVMSLTLELQDKAKDSGRIGVHAVSELAQDLTPTYLESRGFKSVPKSVAYGYTAS  156

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF+QDMPYAYIHEF RTSMAGKIRRFKGGYTS+W+K+SE++PI+  C T+VL+I+RNS
Sbjct  157   GYGFVQDMPYAYIHEFTRTSMAGKIRRFKGGYTSLWQKISESLPIEVNCKTDVLAIRRNS  216

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
               V VDV+  NG +Q MEFDKIIISG+FPF NG TYR P++ +     + MD+S +E+  
Sbjct  217   DSVRVDVKRNNGEIQEMEFDKIIISGSFPFTNGNTYRFPAENSTESETEVMDLSEVERYF  276

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             F KVQTI+YYT+VL+I GLE +P+GFYYF  +MEDPA IG+PVAMQKFY DT++FLFWSY
Sbjct  277   FRKVQTIDYYTTVLKIKGLEDMPVGFYYFGEYMEDPATIGHPVAMQKFYADTDIFLFWSY  336

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GNS DI    V ELAKK V+ MG +V++ +LQR FKYFPHV  Q+MKDGFYEKLE++LQG
Sbjct  337   GNSFDIKRPTVAELAKKVVMSMGAKVEEEVLQRRFKYFPHVGSQEMKDGFYEKLESELQG  396

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
             Q NTYYVGGLMAFELTERN+SY+M LI KHFAN+  VP FPYVK LF LKS       K+
Sbjct  397   QRNTYYVGGLMAFELTERNSSYAMDLICKHFANNNSVPMFPYVKSLFSLKSDCWDRNPKE  456

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             L E  GV+FP+LS+LD YL+HWGT  +T++KTLYTW+ E G V+ +RTY E+H  A  IA
Sbjct  457   LGE--GVEFPDLSTLDGYLKHWGTESMTKDKTLYTWIGEDGAVVCQRTYAELHAKASCIA  514

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
             +KLLTS+KP IKPGD+VLL+YVPGLDF+DAFFGCLRA+V+P+P +PPDP QRGG QALL 
Sbjct  515   RKLLTSRKPVIKPGDRVLLVYVPGLDFIDAFFGCLRAKVLPVPVLPPDPLQRGG-QALLK  573

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPDLPWLHTDSWVkkpk  2280
             I +IAK CN VAILST  YH  VR  S KN++    K+     WP+LPW+HTDSW+K  K
Sbjct  574   IESIAKSCNAVAILSTLLYHSAVRAGSVKNLISLAGKN---GKWPNLPWMHTDSWLKDSK  630

Query  2281  lfk---kpkDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRT  2451
             +        + + QP  +DLCFLQFTSGST D KGVMITHGG+IHNVKLM++ YKSTS+T
Sbjct  631   VLAPGNIAYESECQP--DDLCFLQFTSGSTGDAKGVMITHGGLIHNVKLMKRIYKSTSKT  688

Query  2452  ILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNF  2631
             +LVSWLPQYHDMGLIGGL T LVSGGS ILFSP+TF+KNPLLWLQ MSK+ ATHSA PNF
Sbjct  689   VLVSWLPQYHDMGLIGGLFTALVSGGSAILFSPMTFIKNPLLWLQIMSKYHATHSAGPNF  748

Query  2632  AFELLVRRLE---SSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPG  2802
             AFELL+RRLE     K  NFDLSS+ FLM AAEP+RQ TLKRFVELT+ FGLS+EVMAPG
Sbjct  749   AFELLIRRLEYADKDKVRNFDLSSLIFLMVAAEPVRQRTLKRFVELTRPFGLSQEVMAPG  808

Query  2803  YGLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKE  2982
             YGLAENCVFVSCAYGEG P+ VDWQGRVCCGY+ +PN++ +DI+++ PE+ +E  + GKE
Sbjct  809   YGLAENCVFVSCAYGEGKPILVDWQGRVCCGYV-EPNSEDIDIRVVDPESNEELKESGKE  867

Query  2983  GEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDL  3162
             GEIWISS SAGIGYWG EELSQ TF N + + PG++Y RTGDLGRIID K+FITGR KDL
Sbjct  868   GEIWISSPSAGIGYWGREELSQSTFRNVLQNHPGRKYTRTGDLGRIIDGKVFITGRIKDL  927

Query  3163  IIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAE  3342
             IIVAG+NIY++D+EKTVES+SEL+RPGCCAV+G+PE+VL SKGI     SD++GLVVIAE
Sbjct  928   IIVAGRNIYSTDVEKTVESASELLRPGCCAVIGVPEEVLSSKGISLPDCSDQVGLVVIAE  987

Query  3343  VRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTL  3522
             VRD K +  DV+++I TRVAEEHGV +ASI  IKPR+ISKTTSGKIKR+EC K F  GTL
Sbjct  988   VRDAKHVDKDVVENIKTRVAEEHGVTVASIKLIKPRTISKTTSGKIKRFECLKHFTDGTL  1047

Query  3523  DVIEEQMNGERSLPRNDGIIVPANG---KISKTDIVNFLKDLLSQQTGIPVSKISTGETL  3693
             + + +    +R L R+        G   +  K +IV FLK L+S+QTGIP+  IS  E+L
Sbjct  1048  NTVPDPFFAKRKLLRSFTTGTSKEGLTPRSRKKEIVEFLKGLVSEQTGIPIKNISATESL  1107

Query  3694  VSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEKNHPMLTNSS--  3867
             VSYG++SIGVVRAAQK+S F G+ +GA+DIF+ATCI DLA F E+L  K+ P L NS   
Sbjct  1108  VSYGIDSIGVVRAAQKLSDFLGVPVGAVDIFTATCIADLASFSENLAMKSQPHLMNSQSY  1167

Query  3868  --ETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPAYISVSMFKPLI-----LA  4026
               E  I S+   + VST   I++W   L+AL YV  +L  PAY SVS F  L+     L 
Sbjct  1168  QPEPDIDSAEFDTEVSTTRLISVWFFQLLALVYVCAMLSFPAYFSVSAFTSLLSASHMLN  1227

Query  4027  NQSPWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPEISVWSVEFVKWWA  4206
              + PW+ Y I LA AP +W+L I  TCI    LGN+ L+PNY L PE+S+WS+ FVKWWA
Sbjct  1228  EEFPWWNYLIPLALAPLAWILGIISTCISIAFLGNSFLKPNYALTPEVSIWSIHFVKWWA  1287

Query  4207  LYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDPLLVSIDEESVISE  4386
             LYKAQEISSKV A HLRGTVFLNYWF++LGAKI SS L+DTVDITDP LVSI + +VI+E
Sbjct  1288  LYKAQEISSKVFAEHLRGTVFLNYWFEMLGAKIGSSVLLDTVDITDPSLVSIGDGAVIAE  1347

Query  4387  GALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLAQNKKAAAKISKPL  4566
             GAL+QSHEVKNG+LSF  +RIG+ SS+GPYAV+QKGS +G+ A+V            +PL
Sbjct  1348  GALLQSHEVKNGILSFQAIRIGRNSSVGPYAVIQKGSTLGEEADV------------QPL  1395

Query  4567  NGHKGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLNSLSAAIAYLVWIWLLQKPPSLHHFL  4746
                +G        + H    + +   GIYM+G L++LSAAI Y ++IWL QKP S+ HF 
Sbjct  1396  QKTEGGKAVLKSSKAHNVQKATYHFMGIYMVGLLSTLSAAIIYFLYIWLSQKPASIQHFS  1455

Query  4747  FICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHGLILSVFTFMLNHFVSR  4926
             F+CI+GAFHW P+ II +  M  ++P +  +FA  VA  Y AHGLILS+ T  L HF++ 
Sbjct  1456  FLCISGAFHWTPFTIIAYATMIANVPSNPATFAISVAIVYLAHGLILSLLTCTLTHFLAE  1515

Query  4927  KGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWMGAKIGQHCSIRAINPVVE  5106
             K +  +   + W+ HR+ +ACH+RFAKLLSGTE FC+YL  +GA +GQHCSIRA+NPV +
Sbjct  1516  KQEKRESHMKAWLRHRITIACHLRFAKLLSGTEAFCIYLRLLGASVGQHCSIRAVNPVSD  1575

Query  5107  PGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQGLILPGSFIEKDVILG  5286
             P L+++ DGVHLGDFSR++ G++++ G+  G+I++++NSV+GSQ LILPGS ++KDVILG
Sbjct  1576  PELITIGDGVHLGDFSRMIAGFYSSSGFTQGKIEVQDNSVVGSQSLILPGSVVQKDVILG  1635

Query  5287  ALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMDPKYKKVLGSLAANLAASTL  5466
             ALSVAP NSVL   G ++GS+  VM++N    LDDRIEEMD KYKK++G+LAA LAA+TL
Sbjct  1636  ALSVAPANSVLRQGGVYIGSQTPVMIKNTMHALDDRIEEMDYKYKKIVGNLAATLAANTL  1695

Query  5467  KLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYPVIIRHSNCLSSDDDARLDPR  5646
             K+K+RYFHRIG +GKG L++Y+ L G PDHKIF  G +YP+++RHSN +S+DDDAR+D R
Sbjct  1696  KVKARYFHRIGVSGKGYLKIYDNLKGFPDHKIFQAGKSYPIVVRHSNGMSADDDARIDLR  1755

Query  5647  GAAIRILPHERtttttttplldltlktGKAFHARTIGDFATWLVCGAAAREEHVKHAPHI  5826
             GAAIRIL       + ++ LLDLTLKTGKA  ARTIGDFATWLVCG  ARE+HVK APHI
Sbjct  1756  GAAIRIL--SDDNGSNSSSLLDLTLKTGKALSARTIGDFATWLVCGLPAREQHVKRAPHI  1813

Query  5827  RDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKLRPFDEKIGEEYGEVEPRGI  6006
             RDA+W SLR  NS+ ELHYYSNICRLFRF DGQEMYV+FKLRP DE I E+ G+VEP GI
Sbjct  1814  RDAVWMSLRNANSFAELHYYSNICRLFRFSDGQEMYVKFKLRPGDENISEDSGKVEPMGI  1873

Query  6007  LPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQIQPIPDDERVRETLLDCT  6186
             LPPETGAIPRDE D RPLLFLAEDF+ RVSSP  VRY+ QLQI+P+P D+   +  LDCT
Sbjct  1874  LPPETGAIPRDEKDTRPLLFLAEDFQSRVSSPGGVRYIFQLQIRPVPHDDATCDVALDCT  1933

Query  6187  KPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEIDVIRATSCNQSASIDHGRS  6366
             KPWDE E PYI++GE+ IDQ LT  ESE L+FNP+ RC+E+DVIRATS +QSASIDHGRS
Sbjct  1934  KPWDESEFPYIDIGEVHIDQNLTGAESEALQFNPYIRCHEVDVIRATSSSQSASIDHGRS  1993

Query  6367  LVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAKLENKDMPKATLARQWYVTLW  6546
             L+YEICQ+LRN +PLPEAWRIF++QSDVK+DLSGCP+AA LE KD  K TLAR WY TLW
Sbjct  1994  LIYEICQHLRNGEPLPEAWRIFIEQSDVKVDLSGCPMAAALEKKDSGKVTLARTWYQTLW  2053

Query  6547  LMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQWLLPLWWGGSGILAGLVCAL  6726
             ++  QP LQ  LPYFL+GL+I+APLN + +  E  ++   WLLPL W  SG+LA L C L
Sbjct  2054  VIFAQPLLQTFLPYFLMGLLIFAPLNWILHLKESKKVAMHWLLPLVWVSSGVLAALACVL  2113

Query  6727  SKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYFMETATGTFLMGIWMRLMGSEV  6906
             +KW+LVGKK +G+T  IWS G+FMDT+WQA RTV G+YFME   G+ L  +W++LMGS++
Sbjct  2114  AKWILVGKKKEGQTVHIWSIGVFMDTVWQAFRTVVGDYFMEMTRGSILFLLWLKLMGSDI  2173

Query  6907  ARD-GVYIDSMGATLNPDMVRIEEYGSVGREALLFGHIYEG-GGEVKYGRISVKNGGFVG  7080
               D G Y+DSMGA LNP+MV IE  G VGREALLFGHIYEG GG+VK+GRI V  GGFVG
Sbjct  2174  DLDQGAYVDSMGAALNPEMVEIERGGCVGREALLFGHIYEGEGGKVKFGRIRVGEGGFVG  2233

Query  7081  SRAVAMPGATIDSGGSLGALSLAM  7152
             SRA+AMPG  I+ GG+L ALSLAM
Sbjct  2234  SRAIAMPGVRIEIGGNLSALSLAM  2257



>gb|KDO64910.1| hypothetical protein CISIN_1g037878mg [Citrus sinensis]
Length=2280

 Score =  2949 bits (7645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1446/2320 (62%), Positives = 1801/2320 (78%), Gaps = 85/2320 (4%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+ G  +DD F KLHPC+P  TRIGIVG GPSGLS AYAL KLGY NV +LEK+H+ GGM
Sbjct  1     MDPGKSIDDQFCKLHPCLPVNTRIGIVGGGPSGLSTAYALAKLGYRNVTLLEKYHTVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVD-SDWAYTDMRV  660
             CES++I+                        E GAE+EEMD+HKLAL+D S   + D++V
Sbjct  61    CESVEIE------------------------EAGAELEEMDSHKLALIDGSTGEFQDIKV  96

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             A+DY+SVI +TL+LQD+ K + RIGV++VS++ASD+TP +L+D+G KSVPKSVAYGYTAS
Sbjct  97    ADDYVSVISLTLELQDKAKESGRIGVHAVSDLASDLTPTYLEDRGFKSVPKSVAYGYTAS  156

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF+QDMPYAYIHEF RTSMAGKIRRFKGGYTS+W+KLS+ +P +  CN+EVL+I+R+S
Sbjct  157   GYGFVQDMPYAYIHEFTRTSMAGKIRRFKGGYTSLWQKLSKYLPTEVHCNSEVLAIRRDS  216

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
             + V VDV+H NG  + MEFDKIIISGAFP  NG+ YRSP+ K        MDM  LEK+L
Sbjct  217   TTVGVDVKHSNGECEVMEFDKIIISGAFPVKNGKFYRSPTSKPTESETQVMDMDELEKEL  276

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             FSKVQTI+YYT+VL+I GLEHLP+GFYYF  +M+DPA IG+PVAMQKF+ DT++FLFWSY
Sbjct  277   FSKVQTIDYYTTVLKITGLEHLPVGFYYFGEYMDDPATIGHPVAMQKFFADTDIFLFWSY  336

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GNS+DI G  V E+A K V  MGG ++ V+LQR FKYFPHVN +DMKDGFY++LE +LQG
Sbjct  337   GNSVDITGPTVTEVAIKTVENMGGVIENVVLQRRFKYFPHVNSKDMKDGFYDRLEYELQG  396

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
             Q NTYYVGGLMAFELTERN+SYSMAL+ KHFAN+   P FPYVK LFPL+S +    FK+
Sbjct  397   QRNTYYVGGLMAFELTERNSSYSMALMCKHFANNYSTPEFPYVKNLFPLQSDNWARNFKE  456

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             L+E+PGV+FPELSSLD YL+HWGT  +T+ KTL+TW+NE+G  +++ TY+E+  NA  IA
Sbjct  457   LEELPGVEFPELSSLDGYLKHWGTHRITQKKTLFTWINEEGVAVNQSTYEELDANASRIA  516

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
              KLLTS+KP IKPGD+VLL+YVPGLDFVDAFFGC+RA+V+P+P +PPDP QR GGQALL 
Sbjct  517   HKLLTSRKPVIKPGDRVLLVYVPGLDFVDAFFGCMRAKVLPVPVLPPDPLQR-GGQALLK  575

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPDLPWLHTDSWVkkpk  2280
             I NI+K C  VAILST  YH  VR+                 SWP+LPWLHTDSWVK  K
Sbjct  576   IENISKSCGAVAILSTIGYHSAVRV----------------GSWPNLPWLHTDSWVKNSK  619

Query  2281  lfkkpkD---EQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRT  2451
                        + QP  +DLCFLQFTSGST D KGVMITHGG+IHNVKLMRKRYKSTS+T
Sbjct  620   NLLAENVVCFTESQP--DDLCFLQFTSGSTGDAKGVMITHGGLIHNVKLMRKRYKSTSKT  677

Query  2452  ILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNF  2631
             +LVSWLPQYHDMGLIGGL T +V G + ILFSP+TF+KNPLLWL+TMSK+RATHSA PNF
Sbjct  678   VLVSWLPQYHDMGLIGGLFTAMVGGSTAILFSPLTFIKNPLLWLETMSKYRATHSAGPNF  737

Query  2632  AFELLVRRLESSKEE--NFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGY  2805
             AFEL+VRRLESSK++  +FDLSSM FLM AAEP+RQTT+KRFVELT+ FGLS+ VMAPGY
Sbjct  738   AFELMVRRLESSKDKVRSFDLSSMKFLMVAAEPVRQTTVKRFVELTRPFGLSQGVMAPGY  797

Query  2806  GLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEG  2985
             GLAENCVFVSCAYG+G P+ +DWQGRVCCGY+ Q + D VDI+I++PET +E  +PGKEG
Sbjct  798   GLAENCVFVSCAYGQGKPIILDWQGRVCCGYVDQNDPD-VDIRIVNPETSEEIGEPGKEG  856

Query  2986  EIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLI  3165
             E+WISS SAGIGYWG EELSQ TF N++ +  G++Y RTGDLGRIID K FITGR KDLI
Sbjct  857   EVWISSPSAGIGYWGREELSQITFRNELQNNRGRKYTRTGDLGRIIDGKFFITGRIKDLI  916

Query  3166  IVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEV  3345
             IVAG+N+Y++D+EKTVESS+E +RPGCCAV+G+PE+VL +KGI     SD++GLVVIAEV
Sbjct  917   IVAGRNVYSADVEKTVESSTEHIRPGCCAVIGVPEEVLSTKGISVSDGSDQVGLVVIAEV  976

Query  3346  RDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLD  3525
             RDGKP+  DV+++I TRV EEHGV +AS+  IKPR++SKTTSGKIKR+EC K+F+ GTL+
Sbjct  977   RDGKPVDKDVIENIKTRVVEEHGVTVASVKLIKPRTMSKTTSGKIKRFECLKQFVDGTLN  1036

Query  3526  VIEEQMNGERSL--------------PRNDGIIVP-ANGKISKTDIVNFLKDLLSQQTGI  3660
              + E +  +R L              PR   +  P A+ K+S  DIV FLK L+S+QTGI
Sbjct  1037  TVPEPLFTKRKLTRSFTTGTCKEGRTPRPQLVSSPVASKKMSNKDIVEFLKGLVSEQTGI  1096

Query  3661  PVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEK  3840
             P++K+S  ++LVSYG++SIGVVRAAQK+S F G+ +GA+DIF+ATCI DLA F E+L+ K
Sbjct  1097  PITKVSATDSLVSYGIDSIGVVRAAQKLSDFLGVPVGAVDIFTATCIADLASFSENLVMK  1156

Query  3841  NHP-MLTNSSETKISSSGIPSV---VSTFDKITIWLIHLVALAYVSLLLIIPAYISVSMF  4008
             + P ++T+SS T    +        VS   +  IW+  L+AL YVS++LI+PAY+SVS F
Sbjct  1157  SQPQLMTDSSFTPEPETDFDEFDMEVSKARQCGIWIFQLLALVYVSVMLILPAYLSVSAF  1216

Query  4009  KPLILANQS-----PWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPEIS  4173
               L+ A Q+     PW  Y  SL  AP +W+LCIF TCI   + GN+ L+PNY LNPE+S
Sbjct  1217  TTLVSAPQTLLDERPWLNYMFSLTFAPLAWILCIFATCISITIFGNSFLRPNYTLNPEVS  1276

Query  4174  VWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDPLL  4353
             +WS +FVKWWALYK  E+S KVLAV+LRGTVFLN+WF++LGAK+ SS L+DTVDITDP L
Sbjct  1277  IWSADFVKWWALYKVHEVSCKVLAVYLRGTVFLNWWFEMLGAKLGSSVLLDTVDITDPSL  1336

Query  4354  VSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLAQN  4533
             V I + +VISEGALIQSHEVKNGVLSF  ++I ++ S+GPYAV+QKGS++G+ AEV    
Sbjct  1337  VLIGDGAVISEGALIQSHEVKNGVLSFQPIKIARKVSVGPYAVIQKGSVIGEEAEVAPLQ  1396

Query  4534  KKAAAK-ISKPLNGH---KGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLNSLSAAIAYLV  4701
             K    K I K  N +   KG    +I   +     ++ Q  GIY++ +L++LSAAI Y +
Sbjct  1397  KSEGGKPILKSTNANYVQKGGAVSKI-STHRTQDEAIHQFIGIYIVSFLSTLSAAITYFL  1455

Query  4702  WIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHGL  4881
             +IWL QKP S  HF F+CI+GAFHW P+ II +  MF S+P +   FA   A  Y  HGL
Sbjct  1456  YIWLSQKPASPRHFAFLCISGAFHWLPFTIIAYATMFASVPANPAYFAISTAVAYLFHGL  1515

Query  4882  ILSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWMGAK  5061
             +LS  T +L HF++ K +  +   + W+ HR+ +ACH+RFAKLLSGTE FC+YL  +GAK
Sbjct  1516  VLSYLTCILTHFLAGKKEEKQTHLKAWLCHRITIACHLRFAKLLSGTEAFCIYLRLLGAK  1575

Query  5062  IGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQG  5241
             IG++CSIRAINPV  P  V++  GVHLGDFSRI+PG++++ G+I G++++++NSVIGSQ 
Sbjct  1576  IGRYCSIRAINPVSCPQQVTLGAGVHLGDFSRIIPGFYSSIGFIFGKVEVQDNSVIGSQS  1635

Query  5242  LILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMDPKYK  5421
             L+LP S + +DVILGALSVAP++SVL+  G ++GS++ VM++N    LDDRIEEMD KYK
Sbjct  1636  LVLPNSVVSRDVILGALSVAPMHSVLQRGGIYIGSQSPVMIKNTMHALDDRIEEMDMKYK  1695

Query  5422  KVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYPVIIRH  5601
             K++G+L+ANLAA+TLK+KSRYFHRIG +G+G L +Y+ + GLPDHKIF PG  YPVI+RH
Sbjct  1696  KIVGNLSANLAATTLKVKSRYFHRIGVSGRGQLTIYDNIQGLPDHKIFHPGKCYPVIVRH  1755

Query  5602  SNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFATWLVC  5781
             SN LS+DDDAR+D RGAAIRI          T+ LLDLTLKTG AF+ARTIGDFATWLVC
Sbjct  1756  SNSLSADDDARIDARGAAIRIFSD---LNGNTSSLLDLTLKTGNAFYARTIGDFATWLVC  1812

Query  5782  GAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKLRPFD  5961
             G AAREEHVK  PHIRDA+W SLR  +SY E+HYYSNICRLFRF DGQEMYV+FKLRP+D
Sbjct  1813  GLAAREEHVKRVPHIRDAVWKSLRLSDSYAEMHYYSNICRLFRFTDGQEMYVKFKLRPYD  1872

Query  5962  EKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQIQP  6141
             E IGE+ GEVEPRGILPPETGAIPRD+ND RPLLFLA++F+ RVSSP  VRY+ QLQI+P
Sbjct  1873  ESIGEDSGEVEPRGILPPETGAIPRDDNDTRPLLFLADEFQRRVSSPSGVRYIFQLQIRP  1932

Query  6142  IPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEIDVIR  6321
             IP DE +++  LDCTKPWDE E PYI+VGEI+IDQ L+ +ESE+LEFNP+ +CNEIDVI 
Sbjct  1933  IPQDEAMQDIALDCTKPWDEAEYPYIDVGEISIDQNLSTEESEKLEFNPYLKCNEIDVIP  1992

Query  6322  ATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAKLENKD  6501
             AT+ +QSASIDHGRSL+YEICQ+LRN +PLPE+WRIFL+QSDVK+DLSGCP+AA LE K 
Sbjct  1993  ATTSSQSASIDHGRSLIYEICQHLRNGEPLPESWRIFLEQSDVKVDLSGCPMAAALEEKT  2052

Query  6502  MPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQWLLPL  6681
               K TL R WY TLW +  QP LQ VLPYFL+GLVI+ PL    +  E   +   WLLP+
Sbjct  2053  EDKVTLERTWYQTLWSIFAQPLLQTVLPYFLIGLVIFTPLKWTLFLKENKILPLHWLLPM  2112

Query  6682  WWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYFMETATG  6861
             +W  SGILA L CA +KWVLVGKK +G++  IWS+G+ MDT+WQA RT+ GEYF+E  +G
Sbjct  2113  FWVSSGILAALACAAAKWVLVGKKKEGESVQIWSKGVLMDTVWQAFRTLVGEYFVEMTSG  2172

Query  6862  TFLMGIWMRLMGSEVAR-DGVYIDSMGATLNPDMVRIE-EYGSVGREALLFGHIYEG-GG  7032
             +FL   WM+LMG+E+    G Y+DSMGA LNP+MV +E   G VG+EALLFGHIYEG GG
Sbjct  2173  SFLFVAWMKLMGAEIELGQGAYVDSMGAVLNPEMVEMEGNGGCVGKEALLFGHIYEGDGG  2232

Query  7033  EVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             +VK+G+I +  GGFVGSRA AMPG  I++GGSL +LSLAM
Sbjct  2233  KVKFGKIRIGEGGFVGSRAAAMPGVRIENGGSLSSLSLAM  2272



>ref|XP_010091993.1| Long-chain-fatty-acid--AMP ligase FadD28 [Morus notabilis]
 gb|EXB48399.1| Long-chain-fatty-acid--AMP ligase FadD28 [Morus notabilis]
Length=2328

 Score =  2944 bits (7631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1455/2325 (63%), Positives = 1793/2325 (77%), Gaps = 47/2325 (2%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+    ++D F KLHPC+P  TRIGIVG GPSGLSAAYAL KLGY+NV VLEK+HS GGM
Sbjct  1     MDPEKTIEDQFCKLHPCLPINTRIGIVGGGPSGLSAAYALAKLGYTNVTVLEKYHSVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRV  660
             CES++I+G+ YDLGGQVLAANSAP IFHLA+E  +E+EEMD+HKLAL+DS    Y D++V
Sbjct  61    CESVEIKGKIYDLGGQVLAANSAPVIFHLARETDSELEEMDSHKLALIDSSTGQYQDIKV  120

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             A+DY+SV+ +TL+LQD+ K+++RIGV++VSE A D+TP++L+  GL+SVPKSVAYGYTAS
Sbjct  121   ADDYVSVMSLTLELQDKAKSSSRIGVHAVSEFALDLTPQYLEAHGLESVPKSVAYGYTAS  180

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF+QDMPYAYIHEF RTSMAGKIRRFKGGYTS+W+K+SE++PI+  CNTEVL++KR+ 
Sbjct  181   GYGFVQDMPYAYIHEFTRTSMAGKIRRFKGGYTSLWRKISESLPIEVYCNTEVLAVKRDC  240

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
             SGV +DVR  NG  + MEFDKIIISG+FPF NGR YRSP   +     + +DMS LEK+L
Sbjct  241   SGVRIDVRDCNGEFKVMEFDKIIISGSFPFKNGRVYRSPPSNSTEHETEAIDMSDLEKEL  300

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             FSKV+TI+YYT+V++I GL+H+P+GFYYF ++M+DP+ IG PVAMQ+FY DT++FLFWSY
Sbjct  301   FSKVKTIDYYTTVMKIKGLDHMPIGFYYFGDYMDDPSKIGYPVAMQRFYADTDIFLFWSY  360

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GNS+DI G  V ELA + V  +GGQV++V+LQR FKYFPHV+ QDMK+GFY+KLE +LQG
Sbjct  361   GNSVDIKGPNVTELAIETVKTIGGQVEEVVLQRRFKYFPHVSSQDMKNGFYDKLEYELQG  420

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
               NTYYVGGLMAFELTERNASY+MALI K FA+    P FPYVK L PLK   +    K 
Sbjct  421   LRNTYYVGGLMAFELTERNASYAMALICKRFASKDSAPIFPYVKSLNPLKKKCQKRNPKS  480

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             LDE+PGV+FP+L SLD YL +WGT  VT+NKTLYTW+NE+G V+  RTYKE+H NA   A
Sbjct  481   LDELPGVEFPDLPSLDCYLNYWGTHRVTQNKTLYTWINEEGAVVCHRTYKELHNNASYTA  540

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
             QKLLTS+KP IKPGD+VLL+YVPGLDF+DAFFGCLRA+V+P+P +PPDP QR GGQAL+ 
Sbjct  541   QKLLTSKKPVIKPGDRVLLVYVPGLDFIDAFFGCLRAKVLPVPVLPPDPMQR-GGQALMK  599

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNS-WPDLPWLHTDSWVkkp  2277
             I NIAK C  VAILST  YH  VR    K+++    K+++S + WP+LPWLHTDSW+K  
Sbjct  600   IENIAKSCQAVAILSTLGYHSAVRAGLVKSLISLTGKNRNSTARWPNLPWLHTDSWIKDS  659

Query  2278  klfkkpkD-EQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTI  2454
             K        +  +P  +D+ FLQFTSGST D KGVMITHGG+IHNVKLMR+ YKS S+TI
Sbjct  660   KNTIVEGKADHSEPKPDDVSFLQFTSGSTGDAKGVMITHGGLIHNVKLMRRIYKSASKTI  719

Query  2455  LVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFA  2634
             LVSWLPQYHDMGLIGGL T LVSG S ILFSP++F+KNPLLWLQTMSK+RATHSA PNFA
Sbjct  720   LVSWLPQYHDMGLIGGLFTALVSGASSILFSPLSFIKNPLLWLQTMSKYRATHSAGPNFA  779

Query  2635  FELLVRRLESSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLA  2814
             FEL+VRRLES+K   FDLSSM FLM AAEP+RQ T+KRF+ELT  FGLS++VMAPGYGLA
Sbjct  780   FELVVRRLESNKNHIFDLSSMVFLMIAAEPVRQKTVKRFIELTNCFGLSQDVMAPGYGLA  839

Query  2815  ENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIW  2994
             ENCVFVSCA+GEG PV VDW+GRVCCGY+  PN   VDI+I+ PE G+E D+ GKEGEIW
Sbjct  840   ENCVFVSCAFGEGRPVLVDWEGRVCCGYV-DPNDADVDIRIVDPEIGEELDEDGKEGEIW  898

Query  2995  ISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVA  3174
             ISS S+GIGYWG EELSQ  F N++ +  G+RY RTGDLGRIID  LFITGR KDLIIVA
Sbjct  899   ISSPSSGIGYWGREELSQNIFGNELQNHHGRRYTRTGDLGRIIDGNLFITGRIKDLIIVA  958

Query  3175  GKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDG  3354
             G+NIY++D+EKTVESS EL+RPGCCAV+G+PE+ L +KGI     SD +GLVVIAEV+DG
Sbjct  959   GRNIYSADVEKTVESSFELLRPGCCAVIGVPEETLSAKGISVPDNSDHVGLVVIAEVKDG  1018

Query  3355  KPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVIE  3534
             KP   DV++ I TRVAEEHGV +AS+  IKPR+ISKTTSGKIKR+EC K+FI GTL+++ 
Sbjct  1019  KPASEDVVEKIKTRVAEEHGVNVASVKLIKPRTISKTTSGKIKRFECLKQFIDGTLNIVP  1078

Query  3535  EQMNGERSL--------------PRNDGIIVPAN--GKISKTDIVNFLKDLLSQQTGIPV  3666
             E +  ++ L              PR   +  P     K+   +IV FLK L+S+QTGIP+
Sbjct  1079  EPIIRKKFLTRSFTTGTCKEGKTPRPQLVSSPIQTPTKVKIKEIVEFLKGLVSEQTGIPI  1138

Query  3667  SKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEK--  3840
             + IST E LVSYG++SIGVVRAAQK+S F G+ +GAIDIF+ATCI +LA F E+LL K  
Sbjct  1139  NDISTTENLVSYGIDSIGVVRAAQKLSDFLGVPVGAIDIFTATCIAELAHFSENLLLKSQ  1198

Query  3841  ----NHPMLTNSSETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPAYISVSMF  4008
                 N   L+  SE KI S      +S   ++ IW +  +AL Y++ LL+ PAY S S  
Sbjct  1199  HEHMNTSSLSYDSELKIDSVESVMEISKSRQLGIWFLQNLALIYIAFLLVFPAYFSFSTL  1258

Query  4009  -----KPLILANQSPWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPEIS  4173
                    L L  + P  +Y I L  +PF+W+LCI  TCIC  LLGN+ L+PNY LNPEIS
Sbjct  1259  MWSISAILPLTERYPILYYLIPLTFSPFAWILCIVFTCICLSLLGNSFLRPNYALNPEIS  1318

Query  4174  VWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDPLL  4353
             +WSV+FVKWWALYKAQE+SSKVLA HLRGTVFL  WF++LGAKI SS L+DTVDITDP L
Sbjct  1319  IWSVDFVKWWALYKAQEVSSKVLAEHLRGTVFLKCWFEMLGAKIGSSVLLDTVDITDPSL  1378

Query  4354  VSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLAQN  4533
             VSI + SVI+EGALIQSHEVKNG+LSF   RIG+ S IGPYAV+Q G  V +  E++   
Sbjct  1379  VSIGDGSVIAEGALIQSHEVKNGILSFFPTRIGRNSCIGPYAVIQNGISVVEDLEIMPLQ  1438

Query  4534  K---KAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLNSLSAAIAYLVW  4704
             K   K A K  +  N HKG +      +      ++    GIY++G+L+SLSAAI Y ++
Sbjct  1439  KNGAKLAIKSLRSTNLHKGALIPDDTSKTQT--EAIHHFMGIYLVGFLSSLSAAIMYFIY  1496

Query  4705  IWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHGLI  4884
             +WL +K PSL  + F+C  GAFHW PY II +  MF+++  +   FA  +A  Y AHGLI
Sbjct  1497  VWLTKKSPSLQEYTFLCSFGAFHWMPYTIIAYATMFSNISSNIYQFAISIAIAYLAHGLI  1556

Query  4885  LSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWMGAKI  5064
             L+  T    HF+S K +T +     W+ HR+ +ACH+RFAKLLSGTE FCVYL  +GAKI
Sbjct  1557  LTFLTSASTHFISSKPNTKESHLRTWLCHRIRIACHLRFAKLLSGTEAFCVYLRLLGAKI  1616

Query  5065  GQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQGL  5244
             G+HCSIRAINPV EP L+S++ GVHLGDFS+I+PG++++ G+I  +I++++NSVIGSQ L
Sbjct  1617  GKHCSIRAINPVSEPKLISISSGVHLGDFSKIIPGFYSSNGFIKRKIEVQDNSVIGSQSL  1676

Query  5245  ILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMDPKYKK  5424
             +LPGS I+KDVILGALSVAPLN VL+  G +VGS+  +M++N    +DDRIEEMD KYKK
Sbjct  1677  VLPGSVIQKDVILGALSVAPLNCVLQRGGVYVGSQAPIMIKNTMHSVDDRIEEMDMKYKK  1736

Query  5425  VLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLP-DHKIFGPGATYPVIIRH  5601
             ++G+LAANLAA+TLK+KSRYFHRIG +GKG L++Y+ +   P +HKIF PG TYPVIIRH
Sbjct  1737  IVGNLAANLAATTLKVKSRYFHRIGVSGKGHLKIYDNIINWPNNHKIFSPGKTYPVIIRH  1796

Query  5602  SNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFATWLVC  5781
             SN LS+DDDAR+D RGAAIRIL  E  ++     LLDLTLKTGKAF+AR+I DFATWLVC
Sbjct  1797  SNSLSADDDARIDARGAAIRILSDE-PSSDKDATLLDLTLKTGKAFYARSISDFATWLVC  1855

Query  5782  GAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKLRPFD  5961
             G  AREEHVK APH+R+A+W SLR  +SYT+LHYYSNICRLFRF +GQEMYV+FKLRP+D
Sbjct  1856  GLPAREEHVKRAPHVREAVWTSLRNADSYTQLHYYSNICRLFRFSEGQEMYVKFKLRPYD  1915

Query  5962  EKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQIQP  6141
             + IGE  G+VEP GILPPETGAIPR+E D RPLLFLA+DF+ RV S   +RYV QLQ +P
Sbjct  1916  QTIGEGSGKVEPIGILPPETGAIPRNETDTRPLLFLADDFRSRVESKPGLRYVFQLQFRP  1975

Query  6142  IPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEIDVIR  6321
             +PDDE  RE  LDCT PWDE E PYI+VGEI I + L+ +ESE+L+FNPF R +E+DVIR
Sbjct  1976  VPDDENARELALDCTNPWDETEFPYIDVGEINISENLSAEESEKLDFNPFLRSHEVDVIR  2035

Query  6322  ATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAK-----  6486
             ATSC+QSASIDHGRSL+YEICQ+LRN +PLPEAWR+FL+QSDVK+DLSGCPL        
Sbjct  2036  ATSCSQSASIDHGRSLIYEICQHLRNGQPLPEAWRMFLEQSDVKVDLSGCPLMGASATTL  2095

Query  6487  LENKDMPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQ-IQK  6663
             ++ KD    TLAR W  TLW    QP LQ V P+FLLGLVI+APL  +    E  + +  
Sbjct  2096  MDKKDEEIVTLARTWDQTLWATFVQPLLQTVFPFFLLGLVIFAPLKWVLCLKESQKAVPL  2155

Query  6664  QWLLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYF  6843
              WL+PL+W  SG LA L C ++KWVLVGK+ +G+   IWS+ +FMDT WQA RT+ GEYF
Sbjct  2156  YWLIPLFWVISGCLAALGCVVAKWVLVGKREEGENMMIWSKWVFMDTTWQAFRTIVGEYF  2215

Query  6844  METATGTFLMGIWMRLMGSEVARD-GVYIDSMGATLNPDMVRIEEYGSVGREALLFGHIY  7020
             ME  TG+ L  +WMRLMGS+V  D G Y+D+MG  LNP+M+ I   G VGREALLFGH+Y
Sbjct  2216  MEMTTGSLLFLVWMRLMGSDVEWDQGAYVDTMGVLLNPEMMEIGRGGCVGREALLFGHVY  2275

Query  7021  EG-GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             EG GG++K+G+I V  GGFVGSRAVAMPG  ++SGG L ALSLAM
Sbjct  2276  EGDGGKIKFGKIKVGEGGFVGSRAVAMPGVRVESGGCLSALSLAM  2320



>emb|CDP14089.1| unnamed protein product [Coffea canephora]
Length=2307

 Score =  2937 bits (7615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1439/2314 (62%), Positives = 1783/2314 (77%), Gaps = 46/2314 (2%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+    ++D+F KLHP  P  TRI IVG GPSG+SAAYAL KLGY N+ VLEK+H+  GM
Sbjct  1     MDLKNSIEDVFSKLHPSFPVNTRIAIVGGGPSGISAAYALSKLGYHNITVLEKYHTVSGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDS-DWAYTDMRV  660
             CES+DI+G+ YDLGGQVLAANSAPTIFHLAKE  +E+EEMD+HKLAL+DS    Y D++V
Sbjct  61    CESVDIEGKIYDLGGQVLAANSAPTIFHLAKETASELEEMDSHKLALIDSMTGKYQDIQV  120

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             A+DY+SV+ +TL LQD+   + RIGV+ VS+ A+++TP FL+ +G KSVPKSVAYGYTAS
Sbjct  121   ADDYVSVVSLTLDLQDKTNNSGRIGVHGVSDFAAELTPTFLEGRGFKSVPKSVAYGYTAS  180

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGFIQDM YAYIHEF RTSMAGKIRRFKGGY S+W+K+S+++P +  CNTEVL ++RNS
Sbjct  181   GYGFIQDMSYAYIHEFTRTSMAGKIRRFKGGYMSLWQKISKSLPAQVLCNTEVLGVRRNS  240

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
              GV VD+R+ N  L+ M FDKIIISG+ PF +GRTYRSPS  +A      MD S +EK+L
Sbjct  241   LGVEVDIRNSNAELETMSFDKIIISGSLPFISGRTYRSPSSASADSENKVMDFSEIEKEL  300

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             FSKVQTI+YYT+VL+I GLE +P+GFYYF  FM+DPA IGNPVAMQKFY DT++FLFWSY
Sbjct  301   FSKVQTIDYYTTVLKIKGLEEMPVGFYYFGEFMDDPATIGNPVAMQKFYADTDIFLFWSY  360

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GNS  I G  V +LA   V ++GG V+KV+LQR FKYFPHV  QDMK+GFY++LET+LQG
Sbjct  361   GNSDTIKGPTVTQLAIDTVQRIGGVVQKVVLQRRFKYFPHVKSQDMKEGFYDRLETELQG  420

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
             Q+NTYYVGGLMAFELTERN+SY+MAL++KHF +   +P F YVK LFPL S       + 
Sbjct  421   QMNTYYVGGLMAFELTERNSSYAMALMQKHFGSSEPLPKFAYVKSLFPLYSDIRDKKPET  480

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             LDEIPGV+FP+LSS+D YL+HWGT  +  NKTLYTW+NE+G+V+ +RTY E+H NA +IA
Sbjct  481   LDEIPGVEFPDLSSVDGYLKHWGTHKMILNKTLYTWINEEGEVVGQRTYGELHANASSIA  540

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
               LLTS+KP I+PGD+VLL++VPGLDF+DAFFGCLRA+V+P+P +PPDP QR GGQALL 
Sbjct  541   HMLLTSKKPVIRPGDRVLLVHVPGLDFIDAFFGCLRAKVLPVPALPPDPLQR-GGQALLK  599

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKD-KSSNSWPDLPWLHTDSWVkkp  2277
             + NI K CN VAILST  YH  VR  S KN+L   SK  K++  WP+LPW HTDSW++  
Sbjct  600   VENIVKACNAVAILSTIGYHAAVRAGSVKNLLSLSSKSRKNTARWPNLPWFHTDSWIRNS  659

Query  2278  klfkkpkDEQG-QPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTI  2454
             K      +E G +P  +DLCFLQFTSGST D KGVMITHGG+IHNVKLMR+RYKSTS T+
Sbjct  660   KDLIHKDNEYGNEPKPDDLCFLQFTSGSTGDAKGVMITHGGLIHNVKLMRRRYKSTSSTV  719

Query  2455  LVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFA  2634
             LVSWLPQYHDMGLIGGL T LVSGGS ILFSP+TF+KNPLLWL+TMSK+RATHSA PNFA
Sbjct  720   LVSWLPQYHDMGLIGGLFTSLVSGGSAILFSPITFIKNPLLWLETMSKYRATHSAGPNFA  779

Query  2635  FELLVRRLESSKEE--NFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYG  2808
             FEL+VRR+E SKE+   +DLSSM FLM  AEP+RQ TLKRF+ELT + GLS+ VMAPGYG
Sbjct  780   FELVVRRMEISKEKIWTYDLSSMIFLMVGAEPVRQKTLKRFLELTSALGLSQWVMAPGYG  839

Query  2809  LAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGE  2988
             LAENCVFV+CAYGEG P+ VDWQGRV CGY+  PN   VDI+I+ PETG END+PGKEGE
Sbjct  840   LAENCVFVNCAYGEGKPILVDWQGRVSCGYV-TPNNADVDIRIVDPETGAENDEPGKEGE  898

Query  2989  IWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLII  3168
             IWISS SAGIGYWG  + S++TF N I + PGK Y RTGDLGRIID  LF+TGR KDLII
Sbjct  899   IWISSPSAGIGYWGTNDQSERTFRNKIANHPGKIYTRTGDLGRIIDGNLFVTGRIKDLII  958

Query  3169  VAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVR  3348
             VAG+NIY +D+EKTVESSSEL+R GCCAV+G+ E++L +KGI     SD++GLVVIAEV+
Sbjct  959   VAGRNIYLADVEKTVESSSELLRAGCCAVIGVAEEILAAKGISAADNSDQVGLVVIAEVK  1018

Query  3349  DGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDV  3528
             DGKP+  DV++ I +R+AEEHGV +A++  IKPR+ISKTTSGKIKR+EC K+F  GTL++
Sbjct  1019  DGKPVSKDVINDINSRIAEEHGVSVAAVKLIKPRTISKTTSGKIKRFECLKQFTDGTLNL  1078

Query  3529  IEEQMNGERSLPRN-------DGIIVPANGKI--------------SKTDIVNFLKDLLS  3645
             + +    +RSL R+       +G    A+ KI              +   IV FLK L+S
Sbjct  1079  VPDPTVTKRSLIRSFTTGSCKEGKTPRAHLKIDPPLQMSSSPSSGLTNKQIVEFLKRLVS  1138

Query  3646  QQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVE  3825
             +QTGIP +KIST E+L+SYG++SIGVVRAAQK+S F G+ +GA+DIF+ATCI+DLA F E
Sbjct  1139  EQTGIPFNKISTTESLMSYGIDSIGVVRAAQKLSDFLGVPVGAVDIFTATCIEDLASFSE  1198

Query  3826  SLLEKNHPMLTNS---SETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPAYIS  3996
             + + K+ P LT +    E   +   + + VS   ++ I L+ L+AL YVS+LL++P YIS
Sbjct  1199  NHVMKSRPQLTRTISHLEETETEYELLTEVSVSRQLGIILLQLIALTYVSVLLMLPPYIS  1258

Query  3997  VSMFKPLILANQSPWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPEISV  4176
             +S+FK L+ ++ + W  Y ISLA AP SW+ CIF TCI   L GN+ LQPNY L PEIS+
Sbjct  1259  ISVFKNLVFSHTASWPSYVISLAFAPLSWIFCIFATCISISLFGNSFLQPNYALKPEISI  1318

Query  4177  WSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDPLLV  4356
             W+V+FVKWWALYK  E+SSK +AVHLRGTVFL YWF+ILGAKI SS L+DTVDITDP LV
Sbjct  1319  WTVDFVKWWALYKVHEVSSKTMAVHLRGTVFLKYWFQILGAKIGSSVLLDTVDITDPALV  1378

Query  4357  SIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLAQNK  4536
             SI + +VI+EGALIQSHEVKNG+LS   +RIGK SSIGPYAV+QKGS++G+ +EV A  K
Sbjct  1379  SIGDGTVIAEGALIQSHEVKNGILSLLPIRIGKSSSIGPYAVIQKGSVLGERSEVPASQK  1438

Query  4537  KAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLNSLSAAIAYLVWIWLL  4716
               A            +VT R          +++ L GIYM+G+++++SAA+ Y + I + 
Sbjct  1439  TEAGD----------RVTERSDAIEDNESQAIYHLMGIYMVGFISTISAAVLYFLHIGIS  1488

Query  4717  QKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHGLILSVF  4896
             QKP S+ +F F CI GAFHWFP  I+ +  M  S   S ++FA +VA  Y AHGLI    
Sbjct  1489  QKPLSIDNFAFFCITGAFHWFPLAIVAYATMIASQSASPVTFATLVATAYLAHGLINIFL  1548

Query  4897  TFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWMGAKIGQHC  5076
             T  L  F+SR  +  K     W+ HR+ VACH+RFAKLLSGTE FC+YL  +GAK+G++C
Sbjct  1549  TSSLTFFLSRNKENKKSHLHTWLQHRIIVACHLRFAKLLSGTEAFCIYLRLLGAKVGKYC  1608

Query  5077  SIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQGLILPG  5256
             SIRAINPV EP L+S+  GVHLGDFSRI+  Y+++ G   G++D+++N+VIGSQ + LPG
Sbjct  1609  SIRAINPVSEPKLLSLGAGVHLGDFSRIITSYYSSKGISRGKVDVQDNAVIGSQSIALPG  1668

Query  5257  SFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMDPKYKKVLGS  5436
             S I+KDVILGALSVAP NSVL+  G +VGS+N VM++N+   LD+RIEEMD KYKK++G+
Sbjct  1669  SIIQKDVILGALSVAPENSVLQRGGVYVGSQNPVMIKNRLQALDERIEEMDIKYKKIVGN  1728

Query  5437  LAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYPVIIRHSNCLS  5616
             LAANLAA+TLK+++RYFHRIG  G+G LR+Y+ + GLPDHKIF PG +YP+IIRHSN L+
Sbjct  1729  LAANLAATTLKVRTRYFHRIGVGGRGVLRMYDNITGLPDHKIFHPGKSYPIIIRHSNSLT  1788

Query  5617  SDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFATWLVCGAAAR  5796
             +DDDAR+D RGAA+RI           TPLLDLTLKTGKAF+ARTI DFATWLVCG AAR
Sbjct  1789  ADDDARIDARGAALRIFSDN---ANIETPLLDLTLKTGKAFYARTISDFATWLVCGLAAR  1845

Query  5797  EEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKLRPFDEKIGE  5976
             EEHVK  PH+RDA+W SLR  +SYT+LHYYSNICRL RF DGQEMYV+FKLRPFDE + E
Sbjct  1846  EEHVKRVPHVRDAVWMSLRNADSYTQLHYYSNICRLLRFTDGQEMYVKFKLRPFDESVTE  1905

Query  5977  EYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQIQPIPDDE  6156
             + G+V+P GILPPETGAIPRD +DKRPLLFLA+DF+ RVSSP  V Y+ QLQ +P+P DE
Sbjct  1906  DSGKVDPIGILPPETGAIPRDSSDKRPLLFLADDFQQRVSSPGGVHYIFQLQFRPVPSDE  1965

Query  6157  RVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEIDVIRATSCN  6336
               ++  LDCTKPWDE E P I+VGEITIDQ L+++++EELEFNPF RCNE+DVIRA+S +
Sbjct  1966  VSQDNALDCTKPWDETEYPCIDVGEITIDQNLSKEQAEELEFNPFLRCNEVDVIRASSAS  2025

Query  6337  QSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAKLENKDMPKAT  6516
             QSASIDHGRSL+YEICQ+LRN KPLPEAWR F+++SDVK+DLSGCP+AA L   +  K T
Sbjct  2026  QSASIDHGRSLIYEICQHLRNGKPLPEAWRTFIEKSDVKVDLSGCPVAAALNKTESDKVT  2085

Query  6517  LARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQWLLPLWWGGS  6696
             L R WY T+W    QP LQ  LPY+LL  V+ APLN L  T         W+LPL+W  S
Sbjct  2086  LQRTWYQTVWATLAQPLLQTFLPYYLLAYVVCAPLNFLLDTKTTKNYPLHWMLPLFWVFS  2145

Query  6697  GILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYFMETATGTFLMG  6876
             G+L  L    +KW+LVGKK  G T  +WSR +F DTIWQA R + GEYFME   G+ L  
Sbjct  2146  GLLVALASVFAKWILVGKKKDGGTARLWSRSVFADTIWQAFRLLVGEYFMEMTGGSILFA  2205

Query  6877  IWMRLMGSEVA-RDGVYIDSMGATLNPDMVRIEEYGSVGREALLFGHIYEG-GGEVKYGR  7050
             +WM+LMGS +    GVY+DSMGA LNP+MV IE  GSVG+EALLFGHIY+G GG +K+G+
Sbjct  2206  LWMKLMGSNIELSQGVYVDSMGALLNPEMVEIERGGSVGKEALLFGHIYDGEGGMIKFGK  2265

Query  7051  ISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             I V  GGFVGSRAVAMPG  +++GG L ++SLAM
Sbjct  2266  IEVGEGGFVGSRAVAMPGVRVETGGCLASVSLAM  2299



>ref|XP_011080317.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105163603 
[Sesamum indicum]
Length=2327

 Score =  2935 bits (7610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1431/2322 (62%), Positives = 1814/2322 (78%), Gaps = 45/2322 (2%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             ME    V+D F KLHPC P  TRIGI+G GPSGLSAAYAL KLGY+N+ VLEK+H+  GM
Sbjct  1     MEPEKSVEDQFSKLHPCWPVNTRIGILGGGPSGLSAAYALCKLGYNNITVLEKYHTVSGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRV  660
             CES+DI+G+ YDLGGQVLAA+S+PTIFHLAKE+G+E+EEMD+HKLAL+DS    Y D++V
Sbjct  61    CESVDIEGKFYDLGGQVLAASSSPTIFHLAKEMGSELEEMDSHKLALIDSQTGEYQDIQV  120

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             A+DY+SVI +TL+LQ++ K + RIGV++VS+ ASD+TP+FL+  GL++VPKSVAYGYTAS
Sbjct  121   ADDYVSVISLTLELQEKAKKSGRIGVHAVSDFASDLTPKFLEGHGLEAVPKSVAYGYTAS  180

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF QDMPYAYIHEF RTSMAGKIRRFKGGY S W+K+SE++P++  CNTEV++I+R+ 
Sbjct  181   GYGFPQDMPYAYIHEFTRTSMAGKIRRFKGGYMSFWQKISESLPLEVLCNTEVVAIRRHP  240

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
             SGV VDV+  +G  +++EFDK+IISGAFPF  G+TYRSPS   A    D +D+S LEK+L
Sbjct  241   SGVSVDVKQNDGDSRSLEFDKMIISGAFPFKYGKTYRSPSVNLADAENDMLDLSELEKEL  300

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             FSKVQTI+YYT VL+I GLEHLP+GFYYF  FM+DP  +GNPVAMQ+FY+DT++FLFWSY
Sbjct  301   FSKVQTIDYYTIVLKIKGLEHLPVGFYYFAEFMDDPQTMGNPVAMQRFYSDTDIFLFWSY  360

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GNS ++ G EV +LA  AV +MGG+V++++LQR FKYFPHV  QD+K+GFY+K+E +LQG
Sbjct  361   GNSAEMKGPEVTQLAIDAVKRMGGEVERIVLQRRFKYFPHVESQDIKNGFYDKVEMELQG  420

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
             Q NTYY+GGLMAFELTERN+SY+MAL+R+HFA D  +P FPYVKRLF +KS       ++
Sbjct  421   QQNTYYIGGLMAFELTERNSSYAMALVRRHFACDGPLPRFPYVKRLFLVKSECLDKIPQK  480

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             LDE  GV+FP+LSSLD YL+HWGT  + +NK LY W+N++G+V+ +RT+ E+H NA  IA
Sbjct  481   LDESKGVEFPDLSSLDCYLKHWGTHSIIQNKILYNWINDEGEVVSQRTFGELHANAACIA  540

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
             +KLL+S+KP  KPGD+VLLI+VPGLDF+DAFFGCLRARV+P+P +PPDP QR GGQALL 
Sbjct  541   EKLLSSRKPTFKPGDRVLLIHVPGLDFIDAFFGCLRARVLPVPVLPPDPLQR-GGQALLK  599

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSWVkkp  2277
             I NIAK CN VAILST  YH  VR    KN++ F     K S  WP+LPWLHTDSW+KK 
Sbjct  600   IENIAKSCNAVAILSTVGYHSAVRAGFVKNLIQFSSRNGKCSARWPNLPWLHTDSWIKKS  659

Query  2278  klf-kkpkDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTI  2454
             K       D    P +++LCFLQFTSGST D KGVMITHGG+IHNVKLMR+RY+STS T+
Sbjct  660   KGLPAANMDSNVVPQTDELCFLQFTSGSTGDAKGVMITHGGLIHNVKLMRRRYRSTSNTV  719

Query  2455  LVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFA  2634
             LVSWLPQYHDMGLIGGL T LVSGG+ ILFSP+TF+K+PLLWL+T+SK+R THSA PNF+
Sbjct  720   LVSWLPQYHDMGLIGGLFTALVSGGTAILFSPMTFIKSPLLWLETISKYRGTHSAGPNFS  779

Query  2635  FELLVRRLE--SSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYG  2808
             FEL++RRLE   +K  N+DLS M FLM AA P+RQ TLKRFVELT  +GLS+ VMAPGYG
Sbjct  780   FELVIRRLELDKNKVRNYDLSPMKFLMVAAXPVRQKTLKRFVELTAPYGLSQYVMAPGYG  839

Query  2809  LAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGE  2988
             LAENCVFVSCAYGEG PV VDWQGRV CGY+   + D VD++I+ P+TG+E+ +PG+EGE
Sbjct  840   LAENCVFVSCAYGEGKPVLVDWQGRVSCGYVSTSDPD-VDVRIVDPQTGEEHKEPGQEGE  898

Query  2989  IWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLII  3168
             IWISS SAGIGYWG  ELS+ TF N + + PGKRY RTGDLGRIID  LFITGR KDLI+
Sbjct  899   IWISSPSAGIGYWGRMELSETTFRNKLENHPGKRYTRTGDLGRIIDGSLFITGRIKDLIV  958

Query  3169  VAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVR  3348
             VAG+NIY++D+EKTVESSS+L+RPGCCAV+G+PE++L +KGI    ASD++GL+VIAEVR
Sbjct  959   VAGRNIYSADVEKTVESSSDLLRPGCCAVIGVPEEILSTKGISVPDASDQVGLIVIAEVR  1018

Query  3349  DGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDV  3528
             DGKP   DV++ I  +VAEEHGV +A++  IKPR+ISKTTSGKIKR+EC K+F   TL++
Sbjct  1019  DGKPANKDVIEQIKAKVAEEHGVSLAAVKLIKPRTISKTTSGKIKRFECLKQFTDETLNL  1078

Query  3529  IEEQMNGERSL----------------PRNDGIIVPANGKISKTDIVNFLKDLLSQQTGI  3660
             + E +  +R+L                P+ +  I   N ++S  +IV FLK L+S+QTGI
Sbjct  1079  VPEPIIAKRTLTRSNTTGTCREGHTPRPKRNTTISLPNPRVSYIEIVEFLKKLVSEQTGI  1138

Query  3661  PVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEK  3840
               SKIST   L SYG++SIGVVRAAQK+S F G+ +GA+DIF+AT I+DLA F E+LL K
Sbjct  1139  HGSKISTTANLTSYGIDSIGVVRAAQKLSDFLGVPVGAVDIFTATSIEDLASFSENLLIK  1198

Query  3841  NHPM-LTNS---SETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPAYISVSMF  4008
             +HP  + NS   +E +  SS + + VS   ++ I ++  +AL Y+S LL  PAY+S+S++
Sbjct  1199  SHPQDMRNSDSYAEVEDISSQLATEVSLLHQMGIMVLQFLALMYISFLLTTPAYLSISVY  1258

Query  4009  KPLILANQS-----PWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPEIS  4173
               LI +N S     PW  Y ISLA AP +W+LCIF TC C  L GN+ LQPNY L P  S
Sbjct  1259  MKLISSNLSPTTLTPWTPYMISLAFAPLAWILCIFATCSCIALFGNSFLQPNYALIPNTS  1318

Query  4174  VWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDPLL  4353
             +WS++++KWWALYKAQE+SSKV AVHLRGT+ LNYWF++ GAKIASS L+DT+DITDP L
Sbjct  1319  IWSLDYIKWWALYKAQEVSSKVFAVHLRGTILLNYWFQMFGAKIASSVLLDTIDITDPAL  1378

Query  4354  VSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLAQN  4533
             VSI + +V++EG L+QSHEVKNG+LSF  +RIGKRSS+GPYAV+QKG+++ DG EV A  
Sbjct  1379  VSIGDGAVLAEGVLVQSHEVKNGILSFRPIRIGKRSSVGPYAVIQKGTVLRDGTEVPALQ  1438

Query  4534  KKAAAKISKPLN--GHKGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLNSLSAAIAYLVWI  4707
                  K+    +   H  KV    + R+  N   V+ L G+Y +G+++SLSAAI Y V+I
Sbjct  1439  VTEEGKLVPKSDKANHIQKVAELSKDRDDTNQ-VVYHLMGVYTVGFISSLSAAIVYCVYI  1497

Query  4708  WLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHGLIL  4887
              + Q  P++ HF+F+CI+GAFHWFP  ++ +  + +   +S+ SFA  VAA Y+AHGLIL
Sbjct  1498  MICQTTPTIEHFMFLCISGAFHWFPLTLVAYANIISGTSLSSWSFAVSVAAAYSAHGLIL  1557

Query  4888  SVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWMGAKIG  5067
              + T ++N+ +SR  +T K   + W+ HR+ VACH+R+AKLLSGTE FC+YL  +G K+G
Sbjct  1558  ILLTSLINYSLSRNEETPKAHLKTWLRHRIIVACHLRYAKLLSGTEAFCIYLRLLGGKVG  1617

Query  5068  QHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQGLI  5247
             ++CSIRAINPV+EP LVS+  GVHLGDFSRI+ G++++ G+  G+++++ENS++GSQ L+
Sbjct  1618  KYCSIRAINPVLEPTLVSIGAGVHLGDFSRIITGFYSSRGFTRGKVEVQENSIVGSQSLV  1677

Query  5248  LPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMDPKYKKV  5427
             LPG+ I+ +VILGALS AP+NSVL+  G ++GS+  +M++N    LD+RIEEMD KYKK+
Sbjct  1678  LPGATIQNEVILGALSFAPINSVLQRGGVYIGSQTPIMIKNTMHELDERIEEMDHKYKKI  1737

Query  5428  LGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYPVIIRHSN  5607
             +G+LAANLAA+TLK+++RYFHRIG + KG LR+Y  + G PDHKIF PG TYPVI+RHSN
Sbjct  1738  VGNLAANLAATTLKVRTRYFHRIGVSAKGVLRIYENIKGFPDHKIFQPGKTYPVIVRHSN  1797

Query  5608  CLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFATWLVCGA  5787
              LS+DDDAR+D RGAA+RI       +    PLLDLTLKTGKAF+ARTI DFATWLVCG 
Sbjct  1798  SLSADDDARIDARGAALRIFSEN---SDCQAPLLDLTLKTGKAFYARTISDFATWLVCGL  1854

Query  5788  AAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKLRPFDEK  5967
              AREE VK APHIRDA+W SLR   ++TELHYYSNICRLFRFKDGQEM+V+FKLRPFDE+
Sbjct  1855  PAREEQVKRAPHIRDAVWMSLRNAETFTELHYYSNICRLFRFKDGQEMFVKFKLRPFDER  1914

Query  5968  IGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQIQPIP  6147
             I E+ G+VEP GILPPETGAIPRD  DKRPLLFLA+DF+ RVSSP  VRY+ QLQ QP+P
Sbjct  1915  IDEDSGKVEPIGILPPETGAIPRDSKDKRPLLFLADDFQRRVSSPSGVRYIFQLQFQPVP  1974

Query  6148  DDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEIDVIRAT  6327
              D   ++ +LDCTKPWDE + PY++VGE+ I+Q LT+++SEELEFNPF RC+EIDVIRAT
Sbjct  1975  QDAATQDAILDCTKPWDESKFPYVDVGEVIINQNLTKEQSEELEFNPFLRCHEIDVIRAT  2034

Query  6328  SCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAKLE-----  6492
             S +QSASIDHGRSLVYEICQ+LRN +PLPEAWR F++QSDVK+DLSGCP+AA L+     
Sbjct  2035  SASQSASIDHGRSLVYEICQHLRNNEPLPEAWRTFIEQSDVKVDLSGCPVAAMLQKGNPN  2094

Query  6493  NKDMPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQWL  6672
             + +  K TLAR WY T W +  QP LQ  LPYFLL  V   PL+ L   H   +    WL
Sbjct  2095  SSNSSKVTLARNWYQTSWSVFAQPLLQTFLPYFLLAYVTSGPLSWLLSAHTTIKHPLHWL  2154

Query  6673  LPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYFMET  6852
             LPL+W  SGI A L CA++KW+LVGKK  G +  +WS+ IFMDTIWQA +T+ G+YFME 
Sbjct  2155  LPLFWVISGIWAALACAIAKWILVGKKKDGGSALMWSKSIFMDTIWQAFKTLVGDYFMEM  2214

Query  6853  ATGTFLMGIWMRLMGSEVARD-GVYIDSMGATLNPDMVRIEEYGSVGREALLFGHIYEG-  7026
              +G+ L  +WM+LMGSE+    GVY+DSMGA LNP+MV IE  G VGREALLFGHIYEG 
Sbjct  2215  TSGSTLFAVWMKLMGSEIEMSGGVYVDSMGAVLNPEMVEIERGGCVGREALLFGHIYEGE  2274

Query  7027  GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
              G+VK+G+I +  GGFVGSR+++MPG  ++ GGSLGALSLAM
Sbjct  2275  DGKVKFGKIRIGEGGFVGSRSISMPGVVVEDGGSLGALSLAM  2316



>ref|XP_009374851.1| PREDICTED: uncharacterized protein LOC103963721 [Pyrus x bretschneideri]
Length=2311

 Score =  2933 bits (7603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1417/2315 (61%), Positives = 1783/2315 (77%), Gaps = 44/2315 (2%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+ G  V+D F +LHPC+P  TRI IVG GPSGLS+AYAL+KLGYSNV VLEKHH+ GGM
Sbjct  1     MDPGKSVEDQFSRLHPCLPLNTRIAIVGGGPSGLSSAYALVKLGYSNVTVLEKHHTVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWAYTDMRVA  663
             CES+DI+G+ YDLGGQVLA NSAP IFHLAKE G+E+ EMD+HKLAL+D    Y D++VA
Sbjct  61    CESVDIEGKIYDLGGQVLATNSAPVIFHLAKETGSELVEMDSHKLALIDKSGQYQDIKVA  120

Query  664   EDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTASG  843
             +DY+SVI +TL+LQD+   + RIGV++VSE ASD+TP +L+ +G  S+PKSVAYGYTASG
Sbjct  121   DDYVSVISLTLELQDKAAKSGRIGVHAVSEYASDLTPVYLERQGFSSIPKSVAYGYTASG  180

Query  844   YGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNSS  1023
             YGF+QD+PYAYIHEF RTSMAGKIRRFKGGYTS+W+K+S+++P+   CNTEVL+I+R S 
Sbjct  181   YGFVQDLPYAYIHEFTRTSMAGKIRRFKGGYTSLWEKISKSLPM-VHCNTEVLAIRRYSD  239

Query  1024  GVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDLF  1203
              V VDV+  +G ++A+EFDKIIISG+FP + G+ YRSP         + M+M  +E +LF
Sbjct  240   SVSVDVKSCDGEVKALEFDKIIISGSFPLNYGKIYRSPPSHPTERGSEVMEMGDVETELF  299

Query  1204  SKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSYG  1383
             SKVQTI+YYT+VL++ G+E +P+GFYYFE +M +PA IGNPVAMQKFY DT+V LFWSYG
Sbjct  300   SKVQTIDYYTTVLKVKGIEDMPIGFYYFEEYMSNPATIGNPVAMQKFYADTDVLLFWSYG  359

Query  1384  NSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQGQ  1563
             NSID+ G  V ELA  A   +G +V +V+LQR FKYFPHV  Q+MKDGFYEKLE++LQG 
Sbjct  360   NSIDVTGPTVTELAIDAAKLIGAEVTEVVLQRRFKYFPHVGSQEMKDGFYEKLESELQGF  419

Query  1564  LNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQL  1743
              NTYYVGGLMAFELTERN+SY+M L+ KHFAND  VP FPY K LF L+    G + K +
Sbjct  420   RNTYYVGGLMAFELTERNSSYAMGLVCKHFANDNPVPKFPYAKSLFALQQQWGG-SPKSM  478

Query  1744  DEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQ  1923
              E+PGV+FP LSSLD YL+HWG  GVT+N TLYTW+NE+G V+ +RTY E+H NA  IAQ
Sbjct  479   TELPGVEFPNLSSLDGYLKHWGAHGVTQNNTLYTWINEEGAVVSQRTYAELHANASCIAQ  538

Query  1924  KLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHI  2103
             KLLT +KP I+P D+VLL++VPGLDFVDAFFGCLRA V+P+P +PPDP QRGG QALL I
Sbjct  539   KLLTCKKPRIRPRDRVLLVHVPGLDFVDAFFGCLRANVLPVPVLPPDPLQRGG-QALLKI  597

Query  2104  ANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSWVkkpk  2280
              NIAK C  VAILST SYH  V+  S KN++     K  S+  WP+LPWLHTDSW+K   
Sbjct  598   ENIAKSCGAVAILSTISYHWAVQAGSVKNIISLTAKKPNSTARWPNLPWLHTDSWIKNST  657

Query  2281  lfkkpk-DEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTIL  2457
                    +++ +P   ++ FLQFTSGST D KGVMITHGG+IHNVKLMR+RYKSTS+T+L
Sbjct  658   NVILEDFNDEFEPQPNEVSFLQFTSGSTGDAKGVMITHGGLIHNVKLMRRRYKSTSKTVL  717

Query  2458  VSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAF  2637
             VSWLPQYHDMGLIGGL T LVSGG+ +LFSP+TF++NPLLWLQ MSK++ATHSA PNFA 
Sbjct  718   VSWLPQYHDMGLIGGLFTALVSGGTAVLFSPLTFIRNPLLWLQIMSKYQATHSAGPNFAV  777

Query  2638  ELLVRRLESSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAE  2817
             EL+VRRLE  K   +DLSSM FLM AAEP+RQ TLKRFVELT+ FG S+EVMAPGYGLAE
Sbjct  778   ELVVRRLELEKNRKYDLSSMKFLMVAAEPVRQKTLKRFVELTRPFGFSQEVMAPGYGLAE  837

Query  2818  NCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWI  2997
             NCVFVSCAYGEG P+ VDWQGRVCCGY+  P+ + VDI+I+ PE  +E  + GKEGEIWI
Sbjct  838   NCVFVSCAYGEGRPIMVDWQGRVCCGYV-NPDDEDVDIRIVDPEKCEELKEVGKEGEIWI  896

Query  2998  SSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAG  3177
             SS SAGIGYWG EELSQKT+ N +   PG+ Y RTGDLGRIID KLFITGR KDLIIVAG
Sbjct  897   SSPSAGIGYWGREELSQKTYRNKLPDYPGRIYTRTGDLGRIIDRKLFITGRIKDLIIVAG  956

Query  3178  KNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGK  3357
             +NIY++D+EKTVES+SE+VRPGCCAV+ +P ++L  KGI     +D++GLVVIAEVRDGK
Sbjct  957   RNIYSADVEKTVESASEVVRPGCCAVIAVPMEILSMKGISVPDNADQVGLVVIAEVRDGK  1016

Query  3358  PLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVIEE  3537
             P+  DV++ I  RVAEEHGV +AS+  I+P+SISKTTSGKIKR+EC ++F  GTL+V+ E
Sbjct  1017  PVGKDVVEQIQARVAEEHGVTVASVKMIRPKSISKTTSGKIKRFECLQQFTDGTLNVVPE  1076

Query  3538  QMNGERSLPRN-------DGII----------VPANGKISKTDIVNFLKDLLSQQTGIPV  3666
              +  ++ L R+       +GI           +P+  KIS  DIV+FLK L+S+QTGI +
Sbjct  1077  PILTKKKLMRSFTTGTCKEGITPRPQFVRGSPLPSP-KISNKDIVDFLKRLVSEQTGISI  1135

Query  3667  SKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEKNH  3846
             +KIS  E+LVSYG++SIGVVRAAQK+S F G+ +GA+DIF+ATCI DLA F E+L+  + 
Sbjct  1136  NKISNTESLVSYGIDSIGVVRAAQKLSDFLGVPVGAVDIFTATCIADLASFSENLVMNSQ  1195

Query  3847  PMLTNSS------ETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPAYISVSMF  4008
             P L+ +       ET+  S+ +   +     + IWL  L+AL YV+ +L IPAY+SVS F
Sbjct  1196  PQLSTTPSNVPQFETETDSAELVMELPESHHLVIWLFQLLALIYVAFMLAIPAYLSVSAF  1255

Query  4009  KPLILANQS-----PWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPEIS  4173
                + A  +     P+  Y   L  AP +W+ CI  TC+    LGN+ L+PN+ LNPE+S
Sbjct  1256  MNCVSATHALVEGIPYLDYLTLLTFAPLAWIFCILSTCVSIAFLGNSFLKPNFALNPEVS  1315

Query  4174  VWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDPLL  4353
             +WSV+FVKWWALYKAQE++SKVLA HLRGTVFL YWF++LGA+I SS L+DTVDITDP L
Sbjct  1316  IWSVDFVKWWALYKAQEVASKVLAEHLRGTVFLKYWFEMLGARIGSSVLLDTVDITDPSL  1375

Query  4354  VSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLAQN  4533
             VSI +  VI+EGALIQSHEVKNGVLSF  +RIG+ SS+ PYAV+QKG+I+G+  EV+A  
Sbjct  1376  VSIGDGVVIAEGALIQSHEVKNGVLSFLPIRIGQNSSVAPYAVVQKGTILGEELEVMALQ  1435

Query  4534  KKAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLNSLSAAIAYLVWIWL  4713
             K       K  N   GK+   + K       +V+Q  GIY++G L++LSA+I YLV+IW+
Sbjct  1436  KSGGKSAVKATNLQNGKMLPNVTKETQ--DAAVYQFIGIYIVGLLSTLSASIVYLVYIWM  1493

Query  4714  LQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHGLILSV  4893
              QKP S   F F C+ GAFHW PY +I +  MF+++P+  +  +  +A  Y A+G++LS 
Sbjct  1494  SQKPLSPQEFAFACLFGAFHWMPYTVIAYATMFSNVPLGIIYSSISLAVAYLAYGIVLSF  1553

Query  4894  FTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWMGAKIGQH  5073
              T  L    S   +        W+ HR+ +ACH+RFAKLLSGTE FC+Y+  +GAK+G+H
Sbjct  1554  LTGALTRLFSSNQEKKTTHFRTWLCHRITIACHLRFAKLLSGTEAFCMYMRLLGAKVGKH  1613

Query  5074  CSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQGLILP  5253
             CS+RAINP+ +P L+S+  G+HLGDFSRI+ GY+++ G++SG++++ +NSV+GS+ ++LP
Sbjct  1614  CSVRAINPISDPKLISLGSGIHLGDFSRIIAGYYSSHGFVSGKVEVHDNSVVGSESVVLP  1673

Query  5254  GSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMDPKYKKVLG  5433
             GS ++KDVILGALSVAP+NSVL+  G ++GS+  +M++N    LDDRIEEMD KYKK++G
Sbjct  1674  GSVLQKDVILGALSVAPVNSVLQAGGVYIGSQTPMMIKNTMHSLDDRIEEMDMKYKKIVG  1733

Query  5434  SLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYPVIIRHSNCL  5613
             +LAANLAA+TLK+KSRYFHRIG +GKG+L++Y+ + GLPDHKIF PG +YPVI+RHSN L
Sbjct  1734  NLAANLAATTLKVKSRYFHRIGVSGKGTLKIYDNIKGLPDHKIFCPGKSYPVIVRHSNSL  1793

Query  5614  SSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFATWLVCGAAA  5793
             S+DDDAR+D RGAAIRIL  E    T+ + L DLTLKTG AF+ARTI DFATWLVCG  A
Sbjct  1794  SADDDARIDARGAAIRILSDE----TSDSSLFDLTLKTGNAFYARTIADFATWLVCGLPA  1849

Query  5794  REEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKLRPFDEKIG  5973
             REE VK APH+RDA+W SLR  NSY ELHYYSNICRLFRF+DGQEMYV+FKLRP DE I 
Sbjct  1850  REEFVKRAPHVRDAVWTSLRHANSYAELHYYSNICRLFRFEDGQEMYVKFKLRPSDENIS  1909

Query  5974  EEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQIQPIPDD  6153
             EE G+VEP GILPP+TGAIPR++ND RPLLFLAEDF+ RV++   VRY+ QLQ++P+P D
Sbjct  1910  EEAGKVEPIGILPPDTGAIPRNDNDTRPLLFLAEDFQSRVNA-KGVRYIFQLQVRPVPHD  1968

Query  6154  ERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEIDVIRATSC  6333
             E  R+  LDCTKPW E E PYI+VGE+ I+  L+ ++SE+L+FNPF RC+E+DVIRA+SC
Sbjct  1969  EAARDVALDCTKPWSESEFPYIDVGEVNINHNLSAEQSEQLDFNPFLRCHEVDVIRASSC  2028

Query  6334  NQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAKLENKDMPKA  6513
             +QSASIDHGRSL+YEICQ+LRN  PLPEAW+IF++QSDVK+DLSGCP+AA L  KD    
Sbjct  2029  SQSASIDHGRSLIYEICQHLRNGAPLPEAWKIFIEQSDVKVDLSGCPMAAALMKKDTQNV  2088

Query  6514  TLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQWLLPLWWGG  6693
             TL R  + TLW    QP LQ VLP+FLL LVIYAPLN + +     ++   WL PL+W  
Sbjct  2089  TLERTLFQTLWATLAQPLLQTVLPHFLLALVIYAPLNWMLHLKNAQKVALHWLFPLFWVS  2148

Query  6694  SGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYFMETATGTFLM  6873
             SG+LAGL C ++KW+LVGKK +G+T  IWS G+F+DT WQA RT+ G YF E  +G+   
Sbjct  2149  SGLLAGLACVVAKWLLVGKKKEGETVHIWSIGVFLDTTWQAFRTLVGSYFAEMTSGSIFF  2208

Query  6874  GIWMRLMGSEVARD-GVYIDSMGATLNPDMVRIEEYGSVGREALLFGHIYEGG-GEVKYG  7047
              +WM+LMGSE+  D G Y+DSMGA LNP+MV IE  G VGREALLFGHIYEG  G+VK+G
Sbjct  2209  VLWMKLMGSEIELDQGAYVDSMGALLNPEMVEIERGGCVGREALLFGHIYEGDEGKVKFG  2268

Query  7048  RISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             +ISV  GGFVGSRA+AMPG  ++ GGSL ALSLAM
Sbjct  2269  KISVGEGGFVGSRAIAMPGVRVEVGGSLSALSLAM  2303



>ref|XP_007014908.1| AMP-dependent synthetase and ligase family protein [Theobroma 
cacao]
 gb|EOY32527.1| AMP-dependent synthetase and ligase family protein [Theobroma 
cacao]
Length=2454

 Score =  2933 bits (7603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1431/2327 (61%), Positives = 1798/2327 (77%), Gaps = 49/2327 (2%)
 Frame = +1

Query  286   ICKEM--------EMESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYS  441
             ICK +        +M+ G  ++D F KLHPC+PT T IGI+GAGPSG+SAAYALIKLGY+
Sbjct  131   ICKSLLVGGLNLSKMDQGKSIEDQFSKLHPCLPTNTSIGIIGAGPSGISAAYALIKLGYN  190

Query  442   NVAVLEKHHSAGGMCESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLA  621
             NV +LEK+H+ GGMCES++IQG+ YDLGGQVLAANSAP IFHLAKE+G+E+EEMD+HKLA
Sbjct  191   NVTILEKYHTVGGMCESVEIQGKIYDLGGQVLAANSAPVIFHLAKEIGSELEEMDSHKLA  250

Query  622   LVDSDWA-YTDMRVAEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGL  798
              +DS    Y D++VA+DY+S+I +TL+LQD+ KA+NRIGV +VS++A+D+TP +L+  G 
Sbjct  251   HIDSSTGKYQDIKVADDYVSMISLTLELQDKAKASNRIGVNAVSDLAADLTPTYLEGHGF  310

Query  799   KSVPKSVAYGYTASGYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIK  978
             KSVPKSVAYGYTASGYGF+QDMPYAY+HEF RTSMAGKIRRFKGGYTS W+K+S+++P+K
Sbjct  311   KSVPKSVAYGYTASGYGFVQDMPYAYVHEFTRTSMAGKIRRFKGGYTSFWEKISKSLPVK  370

Query  979   FECNTEVLSIKRNSSGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGL  1158
               CN EVL+++RN+ GV +DV++ NG    MEFDK+I+SGAFPF NG+TYRSP    A  
Sbjct  371   VICNAEVLAVRRNALGVSIDVKNVNGDSDVMEFDKLIVSGAFPFKNGKTYRSPLSHPAEN  430

Query  1159  FCDKMDMSTLEKDLFSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQ  1338
                 MD++ LEK+LFSKV TI+YYT+ L+I GLE +P+GFYYF  +M+DPA IG PVAMQ
Sbjct  431   ETGVMDLNDLEKELFSKVMTIDYYTTALKIKGLEDMPVGFYYFGEYMDDPATIGQPVAMQ  490

Query  1339  KFYTDTNVFLFWSYGNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDM  1518
             +F+ D ++FLFWSYGNS++I G+ V ELA KAV  MGG+V++V+LQR FKYFPHV+ QDM
Sbjct  491   RFFADADIFLFWSYGNSLNIRGATVCELAIKAVETMGGEVEQVVLQRRFKYFPHVSSQDM  550

Query  1519  KDGFYEKLETQLQGQLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRL  1698
             K+GFYE++E++LQG+ NTYYVGGLMAFELTERN+SY+MAL+ KHFAN+   P  PYVK L
Sbjct  551   KNGFYERIESELQGKRNTYYVGGLMAFELTERNSSYAMALVCKHFANNNSPPVLPYVKSL  610

Query  1699  FPLKSSSEGLAFKQLDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDR  1878
             FPLKS       K+L E PGV+FP+LS+LD YL+HWGT  V ++KTLYTW+NE+G     
Sbjct  611   FPLKSDCGNRNPKELGEDPGVQFPDLSTLDGYLKHWGTHEVIQSKTLYTWINEEGAAFGE  670

Query  1879  RTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptip  2058
             RTY E+H NAF+IA K+LTS+KPAIKPGD+VLL+YVPGLDF+DAFFGCLRA+V+P+P +P
Sbjct  671   RTYAELHANAFSIAHKILTSRKPAIKPGDRVLLVYVPGLDFIDAFFGCLRAKVLPVPVLP  730

Query  2059  pdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKD-KSSNSWP  2235
             PDP QR GGQALL I NIAK C  VAILST  YH  VR    KN+L    K+ KSS +WP
Sbjct  731   PDPLQR-GGQALLKIENIAKSCGAVAILSTIVYHSAVRAGMVKNLLSLTGKNGKSSANWP  789

Query  2236  DLPWLHTDSWVkk-pklfkkpkDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNV  2412
             +LPWLHTDSW+K   K+      +Q +P   D+CFLQFTSGST D KGVMITH G+IHNV
Sbjct  790   NLPWLHTDSWIKNFKKVLLNDIADQPEPQPNDICFLQFTSGSTGDAKGVMITHSGLIHNV  849

Query  2413  KLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTM  2592
             KLMRK YKSTS+T+LVSWLPQYHDMGLIGGL T +VSGGS ILFSP+TF++NPL+WLQ M
Sbjct  850   KLMRKIYKSTSKTVLVSWLPQYHDMGLIGGLFTAMVSGGSAILFSPMTFIRNPLMWLQIM  909

Query  2593  SKWRATHSAAPNFAFELLVRRLE-SSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQS  2769
             SK++ATHSA PNFAFEL+VRRLE   K  N+DLSS+ FLM AAEP+RQ TL RFVELT  
Sbjct  910   SKYQATHSAGPNFAFELVVRRLEFEDKVWNYDLSSLIFLMVAAEPLRQRTLGRFVELTHP  969

Query  2770  FGLSREVMAPGYGLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPE  2949
             FGLS+EVMAPGYGLAENCVFVSCAYGEG P+ VDWQGRVCCGY+   N D V+I+I+ PE
Sbjct  970   FGLSQEVMAPGYGLAENCVFVSCAYGEGKPILVDWQGRVCCGYVDPGNQD-VEIRIVDPE  1028

Query  2950  TGKENDDPGKEGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDS  3129
             TG E ++ GKEGEIWISS SAGIGYWG EE S +TF N++ +  G++Y RTGDLGRIID 
Sbjct  1029  TGVELEEVGKEGEIWISSPSAGIGYWGREEYSHQTFRNELKNRTGRKYTRTGDLGRIIDG  1088

Query  3130  KLFITGRTKDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRA  3309
             KLFITGR KD+IIVAG+NIY++D+EKTVESSSEL+RPGCCAV+G+PE+VL  KGI     
Sbjct  1089  KLFITGRIKDIIIVAGRNIYSADVEKTVESSSELLRPGCCAVIGVPEEVLSEKGISVPDG  1148

Query  3310  SDELGLVVIAEVRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRY  3489
             SD +GLVVIAEVRDGKP+  D+++ I TRV EEHGV +A+I  IKP++ISKTTSGKIKR+
Sbjct  1149  SDNVGLVVIAEVRDGKPVDKDIIEQIKTRVTEEHGVNVAAIKLIKPKTISKTTSGKIKRF  1208

Query  3490  ECAKRFISGTLDVIEEQMNGERSLPRNDGIIVPANG--------------KISKTDIVNF  3627
             EC K+F  G+L++++E    +R+L R+        G              ++   DIV F
Sbjct  1209  ECLKQFTEGSLNIVQEPTFSKRTLVRSFTTGTCKEGRTPRQLLSSPLPSPRLRNKDIVEF  1268

Query  3628  LKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDD  3807
             LK L+S+ TGIP   IS  E+L SYG++SIGVVRAAQK+S + G+ +GA+DIF+ATCI D
Sbjct  1269  LKGLISELTGIPTKNISATESLASYGIDSIGVVRAAQKLSDYLGVPVGAVDIFTATCIVD  1328

Query  3808  LADFVESLLEKNHPMLTNSS----ETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLL  3975
             LA+F E+L+ K+ P L  +S    E  + S      VS + ++  W +  +AL  VS++L
Sbjct  1329  LANFSENLIAKSKPELMTTSSLLPEPDLDSDEYLVEVSIYRQVGFWCLQFLALIVVSIML  1388

Query  3976  IIPAYISVSMFKPLILANQSP-----WFFYFISLACAPFSWMLCIFLTCICTRLLGNALL  4140
              +PAY+SVS F      + +      W  Y I LA AP  W+LC+ LTCIC  + GN  L
Sbjct  1389  SVPAYLSVSAFMTFTSVSHTTTGGIHWSTYLIYLAIAPLVWILCMALTCICIAVFGNPFL  1448

Query  4141  QPNYVLNPEISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSAL  4320
             +PNY L+ +IS+WS++FVKWWALYK Q+ISSKV A HLRGTVFLNYWF++LGA+I SS L
Sbjct  1449  RPNYALSHDISIWSIDFVKWWALYKVQQISSKVFAEHLRGTVFLNYWFEMLGARIGSSVL  1508

Query  4321  IDTVDITDPLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSI  4500
             +DTVDITDP LVSI + +V++EGALIQSHEVKNG+LSF  +RIG+ S+IGPY V+QKGS+
Sbjct  1509  LDTVDITDPSLVSIGDGAVVAEGALIQSHEVKNGILSFHSIRIGRNSTIGPYTVIQKGSV  1568

Query  4501  VGDGAEVLA-QNKKAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLNSL  4677
             +G GAE+L  Q  +    I +    +  + +  +   N   + ++    GIY++G+L+  
Sbjct  1569  LGVGAEILPLQKSEGGTPIIRSAKANNAQKSTGL--SNATPNKTMSHFMGIYLVGFLSGF  1626

Query  4678  SAAIAYLVWIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVA  4857
             SAAI Y + +WL + PPS  HF F+CI+GA HW P  +I +  MF S+ ++  SFA  VA
Sbjct  1627  SAAILYFLCVWLSKTPPSAEHFAFVCISGAVHWIPLAVIAYVTMFASITLNPASFAISVA  1686

Query  4858  AGYTAHGLILSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCV  5037
               Y AHG+ILS  T  L H ++ +  + +   + ++ HR+ +ACH+RFAKLLSGTE FC+
Sbjct  1687  VAYLAHGIILSFLTCALTHLLTERQQSKQSHVKVFLGHRITIACHLRFAKLLSGTEAFCM  1746

Query  5038  YLHWMGAKIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRE  5217
             YL  +GAK+GQHCSIRAINP+ +P LV + DGVHLGDFSRIV G++T  G+I  ++++++
Sbjct  1747  YLRLLGAKVGQHCSIRAINPISDPELVKIGDGVHLGDFSRIVTGFYTCNGFIRKKVEVQD  1806

Query  5218  NSVIGSQGLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRI  5397
             NSVIGSQ LILPGS +EKDVILGALSVAP N+VL+  G +VGS+   MV+N    LDDRI
Sbjct  1807  NSVIGSQSLILPGSLVEKDVILGALSVAPENTVLQRGGVYVGSQTPTMVKNTKHALDDRI  1866

Query  5398  EEMDPKYKKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGA  5577
             EEMD KYKK++G+LAA+LA++TLK+KSRYFHRIG  G G L++Y+ + G PDHKI  PG 
Sbjct  1867  EEMDMKYKKIVGNLAASLASTTLKVKSRYFHRIGVGGNGYLKVYDKIEGFPDHKILHPGK  1926

Query  5578  TYPVIIRHSNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIG  5757
              Y V++RHSN LS+DDDAR+D RGAA+RIL          TPLLDLTLKTGKAF+ARTI 
Sbjct  1927  CYGVVVRHSNSLSADDDARIDARGAAVRILAENN------TPLLDLTLKTGKAFYARTIS  1980

Query  5758  DFATWLVCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYV  5937
             DFATWLVCG AAREEHVK  PH+R+A+W SL + NSYTELHYYSN  RL RF DG+E YV
Sbjct  1981  DFATWLVCGLAAREEHVKRVPHVRNAVWMSLCQANSYTELHYYSNFVRLLRFADGEESYV  2040

Query  5938  RFKLRPFDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRY  6117
             +FKLRP+DE I E+ G+VEP GILPPETGAIPRD+ D RPLLFLAEDF+ R+SS   VRY
Sbjct  2041  KFKLRPYDESISEDAGKVEPTGILPPETGAIPRDDKDTRPLLFLAEDFQHRISS-GGVRY  2099

Query  6118  VLQLQIQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFR  6297
             + QLQ++P+P DE  R+  LDCTKPWDE E PYI VGEI I+Q LT++E+E LEFNPF R
Sbjct  2100  IFQLQVRPVPQDEATRDIALDCTKPWDETEFPYINVGEIYIEQNLTKEEAEALEFNPFLR  2159

Query  6298  CNEIDVIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPL  6477
             C+E+DVIRA++ +QSASIDHGRSL+YEICQ LRN++PLPEAW+IFL+QSDVK+DLSGCP+
Sbjct  2160  CHEVDVIRASTSSQSASIDHGRSLIYEICQRLRNKEPLPEAWKIFLEQSDVKVDLSGCPM  2219

Query  6478  AAKLENKDMPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQI  6657
             AA LE K+  K TL R WY T W +  QP LQ VLPYFLLGL ++APL+ + Y  E  + 
Sbjct  2220  AAALEKKETGKVTLERTWYQTSWAIFAQPLLQTVLPYFLLGLAVFAPLSSVLYMKESKKF  2279

Query  6658  QKQWLLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGE  6837
                WLLPL W  SG++A L C ++KW+LVGKK +G+T  IWS+G+FMDTIWQA RT+ GE
Sbjct  2280  PLHWLLPLLWVSSGLIAALTCVVAKWILVGKKNEGETVQIWSKGVFMDTIWQAFRTLVGE  2339

Query  6838  YFMETATGTFLMGIWMRLMGSEVARD-GVYIDSMGATLNPDMVRIEEYGSVGREALLFGH  7014
             YFME  +G+ L  +WM+LMGS++  D GVY+DSMGA+LNP+MV IE  G VGREA LFGH
Sbjct  2340  YFMEMTSGSILFVLWMKLMGSDIELDQGVYVDSMGASLNPEMVEIERGGCVGREAHLFGH  2399

Query  7015  IYEG-GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             IYEG GG+VK+G+I +  GGF+GSRAV MPG  ++SGGSL +LSLAM
Sbjct  2400  IYEGEGGKVKFGKIRIGEGGFIGSRAVVMPGVRVESGGSLCSLSLAM  2446



>ref|XP_006348564.1| PREDICTED: uncharacterized protein LOC102582076 [Solanum tuberosum]
Length=2309

 Score =  2927 bits (7588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1433/2323 (62%), Positives = 1790/2323 (77%), Gaps = 62/2323 (3%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+    ++D F K+HPC P  TRI IVGAGPSG+SAAYAL  LGY+NV V+EKHHS GGM
Sbjct  1     MDDQKSIEDKFSKIHPCFPVNTRIAIVGAGPSGISAAYALCNLGYNNVTVIEKHHSVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRV  660
             CES+DI+GR YDLGGQVLAANSAPTIFHLAKE G+E+ E+D+HKL L+DS    Y D +V
Sbjct  61    CESVDIEGRIYDLGGQVLAANSAPTIFHLAKETGSELVELDSHKLGLIDSQTGNYKDNKV  120

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             A+DY+S+        D+ K + RIG+++VS++ASD+TP FL+ +G KSVPKSVAYGYTAS
Sbjct  121   ADDYVSM--------DKAKDSGRIGIHAVSDLASDMTPAFLESRGFKSVPKSVAYGYTAS  172

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF+QDMPYAYIHEF RTSMAGKIRRFK GYTS+WKK+SE++PI     TEVLS++R+S
Sbjct  173   GYGFVQDMPYAYIHEFTRTSMAGKIRRFKDGYTSLWKKVSESLPITVMLQTEVLSVRRDS  232

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
             +GV +DV++ +  L++MEFDK+I+SGAFPF +GRTYRSPS  +A      + +S LEK+L
Sbjct  233   TGVEIDVKNSSSDLESMEFDKVILSGAFPFRSGRTYRSPSSISADPENGVLQLSELEKEL  292

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             FS+VQTI+YYT+VL+I GLEH+P+GFYYFE FM+DPA IGNPVAMQ+FY+DTN+FLFWSY
Sbjct  293   FSQVQTIDYYTTVLKIKGLEHIPVGFYYFEEFMDDPATIGNPVAMQRFYSDTNIFLFWSY  352

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GNS ++  S V++LA  AV ++G +V+ V+LQR FKYFPHVN QDMKDGFY+K+E QLQG
Sbjct  353   GNSANVDSSTVLQLAVDAVKRIGCEVEMVVLQRRFKYFPHVNSQDMKDGFYDKIENQLQG  412

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
             Q NTYYVGGLMAFELTERN+SYSMALI KHFAN    P FPYVKRLFPL S       K 
Sbjct  413   QKNTYYVGGLMAFELTERNSSYSMALISKHFANTDPQPGFPYVKRLFPLLSDCSDKNPKA  472

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             L E   V+FPELS+LD YL++W    +T  KTLY W++E+G V++ RTY+E++ NA  IA
Sbjct  473   LKESQQVEFPELSNLDGYLKYWANHNITCKKTLYKWISEEGQVVNGRTYEELNANASCIA  532

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
             QKLL+S+KP +K GD+VLL+YVPGLDF+D+FFGCLR+ V+P+P +P DP QR GGQALL 
Sbjct  533   QKLLSSRKPVMKQGDRVLLVYVPGLDFIDSFFGCLRSGVLPVPVLPSDPMQR-GGQALLK  591

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSWVkkp  2277
             I NIAK CN VAILST  YH  VR  S KN++   +    SS  WP+LPW+HTDSWVK  
Sbjct  592   IENIAKSCNAVAILSTAGYHAAVRAGSVKNLISLNRKNGTSSARWPNLPWIHTDSWVKNA  651

Query  2278  klfkkpkDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTIL  2457
             K      +++ +P  +++CFLQFTSGST D KGVMITHGG+IHNVKLMRK YKSTS T+L
Sbjct  652   KEIHSNSNDKFEPQPDNVCFLQFTSGSTGDAKGVMITHGGLIHNVKLMRKVYKSTSNTVL  711

Query  2458  VSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAF  2637
             +SWLPQYHDMGLIGGL T LVSGGS ILFSP+TF++NPL+WL+TMSK++ATHSA PNFAF
Sbjct  712   ISWLPQYHDMGLIGGLFTALVSGGSAILFSPMTFIRNPLMWLETMSKYKATHSAGPNFAF  771

Query  2638  ELLVRRLESSKEEN--FDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGL  2811
             EL+VRRLE++KE+   +DLSS+ FLM AAEP+RQ TLK F+ELT+ FGLS+ VMAPGYGL
Sbjct  772   ELVVRRLEANKEKQWKYDLSSLKFLMVAAEPVRQKTLKNFIELTRPFGLSQRVMAPGYGL  831

Query  2812  AENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEI  2991
             AENCVFVSCAYGEG P+ VDWQGRV CGY  Q   D VDIKI+ PE+GKE+D+ G+EGEI
Sbjct  832   AENCVFVSCAYGEGKPILVDWQGRVGCGYTNQNEAD-VDIKIVDPESGKEHDESGREGEI  890

Query  2992  WISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIV  3171
             WISS SAGIGYWG EEL++KTF N + S   K Y  TGDLGRIID  LFITGR KDLIIV
Sbjct  891   WISSPSAGIGYWGREELTEKTFRNKLGSHSEKVYTGTGDLGRIIDGNLFITGRIKDLIIV  950

Query  3172  AGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRD  3351
             AG+NIY SDIEKTVESSSE++RPGCCAV+G+PE+ L SKG+     SD++GLVVIAEVRD
Sbjct  951   AGRNIYPSDIEKTVESSSEILRPGCCAVIGVPEETLSSKGVPVPDHSDQVGLVVIAEVRD  1010

Query  3352  GKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVI  3531
             GKP+  DV + I  RVAEEHGV +AS+  IKP++ISKTTSGKIKR+EC K+FI GTLDV+
Sbjct  1011  GKPVSKDVAEEIKARVAEEHGVTLASVKLIKPKTISKTTSGKIKRFECLKQFIDGTLDVV  1070

Query  3532  EEQMNGERSL----------------PRNDGIIVPANGKISKTDIVNFLKDLLSQQTGIP  3663
              +Q++ +R L                P  +   +    +++K +IV FLK L+S+QTGI 
Sbjct  1071  PDQISSKRKLLRSFTTGSCREGNTPRPHLNTTSLSPTPRLNKKEIVEFLKGLVSEQTGIS  1130

Query  3664  VSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEKN  3843
             +SKI+T E+LVSYGV+SIGVVRAAQK+S F G+ +GAIDIF+ATCI+DLA F E L+ K+
Sbjct  1131  ISKITTTESLVSYGVDSIGVVRAAQKLSDFLGVQVGAIDIFTATCIEDLASFTEDLVIKS  1190

Query  3844  HP-------MLTNSSETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPAYISVS  4002
              P        L + SE   S + +   VS   +  I L+ L+AL Y   +L++PAY S+S
Sbjct  1191  RPHDAANPSYLPDYSEDD-SCNLVAEEVSPSHRFGIILLQLLALVYAIFMLVLPAYSSIS  1249

Query  4003  MFKPLILANQS-----PWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPE  4167
             +FK LIL N +     PW  Y ISL  APF+W+LCI  TCIC   LGN +LQPNY L PE
Sbjct  1250  VFKNLILTNPTLVTSFPWAGYAISLVFAPFAWLLCISTTCICIGTLGNLVLQPNYSLTPE  1309

Query  4168  ISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDP  4347
             +S+WS++FVKWWALYKAQEISSKV+AVHLRGTVFL YWF++ GA+I SS ++DT+DI+DP
Sbjct  1310  VSIWSLDFVKWWALYKAQEISSKVMAVHLRGTVFLKYWFQVFGARIGSSVVLDTIDISDP  1369

Query  4348  LLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLA  4527
              LVSI + +VI+EGALIQ HEVKNG+LSF  VRIGK  S+GPYAVLQKGSI+ +G EV +
Sbjct  1370  ALVSIGDGAVIAEGALIQGHEVKNGILSFLPVRIGKNCSVGPYAVLQKGSILAEGTEVAS  1429

Query  4528  QNKKAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLNSLSAAIAYLVWI  4707
               K AA+K     +  + KV     +  HG   +++ L GIY++G++++LS AI Y ++I
Sbjct  1430  LQKTAASK-----SNSRKKVIEPENETEHGLITAMYHLMGIYIVGFISALSGAILYFLYI  1484

Query  4708  WLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHGLIL  4887
              L QK PSLHHF  IC++GAFHW P+ II + A+ +S   S + FA  VA  Y AHGLIL
Sbjct  1485  LLAQKSPSLHHFSLICLSGAFHWLPFTIIAYMAIISSTTSSPIIFAISVATVYLAHGLIL  1544

Query  4888  SVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWMGAKIG  5067
             S+ T  +N F+ +  +TD   R  W+ HR+N+ACH+RFAKLLSGTE FC+YL  +GAK+G
Sbjct  1545  SILTIFVNKFLLQ--NTDDSLR-IWLKHRINIACHLRFAKLLSGTEAFCMYLRLLGAKVG  1601

Query  5068  QHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQGLI  5247
              HCSIRAIN V +P L+S+ +GVHLGDFSRI+ G++++ GY SG +++++NSV+GSQ ++
Sbjct  1602  NHCSIRAINAVSDPKLMSLGEGVHLGDFSRIITGFYSSSGYTSGIVEVQDNSVVGSQSVV  1661

Query  5248  LPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMDPKYKKV  5427
             LP S I+++VILGALSVAP+NSVL+  G +VGS++ VM++N    +D+RIEEMDPKYKK+
Sbjct  1662  LPRSLIQENVILGALSVAPMNSVLQSGGIYVGSQSPVMIKNTRHAMDERIEEMDPKYKKI  1721

Query  5428  LGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYPVIIRHSN  5607
             +G+LAANLAA+TLK+K+RYFHRIG +GKG LR+Y+ + G PDHKIF  G  YPVI+RHSN
Sbjct  1722  VGNLAANLAATTLKVKTRYFHRIGVSGKGMLRMYDNIKGFPDHKIFVSGKQYPVIVRHSN  1781

Query  5608  CLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFATWLVCGA  5787
              LS+DDDARLD RGAA+RIL  +        PLLDLTLKTG+AF+ARTI DFATWLVCG 
Sbjct  1782  SLSADDDARLDARGAALRIL-SDHANFDDEKPLLDLTLKTGEAFYARTISDFATWLVCGL  1840

Query  5788  AAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKLRPFDEK  5967
             AAREEHVK  PH+RDA+W SLR  NSYTE+HYYSNICRLFRF DGQEMYV+FKLRP DE 
Sbjct  1841  AAREEHVKRVPHVRDAVWTSLRDSNSYTEMHYYSNICRLFRFTDGQEMYVKFKLRPCDEN  1900

Query  5968  IGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQIQPIP  6147
             IG++ G+VEP GILPPETGAIPR +ND RPLLFL +DFK RVSS   VRY+ QLQ + +P
Sbjct  1901  IGKDSGKVEPIGILPPETGAIPRKDNDTRPLLFLVDDFKKRVSSQGGVRYIFQLQFRTVP  1960

Query  6148  DDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEIDVIRAT  6327
              DE +++  LDCT+PWDE E PY++VGEI IDQ LT+++SE+LEFNPF RC+EIDV++AT
Sbjct  1961  KDEAIQDIALDCTRPWDEAEFPYVDVGEIFIDQNLTKEQSEQLEFNPFLRCHEIDVVKAT  2020

Query  6328  SCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAA-----KLE  6492
             S +QSASIDHGRSL+YEICQ+LRN +PLPEAW+ F++QSDVK+DLSGCP+A+     K E
Sbjct  2021  SASQSASIDHGRSLIYEICQHLRNGEPLPEAWKNFIEQSDVKVDLSGCPIASAVLQVKQE  2080

Query  6493  NKDMPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQWL  6672
             +    + TL+R WY T W    QP LQ  LPYFLL   I++PLNCL ++   T     W 
Sbjct  2081  STHHQEVTLSRTWYQTSWSTFAQPILQTFLPYFLLAYSIHSPLNCLIFS--TTNHPLYWF  2138

Query  6673  LPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYFMET  6852
              P +W  SG+LA L C L+K V   +K  G    IWS+G+ M+T+WQA RT+  +YFME 
Sbjct  2139  FPFFWISSGLLAALTCVLAKLVFTTRKKDGGKSLIWSKGLLMETLWQAFRTLVSDYFMEM  2198

Query  6853  ATGTFLMGIWMRLMGSEVA---RDGVYIDSMGATLNPDMVRIEEYGSVGREALLFGHIYE  7023
              TG+FL  IWM+LMGSEV      GVY+DS G  LNP+M+ IE  G +G+EALLFGHIYE
Sbjct  2199  TTGSFLFVIWMKLMGSEVELSHHQGVYVDSNGVLLNPEMIEIEGGGCIGKEALLFGHIYE  2258

Query  7024  GGGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             G GEVK+G++ +  G FVGSRAVAMPG  ++SG  L ALSLAM
Sbjct  2259  GEGEVKFGKVRIGEGSFVGSRAVAMPGVVVESGCCLNALSLAM  2301



>ref|XP_009364730.1| PREDICTED: uncharacterized protein LOC103954620 [Pyrus x bretschneideri]
Length=2308

 Score =  2924 bits (7580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1416/2315 (61%), Positives = 1783/2315 (77%), Gaps = 47/2315 (2%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+ G  V+D F +LHPC+P  TRIGIVG GPSGLS+AYAL+ LGYSNV VLEKHH+ GGM
Sbjct  1     MDPGKSVEDQFSRLHPCLPLNTRIGIVGGGPSGLSSAYALVNLGYSNVTVLEKHHTVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWAYTDMRVA  663
             CES+DI+G+ YDLGGQVLAANSAP IFHLAKE G+E++EMD+HKLAL+D    Y D++VA
Sbjct  61    CESVDIEGKIYDLGGQVLAANSAPVIFHLAKETGSELDEMDSHKLALIDKSGQYQDIKVA  120

Query  664   EDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTASG  843
             +DY+SVI +TL+LQD+   + RIGV++VSE ASD+TP +L+ +G  SVPKSVAYGYTASG
Sbjct  121   DDYVSVISLTLELQDKAAKSGRIGVHAVSEYASDLTPVYLECQGFSSVPKSVAYGYTASG  180

Query  844   YGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNSS  1023
             YGF+QDMPYAYIHEF RTSMAGKIRRFKGGYTS W+K+S+++P+   CNTEVL I+R S 
Sbjct  181   YGFVQDMPYAYIHEFTRTSMAGKIRRFKGGYTSFWEKISKSLPM-VHCNTEVLEIRRYSD  239

Query  1024  GVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDLF  1203
              V VDV+  +G +++MEFDKIIISG+FP ++GR YRSPS  T     + M+M  +EK+LF
Sbjct  240   SVGVDVKSCDGEVKSMEFDKIIISGSFPLNSGRIYRSPSHPTEH-GSEVMEMGDVEKELF  298

Query  1204  SKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSYG  1383
             SKVQTI+YYT+VL++ G+EH+P+GF+YFE +M +PA IGNPVAMQKFY DT++ LFWSYG
Sbjct  299   SKVQTIDYYTTVLKVKGIEHMPIGFFYFEEYMSNPATIGNPVAMQKFYADTDILLFWSYG  358

Query  1384  NSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQGQ  1563
             NS+DI G+ V ELA  A   +G +V +V+LQR FKYFPHV  Q+MKDGFYEKLE++LQG 
Sbjct  359   NSVDITGTTVTELAIDAAKLIGAEVTEVVLQRRFKYFPHVGSQEMKDGFYEKLESELQGF  418

Query  1564  LNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQL  1743
              NTYYVGGLMAFELTERN+SY+M L+ KHFAND  VP FPY K LF  +    G + K++
Sbjct  419   RNTYYVGGLMAFELTERNSSYAMGLVCKHFANDNSVPKFPYAKSLFSSQQRWGG-SPKRM  477

Query  1744  DEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQ  1923
              E+PGV+FP LSSLD YL+HWG  GVT+NKTLYTW+NE+G V+ +RTY E+H NA  IAQ
Sbjct  478   TEVPGVEFPNLSSLDGYLKHWGAHGVTQNKTLYTWINEEGVVVSQRTYAELHDNASCIAQ  537

Query  1924  KLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHI  2103
             KLLT + P I+P D+VLL++VPGLDFVDAFFGCLRA V+P+P +PPDP QRGG QALL I
Sbjct  538   KLLTCKNPVIRPRDRVLLVHVPGLDFVDAFFGCLRANVLPVPVLPPDPLQRGG-QALLKI  596

Query  2104  ANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSWVkkpk  2280
              NIAK C  VAILST SYH  V+  S KNM+     K KSS  WP+LPWLHTDSW+K  K
Sbjct  597   ENIAKSCGAVAILSTISYHWAVQAGSVKNMISLTAKKPKSSGRWPNLPWLHTDSWIKNSK  656

Query  2281  lfkkpk-DEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTIL  2457
                     ++ +P  +++ FLQFTSGST D KGVMITH G+IHNVKLMR+RY STS T+L
Sbjct  657   NVVVEDFKDEFEPQPDEVSFLQFTSGSTGDAKGVMITHSGLIHNVKLMRRRYNSTSTTVL  716

Query  2458  VSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAF  2637
             VSWLPQYHDMGLIGG+ T LVSGG+ +LFSP++F++NPLLWLQ MSK++ATHSA PNFAF
Sbjct  717   VSWLPQYHDMGLIGGIFTALVSGGTAVLFSPLSFIRNPLLWLQIMSKYQATHSAGPNFAF  776

Query  2638  ELLVRRLESSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAE  2817
             EL++RRLES K   +DLSSM FLM AAEP+RQ TLKRFVEL + FGLS+EVMAPGYGLAE
Sbjct  777   ELVIRRLESDKNRKYDLSSMKFLMVAAEPVRQKTLKRFVELARPFGLSQEVMAPGYGLAE  836

Query  2818  NCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWI  2997
             NCVFVSCAYGEG P+ VDWQGRVCCGY+  P  + VDI+I+ PE+G+E  + GKEGEIWI
Sbjct  837   NCVFVSCAYGEGKPIMVDWQGRVCCGYV-NPGDEDVDIRIVDPESGEELKEAGKEGEIWI  895

Query  2998  SSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAG  3177
             SS SAGIGYWG EELSQ T+ N +   PG+ Y RTGDLGRIID KLFITGR KDLIIVAG
Sbjct  896   SSPSAGIGYWGREELSQNTYRNKLPDYPGRIYTRTGDLGRIIDRKLFITGRIKDLIIVAG  955

Query  3178  KNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGK  3357
             +NIY++D+EKTVES++E+VRPGCCAV+ +P ++L  KGI     +D++GLVVIAEVRDG+
Sbjct  956   RNIYSADVEKTVESAAEVVRPGCCAVIAVPMEILSMKGISVPDNADQVGLVVIAEVRDGE  1015

Query  3358  PLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVIEE  3537
             P+  DV++ I  RVAEEHGV +AS+  I+P++ISKTTSGKIKR+EC ++F  GTL+V+ E
Sbjct  1016  PVGKDVVEQIQARVAEEHGVIVASVKMIRPKTISKTTSGKIKRFECLQQFTDGTLNVVPE  1075

Query  3538  QMNGERSLPRN-------DGI--------IVPANGKISKTDIVNFLKDLLSQQTGIPVSK  3672
              +   + L R+       +G           P + KIS  DIV+FLK L+S+QTGI ++K
Sbjct  1076  PILINKKLMRSFTTGTCKEGTPRPQFVRGSPPPSPKISNKDIVDFLKRLVSEQTGISINK  1135

Query  3673  ISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEKNHPM  3852
             IS  E+LVSYG++SIGVVRAAQK+S F G+ +GA+DIF+ATCI DLA F E+L+  + P 
Sbjct  1136  ISNTESLVSYGIDSIGVVRAAQKLSDFLGVPVGAVDIFTATCIADLASFSENLVMNSQPQ  1195

Query  3853  LTNS--------SETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPAYISVSMF  4008
             L+ +        +ET+  S+ +   +     + IW   L+AL YV+ +L IPAY+SVS F
Sbjct  1196  LSTTPSNVPQLETETETDSAELVMELPESQHLVIWSFQLLALVYVAFMLSIPAYLSVSAF  1255

Query  4009  KPLILANQS-----PWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPEIS  4173
                + A  +     P+  Y I L  AP +W+LCIF TC+    LGN+ L+PNY LNPE+S
Sbjct  1256  MKCVSATHALVEGIPYLDYLILLTFAPLAWILCIFSTCVSIAFLGNSFLKPNYALNPEVS  1315

Query  4174  VWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDPLL  4353
             +WSV+FVKWWALYKA E++SKVLA HLRGT+FL YWF++LGA+I SS  +DTVDITDP L
Sbjct  1316  IWSVDFVKWWALYKAHEVASKVLAEHLRGTMFLKYWFEMLGARIGSSVFLDTVDITDPSL  1375

Query  4354  VSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLAQN  4533
             VSI + +VI+EGALIQSHEVKNGVLSF  +RIG+ SS+GPYA++QKG+I+G+  EV+A  
Sbjct  1376  VSIGDGAVIAEGALIQSHEVKNGVLSFLPIRIGQNSSVGPYAIVQKGTILGEDLEVMALQ  1435

Query  4534  KKAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLNSLSAAIAYLVWIWL  4713
             K      +K  N     V       +      V+Q  GIY++G L +LSA+I YLV+IW+
Sbjct  1436  KSGGKSAAKATNLQNVSVLS-----SETEDGVVYQFIGIYIVGLLGTLSASIVYLVYIWM  1490

Query  4714  LQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHGLILSV  4893
              QKP S   F F C+ GAFHW PY +I +  MF+++P+  +  +  +A  Y A+G++LS 
Sbjct  1491  SQKPLSPQEFAFACLFGAFHWMPYTVIAYATMFSNVPLGIIYSSISMAVAYLAYGVVLSF  1550

Query  4894  FTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWMGAKIGQH  5073
              T  L   +S            W+ HR+ +ACH RFAKLLSGTE FC+Y+  +GAK+G+H
Sbjct  1551  LTAALTRLISSNQGKKTTHFRMWLCHRITIACHHRFAKLLSGTEAFCMYMRLLGAKVGKH  1610

Query  5074  CSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQGLILP  5253
             CSIRAINP+ +P L+S+  GVHLGDFSRI+ GY+++ G +SG++++ +NSV+GS+ ++LP
Sbjct  1611  CSIRAINPISDPKLISLGSGVHLGDFSRIIAGYYSSHGLVSGKVEVHDNSVVGSESVVLP  1670

Query  5254  GSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMDPKYKKVLG  5433
             GS ++KDVILGALSVAP+NSVL+  G ++GS+  +M++N    L+DRIEEMD KYKK++G
Sbjct  1671  GSVLQKDVILGALSVAPVNSVLQAGGVYIGSQAPMMIKNTMHSLEDRIEEMDMKYKKIVG  1730

Query  5434  SLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYPVIIRHSNCL  5613
             +LAANLAA+TLK+KSRYFHRIG +GKG+L++Y+ + GLPDHKIF  G +YPVI+RHSN L
Sbjct  1731  NLAANLAATTLKVKSRYFHRIGVSGKGTLKIYDNIKGLPDHKIFCQGKSYPVIVRHSNSL  1790

Query  5614  SSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFATWLVCGAAA  5793
             S+DDDAR+D RGAAIRI     +  ++ + L DLTLKTGKAF+ARTI DFATWLVCG  A
Sbjct  1791  SADDDARIDARGAAIRI----LSDESSESSLFDLTLKTGKAFYARTIADFATWLVCGLPA  1846

Query  5794  REEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKLRPFDEKIG  5973
             REE+VK APH+RDA+W SLR  NSY ELHYYSNICRLFRF+DGQEMYV+FKLRP DE I 
Sbjct  1847  REEYVKRAPHVRDAVWTSLRHANSYAELHYYSNICRLFRFEDGQEMYVKFKLRPSDENIS  1906

Query  5974  EEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQIQPIPDD  6153
             EE G+VEP GILPP+TGAIPR +ND RPLLFLA+DF+ RV++ + VRY+ QLQ++P+P D
Sbjct  1907  EEAGKVEPIGILPPDTGAIPRSDNDTRPLLFLAKDFQSRVNA-EGVRYIFQLQVRPVPRD  1965

Query  6154  ERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEIDVIRATSC  6333
             E  R+  LDCTKPW E E PYI+VGE+ I+  L+ ++SE+L+FNPF RC E+DVIRA+SC
Sbjct  1966  EAARDIALDCTKPWSESEFPYIDVGEVNINHNLSAEQSEQLDFNPFLRCPEVDVIRASSC  2025

Query  6334  NQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAKLENKDMPKA  6513
             +QSASIDHGRSL+YEICQ+LRN  PLPEAW+IFL+QSDVK+DLSGCP+AA L  KD  K 
Sbjct  2026  SQSASIDHGRSLIYEICQHLRNGAPLPEAWKIFLEQSDVKVDLSGCPMAASLMKKDAQKV  2085

Query  6514  TLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQWLLPLWWGG  6693
             TL R  +  LW    QP LQ VLP+FLL LVIYAPLN   + +   +I   WL PL+W  
Sbjct  2086  TLERTLFQALWATFAQPLLQTVLPHFLLALVIYAPLNWTLHMNNTQKIALHWLFPLFWVS  2145

Query  6694  SGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYFMETATGTFLM  6873
             SG+LAGL C ++KW+LVGKK +G+T  IWS G+F+DT WQA RT+ G YF E  +G+   
Sbjct  2146  SGLLAGLACIVAKWLLVGKKKEGETVHIWSIGVFLDTTWQAFRTLVGSYFAEMTSGSIFF  2205

Query  6874  GIWMRLMGSEVARD-GVYIDSMGATLNPDMVRIEEYGSVGREALLFGHIYEGG-GEVKYG  7047
              +WM+LMGSE+  D G Y+DSMGA LNP+MV IE  G VGREALLFGHIYEG  G+VK+G
Sbjct  2206  VLWMKLMGSEIELDQGAYVDSMGALLNPEMVEIERGGCVGREALLFGHIYEGDEGKVKFG  2265

Query  7048  RISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             +ISV  GGFVGSRA+AMPG  ++ GGSL ALSLAM
Sbjct  2266  KISVGEGGFVGSRAIAMPGVRVEVGGSLSALSLAM  2300



>ref|XP_008243597.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103341819 
[Prunus mume]
Length=2300

 Score =  2917 bits (7563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1431/2316 (62%), Positives = 1790/2316 (77%), Gaps = 57/2316 (2%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+ G  ++D F +LHPC+P  TRIGIVGAGPSGLSAAYAL+KLGYSNV VLEK+H+ GGM
Sbjct  1     MDPGKSIEDQFSRLHPCLPMNTRIGIVGAGPSGLSAAYALVKLGYSNVTVLEKYHTVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRV  660
             CES++I+G  YDLGGQVLAANSAP IFHLAKE G+E+EEMD+HKLAL+D+    Y D++V
Sbjct  61    CESVEIEGNIYDLGGQVLAANSAPVIFHLAKETGSELEEMDSHKLALIDNTTGEYQDIKV  120

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             A+DY+SVI +TL+LQD+  ++ RIGV++VSE ASD+TP +L+  G KSVPKSVAYGYTAS
Sbjct  121   ADDYVSVISLTLELQDKAASSGRIGVHAVSEYASDLTPVYLERHGFKSVPKSVAYGYTAS  180

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYG+IQDMPYAYIHEF RTSMAGKIRRFKGGYTS+WKK+SE++P    CNTEVL I+R+S
Sbjct  181   GYGYIQDMPYAYIHEFTRTSMAGKIRRFKGGYTSLWKKISESLP-TVHCNTEVLEIRRHS  239

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
               V VDV+  NG ++ MEFDKIIISG+FP  NGRTYRS     A    + M+M  +EK+L
Sbjct  240   DCVSVDVKSCNGEVKVMEFDKIIISGSFPLKNGRTYRSLPSHPAEHESEVMEMGDVEKEL  299

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             FSKVQTI+YYT+VL+I G+EH+PMGFYYF+ ++ +PA IG+PVAMQ+F+ DT++FLFWSY
Sbjct  300   FSKVQTIDYYTTVLKIKGIEHMPMGFYYFDEYISNPATIGHPVAMQRFFADTDIFLFWSY  359

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GNS++I G  V +LA  A   +GG+VK+V+LQR FKYFPHV  Q+M DGFYEKLE+QLQ 
Sbjct  360   GNSVNITGPTVTKLAIDAAKLIGGEVKEVVLQRRFKYFPHVGSQEMMDGFYEKLESQLQS  419

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
               NTYYVGGLMAFELTERN+SY+M L+ KHFAND  +P FPY K LF L+    G + K 
Sbjct  420   FKNTYYVGGLMAFELTERNSSYAMGLVCKHFANDNSMPNFPYAKSLFALQQQWGG-SPKS  478

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             + E+PGV+FP L SLD YL+HWG   V +NK LYTW++E+G+V+ +RTY E+H NA  IA
Sbjct  479   MAELPGVEFPNLPSLDGYLKHWGAHRVIQNKLLYTWISEEGEVVSQRTYAELHANASCIA  538

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
             Q LLT +KP IKPGD+VLL++VPGLDFVDAFFGCLRA+V+P+P +PPDP QRGG QALL 
Sbjct  539   QMLLTCRKPVIKPGDRVLLVHVPGLDFVDAFFGCLRAKVLPVPVLPPDPLQRGG-QALLK  597

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNM--LFGKSKDKSSNSWPDLPWLHTDSWVkk  2274
             I NIAK C  VAILST SYH  V+  S KNM  L GK++ KS   WP+LPWLHTDSW+K 
Sbjct  598   IENIAKSCGAVAILSTISYHWAVQAGSVKNMISLTGKNQ-KSKARWPNLPWLHTDSWIKN  656

Query  2275  pklfkkp-kDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRT  2451
              K        ++ +P  +D+CFLQFTSGST D KGVMITHGG+IHNVKLMRKRYKSTS+T
Sbjct  657   SKNVVVDGIADEFEPQGDDVCFLQFTSGSTGDAKGVMITHGGLIHNVKLMRKRYKSTSKT  716

Query  2452  ILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNF  2631
             +LVSWLPQYHDMGLIGGL T LVSGG+ ILFSP+TF++NPLLWLQ MSK++ATHSA PNF
Sbjct  717   VLVSWLPQYHDMGLIGGLFTALVSGGTAILFSPLTFIRNPLLWLQIMSKYQATHSAGPNF  776

Query  2632  AFELLVRRLESSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGL  2811
             AFEL+VRRLES K+  FDLSS+              +KRFVELT  FGLS+EVMAPGYGL
Sbjct  777   AFELVVRRLESDKKRKFDLSSI-------------XVKRFVELTHPFGLSQEVMAPGYGL  823

Query  2812  AENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEI  2991
             AENCVFVSCAYGEG P+ VDWQGRVCCGY+  P+ + V+I+I+ PE+G+E  + GKEGEI
Sbjct  824   AENCVFVSCAYGEGKPIMVDWQGRVCCGYV-NPDDEDVNIRIVDPESGEELKEAGKEGEI  882

Query  2992  WISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIV  3171
             WISS SAGIGYWG EELSQKT+ N +   PG+ Y RTGDLGR+ID KLFITGR KDLIIV
Sbjct  883   WISSPSAGIGYWGREELSQKTYRNKLPDHPGRNYTRTGDLGRVIDRKLFITGRIKDLIIV  942

Query  3172  AGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRD  3351
             AG+NIY++D+EKTVES+SELVRPGCCAV+ +P ++L +KGI    +SD++GLVVIAEVRD
Sbjct  943   AGRNIYSADVEKTVESASELVRPGCCAVIPVPVEILSTKGITVSDSSDQVGLVVIAEVRD  1002

Query  3352  GKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVI  3531
             GKP+  DV++ I  RVAEEHGV +AS+  I+P++ISKTTSGKIKR+EC ++F  GTL+V+
Sbjct  1003  GKPVGKDVVEQIQARVAEEHGVSVASVKIIRPKTISKTTSGKIKRFECLQQFTDGTLNVV  1062

Query  3532  EEQMNGERSLPRN-------DGII---------VPANGKISKTDIVNFLKDLLSQQTGIP  3663
              E +  +R L R+       +GI           P + K+S  +IV+FLK L+S+QTGI 
Sbjct  1063  PEPIITQRRLLRSFTTGTCKEGITPRPQLVRSSPPPSPKLSNKEIVDFLKRLVSEQTGIS  1122

Query  3664  VSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEKN  3843
             ++KIS  E+LVSYG++SIGVVRAAQK+S F G+ +GA+DIF+ATCI DLA F E+L+  +
Sbjct  1123  INKISNTESLVSYGIDSIGVVRAAQKLSDFLGVPVGAVDIFTATCIADLASFSENLVMNS  1182

Query  3844  HP-MLTNSSETKISSSGIPSV-----VSTFDKITIWLIHLVALAYVSLLLIIPAYISVSM  4005
              P +LT  S      +GI S      +     + I L  L+AL YV+L+L IPAY+SVS 
Sbjct  1183  QPQLLTTPSNVPQPDTGIDSAELVMEIPETHHLVISLFQLLALIYVALMLSIPAYLSVSA  1242

Query  4006  FKPLILANQS-----PWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPEI  4170
             F   + A  +     P+  Y   L  AP +W+ CI  TC+    LGN+ L+PNY LNPE+
Sbjct  1243  FMSCVSATHTLVEGIPYLDYLTLLTFAPLAWIFCILSTCVSIAFLGNSFLKPNYALNPEV  1302

Query  4171  SVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDPL  4350
             S+WS++FVKWWALYKA E++SKV+A HLRGTVFL YWF++LGA+I S  L+DTVDITDP 
Sbjct  1303  SIWSMDFVKWWALYKAHEVASKVMAEHLRGTVFLKYWFEMLGARIGSLVLLDTVDITDPS  1362

Query  4351  LVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLAQ  4530
             LVSI + +VI+EGALIQSHEVKNGVLSF  +RIG+ SS+GPY+V+QKG+I+G+  EV+A 
Sbjct  1363  LVSIGDGAVIAEGALIQSHEVKNGVLSFLPIRIGQNSSVGPYSVVQKGTILGEEDEVMAL  1422

Query  4531  NKKAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLNSLSAAIAYLVWIW  4710
              K  +    K  N   GK+   +         +++Q  GIY++G L +LSA++ YLV+IW
Sbjct  1423  QKCGSKSAVKAKNLQNGKMLSNVTMETQ--DEAIYQFIGIYIVGLLGTLSASVVYLVYIW  1480

Query  4711  LLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHGLILS  4890
             + QKP S   F F CI GAFHW PY II +  MF+ +P + +  +  +A  Y ++GL+LS
Sbjct  1481  MSQKPLSPQEFAFSCIFGAFHWMPYTIIAYAIMFSDVPSNIIYLSISIAVAYLSYGLVLS  1540

Query  4891  VFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWMGAKIGQ  5070
               T  L HF+S K +        W+ HR+ +ACH+RFAKLLSGTE FC+YL  +GAK+G+
Sbjct  1541  FLTSALTHFISSKQEKKTSHFRTWLCHRITIACHLRFAKLLSGTEAFCMYLRLLGAKVGK  1600

Query  5071  HCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQGLIL  5250
             HCSIRAINP+ +P L+S+  GVHLGDFSRI+ G+++  G+ISG+I++++NSV+GS+ ++L
Sbjct  1601  HCSIRAINPISDPKLISLGSGVHLGDFSRIIAGFYSFNGFISGKIEVQDNSVVGSESVVL  1660

Query  5251  PGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMDPKYKKVL  5430
             PGS I++DVILGALSVAP+NSVL+  G ++GS+  +M++N    LDDRIEEMD KYKK++
Sbjct  1661  PGSVIQQDVILGALSVAPVNSVLQAGGVYIGSQTPIMIKNTMHSLDDRIEEMDIKYKKIV  1720

Query  5431  GSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYPVIIRHSNC  5610
             G+LAANLAA+TLK+KSRYFHRIG +GKG L++Y+ + GLPDHKIF PG +YPVIIRHSN 
Sbjct  1721  GNLAANLAATTLKVKSRYFHRIGVSGKGYLKIYDNIKGLPDHKIFCPGKSYPVIIRHSNS  1780

Query  5611  LSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFATWLVCGAA  5790
             LS+DDDAR+D RGAAIRIL  E    T  + L DLTLKTGKAF+ARTI DFATWLVCG A
Sbjct  1781  LSADDDARIDARGAAIRILSDE----TNNSALFDLTLKTGKAFYARTIADFATWLVCGLA  1836

Query  5791  AREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKLRPFDEKI  5970
             AREE+VK APH+RDA+W SLR  NSY ELHYYSNICRLFRF DGQEMYV+FKLRP DE I
Sbjct  1837  AREEYVKRAPHVRDAVWTSLRHANSYAELHYYSNICRLFRFTDGQEMYVKFKLRPSDENI  1896

Query  5971  GEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQIQPIPD  6150
              EE G+VEP GILPP+TGAIPRD+ D RPLLFLA+DFK RV+    VRYV QLQ++P+P 
Sbjct  1897  SEEAGKVEPIGILPPDTGAIPRDDKDTRPLLFLAKDFKSRVNDQGGVRYVFQLQVRPVPH  1956

Query  6151  DERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEIDVIRATS  6330
             DE  R+  LDCTKPW++ E PYI+VGEI I+Q+L+ +ESE+L+FNPF +C+E+ VIRA+S
Sbjct  1957  DESARDIALDCTKPWNDAEFPYIDVGEININQMLSAEESEQLDFNPFLQCHEVGVIRASS  2016

Query  6331  CNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAKLENKDMPK  6510
             C+QSASIDHGRSL+YEICQ+LRN +PLPEAW+IFL QSDVK+DLSGCP+AA L+  D  K
Sbjct  2017  CSQSASIDHGRSLIYEICQHLRNGEPLPEAWKIFLQQSDVKVDLSGCPMAAALKINDTHK  2076

Query  6511  ATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQWLLPLWWG  6690
              TL R  + TLW    QP LQ VLP+FLLGLVIYAPLN   Y  +  ++    L PL+W 
Sbjct  2077  VTLERALFQTLWATFAQPLLQTVLPHFLLGLVIYAPLNWTLYLKDAQKLPLHLLFPLFWV  2136

Query  6691  GSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYFMETATGTFL  6870
              SG LAGL C ++KW+LVGKK +G+   IWS G+F+DT WQA RT+ G YFME  +G+  
Sbjct  2137  SSGCLAGLACVVAKWLLVGKKKEGEAVHIWSIGVFLDTTWQAFRTLVGSYFMEMTSGSIF  2196

Query  6871  MGIWMRLMGSEVARD-GVYIDSMGATLNPDMVRIEEYGSVGREALLFGHIYEGG-GEVKY  7044
               +WM+LMGSE+  D G Y+DSMGA LNP+MV IE  G VGR+ALLFGHIYEG  G+VK+
Sbjct  2197  FVLWMKLMGSEIELDQGAYVDSMGALLNPEMVEIERGGCVGRDALLFGHIYEGDEGKVKF  2256

Query  7045  GRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             G+IS+  GGFVGSRA+AMPG  ++SGG L ALSLAM
Sbjct  2257  GKISIGEGGFVGSRAIAMPGVRVESGGYLSALSLAM  2292



>ref|XP_002513447.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48850.1| conserved hypothetical protein [Ricinus communis]
Length=2278

 Score =  2913 bits (7552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1416/2315 (61%), Positives = 1775/2315 (77%), Gaps = 77/2315 (3%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M++ V ++D   KLHPC+P  T+IGIVG GPSG+SAAYAL +LGY+NV VLEKHH+ GGM
Sbjct  1     MDTAVSIEDQLSKLHPCLPVNTKIGIVGGGPSGISAAYALTRLGYTNVTVLEKHHTVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRV  660
             CES+ I+                            E+EEMD+HKLAL+DS    Y D+ V
Sbjct  61    CESVVIEEAE------------------------LELEEMDSHKLALIDSSTGKYEDINV  96

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
              +DY+SV+ +TL+LQD+ K + +IG++++S+ ASD+TP +L+ +GLKSVPKSVAYGYTAS
Sbjct  97    KDDYVSVMSLTLELQDKAKDSGQIGIHAISKFASDLTPTYLECRGLKSVPKSVAYGYTAS  156

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYG  QDMPYAYIHEF RTSMAGK+RRFKGGYTS+W+K++EA+PI+  CNTEVL+++R S
Sbjct  157   GYGLPQDMPYAYIHEFTRTSMAGKLRRFKGGYTSLWQKVAEALPIEVHCNTEVLAVRRKS  216

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
              G  VD+++  G ++ MEFDKIIISGAFPF +G+TYRS + ++     + MD+  LE +L
Sbjct  217   DGASVDIKNSRGEVKEMEFDKIIISGAFPFKDGKTYRSATAESKEPENEIMDLGDLEGEL  276

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             FSKV+TI+YYT+VL+  GLE +PMGFYYF  +M+DPA  G PVAMQKFY DT++FLFWSY
Sbjct  277   FSKVRTIDYYTTVLKTKGLEDMPMGFYYFGEYMDDPATTGRPVAMQKFYADTDIFLFWSY  336

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GN++DI G  V +LA K V  MG +V+KVILQR F+YFPHV+ QD+KDGFYE+LE++LQG
Sbjct  337   GNAVDITGPTVTDLAIKVVKNMGAEVEKVILQRRFRYFPHVSSQDVKDGFYERLESELQG  396

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
               NTYYVGGLMAFELTERNASY+MAL+ KHFAN   +P FPYVK               +
Sbjct  397   LRNTYYVGGLMAFELTERNASYAMALMCKHFANYNSLPMFPYVK---------------E  441

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             L E+PGV+FP+LS+L +YL+HW    VT+NKTLYTW+NE+G  + +RTY EV  NA  I+
Sbjct  442   LGELPGVEFPDLSNLAAYLKHWAMHKVTQNKTLYTWINEEGAAVCQRTYAEVLANASCIS  501

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
              KLLTSQKPA+KPGD+VLLI+VPGLDFVDAFFGCL A+VIP+P +PPDP QRGG QALL 
Sbjct  502   HKLLTSQKPAVKPGDRVLLIHVPGLDFVDAFFGCLIAKVIPVPVLPPDPLQRGG-QALLK  560

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKD-KSSNSWPDLPWLHTDSWVkkp  2277
             I NIAK CN VAILST  YH  VR    KN++    K+ KSS  WPDLPW+HTDSW+K  
Sbjct  561   IENIAKCCNAVAILSTTRYHSAVRAGFVKNLISLTGKNGKSSARWPDLPWIHTDSWIKNS  620

Query  2278  klfk-kpkDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTI  2454
                  +  D Q +P  +DLCFLQFTSGST D KGV+I+H G+IHNVKLMR+RYKSTS+T+
Sbjct  621   TDVLPRKMDYQSEPQPDDLCFLQFTSGSTGDAKGVIISHSGLIHNVKLMRRRYKSTSKTV  680

Query  2455  LVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFA  2634
             LVSWLPQYHDMGL+GGL T LVSGGS ILFSP+TF+KNPLLWLQTMSK+RATHSA PNFA
Sbjct  681   LVSWLPQYHDMGLVGGLFTALVSGGSAILFSPLTFIKNPLLWLQTMSKYRATHSAGPNFA  740

Query  2635  FELLVRRLESSKEE--NFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYG  2808
             FEL++RRLES +E+  N+DLSSM FLM AAEP+RQ TLKRF+ELT+ FGL +EVMAPGYG
Sbjct  741   FELVIRRLESDREKVRNYDLSSMVFLMVAAEPVRQKTLKRFIELTRPFGLYQEVMAPGYG  800

Query  2809  LAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGE  2988
             LAENCVFVSCA+GEG P+ +DWQGRVCCGY    + D VDI+I+ PE G+E ++PGKEGE
Sbjct  801   LAENCVFVSCAFGEGKPILIDWQGRVCCGYANPADAD-VDIRIVDPENGEEFEEPGKEGE  859

Query  2989  IWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLII  3168
             IWISS SAG+GYWG EE SQKTF N + + PG+ Y RTGDLGRIID KLFITGR KDLII
Sbjct  860   IWISSASAGVGYWGREEHSQKTFRNVLQNHPGRIYTRTGDLGRIIDEKLFITGRIKDLII  919

Query  3169  VAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVR  3348
             VAG+NIY++D+EKTVES+SEL+RPGCCAVVG PE+VL SKGIL    SD++GLVVIAEVR
Sbjct  920   VAGRNIYSADVEKTVESASELLRPGCCAVVGAPEEVLSSKGILVPDGSDQVGLVVIAEVR  979

Query  3349  DGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDV  3528
             DGKP+  DV+++I  RV EEHGVP+A +  IKPR+ISKTTSGKIKR+EC K+F  GTL+V
Sbjct  980   DGKPVDKDVVENIKNRVTEEHGVPVACVKLIKPRTISKTTSGKIKRFECLKQFTEGTLNV  1039

Query  3529  IEEQMNGERSL--------------PRNDGIIVP-ANGKISKTDIVNFLKDLLSQQTGIP  3663
             + + +  +R+               PR   +  P    K+   +I+ FLK ++S+QTGIP
Sbjct  1040  VPDPIFSKRTFVRSFSSGTCKEGRTPRPQLLSSPIQKSKLGNREIIEFLKGIVSEQTGIP  1099

Query  3664  VSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEKN  3843
                IST E+L SYG++SIGVVRAAQK+S F G+ IGA+DIF+ATCI DLA F E+L+ K+
Sbjct  1100  AGNISTIESLTSYGIDSIGVVRAAQKLSDFLGVPIGAVDIFTATCIADLASFSENLVMKS  1159

Query  3844  HPMLTNSS----ETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPAYISVSMFK  4011
              P L +S     +  + S+ + + +S   +I IW+  L+AL Y+S++L +PAY+SVS F 
Sbjct  1160  QPHLIDSESHLPQLDMDSADLMTEISRAHQIYIWIFQLLALIYISIMLSLPAYLSVSAFT  1219

Query  4012  PLILANQSP-----WFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPEISV  4176
              LI A+ +      W  Y ISLA AP +W+LCI  TCI    LGN+ L+PNY L P+ S+
Sbjct  1220  SLISASHTSADKVHWSAYLISLASAPLAWVLCIVSTCISIAFLGNSFLRPNYALTPKTSI  1279

Query  4177  WSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDPLLV  4356
             WS +FVKWWALYKAQEISSKV A HLRGT FLNYWF++LGA+I SS L+DTV ITDP LV
Sbjct  1280  WSTDFVKWWALYKAQEISSKVFAEHLRGTPFLNYWFEVLGARIGSSVLLDTVAITDPSLV  1339

Query  4357  SIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLAQNK  4536
             SI +  VI+EGALIQ HEVKNG+LSF+ ++I + SS+GPYAV+QKGS++G+G  V    K
Sbjct  1340  SIGDGVVIAEGALIQGHEVKNGILSFNPIKIARNSSVGPYAVVQKGSVIGEGVHVPPLQK  1399

Query  4537  KAAAKIS-KPLNGHKGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLNSLSAAIAYLVWIWL  4713
               A KI+ K     KG V +      +G   +++   GIYM+G L+++SAAI YL +IWL
Sbjct  1400  YEADKITFKSSKVQKGAVHQNPDMSQNG---AIYHFMGIYMVGLLSTVSAAIIYLFFIWL  1456

Query  4714  LQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHGLILSV  4893
              Q+P SL +F F+CI+GAFHW P  II +  MF ++ ++ + FA  VA  Y AHG+ILS 
Sbjct  1457  SQRPASLQYFSFLCISGAFHWVPLTIIAYATMFVTVALNPIDFAISVAIAYLAHGVILSF  1516

Query  4894  FTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWMGAKIGQH  5073
              T  L HF+S K +  +   + W+ HR+ +ACHIRFAKLLSGTE FC+YL  +GAK+G+H
Sbjct  1517  LTCTLTHFLSEKQEKKQFHLKTWLRHRITIACHIRFAKLLSGTEAFCIYLRLLGAKVGKH  1576

Query  5074  CSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQGLILP  5253
             CSIRAINPV +P  +++  GVHLGDFSRI+ G++++ G+  G+I+++ NSV+GSQ L+LP
Sbjct  1577  CSIRAINPVSDPESITIGAGVHLGDFSRIIAGFYSSSGFTRGKIEVQNNSVVGSQSLVLP  1636

Query  5254  GSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMDPKYKKVLG  5433
             GS ++KDVILGALSVAP+NSVL+  G ++GS+  VM++N    LDDRIEEMD KY+K++G
Sbjct  1637  GSVLQKDVILGALSVAPMNSVLQSGGVYIGSQTPVMIKNTMHALDDRIEEMDVKYRKIVG  1696

Query  5434  SLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYPVIIRHSNCL  5613
             +LAANLAA+TLK+KSRYFHRIG +GKG L++YN + GLP+H IF  G  YP+++RHSN L
Sbjct  1697  NLAANLAATTLKVKSRYFHRIGVSGKGHLQMYNNIKGLPEHNIFKAGKRYPIVVRHSNSL  1756

Query  5614  SSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFATWLVCGAAA  5793
             S+DDDAR+D RGAAIR+L  E+    + + L       GKAF+ART+GDFATWLVCG  A
Sbjct  1757  SADDDARIDARGAAIRLLSDEKEIGASFSLLDITLKT-GKAFYARTVGDFATWLVCGLPA  1815

Query  5794  REEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKLRPFDEKIG  5973
             REE VK  PHIRDA+W SLR  +SY ELHYYSNICRLFRF DGQEMYV+FKLRP+D  I 
Sbjct  1816  REEFVKRVPHIRDAVWMSLRNSDSYAELHYYSNICRLFRFTDGQEMYVKFKLRPYDANIS  1875

Query  5974  EEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQIQPIPDD  6153
             E+ G+VEP  ILPPETGAIPRD+ D RPLLFLAEDF+ RVSSP  V Y+ QLQI+ +PDD
Sbjct  1876  EDSGKVEPTAILPPETGAIPRDDKDTRPLLFLAEDFQRRVSSPGGVCYIFQLQIRAVPDD  1935

Query  6154  ERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEIDVIRATSC  6333
             E +R+  LDCTKPWDE E PYI+VGEITIDQ LT +ESE LEFNP+ RC EIDVIRATSC
Sbjct  1936  EAIRDIALDCTKPWDETEFPYIDVGEITIDQNLTGEESERLEFNPYLRCPEIDVIRATSC  1995

Query  6334  NQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAKLENKDMPKA  6513
             +QSASIDHGRSL+YEICQ+LRN +PLPEAW++F++QSDV++DLSGCP+AA LE KD  K 
Sbjct  1996  SQSASIDHGRSLIYEICQHLRNGEPLPEAWKMFIEQSDVEVDLSGCPMAAVLEKKDSGKV  2055

Query  6514  TLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQWLLPLWWGG  6693
             TLAR WY T W + GQP LQ V PYFL+GLVI+APLN + +  E  +I   WLLPL+W  
Sbjct  2056  TLARTWYQTSWAILGQPLLQTVFPYFLMGLVIFAPLNLVLFLKESKKISLHWLLPLFWFS  2115

Query  6694  SGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYFMETATGTFLM  6873
             SGILA LVC ++KW+LVGKK +G+T  IWS+G+FMDTIWQA RT+ GEYF+E  +G+ L 
Sbjct  2116  SGILAALVCVVAKWILVGKKKEGETTLIWSKGVFMDTIWQAFRTIAGEYFIEMTSGSVLF  2175

Query  6874  GIWMRLMGSEVA-RDGVYIDSMGATLNPDMVRIEEYGSVGREALLFGHIYEG-GGEVKYG  7047
              +W++LMGS++    G YIDSMGA LNP+MV IE  G VG+EA+LFGHIYEG GG+VK+G
Sbjct  2176  NLWLKLMGSDINLHQGAYIDSMGAALNPEMVEIERGGCVGKEAILFGHIYEGEGGKVKFG  2235

Query  7048  RISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             +I V   GFVGSRA+AMPG  ++SGG+L ALSLAM
Sbjct  2236  KIRVGECGFVGSRAIAMPGVRVESGGNLSALSLAM  2270



>ref|XP_009790710.1| PREDICTED: uncharacterized protein LOC104238130 [Nicotiana sylvestris]
Length=2318

 Score =  2911 bits (7546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1424/2317 (61%), Positives = 1784/2317 (77%), Gaps = 41/2317 (2%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M++   ++D F K+HPC P  TRI IVGAGPSG+SAAYAL  LGY+NV V EKHHS GGM
Sbjct  1     MDAQKSIEDKFSKIHPCFPVNTRIAIVGAGPSGISAAYALCNLGYNNVTVFEKHHSVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRV  660
             CES+DI+G+ YDLGGQVLAANSAPTIFHLAKE G+E+ E+ +HKLAL+DS    Y D +V
Sbjct  61    CESVDIEGKIYDLGGQVLAANSAPTIFHLAKETGSELVELGSHKLALIDSQTGNYQDNKV  120

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             A+DY+SVI +TL+LQD+ K + RIGV++VS+IASD+TP FL+ +G K VPKSVAYGYTAS
Sbjct  121   ADDYVSVISLTLELQDKAKDSGRIGVHAVSDIASDMTPSFLESRGFKYVPKSVAYGYTAS  180

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF+QDMPYAYIHEF RTSMAGKIRRFK GYTS+WKK+SE++PI   C TEVLS++R++
Sbjct  181   GYGFVQDMPYAYIHEFTRTSMAGKIRRFKDGYTSLWKKVSESLPITVMCQTEVLSVRRDT  240

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
             SGV +DV+  +   Q+MEFDK+I+SGAFP+ NGRTYRSPS  +A    + +++S LEK+L
Sbjct  241   SGVKIDVKSSSADFQSMEFDKVILSGAFPYRNGRTYRSPSPISADPEYEVLELSELEKEL  300

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             FSKVQTI+YYT+VL+I GLEH+P+GFYYFE FM+DP  IGNPVAMQ+FY++TN+FLFWSY
Sbjct  301   FSKVQTIDYYTTVLKIKGLEHMPVGFYYFEEFMDDPETIGNPVAMQRFYSNTNIFLFWSY  360

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GNS +I GS V++LA  AV ++GG+V+ ++LQR FKYFPHVN QDMKD FY+K+E QLQG
Sbjct  361   GNSANIEGSTVLQLAIDAVKRIGGEVEMIVLQRRFKYFPHVNSQDMKDEFYDKIENQLQG  420

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
             Q NTYYVGGLMAFELTERN+SYSMALI KHFAN    P FPYVKRLFPL S         
Sbjct  421   QQNTYYVGGLMAFELTERNSSYSMALISKHFANPDTQPRFPYVKRLFPLLSDRLDKNPTA  480

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             L E   V+FPEL+SLD YL+ W T  +T  KTLY W++E+G V+++RTY+E++ NA  I+
Sbjct  481   LKEYQQVEFPELTSLDGYLKQWSTHNITRKKTLYKWISEEGQVVNQRTYEELNANASCIS  540

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
             QKLL+SQKP +K GD+VLL+YVPGLDFVDAFFGC+RA V+P+P +P DP QR GGQALL 
Sbjct  541   QKLLSSQKPNMKQGDRVLLVYVPGLDFVDAFFGCIRAGVLPVPVLPSDPMQR-GGQALLK  599

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSWVkkp  2277
             I NIAK C  VAILST  YH  VR  S K++L   +   K S  WP+LPW+HTDSWVK  
Sbjct  600   IENIAKSCIAVAILSTAGYHAAVRAGSVKSLLSLNRKNGKFSARWPNLPWIHTDSWVKNA  659

Query  2278  klfkkpkDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTIL  2457
             K      +++ +P  +++CFLQFTSGST D KGVMITHGG+IHNVKLMR+ YKSTS T+L
Sbjct  660   KEMHSNNNDRFEPQPDNVCFLQFTSGSTGDAKGVMITHGGLIHNVKLMRRVYKSTSNTVL  719

Query  2458  VSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAF  2637
             +SWLPQYHDMGLIGGL T LVSGGS ILFSP+TF++NPLLWL+TMSK++ATHSA PNFAF
Sbjct  720   ISWLPQYHDMGLIGGLFTALVSGGSAILFSPMTFIRNPLLWLETMSKYKATHSAGPNFAF  779

Query  2638  ELLVRRLESSKEE--NFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGL  2811
             EL+VRRLE++KE+   +DLS + FLM AAEP+RQ TLKRF+ELT+SFGLS+ VMAPGYGL
Sbjct  780   ELVVRRLEANKEKGWKYDLSPLKFLMVAAEPVRQKTLKRFIELTRSFGLSQRVMAPGYGL  839

Query  2812  AENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEI  2991
             AENCVFVSCAYGEG  + VDWQGRVCCGY  Q   D VDIKI+ PE+G+E+ + GKEGEI
Sbjct  840   AENCVFVSCAYGEGRSILVDWQGRVCCGYANQNEAD-VDIKIVDPESGEEHKEYGKEGEI  898

Query  2992  WISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIV  3171
             WISS SAG GYWG EEL++KTF N + +   K Y RTGDLGRII+  LFITGR KDLIIV
Sbjct  899   WISSPSAGTGYWGREELTEKTFRNKLGTHSEKVYTRTGDLGRIIEGNLFITGRIKDLIIV  958

Query  3172  AGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRD  3351
             AG+NIY SDIEKTVESSSEL+RPGCCAV+G+PE+ L SKG+     SD++GLVVIAEVRD
Sbjct  959   AGRNIYPSDIEKTVESSSELLRPGCCAVIGVPEETLSSKGVSVPDHSDQVGLVVIAEVRD  1018

Query  3352  GKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVI  3531
             GKP+  DV + I  RVAEEHGV +AS+  IKPR+ISKTTSGKIKR+EC K+F  GTLDV+
Sbjct  1019  GKPVSKDVAEEIKARVAEEHGVTLASVKLIKPRTISKTTSGKIKRFECLKQFSDGTLDVV  1078

Query  3532  EEQMNGERSLPRNDGIIVPANG----------------KISKTDIVNFLKDLLSQQTGIP  3663
              +Q++ +R L R+        G                +++K +IV FLK L+S+QTGI 
Sbjct  1079  PDQISSKRKLLRSFTTASCKEGNTPRPHLNRTSPSPTPRLNKIEIVEFLKRLISEQTGIC  1138

Query  3664  VSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEKN  3843
             +SKI+T E+LVSYG++SIGVVRAAQK+S F G+ +GAIDIF+ATCI+DLA F E L+ K+
Sbjct  1139  ISKITTTESLVSYGIDSIGVVRAAQKLSDFLGVQVGAIDIFTATCIEDLASFTEDLVRKS  1198

Query  3844  HPMLTNSSE-----TKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPAYISVSMF  4008
              P  T +       ++  S    +  S F +  I L+ L+AL Y   +L+IPAY S+S+F
Sbjct  1199  RPQDTENPSCFQDYSEDDSCNFLAEASPFRRFGIMLLQLLALVYAIFMLVIPAYSSMSVF  1258

Query  4009  KPLILA-----NQSPWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPEIS  4173
             K LIL      N  PW  Y ISL  APF+W+LCI  TCIC  +LGN +LQPNY L PE+S
Sbjct  1259  KKLILESPTLINSFPWAGYAISLIFAPFAWILCICTTCICIGILGNLVLQPNYSLTPEVS  1318

Query  4174  VWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDPLL  4353
             +WS++FVKWWALYKAQE++SKV+AVHLRGTVFL YWF+ILG+KI SS ++DTVDI+DP L
Sbjct  1319  IWSLDFVKWWALYKAQEMASKVMAVHLRGTVFLKYWFQILGSKIGSSVVLDTVDISDPAL  1378

Query  4354  VSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLAQN  4533
             VSI + +VI+EGALIQ HEVKNG+LSF   RIGK  S+GPYAVLQKGS++G+G E+ +  
Sbjct  1379  VSIGDGAVIAEGALIQGHEVKNGILSFFPARIGKNCSVGPYAVLQKGSVLGEGTEIASLQ  1438

Query  4534  KKAAAKISKPLNGHKGKVTRRIRKRNHGN-HNSVFQLFGIYMIGYLNSLSAAIAYLVWIW  4710
             K     +SK  +  K +    + K   G    +++ L GIY++G++++LS AI Y ++I 
Sbjct  1439  KTEGKAVSKSNSSKKVRNLTSLPKETEGGLSQAMYHLMGIYIVGFISALSGAILYFLYIL  1498

Query  4711  LLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHGLILS  4890
             L QK PSL HF  IC++GAFHW P+ II +  + ++   S + FA  VA  Y AHGL LS
Sbjct  1499  LAQKSPSLQHFSLICLSGAFHWLPFTIIAYMTIISTTSSSPIIFAISVATAYLAHGLTLS  1558

Query  4891  VFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWMGAKIGQ  5070
               T ++N+F+S+  D    +   W+ HR+N+A H+RFAKLLSGTE FC+YL  +GAK+G+
Sbjct  1559  FLTILVNNFLSKSTDD---SLRIWLKHRINIAGHLRFAKLLSGTEAFCMYLRTLGAKVGK  1615

Query  5071  HCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQGLIL  5250
             HCSIRAINPV +P L+ + DGVHLGDFSRI+ G++++ G+ SG +++++NSV+GSQ ++L
Sbjct  1616  HCSIRAINPVSDPKLIKLGDGVHLGDFSRIITGFYSSSGFTSGVVEVQDNSVVGSQSVVL  1675

Query  5251  PGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMDPKYKKVL  5430
             P S ++KDVILGALSVAP+NS+L   G +VGS+  VM++N    +D+RIEEMD KYKK++
Sbjct  1676  PKSLVQKDVILGALSVAPMNSILHSGGIYVGSQVPVMIKNTQHSMDERIEEMDTKYKKIV  1735

Query  5431  GSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYPVIIRHSNC  5610
             G+LAANLAA+TLK+K+RYFHRIG +GKG L++Y+ + G P+HKIF  G  +PVI+RHSN 
Sbjct  1736  GNLAANLAATTLKVKTRYFHRIGVSGKGVLKMYDNIKGFPEHKIFQSGKRFPVIVRHSNS  1795

Query  5611  LSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFATWLVCGAA  5790
             LS+DDDARLD RGAA+RIL    TT+    P+LDLTLKTGKAF+ARTI DFATWLVCG A
Sbjct  1796  LSADDDARLDARGAALRIL--SDTTSDDEKPILDLTLKTGKAFYARTISDFATWLVCGLA  1853

Query  5791  AREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKLRPFDEKI  5970
             AREEHVK  PH+RDA+W SLR  NS+TE+HYYSNICRLFRFKDGQEMYV+FKLRP DE I
Sbjct  1854  AREEHVKRVPHVRDAVWTSLRDSNSFTEMHYYSNICRLFRFKDGQEMYVKFKLRPCDENI  1913

Query  5971  GEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQIQPIPD  6150
              E+ G+VEP GILPPETGAIPR +ND RPLLFLA+DF+ RVSS   V Y+ QLQ +P+P 
Sbjct  1914  SEDSGKVEPIGILPPETGAIPRRDNDTRPLLFLADDFQKRVSSSGGVCYIFQLQFRPVPK  1973

Query  6151  DERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEIDVIRATS  6330
             DE  ++  LDCT+PWDE E PY++VGEI +DQ LT+++SE+LEFNPF RC+E+DVI+ATS
Sbjct  1974  DEATQDIALDCTRPWDEAEFPYVDVGEIIVDQNLTKEQSEKLEFNPFLRCHEVDVIKATS  2033

Query  6331  CNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAKLENKDMPK  6510
              +QSASIDHGRSL+YEICQ+LRN +PLPEAW+ F++QSDVK+DLSGCP+A+ L+ K   +
Sbjct  2034  ASQSASIDHGRSLIYEICQHLRNGEPLPEAWKNFIEQSDVKVDLSGCPIASSLQVKQETR  2093

Query  6511  --ATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQWLLPLW  6684
                 L+R WY T W    QP  Q  LPYF L   I+ PL+ L    + T     W  P +
Sbjct  2094  HEIALSRAWYQTSWSTFAQPLFQTFLPYFFLAYSIHGPLHWLLVLKQTTTQPLYWFFPFF  2153

Query  6685  WGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYFMETATGT  6864
             W  SG++A LVC L+K V   +K  G    IWS G+ ++TIWQA RT+  +YFME  TG+
Sbjct  2154  WISSGLIAALVCVLAKAVFTTRKKDGGKAHIWSIGLLLETIWQAFRTLVSDYFMEMTTGS  2213

Query  6865  FLMGIWMRLMGSEVA-RDGVYIDSMGATLNPDMVRIEEYGSVGREALLFGHIYEGGGEVK  7041
             FL  IWM+LMGSEV    GVY+DS+G  LNP+MV IE  G VG+EALLFGHIYEG G VK
Sbjct  2214  FLFVIWMKLMGSEVELSQGVYVDSVGTLLNPEMVEIERGGCVGKEALLFGHIYEGEGVVK  2273

Query  7042  YGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             +G++ +  G FVGSRAVAMPG  ++SG SL ALSLAM
Sbjct  2274  FGKVRIGEGSFVGSRAVAMPGVVVESGCSLNALSLAM  2310



>ref|XP_010317976.1| PREDICTED: uncharacterized protein LOC104646358 [Solanum lycopersicum]
Length=2319

 Score =  2910 bits (7543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1429/2315 (62%), Positives = 1788/2315 (77%), Gaps = 53/2315 (2%)
 Frame = +1

Query  322   VDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGMCESIDI  501
             ++D F K+HPC P  TRI IVGAGPSG+SAAYAL  LGY+NV V+EKHHS GGMCES+DI
Sbjct  12    IEDKFSKIHPCFPVNTRIAIVGAGPSGISAAYALCNLGYNNVTVIEKHHSVGGMCESVDI  71

Query  502   QGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRVAEDYIS  678
             +GR YDLGGQVLAANSAPTIFHLAKE G+E+ E+D+HKL L+DS    Y D +VA+DY+S
Sbjct  72    EGRVYDLGGQVLAANSAPTIFHLAKETGSELVELDSHKLGLIDSQTGNYQDNKVADDYVS  131

Query  679   VIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTASGYGFIQ  858
             VI +TL+LQD+ K + RIG+++VS++ASD+TP FL+ +G KS+PKSVAYGYTASGYGF+Q
Sbjct  132   VISLTLELQDKAKDSGRIGIHAVSDLASDMTPAFLESRGFKSIPKSVAYGYTASGYGFVQ  191

Query  859   DMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNSSGVCVD  1038
             DMPYAYIHEF RTSMAGKIRRFK GYTS+WKK+SE++PI     TEVLSI+RNS+GV +D
Sbjct  192   DMPYAYIHEFTRTSMAGKIRRFKDGYTSLWKKVSESLPITVMLQTEVLSIRRNSTGVEID  251

Query  1039  VRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDLFSKVQT  1218
             ++ R+  L++MEFDK+I+SGAFPF +GRTYRSPS  TA      + +S LEK+LFS+VQT
Sbjct  252   IKDRSSDLESMEFDKVILSGAFPFRSGRTYRSPSSITADPENGVLQLSELEKELFSQVQT  311

Query  1219  IEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSYGNSIDI  1398
             I+YYT+VL+I GLEH+P+GFYYFE FM+DPA IGNPVAMQ+FY+DTNVFLFWSYGNS ++
Sbjct  312   IDYYTTVLKIKGLEHIPVGFYYFEEFMDDPATIGNPVAMQRFYSDTNVFLFWSYGNSANV  371

Query  1399  LGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQGQLNTYY  1578
              GS V++LA  AV ++GG+V+ V+LQR FKYFPHVN QDMKDGFY+K+E +LQGQ NTYY
Sbjct  372   KGSTVLQLAVDAVKRIGGEVEMVVLQRRFKYFPHVNSQDMKDGFYDKIENKLQGQKNTYY  431

Query  1579  VGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQLDEIPG  1758
             VGGLMAFELTERN+SYSMALI KHFAN    P FPYVKRLFPL S       K L E   
Sbjct  432   VGGLMAFELTERNSSYSMALISKHFANTDPQPGFPYVKRLFPLLSDCSDKNPKALKESHQ  491

Query  1759  VKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTS  1938
             V+FPEL SLD YL++W    +T  KTLY W++E+G V++ RTY+E++ NA  IAQKLL+S
Sbjct  492   VEFPELYSLDGYLKYWSNHNITCKKTLYKWISEEGQVVNERTYEELNANASCIAQKLLSS  551

Query  1939  QKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIAK  2118
             +KP +K GD+VLL+YVPGLDF+DAFFGC RA V+P+P +P DP QR GGQALL I NIAK
Sbjct  552   RKPVMKQGDRVLLVYVPGLDFIDAFFGCFRAGVLPVPVLPSDPMQR-GGQALLKIENIAK  610

Query  2119  VCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSWVkkpklfkkp  2295
              CN VAILST  YH  VR  S KN++   +    SS  WP+L W+HTDSWVK  K     
Sbjct  611   SCNAVAILSTAGYHAAVRAGSVKNLISLNRKNGTSSGRWPNLLWIHTDSWVKNAKEMHSN  670

Query  2296  kDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQ  2475
              +++ +P  +++CFLQFTSGST D KGVMITHGG+IHNVKLMRK YKSTS T+L+SWLPQ
Sbjct  671   SNDKFEPQPDNVCFLQFTSGSTGDAKGVMITHGGLIHNVKLMRKVYKSTSNTVLISWLPQ  730

Query  2476  YHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRR  2655
             YHDMGLIGGL T LVSGGS +LFSP+TF++NPL+WL+TMSK++ATHSA PNFAFEL+VRR
Sbjct  731   YHDMGLIGGLFTALVSGGSAVLFSPMTFIRNPLMWLETMSKYKATHSAGPNFAFELVVRR  790

Query  2656  LESSKEEN--FDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVF  2829
             LE++KE+   +DLSS+ FLM AAEP+RQ TLK F+ELT+ FGLS+ VMAPGYGLAENCVF
Sbjct  791   LEANKEKQWKYDLSSLKFLMVAAEPVRQKTLKNFIELTRPFGLSQRVMAPGYGLAENCVF  850

Query  2830  VSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLS  3009
             VSC YGEG P+ VDWQGRV CGY  Q   D VDIKI+ PE+G+E+D+ G+EGEIWISS S
Sbjct  851   VSCGYGEGKPILVDWQGRVGCGYANQNEAD-VDIKIVDPESGEEHDESGREGEIWISSPS  909

Query  3010  AGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIY  3189
             AGIGYWG EEL++KTF+N + S   K Y RTGDLGRIID  LFITGR KDLIIVAG+NIY
Sbjct  910   AGIGYWGREELTEKTFKNKLGSHSEKVYTRTGDLGRIIDGNLFITGRIKDLIIVAGRNIY  969

Query  3190  TSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGKPLPY  3369
              SDIEKTVESSSE++RPGCCAV+G+PE+ L SKG+     SD++GLVVIAEVRDGKP+  
Sbjct  970   PSDIEKTVESSSEILRPGCCAVIGVPEETLYSKGVPVPDHSDQVGLVVIAEVRDGKPVSK  1029

Query  3370  DVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVIEEQMNG  3549
             DV + I  RVAEEHGV +AS+  IKP++ISKTTSGKIKR+EC K+FI GTLDV+ +Q++ 
Sbjct  1030  DVAEEIKARVAEEHGVTLASVKLIKPKTISKTTSGKIKRFECLKQFIDGTLDVVPDQISS  1089

Query  3550  ERSLPR-----------------NDGIIVPANGKISKTDIVNFLKDLLSQQTGIPVSKIS  3678
             +R L R                 N     P  G ++K +IV FLK L+S+QTGI +SKI+
Sbjct  1090  KRKLLRSFTTGSCREGNTPRSHLNTTSPSPTPG-LNKKEIVEFLKGLVSEQTGISISKIT  1148

Query  3679  TGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEKNHP---  3849
             T E+LVSYG++SIGVVR+AQK+S F G+ +GAIDIF+ATCI+DLA F E L+ K+ P   
Sbjct  1149  TTESLVSYGIDSIGVVRSAQKLSDFLGVQVGAIDIFTATCIEDLASFTEDLVIKSRPHDA  1208

Query  3850  ----MLTNSSETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPAYISVSMFKPL  4017
                  L + SE   S + +   VS   +  I L+ L+AL Y   +L++PAY S+S+FK L
Sbjct  1209  TNPSYLPDYSEDD-SCNLVAEEVSPSHRFGIILLQLLALVYAIFMLVLPAYSSISVFKNL  1267

Query  4018  ILANQS-----PWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPEISVWS  4182
             IL N +     PW  Y ISL  APF+W+LCI  TCIC   LGN +LQPNY L PE+S+WS
Sbjct  1268  ILTNPTLVISFPWVGYAISLIFAPFAWILCISTTCICIGTLGNLVLQPNYSLTPEVSIWS  1327

Query  4183  VEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDPLLVSI  4362
              +FVKWWALYKAQEISSKV+AVHLRGTVFL YWF++ GA+I  S ++DT+DI+DP LVSI
Sbjct  1328  FDFVKWWALYKAQEISSKVMAVHLRGTVFLKYWFQVFGARIGPSVVLDTIDISDPALVSI  1387

Query  4363  DEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLAQNKKA  4542
              + +VI+EGALIQ HEVKNG+LSF  VRIGK  S+GPYAVLQKGS++ +G EV +  K +
Sbjct  1388  GDGAVIAEGALIQGHEVKNGILSFHPVRIGKNCSVGPYAVLQKGSVLAEGTEVASLQKTS  1447

Query  4543  AAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLNSLSAAIAYLVWIWLLQK  4722
             ++K +      + KV     +  HG   +++ L GIY++G++++LS AI Y ++I L QK
Sbjct  1448  SSKSNS-----RKKVVEPANETEHGLITAMYHLMGIYIVGFISALSGAILYFLYILLAQK  1502

Query  4723  PPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHGLILSVFTF  4902
              PSLHHF  IC++GAFHW P+ II + A+ +S+  S + FA  VA  Y AHGL LS+ T 
Sbjct  1503  SPSLHHFSLICLSGAFHWLPFTIIAYMAIISSITSSPIIFAISVATVYLAHGLTLSILTI  1562

Query  4903  MLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWMGAKIGQHCSI  5082
              +N+F+ R  +TD   R  W+ HR+N+ACH+RFAKLLSGTE FC+YL  +GAK+G HCSI
Sbjct  1563  FVNNFLLR--NTDNSLR-IWLKHRINIACHLRFAKLLSGTEAFCMYLRLLGAKVGNHCSI  1619

Query  5083  RAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQGLILPGSF  5262
             RAIN V +P L+S+ +GVHLGDFSRIV G++++ GY SG +++++NSV+GSQ ++LP S 
Sbjct  1620  RAINAVCDPKLISLGEGVHLGDFSRIVTGFYSSSGYTSGIVEVQDNSVVGSQSVVLPRSL  1679

Query  5263  IEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMDPKYKKVLGSLA  5442
             I+++VILGALSVAP++SVL+  G +VGS++ VM++N    +D+RIE+MDPKYKK++G+LA
Sbjct  1680  IQENVILGALSVAPIDSVLQSGGVYVGSQSPVMIKNTRHAMDERIEDMDPKYKKIVGNLA  1739

Query  5443  ANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYPVIIRHSNCLSSD  5622
             ANLAA+TLK+K+RYFHRIG +GKG L++Y+ + G PDH IF     YPVI+RHSN LS+D
Sbjct  1740  ANLAATTLKVKTRYFHRIGVSGKGMLKIYDNIKGFPDHTIFVSSKQYPVIVRHSNSLSAD  1799

Query  5623  DDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFATWLVCGAAAREE  5802
             DDARLD RGAA+RIL  +   +    PLLDLTLKTG+AF+ARTI DFATWLVCG AAREE
Sbjct  1800  DDARLDARGAALRIL-SDHANSDDEKPLLDLTLKTGEAFYARTISDFATWLVCGLAAREE  1858

Query  5803  HVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKLRPFDEKIGEEY  5982
             HVK  PH+RDA+W SLR  NSYTE+HYYSNICRLFRF DGQEMYV+FKLRP DE IG++ 
Sbjct  1859  HVKRVPHVRDAVWTSLRDSNSYTEMHYYSNICRLFRFTDGQEMYVKFKLRPGDENIGKDS  1918

Query  5983  GEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQIQPIPDDERV  6162
             G+VEP GILPPETGAIPR +ND RPLLFL +DFK RVSS   VRY+ QLQ + +P DE  
Sbjct  1919  GKVEPIGILPPETGAIPRKDNDTRPLLFLVDDFKKRVSSQGGVRYIFQLQFRSVPKDEAT  1978

Query  6163  RETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEIDVIRATSCNQS  6342
             ++  LDCT+PWDE E PY++VGEI +DQ LT+K+SE+LEFNPF RC+EIDV++ATS +QS
Sbjct  1979  QDIALDCTRPWDEAEFPYVDVGEIVVDQNLTKKQSEQLEFNPFLRCHEIDVVKATSASQS  2038

Query  6343  ASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLA--AKLENKDMPKAT  6516
             ASIDHGRSL+YEICQ+LRN +PLPEAW+ F++QSDVK+DLSGCP+A   K E+    +  
Sbjct  2039  ASIDHGRSLIYEICQHLRNGEPLPEAWKNFIEQSDVKVDLSGCPIALQVKQESTHHQEVA  2098

Query  6517  LARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQWLLPLWWGGS  6696
             L+R WY T W    QP LQ  LPYFLL   I++PLN L  +   T  Q  W  P +W  S
Sbjct  2099  LSRTWYQTSWSTFAQPILQTFLPYFLLSYSIHSPLNWLICS--TTSHQLYWFFPFFWISS  2156

Query  6697  GILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYFMETATGTFLMG  6876
             G++A   C L+K V   +K  G    IWS+G+ M+T+WQA RT+  +YFME  TG+FL  
Sbjct  2157  GVIAAFTCVLAKLVFTTRKKDGGKSLIWSKGLLMETLWQAFRTLVSDYFMEMTTGSFLFV  2216

Query  6877  IWMRLMGSEVA---RDGVYIDSMGATLNPDMVRIEEYGSVGREALLFGHIYEGGGEVKYG  7047
             IWM+LMGS+V      GVY+DS G  LNP+M+ IE  G +G+EALLFGHIYEG GEVK+G
Sbjct  2217  IWMKLMGSQVELSHDQGVYVDSNGVLLNPEMIEIEGGGCIGKEALLFGHIYEGEGEVKFG  2276

Query  7048  RISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             ++ +  G FVGSRAVAMPG  ++SG  L ALSLAM
Sbjct  2277  KVRIGEGSFVGSRAVAMPGVVVESGCCLNALSLAM  2311



>ref|XP_009588290.1| PREDICTED: uncharacterized protein LOC104085877 [Nicotiana tomentosiformis]
Length=2311

 Score =  2908 bits (7538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1425/2316 (62%), Positives = 1791/2316 (77%), Gaps = 46/2316 (2%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M++   ++D F K+HPC P  TRI IVGAGPSG+SAAYAL  LGY+NV V+EKHHS GGM
Sbjct  1     MDAQKSIEDKFSKIHPCFPVNTRIAIVGAGPSGISAAYALSNLGYNNVIVIEKHHSVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRV  660
             CES+DI+G+ YDLGGQVLAANSAPTIFHLAKE G+E+ E+ +HKLAL+DS    Y D +V
Sbjct  61    CESVDIEGKIYDLGGQVLAANSAPTIFHLAKETGSELVELGSHKLALIDSQTGNYQDNKV  120

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             A+DY+SVI +TL+LQD+ K + RIGV++VS+IASD+TP FL+ +G KSVPKSVAYGYTAS
Sbjct  121   ADDYVSVISLTLELQDKAKDSGRIGVHAVSDIASDMTPSFLESRGFKSVPKSVAYGYTAS  180

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF+QDMPYAYIHEF RTSMAGKIRRFK GYTS+WKK+SE++PI   C TEVLS++R++
Sbjct  181   GYGFVQDMPYAYIHEFTRTSMAGKIRRFKDGYTSLWKKVSESLPITVMCQTEVLSVRRDT  240

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
             SGV + V++ +G  ++MEFDK+I+SGAFP+ NG+ YRSPS  +A    + +++S LEK+L
Sbjct  241   SGVKIGVKNSSGDFKSMEFDKVILSGAFPYRNGKIYRSPSSISADPENEVLELSELEKEL  300

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             FSKVQTI+YYT+VL+I GLEH+P+GFYYFE FM+DP  IGNPVAMQ+FY++TN+FLFWSY
Sbjct  301   FSKVQTIDYYTTVLKIKGLEHMPVGFYYFEEFMDDPETIGNPVAMQRFYSNTNIFLFWSY  360

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GN+ ++  S V++LA  AV ++GG+V+ ++LQR FKYFPHVN QDMK+GFY+K+E QLQG
Sbjct  361   GNAANVEVSTVLQLAIDAVKRIGGEVEMIVLQRRFKYFPHVNSQDMKEGFYDKIENQLQG  420

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
             Q NTYYV GLMAFELTERN+SYSM LI KHFAN    PTFPYVKRLFPL S         
Sbjct  421   QQNTYYVSGLMAFELTERNSSYSMDLISKHFANPDTQPTFPYVKRLFPLLSDRLDKNTTA  480

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             L E   V+FPEL+SLD YL+HW T  +T  KTLY W++E+G V+++RTY+E++ N+  I+
Sbjct  481   LKEYQQVEFPELTSLDGYLKHWSTHNITRKKTLYKWISEEGQVVNQRTYEELNANSSCIS  540

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
             QKLL+SQKP +K GD+VLL+YVPGLDFVDAFFGCLRA V+P+P +P DP QR GGQALL 
Sbjct  541   QKLLSSQKPNMKQGDRVLLVYVPGLDFVDAFFGCLRAGVLPVPVLPSDPMQR-GGQALLK  599

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSWVkkp  2277
             I NIAK CN VAILST  YH  VR  S K++L   +     S  WP+LPW+HTDSWVK  
Sbjct  600   IENIAKSCNAVAILSTAGYHAAVRAGSVKSLLSLNRKNGTCSARWPNLPWIHTDSWVKNS  659

Query  2278  klfkkpkDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTIL  2457
             K      +E  +P  +++CFLQFTSGST D KGVMITHGG+IHNVKLMR+ YKSTS T+L
Sbjct  660   KGMHSNNNESFEPRPDNVCFLQFTSGSTGDAKGVMITHGGLIHNVKLMRRVYKSTSNTVL  719

Query  2458  VSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAF  2637
             +SWLPQYHDMGLIGGL T LVSGGS ILFSP+TF++NPLLWL+TMSK++ATHSA PNFAF
Sbjct  720   ISWLPQYHDMGLIGGLFTALVSGGSAILFSPMTFIRNPLLWLETMSKYKATHSAGPNFAF  779

Query  2638  ELLVRRLESSKEE--NFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGL  2811
             EL++RRLE++KE+   +DLSS+ FLM AAEP+RQ TLKRF+ELT+ FGLS+ VMAPGYGL
Sbjct  780   ELVIRRLEANKEKEWKYDLSSLKFLMVAAEPVRQKTLKRFIELTRPFGLSQRVMAPGYGL  839

Query  2812  AENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEI  2991
             AENCVFVSCAYGEG P+ VDWQGRVCCGY  Q   D VDIKI+ PE+G+E+ + GKEGEI
Sbjct  840   AENCVFVSCAYGEGRPILVDWQGRVCCGYANQNEAD-VDIKIVDPESGEEHKESGKEGEI  898

Query  2992  WISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIV  3171
             WISS SAGIGYWG EEL++KTF N + +   K Y RTGDLGRII+  LFITGR KDLIIV
Sbjct  899   WISSPSAGIGYWGREELTEKTFRNKLGTRSKKVYTRTGDLGRIIEGNLFITGRIKDLIIV  958

Query  3172  AGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRD  3351
             AG+NIY SDIEKTVESSSEL+RPGCCAV+G+PE+ L SKG+     SD++GLVVIAE+RD
Sbjct  959   AGRNIYPSDIEKTVESSSELLRPGCCAVIGVPEETLSSKGVSVPDHSDQVGLVVIAELRD  1018

Query  3352  GKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVI  3531
             GKP+  DV + I  RVAEEHGV +AS+  IKPR+ISKTTSGKIKR+EC K+F  GTLDV+
Sbjct  1019  GKPVSKDVAEEIKARVAEEHGVTLASVKLIKPRTISKTTSGKIKRFECLKQFSDGTLDVV  1078

Query  3532  EEQMNGERSLPRN-------DG--------IIVPA-NGKISKTDIVNFLKDLLSQQTGIP  3663
              +Q++ +R L R+       +G        I  P+   +++K +IV FLK L+S+QTGI 
Sbjct  1079  PDQISSKRKLLRSFTTASCREGHTPRPHLNITSPSPTPRLNKIEIVEFLKRLISEQTGIS  1138

Query  3664  VSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEKN  3843
             +SKI+T E+LVSYG++SIGVVRAAQK+S F G+ +GAIDIF+ATCI+DLA F E L+ K+
Sbjct  1139  ISKITTTESLVSYGIDSIGVVRAAQKLSDFLGVQVGAIDIFTATCIEDLASFTEDLVRKS  1198

Query  3844  --HPMLTNSSETKIS---SSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPAYISVSMF  4008
               H     SS    S   S  + + VS+  +  I L+ L+AL Y   +L++PAY S+ +F
Sbjct  1199  RLHDTENPSSFQDYSEDDSCNLVAEVSSSRRFGIMLLQLLALVYAIFMLVLPAYSSIFVF  1258

Query  4009  KPLILA-----NQSPWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPEIS  4173
             K LILA     N  PW  Y ISL  AP +W+LCIF TC+C  +LGN +LQPNY L PE+S
Sbjct  1259  KTLILASPILMNSFPWVGYAISLMFAPSAWLLCIFTTCLCIGILGNLVLQPNYSLTPEVS  1318

Query  4174  VWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDPLL  4353
             +WS++FVKWWALYKAQE+SSKV+AVHLRGTVFL YWF++ GA+I SS ++DTVDI+DP L
Sbjct  1319  IWSLDFVKWWALYKAQEMSSKVMAVHLRGTVFLKYWFQVFGARIGSSVVLDTVDISDPAL  1378

Query  4354  VSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLAQN  4533
             VSI + +VI+EG LIQ HEVKNG+LSF  V+IGK  S+GPYAVLQKGS++G G EV +  
Sbjct  1379  VSIGDGAVIAEGVLIQGHEVKNGILSFLPVKIGKNCSVGPYAVLQKGSVLGGGTEVASLQ  1438

Query  4534  KKAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLNSLSAAIAYLVWIWL  4713
             K     +SK  +  K K T        G   +++ L GIY++G++++LS AI Y ++I L
Sbjct  1439  KTEGKAVSKSNSSKKTKETE------GGLSQAMYHLMGIYIVGFISALSGAILYFLYILL  1492

Query  4714  LQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHGLILSV  4893
              QK PSL HF  IC++GAFHW P+ II++  + ++   S + FA  VA  Y AHGLILS 
Sbjct  1493  AQKSPSLQHFSLICLSGAFHWLPFTIISYMTIISTTSSSPIIFAISVATAYLAHGLILSF  1552

Query  4894  FTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWMGAKIGQH  5073
              T  +N+F S+  D    +   W+ HR+N+ CH+RFAKLLSGTE FC+YL  +G KIG+H
Sbjct  1553  LTIFVNNFFSKSTDD---SLRIWLKHRINIVCHLRFAKLLSGTEAFCMYLRLLGGKIGKH  1609

Query  5074  CSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQGLILP  5253
             CSIRAIN V +P L+S+ DGVHLGDFSRI+ G++++ G+ SG +++++NSV+GSQ ++LP
Sbjct  1610  CSIRAINAVSDPKLISLGDGVHLGDFSRIITGFYSSSGFTSGVVEVQDNSVVGSQSVVLP  1669

Query  5254  GSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMDPKYKKVLG  5433
              S ++KDVILGALSVAP+N VL   G +VGS+  VM++N    +D+RIEEMD KYKK++G
Sbjct  1670  KSLVQKDVILGALSVAPMNFVLHSGGVYVGSQVPVMIKNTQHSMDERIEEMDTKYKKIVG  1729

Query  5434  SLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYPVIIRHSNCL  5613
             +LAANLAA+TLK+K+RYFHRIG +GKG L++Y+ + GLP+HKIF  G  +PVI+RHSN L
Sbjct  1730  NLAANLAATTLKVKTRYFHRIGVSGKGVLKMYDNIKGLPEHKIFRSGKHFPVIVRHSNSL  1789

Query  5614  SSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFATWLVCGAAA  5793
             S+DDDARLD RGAA+RIL    TT+     +LDLTLKTGKAF+ARTI DFATWLVCG AA
Sbjct  1790  SADDDARLDARGAALRIL--SDTTSDDGKTILDLTLKTGKAFYARTISDFATWLVCGLAA  1847

Query  5794  REEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKLRPFDEKIG  5973
             REEHVK  PH+RDA+W SLR  NS+TE+HYYSNICRLFRFKDGQEMYV+FKLRP DE I 
Sbjct  1848  REEHVKRVPHVRDAVWTSLRDSNSFTEMHYYSNICRLFRFKDGQEMYVKFKLRPCDENIT  1907

Query  5974  EEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQIQPIPDD  6153
             E+ G+VEP GILPPETGAIPR +ND RPLLFLA+DF+ RVSSP  +RY+ QLQ +P+P D
Sbjct  1908  EDSGKVEPIGILPPETGAIPRRDNDTRPLLFLADDFQKRVSSPGGIRYIFQLQFRPVPKD  1967

Query  6154  ERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEIDVIRATSC  6333
             E  ++  LDCT+PWDE E PY++VGEI IDQ L +++SE+LEFNPF RC+E+DV++ATS 
Sbjct  1968  EATQDIALDCTRPWDEAEFPYVDVGEIIIDQNLNKEQSEKLEFNPFLRCHEVDVVKATSA  2027

Query  6334  NQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAKLENKDMP--  6507
             +QSASIDHGRSL+YEICQ+LRN +PLPEAW+ F++QSDVK+DLSGCP+A+ L+ K     
Sbjct  2028  SQSASIDHGRSLIYEICQHLRNGEPLPEAWKNFIEQSDVKVDLSGCPIASSLQVKQETNH  2087

Query  6508  KATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQWLLPLWW  6687
             +  L+R W+ T W    QP LQ  LPYF L   I+ PLN L +  + T+    W  P +W
Sbjct  2088  EIALSRTWFQTSWSTFAQPLLQTFLPYFFLAYSIHGPLNWLMFLKQTTKQPLYWFFPFFW  2147

Query  6688  GGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYFMETATGTF  6867
               SG++A LVC L+K V   +K  G    IWS  + M+TIWQA RT+  +YFME  TG+F
Sbjct  2148  ISSGLIAALVCVLAKAVFTTRKKDGGKAHIWSTSLLMETIWQAFRTLVSDYFMEMTTGSF  2207

Query  6868  LMGIWMRLMGSEVA-RDGVYIDSMGATLNPDMVRIEEYGSVGREALLFGHIYEGGGEVKY  7044
             L  IWM+LMGSEV    GVY+DSMGA LNP+M+ IE  G VG+EALLFGHIYEG G VK+
Sbjct  2208  LFVIWMKLMGSEVEISQGVYVDSMGALLNPEMMEIERGGCVGKEALLFGHIYEGEGVVKF  2267

Query  7045  GRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             G++ +  G FVGSRAVAMPG  ++SG SL ALSLAM
Sbjct  2268  GKVRIGEGSFVGSRAVAMPGVVVESGCSLNALSLAM  2303



>ref|XP_010034281.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104423492 
[Eucalyptus grandis]
Length=2443

 Score =  2900 bits (7519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1420/2324 (61%), Positives = 1793/2324 (77%), Gaps = 58/2324 (2%)
 Frame = +1

Query  301   EMESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGG  480
             +M+    V+D F KLHPC+P  TRIGI+G GPSGLSAAYAL +LGYS++ V+EKH+S GG
Sbjct  132   KMDCRKSVEDQFSKLHPCLPLDTRIGIIGGGPSGLSAAYALARLGYSDITVIEKHNSVGG  191

Query  481   MCESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMR  657
             MCES++I+G  YDLGGQVLAANSAP IFHLAK  G E+EEMD HKLAL+DS  A Y D+ 
Sbjct  192   MCESVEIEGMVYDLGGQVLAANSAPVIFHLAKASGTELEEMDLHKLALIDSFTAEYYDIN  251

Query  658   VAEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTA  837
             V EDY+S++ +TL++QD+VK +NRIG+++VS+IASD+TP +L+  G+  VPKSV YGYTA
Sbjct  252   VVEDYMSLVSLTLEIQDKVKDSNRIGIHAVSDIASDLTPAYLEAHGINGVPKSVQYGYTA  311

Query  838   SGYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRN  1017
             SGYGF+QDMPYAY+HEF RTSMAGKIRR KGGY S+WKK+SE++ IK  CNT V ++ RN
Sbjct  312   SGYGFVQDMPYAYLHEFTRTSMAGKIRRMKGGYMSLWKKISESLTIKVCCNTVVQAVSRN  371

Query  1018  SSGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSP---SQKTAGLFCDKMDMSTL  1188
             SSGV VD+ + +G ++  EFDKIIISGAFPF + RTYRSP   ++   GL    +D+S L
Sbjct  372   SSGVNVDITNSSGEIEHKEFDKIIISGAFPFKHSRTYRSPPSSAEAETGL----LDVSDL  427

Query  1189  EKDLFSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFL  1368
             E++LFSKVQTI+YYT+VL+I GLE +P+GFYY   +M+DP+ IG+PVAMQ+FY DTN+FL
Sbjct  428   ERELFSKVQTIDYYTTVLKIKGLERIPVGFYYLGEYMDDPSTIGHPVAMQRFYADTNIFL  487

Query  1369  FWSYGNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLET  1548
             FWSYG+S++I GS V++LA + V +MGG+V+KVILQR FKYFPHV  +DMK+GFYE++E+
Sbjct  488   FWSYGDSVNIRGSNVIDLAIEVVKRMGGEVEKVILQRRFKYFPHVGSEDMKEGFYERVES  547

Query  1549  QLQGQLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGL  1728
             +LQG  NTYYVGGL AFELTERN+SY+MALI KHFA+   +PTFPYVK LF L+   E  
Sbjct  548   ELQGHRNTYYVGGLFAFELTERNSSYAMALICKHFASANSLPTFPYVKSLFTLQLDQEET  607

Query  1729  AFKQLDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNA  1908
             + + L E  GV FP L +LDSYL+HW    +T+NK+LY+W+NE+G V+ +RTY E+ +NA
Sbjct  608   SHRTLSEAHGVVFPNLPTLDSYLKHWAAQEITQNKSLYSWINEEGAVVCQRTYAELDSNA  667

Query  1909  FTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQ  2088
               IA KLLTSQKP IKPGD+VLL++VPGLDFVDAFFGCLRARV+P+P +PPDP QRGG Q
Sbjct  668   SCIAHKLLTSQKPTIKPGDRVLLVHVPGLDFVDAFFGCLRARVVPVPVLPPDPLQRGG-Q  726

Query  2089  ALLHIANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSW  2265
             AL+ I NIA +CN VAILST  YH  VR  S K+++ F   + KS+  WP+LPWLHTDSW
Sbjct  727   ALMKIENIANLCNAVAILSTVGYHAAVRAGSVKSLISFTGKRAKSTAQWPNLPWLHTDSW  786

Query  2266  VkkpklfkkpkDE-QGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKST  2442
             +K  K+        Q +   +DLCFLQFTSGST D KGVMIT+GG+IHNVKLMR+RY+ST
Sbjct  787   IKSSKVLPALNVAFQSESQLDDLCFLQFTSGSTGDAKGVMITNGGLIHNVKLMRRRYQST  846

Query  2443  SRTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAA  2622
             S T+LVSWLPQYHDMGLIGGL T +V GGS ILFSP+TF+KNPLLWLQ +S ++ATH+A 
Sbjct  847   SNTVLVSWLPQYHDMGLIGGLFTAMVCGGSAILFSPLTFIKNPLLWLQMISDYKATHTAG  906

Query  2623  PNFAFELLVRRLES--SKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMA  2796
             PNFAFEL++RRLE+  +K  N+DLSS+ F M AAEP+RQ TLK F+ELT+ FGLS+EVMA
Sbjct  907   PNFAFELVLRRLEADKAKAHNYDLSSLIFFMVAAEPVRQKTLKTFIELTRPFGLSQEVMA  966

Query  2797  PGYGLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPG  2976
             PGYGLAENCVFVSCAYG+  P+ VDWQGR+CCGY+ +P+   VDI+I+  + G E D+ G
Sbjct  967   PGYGLAENCVFVSCAYGKKKPILVDWQGRICCGYV-EPDDADVDIRIVDADAGLEVDEDG  1025

Query  2977  KEGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTK  3156
             KEGEIWISS SAGIGYWG EELSQKTF N +   PG++Y RTGDLGR+I   LFITGR K
Sbjct  1026  KEGEIWISSPSAGIGYWGKEELSQKTFRNMLQKYPGRKYTRTGDLGRVIQGNLFITGRIK  1085

Query  3157  DLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVI  3336
             DLIIVAG+NIY++D+EKTVESSSEL+RPGCCAV+ +PEDVL +KGI    ASDE+GLVVI
Sbjct  1086  DLIIVAGRNIYSADVEKTVESSSELLRPGCCAVISVPEDVLSAKGISLPDASDEVGLVVI  1145

Query  3337  AEVRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISG  3516
             AE++DGKP+  D+++ I +RVAEEHGV +AS+  I+PR+ISKTTSGKIKR+EC K+F+ G
Sbjct  1146  AELKDGKPVDKDIINQIESRVAEEHGVTVASVKLIRPRTISKTTSGKIKRFECLKQFVDG  1205

Query  3517  TLDVIEEQMNGERSLPRN-------DGII---------VPANGKISKTDIVNFLKDLLSQ  3648
             TL+ + + +  +R L R+       +G           +P + K+S  +IV FLK L+S+
Sbjct  1206  TLNTVPDPIVTKRLLTRSFTTGTCREGKTPRSHLAKSSLPPSPKLSNRNIVEFLKQLVSE  1265

Query  3649  QTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVES  3828
             QTGI +  IS  E+LVSYG++SIGVVRAAQK+S F G+ +GA+DIF+ATCI DLA+F E+
Sbjct  1266  QTGISIQNISATESLVSYGIDSIGVVRAAQKLSDFLGVPVGAVDIFTATCIADLANFTEN  1325

Query  3829  LLEKNHPML----TNSSETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPAYIS  3996
             LL K+ P L    +N SE +I ++     +S      IW   L+AL YVS +L+ PAY+S
Sbjct  1326  LLMKSQPHLVTTQSNHSEPEILTADFSLEISRLHPWLIWSFQLLALLYVSFILVFPAYLS  1385

Query  3997  VSMFKPLILANQS-----PWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLN  4161
             VS F+ L++A+Q      PW  Y   +  AP  W+LCI LT I     GN+ L+ NY L 
Sbjct  1386  VSTFQILVVASQKLINGLPWLHYTSVVLLAPLFWILCIALTSISIAFFGNSFLRLNYALT  1445

Query  4162  PEISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDIT  4341
             PE+SVWSV+FVKWWALYKAQE+SSKVLAVHLRGTVFL +WF++LGA+I SS L+DTVDIT
Sbjct  1446  PEVSVWSVDFVKWWALYKAQEVSSKVLAVHLRGTVFLKHWFEMLGARIGSSVLLDTVDIT  1505

Query  4342  DPLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEV  4521
             DP LVSI + +VI+EGAL+QSHEV+N VL F  +RIG+  S+GPYAV+QKGS++G+GAEV
Sbjct  1506  DPSLVSIGDGAVIAEGALLQSHEVRNSVLRFQPIRIGRNCSVGPYAVIQKGSVLGEGAEV  1565

Query  4522  LAQNK----KAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQLF-GIYMIGYLNSLSAA  4686
             LA  K    K+A K++K  N         I K + G+     Q F GIYM+G ++SLSAA
Sbjct  1566  LALQKSEGGKSALKMAKAEN---------ILKVSPGSLKETIQQFMGIYMVGLVSSLSAA  1616

Query  4687  IAYLVWIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGY  4866
               +L+++ L QK PSL    F+CI+GA HW P+ I  +  MFT+   +   FA  +A  Y
Sbjct  1617  AVFLLYMRLSQKVPSLEQLAFLCISGALHWIPFTIAAYATMFTNALPNPFEFAISLATAY  1676

Query  4867  TAHGLILSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLH  5046
              AHGL+LS+ T +  + ++ K    +   + W  HR+ VACH+RFAKLLSGTE FCVYL 
Sbjct  1677  FAHGLVLSLLTSIFTNLLASKEKKTQTHIKTWFGHRLTVACHLRFAKLLSGTEAFCVYLR  1736

Query  5047  WMGAKIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSV  5226
              +GAK+G++CSIR+INPV +P +VS+  GVHLGDFSRI+ G+++  GYI   + +++NSV
Sbjct  1737  LLGAKVGKYCSIRSINPVADPRMVSIGAGVHLGDFSRIITGFYSHSGYIQNNVHVKDNSV  1796

Query  5227  IGSQGLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEM  5406
             IGSQ LILPGS +EKDVILGA+SVAP+NSVL+  G ++GS++ VMV+N T  LDDRIEEM
Sbjct  1797  IGSQSLILPGSVVEKDVILGAISVAPVNSVLQSGGVYMGSQSPVMVKNTTHALDDRIEEM  1856

Query  5407  DPKYKKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYP  5586
             DP+Y K++G+LAANLA +TLK+KSRYFHRIG +GKG L+LY+ +  LP+H IFGPG  + 
Sbjct  1857  DPRYXKIVGNLAANLAVTTLKVKSRYFHRIGVSGKGYLKLYDDIQRLPEHNIFGPGKKFT  1916

Query  5587  VIIRHSNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFA  5766
             VI+RHSN LS+DDDARLD RGAA+RIL  E+   +    L   T   G AF+ARTI DFA
Sbjct  1917  VIVRHSNSLSADDDARLDARGAALRILSDEKGDDSPLLDLTLKT---GNAFYARTISDFA  1973

Query  5767  TWLVCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFK  5946
             TWLVCG AAREEH+K  PH+RDA+W SLR+ +SY +LHYYSNICRLFRFKDGQEMYV+FK
Sbjct  1974  TWLVCGLAAREEHIKRVPHVRDAVWTSLRQADSYADLHYYSNICRLFRFKDGQEMYVKFK  2033

Query  5947  LRPFDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQ  6126
             LRPFDE IGE+ G+VEP GILPPETGAIPRD ND RPLLFLAEDF+ RV SP+ VRY+ Q
Sbjct  2034  LRPFDENIGEDIGKVEPSGILPPETGAIPRDANDTRPLLFLAEDFQNRVKSPNGVRYIFQ  2093

Query  6127  LQIQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNE  6306
             LQ++PIP DE  R+  LDCTKPWDE + PYI+VGE+TI+++LT++ SE LEFNPF RC+E
Sbjct  2094  LQVRPIPQDEAARDIALDCTKPWDELQFPYIDVGEVTINEILTKEGSERLEFNPFLRCHE  2153

Query  6307  IDVIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAK  6486
             +DVIRATS +QSASIDHGRSLVYEICQ+LRN  PLPEAWR+FL+QSDVK+DLSGCP+AA 
Sbjct  2154  VDVIRATSSSQSASIDHGRSLVYEICQHLRNGDPLPEAWRVFLEQSDVKVDLSGCPMAAA  2213

Query  6487  LENKDMPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQ  6666
             LE KD  + TL+R  Y+T W +  QP LQ +LPYFLLGL+IY PLN L +      +   
Sbjct  2214  LERKDTEEVTLSRPRYLTTWAVFAQPLLQTILPYFLLGLIIYFPLNLLLHCKSTRNMPVL  2273

Query  6667  WLLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYFM  6846
             W  P +W  +GIL  L C  +K++LVGKK + +T  IWSRG+FMDT+WQAIRTV G+YF+
Sbjct  2274  WTFPFFWVSTGILTALACVAAKYILVGKKREDETVHIWSRGVFMDTVWQAIRTVFGDYFV  2333

Query  6847  ETATGTFLMGIWMRLMGSEVARD-GVYIDSMGATLNPDMVRIEEYGSVGREALLFGHIYE  7023
             E  +G+ L  +WM+LMGS +  D G Y+DSMGA LNP+MV +E  GSV +EALLFGH+Y+
Sbjct  2334  EMTSGSALFLMWMKLMGSYIELDKGTYVDSMGAALNPEMVEVEGGGSVEKEALLFGHVYD  2393

Query  7024  G-GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             G  G VK+G+I V  GGFVGSRAVAMPG  ++SGGSL ALSLAM
Sbjct  2394  GEDGVVKFGKIVVGEGGFVGSRAVAMPGVAVESGGSLSALSLAM  2437



>ref|XP_010031846.1| PREDICTED: uncharacterized protein LOC104421554 [Eucalyptus grandis]
Length=2313

 Score =  2890 bits (7492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1416/2323 (61%), Positives = 1791/2323 (77%), Gaps = 58/2323 (2%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+S   V+D F KLHPC+P  TRIG+VG GPSGLSAAYAL KLGY ++ V+EKH++ GGM
Sbjct  1     MDSQKSVEDQFSKLHPCLPLDTRIGVVGGGPSGLSAAYALAKLGYRDITVIEKHNTVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDS-DWAYTDMRV  660
             CES++I+G+ YDLGGQVLAANSAP IFHLAKE G ++EEMD HKLAL+DS    Y D+ V
Sbjct  61    CESVEIEGKVYDLGGQVLAANSAPVIFHLAKESGTQLEEMDLHKLALIDSLTGEYHDINV  120

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             AEDY+S++ +TL +QD+ K TNRIG+++VS+IASD+TP +L+  G+KSVPKSV YGYTAS
Sbjct  121   AEDYMSLVSLTLDIQDKAKDTNRIGIHAVSDIASDLTPAYLEAHGIKSVPKSVQYGYTAS  180

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF+QDMPYAYIHEF RTSMAGKIRR KGGY ++WKK+S+++ IK  CNTEV +++RN 
Sbjct  181   GYGFVQDMPYAYIHEFTRTSMAGKIRRMKGGYMNLWKKISDSLLIKVCCNTEVQAVRRNG  240

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPS---QKTAGLFCDKMDMSTLE  1191
             SGV VD+ + +G  +  EFDKIIISGAFPF N RTYRS S   +   GL    +D+S LE
Sbjct  241   SGVNVDITNSSGETEHKEFDKIIISGAFPFKNSRTYRSTSSSTEAETGL----LDVSDLE  296

Query  1192  KDLFSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLF  1371
             ++LFSKVQTI+YYT+VL+I GLE +P+GFYY   +MEDP+ IG+PVA+Q+FY D+N+FLF
Sbjct  297   RELFSKVQTIDYYTTVLKIKGLERIPVGFYYLGEYMEDPSTIGHPVAIQRFYADSNIFLF  356

Query  1372  WSYGNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQ  1551
             WSYG+S++I GS V++LA + V +MGGQV+KV LQR FKYFPHV+ +DMK+GFYE++E++
Sbjct  357   WSYGDSVNIRGSNVIDLAIEVVRRMGGQVEKVFLQRRFKYFPHVSSKDMKEGFYERIESE  416

Query  1552  LQGQLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLA  1731
             LQG  NTYYVGGL AFELTERN+SY+MALI KHFA+   +P  PYVK LF L+   E   
Sbjct  417   LQGHRNTYYVGGLFAFELTERNSSYAMALICKHFASANSLPALPYVKSLFTLQLDQEETG  476

Query  1732  FKQLDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAF  1911
              K L E  G+ FP+L +LDSYL+HW    +T+NKTLYTW+NE+G V+ +RTY E+ +NA 
Sbjct  477   LKTLSETHGIVFPDLPNLDSYLKHWAAKEITQNKTLYTWINEEGAVVCQRTYAELDSNAS  536

Query  1912  TIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQA  2091
              IA KLLTS+KP IKPGD+VLL++VPGLDFVD+FFGCLRA+V+P+P +PPDP QRGG QA
Sbjct  537   CIAHKLLTSRKPTIKPGDRVLLVHVPGLDFVDSFFGCLRAKVVPVPVLPPDPLQRGG-QA  595

Query  2092  LLHIANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSWV  2268
             L  I NIAK+CN VAILST  YH  VR  S KN++ F +   +S+  WP+LPWLHTDSW+
Sbjct  596   LTKIENIAKLCNAVAILSTVGYHSAVRAGSVKNLISFTRKSVESTAQWPNLPWLHTDSWI  655

Query  2269  kkpklf-kkpkDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTS  2445
             K  K+        Q +   +DLCFLQFTSGST D KGVMITHGG+IHNVKLMR+RY+STS
Sbjct  656   KSSKVLPASNIGSQSESQPDDLCFLQFTSGSTGDAKGVMITHGGLIHNVKLMRRRYRSTS  715

Query  2446  RTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAP  2625
              T+LVSWLPQYHDMGLIGGL T +V GG+ ILFSP+TF++NPLLWLQT+S ++ATHSA P
Sbjct  716   NTVLVSWLPQYHDMGLIGGLFTAMVCGGTAILFSPLTFIRNPLLWLQTISDYKATHSAGP  775

Query  2626  NFAFELLVRRLES--SKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAP  2799
             NFAFEL++RRLE+  +K  ++DLSSM F M AAEP+RQ TLKRFVELT+ +GLS+EVMAP
Sbjct  776   NFAFELVIRRLEADKAKAHDYDLSSMIFFMIAAEPVRQKTLKRFVELTRPYGLSQEVMAP  835

Query  2800  GYGLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGK  2979
             GYGLAENCVFV CAYG+  P+ VDWQGR+CCGY+  PN   VDI+I+  +TG E D+ GK
Sbjct  836   GYGLAENCVFVGCAYGKKKPILVDWQGRICCGYV-DPNDADVDIRIVDADTGLEVDEDGK  894

Query  2980  EGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKD  3159
             EGEIWISS SAGIGYWG EELSQKTF N +   PG++Y RTGDLGR+I   LFITGR KD
Sbjct  895   EGEIWISSPSAGIGYWGKEELSQKTFRNKLQKYPGRKYTRTGDLGRVIQGNLFITGRIKD  954

Query  3160  LIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIA  3339
             LIIVAG+NIY++D+EKTVESSSEL+RPGCCAV+ +PEDVL +KGI    ASDE+GLVVIA
Sbjct  955   LIIVAGRNIYSADVEKTVESSSELLRPGCCAVISVPEDVLSAKGISLPDASDEVGLVVIA  1014

Query  3340  EVRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGT  3519
             E++DGKP+  D++  I + VAEEHGV +AS+  I+PR+ISKTTSGKIKR+EC K+F+ GT
Sbjct  1015  ELKDGKPVDKDIIKQIESHVAEEHGVTVASVKLIRPRTISKTTSGKIKRFECLKQFVDGT  1074

Query  3520  LDVIEEQMNGERSLPRN-------DGII---------VPANGKISKTDIVNFLKDLLSQQ  3651
             L+ + + +  +R L R+       +G           +P + K+S  +IV FLK L+S+Q
Sbjct  1075  LNTVPDPIVTKRLLTRSFTTGTCREGNTPRSHLAKSSLPPSPKLSNRNIVEFLKQLVSEQ  1134

Query  3652  TGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESL  3831
              GI +  IS  E+LVSYG++SIGVVRAAQK+S F G+ +GA+DIF+ATCI DLA+F E+L
Sbjct  1135  MGISIQNISATESLVSYGIDSIGVVRAAQKLSDFLGVPVGAVDIFTATCIADLANFTENL  1194

Query  3832  LEKNHPML----TNSSETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPAYISV  3999
             L K+ P L    +N SE +I ++     +S      IW   L+AL YVS +L+ PAY+SV
Sbjct  1195  LMKSQPHLVTTQSNHSEPEILTADFSVEISRLHPWLIWSFQLLALLYVSFILVFPAYLSV  1254

Query  4000  SMFKPLILANQS-----PWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNP  4164
             S F+ L++A+Q      PW  +   +  AP  W+LCI LT I     GN+ L+ NY L P
Sbjct  1255  SAFQILVVASQKLIDGLPWLHHTSVVLLAPLFWILCIALTSISIAFFGNSFLRINYTLTP  1314

Query  4165  EISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITD  4344
             E+SVWSV+FVKWWALYKAQE+SSKVLAVHLRGTVFL +WF++LGA+I SS L+DTVDITD
Sbjct  1315  EVSVWSVDFVKWWALYKAQEVSSKVLAVHLRGTVFLKHWFEMLGARIGSSVLLDTVDITD  1374

Query  4345  PLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVL  4524
             P LVSI + +VI+EGAL+QSHEV+N +L F  +RIG+  S+GPYAV+QKGS++G+GAEVL
Sbjct  1375  PSLVSIGDGAVIAEGALLQSHEVRNSILRFQPIRIGRNCSVGPYAVIQKGSVLGEGAEVL  1434

Query  4525  AQNK----KAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQLF-GIYMIGYLNSLSAAI  4689
             +  K    K+A K++K  N         I K + G+     Q F GIYM+G ++SLSAA 
Sbjct  1435  SLQKSEGGKSALKMAKAEN---------ILKVSPGSLKETIQQFMGIYMVGLVSSLSAAA  1485

Query  4690  AYLVWIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYT  4869
              +L+++ L QK PSL    F+CI+GA HW P+ I+ +  MFT+   +   FA  +A  Y 
Sbjct  1486  VFLLYMRLSQKVPSLEQLAFLCISGALHWVPFTIVAYATMFTNTLPNPFEFAISLATAYF  1545

Query  4870  AHGLILSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHW  5049
             AHGL+LS+ T +  + ++ K    +   + W+ HR+ VACH+RFAKLLSGTE FC+YL  
Sbjct  1546  AHGLVLSLLTSIFTNLLASKEKKTQTHIKTWLGHRLAVACHLRFAKLLSGTEAFCMYLRL  1605

Query  5050  MGAKIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVI  5229
             +GAK+G++CSIR+INPV +P +VS+  GVHLGDFSRI+ G+++  GYI   + +++NSVI
Sbjct  1606  LGAKVGKYCSIRSINPVTDPRMVSIGAGVHLGDFSRIMTGFYSQSGYIQSNVHVKDNSVI  1665

Query  5230  GSQGLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMD  5409
             GSQ LILPGS +EKDVILGA+SVAP+NSVL+  G ++GS++ VMV+N T  +DDRIEEMD
Sbjct  1666  GSQSLILPGSVVEKDVILGAISVAPVNSVLQSGGVYMGSQSPVMVKNTTHAMDDRIEEMD  1725

Query  5410  PKYKKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYPV  5589
              +YK+++G+LAANLAA+TLK+KSRYFHRIG +GKG L+LY+ + GLP+H IFGPG  Y V
Sbjct  1726  SRYKRIVGNLAANLAATTLKVKSRYFHRIGVSGKGYLKLYDDIQGLPEHNIFGPGKKYTV  1785

Query  5590  IIRHSNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFAT  5769
             I+RHSN LS+DDDARLD RGAA+RIL  E+   +    L   T   GKAF+ARTI DFAT
Sbjct  1786  IVRHSNSLSADDDARLDARGAALRILSDEKGDDSPLLDLTLKT---GKAFYARTISDFAT  1842

Query  5770  WLVCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKL  5949
             WLVCG AAREEHVK  PH+RDA+W SLR+ +SY E+HYYSNICRLFRFKDGQEMYV+FKL
Sbjct  1843  WLVCGLAAREEHVKRVPHVRDAVWTSLRQADSYAEMHYYSNICRLFRFKDGQEMYVKFKL  1902

Query  5950  RPFDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQL  6129
             RP D+ IGE+ G+VEP GILPPETGAIPRD ND RPLLFLAEDF+ RV SP+ VRY+ QL
Sbjct  1903  RPSDKNIGEDTGKVEPSGILPPETGAIPRDANDTRPLLFLAEDFQNRVKSPNGVRYIFQL  1962

Query  6130  QIQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEI  6309
             Q+ P+P DE  R+  LDCTKPWDE + PYI+VGE+ I++ LT++ SE LEFNPF RC+E+
Sbjct  1963  QVMPVPQDEAARDIALDCTKPWDESQFPYIDVGEVIINENLTKEGSERLEFNPFLRCHEV  2022

Query  6310  DVIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAKL  6489
             DVIRATS +QSASIDHGRSLVYEICQ+LRN  PLPEAWR+FL+QSDVK+DLSGCP+AA L
Sbjct  2023  DVIRATSSSQSASIDHGRSLVYEICQHLRNGDPLPEAWRVFLEQSDVKVDLSGCPMAAAL  2082

Query  6490  ENKDMPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQW  6669
             + KD  K TL+R WY+T W +  QP LQ +LPYFLLGL+IY PLN L +      +   W
Sbjct  2083  QRKDTEKVTLSRPWYLTTWAVFAQPLLQTILPYFLLGLIIYFPLNLLLHCKNTRNMPVHW  2142

Query  6670  LLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYFME  6849
               P +W  +G+LA L C  +K++LVGKK + +T  IWSRG+FMDT+WQAIRTV G+YF+E
Sbjct  2143  TFPFFWVSTGVLAALACVAAKYILVGKKREEETVHIWSRGVFMDTVWQAIRTVFGDYFVE  2202

Query  6850  TATGTFLMGIWMRLMGSEVARD-GVYIDSMGATLNPDMVRIEEYGSVGREALLFGHIYEG  7026
               +G+ L  +WM+LMGS +  D G Y+DSMGA LNP+MV +E  GSV REALLFGH+Y+G
Sbjct  2203  MTSGSALFLMWMKLMGSYIELDKGTYVDSMGAALNPEMVEVEGGGSVEREALLFGHVYDG  2262

Query  7027  -GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
              GG VK+G+I V   GFVGSRAVAMPG  ++S GSL ALSLAM
Sbjct  2263  EGGVVKFGKIVVGERGFVGSRAVAMPGVVVESEGSLSALSLAM  2305



>gb|EYU46303.1| hypothetical protein MIMGU_mgv1a021307mg [Erythranthe guttata]
Length=2328

 Score =  2881 bits (7469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1407/2331 (60%), Positives = 1783/2331 (76%), Gaps = 62/2331 (3%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             ME+   ++D F KLHPC    TRI ++G GPSGLSAAYAL K+GY NV VLEK+H+  GM
Sbjct  1     METEKSIEDQFSKLHPCWSLNTRIAVLGGGPSGLSAAYALCKIGYGNVTVLEKYHTVSGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRV  660
             CES+DI+GR YDLGGQVLAA+S+PTIFHL+KE+G E+EEMD+HKLAL+DS    Y D++V
Sbjct  61    CESVDIEGRFYDLGGQVLAASSSPTIFHLSKEMGCEMEEMDSHKLALIDSKTGKYEDIKV  120

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             A+DY+SVI +TL++Q++ K + RIGV++VSE ASD+TPEFL+ +G+KSVPKSVAYGYTAS
Sbjct  121   ADDYVSVISLTLEIQEKAKNSGRIGVHAVSESASDLTPEFLEARGMKSVPKSVAYGYTAS  180

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF+QDMPYAYIHEF RTSMAGKIRRFKGGY S W+K+S+++P+K  CNT+V+SI+R S
Sbjct  181   GYGFVQDMPYAYIHEFTRTSMAGKIRRFKGGYMSFWQKISKSLPLKLLCNTQVVSIRRCS  240

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
             S V VDV          EFDK+I+SG+FPF +G+TYRSPS   A    + MD + LEK+L
Sbjct  241   SVVEVDVEINGSDRTTFEFDKMIVSGSFPFEHGKTYRSPSVTVAEPESEIMDFTELEKEL  300

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             F KVQTI+YYT+V++I G+EH+P+GFYYF  FM+DP  IGNPVAMQ+FY+DT+VFLFWSY
Sbjct  301   FDKVQTIDYYTTVMKIKGMEHMPVGFYYFGEFMDDPQTIGNPVAMQRFYSDTDVFLFWSY  360

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GN  DI G +V +LA  AV +MGG+V++ ILQR FKYFPHV  QD+KDGFY+K+ETQLQG
Sbjct  361   GNYADITGPQVTQLAIDAVKRMGGEVERTILQRRFKYFPHVQSQDIKDGFYDKIETQLQG  420

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
             Q NTYY+GGLMAFELTERN+SY+M+LIRKHFA+D  +P FPYVKRLF     S     ++
Sbjct  421   QNNTYYIGGLMAFELTERNSSYAMSLIRKHFASDDPLPKFPYVKRLFSGTPVSCDKMPRK  480

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             LDE  GV+FP+LSSLD YL+HWGT  V  +K LYTW+N+ G+V  RRTY E+H NA  IA
Sbjct  481   LDESEGVEFPDLSSLDCYLKHWGTHSVIRSKILYTWINDGGEVSSRRTYMELHANADIIA  540

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
             +KLL+++KP IKPGD+VLLI+VPGL+F+DAFFGCLRARV+P+P +PPDP QR GGQALL 
Sbjct  541   EKLLSNRKPVIKPGDRVLLIHVPGLEFIDAFFGCLRARVLPVPVLPPDPLQR-GGQALLK  599

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNM-----LFGKSKDKSSNSWPDLPWLHTDSW  2265
             I NIAK CN VAILST  YH  VR    KN+     L G++   +S  WPDLPWLHTDSW
Sbjct  600   IENIAKSCNAVAILSTVGYHSAVRAGFVKNLIQFSNLNGRNSSSTSARWPDLPWLHTDSW  659

Query  2266  Vkkpk-lfkkpkDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKST  2442
             +KK K            P  +DLCFLQFTSGST D KGVMITHGG+IHNVKLMR+RYKST
Sbjct  660   IKKSKGSSGTNIGGVTPPRGDDLCFLQFTSGSTGDAKGVMITHGGLIHNVKLMRRRYKST  719

Query  2443  SRTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAA  2622
             S T+LVSWLPQYHDMGLIGGL T LVSGG+ +LFSP+TF+KNPLLWL+ +S ++ THSA 
Sbjct  720   SNTVLVSWLPQYHDMGLIGGLFTALVSGGTAVLFSPMTFIKNPLLWLEIISNYKGTHSAG  779

Query  2623  PNFAFELLVRRLESSKEE--NFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMA  2796
             PNFAFEL++RRLE  K     +DLSSM FLM AAEP+RQ TLK+F+ELT   GLS  V+A
Sbjct  780   PNFAFELMIRRLELEKNRALKYDLSSMVFLMVAAEPVRQKTLKKFIELTSPHGLSEYVLA  839

Query  2797  PGYGLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPG  2976
             PGYGLAENCVFVSCAYGEG P+ VDWQGRV CGY+   + D VD++I+ P++G+E   P 
Sbjct  840   PGYGLAENCVFVSCAYGEGKPILVDWQGRVSCGYVDYADRD-VDVRIVDPQSGEERKYPE  898

Query  2977  KEGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTK  3156
              EGEIWISS S GIGYWG  ELS+ TF N   + PGK Y RTGDLGR+ID  LFITGR K
Sbjct  899   IEGEIWISSPSGGIGYWGRSELSETTFRNVFETRPGKMYTRTGDLGRVIDGNLFITGRIK  958

Query  3157  DLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVI  3336
             DLIIVAG+NIY++D+EKTVE SS+++RPGCCAV+G+PE++L +KGI    +SD +GLVVI
Sbjct  959   DLIIVAGRNIYSADVEKTVEGSSDILRPGCCAVIGVPEEILSTKGISVPESSDRVGLVVI  1018

Query  3337  AEVRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISG  3516
             AEV+DGKP   +V++ I   VAEEHGV +A++  IKPR+ISKTTSGKIKR+EC K+F  G
Sbjct  1019  AEVKDGKPANGEVVERIKATVAEEHGVGLAAVKLIKPRTISKTTSGKIKRFECLKQFTDG  1078

Query  3517  TLDVIEEQMNGERSLPRND-----------------GIIVPANGKISKTDIVNFLKDLLS  3645
             TL+++ + +  +R+L R++                  I+ P N K+S  +I ++LK L+S
Sbjct  1079  TLNLVPDPIIPKRTLFRSNTTGTCREGHTPRPQLKRNILTPTNTKLSYAEIEDYLKKLVS  1138

Query  3646  QQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVE  3825
             +QTG P SKIS+   L SYG++SIGVVRAAQK+S F G+ +GA+DIF+AT I+DLA F E
Sbjct  1139  EQTGFPYSKISSTANLTSYGIDSIGVVRAAQKLSDFLGVPVGAVDIFTATSIEDLATFSE  1198

Query  3826  SLLEKNHPMLTNSSETKISSSG-------IPSVVSTFDKITIWLIHLVALAYVSLLLIIP  3984
              L+ K+ P   +  + ++  S        +   VS+F K++  ++  +ALAYVS+LLI+P
Sbjct  1199  GLVMKSQPRNPSGDDQELDMSSQFETEVFLHQEVSSFHKLSTMVLQFLALAYVSVLLILP  1258

Query  3985  AYISVSMFKPLILAN------QSPWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQP  4146
             +Y+S+S++  LI +N       + +  Y ISLA  P SW+ C+  TC C  L GN+ LQP
Sbjct  1259  SYLSISLYAKLISSNFALMTTINGYAPYIISLAFTPLSWLFCMLSTCGCISLFGNSFLQP  1318

Query  4147  NYVLNPEISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALID  4326
             NY L P+ S+WS++++KWWALYKAQE+SSKVLAVHLRGTV LNYWF++ GAKI SS L+D
Sbjct  1319  NYALVPDTSIWSLDYIKWWALYKAQEVSSKVLAVHLRGTVLLNYWFRMFGAKIGSSVLLD  1378

Query  4327  TVDITDPLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVG  4506
             T+DITDP LVSI + SV++EGAL+QSHEVKNG+LSF  +RIGK SS+GPYAV+QKG+++ 
Sbjct  1379  TIDITDPALVSIGDGSVLAEGALVQSHEVKNGILSFRPIRIGKNSSVGPYAVIQKGTVLR  1438

Query  4507  DGAEVLAQNKKAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLNSLSAA  4686
             DG +V A       K  K  N HK       RK ++    +++ L G+Y++G+++S SAA
Sbjct  1439  DGTDVPALQVTEEGKHIKSNNTHK---IAEQRKESNETQTAIYHLMGVYVVGFVSSFSAA  1495

Query  4687  IAYLVWIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFT-SLPVSTLSFAGMVAAG  4863
             I Y ++I L Q  P + HF+F+CIAGAFHW P  I+ +  +   +L +S L+F+  VA  
Sbjct  1496  ILYFMYIQLSQMSPKIEHFMFLCIAGAFHWLPLTIVAYAIIVNGTLSLSPLTFSVYVATA  1555

Query  4864  YTAHGLILSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYL  5043
             Y+AHGLIL + T ++NH +S+  ++   TR+ W+ HR+ VACH+RF+KLLSGTE FC+YL
Sbjct  1556  YSAHGLILILLTSLINHSLSKNNESS--TRKTWLRHRIIVACHLRFSKLLSGTEAFCIYL  1613

Query  5044  HWMGAKIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENS  5223
               +GAK+G+HCS+RAINPV+EP LVS+ +GVHLGDFSRI+ G++++ G++ G +D++ENS
Sbjct  1614  RLLGAKVGRHCSVRAINPVLEPKLVSIGNGVHLGDFSRIITGFYSSDGFVKGEVDVQENS  1673

Query  5224  VIGSQGLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEE  5403
             VIGSQ ++LPG+ I+K+VILGALS AP+NSVL+  G ++GS+  VM++N T  LD+RIEE
Sbjct  1674  VIGSQSIVLPGATIQKEVILGALSAAPMNSVLQRGGVYIGSQTPVMIKNTTHELDERIEE  1733

Query  5404  MDPKYKKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATY  5583
             MD KYKK++G+LAANLAA+TLK+++RYFHR+G +GKG L++Y+ + GLPDH+IF  G TY
Sbjct  1734  MDMKYKKIVGNLAANLAATTLKVRTRYFHRVGVSGKGVLKMYDEIKGLPDHEIFRSGKTY  1793

Query  5584  PVIIRHSNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDF  5763
             PVIIRHSN LS+DDDAR+D RGAA+RI    +       PLLDLTLKTG AF+ARTI DF
Sbjct  1794  PVIIRHSNSLSADDDARIDARGAAVRIFSDSQ-----EVPLLDLTLKTGNAFYARTISDF  1848

Query  5764  ATWLVCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRF  5943
             ATWLVCG  AREEHVK APHIR+A+W SLR   ++TELHYYSNICRL RFKDG EMYV+F
Sbjct  1849  ATWLVCGLPAREEHVKRAPHIREAVWTSLRNAETFTELHYYSNICRLLRFKDGSEMYVKF  1908

Query  5944  KLRPFDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVL  6123
             KLRPFDE+I E+ G+VEP GILPPETGAIPRD NDKRP+ FLA+DF+ RVS PD VRYV 
Sbjct  1909  KLRPFDERITEDSGKVEPIGILPPETGAIPRDSNDKRPMQFLADDFQTRVSCPDGVRYVF  1968

Query  6124  QLQIQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCN  6303
             QLQ +P+P D   ++  LDCTKPWDE E P+++VGE+ I + LT++++E LEFNPF RC 
Sbjct  1969  QLQFRPVPRDVETQDEALDCTKPWDEVEFPFVDVGEVVISENLTKEQTENLEFNPFLRCE  2028

Query  6304  EIDVIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAA  6483
             E+DVIRA S +QSASIDHGRSL+YEICQ+LRN  PLPEAWR F++QSDVK+DLSGCP+AA
Sbjct  2029  EVDVIRARSASQSASIDHGRSLIYEICQHLRNNDPLPEAWRSFIEQSDVKVDLSGCPVAA  2088

Query  6484  KLENKDMPKA------TLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHE  6645
              + +K    +      TLAR WY T W +  QP LQ  LPYF+L  VI  PLN +  +  
Sbjct  2089  SMSHKRDSNSNSGEGVTLARTWYQTSWSILAQPLLQTFLPYFVLAYVISRPLNWVLVSAN  2148

Query  6646  MTQIQKQWLLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRT  6825
                +   W LPL+W  SG+ AG+ CA +KWVLVGKK  G T  +WSR +FMDTIWQA +T
Sbjct  2149  KYPL--HWTLPLFWVISGVWAGIACAAAKWVLVGKKKDGGTALMWSRSVFMDTIWQAFKT  2206

Query  6826  VTGEYFMETATGTFLMGIWMRLMGSEV-ARDGVYIDSMGATLNPDMVRIEEYGSVGREAL  7002
             + GEYFMET  G+ L   WM+LMGSE+    GVY+D+MGA LNP+MV IE  G VGREAL
Sbjct  2207  LVGEYFMETTMGSMLFAAWMKLMGSEIEVGGGVYVDTMGAILNPEMVEIERGGCVGREAL  2266

Query  7003  LFGHIYEG-GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             LFGHIYEG GG+VK+GRI+V  GGFVGSR VAMPG  +  GG LGALSLAM
Sbjct  2267  LFGHIYEGEGGKVKFGRITVGEGGFVGSRGVAMPGVVVADGGCLGALSLAM  2317



>emb|CBI16432.3| unnamed protein product [Vitis vinifera]
Length=2221

 Score =  2877 bits (7458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1418/2301 (62%), Positives = 1766/2301 (77%), Gaps = 106/2301 (5%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+S   ++D F KLHP +P +TRIGIVG GPSGLSAAYAL KLGYSNV VLEK+ + GGM
Sbjct  1     MDSRKSIEDQFSKLHPSLPVSTRIGIVGGGPSGLSAAYALAKLGYSNVTVLEKYQTVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRV  660
             CES +I+                        E+G+E+EEMD+HKL L+DS    + D++V
Sbjct  61    CESAEIE------------------------EIGSELEEMDSHKLTLIDSSTGKHKDIKV  96

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             A+DY+SVI +TL+LQD+ K + RIGV++VSEIASD+TPEFL+ +G KSVPKSVA GYTAS
Sbjct  97    ADDYVSVISLTLELQDKAKDSGRIGVHAVSEIASDLTPEFLEARGFKSVPKSVACGYTAS  156

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF+QDMPYAYIHEF RTSMAGKIRRFKGGY + WKKLSE +PI+  CNTEVL+++R+S
Sbjct  157   GYGFVQDMPYAYIHEFTRTSMAGKIRRFKGGYMNFWKKLSEMLPIEVRCNTEVLAVRRSS  216

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
             +GV VDV++ NG ++ +EFD+IIISG+FPF NG+TYR+P   +A      MDM+ LEK L
Sbjct  217   AGVSVDVKNSNGEVEVIEFDEIIISGSFPFKNGKTYRAPPSSSAEPETGVMDMNELEKKL  276

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             FSKVQTI+YYT+VL+I GLEH+P+GFYYFE FM+DPA IG+PVAMQ+FY +T+VFLFWSY
Sbjct  277   FSKVQTIDYYTTVLKIKGLEHIPVGFYYFEEFMDDPATIGHPVAMQRFYNNTDVFLFWSY  336

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GNS+DI G  V ELA      MGG++++V+LQR FKYFPH++ QDMK+GFYEK+E++LQG
Sbjct  337   GNSVDIKGPTVTELAINTAKNMGGEIEEVVLQRRFKYFPHISSQDMKEGFYEKVESELQG  396

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
               NTYYVGGLMAFELTERNASY++AL+ KHFAND   PTFPYVKRLFPL+S   G   K 
Sbjct  397   MRNTYYVGGLMAFELTERNASYAVALVCKHFANDTPSPTFPYVKRLFPLQSDGWGGNPKI  456

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             LDE PGVKFP+++SLD YL+HWGT  V +NKTLYTW+NE+G V+ +RTY+E+H NA  IA
Sbjct  457   LDEFPGVKFPDIASLDGYLKHWGTHEVIQNKTLYTWINEEGVVVSQRTYRELHANASCIA  516

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
               LL +QKP  KPGD+VLL+Y+PGLDF+DAFFGCLRA+++P+P +PPDP QR GGQALL 
Sbjct  517   HNLLLNQKPLFKPGDRVLLVYIPGLDFIDAFFGCLRAKLLPVPVLPPDPLQR-GGQALLK  575

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPDLPWLHTDSWVkkpk  2280
             I NIAK CN +AILST  YH                       WP+LPWLHTDSW+K  +
Sbjct  576   IENIAKSCNALAILSTIRYHAA--------------------RWPNLPWLHTDSWIKYSR  615

Query  2281  lfkkp-kDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTIL  2457
                +    +Q +P  +DLCFLQFTSGST D KGVMITHGG+IHNVKLMR+RYKSTS+T+L
Sbjct  616   NLLQEDIADQSEPQPDDLCFLQFTSGSTGDAKGVMITHGGLIHNVKLMRRRYKSTSKTVL  675

Query  2458  VSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAF  2637
             VSWLPQYHDMGLIGGL + LVSGGS +LFSP++F+KNPLLWLQTMSK++ATHSA PNFAF
Sbjct  676   VSWLPQYHDMGLIGGLFSALVSGGSAVLFSPMSFIKNPLLWLQTMSKFQATHSAGPNFAF  735

Query  2638  ELLVRRLESSKE--ENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGL  2811
             EL+VRRLES K+   N++LSSM FLM AAEP+RQ TLKRFV+LT  FGL  EV+APGYGL
Sbjct  736   ELVVRRLESGKDTVHNYNLSSMIFLMVAAEPVRQNTLKRFVKLTSPFGLCEEVLAPGYGL  795

Query  2812  AENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEI  2991
             AENCVFVSCAYGEG P+ VDWQ RVCCGY+   N D VDI+++ PETG+E ++ GKEGEI
Sbjct  796   AENCVFVSCAYGEGKPILVDWQERVCCGYVDTENAD-VDIRVVDPETGEEQEEVGKEGEI  854

Query  2992  WISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIV  3171
             WISS SAG+GYWG EELS KTF N++ + PG+RY RTGDLGRIID KLFITGR KDLIIV
Sbjct  855   WISSPSAGVGYWGREELSGKTFRNELQNHPGRRYTRTGDLGRIIDGKLFITGRIKDLIIV  914

Query  3172  AGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRD  3351
             AG+NIY +D+EKTVESSSEL+RPGCCA                              VRD
Sbjct  915   AGRNIYAADVEKTVESSSELLRPGCCA------------------------------VRD  944

Query  3352  GKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVI  3531
             GK +  DV++ I   VAEEHGV +ASI  IKP++ISKTTSGKIKR++C ++F  GTL ++
Sbjct  945   GKHVGKDVIEQIQAHVAEEHGVTVASIKLIKPKTISKTTSGKIKRFDCIRQFSDGTLSLV  1004

Query  3532  EEQMNGERSLPRNDGIIVPANGKISKTDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVN  3711
              E +     L +        N ++SK DIV FLK L+S+QTGIP+  I   E+L SYG++
Sbjct  1005  PEPI-----LSKKLNKYPLTNPRLSKEDIVEFLKGLVSEQTGIPIKNIFASESLSSYGID  1059

Query  3712  SIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEKNH------PMLTNSSET  3873
             SIGVVRAAQK+S F G+ +GA+D+F+ATCI DLA+F E+L+ K+H      P      ET
Sbjct  1060  SIGVVRAAQKLSDFLGVPVGAVDMFTATCIADLANFSENLVRKSHHQYMTAPSYVPEPET  1119

Query  3874  KISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPAYISVSMFKPLI-----LANQSP  4038
              +S   +   ++   K+ IW   L+AL Y+S+LLIIPAY+SVS F  L+     L + + 
Sbjct  1120  DLSE--LVMEIAPSHKLGIWFFQLLALIYISVLLIIPAYLSVSAFISLLSTCCNLIDGTS  1177

Query  4039  WFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPEISVWSVEFVKWWALYKA  4218
             W  Y ISLA AP +W+LCIF TCIC   LGN+ LQPNY L PEIS+WS +FVKWW LYK 
Sbjct  1178  WLDYLISLAFAPLAWLLCIFSTCICIAYLGNSFLQPNYALTPEISIWSKDFVKWWGLYKV  1237

Query  4219  QEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDPLLVSIDEESVISEGALI  4398
             QE++SKVLAVHLRGTVFL  WF++LGA+I SS L+DT+DITDP LVSI + +VI+EGALI
Sbjct  1238  QEVASKVLAVHLRGTVFLKCWFEMLGARIGSSVLLDTIDITDPSLVSIGDGAVIAEGALI  1297

Query  4399  QSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLA-QNKKAAAKISKPLNGH  4575
             QSHEVKNG+LSF  +RIG+  S+GPYA++QKGS++ +GAEV A Q  +    + +    +
Sbjct  1298  QSHEVKNGILSFLPIRIGQNCSVGPYALIQKGSVLAEGAEVQASQKSEGGTSVFQSNKAN  1357

Query  4576  KGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLNSLSAAIAYLVWIWLLQKPPSLHHFLFIC  4755
              G V  +   RN     +++   GIYM+G+L+SL+AA+ Y +++WL + PPS  HF F+C
Sbjct  1358  NGSVLPK-DSRN-AQIEAIYHFLGIYMVGFLSSLAAALFYFLYLWLSRSPPSFQHFTFLC  1415

Query  4756  IAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHGLILSVFTFMLNHFVSRKGD  4935
             I+GAFHWFP+ II +T MF+S  +S   FA  VA  Y AHGLILS  T  +  F++RK D
Sbjct  1416  ISGAFHWFPFTIIAYTTMFSSASLSPPYFAISVAVAYLAHGLILSFLTCTMTRFLARKPD  1475

Query  4936  TDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWMGAKIGQHCSIRAINPVVEPGL  5115
             T +   + W+ HR+ +ACH+RFAKLLSGTE  C+YL  +GAKIG HCSIRAINPV EP L
Sbjct  1476  TKQSHMKTWLRHRIMIACHLRFAKLLSGTEALCIYLRLLGAKIGSHCSIRAINPVSEPEL  1535

Query  5116  VSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQGLILPGSFIEKDVILGALS  5295
             +S+  GVH+GDFSRI+PG++++ G+  G+I + +NSV+GSQ L+LPGS ++KDVILGALS
Sbjct  1536  ISIGAGVHMGDFSRIIPGFYSSSGFTCGQIKVEDNSVVGSQSLVLPGSVLQKDVILGALS  1595

Query  5296  VAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMDPKYKKVLGSLAANLAASTLKLK  5475
             VAP+NSVL+  G ++GS+  VM++N    LD RIEEMD KYK+++G+LAANLA +T+K+K
Sbjct  1596  VAPMNSVLQRGGVYIGSQTPVMIKNTLHALDQRIEEMDVKYKRIVGNLAANLAVTTMKVK  1655

Query  5476  SRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYPVIIRHSNCLSSDDDARLDPRGAA  5655
             SRYFHRIG  GKG L++Y+ + G PDHKIF PG +YPV+IRHSN L++DDDAR+D RGAA
Sbjct  1656  SRYFHRIGVGGKGILKIYDNIKGFPDHKIFQPGKSYPVLIRHSNSLAADDDARIDARGAA  1715

Query  5656  IRILPHERtttttttplldltlktGKAFHARTIGDFATWLVCGAAAREEHVKHAPHIRDA  5835
             +RILP E     + +PLLDLTLKTG AF+ARTI DFATWLVCG AAREEHVK  P +RDA
Sbjct  1716  LRILPDE---PGSDSPLLDLTLKTGNAFYARTIADFATWLVCGLAAREEHVKRIPRVRDA  1772

Query  5836  MWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKLRPFDEKIGEEYGEVEPRGILPP  6015
             +W SLRR +S+ ELHYYSNICRLFRFKDGQEMYV+ KLRP+DEK  E+ G++EP GILPP
Sbjct  1773  VWASLRRADSFAELHYYSNICRLFRFKDGQEMYVKLKLRPYDEKFSEDSGKIEPIGILPP  1832

Query  6016  ETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQIQPIPDDERVRETLLDCTKPW  6195
             ETGAIPRD+ D RPLLFLAEDF+ RV+S   VRYV Q+Q QP+P DE   ++ LDCTKPW
Sbjct  1833  ETGAIPRDDTDTRPLLFLAEDFQQRVNSAGGVRYVFQMQFQPVPGDEATCDSALDCTKPW  1892

Query  6196  DEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEIDVIRATSCNQSASIDHGRSLVY  6375
             DE E P+I+VGEI +DQ+LT +ESE+LEFNPF +C+E+DVIRA+S +QSASIDHGRSL+Y
Sbjct  1893  DENEFPHIDVGEIIVDQMLTREESEQLEFNPFLQCHEVDVIRASSSSQSASIDHGRSLIY  1952

Query  6376  EICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAKLENKDMPKATLARQWYVTLWLMS  6555
             EICQ+LRNR+PLPEAWRIFL+QSD K+DLSGCP+AA L+ KD+   TL+R WY TLW++ 
Sbjct  1953  EICQHLRNREPLPEAWRIFLEQSDFKVDLSGCPMAAALQKKDVQNVTLSRTWYQTLWVIF  2012

Query  6556  GQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQWLLPLWWGGSGILAGLVCALSKW  6735
              QP LQ VLPYF++GLV++APLN +FY     ++   WLLP +W  SG LA LVC ++KW
Sbjct  2013  AQPLLQTVLPYFIMGLVVFAPLNWVFYWKNTKKLPLHWLLPFFWLSSGTLAALVCIVAKW  2072

Query  6736  VLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYFMETATGTFLMGIWMRLMGSEVA-R  6912
              LVGKK +G+T  IWSR +FMDTIWQA RT+ GEYFME  TG+FL  +WMRLMGS +   
Sbjct  2073  GLVGKKKEGETALIWSRSVFMDTIWQAFRTLVGEYFMEMITGSFLFALWMRLMGSNIELN  2132

Query  6913  DGVYIDSMGATLNPDMVRIEEYGSVGREALLFGHIYEG-GGEVKYGRISVKNGGFVGSRA  7089
             +G Y+DSMGA LNP+MV IE  G VGREALLFGHIYEG GG+VK+G+IS+  GGFVGSRA
Sbjct  2133  EGAYVDSMGAVLNPEMVEIERGGCVGREALLFGHIYEGEGGKVKFGKISIGEGGFVGSRA  2192

Query  7090  VAMPGATIDSGGSLGALSLAM  7152
             V MPG  +++GGSL  LSLAM
Sbjct  2193  VVMPGVRVETGGSLSDLSLAM  2213



>ref|XP_008800677.1| PREDICTED: uncharacterized protein LOC103714963 [Phoenix dactylifera]
Length=2331

 Score =  2868 bits (7436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1413/2335 (61%), Positives = 1768/2335 (76%), Gaps = 62/2335 (3%)
 Frame = +1

Query  298   MEMESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAG  477
             M+M   ++V   F KLHPC P  TRI IVGAGPSGLSAAYAL KLGY N+ + EK+ +  
Sbjct  1     MDMRQSIEVQ--FSKLHPCFPVETRICIVGAGPSGLSAAYALAKLGYRNITMFEKYQTVA  58

Query  478   GMCESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDM  654
             GMCES+DI+G+TYDLGGQV+AANSAP I HLAKEVGAE EEMD+HKLAL+DS    Y DM
Sbjct  59    GMCESVDIEGKTYDLGGQVIAANSAPVISHLAKEVGAEFEEMDSHKLALIDSHTGNYEDM  118

Query  655   RVAEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYT  834
              VA+DY+S++ +TLKLQDE   +  IG++++SE+ASD T +FLK  GL SVPKSVAYGYT
Sbjct  119   EVADDYVSIMSLTLKLQDEANKSGHIGLHALSEVASDPTLDFLKQHGLNSVPKSVAYGYT  178

Query  835   ASGYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKR  1014
             ASGYGF+QDMPYAYI EF RTSMAGKIRRFKGGY S+W+KLS+++P K  CNTEVL + R
Sbjct  179   ASGYGFVQDMPYAYIQEFTRTSMAGKIRRFKGGYMSMWEKLSQSLPFKVLCNTEVLKVTR  238

Query  1015  NSSGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQK--TAGLFCDKMDMSTL  1188
             +  G+ V VR+  G    MEFDKII+SGA  F NGRTYRS S     AG   + + ++ L
Sbjct  239   SCVGISVTVRNAEGEENIMEFDKIILSGALAFKNGRTYRSSSLLYFPAGE-SEVVVLNDL  297

Query  1189  EKDLFSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFL  1368
             EK+LFSKVQTI+YYT+VL+I GL+H+P+GFYYF  FMEDPA IG+PVAMQ+F+ DT+VFL
Sbjct  298   EKELFSKVQTIDYYTTVLKIKGLDHMPLGFYYFGEFMEDPATIGHPVAMQRFFADTDVFL  357

Query  1369  FWSYGNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLET  1548
             FWSYGNS+DI G  V +L    V  +GG V+KV+LQR FKYFPHV+ +DM++GFYEKLE+
Sbjct  358   FWSYGNSLDINGPIVTKLLMDVVNAVGGVVEKVLLQRRFKYFPHVSSEDMRNGFYEKLES  417

Query  1549  QLQGQLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGL  1728
             Q+QG  NTYYVGGL+AFELTERN+SYSMA++ KHFAND  +P+FPYVKRLFPL SS E  
Sbjct  418   QIQGFQNTYYVGGLLAFELTERNSSYSMAMVCKHFANDDELPSFPYVKRLFPLISSHEPR  477

Query  1729  AFKQLDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNA  1908
             + ++L E+PGV+FP++ SLD YL+ WGT  +T  KTLYTW+NE+G V++RRTY E+H NA
Sbjct  478   SPRELGELPGVEFPDIPSLDGYLKFWGTHRITMKKTLYTWINEEGRVVNRRTYGELHDNA  537

Query  1909  FTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQ  2088
               IA+KLLTS KP +KPGD+VLL+++PGL+FVDAFF CL+A+++P+P +PPDP QR GGQ
Sbjct  538   SHIARKLLTSNKPILKPGDRVLLVFLPGLEFVDAFFACLKAKIVPVPVLPPDPLQR-GGQ  596

Query  2089  ALLHIANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSW  2265
             ALL I NI+K C+ +AILST SYH  VR    KN++   KS  K S  WPDLPWLHTDSW
Sbjct  597   ALLKIENISKACDAMAILSTSSYHAAVRAGFVKNVIALTKSNTKYSACWPDLPWLHTDSW  656

Query  2266  Vkk----pklfkkpkDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRY  2433
             +K                 +P   DLCFLQFTSGST D KGVMITHGG+IHNVKLMRK Y
Sbjct  657   IKNYRNHSSDSSLIAGANSEPRPNDLCFLQFTSGSTGDAKGVMITHGGLIHNVKLMRKIY  716

Query  2434  KSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATH  2613
             +STSRTILVSWLPQYHDMGLIGGL T LVSGG+ +LFSP++F++NPLLWLQT++ +RATH
Sbjct  717   RSTSRTILVSWLPQYHDMGLIGGLFTALVSGGAAVLFSPMSFIRNPLLWLQTINDYRATH  776

Query  2614  SAAPNFAFELLVRRLESSKEEN--FDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSRE  2787
             SA PNFAFEL++RRLES K++   +DLSS+ FLM AAEP+RQ TLKRF+E++QSFGLS+E
Sbjct  777   SAGPNFAFELVIRRLESDKDKTRAYDLSSLVFLMVAAEPVRQKTLKRFIEISQSFGLSQE  836

Query  2788  VMAPGYGLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKEND  2967
             VMAPG+GLAENCVFVSCA+GEG PVF+DWQGRVCCGY+   + D VDI+I+ PET KE++
Sbjct  837   VMAPGFGLAENCVFVSCAFGEGKPVFIDWQGRVCCGYVCSNDLD-VDIRIVDPETLKEHE  895

Query  2968  DPGKEGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITG  3147
             + GKEGEIWISS SAG+GYWG +E+SQKTF N++ + PGK++ RTGDLGRIID KLFITG
Sbjct  896   EYGKEGEIWISSPSAGVGYWGNQEMSQKTFFNELENQPGKKFTRTGDLGRIIDGKLFITG  955

Query  3148  RTKDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGL  3327
             R KDLII+AG+NIY++D+EKTVESSSE +RPGCCAV+G+PE+VL +KG+     SD++GL
Sbjct  956   RIKDLIILAGRNIYSADVEKTVESSSEFLRPGCCAVIGVPEEVLTAKGVSVPEISDQVGL  1015

Query  3328  VVIAEVRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRF  3507
             VVIAEV++GKP+  ++++ I TRVAEEHGVP+A++  IKPR+I KTTSGKI+R+EC K+F
Sbjct  1016  VVIAEVKEGKPVNGEIVEQIKTRVAEEHGVPVAAVNLIKPRTICKTTSGKIRRFECLKQF  1075

Query  3508  ISGTLDVIEEQMNGERSLPRNDGIIVPANGKISKT----------------------DIV  3621
               GTL +     + +RSL R+        G+ +++                      +I 
Sbjct  1076  TDGTLSLATGPCSSKRSLFRSFTTGSSGEGRRTRSLLGKPGPPSPRPQPLNSGKSMIEIT  1135

Query  3622  NFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCI  3801
              FLK L+S+QTGI V KI+  E+LVSYG++SIGVVRAAQK+S + G+ IGA+DIF+ATCI
Sbjct  1136  KFLKGLVSEQTGISVDKIAATESLVSYGIDSIGVVRAAQKLSDYLGVPIGAVDIFTATCI  1195

Query  3802  DDLADFVESLLEKNHP--MLTNSSETKISSSGIPSVVSTFDKITIW-----LIHLVALAY  3960
              DLA F E+LL K+ P  M+T S   +  +  +  V   F+K  +W        L+A+ Y
Sbjct  1196  SDLASFSENLLMKSRPESMITASHSLEAETELLRPV---FNKSPLWKLGIGFFQLLAIIY  1252

Query  3961  VSLLLIIPAYISVSMFKPL---ILANQSPWFFYFISLACAPFSWMLCIFLTCICTRLLGN  4131
             +S +LI+PAY S S F      I   ++    + ISL   P +W+  IFLTCI  R+ GN
Sbjct  1253  ISCILILPAYASCSAFLSFLSHIPIEKTSLSCFLISLFLTPLAWIFYIFLTCISLRIFGN  1312

Query  4132  ALLQPNYVLNPEISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIAS  4311
             + LQPNYV+ PEIS+WS++FVKWWAL KA+E++ KVLAVHLRGT FLNYWFK+ GA++ S
Sbjct  1313  SFLQPNYVMTPEISIWSIDFVKWWALNKAREVAGKVLAVHLRGTTFLNYWFKMQGARLGS  1372

Query  4312  SALIDTVDITDPLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQK  4491
             S LIDT+DITDP LVSI   +VI+EG LIQSHEV+NGVL F  +++G  SSIGPYAV+ K
Sbjct  1373  SVLIDTIDITDPPLVSIGGGAVIAEGVLIQSHEVRNGVLIFQPIKVGSNSSIGPYAVIGK  1432

Query  4492  GSIVGDGAEVLAQNK----KAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQLFGIYMI  4659
             GSIVGD  ++L   K    K   +  K   G KG       +         +   GIY +
Sbjct  1433  GSIVGDDTDILPLQKIEGGKPMFRSEKTFKGQKGGAMTEFYEELPEKLVPFYHFMGIYAV  1492

Query  4660  GYLNSLSAAIAYLVWIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLS  4839
             G LNSL  A+ YL++I+L +  P LHHF F+C+AGAFHW P  I  + A+ + +  +  +
Sbjct  1493  GLLNSLCGAVLYLIYIYLSESSPLLHHFTFVCLAGAFHWLPSTITAYAAITSDIASNPAT  1552

Query  4840  FAGMVAAGYTAHGLILSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSG  5019
             FA  +A GY AHGLIL + T  LN  ++ K    +     W+ HR+NVACH+RFAKLLSG
Sbjct  1553  FASFIAIGYVAHGLILGLLTCFLNRLLTGKQGMKQSHLRTWLRHRINVACHLRFAKLLSG  1612

Query  5020  TELFCVYLHWMGAKIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISG  5199
             TE FC++L  +GAKIGQHCSIRAINPV +P L+S+ DGVHLGDFSRI+ G+++ G +  G
Sbjct  1613  TEAFCMFLRLLGAKIGQHCSIRAINPVTDPELISIGDGVHLGDFSRILTGFYSPGRFSHG  1672

Query  5200  RIDIRENSVIGSQGLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTL  5379
              + ++ NSV+GSQ L+LPG+ I++DVILG+LS+AP+NSVL+  G ++GS+  +MV+N   
Sbjct  1673  EVKVQNNSVLGSQSLVLPGTVIQEDVILGSLSIAPVNSVLQSGGIYMGSQTPIMVKNTLH  1732

Query  5380  PLDDRIEEMDPKYKKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHK  5559
               D+RIEEMD KYKK++G+LA NLA +T+   SRYFHRIG  G+G L+LY  LPG   HK
Sbjct  1733  ASDERIEEMDQKYKKIVGNLAGNLAITTMNANSRYFHRIGVGGRGVLKLYQDLPGFQKHK  1792

Query  5560  IFGPGATYPVIIRHSNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAF  5739
             IF  G   PVIIRHSN LS+DDDAR+D RGAA+RIL       +   PLLDLTLKTGK F
Sbjct  1793  IFCAGKCLPVIIRHSNSLSADDDARIDARGAAVRILSQ----GSGEAPLLDLTLKTGKTF  1848

Query  5740  HARTIGDFATWLVCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKD  5919
             +ARTI DFATWLVCG AARE+ VKHAPHIRDA+WGSLR  +SY ELHYYSNICRL RF D
Sbjct  1849  YARTIADFATWLVCGLAAREQQVKHAPHIRDAVWGSLRNASSYAELHYYSNICRLLRFDD  1908

Query  5920  GQEMYVRFKLRPFDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSS  6099
             GQEMYV+FKLRP D +IGE+ G VEP GILPPETGAIPR END RPLLFLA+DF+ RV S
Sbjct  1909  GQEMYVKFKLRPLDPEIGEDSGLVEPEGILPPETGAIPRKENDTRPLLFLADDFRKRVDS  1968

Query  6100  PDKVRYVLQLQIQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELE  6279
             P  V Y+ QLQ +P+P DE  RE  LDCTKPWD+ + PYI++GEITID+ LT +ESE LE
Sbjct  1969  PGGVHYIFQLQCRPVPADEADREVALDCTKPWDDIKFPYIDIGEITIDKNLTAEESERLE  2028

Query  6280  FNPFFRCNEIDVIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLD  6459
             FNPF RC+E+DVIRATS +QSASIDHGRSLVYE+CQ+LRN +PLP AWR FL+QSD K+D
Sbjct  2029  FNPFLRCHEVDVIRATSSSQSASIDHGRSLVYEVCQHLRNGQPLPAAWRSFLEQSDAKVD  2088

Query  6460  LSGCPLAAKLENKDMPK--ATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLF  6633
             LSGCP+AA ++ K   +   TLAR WY  LW  + QP LQ  LPYF++GLVI+ PL  + 
Sbjct  2089  LSGCPMAAAVQAKKGGERSGTLARTWYQMLWATACQPLLQTFLPYFIIGLVIFGPLQWML  2148

Query  6634  YTHEMTQIQKQWLLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQ  6813
               +   Q+   WLLPL+W  SGI+A L C L+KWVLVGKK +G+T  IWS G+FMD+ WQ
Sbjct  2149  LINSAKQLPLHWLLPLFWVISGIMAALACVLAKWVLVGKKKEGQTVMIWSWGVFMDSAWQ  2208

Query  6814  AIRTVTGEYFMETATGTFLMGIWMRLMGSEVARD-GVYIDSMGATLNPDMVRIEEYGSVG  6990
             A+RTV G+YF+E  +G+ L G+WMRLMGS +  D GVY+DSMGA LNP+MV IEE G+VG
Sbjct  2209  ALRTVAGDYFVEMTSGSILFGVWMRLMGSVMEVDQGVYVDSMGAVLNPEMVEIEEGGAVG  2268

Query  6991  REALLFGHIYEG-GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             R+ALLFGHIYEG GG VK+G++ ++ GGFVGSRAVAMPG  I+SG SL ALSLAM
Sbjct  2269  RDALLFGHIYEGEGGRVKFGKVRIEEGGFVGSRAVAMPGVRIESGASLDALSLAM  2323



>ref|XP_008449759.1| PREDICTED: uncharacterized protein LOC103491548 isoform X1 [Cucumis 
melo]
Length=2321

 Score =  2859 bits (7412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1419/2322 (61%), Positives = 1778/2322 (77%), Gaps = 48/2322 (2%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M +G  ++D F KLHP +P  TRIGI+G GPSGLSAAYAL KLGY+ V VLEK+H  GGM
Sbjct  1     MATGKSLEDKFSKLHPSLPLNTRIGIIGGGPSGLSAAYALAKLGYTGVTVLEKNHDVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWAYTDMRVA  663
             CES++I+G+ YDLGGQVLAANSAPTIFHLAKE G+E+EE+D+HKLAL+D+   Y D+RVA
Sbjct  61    CESVEIEGKIYDLGGQVLAANSAPTIFHLAKETGSELEELDSHKLALIDTSGEYQDIRVA  120

Query  664   EDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTASG  843
             +DY S+I +TL+LQD+ K +  IGV++VS  ASD+TP +L+ +GL SVPKSVAYGYTASG
Sbjct  121   DDYTSIISLTLQLQDKAKDSGHIGVHAVSAFASDLTPTYLEARGLTSVPKSVAYGYTASG  180

Query  844   YGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNSS  1023
             YGF+QDMPYAY+HEF RTSMAGKIRRFKGGY  +WK++SE++PIK  C TEV+S++R+S+
Sbjct  181   YGFVQDMPYAYVHEFTRTSMAGKIRRFKGGYGGLWKRISESLPIKVHCKTEVVSVRRSSN  240

Query  1024  GVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDLF  1203
              V + V  R+  L ++EFDKIIISG+FPF N RTYRS S K +    + MDMS LE++LF
Sbjct  241   SVTLRVMDRDKNLASLEFDKIIISGSFPFRNCRTYRSSSPKLSEEGAEVMDMSRLEEELF  300

Query  1204  SKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSYG  1383
             SKV TI+YYT+VL+IDGL+HLP+GFYYF   M++P  IG PVAMQKFY DTN+FL WSYG
Sbjct  301   SKVYTIDYYTTVLKIDGLDHLPLGFYYFGKHMDNPETIGYPVAMQKFYPDTNIFLLWSYG  360

Query  1384  NSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQGQ  1563
             NS DI G  V  LA   + KMGG+VKKVILQR FKYFPHV  +DM+DGFY++LE +LQG 
Sbjct  361   NSADITGPNVTALAINTITKMGGEVKKVILQRRFKYFPHVCSKDMEDGFYKRLELELQGS  420

Query  1564  LNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQL  1743
             LNTYY GGLMAFELTERN+SY+MAL+ KHFAND   PTF Y K +F  +S  E  A K L
Sbjct  421   LNTYYTGGLMAFELTERNSSYAMALVCKHFANDNSSPTFSYAKPMFLFQSKQERDA-KGL  479

Query  1744  DEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQ  1923
              E+PGV+FP LSSLD YLRHWG+  VT ++ LYTWLNE+G VL +RTY+E+H NA  IAQ
Sbjct  480   GELPGVEFPNLSSLDGYLRHWGSHHVTRDRVLYTWLNEEGSVLGQRTYRELHLNASCIAQ  539

Query  1924  KLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHI  2103
             KLL++QKP+IKPGD+VLLIYVPGLDF+DAFFGCLRA+V+P+P +PPDP QR GGQALL I
Sbjct  540   KLLSNQKPSIKPGDRVLLIYVPGLDFIDAFFGCLRAKVLPVPVLPPDPLQR-GGQALLKI  598

Query  2104  ANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSWVkkpk  2280
               IAK C+ VAILST SYH  VR+   KNM+   +   KSS  WP LPW+HTDSW+K   
Sbjct  599   EYIAKSCSAVAILSTLSYHSAVRVGKVKNMIGLTRENGKSSAVWPKLPWMHTDSWIKNFA  658

Query  2281  lfk--kpkDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTI  2454
                      +Q  P  +D+ FLQFTSGST D KGVMITHGG+IHNVKLMR+RYKSTSRT+
Sbjct  659   NLTPPDTMADQSDPHPDDVSFLQFTSGSTGDAKGVMITHGGLIHNVKLMRRRYKSTSRTV  718

Query  2455  LVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFA  2634
             LVSWLPQYHDMGLIGGL T LVSGG+ ILFSP+TF+KNPLLWL TMSK++ATHSA PNFA
Sbjct  719   LVSWLPQYHDMGLIGGLFTALVSGGTAILFSPLTFIKNPLLWLHTMSKYKATHSAGPNFA  778

Query  2635  FELLVRRLE--SSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYG  2808
             FEL+ RRLE    K + +DLSSM FLM AAEP+R+TTLK+F+ELT  FGL+ E MAPGYG
Sbjct  779   FELVARRLEVNKGKVQTYDLSSMVFLMIAAEPVRKTTLKKFLELTVPFGLTEEKMAPGYG  838

Query  2809  LAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGE  2988
             LAENCVFVSCA+GEG+P+FVDWQGRVCCGY+ Q NTD +DI+I++P TGKE ++ GKEGE
Sbjct  839   LAENCVFVSCAFGEGIPIFVDWQGRVCCGYVDQDNTD-IDIRIVNPGTGKELEEDGKEGE  897

Query  2989  IWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLII  3168
             IWISS SAGIGYWG EELSQ+TF N++ + PG+RY RTGDLGR+ID KLFITGR KDLII
Sbjct  898   IWISSPSAGIGYWGREELSQETFRNELQNHPGRRYTRTGDLGRVIDGKLFITGRIKDLII  957

Query  3169  VAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVR  3348
              AG+NIY +D+EKTVESSS+L+RPGCCAV+G+PE++L+ KGI     SD++GLVVIAEV+
Sbjct  958   AAGRNIYPADVEKTVESSSDLLRPGCCAVIGVPEEILMEKGIQVPDCSDQVGLVVIAEVK  1017

Query  3349  DGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDV  3528
             DGKP+  D++D I  RVAEEHGV +ASI  IKPR+ISKTTSGKIKR+EC K+F+ GTL+V
Sbjct  1018  DGKPIAKDIIDQIQNRVAEEHGVSVASIKLIKPRTISKTTSGKIKRFECLKQFVDGTLNV  1077

Query  3529  IEEQMNGERSLPRN-------DGII---------------VPANGKISKTDIVNFLKDLL  3642
             + E +   R+  R+       +GI                V    +IS  DI  FLK L+
Sbjct  1078  VPEAIKLRRTFLRSFSTGTCKEGITPRPQQTKLSRASVPSVQPGLRISNRDIEEFLKGLV  1137

Query  3643  SQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFV  3822
             S+ T I ++KIS  E+L+SYG++SI VVRAAQK+S+F G+ +GA+DIF+A+CI DLA   
Sbjct  1138  SELTNISINKISATESLLSYGIDSILVVRAAQKLSNFLGVPVGAVDIFTASCIADLASIS  1197

Query  3823  ESLLEKNHPMLTNSS-----ETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPA  3987
             E++L K+H   T ++     +T     G+ +V  T  +  IW   L+AL +V+++++ PA
Sbjct  1198  ENILAKSHAQSTKNTTNPTYDTNCVLVGMETVSWT-RQFVIWFSQLLALIFVAMMVLFPA  1256

Query  3988  YISVSMFK---PLI--LANQSPWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNY  4152
             Y+S+S F    P++  L +      Y + L  AP +W+LCI  +CIC    GN+ L+PNY
Sbjct  1257  YLSISAFTSSLPILHNLTDNISLMDYLLPLTLAPLAWILCIVSSCICIAFFGNSFLRPNY  1316

Query  4153  VLNPEISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTV  4332
              L PE+S+WS++FVKWWALYKAQ++SSKVLAVHLRGTVFL YW+++ GA+I SS ++DTV
Sbjct  1317  ALTPEVSIWSLDFVKWWALYKAQDVSSKVLAVHLRGTVFLKYWYEMFGARIGSSVILDTV  1376

Query  4333  DITDPLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDG  4512
             DITDP LVSI +   ++EGALIQSHEVKNGVLSF  +RIG+ SS+GPYA + KG+I+G+ 
Sbjct  1377  DITDPSLVSIGDGVAVAEGALIQSHEVKNGVLSFLPIRIGRNSSVGPYASIHKGAILGEE  1436

Query  4513  AEVLA-QNKKAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLNSLSAAI  4689
              EV A Q  +     S      KG   RR          +++  FGIY++G+L SLSAAI
Sbjct  1437  VEVPALQRIEGIETTSGNRCFEKGSEPRR-NAGERQERETIYHFFGIYILGFLGSLSAAI  1495

Query  4690  AYLVWIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYT  4869
              Y  +IWL Q  PSL HF F+C+ GAFHW P+ +I +  +F  +P + +SFA + ++ Y 
Sbjct  1496  VYYFYIWLSQSSPSLQHFSFLCLVGAFHWIPFTVIAYATIFAEVPSNAISFAILFSSMYL  1555

Query  4870  AHGLILSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHW  5049
              HG+IL + TF++ + ++ K   ++   + W+ HR+  A H+RFAKLLSGTE FC+YL  
Sbjct  1556  FHGIILCILTFVVKNLLTSKPQMEQTPLKIWLCHRITAASHLRFAKLLSGTEAFCIYLRL  1615

Query  5050  MGAKIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVI  5229
             +GAKIG+HCSIRAINPV +P L+S+  GVHLGDFSRI+ G+++T G   G+I+++ENSVI
Sbjct  1616  LGAKIGKHCSIRAINPVSDPELISIRTGVHLGDFSRIISGFYSTNGLTRGKIEVQENSVI  1675

Query  5230  GSQGLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMD  5409
             GSQ ++LPGS I++DV+LGALSV+P+NS L   G +VGS   VM++N    LD+RIE+MD
Sbjct  1676  GSQSIVLPGSVIQEDVVLGALSVSPMNSTLIRGGIYVGSRTPVMIKNTMHILDERIEKMD  1735

Query  5410  PKYKKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYPV  5589
               YKK++G+LAANLAA+TLK+K+RYFHRIG +GKG L++Y+ + GLPDHKIF PG +YPV
Sbjct  1736  KIYKKIVGNLAANLAATTLKVKARYFHRIGVSGKGYLKIYDNIKGLPDHKIFSPGKSYPV  1795

Query  5590  IIRHSNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFAT  5769
              IRHSN LS+DDDAR+D RGAA+RIL    +  + TTPLLDLTLKTG AF+ARTI DFA+
Sbjct  1796  FIRHSNSLSADDDARIDARGAALRIL----SDGSDTTPLLDLTLKTGNAFYARTIADFAS  1851

Query  5770  WLVCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKL  5949
             WLVCG  ARE+HVK  PHIRDA+W SLR  NSYTELHYYSNICRLFRF DGQEMYV+ KL
Sbjct  1852  WLVCGLPAREQHVKKVPHIRDAVWNSLRLTNSYTELHYYSNICRLFRFNDGQEMYVKLKL  1911

Query  5950  RPFDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQL  6129
             RP+D+ I E+ G+VEP GILPPETGAIPR ++DKRPLLFLAEDF  RV+SP+ VRYV Q+
Sbjct  1912  RPYDKTIDEDSGKVEPIGILPPETGAIPRADDDKRPLLFLAEDFLNRVNSPEGVRYVFQI  1971

Query  6130  QIQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEI  6309
             Q +P+P DE  R+  LDCTKPWDE E P  ++GEI I Q L+++ESE LEFNPF RC+E+
Sbjct  1972  QTRPVPQDEAERDIALDCTKPWDETEFPCQDIGEIEIHQSLSKEESEALEFNPFLRCHEV  2031

Query  6310  DVIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAKL  6489
             DVI ATS +QSASIDHGRSL+YEICQ+LRN  PLPEAW+IFL QSD K+DLSGCP+AA L
Sbjct  2032  DVISATSISQSASIDHGRSLIYEICQHLRNGTPLPEAWKIFLQQSDTKVDLSGCPMAAAL  2091

Query  6490  ENKDMPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQW  6669
             + +   K  L R WY  LWL   QP  Q  LPYF++GLVI+ PL  + +  E  ++   W
Sbjct  2092  KERANEKTALDRTWYQNLWLTFFQPTFQTALPYFIMGLVIFPPLASVMHLKENKKLPLHW  2151

Query  6670  LLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYFME  6849
             LLPL W  SGI+A L C ++KW+LV KK +G+T  IWS  IFMDT WQAI+TV G+YFME
Sbjct  2152  LLPLLWVSSGIIAALCCIVAKWILVQKKKEGETIGIWSIRIFMDTTWQAIKTVVGDYFME  2211

Query  6850  TATGTFLMGIWMRLMGSEVARD-GVYIDSMGATLNPDMVRIEEYGSVGREALLFGHIYEG  7026
               TG+F+  + M+LMGS+V  D G Y+DSMGA LNP+MV+I   GSVGREALLFGHIYEG
Sbjct  2212  MTTGSFIFVLIMKLMGSDVDMDQGTYVDSMGALLNPEMVKIHRGGSVGREALLFGHIYEG  2271

Query  7027  GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             GGEVK+G I +   GFVGSRA+AMPG  ++S  S+  LSLAM
Sbjct  2272  GGEVKFGNIEIGEDGFVGSRAIAMPGVRVESEASIAPLSLAM  2313



>ref|XP_010034280.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104423491 
[Eucalyptus grandis]
Length=2360

 Score =  2857 bits (7406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1411/2319 (61%), Positives = 1775/2319 (77%), Gaps = 45/2319 (2%)
 Frame = +1

Query  301   EMESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGG  480
             +M+S   V+D F KLHPC+P  TRIGIVG G SGLSA YAL+KLGY ++ V+EKH S GG
Sbjct  44    KMDSQKSVEDQFSKLHPCLPLDTRIGIVGGGSSGLSAVYALVKLGYRDITVIEKHKSVGG  103

Query  481   MCESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDS-DWAYTDMR  657
             MCES++I+G+ YDLGGQVLAANSAP IFHLAKE G E+EEMD HKLAL+DS    Y D+ 
Sbjct  104   MCESVEIEGKVYDLGGQVLAANSAPVIFHLAKESGTELEEMDLHKLALIDSFTGEYQDIN  163

Query  658   VAEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTA  837
              AEDY+S++ +TL++QD+ K +NRIG+++VS+IASD+TP +L+  G+KS+PKSV YGYTA
Sbjct  164   AAEDYMSLVSLTLEIQDKAKDSNRIGIHAVSDIASDLTPAYLEAHGIKSIPKSVQYGYTA  223

Query  838   SGYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRN  1017
             SGYGF+QDMPYAYIHEF RTSMAGKIRR KGGY S+WKK+S+++ IK  CNTEV +++R+
Sbjct  224   SGYGFVQDMPYAYIHEFTRTSMAGKIRRIKGGYMSLWKKISDSLLIKVCCNTEVQAVRRD  283

Query  1018  SSGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPS---QKTAGLFCDKMDMSTL  1188
             SSG  VD+ + +G  +  EFDKIIISGAFPF + RTYRS S   +   GL    +D+S L
Sbjct  284   SSGANVDITNSSGETEHKEFDKIIISGAFPFKHSRTYRSTSFSREAETGL----LDVSDL  339

Query  1189  EKDLFSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFL  1368
             E++LFSKVQTI+YYT+VL+I+GLE + +GFYY    MEDP+ IG+PVA+Q+FY DTN+FL
Sbjct  340   ERELFSKVQTIDYYTTVLKINGLERIAVGFYYLGENMEDPSTIGHPVAIQRFYADTNIFL  399

Query  1369  FWSYGNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLET  1548
             FWSYG+S++I GS V++LA + V +MGG+V+KVILQR FKYFPH+  +DMKD FYE++E+
Sbjct  400   FWSYGDSVNIRGSNVIDLAIEVVKRMGGEVEKVILQRRFKYFPHIGSKDMKDRFYERIES  459

Query  1549  QLQGQLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGL  1728
             +LQG  NTYYVGGL AFELTERN+SY+MALI KHFA+    PT PYVK LF L+   E  
Sbjct  460   ELQGHRNTYYVGGLFAFELTERNSSYAMALICKHFASANSFPTLPYVKSLFTLQLDQEEA  519

Query  1729  AFKQLDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNA  1908
               K L E  GV FP+L +LDSYL+HW    +T+NK LYTW+NE+G V+ +RTY E+  NA
Sbjct  520   GLKTLSETHGVVFPDLPTLDSYLKHWAAKEITQNKALYTWINEEGAVVCQRTYAELDFNA  579

Query  1909  FTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQ  2088
               IA KLLTS+KP IK GD+VLL++VPGLDFVDAFFGCLRA+V+P+P +PPDP QRGG Q
Sbjct  580   SCIAHKLLTSRKPTIKSGDRVLLVHVPGLDFVDAFFGCLRAKVVPVPVLPPDPLQRGG-Q  638

Query  2089  ALLHIANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSW  2265
             AL  I NIAK CN VAILST  YH  VR  S KN++ F +   +S+  WP+LPWLHTDSW
Sbjct  639   ALAKIENIAKFCNAVAILSTVGYHAAVRAGSVKNLISFTRKSAESTAQWPNLPWLHTDSW  698

Query  2266  Vkkpklf-kkpkDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKST  2442
             +K  K+        Q +   +DLCFLQFTSGST D KGVMITHGG+IHNVKLMR+RY+ST
Sbjct  699   IKSSKVLPASNIGSQSESQPDDLCFLQFTSGSTGDAKGVMITHGGLIHNVKLMRRRYRST  758

Query  2443  SRTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAA  2622
             S T+LVSWLPQYHDMGLIGGL T +V GG+ ILFSP+TF++NPLLWLQT+S ++ATHSA 
Sbjct  759   SNTVLVSWLPQYHDMGLIGGLFTAMVCGGTAILFSPLTFIRNPLLWLQTISDYKATHSAG  818

Query  2623  PNFAFELLVRRLES--SKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMA  2796
             PNFAFEL++RRLE+  +K  ++DLSSM F M AAEP+RQ TLKRFVELT+ +GLS+EVMA
Sbjct  819   PNFAFELVIRRLEADKAKAHDYDLSSMIFFMIAAEPVRQKTLKRFVELTRPYGLSQEVMA  878

Query  2797  PGYGLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPG  2976
             PGYGLAENCVFV CAYG+  P+ VDWQGR+CCGY+  PN   VDIKI+  +TG E D+ G
Sbjct  879   PGYGLAENCVFVGCAYGKKKPILVDWQGRICCGYV-DPNDADVDIKIVDADTGLEVDEDG  937

Query  2977  KEGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTK  3156
             KEGEIWISSLSAGIGYWG EELSQKTF N + + PGK+Y RTGDLGR+I   LFITGR K
Sbjct  938   KEGEIWISSLSAGIGYWGKEELSQKTFRNKLQNYPGKKYTRTGDLGRVIQGNLFITGRIK  997

Query  3157  DLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVI  3336
             DLIIVAG+ IY++D+EKTVESSSEL+RPGCCAV+G+PEDVL +KGI    ASDE+GLVVI
Sbjct  998   DLIIVAGRKIYSTDVEKTVESSSELLRPGCCAVIGVPEDVLSAKGISLPDASDEVGLVVI  1057

Query  3337  AEVRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISG  3516
             AE+RDGKP+  D++  I +RVAEEHGV  AS+  IKPR+ISKTTSGKIKR+EC K+F+ G
Sbjct  1058  AELRDGKPVDKDIIKQIESRVAEEHGVIAASVKLIKPRTISKTTSGKIKRFECLKQFVDG  1117

Query  3517  TLDVIEEQMNGERSLPRN-------DGII---------VPANGKISKTDIVNFLKDLLSQ  3648
             TL+ + + +  +RSL R+       +G           +P + K+S  +IV FLK L+S+
Sbjct  1118  TLNTVPDPIVTKRSLTRSFTTGKCREGKTPQSHLAKSSLPPSPKLSNRNIVEFLKQLVSE  1177

Query  3649  QTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVES  3828
             QTGI +  IS  E+LVSYG++SIGVVRAAQK+S F G+ +GA+DIF+ATCI DLA+F E+
Sbjct  1178  QTGIAIQNISAMESLVSYGIDSIGVVRAAQKLSDFLGVPVGAVDIFTATCIADLANFAEN  1237

Query  3829  LLEKNHP----MLTNSSETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPAYIS  3996
             LL K+ P      +N+ E ++ ++  P  +S   +  IW   L+AL YVS +L+ PAY+S
Sbjct  1238  LLMKSQPHRVTTQSNNPEPEVLTADFPMEISRLHRWRIWSFQLLALLYVSFILVFPAYLS  1297

Query  3997  VSMFKPLILANQS-----PWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLN  4161
             VS F+ L+ A+Q      PW ++   +  AP SW+LCI LT I     GN+ L+ NY L 
Sbjct  1298  VSAFQILVSASQKLIDGLPWLYHPSVVLLAPLSWILCIALTSISIAFFGNSFLRINYALT  1357

Query  4162  PEISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDIT  4341
             PE+S+WSV+FVKWWALYKAQE+SSKVLAVHLRGTVFL +WF++LGA+I SS L+DTVDIT
Sbjct  1358  PEVSIWSVDFVKWWALYKAQEVSSKVLAVHLRGTVFLKHWFEMLGARIGSSVLLDTVDIT  1417

Query  4342  DPLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEV  4521
             DP LVSI + +VI+EGAL+QSHEV++ +L F  +RIG+  S+GPYAV+QKGS++G+GAEV
Sbjct  1418  DPSLVSIGDGAVIAEGALLQSHEVRDSILRFQPIRIGRNCSVGPYAVVQKGSVLGEGAEV  1477

Query  4522  LAQNKKAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLNSLSAAIAYLV  4701
              A  K    K +  + G   K+ +           ++ Q  GIYM+G L+S+SAA  YL+
Sbjct  1478  PALQKSERRKPAFKMAG-ADKILKVSAVSPGSLKETIQQFMGIYMVGLLSSVSAAAVYLL  1536

Query  4702  WIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHGL  4881
             ++ L QK PSL    F+CI+GA HW P+ I+ +  MFT+   +   FA  +A  Y AHGL
Sbjct  1537  YMRLSQKVPSLEQLAFVCISGALHWVPFTIMAYATMFTNALPNPFEFAISLAIAYFAHGL  1596

Query  4882  ILSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWMGAK  5061
             +LS+ T +  H +  K    +   + W  HR+ VACH+RFAKLLSGTE FC+YL  +GAK
Sbjct  1597  VLSLLTSIFTHLLCGKEKKTQTHIKTWFGHRLAVACHLRFAKLLSGTEAFCMYLRLLGAK  1656

Query  5062  IGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQG  5241
             +G++CSIR+INPVV+P +VS+  GVHLGDFSRI+ G+++  GYI   +D+++NSVIGSQ 
Sbjct  1657  VGKYCSIRSINPVVDPRMVSIGAGVHLGDFSRIITGFYSQSGYIQSNVDVKDNSVIGSQS  1716

Query  5242  LILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMDPKYK  5421
             LILPGS +EK+VILGA+SV+P+NSVL+  G ++GS++ VMV+N T  LDDRIEEMDP+YK
Sbjct  1717  LILPGSVVEKNVILGAISVSPVNSVLQSGGVYMGSQSPVMVKNTTYALDDRIEEMDPRYK  1776

Query  5422  KVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYPVIIRH  5601
             K++G+LAANLAA+TLKLKSRYFHRIG +G G L+LY+ + GLP+H IF PG  Y VIIRH
Sbjct  1777  KIVGNLAANLAAATLKLKSRYFHRIGVSGGGYLKLYDDIQGLPEHNIFSPGKKYTVIIRH  1836

Query  5602  SNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFATWLVC  5781
             SN +S+DDDARLD RGAA+RIL  E+   +    L   T   GKA  ARTI DFATW+VC
Sbjct  1837  SNGVSADDDARLDVRGAALRILTDEKEDDSPLLDLTLKT---GKASAARTISDFATWMVC  1893

Query  5782  GAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKLRPFD  5961
             G AAREE VK  PH+RDA W SLR+ +SY +LHYYSN+CRLFRFKDGQEMYV+FKLRPFD
Sbjct  1894  GLAAREERVKREPHLRDAAWSSLRQADSYADLHYYSNVCRLFRFKDGQEMYVKFKLRPFD  1953

Query  5962  EKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQIQP  6141
             + I E+ G+VEP GILPPET AIPRD ND RPLLFLAEDF+ RV S + VRY+ QLQ++P
Sbjct  1954  KNIREDSGKVEPFGILPPETIAIPRDANDTRPLLFLAEDFQNRVKSANGVRYIFQLQVRP  2013

Query  6142  IPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEIDVIR  6321
             IP DE  +E  LDCTKPWDE + PYI+VGE+ I++ LT++ SE LEF PF RC+E+DVIR
Sbjct  2014  IPQDEAAQEIALDCTKPWDELQFPYIDVGEVIINENLTKEGSERLEFKPFLRCHEVDVIR  2073

Query  6322  ATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAKLENKD  6501
             ATS +QSASIDHGRSLVYEICQ LRN  PLP AWRIFL+QSDVK+DLSGCP+AA LE KD
Sbjct  2074  ATSSSQSASIDHGRSLVYEICQRLRNGDPLPGAWRIFLEQSDVKVDLSGCPMAAALERKD  2133

Query  6502  MPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQWLLPL  6681
               K TL R WY+T W +  QP LQ +LPYFLLGL+IY PLN L +      +   W  P 
Sbjct  2134  AEKVTLLRPWYLTTWAVFAQPLLQTILPYFLLGLIIYFPLNLLLHCKNTRNMPVHWTFPF  2193

Query  6682  WWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYFMETATG  6861
             +W  +G+LA L C ++K++LVGKK + +   IWSRG+FMDTIWQAIRTV G+YF+E A+G
Sbjct  2194  FWVSTGVLAALACVVAKYILVGKKSEDERVHIWSRGVFMDTIWQAIRTVVGDYFVEMASG  2253

Query  6862  TFLMGIWMRLMGSEVARD-GVYIDSMGATLNPDMVRIEEYGSVGREALLFGHIYEG-GGE  7035
             + L  +WM+LMGS +  D G Y+DSMGA +NP+MV +E  GSV REALLFGH+Y+G GG 
Sbjct  2254  SALFLMWMKLMGSYIELDKGTYVDSMGAAMNPEMVEVEGGGSVEREALLFGHVYDGEGGV  2313

Query  7036  VKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             VK+G+I V   GFVGSRAVAMPG  ++S GSL ALSLAM
Sbjct  2314  VKFGKIVVGERGFVGSRAVAMPGVAVESEGSLSALSLAM  2352



>ref|XP_009364757.1| PREDICTED: uncharacterized protein LOC103954644 [Pyrus x bretschneideri]
Length=2274

 Score =  2856 bits (7403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1393/2315 (60%), Positives = 1755/2315 (76%), Gaps = 81/2315 (3%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+ G  V+D F +LHPC+P  TRIGIVG GPSGLS+AYAL+KLGYSNV VLEKHH+ GGM
Sbjct  1     MDPGKSVEDQFSRLHPCLPLNTRIGIVGGGPSGLSSAYALVKLGYSNVTVLEKHHTVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWAYTDMRVA  663
             CES+DI+G+ YDLGGQVLAANSAP IFHLAKE G+E++EMD+HKLAL+D    Y D++VA
Sbjct  61    CESVDIEGKIYDLGGQVLAANSAPVIFHLAKETGSELDEMDSHKLALIDKSGQYQDIKVA  120

Query  664   EDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTASG  843
             +DY+SVI +TL+LQD+   + RIGV++VSE ASD+TP +L+ +G  SVPKSVAYGYTASG
Sbjct  121   DDYVSVISLTLELQDKAAKSGRIGVHAVSEYASDLTPVYLECQGFSSVPKSVAYGYTASG  180

Query  844   YGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNSS  1023
             YGF+QDMPYAYIHEF RTSMAGKIRRFKGGYTS W+K+S+++P+   CNTEVL I+R S 
Sbjct  181   YGFVQDMPYAYIHEFTRTSMAGKIRRFKGGYTSFWEKISKSLPM-VHCNTEVLEIRRYSD  239

Query  1024  GVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDLF  1203
              V VDV+  +G +++MEFDK+IISG+FP ++GR YRSPS  T     + M+M  +EK+LF
Sbjct  240   SVGVDVKSCDGEVKSMEFDKVIISGSFPLNSGRIYRSPSHPTEH-GSEVMEMGDVEKELF  298

Query  1204  SKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSYG  1383
             SKVQTI+YYT+VL++ G+EH+P+GF+YFE +M +PA IGNPVAMQKFY DT++ LFWSYG
Sbjct  299   SKVQTIDYYTTVLKVKGIEHMPIGFFYFEEYMSNPATIGNPVAMQKFYADTDILLFWSYG  358

Query  1384  NSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQGQ  1563
             NS+DI G+ V ELA  A   +G +V +V+LQR FKYFPHV  Q+MKDGFYEKLE++LQG 
Sbjct  359   NSVDITGTTVTELAIDAAKLIGAEVTEVVLQRRFKYFPHVGSQEMKDGFYEKLESELQGF  418

Query  1564  LNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQL  1743
              NTYYVGGLMAFELTERN+SY+M L+ KHFAND  VP FPY K LF  +    G + K++
Sbjct  419   RNTYYVGGLMAFELTERNSSYAMGLVCKHFANDNSVPKFPYAKSLFSSQQRWGG-SPKRM  477

Query  1744  DEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQ  1923
              E+PGV+FP LSSLD YL+HWG  GVT+NKTLYTW+NE+G V+ +RTY E+H NA  IAQ
Sbjct  478   TEVPGVEFPNLSSLDGYLKHWGAHGVTQNKTLYTWINEEGVVVSQRTYAELHDNASCIAQ  537

Query  1924  KLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHI  2103
             KLLT + P I+P D+VLL++VPGLDFVDAFFGCLRA V+P+P +PPDP QRGG QALL I
Sbjct  538   KLLTCKNPVIRPRDRVLLVHVPGLDFVDAFFGCLRANVLPVPVLPPDPLQRGG-QALLKI  596

Query  2104  ANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSWVkkpk  2280
              NIAK C  VAILST SYH  V+  S KNM+     K KSS  WP+LPWLHTDSW+K  K
Sbjct  597   ENIAKSCGAVAILSTISYHWAVQAGSVKNMISLTAKKPKSSGRWPNLPWLHTDSWIKNSK  656

Query  2281  lfkkpk-DEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTIL  2457
                     ++ +P  +++ FLQFTSGST D KGVMITH G+IHNVKLMR+RY STS+T+L
Sbjct  657   NVVVEDFKDEFEPQPDEVSFLQFTSGSTGDAKGVMITHSGLIHNVKLMRRRYNSTSKTVL  716

Query  2458  VSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAF  2637
             VSWLPQYHDMGLIGG+ T LVSGG+ +LFSP+TF++NPLLWLQ MSK++ATH        
Sbjct  717   VSWLPQYHDMGLIGGIFTALVSGGTAVLFSPLTFIRNPLLWLQIMSKYQATH--------  768

Query  2638  ELLVRRLESSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAE  2817
                                          IRQ TLKRFVEL + FGLS+EVMAPGYGLAE
Sbjct  769   -----------------------------IRQKTLKRFVELARPFGLSQEVMAPGYGLAE  799

Query  2818  NCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWI  2997
             NCVFVSCAYGEG  + VDWQGRVCCGY+  P  + VDI+I+ PE+G+E  + GKEGEIWI
Sbjct  800   NCVFVSCAYGEGKSIMVDWQGRVCCGYV-NPGDEDVDIRIVDPESGEELKEAGKEGEIWI  858

Query  2998  SSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAG  3177
             SS SAGIGYWG EELSQ T+ N +   PG+ Y RTGDLGRIID KLFITGR KDLIIVAG
Sbjct  859   SSPSAGIGYWGREELSQNTYRNKLPDYPGRIYTRTGDLGRIIDRKLFITGRIKDLIIVAG  918

Query  3178  KNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGK  3357
             +NIY++D+EKTVES++E+VRPGCCAV+ +P ++L  KGI     +D++GLVVIAEVRDG+
Sbjct  919   RNIYSADVEKTVESAAEVVRPGCCAVIAVPMEILSMKGISVPDNADQVGLVVIAEVRDGE  978

Query  3358  PLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVIEE  3537
             P+  DV++ I  RVAEEHGV +AS+  I+P++ISKTTSGKIKR+EC ++F  GTL+V+ E
Sbjct  979   PVGKDVVEQIQARVAEEHGVTVASVKMIRPKTISKTTSGKIKRFECLQQFTDGTLNVVPE  1038

Query  3538  QMNGERSLPRN-------DGI--------IVPANGKISKTDIVNFLKDLLSQQTGIPVSK  3672
              +   + L R+       +G           P + KIS  DIV+FLK L+S+QTGI +SK
Sbjct  1039  PILINKKLMRSFTTGTCKEGTPRPQFVRGSPPPSPKISNKDIVDFLKRLVSEQTGISISK  1098

Query  3673  ISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEKNHPM  3852
             IS  E+LVSYG++SIGVVRAAQK+S F G+ +GA+DIF+ATCI DLA F E+L+  + P 
Sbjct  1099  ISNTESLVSYGIDSIGVVRAAQKLSDFLGVPVGAVDIFTATCIADLASFSENLVMNSQPQ  1158

Query  3853  LTNS--------SETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPAYISVSMF  4008
             L+ +        +ET+  S+ +   +     + IW   L+AL YV+ +L IPAY+SVS F
Sbjct  1159  LSTTPSNVPQLETETETDSAELVMELPESQHLVIWSFQLLALVYVAFMLSIPAYLSVSAF  1218

Query  4009  KPLILANQS-----PWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPEIS  4173
                I A  +     P+  Y I L  AP +W+LCI  TC+    LGN+ L+PNY LNPE+S
Sbjct  1219  MKCISATHALVEGIPYLDYLILLTFAPLAWILCILSTCVSIAFLGNSFLKPNYALNPEVS  1278

Query  4174  VWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDPLL  4353
             +WSV+FVKWWALYKA E++SKVLA HLRGT+FL YWFK+LGA+I SS  +DTVDITDP L
Sbjct  1279  IWSVDFVKWWALYKAHEVASKVLAEHLRGTMFLKYWFKMLGARIGSSVFLDTVDITDPSL  1338

Query  4354  VSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLAQN  4533
             VSI + +VI+EGALIQSHEVKNGVLSF  +RIG+ SS+GPYAV+QKG+I+G+  EV+A  
Sbjct  1339  VSIGDGAVIAEGALIQSHEVKNGVLSFLPIRIGQNSSVGPYAVVQKGTILGEDLEVMALQ  1398

Query  4534  KKAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLNSLSAAIAYLVWIWL  4713
             K      +K  +   GK+   + K        V+Q  GIY++G L +LSA+I YLV+IW+
Sbjct  1399  KSGGKSAAKATDLQNGKMLPNVTKETE--DGVVYQFIGIYIVGLLGTLSASIVYLVYIWM  1456

Query  4714  LQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHGLILSV  4893
              QKP S   F F C+ GAFHW PY +I +  MF+++P+  +  +  +A  Y A+G++LS 
Sbjct  1457  SQKPLSPQEFAFACLFGAFHWMPYTVIAYATMFSNVPLGIIYSSISMAVAYLAYGVVLSF  1516

Query  4894  FTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWMGAKIGQH  5073
              T  L   +S            W+ HR+ +ACH RFAKLLSGTE FC+Y+  +GAK+G+H
Sbjct  1517  LTAALTRLISSNQGKKTTHFRMWLCHRITIACHHRFAKLLSGTEAFCMYMRLLGAKVGKH  1576

Query  5074  CSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQGLILP  5253
             CSIRAINP+ +P L+S+  GVHLGDFSRI+ GY+++ G +SG++++ +NSV+GS+ ++LP
Sbjct  1577  CSIRAINPISDPKLISLGSGVHLGDFSRIIAGYYSSHGLVSGKVEVHDNSVVGSESVVLP  1636

Query  5254  GSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMDPKYKKVLG  5433
             GS ++KDVILGALSVAP+NSVL+  G ++GS+  +M++N    L+DRIEEMD KYKK++G
Sbjct  1637  GSVLQKDVILGALSVAPVNSVLQAGGVYIGSQAPMMIKNTMHSLEDRIEEMDMKYKKIVG  1696

Query  5434  SLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYPVIIRHSNCL  5613
             +LAANLAA+TLK+KSRYFHRIG +GKG+L++Y  + GLPDHKIF  G +YPV++RHSN L
Sbjct  1697  NLAANLAATTLKVKSRYFHRIGVSGKGTLKIYGNIKGLPDHKIFCQGKSYPVMVRHSNSL  1756

Query  5614  SSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFATWLVCGAAA  5793
             S+DDDAR+D RGAAIRI     +  ++ + L DLTLKTGKAF+ARTI DFATWLVCG  A
Sbjct  1757  SADDDARIDARGAAIRI----LSDESSESSLFDLTLKTGKAFYARTIADFATWLVCGLPA  1812

Query  5794  REEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKLRPFDEKIG  5973
             REE+VK APH+RDA+W SLR  NSY ELHYYSNICRLFRF+DGQEMYV+FKLRP DE I 
Sbjct  1813  REEYVKRAPHVRDAVWTSLRHANSYAELHYYSNICRLFRFEDGQEMYVKFKLRPSDENIS  1872

Query  5974  EEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQIQPIPDD  6153
             EE G+VEP GILPP+TGAIPR +ND RPLLFLA+DF+ RV++ + VRY+ QLQ++P+P D
Sbjct  1873  EEAGKVEPIGILPPDTGAIPRSDNDTRPLLFLAKDFQSRVNA-EGVRYIFQLQVRPVPRD  1931

Query  6154  ERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEIDVIRATSC  6333
             E  R+  LDCTKPW E E PYI+VGE+ I+  L+ ++SE+L+FNPF RC E+DVIRA+SC
Sbjct  1932  EAARDIALDCTKPWSESEFPYIDVGEVNINHNLSAEQSEQLDFNPFLRCPEVDVIRASSC  1991

Query  6334  NQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAKLENKDMPKA  6513
             +QSASIDHGRSL+YEICQ+LRN  PLPEAW+IFL+QSDVK+DLSGCP+AA L  KD  K 
Sbjct  1992  SQSASIDHGRSLIYEICQHLRNGAPLPEAWKIFLEQSDVKVDLSGCPMAASLMKKDAQKV  2051

Query  6514  TLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQWLLPLWWGG  6693
             TL R  +  LW    QP LQ VLP+FLL LVIYAPLN   + +   +I   WL PL+W  
Sbjct  2052  TLERTLFQALWATFAQPLLQTVLPHFLLALVIYAPLNWTLHMNNTQKIALHWLFPLFWVS  2111

Query  6694  SGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYFMETATGTFLM  6873
             SG+LAGL C ++KW+LVGKK +G+T  IWS G+F+DT WQA RT+ G YF E  +G+   
Sbjct  2112  SGLLAGLACIVAKWLLVGKKKEGETVHIWSIGVFLDTTWQAFRTLVGSYFAEMTSGSIFF  2171

Query  6874  GIWMRLMGSEVARD-GVYIDSMGATLNPDMVRIEEYGSVGREALLFGHIYEGG-GEVKYG  7047
              +WM+LMGSE+  D G Y+DSMGA LNP+MV IE  G VGREALLFGHIYEG  G+VK+G
Sbjct  2172  VLWMKLMGSEIELDQGAYVDSMGALLNPEMVEIERGGCVGREALLFGHIYEGDEGKVKFG  2231

Query  7048  RISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             +ISV  GGFVGSRA+AMPG  ++ GGSL ALSLAM
Sbjct  2232  KISVGEGGFVGSRAIAMPGVRVEVGGSLSALSLAM  2266



>ref|XP_010943571.1| PREDICTED: uncharacterized protein LOC105061266 [Elaeis guineensis]
Length=2307

 Score =  2853 bits (7397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1418/2314 (61%), Positives = 1755/2314 (76%), Gaps = 64/2314 (3%)
 Frame = +1

Query  340   KLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGMCESIDIQGRTYD  519
             KLHPC P  TRI IVGAGPSGLSAAYAL KLGYSNV + EKH +  GMCES+DI+G+TYD
Sbjct  7     KLHPCFPVETRICIVGAGPSGLSAAYALAKLGYSNVTIFEKHQTVAGMCESVDIEGKTYD  66

Query  520   LGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDS-DWAYTDMRVAEDYISVIPITL  696
             LGGQV+AANSAP I HLAKEVGAE EEMD+HKLAL+DS   +Y DM VA+DY+S++ +TL
Sbjct  67    LGGQVIAANSAPAISHLAKEVGAEFEEMDSHKLALIDSRTGSYKDMEVADDYVSIMSLTL  126

Query  697   KLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTASGYGFIQDMPYAY  876
             KLQDE   +  IG++++S++ASD T +FLK  GL SVPKSVAYGYTASGYG++QDMPYAY
Sbjct  127   KLQDEANKSGHIGIHALSDVASDPTLDFLKHHGLNSVPKSVAYGYTASGYGYVQDMPYAY  186

Query  877   IHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNSSGVCVDVRHRNG  1056
             I EF RTSMAGKIRRF+GGYTS+W+KLS+++P    CNTEVL + R+  GV V VR+  G
Sbjct  187   IQEFTRTSMAGKIRRFEGGYTSMWQKLSQSLPFNVLCNTEVLKVTRSCIGVSVTVRNAGG  246

Query  1057  ALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDLFSKVQTIEYYTS  1236
                 MEFDKII+SGA  F NGRTYRS S  +AG   + + ++ LEK+LFSKVQTI+YYT+
Sbjct  247   EENIMEFDKIILSGALAFKNGRTYRS-SSLSAGE-NEVVALNDLEKELFSKVQTIDYYTT  304

Query  1237  VLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSYGNSIDILGSEVM  1416
             VL+I GL+ +P+GFYYF  FMEDPA IG+PVAMQ+F+ DT+VFLFWSYGNS+DI GS V 
Sbjct  305   VLKIKGLDRMPLGFYYFGEFMEDPATIGHPVAMQRFFADTDVFLFWSYGNSLDIKGSTVT  364

Query  1417  ELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQGQLNTYYVGGLMA  1596
             +L    V  MGG V+KV+LQR FKYFPHVN +DMK+GFYEKLE+Q+QG  NTYYVGGL+A
Sbjct  365   KLLMDVVNTMGGIVEKVLLQRRFKYFPHVNSEDMKNGFYEKLESQIQGFQNTYYVGGLLA  424

Query  1597  FELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQLDEIPGVKFPEL  1776
             FELTERN+SY+MALI KHFAND  +P FPYVKRLFPL S  E  + K+L E+PGV+FP+L
Sbjct  425   FELTERNSSYAMALICKHFANDNELPVFPYVKRLFPLISGHEPCSPKELGELPGVEFPDL  484

Query  1777  SSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIK  1956
              SLDSYL+ WGT  +T NKTLYTW++E+G  ++RRTY E+H NA  IA+KLLTS KP +K
Sbjct  485   PSLDSYLKFWGTHTITMNKTLYTWIDEEGQAVNRRTYGELHDNASLIARKLLTSNKPILK  544

Query  1957  PGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVA  2136
             PGD+VLLI++PGL+FVDAFFGCL+A++IP+P +PPDP QRGG QALL I NI+K  + VA
Sbjct  545   PGDRVLLIFLPGLEFVDAFFGCLKAKIIPVPVLPPDPLQRGG-QALLKIENISKASDAVA  603

Query  2137  ILSTFSYHVTVRIMSAKN-MLFGKSKDKSSNSWPDLPWLHTDSWV------kkpklfkkp  2295
             +LST SYH  VR    KN ++  KS  K S  WPDLPWLHTDSW+               
Sbjct  604   LLSTSSYHAAVRAGFVKNVIMLTKSNTKYSARWPDLPWLHTDSWIKNYRNHSSNSSLIAE  663

Query  2296  kDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQ  2475
              + + QP   DLCFLQFTSGST D KGVMITHGG+IHNVKLMRKRY+STSRTILVSWLPQ
Sbjct  664   VNSESQP--NDLCFLQFTSGSTGDAKGVMITHGGLIHNVKLMRKRYRSTSRTILVSWLPQ  721

Query  2476  YHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRR  2655
             YHDMGLIGGL T LVSGG+ ILFSP+TF++NPLLWLQT++  RATHSA PNFA EL++RR
Sbjct  722   YHDMGLIGGLFTALVSGGTAILFSPMTFIRNPLLWLQTINDHRATHSAGPNFAIELVIRR  781

Query  2656  LESSKEEN--FDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVF  2829
             LES K +   +DLSS+ FLM AAEP+RQ TLKRF+E+++SFGLS+EVMAPGYGLAENCVF
Sbjct  782   LESDKNKTRAYDLSSLVFLMVAAEPVRQKTLKRFIEISRSFGLSQEVMAPGYGLAENCVF  841

Query  2830  VSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLS  3009
             VSCA+GEG PVFVDWQGRVCCGY+   + D VDI+I+ PET KE+++ GKEGEIWISS S
Sbjct  842   VSCAFGEGKPVFVDWQGRVCCGYVCSNDLD-VDIRIVDPETLKEHEEYGKEGEIWISSPS  900

Query  3010  AGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIY  3189
             AG+GYWG +E+SQKTF N++ + PGK++ RTGDLGRIID KLFITGR KDLIIVAG+N+Y
Sbjct  901   AGVGYWGSQEMSQKTFFNELENQPGKKFTRTGDLGRIIDGKLFITGRIKDLIIVAGRNVY  960

Query  3190  TSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGKPLPY  3369
             ++D+EKTVESSSEL+R GCCAVVG+PE++L +KGI      D++GLVVIAEV+DGKP+  
Sbjct  961   SADVEKTVESSSELLRAGCCAVVGVPEEILTAKGISIPEIFDQVGLVVIAEVKDGKPVNG  1020

Query  3370  DVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVIEEQMNG  3549
             ++++ I TRVAEEHGVP+A++  IKPR+I KTTSGKI+R+EC K+F  GTL +  E  + 
Sbjct  1021  EIVEQIKTRVAEEHGVPVAAVNLIKPRTICKTTSGKIRRFECLKQFTEGTLSLATEPGSS  1080

Query  3550  ERSLPRN-------DGIIV-------------PANGKISKTDIVNFLKDLLSQQTGIPVS  3669
             +RSL R+       +G                P N   S  +I  FLK L+S+QTGIPV 
Sbjct  1081  KRSLFRSFKTGSSLEGQRTCSLLCKPRSPHPQPLNVGKSTNEITEFLKGLVSEQTGIPVD  1140

Query  3670  KISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEKNHP  3849
             KI+T E+LVSYG++SIGVVRAAQK+S + G+ +GA+DIF+ATCI DLA F E+LL K+ P
Sbjct  1141  KIATTESLVSYGIDSIGVVRAAQKLSDYLGVPVGAVDIFTATCISDLASFSENLLMKSQP  1200

Query  3850  --MLTNSSETKISSSGIPSV--VSTFDKITIWLIHLVALAYVSLLLIIPAYISVSMFKPL  4017
               + T S   ++ +  +  V  VS   K+ I    L+A+ Y+S +LI+PAY S S F   
Sbjct  1201  QSLTTASHSPEVETELLLPVIDVSPLWKLGIGFFQLLAIIYISCILILPAYFSCSAFLSF  1260

Query  4018  ---ILANQSPWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPEISVWSVE  4188
                I    +    + ISL   P +W+  IF TC+   + GN+ LQPNYVL PEIS+WS++
Sbjct  1261  LSHIPVEHTSLSCFLISLFLTPLAWIFYIFFTCLSLCIFGNSFLQPNYVLTPEISIWSID  1320

Query  4189  FVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDPLLVSIDE  4368
             FVKWWAL KA+E++ KVLAVHLRGT FLNYWFK+ GA++ SS LIDTVDITDP LVSI  
Sbjct  1321  FVKWWALNKAREVAGKVLAVHLRGTTFLNYWFKMQGAQVGSSVLIDTVDITDPPLVSIGG  1380

Query  4369  ESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLAQNKKAAA  4548
              +VI+EG LIQSHEV+NGVLSF  +++G+ SSIGPYAV++KGSIVG+  ++L   K    
Sbjct  1381  GAVIAEGVLIQSHEVRNGVLSFQPIKVGRNSSIGPYAVIEKGSIVGEDVDILPLQKIEG-  1439

Query  4549  KISKPLNGHKGKVTRRIRKRNHGNHN--SVFQLFGIYMIGYLNSLSAAIAYLVWIWLLQK  4722
                       GK   R  K   G       +   GIY +G+LNSL  AI YL++I+L + 
Sbjct  1440  ----------GKPVFRSEKMFKGQKKLGPFYHFMGIYAVGFLNSLCGAILYLMYIYLSKS  1489

Query  4723  PPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHGLILSVFTF  4902
              P LHHF F+C+AGAFHW P  I  + A+ + +P +  +FA  VA GY  HGLIL + + 
Sbjct  1490  SPLLHHFTFVCLAGAFHWLPSTITVYVAITSKVPSNPTTFAFFVAIGYVTHGLILGLISG  1549

Query  4903  MLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWMGAKIGQHCSI  5082
              LN  ++R     +     W+ HR+NVA H+RFAKLLSGTE FC++L  +GAKIG HCSI
Sbjct  1550  FLNRLLTRNQGIKQSHLRTWLRHRINVAFHLRFAKLLSGTEAFCMFLRLLGAKIGWHCSI  1609

Query  5083  RAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQGLILPGSF  5262
             RAINPV  P L+S+ DGVHLGDFSRI+ G+++ G +  G++ ++ NSV+GSQ L+LPG+ 
Sbjct  1610  RAINPVTNPELISIGDGVHLGDFSRILTGFYSPGRFSYGKVKVQRNSVLGSQSLVLPGTI  1669

Query  5263  IEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMDPKYKKVLGSLA  5442
             I++DVILG+LS+AP+NS+L+  G +VGS+  VMV+N     D+RIEEMD KYKK++G+LA
Sbjct  1670  IQEDVILGSLSIAPVNSLLQNGGIYVGSKIPVMVKNTLHASDERIEEMDQKYKKIVGNLA  1729

Query  5443  ANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYPVIIRHSNCLSSD  5622
              NLA +T+ + SRYFHRIG  G+G L++Y  LPG   HKIF      PVIIRHSN LS+D
Sbjct  1730  GNLAITTMNVNSRYFHRIGVGGRGLLKMYQDLPGFQKHKIFCAAKCLPVIIRHSNSLSAD  1789

Query  5623  DDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFATWLVCGAAAREE  5802
             DDAR+D RGAAIRIL       +   PLLDLTLKTGKAF+ARTI DFATWLVCG  ARE+
Sbjct  1790  DDARIDARGAAIRILSE----GSGEAPLLDLTLKTGKAFYARTIADFATWLVCGLPAREQ  1845

Query  5803  HVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKLRPFDEKIGEEY  5982
              VK APHIRDA+WGS+R  NSY ELHYYSNICRL RF DGQEMYV+FKLRP D +I E+ 
Sbjct  1846  QVKRAPHIRDAVWGSMRNANSYVELHYYSNICRLLRFDDGQEMYVKFKLRPLDPEIDEDS  1905

Query  5983  GEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQIQPIPDDERV  6162
             G+V P GILPPETGAIPR E+D RPLLFLA+DF+ RV SP  V Y+ QLQ +P+P  E  
Sbjct  1906  GQVAPEGILPPETGAIPRKESDTRPLLFLADDFRKRVDSPGGVHYIFQLQCRPVPSHEAD  1965

Query  6163  RETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEIDVIRATSCNQS  6342
             R+  LDCTKPWDE E PYI++GEITID+ LT +ESE L+FNPF RC+E+DVIRATSC+QS
Sbjct  1966  RDVALDCTKPWDETEFPYIDIGEITIDKNLTAEESERLDFNPFLRCHEVDVIRATSCSQS  2025

Query  6343  ASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAKLENKD--MPKAT  6516
             ASIDHGRSL+YEICQ LRN +PLP AWR FL+QSD K+DLSGCP+AA ++ K       T
Sbjct  2026  ASIDHGRSLIYEICQQLRNGQPLPAAWRSFLEQSDAKVDLSGCPMAAAVQAKKGGARSIT  2085

Query  6517  LARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQWLLPLWWGGS  6696
             LAR WY  LW  + QP LQ  LPYF+LGLV++ PL  +    E+ Q+   WLLPL+W  S
Sbjct  2086  LARTWYQMLWATTCQPLLQTFLPYFILGLVLFRPLQQMLIVKEVKQLPLHWLLPLFWVLS  2145

Query  6697  GILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYFMETATGTFLMG  6876
             GILA L C L+KWVLVGKK +G+T  IW  G+FMD++WQA+RTV G+YF+E   G+ L G
Sbjct  2146  GILAALACVLAKWVLVGKKKEGQTVMIWGWGVFMDSLWQALRTVVGDYFVEMTCGSILFG  2205

Query  6877  IWMRLMGSEV-ARDGVYIDSMGATLNPDMVRIEEYGSVGREALLFGHIYEG-GGEVKYGR  7050
              WMRLMGS +    GV++DSMGA LNP+MV IE+ GSVGR+ALLFGHIYEG GG VK+G+
Sbjct  2206  TWMRLMGSGIEVGQGVFVDSMGAVLNPEMVEIEKGGSVGRDALLFGHIYEGEGGMVKFGK  2265

Query  7051  ISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             + ++ GG+VGSRAVAMPG  I+SG SL ALSLAM
Sbjct  2266  VRIEEGGYVGSRAVAMPGVRIESGASLDALSLAM  2299



>gb|KHN33325.1| Long-chain-fatty-acid--AMP ligase FadD28 [Glycine soja]
Length=2327

 Score =  2842 bits (7368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1392/2327 (60%), Positives = 1772/2327 (76%), Gaps = 52/2327 (2%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+    V+D F KLHP MP  TRIGIVGAGPSGLSAAYAL +LGY+N+ VLEKHH+ GGM
Sbjct  1     MDPERSVEDQFSKLHPSMPVNTRIGIVGAGPSGLSAAYALARLGYNNITVLEKHHTVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRV  660
             CES++I+G+ YDLGGQVLAA+SAP IFHLAKE G+ +EEMD+HKLA++DS    Y D++V
Sbjct  61    CESVEIEGKVYDLGGQVLAASSAPVIFHLAKETGSPLEEMDSHKLAVIDSSSGKYRDVKV  120

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             A+DY+SV+ +TL++Q++VK + R GV+++SE+ASD+ P++L+  GLKSVPKSVAYGYTAS
Sbjct  121   ADDYVSVMTLTLEIQEKVKNSGRFGVHALSEVASDLAPDYLERHGLKSVPKSVAYGYTAS  180

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGFIQDMPYAYIHEF RTSMAGKIRRFKGGYTS+W++++E++PIK   NTEVL+I+RNS
Sbjct  181   GYGFIQDMPYAYIHEFTRTSMAGKIRRFKGGYTSLWQRIAESLPIKLHYNTEVLAIRRNS  240

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
               V V+V+  N  ++ ME+DKIIISG FP   GRTY+S          D MD+S LEKDL
Sbjct  241   DSVTVNVKGSN-EIETMEYDKIIISGNFPLKYGRTYKSVPSTCLENETDVMDVSELEKDL  299

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             FSKV+T +YYT+VL+I GLEH+P+GFYYF  +MEDP+ IGNPVAMQKFY D+N+FLFWSY
Sbjct  300   FSKVETNDYYTTVLKIKGLEHMPVGFYYFGEYMEDPSTIGNPVAMQKFYADSNIFLFWSY  359

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GNS DI G  V ELA K++  MGG+V+  ILQR FKYFPHV+ QDM++GFYEKLE++LQG
Sbjct  360   GNSADIKGPTVTELAIKSIESMGGEVENFILQRRFKYFPHVSSQDMRNGFYEKLESELQG  419

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
               NTYYVGGLMAFELTERN+SY+MALI K+FA+   +P FPY K LFPL++  +    K+
Sbjct  420   SRNTYYVGGLMAFELTERNSSYAMALICKNFASSSDLPVFPYTKSLFPLQTEIQKKEPKE  479

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             L E+PGVKFP   +L+SYL+HWGT  VT+N+TLYTWLNE G V+D+RTY E H NA  IA
Sbjct  480   LGELPGVKFPNFPALNSYLKHWGTHPVTQNRTLYTWLNEGGTVVDKRTYGEQHLNASCIA  539

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
              KLLTSQKP IKPGD+VLL+YVPGLDFVDAFFGCLRA+V+P+P +PPDP QR GGQAL+ 
Sbjct  540   HKLLTSQKPVIKPGDRVLLVYVPGLDFVDAFFGCLRAKVLPVPVLPPDPMQR-GGQALMK  598

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKD-KSSNSWPDLPWLHTDSWVkkp  2277
             I NI K C  VAILST SYH  VR+   K+++    K+ KS+  WP LPWLHTD+WV   
Sbjct  599   IENITKSCGIVAILSTVSYHSAVRVGLVKSLISLTGKNGKSTAQWPKLPWLHTDTWVNNS  658

Query  2278  klfkkp-kDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTI  2454
             +       D+Q +    D+CFLQFTSGST D KGVMITHGG+IHNVKLMR  YKSTSRT+
Sbjct  659   RNSAVEDVDDQCESQPGDVCFLQFTSGSTGDAKGVMITHGGLIHNVKLMRIIYKSTSRTV  718

Query  2455  LVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFA  2634
             LVSWLPQYHDMGLIGGL T LVSGGS +LFSP+TF+K PLLWL+T+SK++ATHSA PNFA
Sbjct  719   LVSWLPQYHDMGLIGGLFTALVSGGSAVLFSPLTFIKKPLLWLETISKYQATHSAGPNFA  778

Query  2635  FELLVRRLESSKE--ENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYG  2808
             FEL+VRRLES K+  +N DLSSM FLM AAEP+R  TL RF++LT  FGLS++VMAPGYG
Sbjct  779   FELVVRRLESEKDKLQNLDLSSMIFLMVAAEPVRMKTLNRFLDLTTPFGLSQKVMAPGYG  838

Query  2809  LAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGE  2988
             LAENCVFVSCA+GEG P+ VDWQGRVCCGYI  P    VDI I+ PE+G+E ++ GKEGE
Sbjct  839   LAENCVFVSCAFGEGYPILVDWQGRVCCGYI-HPGDADVDIAIVDPESGEELEEDGKEGE  897

Query  2989  IWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLII  3168
             IWISS SAGIGYWG EELSQKTF N++ + PG+ Y +TGDLGRIID KLFITGR KDLII
Sbjct  898   IWISSPSAGIGYWGKEELSQKTFRNELQNHPGRNYTKTGDLGRIIDGKLFITGRIKDLII  957

Query  3169  VAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVR  3348
             VAG+NIY++D+EKTVESSSE +RPGCCAV+ +PE++L +KGI     SD++GLVV+AEVR
Sbjct  958   VAGRNIYSADVEKTVESSSEFLRPGCCAVISVPEEILSAKGISLPDGSDQVGLVVVAEVR  1017

Query  3349  DGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDV  3528
             DGK +  DV++HI TRV EEHGV +AS+  IKPR+ISKTTSGKIKR+EC K+F   TL +
Sbjct  1018  DGKTVSKDVIEHIQTRVVEEHGVSVASVKLIKPRTISKTTSGKIKRFECLKQFSDETLSL  1077

Query  3529  IEEQMNGERSLPRNDGIIVPANG-----------------KISKTDIVNFLKDLLSQQTG  3657
             + + +  ++SL R+        G                 +IS  +IV  LK L+S+Q+G
Sbjct  1078  VPQPILTKKSLVRSFTTGTCREGRTPRAHLVRSSTPLPIPRISNKEIVEHLKRLISEQSG  1137

Query  3658  IPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLE  3837
             IPV+ IS  + + +YG++SIGVV+A QK++ F G+ + AID+F+A+CI +LA+F ESLL 
Sbjct  1138  IPVNNISVTDNMSTYGIDSIGVVKATQKLTDFLGVPVAAIDVFTASCIQELANFSESLLL  1197

Query  3838  KNHP-MLTNSS---ETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPAYISVSM  4005
             K+ P +++NSS   E +I S  +   VS   +  I L+ L+AL Y+S++L+ PAY+S++ 
Sbjct  1198  KSQPQLMSNSSHAPEAEIDSIEVVVDVSKSRQWGICLLQLLALVYISIMLVTPAYLSITA  1257

Query  4006  FKPLILANQS------PWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPE  4167
             F+  I  N S      PW  Y ISL  AP SW+LC+  TCIC    GN+ L+PNY L PE
Sbjct  1258  FQSFI-PNVSESVYGMPWSSYLISLTLAPLSWILCMVSTCICISFFGNSFLRPNYALTPE  1316

Query  4168  ISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDP  4347
             IS++S++FVKWWALYK QEISSKVLA HLRGTVFL YWF+ LGA+I S  L+DTVDITDP
Sbjct  1317  ISIYSMDFVKWWALYKTQEISSKVLATHLRGTVFLKYWFETLGARIGSLVLLDTVDITDP  1376

Query  4348  LLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLA  4527
              LVSI +E  I+EG L+QSHEVKNG+LSF  +RIGK SSIGPY+++QKGS++ +G+EV  
Sbjct  1377  SLVSIGDEVAIAEGVLVQSHEVKNGILSFLPIRIGKNSSIGPYSIIQKGSVIKEGSEVHP  1436

Query  4528  QNK-KAAAKISKP--LNGHKGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLNSLSAAIAYL  4698
               K +    + KP  LN  K      +   N    N+++   GIY+ G ++SL+AAIAY+
Sbjct  1437  LEKVEGGQHVLKPAKLNNVKENAVLLV-TTNKTQSNAMYHFLGIYLTGLVSSLAAAIAYI  1495

Query  4699  VWIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHG  4878
             ++I L   P S  HF F+CI GAFHW P+ I+ +  MF+++P + ++F     + Y  HG
Sbjct  1496  LYIRLFHLPASFQHFSFLCICGAFHWIPFTIVAYATMFSNVPSNPIAFTFSFTSAYLLHG  1555

Query  4879  LILSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWMGA  5058
             LILS  T  L   +  K + ++   + W+ H++ + CH RFAKLLSGTE FC+YL  +GA
Sbjct  1556  LILSSLTCALTRLL--KLNQNQTHFKTWLRHQLTIFCHHRFAKLLSGTEAFCIYLRLLGA  1613

Query  5059  KIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQ  5238
             KIG+HCSIRAINPV  P L+S+ DGVHLGDFS+I+ G+H + GY  G+I++++NSV+GSQ
Sbjct  1614  KIGKHCSIRAINPVSNPELMSIGDGVHLGDFSKIITGFHYSNGYACGKIEVQDNSVVGSQ  1673

Query  5239  GLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMDPKY  5418
              LILPGS +EK+VILGALSVAP+NS+L     ++GS+  V  RN +  LD+RIEEMD +Y
Sbjct  1674  SLILPGSVVEKNVILGALSVAPMNSILHEGSVYIGSQTRVATRNSSYDLDERIEEMDMEY  1733

Query  5419  KKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVL-PGLPDHKIFGPGATYPVII  5595
             KKV+ ++AANLA +T+ +K+RYFHRIG +GKG L++Y+ L  G+P HKIF PG +YP+++
Sbjct  1734  KKVVANMAANLAVTTINVKARYFHRIGVSGKGHLKIYDKLDDGIPLHKIFHPGKSYPIMV  1793

Query  5596  RHSNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFATWL  5775
             RHSN LS+DDDAR+D RGAA+RIL  +   +    PL+DLTLKTG AF+ART+ DFATWL
Sbjct  1794  RHSNSLSADDDARIDARGAALRIL-SDAPDSNHHVPLIDLTLKTGNAFYARTLADFATWL  1852

Query  5776  VCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKLRP  5955
             VCG  AREE VK  PH+R+A+W SLR  NSY ELHYYSNICRL RF DGQEMYV+FKLRP
Sbjct  1853  VCGLPAREELVKRTPHVREAVWNSLRHANSYAELHYYSNICRLMRFTDGQEMYVKFKLRP  1912

Query  5956  FDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQI  6135
             FD  I E+ G+V P GILPPETGAIPRDE D RPLLFLA+DF+ RV+SP  VRYV Q+Q+
Sbjct  1913  FDTSISEDTGKVVPTGILPPETGAIPRDEKDTRPLLFLAKDFQRRVNSPGGVRYVFQVQL  1972

Query  6136  QPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEIDV  6315
             + +P+DE  R+  LDCTKPWDE E PYI+VGEI I++ L+ +ES+ LEFNP+ + +E+DV
Sbjct  1973  RAVPEDEAARDMALDCTKPWDENEFPYIDVGEININENLSREESDRLEFNPYLKSHELDV  2032

Query  6316  IRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAKLEN  6495
             I ATS  QSASIDHGRSL+YEICQ++RNR+PLPE+WR  ++QS+VK+DLS CP+AA L  
Sbjct  2033  IPATSNTQSASIDHGRSLIYEICQHVRNRQPLPESWRNLVEQSNVKVDLSCCPVAALLPK  2092

Query  6496  KDMPKA----TLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQK  6663
             K+  K     TL R WY T   +  QP LQ VLPY ++GL ++APLN L     + +I  
Sbjct  2093  KETKKVMTTLTLTRTWYQTFSALFTQPLLQTVLPYTVVGLAVFAPLNFLVNMKNVEKIPV  2152

Query  6664  QWLLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYF  6843
             QW+ PL+W  SG++A L C ++KW+LVG+K  G+T PIWS+ + MD+ WQAIRT+ G+YF
Sbjct  2153  QWMFPLFWVVSGVMAALACVVAKWILVGRKKDGETVPIWSKRVAMDSTWQAIRTLVGDYF  2212

Query  6844  METATGTFLMGIWMRLMGSEVARD--GVYIDSMGATLNPDMVRIEEYGSVGREALLFGHI  7017
             M+ A+G+FL  +WM+LMG+++  +  G Y+DS GA LNP+MV+IE  G VGREALLFGHI
Sbjct  2213  MDMASGSFLFVMWMKLMGADIDMEGGGAYVDSTGALLNPEMVKIERGGCVGREALLFGHI  2272

Query  7018  YEG--GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             YEG  GG VK+G I +   GFVGSRAV MPG  +++  +L ALSLAM
Sbjct  2273  YEGDEGGMVKFGGIKIGEDGFVGSRAVVMPGVHVENEANLSALSLAM  2319



>gb|KGN54114.1| hypothetical protein Csa_4G286390 [Cucumis sativus]
Length=2318

 Score =  2840 bits (7363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1409/2318 (61%), Positives = 1761/2318 (76%), Gaps = 43/2318 (2%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M++G   +D F KLHP +P  TR GI+G GPSGLSAAYAL KLGY+ V VLEK+   GGM
Sbjct  1     MDTGKSFEDKFSKLHPSLPLNTRFGIIGGGPSGLSAAYALAKLGYNEVTVLEKNQDVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWAYTDMRVA  663
             CES++I+G+ YDLGGQVLAANSAPTIFHLAKE G+E+EE+D+HKLAL+D+   Y D+RVA
Sbjct  61    CESVEIEGKIYDLGGQVLAANSAPTIFHLAKETGSELEELDSHKLALIDTSGEYQDIRVA  120

Query  664   EDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTASG  843
             +DY S I +TL+LQD+ K +  IGV++VS  ASD+TP +L+  GL SVPKSVAYGYTASG
Sbjct  121   DDYTSSISLTLELQDKAKDSGYIGVHAVSAFASDLTPTYLEAHGLTSVPKSVAYGYTASG  180

Query  844   YGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNSS  1023
             YGF+QDMPYAY+HEF RTSMAGKIRRFKGGY  +WK++SE++PIK  C TEV+S++R+S 
Sbjct  181   YGFVQDMPYAYVHEFTRTSMAGKIRRFKGGYGGLWKRISESLPIKVHCQTEVVSVRRSSK  240

Query  1024  GVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDLF  1203
              V + V  R+    ++EFDKIIISG+FPF N RTYRS S K +    + MDMS LE++LF
Sbjct  241   SVTLRVMDRDKNFTSLEFDKIIISGSFPFRNCRTYRSSSPKLSEEEAEVMDMSHLEEELF  300

Query  1204  SKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSYG  1383
             SKV TI+YYT+VL+IDGL HLP+GFYYF   M++P  IG PVAMQKFY DTN+FL WSYG
Sbjct  301   SKVYTIDYYTTVLKIDGLNHLPLGFYYFGKHMDNPETIGYPVAMQKFYPDTNIFLLWSYG  360

Query  1384  NSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQGQ  1563
             NS DI G  V ELA   + KMGG+VKKVILQR FKYFPHV  +DM+DGFY++LE +LQG 
Sbjct  361   NSADITGPNVTELAMNTIAKMGGEVKKVILQRRFKYFPHVCSKDMEDGFYKRLELELQGS  420

Query  1564  LNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQL  1743
             LNTYY GGLMAFELTERN+SY+MAL+ KHFAND    TF Y K +F  +S  E  A   L
Sbjct  421   LNTYYTGGLMAFELTERNSSYAMALVCKHFANDNSSLTFSYAKPMFLFQSKPERDAMG-L  479

Query  1744  DEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQ  1923
              E+PGV+FP LSSLD YLRHWG+  VT+++ LY WLNE+G VL +RTY+E+H NA  IAQ
Sbjct  480   GELPGVEFPNLSSLDGYLRHWGSHHVTQDRVLYNWLNEEGLVLGQRTYRELHLNASCIAQ  539

Query  1924  KLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHI  2103
             KLL++QKP+IKPGD+VLLIYVPGLDF+DAFFGCLRA+V+P+P +PPDP QR GGQALL I
Sbjct  540   KLLSNQKPSIKPGDRVLLIYVPGLDFIDAFFGCLRAKVLPVPVLPPDPLQR-GGQALLKI  598

Query  2104  ANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSWVkkpk  2280
               IAK C  VAILST  YH  VR+   KNM+   + K KSS  WP LPW+HTDSW+K   
Sbjct  599   EYIAKSCGAVAILSTLGYHSAVRVGKVKNMIGLMREKGKSSAVWPKLPWMHTDSWIKNFA  658

Query  2281  lfk--kpkDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTI  2454
                      +Q  P  +++ FLQFTSGST D KGV+ITHGG+IHNVKLMR+RYKSTSRT+
Sbjct  659   NLTPPDTMADQSDPHPDEVSFLQFTSGSTGDAKGVVITHGGLIHNVKLMRRRYKSTSRTV  718

Query  2455  LVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFA  2634
             LVSWLPQYHDMGLIGGL T LVSGG+ ILFSP+TF+KNPLLWL TMSK++ATHSA PNFA
Sbjct  719   LVSWLPQYHDMGLIGGLFTALVSGGTAILFSPLTFIKNPLLWLHTMSKYKATHSAGPNFA  778

Query  2635  FELLVRRLE--SSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYG  2808
             FEL+ RRLE    K + +DLSSM FLM AAEP+R+TTLK+F+ELT  FGL+ E MAPGYG
Sbjct  779   FELVARRLEVNKGKVQTYDLSSMVFLMIAAEPVRKTTLKKFLELTAPFGLTEEKMAPGYG  838

Query  2809  LAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGE  2988
             LAENCVFVSCA+GEG+P+FVDWQGRVCCGY+ Q N D +DI+I++P TGKE ++ GKEGE
Sbjct  839   LAENCVFVSCAFGEGIPIFVDWQGRVCCGYVDQDNAD-IDIRIVNPGTGKELEEDGKEGE  897

Query  2989  IWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLII  3168
             IWISS SAGIGYWG EELSQ+TF N++ + PG+RYIRTGDLGR+ID KLFITGR KDLII
Sbjct  898   IWISSPSAGIGYWGREELSQETFRNELQNHPGRRYIRTGDLGRVIDGKLFITGRIKDLII  957

Query  3169  VAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVR  3348
              AG+NIY +D+EKTVESSS+L+RPGCCAVVG+PE++L+ KGI     SD++GLVVIAEV+
Sbjct  958   AAGRNIYPADVEKTVESSSDLLRPGCCAVVGVPEEILMEKGIQVPDCSDQVGLVVIAEVK  1017

Query  3349  DGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDV  3528
             DGKP+  D++D I  RVAEEHGV +ASI  IKPR+ISKTTSGKIKR+EC K+F+ GTL+V
Sbjct  1018  DGKPIAKDIIDQIQNRVAEEHGVSVASIKLIKPRTISKTTSGKIKRFECLKQFVDGTLNV  1077

Query  3529  IEEQMNGERSLPRN-------DGII------------VPANGKISKTDIVNFLKDLLSQQ  3651
             + + +   R+  R+       +GI             V  + +IS  DI  FLK L+S+ 
Sbjct  1078  VPDAIKLRRTFLRSFSTGTCKEGITPRFQQTNLSRASVQPDPRISNRDIEEFLKGLVSEL  1137

Query  3652  TGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESL  3831
             T IP++KI   E+L+SYG++SI VVRAAQK+S+F G+ +GA+DIF+A+CI DLA   E++
Sbjct  1138  TNIPINKICATESLLSYGIDSILVVRAAQKLSNFLGVPVGAVDIFTASCIADLASISENI  1197

Query  3832  LEKNHPMLTNSSETKISSSGIPSV----VSTFDKITIWLIHLVALAYVSLLLIIPAYISV  3999
             L K+    T ++      +    V    +S   +  IW   L+AL +V++++I PAY+S+
Sbjct  1198  LAKSRAQSTKNTTNLTFETNCALVRMETISWTHQFGIWFFQLLALIFVAMMVIFPAYLSM  1257

Query  4000  SMF---KPLI--LANQSPWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNP  4164
             S F    P++  L +      Y + L  AP +W+LCI  +CIC    GN+ L+PNY L P
Sbjct  1258  SAFLSSLPILHDLTDNIYLMNYLLPLTLAPLAWILCIVSSCICIAFFGNSFLRPNYALTP  1317

Query  4165  EISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITD  4344
             E+S+WS++FVKWWALYKAQ++SSKVLAVHLRGTVFL YW+++ GA+I SS ++DTVDITD
Sbjct  1318  EVSIWSLDFVKWWALYKAQDVSSKVLAVHLRGTVFLKYWYEMFGARIGSSVILDTVDITD  1377

Query  4345  PLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVL  4524
             P LVSI +  VI+EGALIQSHEVKNGVLSF  +RIG+ SS+GPYA + KG+I+G+  EV 
Sbjct  1378  PSLVSIGDGVVIAEGALIQSHEVKNGVLSFLPIRIGQNSSVGPYASIHKGAILGEEVEVP  1437

Query  4525  A-QNKKAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLNSLSAAIAYLV  4701
             A Q  +     S      KG   RR         ++++   GIY++G+L SLSAAI Y  
Sbjct  1438  ALQRIEGIETTSGNRCFEKGSEPRRTGGERQ-ERDTIYHFLGIYLLGFLGSLSAAIVYYF  1496

Query  4702  WIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHGL  4881
             +IWL Q  PSL HF F+C+ GAFHW P+ +I +  +F  +P + +SFA + ++ Y  HG+
Sbjct  1497  YIWLSQSSPSLQHFAFLCLVGAFHWIPFTVIAYATIFAEVPSNAISFAILFSSMYLFHGI  1556

Query  4882  ILSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWMGAK  5061
             IL + TF +   ++ K   ++   + W+ HR+  A H+RFAKLLSGTE FC+YL  +GAK
Sbjct  1557  ILCILTFFVKKLLTSKPQMEQTPLKIWLCHRIITASHLRFAKLLSGTEAFCIYLRLLGAK  1616

Query  5062  IGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQG  5241
             IG+HCSIRAINPV +P L+S+  GVHLGDFSRI+ G+++T G   G+I+++ENSVIGSQ 
Sbjct  1617  IGKHCSIRAINPVSDPELISIRMGVHLGDFSRIISGFYSTNGLTRGKIEVQENSVIGSQS  1676

Query  5242  LILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMDPKYK  5421
             ++LPGS I++DV+LGALSV+P+NS L   G +VGS   VM++N    LD+RIE+MD  YK
Sbjct  1677  IVLPGSLIQEDVVLGALSVSPMNSTLIRGGVYVGSRTPVMIKNTMHILDERIEKMDRIYK  1736

Query  5422  KVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYPVIIRH  5601
             K++G+LAANLAA+TLK+K RYFHRIG +GKG L +Y+ + GLPDHKIF PG +YPV IRH
Sbjct  1737  KIVGNLAANLAATTLKVKRRYFHRIGVSGKGYLTIYDDIKGLPDHKIFSPGKSYPVFIRH  1796

Query  5602  SNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFATWLVC  5781
             SN LS+DDDAR+D RGAA+RIL       + TTPLLDLTLKTG AF+ARTI DFA+WLVC
Sbjct  1797  SNSLSADDDARIDARGAALRILSD----GSDTTPLLDLTLKTGNAFYARTIADFASWLVC  1852

Query  5782  GAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKLRPFD  5961
             G  ARE+HVK  PHIRDA+W SLR  NSYTELHYYSNICRLFRF DGQEMYV+ KLRP+D
Sbjct  1853  GLPAREQHVKKVPHIRDAVWNSLRLTNSYTELHYYSNICRLFRFNDGQEMYVKLKLRPYD  1912

Query  5962  EKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQIQP  6141
             + I E+ G+VEP GILPPETGAIPR ++DKRPLLFLAEDF  RV+SP+ VRYV Q+Q +P
Sbjct  1913  KTIDEDSGKVEPIGILPPETGAIPRADDDKRPLLFLAEDFLNRVNSPEGVRYVFQIQTRP  1972

Query  6142  IPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEIDVIR  6321
             +P DE  ++  LDCTKPWDE E P  ++GEI I Q L+++ESE LEFNPF RC+E+DVI 
Sbjct  1973  VPQDEAEQDIALDCTKPWDETEFPCQDIGEIEIHQSLSKEESEALEFNPFLRCHEVDVIS  2032

Query  6322  ATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAKLENKD  6501
             ATS +QSASIDHGRSL+YEICQ+LRN  PLPEAW+IFL QSD K+DLSGCP+AA L+ + 
Sbjct  2033  ATSISQSASIDHGRSLIYEICQHLRNGTPLPEAWKIFLQQSDTKVDLSGCPMAAALKERS  2092

Query  6502  MPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQWLLPL  6681
               K  L R WY  LWL   QP LQ  LPYF++GLVI+ PL  + +  E  ++   WLLPL
Sbjct  2093  NEKTALDRTWYQNLWLTFFQPTLQTALPYFIMGLVIFPPLASVMHLKENKKLPLHWLLPL  2152

Query  6682  WWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYFMETATG  6861
              W  SGI+A L C ++KW+LV KK +G+T  IWS  IFMDT WQAI+TV G+YFME  TG
Sbjct  2153  LWVSSGIIAALCCVVAKWILVQKKKEGETIGIWSIRIFMDTTWQAIKTVVGDYFMEMTTG  2212

Query  6862  TFLMGIWMRLMGSEV-ARDGVYIDSMGATLNPDMVRIEEYGSVGREALLFGHIYEGGGEV  7038
             +F+  + M+LMGS+V    G Y+DSMGA LNP+MVR+   GSVGREALLFGHIYEGGG V
Sbjct  2213  SFIFVLIMKLMGSDVDMNQGTYVDSMGALLNPEMVRVHRGGSVGREALLFGHIYEGGGVV  2272

Query  7039  KYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             K+G I +   GFVGSRA+AMPG  ++S  S+  LSLAM
Sbjct  2273  KFGNIEIGEDGFVGSRAIAMPGVRVESEASIAPLSLAM  2310



>gb|KCW51230.1| hypothetical protein EUGRSUZ_J00810 [Eucalyptus grandis]
Length=2289

 Score =  2832 bits (7341),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1395/2323 (60%), Positives = 1769/2323 (76%), Gaps = 82/2323 (4%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+S   V+D F KLHPC+P  TRIG+VG GPSGLSAAYAL KLGY ++ V+EKH++ GGM
Sbjct  1     MDSQKSVEDQFSKLHPCLPLDTRIGVVGGGPSGLSAAYALAKLGYRDITVIEKHNTVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDS-DWAYTDMRV  660
             CES++I+                        E G ++EEMD HKLAL+DS    Y D+ V
Sbjct  61    CESVEIE------------------------ESGTQLEEMDLHKLALIDSLTGEYHDINV  96

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             AEDY+S++ +TL +QD+ K TNRIG+++VS+IASD+TP +L+  G+KSVPKSV YGYTAS
Sbjct  97    AEDYMSLVSLTLDIQDKAKDTNRIGIHAVSDIASDLTPAYLEAHGIKSVPKSVQYGYTAS  156

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF+QDMPYAYIHEF RTSMAGKIRR KGGY ++WKK+S+++ IK  CNTEV +++RN 
Sbjct  157   GYGFVQDMPYAYIHEFTRTSMAGKIRRMKGGYMNLWKKISDSLLIKVCCNTEVQAVRRNG  216

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPS---QKTAGLFCDKMDMSTLE  1191
             SGV VD+ + +G  +  EFDKIIISGAFPF N RTYRS S   +   GL    +D+S LE
Sbjct  217   SGVNVDITNSSGETEHKEFDKIIISGAFPFKNSRTYRSTSSSTEAETGL----LDVSDLE  272

Query  1192  KDLFSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLF  1371
             ++LFSKVQTI+YYT+VL+I GLE +P+GFYY   +MEDP+ IG+PVA+Q+FY D+N+FLF
Sbjct  273   RELFSKVQTIDYYTTVLKIKGLERIPVGFYYLGEYMEDPSTIGHPVAIQRFYADSNIFLF  332

Query  1372  WSYGNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQ  1551
             WSYG+S++I GS V++LA + V +MGGQV+KV LQR FKYFPHV+ +DMK+GFYE++E++
Sbjct  333   WSYGDSVNIRGSNVIDLAIEVVRRMGGQVEKVFLQRRFKYFPHVSSKDMKEGFYERIESE  392

Query  1552  LQGQLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLA  1731
             LQG  NTYYVGGL AFELTERN+SY+MALI KHFA+   +P  PYVK LF L+   E   
Sbjct  393   LQGHRNTYYVGGLFAFELTERNSSYAMALICKHFASANSLPALPYVKSLFTLQLDQEETG  452

Query  1732  FKQLDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAF  1911
              K L E  G+ FP+L +LDSYL+HW    +T+NKTLYTW+NE+G V+ +RTY E+ +NA 
Sbjct  453   LKTLSETHGIVFPDLPNLDSYLKHWAAKEITQNKTLYTWINEEGAVVCQRTYAELDSNAS  512

Query  1912  TIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQA  2091
              IA KLLTS+KP IKPGD+VLL++VPGLDFVD+FFGCLRA+V+P+P +PPDP QRGG QA
Sbjct  513   CIAHKLLTSRKPTIKPGDRVLLVHVPGLDFVDSFFGCLRAKVVPVPVLPPDPLQRGG-QA  571

Query  2092  LLHIANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSWV  2268
             L  I NIAK+CN VAILST  YH  VR  S KN++ F +   +S+  WP+LPWLHTDSW+
Sbjct  572   LTKIENIAKLCNAVAILSTVGYHSAVRAGSVKNLISFTRKSVESTAQWPNLPWLHTDSWI  631

Query  2269  kkpklf-kkpkDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTS  2445
             K  K+        Q +   +DLCFLQFTSGST D KGVMITHGG+IHNVKLMR+RY+STS
Sbjct  632   KSSKVLPASNIGSQSESQPDDLCFLQFTSGSTGDAKGVMITHGGLIHNVKLMRRRYRSTS  691

Query  2446  RTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAP  2625
              T+LVSWLPQYHDMGLIGGL T +V GG+ ILFSP+TF++NPLLWLQT+S ++ATHSA P
Sbjct  692   NTVLVSWLPQYHDMGLIGGLFTAMVCGGTAILFSPLTFIRNPLLWLQTISDYKATHSAGP  751

Query  2626  NFAFELLVRRLES--SKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAP  2799
             NFAFEL++RRLE+  +K  ++DLSSM F M AAEP+RQ TLKRFVELT+ +GLS+EVMAP
Sbjct  752   NFAFELVIRRLEADKAKAHDYDLSSMIFFMIAAEPVRQKTLKRFVELTRPYGLSQEVMAP  811

Query  2800  GYGLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGK  2979
             GYGLAENCVFV CAYG+  P+ VDWQGR+CCGY+  PN   VDI+I+  +TG E D+ GK
Sbjct  812   GYGLAENCVFVGCAYGKKKPILVDWQGRICCGYV-DPNDADVDIRIVDADTGLEVDEDGK  870

Query  2980  EGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKD  3159
             EGEIWISS SAGIGYWG EELSQKTF N +   PG++Y RTGDLGR+I   LFITGR KD
Sbjct  871   EGEIWISSPSAGIGYWGKEELSQKTFRNKLQKYPGRKYTRTGDLGRVIQGNLFITGRIKD  930

Query  3160  LIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIA  3339
             LIIVAG+NIY++D+EKTVESSSEL+RPGCCAV+ +PEDVL +KGI    ASDE+GLVVIA
Sbjct  931   LIIVAGRNIYSADVEKTVESSSELLRPGCCAVISVPEDVLSAKGISLPDASDEVGLVVIA  990

Query  3340  EVRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGT  3519
             E++DGKP+  D++  I + VAEEHGV +AS+  I+PR+ISKTTSGKIKR+EC K+F+ GT
Sbjct  991   ELKDGKPVDKDIIKQIESHVAEEHGVTVASVKLIRPRTISKTTSGKIKRFECLKQFVDGT  1050

Query  3520  LDVIEEQMNGERSLPRN-------DGII---------VPANGKISKTDIVNFLKDLLSQQ  3651
             L+ + + +  +R L R+       +G           +P + K+S  +IV FLK L+S+Q
Sbjct  1051  LNTVPDPIVTKRLLTRSFTTGTCREGNTPRSHLAKSSLPPSPKLSNRNIVEFLKQLVSEQ  1110

Query  3652  TGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESL  3831
              GI +  IS  E+LVSYG++SIGVVRAAQK+S F G+ +GA+DIF+ATCI DLA+F E+L
Sbjct  1111  MGISIQNISATESLVSYGIDSIGVVRAAQKLSDFLGVPVGAVDIFTATCIADLANFTENL  1170

Query  3832  LEKNHPML----TNSSETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPAYISV  3999
             L K+ P L    +N SE +I ++     +S      IW   L+AL YVS +L+ PAY+SV
Sbjct  1171  LMKSQPHLVTTQSNHSEPEILTADFSVEISRLHPWLIWSFQLLALLYVSFILVFPAYLSV  1230

Query  4000  SMFKPLILANQS-----PWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNP  4164
             S F+ L++A+Q      PW  +   +  AP  W+LCI LT I     GN+ L+ NY L P
Sbjct  1231  SAFQILVVASQKLIDGLPWLHHTSVVLLAPLFWILCIALTSISIAFFGNSFLRINYTLTP  1290

Query  4165  EISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITD  4344
             E+SVWSV+FVKWWALYKAQE+SSKVLAVHLRGTVFL +WF++LGA+I SS L+DTVDITD
Sbjct  1291  EVSVWSVDFVKWWALYKAQEVSSKVLAVHLRGTVFLKHWFEMLGARIGSSVLLDTVDITD  1350

Query  4345  PLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVL  4524
             P LVSI + +VI+EGAL+QSHEV+N +L F  +RIG+  S+GPYAV+QKGS++G+GAEVL
Sbjct  1351  PSLVSIGDGAVIAEGALLQSHEVRNSILRFQPIRIGRNCSVGPYAVIQKGSVLGEGAEVL  1410

Query  4525  AQNK----KAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQLF-GIYMIGYLNSLSAAI  4689
             +  K    K+A K++K  N         I K + G+     Q F GIYM+G ++SLSAA 
Sbjct  1411  SLQKSEGGKSALKMAKAEN---------ILKVSPGSLKETIQQFMGIYMVGLVSSLSAAA  1461

Query  4690  AYLVWIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYT  4869
              +L+++ L QK PSL    F+CI+GA HW P+ I+ +  MFT+   +   FA  +A  Y 
Sbjct  1462  VFLLYMRLSQKVPSLEQLAFLCISGALHWVPFTIVAYATMFTNTLPNPFEFAISLATAYF  1521

Query  4870  AHGLILSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHW  5049
             AHGL+LS+ T +  + ++ K    +   + W+ HR+ VACH+RFAKLLSGTE FC+YL  
Sbjct  1522  AHGLVLSLLTSIFTNLLASKEKKTQTHIKTWLGHRLAVACHLRFAKLLSGTEAFCMYLRL  1581

Query  5050  MGAKIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVI  5229
             +GAK+G++CSIR+INPV +P +VS+  GVHLGDFSRI+ G+++  GYI   + +++NSVI
Sbjct  1582  LGAKVGKYCSIRSINPVTDPRMVSIGAGVHLGDFSRIMTGFYSQSGYIQSNVHVKDNSVI  1641

Query  5230  GSQGLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMD  5409
             GSQ LILPGS +EKDVILGA+SVAP+NSVL+  G ++GS++ VMV+N T  +DDRIEEMD
Sbjct  1642  GSQSLILPGSVVEKDVILGAISVAPVNSVLQSGGVYMGSQSPVMVKNTTHAMDDRIEEMD  1701

Query  5410  PKYKKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYPV  5589
              +YK+++G+LAANLAA+TLK+KSRYFHRIG +GKG L+LY+ + GLP+H IFGPG  Y V
Sbjct  1702  SRYKRIVGNLAANLAATTLKVKSRYFHRIGVSGKGYLKLYDDIQGLPEHNIFGPGKKYTV  1761

Query  5590  IIRHSNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFAT  5769
             I+RHSN LS+DDDARLD RGAA+RIL  E+   +    L   T   GKAF+ARTI DFAT
Sbjct  1762  IVRHSNSLSADDDARLDARGAALRILSDEKGDDSPLLDLTLKT---GKAFYARTISDFAT  1818

Query  5770  WLVCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKL  5949
             WLVCG AAREEHVK  PH+RDA+W SLR+ +SY E+HYYSNICRLFRFKDGQEMYV+FKL
Sbjct  1819  WLVCGLAAREEHVKRVPHVRDAVWTSLRQADSYAEMHYYSNICRLFRFKDGQEMYVKFKL  1878

Query  5950  RPFDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQL  6129
             RP D+ IGE+ G+VEP GILPPETGAIPRD ND RPLLFLAEDF+ RV SP+ VRY+ QL
Sbjct  1879  RPSDKNIGEDTGKVEPSGILPPETGAIPRDANDTRPLLFLAEDFQNRVKSPNGVRYIFQL  1938

Query  6130  QIQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEI  6309
             Q+ P+P DE  R+  LDCTKPWDE + PYI+VGE+ I++ LT++ SE LEFNPF RC+E+
Sbjct  1939  QVMPVPQDEAARDIALDCTKPWDESQFPYIDVGEVIINENLTKEGSERLEFNPFLRCHEV  1998

Query  6310  DVIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAKL  6489
             DVIRATS +QSASIDHGRSLVYEICQ+LRN  PLPEAWR+FL+QSDVK+DLSGCP+AA L
Sbjct  1999  DVIRATSSSQSASIDHGRSLVYEICQHLRNGDPLPEAWRVFLEQSDVKVDLSGCPMAAAL  2058

Query  6490  ENKDMPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQW  6669
             + KD  K TL+R WY+T W +  QP LQ +LPYFLLGL+IY PLN L +      +   W
Sbjct  2059  QRKDTEKVTLSRPWYLTTWAVFAQPLLQTILPYFLLGLIIYFPLNLLLHCKNTRNMPVHW  2118

Query  6670  LLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYFME  6849
               P +W  +G+LA L C  +K++LVGKK + +T  IWSRG+FMDT+WQAIRTV G+YF+E
Sbjct  2119  TFPFFWVSTGVLAALACVAAKYILVGKKREEETVHIWSRGVFMDTVWQAIRTVFGDYFVE  2178

Query  6850  TATGTFLMGIWMRLMGSEVARD-GVYIDSMGATLNPDMVRIEEYGSVGREALLFGHIYEG  7026
               +G+ L  +WM+LMGS +  D G Y+DSMGA LNP+MV +E  GSV REALLFGH+Y+G
Sbjct  2179  MTSGSALFLMWMKLMGSYIELDKGTYVDSMGAALNPEMVEVEGGGSVEREALLFGHVYDG  2238

Query  7027  -GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
              GG VK+G+I V   GFVGSRAVAMPG  ++S GSL ALSLAM
Sbjct  2239  EGGVVKFGKIVVGERGFVGSRAVAMPGVVVESEGSLSALSLAM  2281



>gb|KHN30113.1| Long-chain-fatty-acid--AMP ligase FadD28 [Glycine soja]
Length=2331

 Score =  2820 bits (7311),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1380/2329 (59%), Positives = 1765/2329 (76%), Gaps = 52/2329 (2%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+    V+D F KLHP MP  TRIGIVGAGPSGLS AYAL +LGY+N+ VLEKHH+ GGM
Sbjct  1     MDPERSVEDQFSKLHPSMPVNTRIGIVGAGPSGLSVAYALARLGYNNITVLEKHHTVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRV  660
             CES++I+G+ YDLGGQVLAA+SAP IFHLAKE G  +EEM++HKLA++DS    Y D++V
Sbjct  61    CESVEIEGKIYDLGGQVLAASSAPVIFHLAKETGCTLEEMNSHKLAVIDSSSGKYQDVKV  120

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             A+DY+SV+ +TL++Q++VK + R GV+++SE+ASD+ P++L+  GLKSVPKSVAYGYTAS
Sbjct  121   ADDYVSVMSLTLQIQEKVKNSGRFGVHALSEVASDLAPDYLERHGLKSVPKSVAYGYTAS  180

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGFIQDMPYAYIHEF RTSMAGKIRRFKGGYTS+W++++E++PIK   +TEVL+I+RNS
Sbjct  181   GYGFIQDMPYAYIHEFTRTSMAGKIRRFKGGYTSLWQRIAESIPIKLHYSTEVLAIRRNS  240

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
               V V+V+  N  ++ MEFDKIIISG FP   GRTYRS          + MD S LEKDL
Sbjct  241   DTVTVNVKGSN-EIETMEFDKIIISGNFPLKYGRTYRSAPSTCLENETEVMDASELEKDL  299

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             FSKV+T +YYT+VL+I GLE +P+GFYYF  +MEDP+ IGNPVAMQKFY D+N+FLFWSY
Sbjct  300   FSKVETNDYYTTVLKIKGLERMPVGFYYFSEYMEDPSTIGNPVAMQKFYADSNIFLFWSY  359

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GNS DI G  V ELA K++  MGG+V+ +ILQR FKYFPHV+ QDM++GFYEKLE++LQG
Sbjct  360   GNSADIKGPTVTELAIKSIESMGGEVQNIILQRRFKYFPHVSSQDMRNGFYEKLESELQG  419

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
               NTYYVGGLMAFELTERN+SY+MALI K+FAN   +P FPY K LFPL++  +    K+
Sbjct  420   SRNTYYVGGLMAFELTERNSSYAMALICKNFANSSDLPVFPYTKSLFPLQTDIQKKEPKE  479

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             L E+PGV+FP L +L+SYL+HWGT  +T+N+TLYTWLNE G V+ +RTY E H NA  IA
Sbjct  480   LVELPGVQFPNLPALNSYLKHWGTHPITQNRTLYTWLNEGGTVVGKRTYGEQHLNASCIA  539

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
              KLLTSQKP IKPGD+VLL+YVPGLDFVDAFFGCLRA+V+P+P +PPDP QR GGQALL 
Sbjct  540   HKLLTSQKPVIKPGDRVLLVYVPGLDFVDAFFGCLRAKVLPVPVLPPDPMQR-GGQALLK  598

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKD-KSSNSWPDLPWLHTDSWVkkp  2277
             I NIAK C  VAILST SYH  VR    K+++    K+ K +  WP LPWLHTD+WV   
Sbjct  599   IENIAKSCGIVAILSTASYHTAVRAGLVKSLISLTGKNGKYTAQWPKLPWLHTDTWVNNS  658

Query  2278  klfkkp-kDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTI  2454
             +       D+Q +P   D+CFLQFTSGST D KGVMITHGG++HNVKLMR RYKSTSRT+
Sbjct  659   RNSAVEDVDDQCEPQPGDVCFLQFTSGSTGDAKGVMITHGGLVHNVKLMRSRYKSTSRTV  718

Query  2455  LVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFA  2634
             LVSWLPQYHDMGLIGGL T LVSGGS +LFSP+TF+K PLLWL+T+SK++ATHSA PNFA
Sbjct  719   LVSWLPQYHDMGLIGGLFTALVSGGSAVLFSPLTFIKKPLLWLETISKYQATHSAGPNFA  778

Query  2635  FELLVRRLESSKE--ENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYG  2808
             FEL+VRRLES K+  ++ DLSSM FLM AAEP+R  TLKRF++LT  FGLS++VMAPGYG
Sbjct  779   FELVVRRLESEKDKLQSLDLSSMIFLMVAAEPVRMKTLKRFLDLTTPFGLSQKVMAPGYG  838

Query  2809  LAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGE  2988
             LAENCVFVSCA+GEG P+ VDWQGRVCCGYI  P    VDI I+ PE+G+E ++ G+EGE
Sbjct  839   LAENCVFVSCAFGEGCPILVDWQGRVCCGYI-HPGDSDVDIIIVDPESGEELEEDGREGE  897

Query  2989  IWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLII  3168
             IWISS SAGIGYWG EELSQKTF N + + PG+ Y RTGDLGRIID KLFITGR KDLII
Sbjct  898   IWISSPSAGIGYWGKEELSQKTFRNKLQNHPGRNYTRTGDLGRIIDGKLFITGRIKDLII  957

Query  3169  VAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVR  3348
             VAG+NIY++D+EKTVESSSE +RPGCCAV+G+PE++L +KGI     SD++GLVV+AEVR
Sbjct  958   VAGRNIYSADVEKTVESSSEFLRPGCCAVIGVPEEILSAKGISLPDGSDQVGLVVVAEVR  1017

Query  3349  DGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDV  3528
             DGK +  DV++HI TRV EEHGV +AS+  IKPR+ISKTTSGKIKR+EC K+F   TL++
Sbjct  1018  DGKTVSKDVIEHIQTRVVEEHGVSVASVKLIKPRTISKTTSGKIKRFECLKQFSDETLNL  1077

Query  3529  IEEQMNGERSLPRNDGIIVPANG-----------------KISKTDIVNFLKDLLSQQTG  3657
             + + +  ++SL R+        G                 +IS  +IV  LK ++S Q+G
Sbjct  1078  VPQPILTKKSLLRSFTTGTCREGRTPRAHLVRSSSPLPIPRISNKEIVEHLKRIISDQSG  1137

Query  3658  IPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLE  3837
             IPV+ IS  + + +YG++SIGVV+A QK++ F G+ + AID+F+A+CI +LA+F E+LL 
Sbjct  1138  IPVNNISVTDNMSTYGIDSIGVVKATQKLTDFLGVPVAAIDVFTASCIQELANFSENLLL  1197

Query  3838  KNHPMLTNSS----ETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPAYISVSM  4005
             K+ P L ++S    E +I  + +   VS   +  I L+ L+AL Y+S++L+ PAY+S++ 
Sbjct  1198  KSQPQLMSNSPHAPEAEIDFTEVVVDVSKSRQWGIRLLQLLALVYISIMLVTPAYLSITA  1257

Query  4006  FKPLILANQS------PWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPE  4167
             F+  I  N S      PW  Y ISL  AP SW+LCI  TC+C    GN+ L+PNY L PE
Sbjct  1258  FQSFI-PNVSESVYGMPWSSYLISLTLAPLSWILCIVSTCLCISFFGNSFLRPNYALTPE  1316

Query  4168  ISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDP  4347
             IS++S++FVKWWALYK QEISSKVLA HLRGTVFL YWF++LGA+I S  L+DTVDITDP
Sbjct  1317  ISIYSMDFVKWWALYKTQEISSKVLATHLRGTVFLKYWFEMLGARIGSLVLLDTVDITDP  1376

Query  4348  LLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLA  4527
              LVSI +E  I+EG L+QSHEVKNG+LSF  +RIGK SSIGPY+++QKGSI+ +G+EV  
Sbjct  1377  SLVSIGDEVAIAEGVLVQSHEVKNGILSFLPIRIGKNSSIGPYSIIQKGSIIKEGSEVQP  1436

Query  4528  -QNKKAAAKISKPLNGHKGKVTRRIR-KRNHGNHNSVFQLFGIYMIGYLNSLSAAIAYLV  4701
              Q  +    + KP   +  K    +    +    N+++   GIY+ G+L+SL++AIAY++
Sbjct  1437  LQKVEGGQHVLKPAKHNNVKENALLLVSTSKIQSNAMYHFLGIYLTGFLSSLASAIAYIL  1496

Query  4702  WIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHGL  4881
             +I L Q P S  HF F+C+ GAFHW P+ ++ +  MF+ +P + ++F     + Y  HGL
Sbjct  1497  YIRLFQIPASFQHFSFLCVCGAFHWIPFTVVAYATMFSDVPSNPIAFTISFTSAYLLHGL  1556

Query  4882  ILSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWMGAK  5061
             IL+  T  L   +  K + ++   + W+ H++ ++CH RFAKLLSGTE FC+YL  +GAK
Sbjct  1557  ILTSLTCALTRLL--KFNQNQTHFKTWLRHQLTISCHHRFAKLLSGTEAFCLYLRLLGAK  1614

Query  5062  IGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQG  5241
             IG+HCSIRAINPV  P L+S+ DGVHLGDFS+I+ G+H + GY  G++++++NSV+GSQ 
Sbjct  1615  IGKHCSIRAINPVSNPELMSIGDGVHLGDFSKIITGFHYSNGYACGKVEVQDNSVVGSQS  1674

Query  5242  LILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMDPKYK  5421
             LILPGS +EK+VILGALSVAP+NS+L     ++GS+  V  RN +  LD+RIEEMD +YK
Sbjct  1675  LILPGSVVEKNVILGALSVAPMNSILHEGSVYIGSQTRVATRNSSYHLDERIEEMDMEYK  1734

Query  5422  KVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPG-LPDHKIFGPGATYPVIIR  5598
             KV+ ++AANLA +T+ +K+RYFHRIG +GKG L++Y+ L G +P HKIF PG +YP+++R
Sbjct  1735  KVVANMAANLAVTTINVKARYFHRIGVSGKGHLKIYDKLDGNIPLHKIFYPGKSYPIMLR  1794

Query  5599  HSNCLSSDDDARLDPRGAAIRILPHER--tttttttplldltlktGKAFHARTIGDFATW  5772
             HSN LS+DDDAR+D RGAA+RIL  E   +       L+DLTLKTG AF+ART+ DFATW
Sbjct  1795  HSNSLSADDDARIDARGAALRILSDESPDSNNLQHASLIDLTLKTGNAFYARTLADFATW  1854

Query  5773  LVCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKLR  5952
             LVCG  AREE VK  PH+RDA+W SLR  NSY ELHYYSNICRL RF DGQEMYV+FKLR
Sbjct  1855  LVCGLPAREELVKRTPHVRDAVWNSLRHANSYAELHYYSNICRLMRFTDGQEMYVKFKLR  1914

Query  5953  PFDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQ  6132
             P D  I E+ G+V P GILPPETGAIPRDE D RPLLFLA+DF+ RV+SP  V YV QLQ
Sbjct  1915  PIDTSISEDTGKVVPTGILPPETGAIPRDEKDTRPLLFLAQDFQRRVNSPGGVCYVFQLQ  1974

Query  6133  IQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEID  6312
             ++ +P+DE   +  LDCTKPWDE E PYI+VGE+ I++ L+ +ES+ LEFNP+ + +E+D
Sbjct  1975  LRAVPEDEAAGDIALDCTKPWDENEFPYIDVGEVNINENLSTEESDRLEFNPYLKSHELD  2034

Query  6313  VIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAKL-  6489
             VI ATS  QSASIDHGRSL+YEICQ++RNR+PLPE+WR  ++QS+VK+DLS CP+AA L 
Sbjct  2035  VIPATSNTQSASIDHGRSLIYEICQHVRNRQPLPESWRNLVEQSNVKVDLSCCPVAAALP  2094

Query  6490  ----ENKDMPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQI  6657
                   K     TL R WY T   +  QP LQ VLPY ++GL ++APLN L     + ++
Sbjct  2095  KKETTKKVTTTLTLTRTWYQTFSALFTQPLLQTVLPYTVMGLAVFAPLNFLVNLKNVEKL  2154

Query  6658  QKQWLLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGE  6837
             Q QW  PL+W  SG++A L C ++KWVLVG+K +G+T P+WS+ + MD+ WQAIRT+ G+
Sbjct  2155  QVQWFFPLFWVVSGVMAALACVVTKWVLVGRKKEGETVPLWSKRVIMDSTWQAIRTLVGD  2214

Query  6838  YFMETATGTFLMGIWMRLMGSEVARD--GVYIDSMGATLNPDMVRIEEYGSVGREALLFG  7011
             YFM+ A+G+FL  +WM+LMG+++  D  G Y+DS GA LNP+MV IE  G VGREALLFG
Sbjct  2215  YFMDMASGSFLFVMWMKLMGADIDMDGGGAYVDSTGAMLNPEMVTIERGGCVGREALLFG  2274

Query  7012  HIYEG--GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             HIYEG  GG VK+G I +   GFVGSRAV MPG  +++  +L ALSLAM
Sbjct  2275  HIYEGDEGGMVKFGGIKIGEDGFVGSRAVVMPGVHVENEANLSALSLAM  2323



>gb|KCW51237.1| hypothetical protein EUGRSUZ_J00816 [Eucalyptus grandis]
Length=2275

 Score =  2811 bits (7286),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1384/2323 (60%), Positives = 1756/2323 (76%), Gaps = 94/2323 (4%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+    V+D F KLHPC+P  TRIGI+G GPSGLSAAYAL +LGYS++ V+EKH+S GGM
Sbjct  1     MDCRKSVEDQFSKLHPCLPLDTRIGIIGGGPSGLSAAYALARLGYSDITVIEKHNSVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRV  660
             CES++I+                          G E+EEMD HKLAL+DS  A Y D+ V
Sbjct  61    CESVEIEAS------------------------GTELEEMDLHKLALIDSFTAEYYDINV  96

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
              EDY+S++ +TL++QD+VK +NRIG+++VS+IASD+TP +L+  G+  VPKSV YGYTAS
Sbjct  97    VEDYMSLVSLTLEIQDKVKDSNRIGIHAVSDIASDLTPAYLEAHGINGVPKSVQYGYTAS  156

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF+QDMPYAY+HEF RTSMAGKIRR KGGY S+WKK+SE++ IK  CNT V ++ RNS
Sbjct  157   GYGFVQDMPYAYLHEFTRTSMAGKIRRMKGGYMSLWKKISESLTIKVCCNTVVQAVSRNS  216

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSP---SQKTAGLFCDKMDMSTLE  1191
             SGV VD+ + +G ++  EFDKIIISGAFPF + RTYRSP   ++   GL    +D+S LE
Sbjct  217   SGVNVDITNSSGEIEHKEFDKIIISGAFPFKHSRTYRSPPSSAEAETGL----LDVSDLE  272

Query  1192  KDLFSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLF  1371
             ++LFSKVQTI+YYT+VL+I GLE +P+GFYY   +M+DP+ IG+PVAMQ+FY DTN+FLF
Sbjct  273   RELFSKVQTIDYYTTVLKIKGLERIPVGFYYLGEYMDDPSTIGHPVAMQRFYADTNIFLF  332

Query  1372  WSYGNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQ  1551
             WSYG+S++I GS V++LA + V +MGG+V+KVILQR FKYFPHV  +DMK+GFYE++E++
Sbjct  333   WSYGDSVNIRGSNVIDLAIEVVKRMGGEVEKVILQRRFKYFPHVGSEDMKEGFYERVESE  392

Query  1552  LQGQLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLA  1731
             LQG  NTYYVGGL AFELTERN+SY+MALI KHFA+   +PTFPYVK LF L+   E  +
Sbjct  393   LQGHRNTYYVGGLFAFELTERNSSYAMALICKHFASANSLPTFPYVKSLFTLQLDQEETS  452

Query  1732  FKQLDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAF  1911
              + L E  GV FP L +LDSYL+HW    +T+NK+LY+W+NE+G V+ +RTY E+ +NA 
Sbjct  453   HRTLSEAHGVVFPNLPTLDSYLKHWAAQEITQNKSLYSWINEEGAVVCQRTYAELDSNAS  512

Query  1912  TIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQA  2091
              IA KLLTSQKP IKPGD+VLL++VPGLDFVDAFFGCLRARV+P+P +PPDP QRGG QA
Sbjct  513   CIAHKLLTSQKPTIKPGDRVLLVHVPGLDFVDAFFGCLRARVVPVPVLPPDPLQRGG-QA  571

Query  2092  LLHIANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSWV  2268
             L+ I NIA +CN VAILST  YH  VR  S K+++ F   + KS+  WP+LPWLHTDSW+
Sbjct  572   LMKIENIANLCNAVAILSTVGYHAAVRAGSVKSLISFTGKRAKSTAQWPNLPWLHTDSWI  631

Query  2269  kkpklfkkpkDE-QGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTS  2445
             K  K+        Q +   +DLCFLQFTSGST D KGVMIT+GG+IHNVKLMR+RY+STS
Sbjct  632   KSSKVLPALNVAFQSESQLDDLCFLQFTSGSTGDAKGVMITNGGLIHNVKLMRRRYQSTS  691

Query  2446  RTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAP  2625
              T+LVSWLPQYHDMGLIGGL T +V GGS ILFSP+TF+KNPLLWLQ +S ++ATH+A P
Sbjct  692   NTVLVSWLPQYHDMGLIGGLFTAMVCGGSAILFSPLTFIKNPLLWLQMISDYKATHTAGP  751

Query  2626  NFAFELLVRRLES--SKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAP  2799
             NFAFEL++RRLE+  +K  N+DLSS+ F M AAEP+RQ TLK F+ELT+ FGLS+EVMAP
Sbjct  752   NFAFELVLRRLEADKAKAHNYDLSSLIFFMVAAEPVRQKTLKTFIELTRPFGLSQEVMAP  811

Query  2800  GYGLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGK  2979
             GYGLAENCVFVSCAYG+  P+ VDWQGR+CCGY+ +P+   VDI+I+  + G E D+ GK
Sbjct  812   GYGLAENCVFVSCAYGKKKPILVDWQGRICCGYV-EPDDADVDIRIVDADAGLEVDEDGK  870

Query  2980  EGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKD  3159
             EGEIWISS SAGIGYWG EELSQKTF N +   PG++Y RTGDLGR+I   LFITGR KD
Sbjct  871   EGEIWISSPSAGIGYWGKEELSQKTFRNMLQKYPGRKYTRTGDLGRVIQGNLFITGRIKD  930

Query  3160  LIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIA  3339
             LIIVAG+NIY++D+EKTVESSSEL+RPGCCAV+ +PEDVL +KGI    ASDE+GLVVIA
Sbjct  931   LIIVAGRNIYSADVEKTVESSSELLRPGCCAVISVPEDVLSAKGISLPDASDEVGLVVIA  990

Query  3340  EVRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGT  3519
             E++DGKP+  D+++ I +RVAEEHGV +AS+  I+PR+ISKTTSGKIKR+EC K+F+ GT
Sbjct  991   ELKDGKPVDKDIINQIESRVAEEHGVTVASVKLIRPRTISKTTSGKIKRFECLKQFVDGT  1050

Query  3520  LDVIEEQMNGERSLPRN-------DGII---------VPANGKISKTDIVNFLKDLLSQQ  3651
             L+ + + +  +R L R+       +G           +P + K+S  +IV FLK L+S+Q
Sbjct  1051  LNTVPDPIVTKRLLTRSFTTGTCREGKTPRSHLAKSSLPPSPKLSNRNIVEFLKQLVSEQ  1110

Query  3652  TGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESL  3831
             TGI +  IS  E+LVSYG++SIGVVRAAQK+S F G+ +GA+DIF+ATCI DLA+F E+L
Sbjct  1111  TGISIQNISATESLVSYGIDSIGVVRAAQKLSDFLGVPVGAVDIFTATCIADLANFTENL  1170

Query  3832  LEKNHPML----TNSSETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPAYISV  3999
             L K+ P L    +N SE +I ++     +S      IW   L+AL YVS +L+ PAY+SV
Sbjct  1171  LMKSQPHLVTTQSNHSEPEILTADFSLEISRLHPWLIWSFQLLALLYVSFILVFPAYLSV  1230

Query  4000  SMFKPLILANQS-----PWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNP  4164
             S F+ L++A+Q      PW  Y   +  AP  W+LCI LT I     GN+ L+ NY L P
Sbjct  1231  STFQILVVASQKLINGLPWLHYTSVVLLAPLFWILCIALTSISIAFFGNSFLRLNYALTP  1290

Query  4165  EISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITD  4344
             E+SVWSV+FVKWWALYKAQE+SSKVLAVHLRGTVFL +WF++LGA+I SS L+DTVDITD
Sbjct  1291  EVSVWSVDFVKWWALYKAQEVSSKVLAVHLRGTVFLKHWFEMLGARIGSSVLLDTVDITD  1350

Query  4345  PLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVL  4524
             P LVSI + +VI+EGAL+QSHEV+N VL F  +RIG+  S+GPYAV+QKGS++G+GAEVL
Sbjct  1351  PSLVSIGDGAVIAEGALLQSHEVRNSVLRFQPIRIGRNCSVGPYAVIQKGSVLGEGAEVL  1410

Query  4525  AQNK----KAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQLF-GIYMIGYLNSLSAAI  4689
             A  K    K+A K++K  N  K + T    + + G+     Q F GIYM+G ++SLSAA 
Sbjct  1411  ALQKSEGGKSALKMAKAENILKARSTVATFQVSPGSLKETIQQFMGIYMVGLVSSLSAAA  1470

Query  4690  AYLVWIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYT  4869
              +L+++ L QK PSL    F+CI+GA HW P+ I  +  MFT+   +   FA  +A  Y 
Sbjct  1471  VFLLYMRLSQKVPSLEQLAFLCISGALHWIPFTIAAYATMFTNALPNPFEFAISLATAYF  1530

Query  4870  AHGLILSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHW  5049
             AHGL+LS+ T +  + ++ K    +   + W  HR+ VACH+RFAKLLSGTE FCVYL  
Sbjct  1531  AHGLVLSLLTSIFTNLLASKEKKTQTHIKTWFGHRLTVACHLRFAKLLSGTEAFCVYLRL  1590

Query  5050  MGAKIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVI  5229
             +GAK+G++CSIR+INPV +P +VS+  GVHLGDFSRI+ G+++  GYI   + +++NSVI
Sbjct  1591  LGAKVGKYCSIRSINPVADPRMVSIGAGVHLGDFSRIITGFYSHSGYIQNNVHVKDNSVI  1650

Query  5230  GSQGLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMD  5409
             GSQ LILPGS +EKDVILGA+SVAP+NSVL+  G ++GS++ VM+               
Sbjct  1651  GSQSLILPGSVVEKDVILGAISVAPVNSVLQSGGVYMGSQSPVMI---------------  1695

Query  5410  PKYKKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYPV  5589
                   +G+LAANLA +TLK+KSRYFHRIG +GKG L+LY+ +  LP+H IFGPG  + V
Sbjct  1696  ------VGNLAANLAVTTLKVKSRYFHRIGVSGKGYLKLYDDIQRLPEHNIFGPGKKFTV  1749

Query  5590  IIRHSNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFAT  5769
             I+RHSN LS+DDDARLD RGAA+RIL  E+   +    L   T   G AF+ARTI DFAT
Sbjct  1750  IVRHSNSLSADDDARLDARGAALRILSDEKGDDSPLLDLTLKT---GNAFYARTISDFAT  1806

Query  5770  WLVCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKL  5949
             WLVCG AAREEH+K  PH+RDA+W SLR+ +SY +LHYYSNICRLFRFKDGQEMYV+FKL
Sbjct  1807  WLVCGLAAREEHIKRVPHVRDAVWTSLRQADSYADLHYYSNICRLFRFKDGQEMYVKFKL  1866

Query  5950  RPFDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQL  6129
             RPFDE IGE+ G+VEP GILPPETGAIPRD ND RPLLFLAEDF+ RV SP+ VRY+ QL
Sbjct  1867  RPFDENIGEDIGKVEPSGILPPETGAIPRDANDTRPLLFLAEDFQNRVKSPNGVRYIFQL  1926

Query  6130  QIQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEI  6309
             Q++PIP DE  R+  LDCTKPWDE + PYI+VGE+TI+++LT++ SE LEFNPF RC+E+
Sbjct  1927  QVRPIPQDEAARDIALDCTKPWDELQFPYIDVGEVTINEILTKEGSERLEFNPFLRCHEV  1986

Query  6310  DVIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAKL  6489
             DVIRATS +QSASIDHGRSLVYEICQ+LRN  PLPEAWR+FL+QSDVK+DLSGCP+AA L
Sbjct  1987  DVIRATSSSQSASIDHGRSLVYEICQHLRNGDPLPEAWRVFLEQSDVKVDLSGCPMAAAL  2046

Query  6490  ENKDMPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQW  6669
             E KD  + TL+R  Y+T W +  QP LQ +LPYFLLGL+IY PLN L +      +   W
Sbjct  2047  ERKDTEEVTLSRPRYLTTWAVFAQPLLQTILPYFLLGLIIYFPLNLLLHCKSTRNMPVLW  2106

Query  6670  LLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYFME  6849
               P +W  +GIL  L C  +K++LVGKK + +T  IWSRG+FMDT+WQAIRTV G+YF+E
Sbjct  2107  TFPFFWVSTGILTALACVAAKYILVGKKREDETVHIWSRGVFMDTVWQAIRTVFGDYFVE  2166

Query  6850  TATGTFLMGIWMRLMGSEVARD-GVYIDSMGATLNPDMVRIEEYGSVGREALLFGHIYEG  7026
               +G+ L  +WM+LMGS +  D G Y+DSMGA LNP+MV +E  GSV +EALLFGH+Y+G
Sbjct  2167  MTSGSALFLMWMKLMGSYIELDKGTYVDSMGAALNPEMVEVEGGGSVEKEALLFGHVYDG  2226

Query  7027  -GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
               G VK+G+I V  GGFVGSRAVAMPG  ++SGGSL ALSLAM
Sbjct  2227  EDGVVKFGKIVVGEGGFVGSRAVAMPGVAVESGGSLSALSLAM  2269



>ref|XP_008449760.1| PREDICTED: uncharacterized protein LOC103491548 isoform X2 [Cucumis 
melo]
Length=2262

 Score =  2794 bits (7242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1381/2263 (61%), Positives = 1733/2263 (77%), Gaps = 48/2263 (2%)
 Frame = +1

Query  481   MCESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWAYTDMRV  660
             MCES++I+G+ YDLGGQVLAANSAPTIFHLAKE G+E+EE+D+HKLAL+D+   Y D+RV
Sbjct  1     MCESVEIEGKIYDLGGQVLAANSAPTIFHLAKETGSELEELDSHKLALIDTSGEYQDIRV  60

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             A+DY S+I +TL+LQD+ K +  IGV++VS  ASD+TP +L+ +GL SVPKSVAYGYTAS
Sbjct  61    ADDYTSIISLTLQLQDKAKDSGHIGVHAVSAFASDLTPTYLEARGLTSVPKSVAYGYTAS  120

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF+QDMPYAY+HEF RTSMAGKIRRFKGGY  +WK++SE++PIK  C TEV+S++R+S
Sbjct  121   GYGFVQDMPYAYVHEFTRTSMAGKIRRFKGGYGGLWKRISESLPIKVHCKTEVVSVRRSS  180

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
             + V + V  R+  L ++EFDKIIISG+FPF N RTYRS S K +    + MDMS LE++L
Sbjct  181   NSVTLRVMDRDKNLASLEFDKIIISGSFPFRNCRTYRSSSPKLSEEGAEVMDMSRLEEEL  240

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             FSKV TI+YYT+VL+IDGL+HLP+GFYYF   M++P  IG PVAMQKFY DTN+FL WSY
Sbjct  241   FSKVYTIDYYTTVLKIDGLDHLPLGFYYFGKHMDNPETIGYPVAMQKFYPDTNIFLLWSY  300

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GNS DI G  V  LA   + KMGG+VKKVILQR FKYFPHV  +DM+DGFY++LE +LQG
Sbjct  301   GNSADITGPNVTALAINTITKMGGEVKKVILQRRFKYFPHVCSKDMEDGFYKRLELELQG  360

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
              LNTYY GGLMAFELTERN+SY+MAL+ KHFAND   PTF Y K +F  +S  E  A K 
Sbjct  361   SLNTYYTGGLMAFELTERNSSYAMALVCKHFANDNSSPTFSYAKPMFLFQSKQERDA-KG  419

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             L E+PGV+FP LSSLD YLRHWG+  VT ++ LYTWLNE+G VL +RTY+E+H NA  IA
Sbjct  420   LGELPGVEFPNLSSLDGYLRHWGSHHVTRDRVLYTWLNEEGSVLGQRTYRELHLNASCIA  479

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
             QKLL++QKP+IKPGD+VLLIYVPGLDF+DAFFGCLRA+V+P+P +PPDP QR GGQALL 
Sbjct  480   QKLLSNQKPSIKPGDRVLLIYVPGLDFIDAFFGCLRAKVLPVPVLPPDPLQR-GGQALLK  538

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSWVkkp  2277
             I  IAK C+ VAILST SYH  VR+   KNM+   +   KSS  WP LPW+HTDSW+K  
Sbjct  539   IEYIAKSCSAVAILSTLSYHSAVRVGKVKNMIGLTRENGKSSAVWPKLPWMHTDSWIKNF  598

Query  2278  klfk--kpkDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRT  2451
                       +Q  P  +D+ FLQFTSGST D KGVMITHGG+IHNVKLMR+RYKSTSRT
Sbjct  599   ANLTPPDTMADQSDPHPDDVSFLQFTSGSTGDAKGVMITHGGLIHNVKLMRRRYKSTSRT  658

Query  2452  ILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNF  2631
             +LVSWLPQYHDMGLIGGL T LVSGG+ ILFSP+TF+KNPLLWL TMSK++ATHSA PNF
Sbjct  659   VLVSWLPQYHDMGLIGGLFTALVSGGTAILFSPLTFIKNPLLWLHTMSKYKATHSAGPNF  718

Query  2632  AFELLVRRLESSKE--ENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGY  2805
             AFEL+ RRLE +K   + +DLSSM FLM AAEP+R+TTLK+F+ELT  FGL+ E MAPGY
Sbjct  719   AFELVARRLEVNKGKVQTYDLSSMVFLMIAAEPVRKTTLKKFLELTVPFGLTEEKMAPGY  778

Query  2806  GLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEG  2985
             GLAENCVFVSCA+GEG+P+FVDWQGRVCCGY+ Q NTD +DI+I++P TGKE ++ GKEG
Sbjct  779   GLAENCVFVSCAFGEGIPIFVDWQGRVCCGYVDQDNTD-IDIRIVNPGTGKELEEDGKEG  837

Query  2986  EIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLI  3165
             EIWISS SAGIGYWG EELSQ+TF N++ + PG+RY RTGDLGR+ID KLFITGR KDLI
Sbjct  838   EIWISSPSAGIGYWGREELSQETFRNELQNHPGRRYTRTGDLGRVIDGKLFITGRIKDLI  897

Query  3166  IVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEV  3345
             I AG+NIY +D+EKTVESSS+L+RPGCCAV+G+PE++L+ KGI     SD++GLVVIAEV
Sbjct  898   IAAGRNIYPADVEKTVESSSDLLRPGCCAVIGVPEEILMEKGIQVPDCSDQVGLVVIAEV  957

Query  3346  RDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLD  3525
             +DGKP+  D++D I  RVAEEHGV +ASI  IKPR+ISKTTSGKIKR+EC K+F+ GTL+
Sbjct  958   KDGKPIAKDIIDQIQNRVAEEHGVSVASIKLIKPRTISKTTSGKIKRFECLKQFVDGTLN  1017

Query  3526  VIEEQMNGERSLPRN-------DGII---------------VPANGKISKTDIVNFLKDL  3639
             V+ E +   R+  R+       +GI                V    +IS  DI  FLK L
Sbjct  1018  VVPEAIKLRRTFLRSFSTGTCKEGITPRPQQTKLSRASVPSVQPGLRISNRDIEEFLKGL  1077

Query  3640  LSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADF  3819
             +S+ T I ++KIS  E+L+SYG++SI VVRAAQK+S+F G+ +GA+DIF+A+CI DLA  
Sbjct  1078  VSELTNISINKISATESLLSYGIDSILVVRAAQKLSNFLGVPVGAVDIFTASCIADLASI  1137

Query  3820  VESLLEKNHPMLTNSS-----ETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIP  3984
              E++L K+H   T ++     +T     G+ +V  T  +  IW   L+AL +V+++++ P
Sbjct  1138  SENILAKSHAQSTKNTTNPTYDTNCVLVGMETVSWT-RQFVIWFSQLLALIFVAMMVLFP  1196

Query  3985  AYISVSMFK---PLI--LANQSPWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPN  4149
             AY+S+S F    P++  L +      Y + L  AP +W+LCI  +CIC    GN+ L+PN
Sbjct  1197  AYLSISAFTSSLPILHNLTDNISLMDYLLPLTLAPLAWILCIVSSCICIAFFGNSFLRPN  1256

Query  4150  YVLNPEISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDT  4329
             Y L PE+S+WS++FVKWWALYKAQ++SSKVLAVHLRGTVFL YW+++ GA+I SS ++DT
Sbjct  1257  YALTPEVSIWSLDFVKWWALYKAQDVSSKVLAVHLRGTVFLKYWYEMFGARIGSSVILDT  1316

Query  4330  VDITDPLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGD  4509
             VDITDP LVSI +   ++EGALIQSHEVKNGVLSF  +RIG+ SS+GPYA + KG+I+G+
Sbjct  1317  VDITDPSLVSIGDGVAVAEGALIQSHEVKNGVLSFLPIRIGRNSSVGPYASIHKGAILGE  1376

Query  4510  GAEVLA-QNKKAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLNSLSAA  4686
               EV A Q  +     S      KG   RR          +++  FGIY++G+L SLSAA
Sbjct  1377  EVEVPALQRIEGIETTSGNRCFEKGSEPRR-NAGERQERETIYHFFGIYILGFLGSLSAA  1435

Query  4687  IAYLVWIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGY  4866
             I Y  +IWL Q  PSL HF F+C+ GAFHW P+ +I +  +F  +P + +SFA + ++ Y
Sbjct  1436  IVYYFYIWLSQSSPSLQHFSFLCLVGAFHWIPFTVIAYATIFAEVPSNAISFAILFSSMY  1495

Query  4867  TAHGLILSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLH  5046
               HG+IL + TF++ + ++ K   ++   + W+ HR+  A H+RFAKLLSGTE FC+YL 
Sbjct  1496  LFHGIILCILTFVVKNLLTSKPQMEQTPLKIWLCHRITAASHLRFAKLLSGTEAFCIYLR  1555

Query  5047  WMGAKIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSV  5226
              +GAKIG+HCSIRAINPV +P L+S+  GVHLGDFSRI+ G+++T G   G+I+++ENSV
Sbjct  1556  LLGAKIGKHCSIRAINPVSDPELISIRTGVHLGDFSRIISGFYSTNGLTRGKIEVQENSV  1615

Query  5227  IGSQGLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEM  5406
             IGSQ ++LPGS I++DV+LGALSV+P+NS L   G +VGS   VM++N    LD+RIE+M
Sbjct  1616  IGSQSIVLPGSVIQEDVVLGALSVSPMNSTLIRGGIYVGSRTPVMIKNTMHILDERIEKM  1675

Query  5407  DPKYKKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYP  5586
             D  YKK++G+LAANLAA+TLK+K+RYFHRIG +GKG L++Y+ + GLPDHKIF PG +YP
Sbjct  1676  DKIYKKIVGNLAANLAATTLKVKARYFHRIGVSGKGYLKIYDNIKGLPDHKIFSPGKSYP  1735

Query  5587  VIIRHSNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFA  5766
             V IRHSN LS+DDDAR+D RGAA+RIL       + TTPLLDLTLKTG AF+ARTI DFA
Sbjct  1736  VFIRHSNSLSADDDARIDARGAALRILSD----GSDTTPLLDLTLKTGNAFYARTIADFA  1791

Query  5767  TWLVCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFK  5946
             +WLVCG  ARE+HVK  PHIRDA+W SLR  NSYTELHYYSNICRLFRF DGQEMYV+ K
Sbjct  1792  SWLVCGLPAREQHVKKVPHIRDAVWNSLRLTNSYTELHYYSNICRLFRFNDGQEMYVKLK  1851

Query  5947  LRPFDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQ  6126
             LRP+D+ I E+ G+VEP GILPPETGAIPR ++DKRPLLFLAEDF  RV+SP+ VRYV Q
Sbjct  1852  LRPYDKTIDEDSGKVEPIGILPPETGAIPRADDDKRPLLFLAEDFLNRVNSPEGVRYVFQ  1911

Query  6127  LQIQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNE  6306
             +Q +P+P DE  R+  LDCTKPWDE E P  ++GEI I Q L+++ESE LEFNPF RC+E
Sbjct  1912  IQTRPVPQDEAERDIALDCTKPWDETEFPCQDIGEIEIHQSLSKEESEALEFNPFLRCHE  1971

Query  6307  IDVIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAK  6486
             +DVI ATS +QSASIDHGRSL+YEICQ+LRN  PLPEAW+IFL QSD K+DLSGCP+AA 
Sbjct  1972  VDVISATSISQSASIDHGRSLIYEICQHLRNGTPLPEAWKIFLQQSDTKVDLSGCPMAAA  2031

Query  6487  LENKDMPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQ  6666
             L+ +   K  L R WY  LWL   QP  Q  LPYF++GLVI+ PL  + +  E  ++   
Sbjct  2032  LKERANEKTALDRTWYQNLWLTFFQPTFQTALPYFIMGLVIFPPLASVMHLKENKKLPLH  2091

Query  6667  WLLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYFM  6846
             WLLPL W  SGI+A L C ++KW+LV KK +G+T  IWS  IFMDT WQAI+TV G+YFM
Sbjct  2092  WLLPLLWVSSGIIAALCCIVAKWILVQKKKEGETIGIWSIRIFMDTTWQAIKTVVGDYFM  2151

Query  6847  ETATGTFLMGIWMRLMGSEVARD-GVYIDSMGATLNPDMVRIEEYGSVGREALLFGHIYE  7023
             E  TG+F+  + M+LMGS+V  D G Y+DSMGA LNP+MV+I   GSVGREALLFGHIYE
Sbjct  2152  EMTTGSFIFVLIMKLMGSDVDMDQGTYVDSMGALLNPEMVKIHRGGSVGREALLFGHIYE  2211

Query  7024  GGGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             GGGEVK+G I +   GFVGSRA+AMPG  ++S  S+  LSLAM
Sbjct  2212  GGGEVKFGNIEIGEDGFVGSRAIAMPGVRVESEASIAPLSLAM  2254



>ref|XP_003597478.1| Bifunctional protein aas [Medicago truncatula]
Length=2339

 Score =  2789 bits (7230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1373/2344 (59%), Positives = 1753/2344 (75%), Gaps = 74/2344 (3%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+    +++ F KLHP +P  TRIGIVGAGPSG+SAAYAL +LGY+N+ VLEKHH+ GGM
Sbjct  1     MDPERSIEEQFSKLHPSLPLNTRIGIVGAGPSGISAAYALSRLGYNNITVLEKHHAVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVD-SDWAYTDMRV  660
             CES++I+G+ YDLGGQVLAA+SAP IFHLAKE  + +EE+D+HKLA++D S   Y D++V
Sbjct  61    CESVEIEGKVYDLGGQVLAASSAPVIFHLAKETESALEELDSHKLAIIDTSSGKYQDIKV  120

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             A+DY+SV+ +TLK+Q++VK + R GV++VSE+A+D+TPEFL+  GLKS+P SVA+GYTAS
Sbjct  121   ADDYVSVMSLTLKIQEKVKNSGRFGVHAVSEVAADLTPEFLEHHGLKSIPNSVAFGYTAS  180

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGFIQDMPYAYIHEF RTSMAGKIRRFKGGYTS+W+K++E++PIK  CNTEVL+I+RN 
Sbjct  181   GYGFIQDMPYAYIHEFTRTSMAGKIRRFKGGYTSLWQKIAESLPIKLHCNTEVLAIRRNF  240

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRS-PSQ----------KTAGLFCD  1167
               V V+V+  N   + MEFDKII+SG FP   GRTYRS PS             A    +
Sbjct  241   DSVNVNVKSSN-ETETMEFDKIIVSGNFPLKYGRTYRSAPSNCIDRYLMRLSNVADSEAE  299

Query  1168  KMDMSTLEKDLFSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFY  1347
              MD S +EK+LFSKV+  +YYT+  +I GL+H+P+GFYYF  +M+DP+ IGNPVAMQKFY
Sbjct  300   VMDASDIEKELFSKVEINDYYTTAFKIRGLDHMPVGFYYFNEYMDDPSTIGNPVAMQKFY  359

Query  1348  TDTNVFLFWSYGNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDG  1527
              DT++FLFWSYGNS DI G  + ELA KA+  +GG+V+  ILQR FKYFPHV+ QDMK+G
Sbjct  360   ADTDIFLFWSYGNSFDIKGPTITELAIKAIKSIGGEVESFILQRRFKYFPHVSSQDMKNG  419

Query  1528  FYEKLETQLQGQLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPL  1707
             FYEKLE++LQG  NTYYVGGLMAFELTERN+SY+MAL+ K+FA+   +P FPY K LFPL
Sbjct  420   FYEKLESELQGSRNTYYVGGLMAFELTERNSSYAMALMCKNFASSSDLPVFPYTKSLFPL  479

Query  1708  KSSSEGLAFKQLDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTY  1887
             ++  +    KQL E+PGV+FP L +L+ YL+HWGT  VTE++TLY+W+NE+G V+ +RTY
Sbjct  480   QTEFQRKEPKQLAELPGVQFPNLPTLNGYLKHWGTHPVTEDRTLYSWINEQGTVIGKRTY  539

Query  1888  KEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdp  2067
             +E H NA  IA KLL SQKP    GDKVLL+YVPGLDF+DAFFGCLRA+VIP+P IPPDP
Sbjct  540   REQHLNASCIASKLLKSQKP----GDKVLLVYVPGLDFIDAFFGCLRAKVIPVPVIPPDP  595

Query  2068  tQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPDLPW  2247
              QR G QALL I NIAK C  VAILST +YH  VR    KN +  K+  KSS  WP LPW
Sbjct  596   MQRSG-QALLKIENIAKSCGIVAILSTVAYHSAVRAGLVKNFITLKN-GKSSARWPSLPW  653

Query  2248  LHTDSWVkkpklfkkpk--DEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLM  2421
             LHTD+WV   + +      D+Q +  S D+CFLQFTSGST D KGVMITHGG+IHNVKLM
Sbjct  654   LHTDTWVNNSRSYALENLYDDQRESQSGDICFLQFTSGSTGDAKGVMITHGGLIHNVKLM  713

Query  2422  RKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKW  2601
             + RYKSTSRT+LVSWLPQYHDMGLIGGL T LVSGG+ +LFSP+TF+K PLLW++TMSK+
Sbjct  714   QSRYKSTSRTVLVSWLPQYHDMGLIGGLFTALVSGGTALLFSPMTFIKKPLLWIETMSKY  773

Query  2602  RATHSAAPNFAFELLVRRLESS---KEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSF  2772
             +ATHSA PNFAFEL+VRRLESS   K +N DLSSM FLM AAEP+RQ TLKRF+ELT  +
Sbjct  774   QATHSAGPNFAFELVVRRLESSDKDKLQNLDLSSMIFLMVAAEPVRQKTLKRFLELTGPY  833

Query  2773  GLSREVMAPGYGLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPET  2952
             GLS++ MAPGYGLAENCVFVSCA+GEG P+FVDWQGRVCCGYI   N D VDI+I+ P+ 
Sbjct  834   GLSQKAMAPGYGLAENCVFVSCAFGEGNPIFVDWQGRVCCGYIHPGNAD-VDIRIVDPDG  892

Query  2953  GKENDDPGKEGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSK  3132
              +E  + GKEGEIWISS SAGIGYWG EELSQ TF+N + + PG+ Y RTGDLGRIID K
Sbjct  893   IEELQEDGKEGEIWISSPSAGIGYWGKEELSQSTFQNQLPNHPGRFYTRTGDLGRIIDGK  952

Query  3133  LFITGRTKDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRAS  3312
             LFITGR KDLIIVAG+NIY+SD+EKTVESSSEL+RPGCCAV+G+PE+ L +KGI     S
Sbjct  953   LFITGRIKDLIIVAGRNIYSSDVEKTVESSSELLRPGCCAVIGVPEETLSAKGISLPDGS  1012

Query  3313  DELGLVVIAEVRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYE  3492
             D++GLVVIAE+RDGKP+  DV+D I TRVAEEHGV +AS+  IKPR+ISKTTSGKI+R+E
Sbjct  1013  DQVGLVVIAELRDGKPVSKDVVDDIQTRVAEEHGVNVASVKLIKPRTISKTTSGKIRRFE  1072

Query  3493  CAKRFISGTLDVIEEQMNGERSLPRNDGIIVPANGK----------------ISKTDIVN  3624
             C K+F  GTL+++ + +  ++ L R+        G+                I   +I+ 
Sbjct  1073  CLKQFADGTLNLVPQPVLTKKKLVRSFTTGTCKEGRTPRAQLANSTPITSPRIGNKEIME  1132

Query  3625  FLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCID  3804
             FLK L+S+Q GIPVSKIS  + + +YG++SI VV+A QK+S F G+ + AID+FSA+CI 
Sbjct  1133  FLKRLISEQAGIPVSKISVTDNMSTYGMDSISVVKATQKLSDFLGVTVAAIDVFSASCIQ  1192

Query  3805  DLADFVESLLEKNHP-MLTNSS---ETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLL  3972
             +L +F E+LL K+ P +L+N S   E +  S+     VS   + +I L+ L+AL ++S+L
Sbjct  1193  ELVNFSENLLLKSQPHLLSNPSYAPEAETESTEFIVDVSKSHQWSIHLLQLLALVFISIL  1252

Query  3973  LIIPAYISVSMFKPLIL-----ANQSPWFFYFISLACAPFSWMLCIFLTCICTRLLGNAL  4137
             ++ PAY+S++ F+  I      A   P   Y  SLA AP SW+LCI  TCIC    GN+ 
Sbjct  1253  VVSPAYLSITTFQIFIASFGKSAYGIPLSNYIFSLALAPLSWILCIASTCICISFFGNSF  1312

Query  4138  LQPNYVLNPEISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSA  4317
             L+PNY L PE+S++S+ FVKWWALYK+QEISSKVLA HL+GTVFLNYWF+ILGA+I SS 
Sbjct  1313  LRPNYALTPEMSIYSIAFVKWWALYKSQEISSKVLATHLKGTVFLNYWFEILGARIGSSV  1372

Query  4318  LIDTVDITDPLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGS  4497
             LIDTVDITDP LVSI +E+VISEG L+QSHEVKNG+LS   +RIG+ SSIGPYAV+QKGS
Sbjct  1373  LIDTVDITDPSLVSIGDEAVISEGVLVQSHEVKNGILSLHPIRIGRNSSIGPYAVIQKGS  1432

Query  4498  IVGDGAEVLAQNK----KAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQLFGIYMIGY  4665
             I+ +GAE+    K    +   K +K  N  +  V      +   +  +++   GIY++ +
Sbjct  1433  IIKEGAEIQPLQKVEGGQHVLKTAKLNNVKENAVLLVTMTKTESD--AIYHFLGIYLVAF  1490

Query  4666  LNSLSAAIAYLVWIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFA  4845
             ++SL+AAI Y ++ W  QKP S+  F F+CI GAFHW P+ I  +  MF+ +  + ++FA
Sbjct  1491  VSSLAAAITYFMYTWFFQKPASIQSFSFVCICGAFHWIPFTITAYATMFSEVQSNPIAFA  1550

Query  4846  GMVAAGYTAHGLILSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTE  5025
                   Y  HGLIL+  T  L   +  +  T   T   W+ ++M ++CH++FAKLLSGTE
Sbjct  1551  ISFTCAYLLHGLILTSLTCSLTRLLKSQKQTHFKT---WLQNQMILSCHLKFAKLLSGTE  1607

Query  5026  LFCVYLHWMGAKIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRI  5205
              FCVYL  +GAKIG+HCSIRAINPV  P L+ + DGVHLGDFSRI+ G++ + GY  G+I
Sbjct  1608  AFCVYLRLIGAKIGKHCSIRAINPVSNPELMLIGDGVHLGDFSRIITGFNYSDGYTCGKI  1667

Query  5206  DIRENSVIGSQGLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQ-TLP  5382
             ++++NSV+GSQ LILPGS +EK+VILGALSVAP+NS+L     ++GS+  V +RN     
Sbjct  1668  EVQDNSVVGSQSLILPGSLVEKNVILGALSVAPMNSILHEGSVYIGSQTRVTMRNSGNAS  1727

Query  5383  LDDRIEEMDPKYKKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKI  5562
              D+RIEEMD  YKK++ +LAANLA +T+  K+RYFHRIG +GKG L++YN L G+P HKI
Sbjct  1728  FDERIEEMDIDYKKIVANLAANLAVTTMNAKARYFHRIGVSGKGHLKIYNKLEGIPMHKI  1787

Query  5563  FGPGATYPVIIRHSNCLSSDDDARLDPRGAAIRILPHERttttttt---plldltlktGK  5733
             F PG +YP+I+RHSN LS+DDDAR+D RGAA+RI   E  T ++ +    L+DLTLKTG 
Sbjct  1788  FHPGKSYPIIVRHSNSLSADDDARIDARGAALRIFSDEPATDSSDSPPPTLIDLTLKTGN  1847

Query  5734  AFHARTIGDFATWLVCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRF  5913
             AF+ART+ DFA+WLVCG AAREE VK APH+R+A+W SLR  +SY E+HYYSN CRL RF
Sbjct  1848  AFYARTLADFASWLVCGLAAREELVKSAPHVREAVWNSLRHADSYAEMHYYSNYCRLMRF  1907

Query  5914  KDGQEMYVRFKLRPFDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRV  6093
             +DGQ+MYV+FKLRP D  I E+ G+V P GILPPETGAI RDEND RPLLFLA DF+ RV
Sbjct  1908  EDGQQMYVKFKLRPHDTSISEDKGKVNPTGILPPETGAIARDENDSRPLLFLANDFQNRV  1967

Query  6094  SSPDKVRYVLQLQIQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEE  6273
             SS + V YV Q+Q++P+PDD + RE  LDCTKPWDE E P+ +VGEI +++ +  ++S++
Sbjct  1968  SSSNGVSYVFQIQVRPVPDDTQGREVALDCTKPWDENEFPFTDVGEINLNENIPMEDSQK  2027

Query  6274  LEFNPFFRCNEIDVIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVK  6453
             LEFNP+ + NE+D I ATS  QSASIDHGRSL+YEICQ++RNR+PLPEAWR  + QS+VK
Sbjct  2028  LEFNPYLKSNELDTITATSSTQSASIDHGRSLIYEICQHVRNRQPLPEAWRNLVQQSNVK  2087

Query  6454  LDLSGCPLAAK---------LENKDMPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLV  6606
             +DLS CP+A+          L+ K  P  TL R WY T   +  QP LQ +LP+ ++GL 
Sbjct  2088  VDLSCCPIASSAPLPEKEPLLKKKATPALTLTRTWYQTFSALFIQPLLQTILPHMVIGLA  2147

Query  6607  IYAPLNCLFYTHEMTQIQKQWLLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSR  6786
              + PLN + Y  ++ ++   WLLP +W  SG +A L C ++K VLVGK+  G+T PIWS+
Sbjct  2148  AFVPLNMVVYFKDVKKLPLHWLLPFFWILSGFIAALSCVIAKRVLVGKRKLGETIPIWSK  2207

Query  6787  GIFMDTIWQAIRTVTGEYFMETATGTFLMGIWMRLMGSEVARDGVYIDSMGATLNPDMVR  6966
              I  D+ WQAIRT+ G+YFM+   G+FL  IWM++MG+E+  DGVY+DS GA LNP+MV+
Sbjct  2208  KIVFDSTWQAIRTLVGDYFMDITNGSFLSVIWMKMMGAEIEMDGVYVDSNGAMLNPEMVK  2267

Query  6967  IEEYGSVGREALLFGHIYEG--GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGAL  7140
             IE  G +GREALLFGHIYEG  GG VKYG I +   GFVGSRAV MPG  ++   SL +L
Sbjct  2268  IERGGCIGREALLFGHIYEGEEGGMVKYGEIKIGEDGFVGSRAVVMPGVEVECEASLASL  2327

Query  7141  SLAM  7152
             SLAM
Sbjct  2328  SLAM  2331



>emb|CAN80678.1| hypothetical protein VITISV_022712 [Vitis vinifera]
Length=2246

 Score =  2775 bits (7194),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1360/2159 (63%), Positives = 1699/2159 (79%), Gaps = 44/2159 (2%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+S   ++D F KLHP +P +TRIGIVG GPSGLSAAYAL KLGYSNV VLEK+ + GGM
Sbjct  1     MDSRKSIEDQFSKLHPSLPVSTRIGIVGGGPSGLSAAYALAKLGYSNVTVLEKYQTVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRV  660
             CES +I+G  YDLGGQVLAANSAP IFH AKE+G+E+EEMD+HKL L+DS    + D++V
Sbjct  61    CESAEIEGNIYDLGGQVLAANSAPVIFHWAKEIGSELEEMDSHKLTLIDSSTGKHKDIKV  120

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             A+DY+SVI +TL+LQD+ K + RIGV++VSEIASD+TPEFL+ +G KSVPKSVA GYTAS
Sbjct  121   ADDYVSVISLTLELQDKAKDSGRIGVHAVSEIASDLTPEFLEARGFKSVPKSVACGYTAS  180

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF+QDMPYAYIHEF RTSMAGKIRRFKGGY + WKKLSE +PI+  CNTEVL+++R+S
Sbjct  181   GYGFVQDMPYAYIHEFTRTSMAGKIRRFKGGYMNFWKKLSEMLPIEVRCNTEVLAVRRSS  240

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
             +GV VDV++ NG ++ +EFD+IIISG+FPF NG+TYR+P   +A      MDM+ LEK L
Sbjct  241   AGVSVDVKNSNGEVEVIEFDEIIISGSFPFKNGKTYRAPPSSSAEPETGVMDMNELEKKL  300

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             FSKVQTI+YYT+VL+I GLEH+P+GFYYFE FM+DPA IG+PVAMQ+FY +T+VFLFWSY
Sbjct  301   FSKVQTIDYYTTVLKIKGLEHIPVGFYYFEEFMDDPATIGHPVAMQRFYNNTDVFLFWSY  360

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GNS+DI G  V ELA      MGG++++V+LQR FKYFPH++ QDMK+GFYEK+E++LQG
Sbjct  361   GNSVDIKGPTVTELAINTAKNMGGEIEEVVLQRRFKYFPHISSQDMKEGFYEKVESELQG  420

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
               NTYYVGGLMAFELTERNASY++AL+ KHFAND    TFPYVKRLFPL+S   G   K 
Sbjct  421   MRNTYYVGGLMAFELTERNASYAVALVCKHFANDTPSXTFPYVKRLFPLQSDXWGGNPKI  480

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             LDE PGVKFP+++SLD YL+HWGT  V +NKTLYTW+NE+G V+ +RTY+E+H NA  IA
Sbjct  481   LDEFPGVKFPDIASLDGYLKHWGTHEVIQNKTLYTWINEEGVVVSQRTYRELHANASCIA  540

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
               LL +QKP  KPGD+VLL+Y+PGLDF+DAFFGCLRA+++P+P +PPDP QR GGQALL 
Sbjct  541   HNLLLNQKPLFKPGDRVLLVYIPGLDFIDAFFGCLRAKLLPVPVLPPDPLQR-GGQALLK  599

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSWVkkp  2277
             I NIAK CN +AILST  YH  V   S K+++ F     K+S  WP+LPWLHTDSW+K  
Sbjct  600   IENIAKSCNALAILSTIRYHAGVCAGSVKSLISFTGKNGKNSARWPNLPWLHTDSWIKYS  659

Query  2278  klfkkp-kDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTI  2454
             +   +    +Q +P  +DLCFLQFTSGST D KGVMITHGG+IHNVKLMR+RYKSTS+T+
Sbjct  660   RNLLQEDIADQSEPQPDDLCFLQFTSGSTGDAKGVMITHGGLIHNVKLMRRRYKSTSKTV  719

Query  2455  LVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFA  2634
             LVSWLPQYHDMGLIGGL + LVSGGS +LFSP++F+KNPLLWLQTMSK++ATHSA PNFA
Sbjct  720   LVSWLPQYHDMGLIGGLFSALVSGGSAVLFSPMSFIKNPLLWLQTMSKFQATHSAGPNFA  779

Query  2635  FELLVRRLESSKE--ENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYG  2808
             FEL+VRRLES K+   N++LSSM FLM AAEP+RQ TLKRFV+LT  FGL  EV+APGYG
Sbjct  780   FELVVRRLESGKDTVHNYNLSSMIFLMVAAEPVRQNTLKRFVKLTSPFGLCEEVLAPGYG  839

Query  2809  LAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGE  2988
             LAENCVFVSCAYGEG P+ VDWQ RVCCGY+   N D VDI+++ PETG+E ++ GKEGE
Sbjct  840   LAENCVFVSCAYGEGKPILVDWQERVCCGYVDTENAD-VDIRVVDPETGEEQEEVGKEGE  898

Query  2989  IWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLII  3168
             IWISS SAG+GYWG EELS KTF N++ + PG+RY RTGDLGRIID KLFITGR KDLII
Sbjct  899   IWISSPSAGVGYWGREELSGKTFRNELQNHPGRRYTRTGDLGRIIDGKLFITGRIKDLII  958

Query  3169  VAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVR  3348
             VAG+NIY +D+EKTVESSSEL+RPGCCAV+G+PE++L  KGI     SD++GLVVIAEVR
Sbjct  959   VAGRNIYAADVEKTVESSSELLRPGCCAVIGVPEEILSQKGISLPDHSDQVGLVVIAEVR  1018

Query  3349  DGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDV  3528
             DGK +  DV++ I   VAEEHGV +ASI  IKP++ISKTTSGKIKR++C ++F  GTL +
Sbjct  1019  DGKHVGKDVIEQIQAHVAEEHGVTVASIKLIKPKTISKTTSGKIKRFDCIRQFSDGTLSL  1078

Query  3529  IEEQMNGERSL--------------PRNDGIIVP-ANGKISKTDIVNFLKDLLSQQTGIP  3663
             + E +  ++ L              PR +    P  N ++SK DIV FLK L+S+QTGIP
Sbjct  1079  VPEPILSKKVLHRSFTTGTCREGNTPRPELNKYPLTNPRLSKEDIVEFLKGLVSEQTGIP  1138

Query  3664  VSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEKN  3843
             +  I   E+L SYG++SIGVVRAAQK+S F G+ +GA+D+F+ATCI DLA+F E+L+ K+
Sbjct  1139  IKNIFASESLSSYGIDSIGVVRAAQKLSDFLGVPVGAVDMFTATCIADLANFSENLVRKS  1198

Query  3844  H------PMLTNSSETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPAYISVSM  4005
             H      P      ET +S   +   ++   K+ IW   L+AL Y+S+LLIIPAY+SVS 
Sbjct  1199  HHQYMTTPSYVPEPETDLSE--LVMEIAPSHKLGIWFFQLLALIYISVLLIIPAYLSVSA  1256

Query  4006  FKPLI-----LANQSPWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPEI  4170
             F  L+     L + + W  Y ISLA AP +W+LCIF TCIC   LGN+ LQPNY L PEI
Sbjct  1257  FISLLSTCCNLIDGTSWLDYLISLAFAPLAWLLCIFSTCICIAYLGNSFLQPNYALTPEI  1316

Query  4171  SVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDPL  4350
             S+WS +FVKWW LYK QE++SKVLAVHLRGTVFL  WF++LGA+I SS L+DT+DITDP 
Sbjct  1317  SIWSKDFVKWWGLYKVQEVASKVLAVHLRGTVFLKCWFEMLGARIGSSVLLDTIDITDPS  1376

Query  4351  LVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLAQ  4530
             LVSI + +VI+EGALIQSHEVKNG+LSF  +RIG+  S+GPYA++QKGS++ +GAEV A 
Sbjct  1377  LVSIGDGAVIAEGALIQSHEVKNGILSFLPIRIGQNCSVGPYALIQKGSVLAEGAEVQAS  1436

Query  4531  NKKAAA----KISKPLNGHKGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLNSLSAAIAYL  4698
              K        + +K  N  KG V  +   RN     +++   GIYM+G+L+SL+AA+ Y 
Sbjct  1437  QKSEGGTSVFQSNKANNVPKGSVLPK-DSRN-AQIEAIYHFLGIYMVGFLSSLAAALFYF  1494

Query  4699  VWIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHG  4878
             +++WL + PPS  HF F+CI+GAFHWFP+ II +T MF+S  +S   FA  VA  Y AHG
Sbjct  1495  LYLWLSRSPPSFQHFTFLCISGAFHWFPFTIIAYTTMFSSASLSPPYFAISVAVAYLAHG  1554

Query  4879  LILSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWMGA  5058
             LILS  T  +  F++RK DT +   + W+ HR+ +ACH+RFAKLLSGTE  C+YL  +GA
Sbjct  1555  LILSFLTCTMTRFLARKPDTKQSHMKTWLRHRIMIACHLRFAKLLSGTEALCIYLRLLGA  1614

Query  5059  KIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQ  5238
             KIG HCSIRAINPV EP L+S+  GVH+GDFSRI+PG++++ G+  G+I + +NSV+GSQ
Sbjct  1615  KIGSHCSIRAINPVSEPELISIGAGVHMGDFSRIIPGFYSSSGFTCGQIKVEDNSVVGSQ  1674

Query  5239  GLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMDPKY  5418
              L+LPGS ++KDVILGALSVAP+NSVL+  G ++GS+  VM++N    LD RIEEMD KY
Sbjct  1675  SLVLPGSVLQKDVILGALSVAPMNSVLQRGGVYIGSQTPVMIKNTLHALDQRIEEMDVKY  1734

Query  5419  KKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYPVIIR  5598
             K+++G+LAANLA +T+K+KSRYFHRIG  GKG L++Y+ + G PDHKIF PG +YPV+IR
Sbjct  1735  KRIVGNLAANLAVTTMKVKSRYFHRIGVGGKGILKIYDNIKGFPDHKIFQPGKSYPVLIR  1794

Query  5599  HSNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFATWLV  5778
             HSN L++DDDAR+D RGAA+RILP E     + +PLLDLTLKTG AF+ARTI DFATWLV
Sbjct  1795  HSNSLAADDDARIDARGAALRILPDE---PGSDSPLLDLTLKTGNAFYARTIADFATWLV  1851

Query  5779  CGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKLRPF  5958
             CG AAREEHVK  P +RDA+W SLRR +S+ ELHYYSNICRLFRFKDGQEMYV+FKLRP+
Sbjct  1852  CGLAAREEHVKRIPRVRDAVWASLRRADSFAELHYYSNICRLFRFKDGQEMYVKFKLRPY  1911

Query  5959  DEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQIQ  6138
             DEK  E+ G++EP GILPPETGAIPRD+ D RPLLFLAEDF+ RV+S   VRYV Q+Q Q
Sbjct  1912  DEKFSEDSGKIEPIGILPPETGAIPRDDTDTRPLLFLAEDFQQRVNSAGGVRYVFQMQFQ  1971

Query  6139  PIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEIDVI  6318
             P+P DE   ++ LDCTKPWDE E P+I+VGEI +DQ+LT +ESE+LEFNPF +C+E+DVI
Sbjct  1972  PVPGDEATCDSALDCTKPWDENEFPHIDVGEIIVDQMLTREESEQLEFNPFLQCHEVDVI  2031

Query  6319  RATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAKLENK  6498
             RA+S +QSASIDHGRSL+YEICQ+LRNR+PLPEAWRIFL+QSD K+DLSGCP+AA L+ K
Sbjct  2032  RASSSSQSASIDHGRSLIYEICQHLRNREPLPEAWRIFLEQSDFKVDLSGCPMAAALQKK  2091

Query  6499  DMPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQWLL  6675
             D+   TL+R WY TLW++  QP LQ VLPYF++GLV++APLN +FY     ++   WL+
Sbjct  2092  DVQNVTLSRTWYQTLWVIFAQPLLQTVLPYFIMGLVVFAPLNWVFYWKNTKKLPLHWLM  2150


 Score =   122 bits (307),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 87/138 (63%), Gaps = 21/138 (15%)
 Frame = +1

Query  6802  TIWQAIRTVTGEYFMETATGTFLMGI-----------WMR--------LMGSEVA-RDGV  6921
             T +Q +  +  +  ++T    F+MG+           W          LMGS +   +G 
Sbjct  2101  TWYQTLWVIFAQPLLQTVLPYFIMGLVVFAPLNWVFYWKNTKKLPLHWLMGSNIELNEGA  2160

Query  6922  YIDSMGATLNPDMVRIEEYGSVGREALLFGHIYEG-GGEVKYGRISVKNGGFVGSRAVAM  7098
             Y+DSMGA LNP+MV IE  G VGREALLFGHIYEG GG+VK+G+IS+  GGFVGSRAV M
Sbjct  2161  YVDSMGAVLNPEMVEIERGGCVGREALLFGHIYEGEGGKVKFGKISIGEGGFVGSRAVVM  2220

Query  7099  PGATIDSGGSLGALSLAM  7152
             PG  +++GGSL  LSLAM
Sbjct  2221  PGVRVETGGSLSDLSLAM  2238



>ref|XP_009418249.1| PREDICTED: uncharacterized protein LOC103998490 [Musa acuminata 
subsp. malaccensis]
Length=2324

 Score =  2774 bits (7190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1383/2337 (59%), Positives = 1746/2337 (75%), Gaps = 75/2337 (3%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M++ + ++D   KLHPC P  TRI IVGAGPSGLSAAYAL KLGY NV + EK  S  GM
Sbjct  1     MDTTICIEDQLSKLHPCFPVQTRIAIVGAGPSGLSAAYALAKLGYGNVTIFEKCQSVAGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDS-DWAYTDMRV  660
             CES+DI+G+ YDLGGQV+AANSAP I HLAKEVGAE EEMD+HKLA +DS    + DM+V
Sbjct  61    CESVDIEGKIYDLGGQVIAANSAPVISHLAKEVGAEFEEMDSHKLAFIDSRSGKFEDMKV  120

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             A+DY S+I +TLKLQDE   +  IG++++S IASD T +FLK  GL S+PKSVAYGYTAS
Sbjct  121   ADDYASLISMTLKLQDEATRSGHIGIHALSGIASDSTLDFLKLHGLSSLPKSVAYGYTAS  180

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF+QDMPYAYI EF RTSMAGKIRRFKGGY S+W+KLS ++P +  CNTEVL +KRN 
Sbjct  181   GYGFVQDMPYAYIQEFTRTSMAGKIRRFKGGYMSMWQKLSLSLPFEVLCNTEVLMVKRNI  240

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
             SGV V V++ +   + M+FDKII SG   F NGRTYRS    T     + +D++ LEK L
Sbjct  241   SGVRVTVKNADDEQKLMKFDKIIFSGNLTFKNGRTYRSSFLTTGE--NEVVDLNDLEKQL  298

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             F KV+TI+YYT+VL+I G EH+ +GFYYF  FMEDPA IG+PVAMQ+F+ DTN+FLFWSY
Sbjct  299   FCKVRTIDYYTTVLKIKGFEHISVGFYYFGEFMEDPATIGHPVAMQRFFADTNIFLFWSY  358

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GNS +I    V  L    V  MGG ++KV+LQR FKYFPHV+ ++MK+GF+EKLETQLQG
Sbjct  359   GNSSNIRSPTVTSLLINVVRTMGGIIEKVVLQRRFKYFPHVDSEEMKNGFFEKLETQLQG  418

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
               NTYY+GGLMAFELTERN+SY+MAL+  +FA    +P  PYVKRLFPL SS E    ++
Sbjct  419   FQNTYYLGGLMAFELTERNSSYAMALVCNYFARRGEMPLIPYVKRLFPLVSSQEPYFQRE  478

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             LDE+ GV+FP+L SLDSYL  WGT  VT +KTLYTW+ E+G V+D+RTY E+H NA  IA
Sbjct  479   LDELAGVEFPDLPSLDSYLSFWGTHPVTVSKTLYTWITEEGQVVDQRTYSELHANACHIA  538

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
             Q LLTS+KP  KPGD+VLL+Y+PGL+F+DAFFGCL+A++IP+P +PPDP +RGG QALL 
Sbjct  539   QNLLTSKKPTFKPGDRVLLVYLPGLEFIDAFFGCLKAKIIPVPLLPPDPLKRGG-QALLK  597

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSWVkkp  2277
             I NI+K+CN VAILST SYH  VR     N++    S  +SS  WPDLPW++TDS +KK 
Sbjct  598   IHNISKLCNTVAILSTSSYHRAVRTGFVMNVISLTNSNSRSSAFWPDLPWIYTDSLIKKY  657

Query  2278  klfkkpkDE--------QGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRY  2433
             +   +   +        + QP  +D+CFLQFTSGST DPKGVMITHGG+IHNVK MR++Y
Sbjct  658   RSQSRKLKDLESEAISSESQP--DDICFLQFTSGSTGDPKGVMITHGGLIHNVKTMRRKY  715

Query  2434  KSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATH  2613
             +STSRTILVSWLPQYHDMGLIGGL T LVSGGS ILFSP+TF++NPLLWLQTMS ++ATH
Sbjct  716   RSTSRTILVSWLPQYHDMGLIGGLFTALVSGGSSILFSPMTFIRNPLLWLQTMSDYQATH  775

Query  2614  SAAPNFAFELLVRRLESSKEEN--FDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSRE  2787
             SAAPNFAFEL++RRLES K +N  +DLSS+ FLM AAEP+RQ TLK+F+++++ FGL +E
Sbjct  776   SAAPNFAFELVIRRLESDKVKNHAYDLSSVVFLMVAAEPVRQKTLKKFIDISRPFGLCQE  835

Query  2788  VMAPGYGLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKEND  2967
             V+APGYGLAENCVFVSCA+GEG PV +DWQGRVCCGY+  PN   VDI II PET KE++
Sbjct  836   VLAPGYGLAENCVFVSCAFGEGKPVLIDWQGRVCCGYV-NPNDSDVDITIIDPETLKEHE  894

Query  2968  DPGKEGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITG  3147
             + GKEGEIWISS SAGIGYWG +++SQKTF N++ +  GKRY RTGDLGRIID KLFITG
Sbjct  895   EFGKEGEIWISSPSAGIGYWGDKDMSQKTFFNELDNHKGKRYTRTGDLGRIIDGKLFITG  954

Query  3148  RTKDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGL  3327
             R KDLIIVAG+NIY++D+EKTVESSS+ +RPGCCAV+G+PE+ L  KGI     SD++GL
Sbjct  955   RIKDLIIVAGRNIYSADVEKTVESSSKALRPGCCAVIGVPEETLTEKGISVPETSDQVGL  1014

Query  3328  VVIAEVRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRF  3507
             VVIAEV++G+ +  ++++ I  RV EEHGV +AS+  IKPR+ISKT+SGKI+R+EC K+F
Sbjct  1015  VVIAEVKEGESVNEEIVEEIKARVTEEHGVSVASVKLIKPRTISKTSSGKIRRFECLKQF  1074

Query  3508  ISGTLDVIEEQMNGERSLPRN------------------DGIIVPANGKISKTDIVNFLK  3633
                TL ++++    ++ L R+                       P N   +  +I+NFLK
Sbjct  1075  TDDTLILVKKPNISKKILSRSFTTGSSIEGRRLHLPLDKSPNFQPRNAGKNVGEIINFLK  1134

Query  3634  DLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLA  3813
              L+++QTG+ V KIS  E+LVSYG++SIGVVRAAQK+S + G+ +GA+DIF+ATCI DLA
Sbjct  1135  RLVAEQTGLEVEKISATESLVSYGIDSIGVVRAAQKLSDYLGVPVGAVDIFTATCISDLA  1194

Query  3814  DFVESLLEKNHP--MLTNSSETKISSSGIPSVV--STFDKITIWLIHLVALAYVSLLLII  3981
              F  +LL ++ P  M T S   ++ +  +   +  ST  K+TIWL+ L+A+ Y+S +L+ 
Sbjct  1195  SFSGNLLLESQPGSMTTTSYLPEVEAEFLGHDINPSTIWKLTIWLLQLLAITYISFILVF  1254

Query  3982  PAYISVSMF---KPLILANQSPWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNY  4152
             PAY+S SMF    PLIL  +  +    ISL  AP +W+  IFLTC+   L GN+ LQ NY
Sbjct  1255  PAYVSSSMFMKLHPLILIEEMSFASSLISLVLAPLAWISYIFLTCLFLSLFGNSFLQLNY  1314

Query  4153  VLNPEISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTV  4332
             VL PE+S+WSV+FVKWWAL KAQE+++K LAV+LRGT FLN+W+++ GA+I SS LIDTV
Sbjct  1315  VLTPEVSIWSVDFVKWWALSKAQELAAKFLAVYLRGTAFLNHWYRMQGARIGSSVLIDTV  1374

Query  4333  DITDPLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDG  4512
             DITDP LVS  E SVI+EG +IQSHEVKNGVLSF  V++G+ S+IGPYA+L+KGS+VGDG
Sbjct  1375  DITDPFLVSFGEASVIAEGVMIQSHEVKNGVLSFHSVQVGRNSTIGPYAILEKGSVVGDG  1434

Query  4513  AEV-----------LAQNKKAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQLFGIYMI  4659
             AEV           + +++KA+    K L+    K              +++ L GIY +
Sbjct  1435  AEVRPLQKVEGVNPIIRSEKASKLCKKELDEEIPKTLV-----------TLYHLLGIYAV  1483

Query  4660  GYLNSLSAAIAYLVWIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLS  4839
             G+L+S S AI YL +++L +    LH+F+  C+AGAFHW P ++    ++ T +     +
Sbjct  1484  GFLSSFSGAIVYLSYVYLTRTSFLLHYFMLACVAGAFHWLPAVVAACASIITEISSGPAT  1543

Query  4840  FAGMVAAGYTAHGLILSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSG  5019
              A  +A  Y  HGL+LS+ + +LN  ++    T +   + W L+R+N+ACH+RFAKLL+G
Sbjct  1544  SASFLALAYFCHGLVLSLLSGILNRCLAGDRGTQRSHIKTWFLYRVNIACHLRFAKLLTG  1603

Query  5020  TELFCVYLHWMGAKIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISG  5199
             TE FC YL   GAK+G+HCSIRAINPV  P ++S+ DGVHLGDFSRIV G++++ G+  G
Sbjct  1604  TEAFCTYLRLFGAKVGRHCSIRAINPVCSPRMISIGDGVHLGDFSRIVTGFYSSDGFTCG  1663

Query  5200  RIDIRENSVIGSQGLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTL  5379
              I +++NSV+GSQ LIL GS I +DV+LGALS+AP+ SVLE  G ++G +  ++V+N   
Sbjct  1664  EIQVQKNSVVGSQSLILSGSNIHEDVVLGALSIAPVGSVLERGGIYMGCQTPILVKNTLH  1723

Query  5380  PLDDRIEEMDPKYKKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHK  5559
              LD+RIEEMD KYKK++G LA NLA +T+K KSRYFHRIG  GKG L +Y  L GLP+H 
Sbjct  1724  ALDERIEEMDEKYKKIVGKLAGNLAITTMKAKSRYFHRIGVGGKGVLNIYQDLSGLPNHN  1783

Query  5560  IFGPGATYPVIIRHSNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAF  5739
             IFGPG  +PV+IRHSN LS+DDDAR+D RGAA+RIL  E    +   PLLDLTLKTGKAF
Sbjct  1784  IFGPGKCFPVVIRHSNSLSADDDARIDARGAALRILSEE----SRRVPLLDLTLKTGKAF  1839

Query  5740  HARTIGDFATWLVCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKD  5919
             +ARTI DFATWL CG  ARE+ V+  PHIRDA+W SLR  NSYTELHYYSNICRL RF  
Sbjct  1840  YARTIEDFATWLSCGLPAREQQVERCPHIRDAVWSSLRNTNSYTELHYYSNICRLLRFDS  1899

Query  5920  GQEMYVRFKLRPFDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSS  6099
             G+EMYV+FKLRP D  IGE  G V P+GILPPETGAIPR+END RPLLFLA+DF+ RV S
Sbjct  1900  GEEMYVKFKLRPVDRDIGEVSGHVAPKGILPPETGAIPREENDTRPLLFLADDFRRRVDS  1959

Query  6100  PDKVRYVLQLQIQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELE  6279
                VRY+ QLQ +P+P D   RE  LDCT+PWDE E PY+++GEITIDQ LT +ESE LE
Sbjct  1960  SGHVRYIFQLQCRPVPSDGEEREWALDCTRPWDETEYPYMDIGEITIDQNLTMEESERLE  2019

Query  6280  FNPFFRCNEIDVIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLD  6459
             FNPF RCNE+D+IRATS +QSASIDHGRSLVYEICQ+LRN  PLP AWR FL+QS  K+D
Sbjct  2020  FNPFLRCNEVDIIRATSASQSASIDHGRSLVYEICQHLRNGTPLPMAWRSFLEQSGAKVD  2079

Query  6460  LSGCPLA--AKLENKDM--PKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNC  6627
             LSGCP+A  A +  K+    + TLAR    TLW    QP LQ +LPYF+LG+VI+  L  
Sbjct  2080  LSGCPMAATAAMLTKEFGDRRVTLARTRCQTLWATCCQPLLQTLLPYFVLGMVIFLLLRW  2139

Query  6628  LFYTHEMTQIQKQWLLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTI  6807
             +       ++   WLLP +W  SGI+AGL+CA +KWVLVG+K +G+   IWSR +FMDT+
Sbjct  2140  MLIVKSTLELPLHWLLPPFWVASGIMAGLICAGAKWVLVGRKKEGEAVLIWSRVVFMDTV  2199

Query  6808  WQAIRTVTGEYFMETATGTFLMGIWMRLMGSEV-ARDGVYIDSMGATLNPDMVRIEEYGS  6984
             WQA+RTV G+YF+E  TG+ L G+WM+LMGS +   DGVY+DSMGA LNP+MV I   G+
Sbjct  2200  WQALRTVVGDYFVEMITGSVLFGVWMQLMGSSIEVDDGVYVDSMGAVLNPEMVEIRSGGA  2259

Query  6985  VGREALLFGHIYEG-GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             VGR+ALLFGH YEG  G VKYG+I V  GGFVGSRAV MPGA ++SGG LGALSLAM
Sbjct  2260  VGRDALLFGHSYEGEEGRVKYGKIKVGEGGFVGSRAVVMPGARVESGGCLGALSLAM  2316



>ref|XP_004487235.1| PREDICTED: uncharacterized protein LOC101501314 [Cicer arietinum]
Length=2320

 Score =  2766 bits (7170),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1375/2330 (59%), Positives = 1754/2330 (75%), Gaps = 65/2330 (3%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+    +++   KLHP +P  TRIGIVGAGPSG+SAAYAL +LGY+N+ VLEKHH+ GGM
Sbjct  1     MDPERSIEEQLSKLHPSLPLNTRIGIVGAGPSGISAAYALARLGYNNITVLEKHHAVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRV  660
             CES++I+G+ YDLGGQVLAA+SAP IFHLAKE G+ +EE+D+HKLA++DS    Y D++V
Sbjct  61    CESVEIEGKVYDLGGQVLAASSAPVIFHLAKETGSALEELDSHKLAVIDSSSGKYQDIKV  120

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             A+DY+S         ++VK + R GV +VSEIA+D+TPE+L+  GLKSVPKSVAYGYTAS
Sbjct  121   ADDYVS---------EKVKNSGRFGVLAVSEIAADLTPEYLEHHGLKSVPKSVAYGYTAS  171

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF+QDMPYAY+HEF RTSMAGKIRRFKGGYTS+W+K++E++PIK  CNTEVL+I+RNS
Sbjct  172   GYGFMQDMPYAYVHEFTRTSMAGKIRRFKGGYTSLWQKIAESLPIKLHCNTEVLAIRRNS  231

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
               V V+V+  N  ++ MEFDKII+SG FP   GRTYR           + MD S +EK+L
Sbjct  232   EIVAVNVKSSN-EIETMEFDKIIVSGNFPLKYGRTYRLSPSTCIDCEAEVMDSSDIEKEL  290

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             FSKV+  +YYT+V +I GL+H+P+GFYYF  +MEDP+ IGNPVAMQKFY DT++FL WSY
Sbjct  291   FSKVEVNDYYTTVFKIKGLDHMPVGFYYFNEYMEDPSTIGNPVAMQKFYADTDIFLLWSY  350

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GNS DI G  + ELA K +  MGG+V+  ILQR FKYFPHV+ QDMK+GFYEKLE++LQG
Sbjct  351   GNSFDIKGPTITELAIKNIESMGGEVESFILQRRFKYFPHVSSQDMKNGFYEKLESELQG  410

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
               NTYYVGGLMAFELTERN+SY+MAL+ K+FA    +P FPY K LFPL++  +    K+
Sbjct  411   SRNTYYVGGLMAFELTERNSSYAMALMCKNFAKSSDLPVFPYTKSLFPLQTEFQRKEPKE  470

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             L E+PGV+FP+L +L+SYL+HWGT  VT+++TLY+W+NE+G V+ +RTY+E H NA  IA
Sbjct  471   LAELPGVQFPDLPTLNSYLKHWGTHPVTQDRTLYSWINEEGKVIVKRTYREQHLNASCIA  530

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
              KLL S KP IKPGDKVLL+Y+PGLDFVDAFFGCLRA+VIP+P +PPDP Q  GGQALL 
Sbjct  531   SKLLKSHKPVIKPGDKVLLVYLPGLDFVDAFFGCLRAKVIPVPVLPPDPMQ-SGGQALLK  589

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPDLPWLHTDSWVkkpk  2280
             I NIAK C  VAILST +YH  VR    K+ +  K+  KSS  WP+LPWLHTD+WV   +
Sbjct  590   IENIAKSCGMVAILSTVAYHSAVRAGLVKSFITLKN-GKSSARWPNLPWLHTDTWVNNSR  648

Query  2281  lfkkp-kDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTIL  2457
                     +Q +  S D+CFLQFTSGST D KGVMITHGG+IHNVKLMR RYKSTS T+L
Sbjct  649   SSAIEDLYDQCESKSGDICFLQFTSGSTGDAKGVMITHGGLIHNVKLMRSRYKSTSMTVL  708

Query  2458  VSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAF  2637
             VSWLPQYHDMGLIGGL T LVSGG+ +LFSP+TF+K PLLW++TMSK++ATHSA PNFAF
Sbjct  709   VSWLPQYHDMGLIGGLFTALVSGGTALLFSPMTFIKKPLLWIETMSKYQATHSAGPNFAF  768

Query  2638  ELLVRRLESSKE--ENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGL  2811
             EL+VRRLES K+  +N DLSSM FLM AAEP+RQ TLKRF+ELT  +GLS++ MAPGYGL
Sbjct  769   ELVVRRLESDKDKFQNLDLSSMIFLMVAAEPVRQKTLKRFLELTGPYGLSQKAMAPGYGL  828

Query  2812  AENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEI  2991
             AENCVFVSCA+GEG P+ VDWQGRVCCGYI   N D +DI+I  P++G+E  + GKEGEI
Sbjct  829   AENCVFVSCAFGEGNPILVDWQGRVCCGYIHPGNAD-IDIRIADPDSGEELQEDGKEGEI  887

Query  2992  WISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIV  3171
             WISS SAGIGYWG EELS++TF N + + PG+ Y RTGDLGRIID KLFITGR KDLIIV
Sbjct  888   WISSPSAGIGYWGKEELSKQTFRNQLPNHPGRAYTRTGDLGRIIDGKLFITGRIKDLIIV  947

Query  3172  AGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRD  3351
             AG+NIY+SD+EKTVESSSE +RPGCCAV+G+PE+ L +KGI     SD++GLVVIAE+RD
Sbjct  948   AGRNIYSSDVEKTVESSSEFLRPGCCAVIGVPEETLSAKGISLPDGSDQVGLVVIAELRD  1007

Query  3352  GKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVI  3531
             GKP+  DV+D+I TRVAEEHGV +AS+  IKP++ISKTTSGKIKR+EC K+F  GTL ++
Sbjct  1008  GKPVSKDVVDNIQTRVAEEHGVNVASVKLIKPKTISKTTSGKIKRFECLKQFADGTLSLV  1067

Query  3532  EEQMNGERSLPRNDGIIVPANG----------------KISKTDIVNFLKDLLSQQTGIP  3663
              + +  +++L R+        G                +IS  +I+ FLK L+S+Q GI 
Sbjct  1068  PQPVLTKKTLLRSFTTGTCKEGRTPRARLANSTPITSPRISNKEILEFLKRLVSEQAGIS  1127

Query  3664  VSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEKN  3843
             VS IS  + + +YG++SI VV+A QK+S F G+ + AID+FSA+CI++LA+F+ +LL K+
Sbjct  1128  VSSISVTDNMSTYGMDSISVVKATQKLSDFLGVPVAAIDVFSASCIEELANFLGNLLLKS  1187

Query  3844  HPMLTN----SSETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPAYISVSMFK  4011
              P L N    S E +  S+ +   VS   + +I  + L+AL Y+S+LL+ PAY+S++ F+
Sbjct  1188  QPHLLNNQSFSPEAETESTELFVDVSKSHRWSICFLQLLALFYISVLLVSPAYLSITTFQ  1247

Query  4012  PLI-LANQS----PWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPEISV  4176
              LI   ++S    PW  Y ISL  AP SW+LCI  TCIC    GN+ L+PNY L+PEIS+
Sbjct  1248  SLIERVDKSLYIIPWSNYLISLILAPLSWILCIASTCICISFFGNSFLRPNYALSPEISI  1307

Query  4177  WSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDPLLV  4356
             +S++FVKWWALYK+QEISSKVLA+HL+GTVFL YWF+ LGA+I SS LIDTVDITDP LV
Sbjct  1308  YSMDFVKWWALYKSQEISSKVLAIHLKGTVFLKYWFETLGARIGSSVLIDTVDITDPSLV  1367

Query  4357  SIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLA-QN  4533
             SI +E+VISEG L+QSHEVKNGVLS   +RIG+ SSIGPYAV+QKGS++ +GAEV   Q 
Sbjct  1368  SIGDEAVISEGVLVQSHEVKNGVLSLHPIRIGRNSSIGPYAVIQKGSVIKEGAEVQPLQK  1427

Query  4534  KKAAAKISKP--LNGHKGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLNSLSAAIAYLVWI  4707
              +    +  P  LN  K      +   +    N+++   GIY++G+L+SL+AAI Y ++ 
Sbjct  1428  VEGGQHVLNPSKLNNVKENAVLLV-TTSKTESNAIYHFLGIYLVGFLSSLAAAITYFMYT  1486

Query  4708  WLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHGLIL  4887
             W  QKP S   F F+CI GAFHW P+ +  +  MF+ +P +   FA      Y  HGLIL
Sbjct  1487  WFFQKPSSFQSFSFVCICGAFHWIPFTLTAYATMFSDVPSNPFDFAISFTCAYLLHGLIL  1546

Query  4888  SVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWMGAKIG  5067
             +  T  L   +  +  T   T   W+  ++ ++CH+RFAKLLSGTE FCVYL  +GAKIG
Sbjct  1547  TSLTCSLTFLLKSQKQTHFKT---WLQQQLILSCHLRFAKLLSGTEAFCVYLRLLGAKIG  1603

Query  5068  QHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQGLI  5247
             +HCSIRAINPV  P L+S+ DGVHLGDFSRI+ G++ + GY  G++++++NSV+GSQ LI
Sbjct  1604  KHCSIRAINPVSNPELMSIGDGVHLGDFSRIITGFNYSNGYACGKVEVQDNSVVGSQSLI  1663

Query  5248  LPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRN-QTLPLDDRIEEMDPKYKK  5424
             LPGS +EK+VILGALS AP+NS+L     ++GS+  V +RN      D+RIE MD  YKK
Sbjct  1664  LPGSLVEKNVILGALSFAPMNSILHEGSVYIGSQTRVTMRNLGNANFDERIEVMDMDYKK  1723

Query  5425  VLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVL-PGLPDHKIFGPGATYPVIIRH  5601
             ++ +LAANLAA+T+  K+RYFHRIG +GKG L++YN L   +P HKIF PG +YP+I+RH
Sbjct  1724  IVANLAANLAATTMNAKARYFHRIGVSGKGQLKIYNKLDESIPMHKIFHPGKSYPIIVRH  1783

Query  5602  SNCLSSDDDARLDPRGAAIRIL---PHERtttttttplldltlktGKAFHARTIGDFATW  5772
             SN LS+DDDAR D RGAA+RIL   P + ++ +  + L+DLTLKTG AF+AR + DFA+W
Sbjct  1784  SNSLSADDDARSDARGAALRILSDEPTKDSSYSHPSTLIDLTLKTGNAFYARNLADFASW  1843

Query  5773  LVCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKLR  5952
             LVCG AAREE VK APH+ DA+W SLR+ +SY ELHYYSN CRL RF+DG++MYV+FKLR
Sbjct  1844  LVCGQAAREELVKAAPHVGDAVWSSLRQADSYAELHYYSNYCRLMRFQDGKQMYVKFKLR  1903

Query  5953  PFDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQ  6132
             P+D  I E+ G+V P GILPPETG IPRDEND RPLLFLA DF+ RVSS + V YV Q+Q
Sbjct  1904  PYDTSINEDKGKVNPTGILPPETGTIPRDENDLRPLLFLANDFQNRVSSTNGVSYVFQMQ  1963

Query  6133  IQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEID  6312
             ++P+PD+E  RE  LDCTKPWDE + P+I+VGEI I++ L+ ++S++LEFNP+ R NE+D
Sbjct  1964  LRPVPDEEHGREVALDCTKPWDENQFPFIDVGEININENLSMEDSQKLEFNPYLRSNELD  2023

Query  6313  VIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAA---  6483
             VI ATS  QSASIDHGRSL+YEICQ++RNR+PLPEAWR  + QS+VK+DLS CP+A+   
Sbjct  2024  VISATSNTQSASIDHGRSLIYEICQHVRNRQPLPEAWRNLVQQSNVKVDLSCCPIASSSP  2083

Query  6484  KLENKD--MPKA---TLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEM  6648
              L  K+  + KA   TL R WY TL  +  QP LQ  LPY ++GL ++ PLN +FY  ++
Sbjct  2084  SLPEKEPLLKKASTLTLTRTWYQTLSALFIQPLLQTFLPYMVIGLSVFVPLNLVFYFKDV  2143

Query  6649  TQIQKQWLLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTV  6828
              + Q  WLLPL+W  SG LA L C ++K VL+GK+  G+T PIWS  I MD+ WQAIRT+
Sbjct  2144  KKHQLHWLLPLFWILSGTLAALACVIAKRVLIGKRKVGETIPIWSMKIVMDSTWQAIRTL  2203

Query  6829  TGEYFMETATGTFLMGIWMRLMGSEVARDGVYIDSMGATLNPDMVRIEEYGSVGREALLF  7008
              G+YFM+   G+FL  IWM+LMGS++  DG Y+DSMGA LNP+MV+IE  G VGREALLF
Sbjct  2204  VGDYFMDMTKGSFLFVIWMKLMGSDIDMDG-YVDSMGAMLNPEMVKIERGGCVGREALLF  2262

Query  7009  GHIYEG--GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             GHIYEG  GG VK+G I +   GFVGSRAV MPG  +++  +L ALSLAM
Sbjct  2263  GHIYEGDEGGMVKFGEIKIGEDGFVGSRAVVMPGVQLENQANLAALSLAM  2312



>gb|KCW51231.1| hypothetical protein EUGRSUZ_J00812 [Eucalyptus grandis]
Length=2259

 Score =  2749 bits (7126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1372/2319 (59%), Positives = 1729/2319 (75%), Gaps = 104/2319 (4%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+S   V+D F KLHPC+P  TRIGIVG G SGLSA YAL+KLGY ++ V+EKH S GGM
Sbjct  1     MDSQKSVEDQFSKLHPCLPLDTRIGIVGGGSSGLSAVYALVKLGYRDITVIEKHKSVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDS-DWAYTDMRV  660
             CES++I+                        E G E+EEMD HKLAL+DS    Y D+  
Sbjct  61    CESVEIE------------------------ESGTELEEMDLHKLALIDSFTGEYQDINA  96

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             AEDY+S++ +TL++QD+ K +NRIG+++VS+IASD+TP +L+  G+KS+PKSV YGYTAS
Sbjct  97    AEDYMSLVSLTLEIQDKAKDSNRIGIHAVSDIASDLTPAYLEAHGIKSIPKSVQYGYTAS  156

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF+QDMPYAYIHEF RTSMAGKIRR KGGY S+WKK+S+++ IK  CNTEV +++R+S
Sbjct  157   GYGFVQDMPYAYIHEFTRTSMAGKIRRIKGGYMSLWKKISDSLLIKVCCNTEVQAVRRDS  216

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPS---QKTAGLFCDKMDMSTLE  1191
             SG  VD+ + +G  +  EFDKIIISGAFPF + RTYRS S   +   GL    +D+S LE
Sbjct  217   SGANVDITNSSGETEHKEFDKIIISGAFPFKHSRTYRSTSFSREAETGL----LDVSDLE  272

Query  1192  KDLFSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLF  1371
             ++LFSKVQTI+YYT+VL+I+GLE + +GFYY    MEDP+ IG+PVA+Q+FY DTN+FLF
Sbjct  273   RELFSKVQTIDYYTTVLKINGLERIAVGFYYLGENMEDPSTIGHPVAIQRFYADTNIFLF  332

Query  1372  WSYGNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQ  1551
             WSYG+S++I GS V++LA + V +MGG+V+KVILQR FKYFPH+  +DMKD FYE++E++
Sbjct  333   WSYGDSVNIRGSNVIDLAIEVVKRMGGEVEKVILQRRFKYFPHIGSKDMKDRFYERIESE  392

Query  1552  LQGQLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLA  1731
             LQG  NTYYVGGL AFELTERN+SY+MALI KHFA+    PT PYVK LF L+   E   
Sbjct  393   LQGHRNTYYVGGLFAFELTERNSSYAMALICKHFASANSFPTLPYVKSLFTLQLDQEEAG  452

Query  1732  FKQLDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAF  1911
              K L E  GV FP+L +LDSYL+HW    +T+NK LYTW+NE+G V+ +RTY E+  NA 
Sbjct  453   LKTLSETHGVVFPDLPTLDSYLKHWAAKEITQNKALYTWINEEGAVVCQRTYAELDFNAS  512

Query  1912  TIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQA  2091
              IA KLLTS+KP IK GD+VLL++VPGLDFVDAFFGCLRA+V+P+P +PPDP QRGG QA
Sbjct  513   CIAHKLLTSRKPTIKSGDRVLLVHVPGLDFVDAFFGCLRAKVVPVPVLPPDPLQRGG-QA  571

Query  2092  LLHIANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSWV  2268
             L  I NIAK CN VAILST  YH  VR  S KN++ F +   +S+  WP+LPWLHTDSW+
Sbjct  572   LAKIENIAKFCNAVAILSTVGYHAAVRAGSVKNLISFTRKSAESTAQWPNLPWLHTDSWI  631

Query  2269  kkpklf-kkpkDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTS  2445
             K  K+        Q +   +DLCFLQFTSGST D KGVMITHGG+IHNVKLMR+RY+STS
Sbjct  632   KSSKVLPASNIGSQSESQPDDLCFLQFTSGSTGDAKGVMITHGGLIHNVKLMRRRYRSTS  691

Query  2446  RTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAP  2625
              T+LVSWLPQYHDMGLIGGL T +V GG+ ILFSP+TF++NPLLWLQT+S ++ATHSA P
Sbjct  692   NTVLVSWLPQYHDMGLIGGLFTAMVCGGTAILFSPLTFIRNPLLWLQTISDYKATHSAGP  751

Query  2626  NFAFELLVRRLES--SKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAP  2799
             NFAFEL++RRLE+  +K  ++DLSSM F M AAEP+RQ TLKRFVELT+ +GLS+EVMAP
Sbjct  752   NFAFELVIRRLEADKAKAHDYDLSSMIFFMIAAEPVRQKTLKRFVELTRPYGLSQEVMAP  811

Query  2800  GYGLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGK  2979
             GYGLAENCVFV CAYG+  P+ VDWQGR+CCGY+  PN   VDIKI+  +TG E D+ GK
Sbjct  812   GYGLAENCVFVGCAYGKKKPILVDWQGRICCGYV-DPNDADVDIKIVDADTGLEVDEDGK  870

Query  2980  EGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKD  3159
             EGEIWISSLSAGIGYWG EELSQKTF N + + PGK+Y RTGDLGR+I   LFITGR KD
Sbjct  871   EGEIWISSLSAGIGYWGKEELSQKTFRNKLQNYPGKKYTRTGDLGRVIQGNLFITGRIKD  930

Query  3160  LIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIA  3339
             LIIVAG+ IY++D+EKTVESSSEL+RPGCCA+                            
Sbjct  931   LIIVAGRKIYSTDVEKTVESSSELLRPGCCAL----------------------------  962

Query  3340  EVRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGT  3519
               RDGKP+  D++  I +RVAEEHGV  AS+  IKPR+ISKTTSGKIKR+EC K+F+ GT
Sbjct  963   --RDGKPVDKDIIKQIESRVAEEHGVIAASVKLIKPRTISKTTSGKIKRFECLKQFVDGT  1020

Query  3520  LDVIEEQMNGERSLPRN-------DGII---------VPANGKISKTDIVNFLKDLLSQQ  3651
             L+ + + +  +RSL R+       +G           +P + K+S  +IV FLK L+S+Q
Sbjct  1021  LNTVPDPIVTKRSLTRSFTTGKCREGKTPQSHLAKSSLPPSPKLSNRNIVEFLKQLVSEQ  1080

Query  3652  TGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESL  3831
             TGI +  IS  E+LVSYG++SIGVVRAAQK+S F G+ +GA+DIF+ATCI DLA+F E+L
Sbjct  1081  TGIAIQNISAMESLVSYGIDSIGVVRAAQKLSDFLGVPVGAVDIFTATCIADLANFAENL  1140

Query  3832  LEKNHP----MLTNSSETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPAYISV  3999
             L K+ P      +N+ E ++ ++  P  +S   +  IW   L+AL YVS +L+ PAY+SV
Sbjct  1141  LMKSQPHRVTTQSNNPEPEVLTADFPMEISRLHRWRIWSFQLLALLYVSFILVFPAYLSV  1200

Query  4000  SMFKPLILANQS-----PWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNP  4164
             S F+ L+ A+Q      PW ++   +  AP SW+LCI LT I     GN+ L+ NY L P
Sbjct  1201  SAFQILVSASQKLIDGLPWLYHPSVVLLAPLSWILCIALTSISIAFFGNSFLRINYALTP  1260

Query  4165  EISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITD  4344
             E+S+WSV+FVKWWALYKAQE+SSKVLAVHLRGTVFL +WF++LGA+I SS L+DTVDITD
Sbjct  1261  EVSIWSVDFVKWWALYKAQEVSSKVLAVHLRGTVFLKHWFEMLGARIGSSVLLDTVDITD  1320

Query  4345  PLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVL  4524
             P LVSI + +VI+EGAL+QSHEV++ +L F  +RIG+  S+GPYAV+QKGS++G+GAEV 
Sbjct  1321  PSLVSIGDGAVIAEGALLQSHEVRDSILRFQPIRIGRNCSVGPYAVVQKGSVLGEGAEVP  1380

Query  4525  AQNKKAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQLF-GIYMIGYLNSLSAAIAYLV  4701
             A  K    K +  + G       +I K + G+     Q F GIYM+G L+S+SAA  YL+
Sbjct  1381  ALQKSERRKPAFKMAG-----ADKILKVSPGSLKETIQQFMGIYMVGLLSSVSAAAVYLL  1435

Query  4702  WIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHGL  4881
             ++ L QK PSL    F+CI+GA HW P+ I+ +  MFT+   +   FA  +A  Y AHGL
Sbjct  1436  YMRLSQKVPSLEQLAFVCISGALHWVPFTIMAYATMFTNALPNPFEFAISLAIAYFAHGL  1495

Query  4882  ILSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWMGAK  5061
             +LS+ T +  H +  K    +   + W  HR+ VACH+RFAKLLSGTE FC+YL  +GAK
Sbjct  1496  VLSLLTSIFTHLLCGKEKKTQTHIKTWFGHRLAVACHLRFAKLLSGTEAFCMYLRLLGAK  1555

Query  5062  IGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQG  5241
             +G++CSIR+INPVV+P +VS+  GVHLGDFSRI+ G+++  GYI   +D+++NSVIGSQ 
Sbjct  1556  VGKYCSIRSINPVVDPRMVSIGAGVHLGDFSRIITGFYSQSGYIQSNVDVKDNSVIGSQS  1615

Query  5242  LILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMDPKYK  5421
             LILPGS +EK+VILGA+SV+P+NSVL+  G ++GS++ VMV+N T  LDDRIEEMDP+YK
Sbjct  1616  LILPGSVVEKNVILGAISVSPVNSVLQSGGVYMGSQSPVMVKNTTYALDDRIEEMDPRYK  1675

Query  5422  KVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYPVIIRH  5601
             K++G+LAANLAA+TLKLKSRYFHRIG +G G L+LY+ + GLP+H IF PG  Y VIIRH
Sbjct  1676  KIVGNLAANLAAATLKLKSRYFHRIGVSGGGYLKLYDDIQGLPEHNIFSPGKKYTVIIRH  1735

Query  5602  SNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFATWLVC  5781
             SN +S+DDDARLD RGAA+RIL  E+   +    L   T   GKA  ARTI DFATW+VC
Sbjct  1736  SNGVSADDDARLDVRGAALRILTDEKEDDSPLLDLTLKT---GKASAARTISDFATWMVC  1792

Query  5782  GAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKLRPFD  5961
             G AAREE VK  PH+RDA W SLR+ +SY +LHYYSN+CRLFRFKDGQEMYV+FKLRPFD
Sbjct  1793  GLAAREERVKREPHLRDAAWSSLRQADSYADLHYYSNVCRLFRFKDGQEMYVKFKLRPFD  1852

Query  5962  EKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQIQP  6141
             + I E+ G+VEP GILPPET AIPRD ND RPLLFLAEDF+ RV S + VRY+ QLQ++P
Sbjct  1853  KNIREDSGKVEPFGILPPETIAIPRDANDTRPLLFLAEDFQNRVKSANGVRYIFQLQVRP  1912

Query  6142  IPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEIDVIR  6321
             IP DE  +E  LDCTKPWDE + PYI+VGE+ I++ LT++ SE LEF PF RC+E+DVIR
Sbjct  1913  IPQDEAAQEIALDCTKPWDELQFPYIDVGEVIINENLTKEGSERLEFKPFLRCHEVDVIR  1972

Query  6322  ATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAKLENKD  6501
             ATS +QSASIDHGRSLVYEICQ LRN  PLP AWRIFL+QSDVK+DLSGCP+AA LE KD
Sbjct  1973  ATSSSQSASIDHGRSLVYEICQRLRNGDPLPGAWRIFLEQSDVKVDLSGCPMAAALERKD  2032

Query  6502  MPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQWLLPL  6681
               K TL R WY+T W +  QP LQ +LPYFLLGL+IY PLN L +      +   W  P 
Sbjct  2033  AEKVTLLRPWYLTTWAVFAQPLLQTILPYFLLGLIIYFPLNLLLHCKNTRNMPVHWTFPF  2092

Query  6682  WWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGEYFMETATG  6861
             +W  +G+LA L C ++K++LVGKK + +   IWSRG+FMDTIWQAIRTV G+YF+E A+G
Sbjct  2093  FWVSTGVLAALACVVAKYILVGKKSEDERVHIWSRGVFMDTIWQAIRTVVGDYFVEMASG  2152

Query  6862  TFLMGIWMRLMGSEVARD-GVYIDSMGATLNPDMVRIEEYGSVGREALLFGHIYEG-GGE  7035
             + L  +WM+LMGS +  D G Y+DSMGA +NP+MV +E  GSV REALLFGH+Y+G GG 
Sbjct  2153  SALFLMWMKLMGSYIELDKGTYVDSMGAAMNPEMVEVEGGGSVEREALLFGHVYDGEGGV  2212

Query  7036  VKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             VK+G+I V   GFVGSRAVAMPG  ++S GSL ALSLAM
Sbjct  2213  VKFGKIVVGERGFVGSRAVAMPGVAVESEGSLSALSLAM  2251



>gb|AES67729.2| AMP-binding enzyme [Medicago truncatula]
Length=2301

 Score =  2739 bits (7101),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1348/2330 (58%), Positives = 1726/2330 (74%), Gaps = 84/2330 (4%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+    +++ F KLHP +P  TRIGIVGAGPSG+SAAYAL +LGY+N+ VLEKHH+ GGM
Sbjct  1     MDPERSIEEQFSKLHPSLPLNTRIGIVGAGPSGISAAYALSRLGYNNITVLEKHHAVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVD-SDWAYTDMRV  660
             CES++I+                        E  + +EE+D+HKLA++D S   Y D++V
Sbjct  61    CESVEIE------------------------ETESALEELDSHKLAIIDTSSGKYQDIKV  96

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             A+DY+SV+ +TLK+Q++VK + R GV++VSE+A+D+TPEFL+  GLKS+P SVA+GYTAS
Sbjct  97    ADDYVSVMSLTLKIQEKVKNSGRFGVHAVSEVAADLTPEFLEHHGLKSIPNSVAFGYTAS  156

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGFIQDMPYAYIHEF RTSMAGKIRRFKGGYTS+W+K++E++PIK  CNTEVL+I+RN 
Sbjct  157   GYGFIQDMPYAYIHEFTRTSMAGKIRRFKGGYTSLWQKIAESLPIKLHCNTEVLAIRRNF  216

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
               V V+V+  N   + MEFDKII+SG FP   GRTYRS          + MD S +EK+L
Sbjct  217   DSVNVNVKSSN-ETETMEFDKIIVSGNFPLKYGRTYRSAPSNCIDSEAEVMDASDIEKEL  275

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             FSKV+  +YYT+  +I GL+H+P+GFYYF  +M+DP+ IGNPVAMQKFY DT++FLFWSY
Sbjct  276   FSKVEINDYYTTAFKIRGLDHMPVGFYYFNEYMDDPSTIGNPVAMQKFYADTDIFLFWSY  335

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GNS DI G  + ELA KA+  +GG+V+  ILQR FKYFPHV+ QDMK+GFYEKLE++LQG
Sbjct  336   GNSFDIKGPTITELAIKAIKSIGGEVESFILQRRFKYFPHVSSQDMKNGFYEKLESELQG  395

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
               NTYYVGGLMAFELTERN+SY+MAL+ K+FA+   +P FPY K LFPL++  +    KQ
Sbjct  396   SRNTYYVGGLMAFELTERNSSYAMALMCKNFASSSDLPVFPYTKSLFPLQTEFQRKEPKQ  455

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             L E+PGV+FP L +L+ YL+HWGT  VTE++TLY+W+NE+G V+ +RTY+E H NA  IA
Sbjct  456   LAELPGVQFPNLPTLNGYLKHWGTHPVTEDRTLYSWINEQGTVIGKRTYREQHLNASCIA  515

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
              KLL SQ    KPGDKVLL+YVPGLDF+DAFFGCLRA+VIP+P IPPDP QR  GQALL 
Sbjct  516   SKLLKSQ----KPGDKVLLVYVPGLDFIDAFFGCLRAKVIPVPVIPPDPMQR-SGQALLK  570

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPDLPWLHTDSWVkkpk  2280
             I NIAK C  VAILST +YH  VR    KN +  K+  KSS  WP LPWLHTD+WV   +
Sbjct  571   IENIAKSCGIVAILSTVAYHSAVRAGLVKNFITLKN-GKSSARWPSLPWLHTDTWVNNSR  629

Query  2281  lfkkpk--DEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTI  2454
              +      D+Q +  S D+CFLQFTSGST D KGVMITHGG+IHNVKLM+ RYKSTSRT+
Sbjct  630   SYALENLYDDQRESQSGDICFLQFTSGSTGDAKGVMITHGGLIHNVKLMQSRYKSTSRTV  689

Query  2455  LVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFA  2634
             LVSWLPQYHDMGLIGGL T LVSGG+ +LFSP+TF+K PLLW++TMSK++ATHSA PNFA
Sbjct  690   LVSWLPQYHDMGLIGGLFTALVSGGTALLFSPMTFIKKPLLWIETMSKYQATHSAGPNFA  749

Query  2635  FELLVRRLESS---KEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGY  2805
             FEL+VRRLESS   K +N DLSSM FLM AAEP+RQ TLKRF+ELT  +GLS++ MAPGY
Sbjct  750   FELVVRRLESSDKDKLQNLDLSSMIFLMVAAEPVRQKTLKRFLELTGPYGLSQKAMAPGY  809

Query  2806  GLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEG  2985
             GLAENCVFVSCA+GEG P+FVDWQGRVCCGYI   N D VDI+I+ P+  +E  + GKEG
Sbjct  810   GLAENCVFVSCAFGEGNPIFVDWQGRVCCGYIHPGNAD-VDIRIVDPDGIEELQEDGKEG  868

Query  2986  EIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLI  3165
             EIWISS SAGIGYWG EELSQ TF+N + + PG+ Y RTGDLGRIID KLFITGR KDLI
Sbjct  869   EIWISSPSAGIGYWGKEELSQSTFQNQLPNHPGRFYTRTGDLGRIIDGKLFITGRIKDLI  928

Query  3166  IVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEV  3345
             IVAG+NIY+SD+EKTVESSSEL+RPGCCAV+G+PE+ L +KGI     SD++GLVVIAE+
Sbjct  929   IVAGRNIYSSDVEKTVESSSELLRPGCCAVIGVPEETLSAKGISLPDGSDQVGLVVIAEL  988

Query  3346  RDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLD  3525
             RDGKP+  DV+D I TRVAEEHGV +AS+  IKPR+ISKTTSGKI+R+EC K+F  GTL+
Sbjct  989   RDGKPVSKDVVDDIQTRVAEEHGVNVASVKLIKPRTISKTTSGKIRRFECLKQFADGTLN  1048

Query  3526  VIEEQMNGERSLPRNDGIIVPANG----------------KISKTDIVNFLKDLLSQQTG  3657
             ++ + +  ++ L R+        G                +I   +I+ FLK L+S+Q G
Sbjct  1049  LVPQPVLTKKKLVRSFTTGTCKEGRTPRAQLANSTPITSPRIGNKEIMEFLKRLISEQAG  1108

Query  3658  IPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLE  3837
             IPVSKIS  + + +YG++SI VV+A QK+S F G+ + AID+FSA+CI +L +F E+LL 
Sbjct  1109  IPVSKISVTDNMSTYGMDSISVVKATQKLSDFLGVTVAAIDVFSASCIQELVNFSENLLL  1168

Query  3838  KNHP-MLTNSS---ETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPAYISVSM  4005
             K+ P +L+N S   E +  S+     VS   + +I L+ L+AL ++S+L++ PAY+S++ 
Sbjct  1169  KSQPHLLSNPSYAPEAETESTEFIVDVSKSHQWSIHLLQLLALVFISILVVSPAYLSITT  1228

Query  4006  FKPLIL-----ANQSPWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPEI  4170
             F+  I      A   P   Y  SLA AP SW+LCI  TCIC    GN+ L+PNY L PE+
Sbjct  1229  FQIFIASFGKSAYGIPLSNYIFSLALAPLSWILCIASTCICISFFGNSFLRPNYALTPEM  1288

Query  4171  SVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDPL  4350
             S++S+ FVKWWALYK+QEISSKVLA HL+GTVFLNYWF+ILGA+I SS LIDTVDITDP 
Sbjct  1289  SIYSIAFVKWWALYKSQEISSKVLATHLKGTVFLNYWFEILGARIGSSVLIDTVDITDPS  1348

Query  4351  LVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLA-  4527
             LVSI +E+VISEG L+QSHEVKNG+LS   +RIG+ SSIGPYAV+QKGSI+ +GAE+   
Sbjct  1349  LVSIGDEAVISEGVLVQSHEVKNGILSLHPIRIGRNSSIGPYAVIQKGSIIKEGAEIQPL  1408

Query  4528  QNKKAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLNSLSAAIAYLVWI  4707
             Q  +    + K    +   V      +     ++++   GIY++ +++SL+AAI Y ++ 
Sbjct  1409  QKVEGGQHVLKTAKLNNNAVLLVTMTKTES--DAIYHFLGIYLVAFVSSLAAAITYFMYT  1466

Query  4708  WLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHGLIL  4887
             W  QKP S+  F F+CI GAFHW P+ I  +  MF+ +  + ++FA      Y  HGLIL
Sbjct  1467  WFFQKPASIQSFSFVCICGAFHWIPFTITAYATMFSEVQSNPIAFAISFTCAYLLHGLIL  1526

Query  4888  SVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWMGAKIG  5067
             +  T  L   +  +  T   T   W+ ++M ++CH++FAKLLSGTE FCVYL  +GAKIG
Sbjct  1527  TSLTCSLTRLLKSQKQTHFKT---WLQNQMILSCHLKFAKLLSGTEAFCVYLRLIGAKIG  1583

Query  5068  QHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQGLI  5247
             +HCSIRAINPV  P L+ + DGVHLGDFSRI+ G++ + GY  G+I++++NSV+GSQ LI
Sbjct  1584  KHCSIRAINPVSNPELMLIGDGVHLGDFSRIITGFNYSDGYTCGKIEVQDNSVVGSQSLI  1643

Query  5248  LPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQ-TLPLDDRIEEMDPKYKK  5424
             LPGS +EK+VILGALSVAP+NS+L     ++GS+  V +RN      D+RIEEMD  YKK
Sbjct  1644  LPGSLVEKNVILGALSVAPMNSILHEGSVYIGSQTRVTMRNSGNASFDERIEEMDIDYKK  1703

Query  5425  VLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYPVIIRHS  5604
             ++ +LAANLA +T+  K+RYFHRIG +GKG L++YN L G+P HKIF PG +YP+I+RHS
Sbjct  1704  IVANLAANLAVTTMNAKARYFHRIGVSGKGHLKIYNKLEGIPMHKIFHPGKSYPIIVRHS  1763

Query  5605  NCLSSDDDARLDPRGAAIRILPHERttttttt---plldltlktGKAFHARTIGDFATWL  5775
             N LS+DDDAR+D RGAA+RI   E  T ++ +    L+DLTLKTG AF+ART+ DFA+WL
Sbjct  1764  NSLSADDDARIDARGAALRIFSDEPATDSSDSPPPTLIDLTLKTGNAFYARTLADFASWL  1823

Query  5776  VCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKLRP  5955
             VCG AAREE VK APH+R+A+W SLR  +SY E+HYYSN CRL RF+DGQ+MYV+FKLRP
Sbjct  1824  VCGLAAREELVKSAPHVREAVWNSLRHADSYAEMHYYSNYCRLMRFEDGQQMYVKFKLRP  1883

Query  5956  FDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQI  6135
              D  I E+ G+V P GILPPETGAI RDEND RPLLFLA DF+ RVSS + V YV Q+Q+
Sbjct  1884  HDTSISEDKGKVNPTGILPPETGAIARDENDSRPLLFLANDFQNRVSSSNGVSYVFQIQV  1943

Query  6136  QPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEIDV  6315
             +P+PDD + RE  LDCTKPWDE E P+ +VGEI +++ +  ++S++LEFNP+ + NE+D 
Sbjct  1944  RPVPDDTQGREVALDCTKPWDENEFPFTDVGEINLNENIPMEDSQKLEFNPYLKSNELDT  2003

Query  6316  IRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAK---  6486
             I ATS  QSASIDHGRSL+YEICQ++RNR+PLPEAWR  + QS+VK+DLS CP+A+    
Sbjct  2004  ITATSSTQSASIDHGRSLIYEICQHVRNRQPLPEAWRNLVQQSNVKVDLSCCPIASSAPL  2063

Query  6487  ------LENKDMPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEM  6648
                   L+ K  P  TL R WY T   +  QP LQ +LP+ ++GL  + PLN + Y  ++
Sbjct  2064  PEKEPLLKKKATPALTLTRTWYQTFSALFIQPLLQTILPHMVIGLAAFVPLNMVVYFKDV  2123

Query  6649  TQIQKQWLLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTV  6828
              ++   WLLP +W  SG +A L C ++K VLVGK+  G+T PIWS+ I  D+ WQAIRT+
Sbjct  2124  KKLPLHWLLPFFWILSGFIAALSCVIAKRVLVGKRKLGETIPIWSKKIVFDSTWQAIRTL  2183

Query  6829  TGEYFMETATGTFLMGIWMRLMGSEVARDGVYIDSMGATLNPDMVRIEEYGSVGREALLF  7008
              G+YFM+   G+FL  IWM++MG+E+  DGVY+DS GA LNP+MV+IE  G +GREALLF
Sbjct  2184  VGDYFMDITNGSFLSVIWMKMMGAEIEMDGVYVDSNGAMLNPEMVKIERGGCIGREALLF  2243

Query  7009  GHIYEG--GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             GHIYEG  GG VKYG I +   GFVGSRAV MPG  ++   SL +LSLAM
Sbjct  2244  GHIYEGEEGGMVKYGEIKIGEDGFVGSRAVVMPGVEVECEASLASLSLAM  2293



>ref|XP_010227171.1| PREDICTED: uncharacterized protein LOC100836614 [Brachypodium 
distachyon]
Length=2343

 Score =  2677 bits (6939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1326/2328 (57%), Positives = 1700/2328 (73%), Gaps = 61/2328 (3%)
 Frame = +1

Query  301   EMESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGG  480
             +M+    +DD F KLHP +P  T+IGIVGAGPSGLSAAYAL KLGY NV V EK  +  G
Sbjct  24    KMDPKKSLDDKFSKLHPSLPVDTKIGIVGAGPSGLSAAYALAKLGYCNVTVFEKCQTVSG  83

Query  481   MCESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMR  657
             MCESIDI+G+TYDLGGQV+AANSAP I HLAKEVGAE EEMD+HKLAL+DS      D+ 
Sbjct  84    MCESIDIEGKTYDLGGQVIAANSAPVITHLAKEVGAEFEEMDSHKLALIDSQTGNIRDLE  143

Query  658   VAEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTA  837
             VAEDY+S+I +TLKLQDE   + R+G++++S +ASD T EFL+  G+ SVPKSVAY YTA
Sbjct  144   VAEDYVSMISLTLKLQDEANKSGRLGIHALSGLASDPTLEFLRQHGINSVPKSVAYSYTA  203

Query  838   SGYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRN  1017
             SGYGF+QDMPYA+I EF RTSMAGKIRRFK GY S+W+KLS+++P +  C TEVL +KRN
Sbjct  204   SGYGFVQDMPYAFIQEFTRTSMAGKIRRFKHGYMSMWEKLSQSLPFEVLCGTEVLRVKRN  263

Query  1018  SSGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKD  1197
             S G  V ++  NG  Q ME DKII SGA  F NG TYRS S        +  +++ LE++
Sbjct  264   SCGASVTIKKNNGDEQVMEVDKIIFSGALAFKNGSTYRSSSLTDGE--SEVAELNDLERE  321

Query  1198  LFSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWS  1377
             LFSKVQTI+YYT+V++I+G EH+P GFYYF  FMEDP  IG+PVAMQKF+ DT++FLFWS
Sbjct  322   LFSKVQTIDYYTTVVKINGFEHIPKGFYYFGEFMEDPTTIGHPVAMQKFFDDTDIFLFWS  381

Query  1378  YGNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQ  1557
             YGNS DI GS V +     V  MGG  + V+LQR FKYFPHV+ +DMKDGFYE+ E+QLQ
Sbjct  382   YGNSADIKGSSVAKCVTDIVSSMGGTAQNVLLQRRFKYFPHVSSEDMKDGFYERFESQLQ  441

Query  1558  GQLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFK  1737
             G  NTYYVGGL+AFELTERNASYS+A + KHFA D+     PY+KRLFPL  +S     +
Sbjct  442   GFQNTYYVGGLLAFELTERNASYSIATVCKHFAVDVEQTVTPYIKRLFPLSRNSNPSPPR  501

Query  1738  QLDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTI  1917
              L E+ GV+FP+L SLD YL +WGT  VT+N  +YTW+NE+G ++++RTY+E+H NA  I
Sbjct  502   DLGELEGVEFPDLPSLDGYLEYWGTHRVTKNNVIYTWINEEGKIMNQRTYQELHENASHI  561

Query  1918  AQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALL  2097
             A KLLTS KP IKPGD+V+LI++PGL+F+DAFFGC+RA VIP+P IPPDP QR GGQ+LL
Sbjct  562   AHKLLTSTKPIIKPGDRVILIHLPGLEFIDAFFGCIRAGVIPVPVIPPDPMQR-GGQSLL  620

Query  2098  HIANIAKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPDLPWLHTDSWVkkp  2277
              + N++KVCN VAILST SYH  VR    KN++      K S  WPD+PW+HT+SW+K  
Sbjct  621   KVENVSKVCNAVAILSTNSYHAAVRAGYIKNIVTLAKSQKCSAQWPDIPWIHTESWIKNY  680

Query  2278  klfkkpkDE--------QGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRY  2433
             +      +         + QP   DLCFLQFTSGST D KGVMITHG +IHNVK+M++RY
Sbjct  681   RRSPDSLNSDNVLSMRTKSQP--SDLCFLQFTSGSTGDAKGVMITHGALIHNVKMMKRRY  738

Query  2434  KSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATH  2613
             KSTS+T+L+SWLPQYHDMGLIGG+ T LVSGG+ ILFSP+TF++NPLLWLQT+S +  TH
Sbjct  739   KSTSKTVLISWLPQYHDMGLIGGIFTALVSGGTSILFSPMTFIRNPLLWLQTISDYHGTH  798

Query  2614  SAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVM  2793
             SA PNFAFEL++RRLE+ K + +DLSSM FLM AAEP+RQ T +RF+ELTQ  GLS  V+
Sbjct  799   SAGPNFAFELVIRRLEAEKNKVYDLSSMIFLMIAAEPVRQKTCRRFIELTQPLGLSEGVL  858

Query  2794  APGYGLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDP  2973
             APGYG+AENCV++ CA+GE  PVF+DWQGRVCCGY+++ + D +DI+I+  +T  E+ D 
Sbjct  859   APGYGMAENCVYICCAFGECKPVFIDWQGRVCCGYVEKDDAD-IDIRIVDADTLIEHQDD  917

Query  2974  GKEGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRT  3153
             G EGEIWISS S+G+GYWG +E+S  TF N + + P KR+ RTGDLGRIID KLFITGR 
Sbjct  918   GIEGEIWISSPSSGVGYWGHQEMSHTTFYNQLKTNPSKRFTRTGDLGRIIDGKLFITGRI  977

Query  3154  KDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVV  3333
             KDLIIVAG+NIY++D+EKTVE+SSE++RPGCCAVVG+PEDVL  KGI    +SD++GLVV
Sbjct  978   KDLIIVAGRNIYSADVEKTVENSSEVLRPGCCAVVGVPEDVLTQKGITIPDSSDQVGLVV  1037

Query  3334  IAEVRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFIS  3513
             IAEVR+GK +  +++D+I TRVAEEHGV +AS+  IKPR+ISKTTSGKI+R+EC K+F+ 
Sbjct  1038  IAEVREGKAVSTEIIDNIKTRVAEEHGVAVASVKLIKPRTISKTTSGKIRRFECMKQFVD  1097

Query  3514  GTLDVIE-EQMNGERSLPRN---------------DGIIVP---ANGKISKTDIVNFLKD  3636
               L + +   ++ ++SL R+                  + P   + GK SK +IV FL  
Sbjct  1098  NNLSLADGNHLSKKKSLFRSLTTGTGMDRRRRPFLKQTLAPHPKSKGKSSK-EIVEFLTQ  1156

Query  3637  LLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLAD  3816
             ++S Q+GIP  KIS   +L SYG +SI VVRAAQK+S F G  +GAIDIF+A+CI +LA 
Sbjct  1157  IVSDQSGIPKDKISPTGSLPSYGFDSIAVVRAAQKLSDFLGTPVGAIDIFAASCISELAS  1216

Query  3817  FVESLLEKNHPMLTN--SSETKISSSGIP-SVVSTFDKITIWLIHLVALAYVSLLLIIPA  3987
             F+E+LL K+ P+L +  S  ++  S  +P  + + F  +   ++  +AL YV  +L++PA
Sbjct  1217  FLENLLPKSQPLLASDLSCSSEDESLVVPIDITADFSVLATGILQSIALIYVCFMLLLPA  1276

Query  3988  YISVSMFKPLILA---NQSPWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVL  4158
             Y++ S +  ++ +    +S    Y  SL  AP +W+  + LT +   +LG + LQPNY L
Sbjct  1277  YLASSTYMHMLYSVSLVKSSLMRYLTSLVMAPIAWIFYVILTSLSLSILGKSFLQPNYAL  1336

Query  4159  NPEISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDI  4338
              P +S+WSV+FVKWWAL KAQ +++K+LAVHL+GTVFLNYWFK+ GA+I SS +IDTVDI
Sbjct  1337  TPNVSIWSVDFVKWWALNKAQGLAAKMLAVHLKGTVFLNYWFKMQGARIGSSVVIDTVDI  1396

Query  4339  TDPLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAE  4518
             TDP L+ + + +VI+EGALIQ HEV++GVLSF  VRIG+ +SIGPYAVLQKG+ V DGA 
Sbjct  1397  TDPSLLVVADGAVIAEGALIQGHEVRDGVLSFRRVRIGREASIGPYAVLQKGTTVDDGAV  1456

Query  4519  VLAQNKKAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQ-LFGIYMIGYLNSLSAAIAY  4695
             V    K    K++     ++ K T    K    N   + + L  IY + ++ SLS+A  Y
Sbjct  1457  VPPLQKIEPGKLT-----YQTKRTSADMKEETRNAGILLEHLVSIYAVAFIGSLSSATVY  1511

Query  4696  LVWIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAH  4875
             +++        S  HF F CIAGAFHW P +I  +  +    P   L+FA  +   Y ++
Sbjct  1512  MLYTHFFGNEDSFQHFSFACIAGAFHWLPAVIAAYPVIVQETPTRALTFALSITFAYLSY  1571

Query  4876  GLILSVFTFMLNHFVSRKGDT-DKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWM  5052
             G+ILS+ + + N  ++ + +T  K+ R   I   +N+A H+RFAK+LSGTE FC+YL  +
Sbjct  1572  GVILSLLSSIANTALATRTETKQKLMRTSLIQRHINIAVHLRFAKMLSGTEAFCMYLRLL  1631

Query  5053  GAKIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIG  5232
             GAKIG+HCSIR+I+ V  P L+S+ DGVHLGDF  IVPG+++   +    I ++EN+++G
Sbjct  1632  GAKIGRHCSIRSIDAVGNPELISIGDGVHLGDFCHIVPGFYSGKAFTGAEIKVQENTIVG  1691

Query  5233  SQGLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIEEMDP  5412
             S  L+LPGS ++++VILGALSVAP NS+L+  G +VG+++L MV+N  L  D+RIE MDP
Sbjct  1692  SGSLLLPGSVLQENVILGALSVAPENSLLQRGGIYVGAQSLTMVKNTLLMEDERIEVMDP  1751

Query  5413  KYKKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGATYPVI  5592
              YKK++G+L+ANLA +T+ +KSRYFHRIG +G+G L++Y  +P LP HKIFG G ++PVI
Sbjct  1752  MYKKIVGNLSANLAITTMNVKSRYFHRIGVSGRGVLKMYQDIPSLPKHKIFGAGKSFPVI  1811

Query  5593  IRHSNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFATW  5772
             +RHSN LS+DDDAR D RGAA+RIL  +        PLLDLTLK+GKAF+ARTI DFATW
Sbjct  1812  VRHSNSLSADDDARFDARGAAVRILSDD-----GEVPLLDLTLKSGKAFYARTIADFATW  1866

Query  5773  LVCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVRFKLR  5952
             LVCG  AREEHVK  PHIRDA+WGSLR  NSYT LHYYSNICRL RF+ G+EMY +FKLR
Sbjct  1867  LVCGLPAREEHVKRVPHIRDAVWGSLRDTNSYTVLHYYSNICRLLRFEGGKEMYAKFKLR  1926

Query  5953  PFDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQ  6132
             P D+ I EE G+V PRGILPPETGAIPRDE+D RPLLFLA+DF  RV SPD V YV+QLQ
Sbjct  1927  PMDQDISEESGQVVPRGILPPETGAIPRDESDTRPLLFLADDFHRRVESPDGVGYVVQLQ  1986

Query  6133  IQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEID  6312
             ++ +P D    +  LDCT+PWDE E PYI++GEI ID  +   E+E+LEFNPF RC E+D
Sbjct  1987  LREVPSDSATCDVALDCTRPWDEAEFPYIDIGEIIIDSNVPADETEKLEFNPFLRCREVD  2046

Query  6313  VIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLAAKLE  6492
             VI ATSC QSASIDHGRSLVYEICQ LRN +PLP +W  FL+QSD K++LSGCP+AA   
Sbjct  2047  VIPATSCKQSASIDHGRSLVYEICQRLRNGEPLPASWAAFLEQSDTKINLSGCPVAAATH  2106

Query  6493  NKD------MPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQ  6654
              +        PK TLAR WY  LW    QP LQ ++PYF+LGLVI+ P   L      T 
Sbjct  2107  TRSNAGEATKPKVTLARAWYKALWATLCQPLLQTLVPYFVLGLVIFLPFRGLLAFATATG  2166

Query  6655  IQKQWLLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTG  6834
                 WLLP++W  SGI A   CA +KWVLVG +  G    IW+  +F+DT+WQAIRT TG
Sbjct  2167  TPLYWLLPIFWTVSGIAAMATCAAAKWVLVGVRADGDAVHIWAPQVFLDTVWQAIRTATG  2226

Query  6835  EYFMETATGTFLMGIWMRLMGSEVA-RDGVYIDSMGATLNPDMVRIEEYGSVGREALLFG  7011
             EYF E   G+ L   WMR+MGS VA  +GVY+DSMGA LNP+MV +E   SVGR+ALLFG
Sbjct  2227  EYFAELTCGSVLFAAWMRMMGSTVAVAEGVYVDSMGALLNPEMVHLERGASVGRDALLFG  2286

Query  7012  HIYEG-GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             H+YEG  G+VK+G++ V   GFVGSRAVAMPG  ++ GG LGAL LAM
Sbjct  2287  HVYEGEAGKVKFGKVHVGEDGFVGSRAVAMPGVVVEDGGYLGALGLAM  2334



>ref|XP_006850079.1| hypothetical protein AMTR_s00022p00216410 [Amborella trichopoda]
 gb|ERN11660.1| hypothetical protein AMTR_s00022p00216410 [Amborella trichopoda]
Length=2320

 Score =  2588 bits (6708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1325/2327 (57%), Positives = 1694/2327 (73%), Gaps = 59/2327 (3%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             ME    V+D F KLHPC+P +TRI IVGAGPSGLSAAYAL  +GY ++ V EK+H+ GGM
Sbjct  1     MEVRSPVEDEFSKLHPCLPLSTRICIVGAGPSGLSAAYALANIGYEDITVYEKYHTVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRV  660
             CES+DI+GR YDLGGQVLA NSAP + +LAKE G E EEMD+HKLAL+D     Y D++V
Sbjct  61    CESVDIEGRIYDLGGQVLAMNSAPVLSNLAKEFGCEFEEMDSHKLALIDDTTGHYEDLKV  120

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             AEDY+S+I +TLKLQDE KA+ ++GV++VS +A D   +FL   GL SVPKSVAYGYTAS
Sbjct  121   AEDYVSIISLTLKLQDEAKASVKLGVHAVSNLAPDPILDFLSLHGLHSVPKSVAYGYTAS  180

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF QDMPYAY+HEF RTSMAGKIRRF GGY S+W+KLS ++P +  CN+EV+ I+R  
Sbjct  181   GYGFTQDMPYAYLHEFTRTSMAGKIRRFNGGYMSLWQKLSTSLPYRVLCNSEVVGIERLD  240

Query  1021  SGVCVDVRHRNGALQ---AMEFDKIIISGAFPFHNGRTYRSPSQKTAGLF-CDKMDMSTL  1188
               V V V  R    +    MEFDKII+SGAFPF  GRTYR+P   T+ +   + MD++ L
Sbjct  241   DKVRVRVLFRGDEEELEKMMEFDKIIVSGAFPFRYGRTYRAPVPATSTVMEPEVMDLNDL  300

Query  1189  EKDLFSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFL  1368
             E++LF KV TI+YYT+VL+I G EH+P GFYYF  FME PA IGNPVAMQKFY DT++FL
Sbjct  301   ERELFCKVHTIDYYTTVLKIKGFEHIPAGFYYFGKFMEHPATIGNPVAMQKFYGDTDIFL  360

Query  1369  FWSYGNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLET  1548
             FWSYGNS ++ G  V++L+   V  MGG+V++V+LQR FKYFPHV  ++MKDGFY+K E+
Sbjct  361   FWSYGNSTNVKGESVLKLSIDVVKSMGGEVQRVVLQRRFKYFPHVTSEEMKDGFYDKWES  420

Query  1549  QLQGQLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGL  1728
             +LQG  NTYYV GL AFELTERNASY+MAL+R+HFA+D   P FPYVKR+ P+ S     
Sbjct  421   ELQGSRNTYYVCGLGAFELTERNASYAMALVRRHFASDGPFPPFPYVKRMLPVHSGHRSQ  480

Query  1729  AFKQLDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNA  1908
               K+L E PGV+FPEL SLD YL  WGT  ++E KTLYTW+NE+G+V   RTY ++H NA
Sbjct  481   KVKELPESPGVEFPELQSLDEYLEFWGTHIISETKTLYTWINEEGEVTSERTYGDLHKNA  540

Query  1909  FTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQ  2088
               IA KL TS KP IKPGD+VLLI+VPGLDFVDAFFGCLRA+V+P+P +PPDP QRGG Q
Sbjct  541   SIIAHKL-TSTKPVIKPGDRVLLIHVPGLDFVDAFFGCLRAKVLPVPLLPPDPLQRGG-Q  598

Query  2089  ALLHIANIAKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPDLPWLHTDSWV  2268
             AL  I N+AK C  VAILST SYH  VR  S +N+L    K+KSS  WP LPWLHTDSW+
Sbjct  599   ALPKIENVAKSCEAVAILSTASYHAAVRAGSVRNLLV-SGKNKSSARWPQLPWLHTDSWL  657

Query  2269  kkpklfkkpkDEQG--QPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKST  2442
             K  +     + E     P  +DLCFLQFTSGST D KGVMITHGG+IHNVKLMRKRYKST
Sbjct  658   KNSRNSGLEEIECSYCTPKPDDLCFLQFTSGSTGDSKGVMITHGGLIHNVKLMRKRYKST  717

Query  2443  SRTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAA  2622
             S+T+LVSWLPQYHDMGLIGGL T LVSGGS ILFSP+TF++NPLLW+  MSK+RATHSA 
Sbjct  718   SKTVLVSWLPQYHDMGLIGGLFTALVSGGSSILFSPLTFIRNPLLWIHCMSKYRATHSAG  777

Query  2623  PNFAFELLVRRLESSK---EENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVM  2793
             PNFAFEL+VRRLE+ K     + DLSS+ FLM AAEP+RQ T+KRF+ELT   GLS EVM
Sbjct  778   PNFAFELVVRRLEAEKVRDRRSLDLSSLIFLMVAAEPVRQKTIKRFIELTSPLGLSEEVM  837

Query  2794  APGYGLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDP  2973
             APGYGLAENCVFVSCA+GE +P+++DWQGRVCCG IK  + D VDI+I+  ETG E    
Sbjct  838   APGYGLAENCVFVSCAWGEKVPIYIDWQGRVCCGNIKPEDPD-VDIRIVDQETGGELHGD  896

Query  2974  GKEGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRT  3153
             GKEGEIW+SS SAGIGYWG  ELS KTF N++   PGK + RTGDLGRII  KLFITGR 
Sbjct  897   GKEGEIWVSSPSAGIGYWGKHELSLKTFGNELDGHPGKSFTRTGDLGRIISGKLFITGRI  956

Query  3154  KDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVV  3333
             KDLIIV+G+N+Y++D+EKTVE+SSEL+RPGCCAV+G+PE+VL +KGI     +D++GLVV
Sbjct  957   KDLIIVSGRNVYSADVEKTVEASSELIRPGCCAVIGVPEEVLSTKGIKVPDGADQVGLVV  1016

Query  3334  IAEVRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFIS  3513
             IAEVR+GKP+  +++  I TRVAEEHGV +AS+  IKPR+ISKTTSGKIKR+EC K+F  
Sbjct  1017  IAEVREGKPVSKELVKQIQTRVAEEHGVTVASVKLIKPRTISKTTSGKIKRFECLKQFTD  1076

Query  3514  GTLDVIEEQMNGER------------SLP---RNDGIIVP----ANGKISKTDIVNFLKD  3636
              +L ++ +    ++            +LP   +    + P       + S+ +I  FL  
Sbjct  1077  ESLSLVADSKPPKKFLLQSFTTGANFNLPPMRQEQSFLEPLKPRKESQKSRREITEFLIG  1136

Query  3637  LLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLAD  3816
             L+++Q  IP+ KIS  ++LVSYG++SIGVVRAAQK+S F G+ +GAIDIF+A CI DLA 
Sbjct  1137  LVAEQASIPLEKISETDSLVSYGIDSIGVVRAAQKLSDFLGVPVGAIDIFTAKCISDLAS  1196

Query  3817  FVESLLEKNH--PMLTNSSETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPAY  3990
             F ESL+ + +    L N  E       +   VS   ++ I  +  + L YV+ +L++PAY
Sbjct  1197  FSESLISEANTASCLVNLPEYDDKPVFLAVEVSNVHRLGIGFLQFLVLIYVAAILVLPAY  1256

Query  3991  ISVSMFKPLI--LANQSPWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNP  4164
             +S S+   ++    + S W +Y +S   +P  W+L +FLTCIC  L GN+ L+PN  LN 
Sbjct  1257  LSCSISMEILNRWVSSSSWVYYPVSAMASPLIWLLYMFLTCICISLFGNSFLRPNVALNQ  1316

Query  4165  EISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITD  4344
             EIS+WS EFV WWA+YK QE++ K++A HLRGT+FLNYWFK+LGA + S  ++D+VDITD
Sbjct  1317  EISIWSKEFVGWWAMYKLQEMAGKIMATHLRGTIFLNYWFKVLGAIVGSEVVLDSVDITD  1376

Query  4345  PLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVL  4524
             P +VSI + +V++EGA+IQ HEVK G++ F  VRIG+ ++IGPYA+++ G  V  G +V 
Sbjct  1377  PFMVSIGDGAVVAEGAMIQGHEVKGGMVRFGAVRIGQGATIGPYAMIRMGCNVNSGFDVP  1436

Query  4525  AQNKKAAAKISKPLNGHKGK-VTRRIRKRNHGNHNSVFQLFGIYMIGYLNSLSAAIAYLV  4701
             A  +     +  P  G K + +T           +++F   GIY +G+L +LSAA AY +
Sbjct  1437  ALQRAEGGAMVVP--GKKDQDLTEGFIGTPPTKVSTLFHFMGIYTVGFLGALSAATAYTL  1494

Query  4702  WIWL----LQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTS--LP-VSTLSFAGMVAA  4860
                     +   P +  FLF+CIAGAFHW P II  F A   S  LP +S+ SFA ++++
Sbjct  1495  LTLFNPNHIDISPQI--FLFVCIAGAFHWPPAIIAAFFAFIPSQALPALSSTSFALLLSS  1552

Query  4861  GYTAHGLILSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVY  5040
              Y A+ LILS+ T +  H ++R  +      + W+LHR+  + H+RFAKLLSGTE FCVY
Sbjct  1553  AYIAYALILSLVTCLATHLLTRNPEYKLCCWKSWLLHRITTSTHLRFAKLLSGTEAFCVY  1612

Query  5041  LHWMGAKIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIREN  5220
             L  +GA IGQ CSIRAINP+ +P L+ + D VHLGDF +I+ G+++  GY  G +++ E 
Sbjct  1613  LRSLGASIGQDCSIRAINPISDPRLLKLCDFVHLGDFCKILTGFYSKLGYCFGNVEVNER  1672

Query  5221  SVIGSQGLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIE  5400
              VIGS  L+LPGS ++++V+LGALS AP+ SVL+  G +VG +N VMV+N    +DDRI+
Sbjct  1673  CVIGSMSLVLPGSCLQEEVVLGALSTAPVKSVLQRGGVYVG-QNPVMVKNTLQQVDDRIQ  1731

Query  5401  EMDPKYKKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGAT  5580
             EMDPKY+KVLG+LAANLA +TLK+KSRYFHRIG A KG+L ++  L G P+H +F  G +
Sbjct  1732  EMDPKYRKVLGNLAANLATTTLKVKSRYFHRIGVAAKGTLEMFKDLKGFPEHAVFSTGKS  1791

Query  5581  YPVIIRHSNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGD  5760
             +PV+IRHSN LS+DDDAR+D RGA IRI+  E        PLLDLTLKTGKAF+ARTIGD
Sbjct  1792  FPVLIRHSNSLSADDDARIDARGAGIRIMDSE------GNPLLDLTLKTGKAFYARTIGD  1845

Query  5761  FATWLVCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVR  5940
             FATWLVCG  ARE  V+  PH+RDA+WGSLRR  SY ELHYYSN CR FR  DG + +V+
Sbjct  1846  FATWLVCGVKAREAQVEREPHVRDAVWGSLRRATSYAELHYYSNFCRSFRGLDGVDRFVK  1905

Query  5941  FKLRPFDEKIGEEYGEVEPRG-ILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRY  6117
             FKLRP D +IGE+ G+V+P G +LPPETGAIPRD+ D RP LFLA+DFK RV+    VRY
Sbjct  1906  FKLRPEDVRIGEDSGKVDPEGRVLPPETGAIPRDDGDDRPPLFLADDFKARVAGDGGVRY  1965

Query  6118  VLQLQIQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFR  6297
             +LQ Q+Q +P +   RE +LDCT+PWD +E PY+++G I +D+ L  +E+E++EFNP+ R
Sbjct  1966  ILQAQVQVVPTNRMERERVLDCTRPWDPEEHPYVDLGIIILDEALGAQEAEQIEFNPYLR  2025

Query  6298  CNEIDVIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPL  6477
               ++DV+ A SC +SASIDHGRSLVYEICQ LRN +PLPE+WR FL+QS  K+DLSGCP+
Sbjct  2026  RPDLDVVPARSCTESASIDHGRSLVYEICQRLRNAEPLPESWRGFLEQSGAKVDLSGCPM  2085

Query  6478  AAKLENKDMPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQI  6657
             A         K  +AR W  ++W + GQP +Q+ +PY LLGL ++ PL  L Y H+   +
Sbjct  2086  AGTASYPVAGKPAVARTWVQSVWALLGQPLVQVGVPYALLGLGMWTPLRFLGYVHQARVV  2145

Query  6658  QKQWLLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGE  6837
               Q LLPL+   SG+L GL+C L+KWVLVG++ + KT  +W   +F+DTIWQAIRTV GE
Sbjct  2146  PLQLLLPLFLVFSGLLGGLLCVLAKWVLVGRQREEKTIHLWGMEVFLDTIWQAIRTVMGE  2205

Query  6838  YFMETATGTFLMGIWMRLMGSEVA-RDGVYIDSMGATLNPDMVRIEEYGSVGREALLFGH  7014
             YFME  +G+ + G WMRL+G++V  RDGVY+DSM A LNPDMV IE  G +GR A+LFGH
Sbjct  2206  YFMEITSGSMVFGAWMRLLGAKVEWRDGVYVDSMEALLNPDMVEIERGGCIGRGAMLFGH  2265

Query  7015  IYEG-GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             IYEG  G VK+G+I V   G VGSRAV MP  T++ G SL  L+LAM
Sbjct  2266  IYEGEEGRVKFGKIIVGEDGVVGSRAVVMPRVTLEVGSSLPPLALAM  2312



>ref|XP_006386098.1| hypothetical protein POPTR_0003s220801g [Populus trichocarpa]
 gb|ERP63895.1| hypothetical protein POPTR_0003s220801g [Populus trichocarpa]
Length=1771

 Score =  2263 bits (5863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1115/1810 (62%), Positives = 1374/1810 (76%), Gaps = 79/1810 (4%)
 Frame = +1

Query  1819  VTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLD  1998
             +T++KTLYTW+ E G V+ +RTY E+H  A  IA+KLLTS+KP IKPGD+VLL+YVPGLD
Sbjct  1     MTKDKTLYTWIGEDGAVVCQRTYAELHAKASCIARKLLTSRKPVIKPGDRVLLVYVPGLD  60

Query  1999  FVDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIM  2178
             F+DAFFGCLRA+V+P                 + I +IAK CN VAILST  YH  VR  
Sbjct  61    FIDAFFGCLRAKVLP-----------------VPIESIAKSCNAVAILSTLLYHSAVR--  101

Query  2179  SAKNMLFGKSKDKSSNSWPDLPWLHTDSWVkkpklfk---kpkDEQGQPLSEDLCFLQFT  2349
             + KN   GK        WP+LPW+HTDSW+K  K+        + + QP  +DLCFLQFT
Sbjct  102   AGKN---GK--------WPNLPWMHTDSWLKDSKVLAPGNIAYESECQP--DDLCFLQFT  148

Query  2350  SGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGG  2529
             SGST D KGVMITHGG+IHNVKLM++ YKSTS+T+LVSWLPQYHDMGLIGGL T LVSGG
Sbjct  149   SGSTGDAKGVMITHGGLIHNVKLMKRIYKSTSKTVLVSWLPQYHDMGLIGGLFTALVSGG  208

Query  2530  SGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLE---SSKEENFDLSSMH  2700
             S ILFSP+TF+KNPLLWLQ MSK+ ATHSA PNFAFELL+RRLE     K  NFDLSS+ 
Sbjct  209   SAILFSPMTFIKNPLLWLQIMSKYNATHSAGPNFAFELLIRRLEYADKDKVRNFDLSSLI  268

Query  2701  FLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFVDWQG  2880
             FLM AAEP+RQ TLKRFVELT+ FGLS+EVMAPGYGLAENCVFVSCAYGEG P+ VDWQG
Sbjct  269   FLMVAAEPVRQRTLKRFVELTRPFGLSQEVMAPGYGLAENCVFVSCAYGEGKPILVDWQG  328

Query  2881  RVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGIGYWGLEELSQKTFE  3060
             RVCCGY+ +PN + +DI+I+ PE+ +E  + GKEGEIWISS SAGIGYWG EELSQ TF 
Sbjct  329   RVCCGYV-EPNGEDIDIRIVDPESNEELKESGKEGEIWISSPSAGIGYWGREELSQSTFR  387

Query  3061  NDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDIEKTVESSSELVRP  3240
             N + + PG++Y RTGDLGRIID K+FITGR KDLIIVAG+NIY++D+EKTVES+SEL+RP
Sbjct  388   NVLQNHPGRKYTRTGDLGRIIDGKVFITGRIKDLIIVAGRNIYSTDVEKTVESASELLRP  447

Query  3241  GCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGKPLPYDVMDHICTRVAEEHGVP  3420
             GCCAV+G+PE+VL SKGI     SD++GLVVIAEVRD KP+  DV+++I +RVAEEHGV 
Sbjct  448   GCCAVIGVPEEVLSSKGISLPDCSDQVGLVVIAEVRDAKPVDKDVVENIRSRVAEEHGVT  507

Query  3421  IASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVIEEQMNGERSL-------------  3561
             +ASI  IKPR+ISKTTSGKIKR+EC K F  GTL+ + + +  +R L             
Sbjct  508   VASIKLIKPRTISKTTSGKIKRFECLKHFTDGTLNTVPDPIFAKRKLLRSFTTGTCKEGL  567

Query  3562  -PRNDGIIVP-ANGKISKTDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAA  3735
              PR+     P    K SK +IV FLK L+S+QTGIP+  IS  E+LVSYG++SIGVVRAA
Sbjct  568   TPRSRFATSPLPTAKFSKKEIVEFLKGLVSEQTGIPIKNISATESLVSYGIDSIGVVRAA  627

Query  3736  QKISSFFGINIGAIDIFSATCIDDLADFVESLLEKNHPMLTNSS----ETKISSSGIPSV  3903
             QK+S F G+ +GA+DIF+ATCI DLA F E+L  K+ P L NS     E  I SS   + 
Sbjct  628   QKLSDFLGVPVGAVDIFTATCIADLASFSENLAMKSQPHLMNSQSYQPEPDIDSSEFDTE  687

Query  3904  VSTFDKITIWLIHLVALAYVSLLLIIPAYISVSMFKPLI-----LANQSPWFFYFISLAC  4068
             VST   I++W   L+AL YV  +L  PAY SVS F  L+     L  + PW+ Y I LA 
Sbjct  688   VSTTRLISVWFFQLLALVYVCAMLSFPAYFSVSAFTSLLSVSHLLNEEFPWWNYLIPLAL  747

Query  4069  APFSWMLCIFLTCICTRLLGNALLQPNYVLNPEISVWSVEFVKWWALYKAQEISSKVLAV  4248
             AP +W+L I  TCI    LGN+ L+PNY L PE+S+WS+ FVKWWALYKAQEISSKV A 
Sbjct  748   APLAWILGIISTCISIAFLGNSFLKPNYALTPEVSIWSIHFVKWWALYKAQEISSKVFAE  807

Query  4249  HLRGTVFLNYWFKILGAKIASSALIDTVDITDPLLVSIDEESVISEGALIQSHEVKNGVL  4428
             HLRGTVFLNYWF++LGAKI SS L+DTVDITDP LVSI + +VI+EGAL+QSHEVKNG+L
Sbjct  808   HLRGTVFLNYWFEMLGAKIGSSVLLDTVDITDPSLVSIGDGAVIAEGALLQSHEVKNGIL  867

Query  4429  SFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLAQNKKAAAKISKPLNGHKGKVTRRIRKR  4608
             SF  +RIG+ SS+GPYAV+QKGS +G+ A+V            +PL   +G        +
Sbjct  868   SFQAIRIGRNSSVGPYAVIQKGSTLGEEADV------------QPLQKTEGGKAVLKSSK  915

Query  4609  NHGNHNSVFQLFGIYMIGYLNSLSAAIAYLVWIWLLQKPPSLHHFLFICIAGAFHWFPYI  4788
              H    + +   GIYM+G L++LSAAI Y ++IWL QKP S+ HF F+CI+GAFHW P+ 
Sbjct  916   AHNVQKATYHFMGIYMVGLLSTLSAAIIYFLYIWLSQKPASIQHFSFLCISGAFHWTPFT  975

Query  4789  IITFTAMFTSLPVSTLSFAGMVAAGYTAHGLILSVFTFMLNHFVSRKGDTDKMTREKWIL  4968
             +I +  M  ++P +  +FA  VA  Y AHGLILS+ T  L HF++ K +  +   + W+ 
Sbjct  976   VIAYATMIANVPSNPATFAISVAIVYLAHGLILSLLTCTLAHFLAEKQEKRESHMKVWLR  1035

Query  4969  HRMNVACHIRFAKLLSGTELFCVYLHWMGAKIGQHCSIRAINPVVEPGLVSVADGVHLGD  5148
             HR+ +ACH+RFAKLLSGTE FC+YL  +GA +G+HCSIRA+NPV +P L+++ DGVHLGD
Sbjct  1036  HRITIACHLRFAKLLSGTEAFCIYLRLLGASVGEHCSIRAVNPVSDPELITIGDGVHLGD  1095

Query  5149  FSRIVPGYHTTGGYISGRIDIRENSVIGSQGLILPGSFIEKDVILGALSVAPLNSVLECC  5328
             FSR++ G++++ G+  G+I++++NSV+GSQ LILPGS ++KDVILGALSVAP NSVL   
Sbjct  1096  FSRMIAGFYSSSGFTQGKIEVQDNSVVGSQSLILPGSVVQKDVILGALSVAPANSVLRQG  1155

Query  5329  GTFVGSENLVMVRNQTLPLDDRIEEMDPKYKKVLGSLAANLAASTLKLKSRYFHRIGAAG  5508
             G ++GS+  VM++N    LDDRIEEMD KYKK++G+LAANLAA+TLK+K+RYFHRIG +G
Sbjct  1156  GVYIGSQTPVMIKNTMHALDDRIEEMDFKYKKIVGNLAANLAATTLKVKTRYFHRIGVSG  1215

Query  5509  KGSLRLYNVLPGLPDHKIFGPGATYPVIIRHSNCLSSDDDARLDPRGAAIRILPHERttt  5688
             KG L++Y+ L G PDHKIF  G +YP+++RHSN LS+DDDAR+D RGAAIRIL       
Sbjct  1216  KGHLKIYDNLKGFPDHKIFQAGKSYPIVVRHSNSLSADDDARIDARGAAIRIL--SDDNG  1273

Query  5689  ttttplldltlktGKAFHARTIGDFATWLVCGAAAREEHVKHAPHIRDAMWGSLRRPNSY  5868
             + ++ LLDLTLKTGKAF+ARTI DFATWLVCG  ARE+HVK APHIRDA+W SLR  NS+
Sbjct  1274  SNSSSLLDLTLKTGKAFYARTIADFATWLVCGLPAREQHVKRAPHIRDAVWMSLRNANSF  1333

Query  5869  TELHYYSNICRLFRFKDGQEMYVRFKLRPFDEKIGEEYGEVEPRGILPPETGAIPRDEND  6048
              +LHYYSNICRLFRF DGQEMYV+FKLRP DE I E+ G+VEP GILPPETGAIPRDE D
Sbjct  1334  ADLHYYSNICRLFRFSDGQEMYVKFKLRPGDENISEDSGKVEPMGILPPETGAIPRDEKD  1393

Query  6049  KRPLLFLAEDFKFRVSSPDKVRYVLQLQIQPIPDDERVRETLLDCTKPWDEKEVPYIEVG  6228
              RPLLFLAEDF+ RVSSP  VRY+ QLQI+P+P D+   +  LDCTKPWDE E PYI++G
Sbjct  1394  TRPLLFLAEDFQSRVSSPGGVRYIFQLQIRPVPHDDATCDVALDCTKPWDESEFPYIDIG  1453

Query  6229  EITIDQVLTEKESEELEFNPFFRCNEIDVIRATSCNQSASIDHGRSLVYEICQYLRNRKP  6408
             E+ IDQ LT  ESE LEFNP+ RC+E+DVIRATS +QSASIDHGRSL+YEICQ+LRN +P
Sbjct  1454  EVHIDQNLTGAESEALEFNPYIRCHEVDVIRATSSSQSASIDHGRSLIYEICQHLRNGEP  1513

Query  6409  LPEAWRIFLDQSDVKLDLSGCPLAAKLENKDMPKATLARQWYVTLWLMSGQPFLQIVLPY  6588
             LPEAWRIF++QSDVK+DLSGCP+AA LE KD  K TLAR WY TLW++  QP LQ  LPY
Sbjct  1514  LPEAWRIFIEQSDVKVDLSGCPMAAALEKKDSGKVTLARTWYQTLWVIFAQPLLQTFLPY  1573

Query  6589  FLLGLVIYAPLNCLFYTHEMTQIQKQWLLPLWWGGSGILAGLVCALSKWVLVGKKYKGKT  6768
             FL+GL+I+APLN +    E  ++   W LPL W  SG+LA L C ++KW+LVGKK +G+T
Sbjct  1574  FLMGLLIFAPLNWILLLKESKKVAMHWFLPLVWVSSGVLAALACVVAKWILVGKKKEGQT  1633

Query  6769  EPIWSRGIFMDTIWQAIRTVTGEYFMETATGTFLMGIWMRLMGSEVARD-GVYIDSMGAT  6945
               IWS G+FMDT+WQA RTV G+YFME  +G+ L  +W++LMGS++  D G Y+DSMGA 
Sbjct  1634  VQIWSIGVFMDTVWQAFRTVVGDYFMEMTSGSILFLLWLKLMGSDIDLDQGAYVDSMGAA  1693

Query  6946  LNPDMVRIEEYGSVGREALLFGHIYEG-GGEVKYGRISVKNGGFVGSRAVAMPGATIDSG  7122
             LNP+MV IE  G VGREALLFGHIYEG GG+VK+GRI V  GGFVGSRA+AMPG  ++ G
Sbjct  1694  LNPEMVEIERGGCVGREALLFGHIYEGEGGKVKFGRIRVGEGGFVGSRAIAMPGVRVEIG  1753

Query  7123  GSLGALSLAM  7152
             G+L ALSLAM
Sbjct  1754  GNLSALSLAM  1763



>ref|XP_010315906.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104645663 
[Solanum lycopersicum]
Length=1565

 Score =  1729 bits (4479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 859/1334 (64%), Positives = 1038/1334 (78%), Gaps = 47/1334 (4%)
 Frame = +1

Query  3211  VESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGKPLPYDVMDHIC  3390
             V+ SS     G C    I     +SKGI   + SD+LGLVV+AE    K LP +V+  IC
Sbjct  253   VQISSFFXCYGSCYSFSISLFNTLSKGISFPKGSDQLGLVVVAEAY--KSLPCEVIKRIC  310

Query  3391  TRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVIEEQMNGERSLPRN  3570
             TRV EEHGV IASI+ IKPRSISKTTSGKI+R+E AKRF+ GTL V+E+  +GE+S   +
Sbjct  311   TRVVEEHGVSIASIMTIKPRSISKTTSGKIRRFEVAKRFVDGTLSVVEDATDGEKSSRES  370

Query  3571  DGIIVP--------ANGKISKTDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVV  3726
                 VP         N KISK  I+ FLK+LL + T +  SKIS  E+LVSYGV+SIGVV
Sbjct  371   KDGSVPXITRNLALGNDKISKGQIIEFLKELLYEMTEVLKSKISITESLVSYGVDSIGVV  430

Query  3727  RAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEKNHPML----TNSSETKISSSGI  3894
             RAAQKIS+F G+ +GAIDIFSATCI+DLADF E LL K+HP L    + S E+K+SS   
Sbjct  431   RAAQKISNFLGVLVGAIDIFSATCIEDLADFAEDLLRKSHPELVTTTSGSCESKMSS---  487

Query  3895  PSVVSTFDKITIWLIHLVALAYVSLLLIIPAYISVSMFKPLILANQ-----SPWFFYFIS  4059
                       T W    +ALAYVS +LI PA ISVS FK  I A Q     +PWF Y +S
Sbjct  488   ----------TXWFFQRLALAYVSFMLIFPACISVSTFKFFISACQMLIQSAPWFGYIVS  537

Query  4060  LACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPEISVWSVEFVKWWALYKAQEISSKV  4239
             L CAP SW+L       C   LG + LQPNY+LNPE+S+WS +FVKWW LYKAQEISSKV
Sbjct  538   LVCAPLSWIL------XCIGFLGKSFLQPNYILNPEVSIWSADFVKWWTLYKAQEISSKV  591

Query  4240  LAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDPLLVSIDEESVISEGALIQSHEVKN  4419
             LAVHLRGTVF+NYWF++LG  I SS ++DTVDITDP LVSI E++VI+EG L+QSHEVKN
Sbjct  592   LAVHLRGTVFINYWFEMLGENITSSPILDTVDITDPSLVSIGEQAVINEGVLLQSHEVKN  651

Query  4420  GVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLAQNKKAAAKISKPLNGHKGKVTRRI  4599
             GVLSF+ +RIG++SSIGPYAV+Q+GSIV DG  VLA N    A   K  +  K K TR+ 
Sbjct  652   GVLSFNPIRIGQKSSIGPYAVVQRGSIVEDGTHVLALNTSKTAVNVKATSTKKDKSTRKS  711

Query  4600  RKRNHGNHNSVFQLFGIYMIGYLNSLSAAIAYLVWIWLLQKPPSLHHFLFICIAGAFHWF  4779
              K +HGNH  + +LF IYM+G+L+SLSAA++Y +++ L Q PPSL HF F  +AGAFHWF
Sbjct  712   MKGSHGNHEHI-KLFSIYMVGFLSSLSAAVSYFIYLSLWQNPPSLKHFRFFYLAGAFHWF  770

Query  4780  PYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHGLILSVFTFMLNHFVSRKGDTDKMTREK  4959
             PY I T+  +F +    + +FA  +A  Y  HGLILS+FT ++NH V +KG+ D M  + 
Sbjct  771   PYTIATYATLFDNSYSGSFTFATTIAIFYICHGLILSLFTCLVNHVVHQKGEMDMM--KT  828

Query  4960  WILHRMNVACHIRFAKLLSGTELFCVYLHWMGAKIGQHCSIRAINPVVEPGLVSVADGVH  5139
              ++HR+NVACHIRF K +SGTELFC+YL  +GAKIGQHCSIRAINP+ EP L+S+ +GVH
Sbjct  829   CLVHRVNVACHIRFTKFMSGTELFCIYLRRLGAKIGQHCSIRAINPISEPNLISIGNGVH  888

Query  5140  LGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQGLILPGSFIEKDVILGALSVAPLNSVL  5319
             LGDFSRIVP  +T+  Y+S +I+I++NSVIGSQGL+LPGS IEKDVILGA+SVAP+NSVL
Sbjct  889   LGDFSRIVPRLYTSSDYVSSKIEIQDNSVIGSQGLVLPGSVIEKDVILGAISVAPMNSVL  948

Query  5320  ECCGTFVGSENLVMVRNQTLPLDDRIEEMDPKYKKVLGSLAANLAASTLKLKSRYFHRIG  5499
             +  G FVGS+N V+V++++  LDDRIEEMD KYKKVLG+LAAN AASTLK+KSR+FHRIG
Sbjct  949   QHGGVFVGSKNPVLVKSKSYSLDDRIEEMDLKYKKVLGNLAANFAASTLKVKSRFFHRIG  1008

Query  5500  AAGKGSLRLYNVLPGLPDHKIFGPGATYPVIIRHSNCLSSDDDARLDPRGAAIRILPHER  5679
             AAGKG L LYN +PG  DHKIF PG TY VI+RHSNCLSSDDDARLDPRGAAIRIL +  
Sbjct  1009  AAGKGCLSLYNDIPGFADHKIFSPGMTYRVIMRHSNCLSSDDDARLDPRGAAIRILSN--  1066

Query  5680  tttttttplldltlktGKAFHARTIGDFATWLVCGAAAREEHVKHAPHIRDAMWGSLRRP  5859
               T   + +LDLTLKTGKAFH RTIGDFATWLVCGAAAREEHVKHAPH+RDAMWGSLR+ 
Sbjct  1067  -GTDENSSILDLTLKTGKAFHTRTIGDFATWLVCGAAAREEHVKHAPHVRDAMWGSLRQA  1125

Query  5860  NSYTELHYYSNICRLFRFKDGQEMYVRFKLRPFDEKIGEEYGEVEPRGILPPETGAIPRD  6039
              SYTELHYYSNICRLFRFK+ QEMYV+FKLRPFD  IGE+ GEV+PRG+LPPETGAIPRD
Sbjct  1126  YSYTELHYYSNICRLFRFKNDQEMYVKFKLRPFDNNIGEDSGEVKPRGVLPPETGAIPRD  1185

Query  6040  ENDKRPLLFLAEDFKFRVSSPDKVRYVLQLQIQPIPDDERVRETLLDCTKPWDEKEVPYI  6219
             END RPL FL EDF+ R+ +P+KVRYVLQLQ++ IP+DE  RE  LDCTKPWDE E PYI
Sbjct  1186  ENDNRPLRFLDEDFQHRLHTPEKVRYVLQLQMRSIPEDEVNREAALDCTKPWDEIEFPYI  1245

Query  6220  EVGEITIDQVLTEKESEELEFNPFFRCNEIDVIRATSCNQSASIDHGRSLVYEICQYLRN  6399
             ++G+ITID  LT++ESE+LEFNPF +C+E+DVIRATSCNQSAS+DHGRS+VY+ICQ+LRN
Sbjct  1246  DIGDITIDATLTKEESEDLEFNPFLKCHEVDVIRATSCNQSASMDHGRSVVYDICQHLRN  1305

Query  6400  RKPLPEAWRIFLDQSDVKLDLSGCPLAAKLENKDMPKAT-LARQWYVTLWLMSGQPFLQI  6576
             RKPLPEAWRIFLDQSDVK+D +GCPLA+ LE KD  K   LAR WYVT+WL+S QPFLQ 
Sbjct  1306  RKPLPEAWRIFLDQSDVKMDFTGCPLASTLEKKDTTKVVMLARSWYVTMWLISVQPFLQT  1365

Query  6577  VLPYFLLGLVIYAPLNCLFYTHEMTQIQKQWLLPLWWGGSGILAGLVCALSKWVLVGKKY  6756
              LPYFL+G +I+APL  LFYT +  ++QK WLLPL+W  +G+L G++CA +KW+LVG K 
Sbjct  1366  FLPYFLMGFIIFAPLKFLFYTSDTIKVQKHWLLPLFWVVTGLLGGVLCAFAKWILVGIKK  1425

Query  6757  KGKTEPIWSRGIFMDTIWQAIRTVTGEYFMETATGTFLMGIWMRLMGSEVARD-GVYIDS  6933
              G+ E IWS+GIF DTIWQAIRT+ G+YFME  +G+FL GIWM+LMGSEVA D G YI+S
Sbjct  1426  DGECELIWSKGIFCDTIWQAIRTLVGDYFMEMKSGSFLFGIWMKLMGSEVAWDEGTYINS  1485

Query  6934  MGATLNPDMVRIEEYGSVGREALLFGHIYEG-GGEVKYGRISVKNGGFVGSRAVAMPGAT  7110
             MGA LNP+MVRI++YGS+ REALLFGHIYEG GG+VKYG+I +   G+VGSRAVAMP  T
Sbjct  1486  MGAVLNPEMVRIDKYGSIEREALLFGHIYEGEGGKVKYGKIKIGESGYVGSRAVAMPRVT  1545

Query  7111  IDSGGSLGALSLAM  7152
             ID+ G+LG LSLAM
Sbjct  1546  IDTKGTLGDLSLAM  1559


 Score =   273 bits (698),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 149/175 (85%), Gaps = 0/175 (0%)
 Frame = +1

Query  1168  KMDMSTLEKDLFSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFY  1347
             ++DM++LE++LF KVQTI+YYT VL+I G +H+PMGFYYF  FM+DP AIGNPVAMQ+FY
Sbjct  73    RIDMNSLEEELFGKVQTIDYYTIVLKITGFDHIPMGFYYFGEFMDDPKAIGNPVAMQRFY  132

Query  1348  TDTNVFLFWSYGNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDG  1527
              DTNVFLFWSYGNS+DI+G +  EL  K V  MGG V+KV+LQR  KYFPHVN QDMK+G
Sbjct  133   NDTNVFLFWSYGNSVDIVGLKETELLIKGVESMGGFVEKVVLQRKLKYFPHVNNQDMKEG  192

Query  1528  FYEKLETQLQGQLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVK  1692
             FYEK+E QLQGQ NTYYVGGLMAFELTERNASY+MAL+ KHFA++  +P FPYVK
Sbjct  193   FYEKVENQLQGQQNTYYVGGLMAFELTERNASYAMALMHKHFASNNPIPAFPYVK  247


 Score = 87.8 bits (216),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  304  MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
            ME    +D+LFLK HPC  T T+IGI+G GPSG SAAYAL+KLGY+N+ +LEK+HS GGM
Sbjct  1    MEPRKAIDELFLKFHPCFDTNTKIGIIGGGPSGTSAAYALVKLGYTNITILEKYHSVGGM  60

Query  484  CESIDIQ  504
            CES DI+
Sbjct  61   CESDDIE  67



>gb|KHN25269.1| Long-chain-fatty-acid--AMP ligase FadD28 [Glycine soja]
Length=1765

 Score =  1721 bits (4456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 886/1582 (56%), Positives = 1131/1582 (71%), Gaps = 74/1582 (5%)
 Frame = +1

Query  997   VLSIKRNSSGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMD  1176
             VL+I+RNS GV V+V+  N  ++ +EFDKIIISG+FP   GRTYRS +        + MD
Sbjct  31    VLAIRRNSDGVTVNVKSLN-QVETLEFDKIIISGSFPLKYGRTYRSLTSTCIDCETEVMD  89

Query  1177  MSTLEKDLFSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDT  1356
              S LEKDLFSKV+T +YYT+VL+I GLEHLP+GFYYF  +MEDP+ +G+PVAMQ+FY+DT
Sbjct  90    ASDLEKDLFSKVETNDYYTTVLKIKGLEHLPVGFYYFSEYMEDPSTMGHPVAMQRFYSDT  149

Query  1357  NVFLFWSYGNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYE  1536
             N+FL WSYGNS+DI    VMEL  K +  +GG+V+ VILQR F YFPHV  QDMKDGFYE
Sbjct  150   NIFLLWSYGNSVDIKEPTVMELVIKTIEAIGGEVEHVILQRRFMYFPHVGSQDMKDGFYE  209

Query  1537  KLETQLQGQLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSS  1716
             KLE++LQG  NTYYVGGLMAFELTERN+SY+MALI K+FA     P FPY K LFPL++ 
Sbjct  210   KLESELQGSRNTYYVGGLMAFELTERNSSYAMALICKNFAYRNDFPIFPYTKNLFPLQAL  269

Query  1717  SEGLAFKQLDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEV  1896
              +    ++L E+P V+FP L +L+SYL HWGT  +T+N+ LYTW+NE+G  + +RTY E+
Sbjct  270   CQKKNRRELGELPEVQFPNLPTLNSYLTHWGTHPITQNRALYTWINEEGTPVCQRTYGEL  329

Query  1897  HTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQR  2076
             + N+  IA KLLTSQKP IKPGDKVLLIYVPGLDF+DAFFGCLRA+VIP+P +PPDP QR
Sbjct  330   YFNSSCIAHKLLTSQKPVIKPGDKVLLIYVPGLDFIDAFFGCLRAKVIPVPILPPDPMQR  389

Query  2077  GGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKD-KSSNSWPDLPWLH  2253
               GQAL+ I N+AK CN VAILST +YH  VR  S KN++    K+ KSS  WP+LPWLH
Sbjct  390   -NGQALIRIENVAKSCNIVAILSTVAYHSAVRAGSLKNLISLTEKNGKSSARWPNLPWLH  448

Query  2254  TDSWVkkpklfkkp-kDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKR  2430
             T +WVK  K       ++Q +P   D+CFLQFTSGST+D KGVMITHGG+IHNVK MR R
Sbjct  449   TGTWVKNSKSMIVEHLEKQCEPQPGDICFLQFTSGSTSDAKGVMITHGGLIHNVKFMRTR  508

Query  2431  YKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRAT  2610
             YKSTSRT LVSWLPQ HDMGLIGGL T LVSGGS +LFSP+TF+K PLLWL+T+SK++AT
Sbjct  509   YKSTSRTTLVSWLPQNHDMGLIGGLFTSLVSGGSAVLFSPMTFIKKPLLWLETISKYQAT  568

Query  2611  HSAAPNFAFELLVRRLESSKE--ENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSR  2784
             HSA PNFAFELL++RLES K+  +N DLSS+ FLM AAEP+RQ T+KRF+ELT  FGLS 
Sbjct  569   HSAGPNFAFELLIQRLESDKDKLQNLDLSSLTFLMVAAEPVRQKTMKRFIELTSPFGLSE  628

Query  2785  EVMAPGYGLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKEN  2964
             +VMAPGYGLAENCVFVSCA+GEG P+ VDWQGR+CCGY+   + D VDI+I+ PET +E 
Sbjct  629   KVMAPGYGLAENCVFVSCAFGEGKPIIVDWQGRICCGYVNHKDAD-VDIRIVDPETCEEL  687

Query  2965  DDPGKEGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFIT  3144
              + GKEGEIWISS SAGI YWG EELSQKTF N++ + PG+ Y RTG LGRIID KLFIT
Sbjct  688   QEDGKEGEIWISSPSAGIEYWGREELSQKTFRNELHNHPGRSYTRTGYLGRIIDQKLFIT  747

Query  3145  GRTKDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELG  3324
             GR KDLIIVAG+NIY++D+EKTVE+SSE +RPGCCAV+G+PE++L +KGI T   SD++G
Sbjct  748   GRIKDLIIVAGRNIYSADVEKTVETSSEFLRPGCCAVIGVPEEILSAKGISTPDGSDQVG  807

Query  3325  LVVIAEVRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKR  3504
             LVVIAEVRDGKP+  D+++ I TRV EEHGV +AS+  IKPR+ISKTTSGKIKR+EC K+
Sbjct  808   LVVIAEVRDGKPVSKDLIEKIKTRVVEEHGVNVASVKLIKPRTISKTTSGKIKRFECVKQ  867

Query  3505  FISGTLDVIEEQMN-----------------GERSLPRNDGI--IVPANGKISKTDIVNF  3627
             F   TL+++ +                    GE   P    +  I+    +ISK +IV F
Sbjct  868   FTDETLNLVPQGSKTILTKKSLLRPFTTGAWGEEKRPGQQQVRSILAPRKRISKNEIVEF  927

Query  3628  LKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDD  3807
             LK L+S+QTGIP++ IS  + L SYG++SIGVV+A QK+S F G  + AID         
Sbjct  928   LKGLISEQTGIPINDISVTDNLTSYGIDSIGVVKATQKLSDFLGTPVAAID---------  978

Query  3808  LADFVESLLEKNHPMLT----NSSETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLL  3975
                    LL K+ P L+    N  E +  S+     VS   +  I ++ L+AL YVS++L
Sbjct  979   ------DLLSKSQPQLSSNLPNIPEAESDSTEFIVEVSKSRQFGIHVLQLLALIYVSIML  1032

Query  3976  IIPAYISVSMFKPLILANQS-----PWFFYFISLACAPFSWMLCIFLTCICTRLLGNALL  4140
             I PAY+S++ +   IL+        PW  Y ISL  AP +W+LCI  TCIC  L G++ L
Sbjct  1033  ISPAYLSITSYLNFILSASKWIDGFPWLNYLISLTFAPLAWILCIASTCICISLFGSSFL  1092

Query  4141  QPNYVLNPEISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSAL  4320
              PNY L  EIS++S++FVKWWALYKAQEISSK+LA+HLRGTV LNYWF++LGA+I SS L
Sbjct  1093  GPNYALTSEISIYSMDFVKWWALYKAQEISSKILAIHLRGTVLLNYWFEMLGARIGSSVL  1152

Query  4321  IDTVDITDPLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSI  4500
             +DTVDITDP +VSI +E VISEG L+QSHEVKNG+LSF  +RIGK SSIGPYAV+QKGS+
Sbjct  1153  LDTVDITDPSMVSIGDEVVISEGVLVQSHEVKNGILSFHPIRIGKCSSIGPYAVIQKGSV  1212

Query  4501  VGDGAEVLAQNKKAAAK-ISKP--LNGHKGKV---TRRIRKRNHGNHNSVFQLFGIYMIG  4662
             +G+G EV A  K    + + KP  LN    K       +   +   ++ ++   GIY++G
Sbjct  1213  IGEGVEVQALRKVGQDQHVFKPAKLNNDNKKCYVQNAELLITSKTQYDIIYHFMGIYLVG  1272

Query  4663  YLNSLSAAIAYLVWIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSF  4842
             +L+SL+A IAY ++IW  ++PPS  HF F+CI GAFHW P+ I T+  MF+ +  + + F
Sbjct  1273  FLSSLAAVIAYFLYIWFSKQPPSPQHFTFVCICGAFHWIPFTIFTYATMFSEVSSNPIIF  1332

Query  4843  AGMVAAGYTAHGLILSVFTFMLNHFVSRKGDTDKMTREKWILH-RMNVACHIRFAKLLSG  5019
             A    + Y  HG IL + T      +       K T+ K  L  +M  +CH+R AKLLSG
Sbjct  1333  AISFTSAYLLHGFILIILTTAFTRLLK---TCQKKTQFKTQLQCQMITSCHLRCAKLLSG  1389

Query  5020  TELFCVYLHWMGAKIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISG  5199
             TE FC+YL  +GAKIG+HCSIRAIN V  P L+S+ DGVHLGDFS ++ G+H++ GY+SG
Sbjct  1390  TEAFCIYLRLLGAKIGKHCSIRAINRVSNPELMSIGDGVHLGDFSCVITGFHSSSGYVSG  1449

Query  5200  RIDIRENSVIGSQGLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTL  5379
             ++++++NSVIGSQ LILPGS ++K+VILGALSVAP+NS L+  G ++GS++ V++RN   
Sbjct  1450  KVEVQDNSVIGSQSLILPGSLVQKNVILGALSVAPMNSTLQEGGVYIGSQSQVVIRNSVK  1509

Query  5380  -PLDDRIEEMDPKYKKVLGSLAANLA---ASTLKLKSRYFHRIGAAGKGSLRLYNVLPGL  5547
                D+ IEEMD   KK +G+LAA L    +  + L   ++    A     L L  VLP  
Sbjct  1510  NAYDEGIEEMDMVSKKRVGNLAAALHKNDSQKVTLTRTWYQTFSALFTQPL-LQTVLP--  1566

Query  5548  PDHKIFGPGATYPVIIRHSNCL  5613
               H + G     P+     NC+
Sbjct  1567  --HMVLGLAVFAPL-----NCV  1581


 Score =   263 bits (673),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 127/228 (56%), Positives = 159/228 (70%), Gaps = 2/228 (1%)
 Frame = +1

Query  6475  LAAKLENKDMPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQ  6654
             LAA L   D  K TL R WY T   +  QP LQ VLP+ +LGL ++APLNC+FY      
Sbjct  1530  LAAALHKNDSQKVTLTRTWYQTFSALFTQPLLQTVLPHMVLGLAVFAPLNCVFYLKSAKN  1589

Query  6655  IQKQWLLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTG  6834
             +   WLLPL+W  SG LA L C ++KW+L GKK  G+  PIWS+ I +D  WQAIRT+ G
Sbjct  1590  LPIYWLLPLFWIHSGALAALACVIAKWILAGKKKAGEAVPIWSQRITLDNTWQAIRTLVG  1649

Query  6835  EYFMETATGTFLMGIWMRLMGSEVARD-GVYIDSMGATLNPDMVRIEEYGSVGREALLFG  7011
             +YFM+  +G+F   +WM+LMG++V  +  VY+DSMGA LNP+MV+IE  G VGREALLFG
Sbjct  1650  DYFMDMTSGSFWFVLWMKLMGAKVDMEHAVYVDSMGALLNPEMVKIERGGCVGREALLFG  1709

Query  7012  HIYEG-GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             H+YEG GG VK+G I +   GF GSRAVAMPG  I+S G+L ALSLAM
Sbjct  1710  HVYEGEGGMVKFGEIKIGEYGFAGSRAVAMPGVQIESEGNLSALSLAM  1757



>ref|XP_007131980.1| hypothetical protein PHAVU_011G056700g, partial [Phaseolus vulgaris]
 gb|ESW03974.1| hypothetical protein PHAVU_011G056700g, partial [Phaseolus vulgaris]
Length=1595

 Score =  1571 bits (4069),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 772/1208 (64%), Positives = 960/1208 (79%), Gaps = 23/1208 (2%)
 Frame = +1

Query  298   MEMESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAG  477
             M++E    ++D F KLHP +P  TRIGIVGAGPSGLSAAYAL +LGY N+ VLEKHH+ G
Sbjct  1     MDLER--SIEDQFSKLHPSLPENTRIGIVGAGPSGLSAAYALARLGYKNITVLEKHHTVG  58

Query  478   GMCESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALV-DSDWAYTDM  654
             GMCES++I+G+ YDLGGQVLAANSAP IFHLA+E  +E+EE+D+HKLA++  S   Y D+
Sbjct  59    GMCESVEIEGKVYDLGGQVLAANSAPVIFHLARETASELEELDSHKLAVIGHSTGEYQDI  118

Query  655   RVAEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYT  834
             +VA+DY+SV+ +TLK+Q++VK  NRIGV++VS+I SD+TPEFL+  GLKSVPKSVAYGYT
Sbjct  119   KVADDYVSVMSLTLKIQEKVKNCNRIGVHAVSDITSDLTPEFLEHHGLKSVPKSVAYGYT  178

Query  835   ASGYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKR  1014
             ASGYGFIQDMPYAY+HEF RTSMAGKIRRFK GYTS+W+K++E++P+K  C TEVL+I+R
Sbjct  179   ASGYGFIQDMPYAYLHEFTRTSMAGKIRRFKNGYTSLWQKIAESLPLKLCCQTEVLAIRR  238

Query  1015  NSSGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEK  1194
             NS GV V  +  N  ++ +EFDKIIISG+FP   GRTYRS          + MD S LEK
Sbjct  239   NSDGVTVKTKSLN-QVETLEFDKIIISGSFPLKYGRTYRSFPSTCIDCETEVMDASDLEK  297

Query  1195  DLFSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFW  1374
             +LFSKV+T +YYT+VL+I+GLEHLP+GFYYF  +MEDP+ IG+PVAMQKFY  TN+FLFW
Sbjct  298   ELFSKVETNDYYTTVLKINGLEHLPVGFYYFSEYMEDPSTIGHPVAMQKFYAGTNIFLFW  357

Query  1375  SYGNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQL  1554
             SYGNS+DI G  VMELA K +  MGG+V+KV+LQR F YFPHV+ QDMKDGFYEKLE++L
Sbjct  358   SYGNSVDIKGPAVMELAIKTIEAMGGEVEKVVLQRRFMYFPHVSSQDMKDGFYEKLESKL  417

Query  1555  QGQLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAF  1734
             QG  NTYYVGGLMAFELTERN+SY+MALI K+FA+   +PTFPY K LFPL++  +    
Sbjct  418   QGSRNTYYVGGLMAFELTERNSSYAMALICKNFAHSNDLPTFPYTKMLFPLQTECQKKNP  477

Query  1735  KQLDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFT  1914
             K+L E+  V+FP L +L+SYL+HWGT  +T+N+ LY+W+NE+G  + RRTY+E++ N+  
Sbjct  478   KELGELAEVQFPNLPTLNSYLKHWGTHPITQNRILYSWINEEGTPVCRRTYRELYFNSSC  537

Query  1915  IAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQAL  2094
             I  KL+TSQKP +KPGDKVLL+YVPGLDF+DAFFGCLRA+VIP+P +PPDP QR  GQAL
Sbjct  538   ITHKLVTSQKPVLKPGDKVLLVYVPGLDFIDAFFGCLRAKVIPVPILPPDPMQR-NGQAL  596

Query  2095  LHIANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSWVk  2271
               I NIAK C+ VAILST +YH  VR  S KN++ F    +KS   WP+LPWLHTD+WVK
Sbjct  597   KQIENIAKSCSIVAILSTVAYHSAVRAGSFKNLISFIGKNEKSLARWPNLPWLHTDTWVK  656

Query  2272  kpklfkkp-kDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSR  2448
             K K       DEQ +P   D+CF QFTSGST+DPKGVMITHGG+IHNVKLMR+RYKSTSR
Sbjct  657   KSKSMVLDHLDEQCEPEPGDICFFQFTSGSTSDPKGVMITHGGIIHNVKLMRRRYKSTSR  716

Query  2449  TILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPN  2628
             T+LVSWLPQYHDMGLIGGL T LVSGGS +LFSP+TF+K PLLWL+ +SK++ATHSA PN
Sbjct  717   TMLVSWLPQYHDMGLIGGLFTSLVSGGSAVLFSPMTFIKKPLLWLEVISKYQATHSAGPN  776

Query  2629  FAFELLVRRLESSKEE--NFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPG  2802
             FAFEL++RRLES K++  N DLSS+ FLM AAEP+RQ TLKRF+ELT  FGLS +VMAPG
Sbjct  777   FAFELVIRRLESDKDKLHNLDLSSLTFLMVAAEPVRQKTLKRFIELTSPFGLSEKVMAPG  836

Query  2803  YGLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKE  2982
             YGLAENCVF  CA+GEG P+ VD QGRVCCGY+   + D +DI+I+ PET KE  + GKE
Sbjct  837   YGLAENCVFACCAFGEGKPIIVDSQGRVCCGYVNHDDAD-IDIRIVDPETFKELHEDGKE  895

Query  2983  GEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDL  3162
             GEIWISS SAGIGYWG EELS+KTF N++ + PG+ Y RTGDLGRIID  LFITGR KDL
Sbjct  896   GEIWISSPSAGIGYWGREELSRKTFRNELHNLPGRSYTRTGDLGRIIDQNLFITGRIKDL  955

Query  3163  IIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAE  3342
             IIVAG+NIY++D+EKTVE+SS+++RPGCCAV+G+PE++L +KGI T   SD++GLVVIAE
Sbjct  956   IIVAGRNIYSADVEKTVETSSDILRPGCCAVIGVPEEILSAKGISTPDGSDQVGLVVIAE  1015

Query  3343  VRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTL  3522
             VRDGKP+  DV++ I TRV EEHGV +ASI  IKPR+ISKTTSGKIKR+EC K+F   TL
Sbjct  1016  VRDGKPVTKDVIEKIKTRVVEEHGVNVASIKLIKPRTISKTTSGKIKRFECVKQFSDETL  1075

Query  3523  DVI---EEQMNGERSL--PRNDGI--------IVPANGKISKTDIVNFLKDLLSQQTGIP  3663
              +I      +  ++SL  P   G+        ++ +   ISK +IV FLK L+S+QTGI 
Sbjct  1076  SLIPIGPTPVLRKKSLLSPFTTGMLREEKTPGLLASRKSISKNEIVEFLKGLISEQTGIS  1135

Query  3664  VSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEKN  3843
             V+ IS  + L SYG++SIGVV+A QK+S F    I AID+F+A+CI +LA+F E LL K+
Sbjct  1136  VNNISVTDNLTSYGIDSIGVVKATQKLSDFLATPISAIDVFTASCILELANFCEDLLSKS  1195

Query  3844  HPMLTNSS  3867
              P LT++S
Sbjct  1196  QPQLTSNS  1203


 Score =   356 bits (914),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 174/383 (45%), Positives = 259/383 (68%), Gaps = 17/383 (4%)
 Frame = +1

Query  4297  AKIASSALIDTVDITDPLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPY  4476
             +K     L+DTVDITDP LVSI ++ +I+EG L+QSHEVKNG+L F+ +RIGK SSIGPY
Sbjct  1221  SKSCQFVLLDTVDITDPSLVSIGDQVIIAEGVLVQSHEVKNGILCFNPIRIGKCSSIGPY  1280

Query  4477  AVLQKGSIVGDGAEVLAQNKKAAAK-ISKPLNGHKGKVTRRIRKR------NHGNHNSVF  4635
             AV+QKGS++ +GAE+ A  K    + + KP      K+   I+K       N   ++ ++
Sbjct  1281  AVIQKGSVIEEGAEIQALQKVGRDQHVLKP-----AKLNNDIKKTELPVNTNKTEYDIIY  1335

Query  4636  QLFGIYMIGYLNSLSAAIAYLVWIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFT  4815
                GIY++G+L+SL+A I+Y ++I    +  S  HF F+CI GAFHW P+ ++ +  MF+
Sbjct  1336  HFMGIYLVGFLSSLAAVISYFLYIRFSNQSLSPQHFSFVCIGGAFHWIPFTLVAYATMFS  1395

Query  4816  SLPVSTLSFAGMVAAGYTAHGLILSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHI  4995
              +  + ++FA    + Y  HG IL + T      +  K   ++   + W+  ++  +CH+
Sbjct  1396  EVSSNPITFAISFTSVYLLHGFILIILTTAFTRLL--KTSQNQTHFKTWLRCQVTTSCHL  1453

Query  4996  RFAKLLSGTELFCVYLHWMGAKIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYH  5175
             R AKLLSGTE FC+YL  +GAKIG+HCSIRAIN V  P L+S+  GVHLGDFSRI+ G+H
Sbjct  1454  RCAKLLSGTEAFCIYLRLLGAKIGKHCSIRAINSVSNPELMSIGSGVHLGDFSRIITGFH  1513

Query  5176  TTGGYISGRIDIRENSVIGSQGLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENL  5355
             ++ G++SG+I++++NSVIGSQ ++LPGS ++K+VILGALSVAP+NS L+  G ++GS++ 
Sbjct  1514  SSSGFVSGKIEVQDNSVIGSQSVVLPGSLVQKNVILGALSVAPMNSTLQEGGVYIGSKSQ  1573

Query  5356  VMVRNQTLPLDDRIEEMDPKYKK  5424
              ++RN     D+ I++MD   KK
Sbjct  1574  AVIRNSR---DEWIQDMDKISKK  1593



>ref|XP_007150400.1| hypothetical protein PHAVU_005G150200g [Phaseolus vulgaris]
 gb|ESW22394.1| hypothetical protein PHAVU_005G150200g [Phaseolus vulgaris]
Length=2183

 Score =  1562 bits (4045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 769/1233 (62%), Positives = 955/1233 (77%), Gaps = 28/1233 (2%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+    V+D F KLHP MP  T+IGIVG GPSGLSAAYAL++LGY+NV VLEKHHS GGM
Sbjct  1     MDPEKSVEDQFSKLHPSMPVNTKIGIVGGGPSGLSAAYALVRLGYNNVTVLEKHHSVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRV  660
             CES++I+GR YDLGGQVLAA+SAP IFHLAKE G+ +EEMD+HKLA++DS    Y D++V
Sbjct  61    CESVEIEGRVYDLGGQVLAASSAPVIFHLAKETGSPLEEMDSHKLAVIDSSSGQYQDIKV  120

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             A+DY+SV+ +TL +Q++VK + R+GV++VSE+ASD+ PE+++  GLKSVPKSVAYGYTAS
Sbjct  121   ADDYVSVMSLTLAIQEKVKHSGRLGVHAVSEVASDLAPEYVEQHGLKSVPKSVAYGYTAS  180

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGFIQDMPYAYIHEF RTSMAGKIRRFKGGYTS+W++++E++PIK  CNTEV +IKRNS
Sbjct  181   GYGFIQDMPYAYIHEFTRTSMAGKIRRFKGGYTSLWQRIAESLPIKLHCNTEVFTIKRNS  240

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
             + V V+V+  +  ++ MEFDKIIISG FP   GRTYRS    +     + MD+S LEKDL
Sbjct  241   NSVTVNVKC-SSEIETMEFDKIIISGNFPLKYGRTYRSVPSTSLECESEVMDVSELEKDL  299

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             FSKV+T +YYT+VL+I G+E +P+GFYYF  +MEDP+ IGNPVAMQKFY D+++FLFWSY
Sbjct  300   FSKVETNDYYTTVLKIKGMEQMPVGFYYFREYMEDPSTIGNPVAMQKFYADSDIFLFWSY  359

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GNS DI G  V ELA K+V  MGG+V+  ILQR FKYFPHV+ QDM++GFYEKLE++LQG
Sbjct  360   GNSADIKGPTVTELAIKSVKSMGGEVENFILQRRFKYFPHVSSQDMRNGFYEKLESELQG  419

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
               NTYYVGGLMAFELTERN+SY+MALI K FAN   +P FPY K LFPL+S  +    K+
Sbjct  420   SRNTYYVGGLMAFELTERNSSYAMALICKKFANSSDLPVFPYTKSLFPLQSEFQKKEPKE  479

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             L E+PGV+FP L +L+SYL+HWGT  VT+N+TLYTW+NE G V  +RTY E H NA  IA
Sbjct  480   LGELPGVQFPNLPTLNSYLKHWGTHTVTQNRTLYTWINEGGTVGGKRTYGEQHLNASCIA  539

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
              KLLTS+K  IKPGD+VLL+YVPGLDF+DAFFGCLRA+V+P+P +PPDP QR GGQALL 
Sbjct  540   HKLLTSEKTVIKPGDRVLLVYVPGLDFIDAFFGCLRAKVLPVPVLPPDPMQR-GGQALLK  598

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSK-DKSSNSWPDLPWLHTDSWVkkp  2277
             I NIAK C  VAILST +YH  VR    K+++    K  KS+  WP LPWLHTDSWV   
Sbjct  599   IENIAKSCGIVAILSTVAYHSAVRAGQLKSLISLTGKIGKSAAQWPKLPWLHTDSWVNNN  658

Query  2278  klfkkp--kDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRT  2451
                      D+Q +    D+CFLQFTSGST D KGVMITHGG+IHNVKLM+  YKSTSRT
Sbjct  659   SRNLALEDVDDQCESKPSDICFLQFTSGSTGDAKGVMITHGGLIHNVKLMKSVYKSTSRT  718

Query  2452  ILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNF  2631
             +LVSWLPQYHDMGLIGGL T LVSGGS +LFSP+TF+K PLLWL+TMSK++ATHSA PNF
Sbjct  719   MLVSWLPQYHDMGLIGGLFTALVSGGSAVLFSPITFIKKPLLWLETMSKYQATHSAGPNF  778

Query  2632  AFELLVRRLESSKE--ENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGY  2805
             AFEL+VRRLES K+  +N +LSSM FLM AAEP+R  T+KRF++LT SFGLS++VMAPGY
Sbjct  779   AFELVVRRLESEKDKLQNLNLSSMVFLMVAAEPVRLKTMKRFLDLTASFGLSQKVMAPGY  838

Query  2806  GLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEG  2985
             GLAENCVFVSCA+GEG P+ VDWQGRV CGYI  P    +DI+I+ PE  +E  + GKEG
Sbjct  839   GLAENCVFVSCAFGEGCPILVDWQGRVSCGYI-HPGDADIDIRIVDPENCEELREDGKEG  897

Query  2986  EIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLI  3165
             EIWISS SAGIGYWG EELSQKTF N++ + PG+ Y RTGDLGRIID KLFITGR KDLI
Sbjct  898   EIWISSPSAGIGYWGKEELSQKTFRNELQNHPGRNYTRTGDLGRIIDGKLFITGRIKDLI  957

Query  3166  IVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEV  3345
             IVAG+NIY++D+EKTVE+SSE +RPGCCAV+G+PE+VL +KGI     SD++GLVV+AEV
Sbjct  958   IVAGRNIYSADVEKTVETSSEFLRPGCCAVIGVPEEVLSAKGITLPDGSDQVGLVVVAEV  1017

Query  3346  RDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLD  3525
             RDGK +  DV++HI TRVAEEHGV +AS+  IKPR+ISKTTSGKIKR+EC K+F   TL+
Sbjct  1018  RDGKAVSKDVIEHIQTRVAEEHGVSVASVKLIKPRTISKTTSGKIKRFECLKQFADETLN  1077

Query  3526  VIEEQMNGERSLPRNDGIIVPANGKI----------------SKTDIVNFLKDLLSQQTG  3657
             ++ + +   +SL R+        G+                 S  +IV  LK L+S+ +G
Sbjct  1078  LVPQPIPTRKSLLRSFTTGTCTEGRTPRAHLVRSSNPLPIPKSNKEIVEHLKRLISEHSG  1137

Query  3658  IPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLE  3837
             IP+  IS  E + +YG++SIGVV+A QK+S F G+ + AID+F+A+CI +LA+F E+L+ 
Sbjct  1138  IPIKDISVAENMSAYGIDSIGVVKATQKLSDFLGVPVAAIDVFTASCIQELANFSENLML  1197

Query  3838  KNHPMLTNSSETKISSSGIPSVVSTFDKITIWL  3936
             K+    +NSS   ++      +V    K   W+
Sbjct  1198  KSQ---SNSSHAPLADIDTTEMVVDVSKSRQWV  1227


 Score =  1083 bits (2802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/954 (55%), Positives = 695/954 (73%), Gaps = 18/954 (2%)
 Frame = +1

Query  4330  VDITDPLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGD  4509
             VDITDP LVSI +E  I+EG L+QSHEVKNG+LS   +RIG+ SSIGPY+ +QKGS++ +
Sbjct  1227  VDITDPSLVSIGDEVAIAEGVLVQSHEVKNGILSLLPIRIGRNSSIGPYSTIQKGSVIKE  1286

Query  4510  GAEVLA-QNKKAAAKISKP--LNGHKGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLNSLS  4680
             G+EV   Q  +    + KP  LN  K      +   +    N+++   GIY+ G+L+SL+
Sbjct  1287  GSEVEPLQKVEGGQHVPKPAKLNNVKENAVLLVTT-SKTQSNAMYHFLGIYLTGFLSSLA  1345

Query  4681  AAIAYLVWIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAA  4860
             AAIAY+++ W  + P S  HF F+CI GAFHW P+ I+ +  MF+ +P + + F      
Sbjct  1346  AAIAYILYTWFFRIPASFQHFSFLCICGAFHWIPFTIVAYATMFSDIPSNPIVFTISFTC  1405

Query  4861  GYTAHGLILSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVY  5040
              Y  HGLIL+  T  L   +  K   ++   + W+ +R+ ++CH RFAKLLSGTE FC+Y
Sbjct  1406  AYLLHGLILTSLTCALTRLL--KFSQNQTHFKTWLRNRLTISCHQRFAKLLSGTEAFCIY  1463

Query  5041  LHWMGAKIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIREN  5220
             L  +GAKIG+HCSIRAINPV  P L+S+ DGVHLGDFS+I+ G+H + GY  G+I++++N
Sbjct  1464  LRLLGAKIGKHCSIRAINPVSNPELMSIGDGVHLGDFSKIITGFHYSNGYACGKIEVQDN  1523

Query  5221  SVIGSQGLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDDRIE  5400
             SV+GSQ L+LPGS +EK+VILGALSVAP+NS+L     ++GS+  V  RN +  LD+RIE
Sbjct  1524  SVVGSQSLVLPGSVVEKNVILGALSVAPMNSILHEGSVYIGSQTRVATRNSSNSLDERIE  1583

Query  5401  EMDPKYKKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGAT  5580
             EMD +YKKV+ ++AANLA +T+ +K+RYFHRIG +GKG L++Y+ L G+P HK+F PG +
Sbjct  1584  EMDMEYKKVVANMAANLAVTTINVKARYFHRIGVSGKGHLKIYDKLEGIPLHKVFQPGKS  1643

Query  5581  YPVIIRHSNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGD  5760
             YPV++RHSN LS+DDDAR+D RGA++RIL       +   PL+DLTLKTG AF+ART+ D
Sbjct  1644  YPVMVRHSNSLSADDDARIDARGASLRIL--SDAPDSNHVPLIDLTLKTGNAFYARTLAD  1701

Query  5761  FATWLVCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYVR  5940
             FA+WLVCG AAREE VK  PH+R+A+W SLR  +SY ELHYYSN CRL R  DGQEMYV+
Sbjct  1702  FASWLVCGLAAREELVKRTPHVREAVWNSLRHAHSYAELHYYSNYCRLMRCTDGQEMYVK  1761

Query  5941  FKLRPFDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYV  6120
             FKLRP D  IGE+ G+V+P GILPPETGAIPRDEND RPLLFLA+DF+ RVSSP  VRYV
Sbjct  1762  FKLRPIDRSIGEDAGKVKPTGILPPETGAIPRDENDTRPLLFLAQDFQRRVSSPGGVRYV  1821

Query  6121  LQLQIQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRC  6300
              Q+Q++ +P+DE  R+  LDC+KPW+E E P I+VGEI I + L+ +ES++LEFNP+ + 
Sbjct  1822  FQVQLRAVPEDEAARDIALDCSKPWNETEFPCIDVGEINITENLSREESDKLEFNPYIKS  1881

Query  6301  NEIDVIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPLA  6480
             +E+DVI ATS  QSASIDHGRSL+YEICQ++RN + LP +WR  ++QS+VK+DLS CP+A
Sbjct  1882  HELDVIPATSNTQSASIDHGRSLIYEICQHVRNGQRLPHSWRNLVEQSNVKVDLSCCPIA  1941

Query  6481  A-------KLENKDMPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYT  6639
             A       K E K +   TL R WY T   +  QP LQ VLPY ++GL ++APLN +   
Sbjct  1942  ASVATPKPKKETKLVTTLTLTRTWYQTFSAVFTQPLLQTVLPYTVVGLSVFAPLNFVVNM  2001

Query  6640  HEMTQIQKQWLLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAI  6819
                 ++  QWL PL+W  SG++  L C ++KWVLVG+K +G+  P+WS+ + MD+ WQAI
Sbjct  2002  KNAEKLSVQWLFPLFWILSGVMGALACVVAKWVLVGRKREGEMVPLWSKRVMMDSTWQAI  2061

Query  6820  RTVTGEYFMETATGTFLMGIWMRLMGSEVARDG-VYIDSMGATLNPDMVRIEEYGSVGRE  6996
             R V GEYFME A+G+FL  +WMRLMGSEV  DG  Y+DSMGA LNP+MV+IE  G VGRE
Sbjct  2062  RAVVGEYFMEIASGSFLFVMWMRLMGSEVDMDGDAYVDSMGALLNPEMVKIERGGCVGRE  2121

Query  6997  ALLFGHIYEG--GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             AL+FGHIYEG  GG VK+G I +   GFVGSRAV MPG  +++  +L ALSLAM
Sbjct  2122  ALVFGHIYEGDEGGMVKFGGIKIGEEGFVGSRAVIMPGVHVENEANLSALSLAM  2175



>ref|XP_004507120.1| PREDICTED: uncharacterized protein LOC101499614 [Cicer arietinum]
Length=2035

 Score =  1535 bits (3973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 764/1213 (63%), Positives = 945/1213 (78%), Gaps = 41/1213 (3%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+    +++ F KLHP +P  TRIGIVGAGPSGLSAAYAL +LGY NV VLEKHH+ GGM
Sbjct  1     MDPERSMEEQFSKLHPSLPENTRIGIVGAGPSGLSAAYALTRLGYKNVTVLEKHHTVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVD-SDWAYTDMRV  660
             CES++I+G+ YDLGGQVL A+SAP IFHLAKE G+ +EE+D+HKLA+VD S   Y D++V
Sbjct  61    CESVEIEGKVYDLGGQVLVASSAPVIFHLAKETGSALEELDSHKLAVVDPSSGEYHDIKV  120

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             A+DY+S         ++VK   RIGV++VS+IASD+TPE+LK  GLKS+PKSVAYGYTAS
Sbjct  121   ADDYVS---------EKVKNCGRIGVHAVSDIASDLTPEYLKCHGLKSIPKSVAYGYTAS  171

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGFIQDMPYAY+HEF RTSMAGKIRRFKGGYTS+W+ ++E++P++  CNTEVL+IKRNS
Sbjct  172   GYGFIQDMPYAYLHEFTRTSMAGKIRRFKGGYTSLWQSIAESLPLRLLCNTEVLAIKRNS  231

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDK--MDMSTLEK  1194
              GV V ++  +  ++ +EFDKIIISG+FP   G+ YRSPS     + C K  MD S LEK
Sbjct  232   DGVTVRIKSLD-VVETLEFDKIIISGSFPLKYGKIYRSPSN---CIECKKEIMDASDLEK  287

Query  1195  DLFSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFW  1374
             DLFSKV+T +YYT+V +I GLEHLP+GFYYF  +MEDP+ IGNPVAMQKFY D+N+FLFW
Sbjct  288   DLFSKVETNDYYTTVFKIKGLEHLPIGFYYFSKYMEDPSTIGNPVAMQKFYADSNIFLFW  347

Query  1375  SYGNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQL  1554
             SYGNS+DI G  V ELA   +  MGG+V+  ILQR FKYFPHV  QDMKDGFYEKLE+QL
Sbjct  348   SYGNSVDIKGPTVKELAMTTIQTMGGEVENFILQRCFKYFPHVGSQDMKDGFYEKLESQL  407

Query  1555  QGQLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAF  1734
             QG  NTYYVGGLMAFELTERN+SYSMALI K+FAN   +PTFPY K LFPL+S  +    
Sbjct  408   QGSRNTYYVGGLMAFELTERNSSYSMALICKNFANTNDLPTFPYTKNLFPLQSEHQKKNP  467

Query  1735  KQLDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFT  1914
             K+LDE+P V+ P   +L+SYL++WGT  +T+N+TLYTW+NE+G  + +RTY E H  +  
Sbjct  468   KELDELPEVQSPNFPTLNSYLKYWGTHPITQNRTLYTWINEEGTPVCQRTYGEQHYYSSC  527

Query  1915  IAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQAL  2094
             IAQKLLTSQKP IKPGD+VLL+YVPGLDF+DAFFGC+RA+V+P+P  PPDP QR  GQAL
Sbjct  528   IAQKLLTSQKPVIKPGDRVLLVYVPGLDFIDAFFGCIRAKVLPVPITPPDPMQR-SGQAL  586

Query  2095  LHIANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSWVk  2271
             + I NIAK C  V ILST +YH  VR  S K+++   + K+KSS  WP+LPWLHTD+WVK
Sbjct  587   MKIENIAKSCGIVGILSTTTYHSAVRAGSLKSLISLTRKKEKSSAQWPNLPWLHTDTWVK  646

Query  2272  kpkl-fkkpkDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSR  2448
               K    +  D+Q +P   D+CFLQFTSGST D KGVMI+HGG+IHNVKLMR RYKSTSR
Sbjct  647   NSKSIVSENVDDQCEPQPGDVCFLQFTSGSTGDAKGVMISHGGLIHNVKLMRSRYKSTSR  706

Query  2449  TILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPN  2628
             T LVSWLPQYHDMGLIGG+ T L+SGGS  LFSP+TF+K PLLWL+ +SK++ATHSA PN
Sbjct  707   TKLVSWLPQYHDMGLIGGIFTSLISGGSAFLFSPMTFIKKPLLWLEIISKYQATHSAGPN  766

Query  2629  FAFELLVRRLESSKE--ENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPG  2802
             FAFELL+RRLES K+  +N DLSS+ FLM A+EP RQ TLKRF+ELT  FGLS++VMAPG
Sbjct  767   FAFELLIRRLESDKDKVKNLDLSSLVFLMVASEPGRQETLKRFIELTAPFGLSQKVMAPG  826

Query  2803  YGLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKE  2982
             YGLAENCVFVSCA+GEG P+ VDWQGRVCCGYI   +TD +D++I+ P+T +E  + GKE
Sbjct  827   YGLAENCVFVSCAFGEGKPITVDWQGRVCCGYINPVDTD-IDVRIVDPDTCEELREDGKE  885

Query  2983  GEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDL  3162
             GEIWISS SAGIGYWG EELSQKTF N++ +  G+ Y RTGDLGRIID KLFITGR KDL
Sbjct  886   GEIWISSPSAGIGYWGREELSQKTFSNELTNHLGRNYTRTGDLGRIIDQKLFITGRIKDL  945

Query  3163  IIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAE  3342
             IIVAG+NIY++D+EKT+E+SSE +RPGCCAV+G+ E++L++KGI     SD++ LVVIAE
Sbjct  946   IIVAGRNIYSADVEKTIETSSEFLRPGCCAVIGVAEEILLAKGISIPDGSDQVALVVIAE  1005

Query  3343  VRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTL  3522
             VRDGKP+  DV+++I TRVAEEHGV +AS+  IKPR+ISKTTSGKIKR+EC K+F   TL
Sbjct  1006  VRDGKPVSKDVIENIKTRVAEEHGVGLASVNLIKPRTISKTTSGKIKRFECIKQFTDETL  1065

Query  3523  DVI---EEQMNGERSLPRNDGIIV---------------PANGK-ISKTDIVNFLKDLLS  3645
             +++    + M  ++SL R+                    PA GK I K DI  FLK L+S
Sbjct  1066  NLVPLGTKSMLTKKSLVRSFTTATCKEAKPFWLQKVRSAPALGKRIDKNDIEEFLKRLIS  1125

Query  3646  QQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVE  3825
             +QT IP++ +S  + L SYG++SIGVV+A QK+S F G  + AID+F+A+CI +LA F E
Sbjct  1126  EQTRIPINNVSVTDNLSSYGIDSIGVVKATQKLSDFLGTPVAAIDVFTASCIQELASFSE  1185

Query  3826  SLLEKNHPMLTNS  3864
              LL K  P L  +
Sbjct  1186  DLLSKTRPQLVRT  1198


 Score =   620 bits (1599),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 318/621 (51%), Positives = 432/621 (70%), Gaps = 28/621 (5%)
 Frame = +1

Query  3577  IIVPANGKISKTDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFF  3756
             I VP   +ISK DIV FLK ++S+QTG+ ++ IS    L SYG++SIGVV+A QK+S F 
Sbjct  1199  IHVPCK-RISKNDIVEFLKGIISEQTGVAINSISVTGNLTSYGIDSIGVVKATQKLSDFL  1257

Query  3757  GINIGAIDIFSATCIDDLADFVESLLEKNHPMLT----NSSETKISSSGIPSVVSTFDKI  3924
             G  + AID+F+A+CI +LA+F E LL K  P L+    N  E  I  + +   VS   + 
Sbjct  1258  GTPVAAIDVFTASCITELANFSEDLLSKTQPQLSSNESNVPEADIDCTELVVEVSKSRQW  1317

Query  3925  TIWLIHLVALAYVSLLLIIPAYISVSMF-KPLILANQS----PWFFYFISLACAPFSWML  4089
             +I L+   AL Y+S++L  PAY+S++ F    + A++S    PW  Y ISL  AP +W+ 
Sbjct  1318  SIRLLQFFALIYISIMLASPAYLSITAFLNSNLCASKSVAGVPWLNYMISLIFAPLAWIH  1377

Query  4090  CIFLTCICTRLLGNALLQPNYVLNPEISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVF  4269
             CI  TCIC  L G++LL  NY L  EIS++SV+FVKWWALYK+QEISSKVLAVHLRGTVF
Sbjct  1378  CIASTCICISLFGSSLLGLNYELTSEISIYSVDFVKWWALYKSQEISSKVLAVHLRGTVF  1437

Query  4270  LNYWFKILGAKIASSALIDTVDITDPLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRI  4449
             L YWF++LGAKI SS LIDTVDITDP LVSI +E+VI+EG L+QSHEVKNG+LS   +RI
Sbjct  1438  LKYWFEMLGAKIGSSVLIDTVDITDPALVSIGDEAVIAEGVLVQSHEVKNGILSLRPIRI  1497

Query  4450  GKRSSIGPYAVLQKGSIVGDGAEVLAQNKKAAA----KISKPLNGHKGKVTRRIRKRNHG  4617
             GK SSIGPYAV+QKGS++G+ AEV A  K        K +K  N  K K    I  +   
Sbjct  1498  GKCSSIGPYAVVQKGSVIGESAEVQALQKVGGGEHVLKPNKLNNIDKNKDLPVISSKTQ-  1556

Query  4618  NHNSVFQLFGIYMIGYLNSLSAAIAYLVWIWLLQKPPSLHHFLFICIAGAFHWFPYIIIT  4797
              H++++   GIY++G+L+SL+AAIAY ++I + ++PPSL HF F+CI GAFHW P+III 
Sbjct  1557  -HDTIYHFIGIYLVGFLSSLAAAIAYFLYIKISKQPPSLQHFSFVCICGAFHWIPFIIIA  1615

Query  4798  FTAMFTSLPVSTLSFAGMVAAGYTAHGLIL----SVFTFMLNHFVSRKGDTDKMTREKWI  4965
             +  MF+ +  + ++FA    + Y  H LIL    +VFT +LN         ++   + W+
Sbjct  1616  YATMFSDVSSNPITFAISFTSAYLLHSLILITLTAVFTRLLNQ--------NQTKFKTWL  1667

Query  4966  LHRMNVACHIRFAKLLSGTELFCVYLHWMGAKIGQHCSIRAINPVVEPGLVSVADGVHLG  5145
              ++MN++CH+R AK LSGTE FCVYL  +GAKIG+HCSIRAINPV  P L+S+  GVH+G
Sbjct  1668  RYQMNISCHLRCAKFLSGTEAFCVYLRLLGAKIGKHCSIRAINPVSNPELMSIGAGVHIG  1727

Query  5146  DFSRIVPGYHTTGGYISGRIDIRENSVIGSQGLILPGSFIEKDVILGALSVAPLNSVLEC  5325
             DFS+I+ G+H++ GY+ G+I++ +NSVIGSQ LILP S I+K+VILGALS+AP+NS+L+ 
Sbjct  1728  DFSKIITGFHSSNGYVWGKIEVHDNSVIGSQSLILPNSLIQKNVILGALSLAPMNSILQE  1787

Query  5326  CGTFVGSENLVMVRNQTLPLD  5388
              G ++GS+    V N +  L+
Sbjct  1788  GGLYIGSQTQSHVGNLSATLN  1808


 Score =   251 bits (640),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 158/228 (69%), Gaps = 5/228 (2%)
 Frame = +1

Query  6475  LAAKLENKDMPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQ  6654
             L+A L  +D  K TL R WY T   +  QPFLQ   P+ LLGL IYAPLN +F  H   +
Sbjct  1803  LSATLNKEDSQKLTLTRTWYQTFTSLFTQPFLQTASPHILLGLSIYAPLNLIF--HLSKK  1860

Query  6655  IQKQWLLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTG  6834
             +   WLLPL+W  SG +A L C ++KWVLVGKK  G+  PIWS+ I MD+ WQAIRT+ G
Sbjct  1861  VPIFWLLPLFWILSGTMAALTCVIAKWVLVGKKKPGEKLPIWSKRIIMDSTWQAIRTLIG  1920

Query  6835  EYFMETATGTFLMGIWMRLMGSEVARDGVYIDSMGATLNPDMVRIEEYGSVGREALLFGH  7014
             +YFME  +G+F+  +WM++MG +V  D VY+DSMGA LNP+MV+IE  G V ++ALLFGH
Sbjct  1921  DYFMEMTSGSFMFVMWMKMMGGDVDED-VYVDSMGALLNPEMVKIERGGCVEKDALLFGH  1979

Query  7015  IYEG--GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             IYEG  GG VK+G I +   GFVGSRA+ MPG  +++  +L A SLAM
Sbjct  1980  IYEGDEGGMVKFGEIKIGEDGFVGSRAMVMPGVVLENDANLAAFSLAM  2027



>gb|KEH30270.1| AMP-binding enzyme [Medicago truncatula]
Length=2027

 Score =  1521 bits (3938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 753/1211 (62%), Positives = 940/1211 (78%), Gaps = 52/1211 (4%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M++   +DD F KLHP +P  TR+GIVGAGPSGLSAAYAL +LGY NV VLEKHH+ GGM
Sbjct  1     MDTERSIDDQFSKLHPSLPENTRVGIVGAGPSGLSAAYALTRLGYKNVTVLEKHHTVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVD-SDWAYTDMRV  660
             CES++I+                        E G+ +EE+D+HKLA+VD +   Y D++V
Sbjct  61    CESVEIE------------------------ETGSALEELDSHKLAVVDPTSGEYQDIKV  96

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             A+DY+SV+ +TL++Q++VK   RIGV++VS+IASD+TPE+L+  GLKS+PKSVAYGYTAS
Sbjct  97    ADDYVSVMSLTLEIQEKVKNRGRIGVHAVSDIASDLTPEYLECHGLKSIPKSVAYGYTAS  156

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF+QDMPYAY+HEF RTSMAGKIRRF+GGYTS+W+K++E++P+K  CNTEVL+IKRNS
Sbjct  157   GYGFVQDMPYAYLHEFTRTSMAGKIRRFQGGYTSLWQKIAESLPLKLLCNTEVLAIKRNS  216

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
              GV V +++ N  ++ MEFDKIIISG+FP   G  YRSPS     L  + MD S LEKDL
Sbjct  217   DGVKVHIKNSN-VVETMEFDKIIISGSFPLKYGSIYRSPST-CIELEKEVMDASELEKDL  274

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             FSKVQT +YYT+V +I GLEH P+GFYYF+ +MEDP  IGNPVAMQKFY D+N+FLFWSY
Sbjct  275   FSKVQTNDYYTTVFKIKGLEHFPIGFYYFDKYMEDPNTIGNPVAMQKFYDDSNIFLFWSY  334

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GNS+DI G  V ELA+K V  MGG+V+  ILQR+FKYFPHV+ QDMKDGFYEKLE++LQG
Sbjct  335   GNSVDIKGPAVKELARKTVEAMGGEVESFILQRNFKYFPHVSSQDMKDGFYEKLESELQG  394

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
               NTYYVGGLMAFELTERN+SY+MALI K+FAN   +PTFPY K LFPL++ S+    K+
Sbjct  395   SRNTYYVGGLMAFELTERNSSYAMALICKNFANSNDLPTFPYTKDLFPLQTESQKKNPKE  454

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             L E+P V+FP L SL+SYL+HWGT  +T+N+TLYTW+NE+G+ + RRTY E H  +  +A
Sbjct  455   LGELPEVRFPNLPSLNSYLKHWGTHPITQNRTLYTWINEEGNPVCRRTYAEQHFYSSCVA  514

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
              KL TSQKP IKPGD+VLL+YVPGLDF+DAFFGCL+A+VIP+P IPPDP QR  GQAL+ 
Sbjct  515   HKLSTSQKPVIKPGDRVLLVYVPGLDFIDAFFGCLKAKVIPVPIIPPDPMQR-SGQALMK  573

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSWVkkp  2277
             I NIAK C  VAILST +YH  VR  S KN++   + K KSS  WP+LPWLHTD+WVK  
Sbjct  574   IENIAKSCGIVAILSTIAYHSAVRAGSLKNLISITRKKGKSSARWPNLPWLHTDTWVKNS  633

Query  2278  klfkkp-kDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTI  2454
             K       D+Q +P  +D+CFLQFTSGST D KGVMI+HGG+IHNVKLM++RYKSTSRT 
Sbjct  634   KTIVLEDLDDQCEPQPDDICFLQFTSGSTGDAKGVMISHGGLIHNVKLMQRRYKSTSRTK  693

Query  2455  LVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFA  2634
             LVSWLPQYHDMGLIGGL T LVSGGS  LFSP+TF+K P+LWL+ +SK++ATHSA PNFA
Sbjct  694   LVSWLPQYHDMGLIGGLFTSLVSGGSAFLFSPMTFIKKPMLWLEIISKYQATHSAGPNFA  753

Query  2635  FELLVRRLESSKE--ENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYG  2808
             FELL+RRLES+K+  +N DLSS+ FLM AAEP+R  TLKRF+ELT  FGLS++VMAPGYG
Sbjct  754   FELLIRRLESNKDKIQNLDLSSLVFLMVAAEPVRHKTLKRFIELTTPFGLSQKVMAPGYG  813

Query  2809  LAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGE  2988
             LAENCVFVSCA+GEG+P+ VDWQGRVCCGY+   +TD +DI+I+  ET KE  + GKEGE
Sbjct  814   LAENCVFVSCAFGEGMPIIVDWQGRVCCGYVHPADTD-IDIRIVDSETCKELHEDGKEGE  872

Query  2989  IWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLII  3168
             +WISS SAG+GYWG EELSQKTF N++++ PG+ Y RTGDLGRIID KLFITGR KDLII
Sbjct  873   VWISSPSAGVGYWGREELSQKTFRNELMNRPGRNYTRTGDLGRIIDQKLFITGRIKDLII  932

Query  3169  VAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVR  3348
             VAG+NIY+SD+EKT+E+SSE +RPGCCAV+G+PE++L +KGI     SD++ LVVIAEVR
Sbjct  933   VAGRNIYSSDVEKTIETSSEFLRPGCCAVIGVPEEILSAKGISIPDGSDQVALVVIAEVR  992

Query  3349  DGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDV  3528
             DGK +  DV++ I  RVAEEHGV +AS+  IKPR+ISKTTSGKIKR+EC K+F   TL++
Sbjct  993   DGKQVSKDVIEIIKMRVAEEHGVVLASVKLIKPRTISKTTSGKIKRFECIKQFTDETLNL  1052

Query  3529  I---EEQMNGERSLPRNDGIIV---------------PANGK-ISKTDIVNFLKDLLSQQ  3651
             +    + M  ++S+  +   +                P + K I+K DIV FLK L+S+Q
Sbjct  1053  VPLGTKPMLTKKSMIWSFSTVTCREEKPPRLQLTKSAPVHSKRINKNDIVEFLKVLISEQ  1112

Query  3652  TGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESL  3831
             TG P++KIS  + L SYG++SIGVV+A QK+S F G  + AID+F+A+CI +LA F E L
Sbjct  1113  TGTPINKISVTDNLTSYGIDSIGVVKATQKLSDFLGTPVAAIDVFTASCIQELASFSEDL  1172

Query  3832  LEKNHPMLTNS  3864
             L K  P    S
Sbjct  1173  LSKTRPQTERS  1183


 Score =   607 bits (1566),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 313/639 (49%), Positives = 434/639 (68%), Gaps = 35/639 (5%)
 Frame = +1

Query  3493  CAKRFISGTLDVIEE-QMNGERSLPRNDGIIVPANGKISKTDIVNFLKDLLSQQTGIPVS  3669
             C +   S + D++ + +   ERS+P      +P+  +ISK DI+ FLK L+S+QTG+ V 
Sbjct  1161  CIQELASFSEDLLSKTRPQTERSIP------IPSK-RISKNDILEFLKRLISEQTGVAVD  1213

Query  3670  KISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEKNHP  3849
             KIS  + L SYG++SIGVV+A QK+S F G  + AID+F+A+CI +LA F E LL K  P
Sbjct  1214  KISVTDNLTSYGIDSIGVVKATQKLSDFLGTPVAAIDVFTASCIQELASFSEDLLSKTQP  1273

Query  3850  MLTNSS----ETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPAYISVSMF-KP  4014
              L+N+     E  I  +     VS   K+ I  +  +AL Y+S++L  PAY+S++ F   
Sbjct  1274  QLSNNPSDVPEVDIDCTEPVVEVSKSRKLGIRSLQFLALIYISIMLASPAYLSITAFLNS  1333

Query  4015  LILANQS----PWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPEISVWS  4182
              + A++S    PW  Y  SL  AP +W+LCI  TC+C  L G++L+  NY    +IS++S
Sbjct  1334  SLSASKSVAGVPWLNYIFSLIFAPLAWILCIASTCVCISLFGSSLVGLNYEHASDISIYS  1393

Query  4183  VEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDPLLVSI  4362
              +FVKWWALYK QEISSKVLA HLRGTVFL YWF++LGA+I SS L+DTVDITDP LVSI
Sbjct  1394  TDFVKWWALYKTQEISSKVLATHLRGTVFLKYWFEMLGARIGSSVLLDTVDITDPTLVSI  1453

Query  4363  DEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLAQNKKA  4542
              +E+V++EG L+QSHEVKNG+LS   ++IGK SSIGPYAV+Q GS++G+  EV A  K A
Sbjct  1454  GDEAVVAEGVLVQSHEVKNGILSLHPIKIGKCSSIGPYAVVQNGSVIGESVEVHALQKVA  1513

Query  4543  AAKISKPLNGHKGKVTRRIRK----RNHGNHNSVFQLFGIYMIGYLNSLSAAIAYLVWIW  4710
               +    L   K K   +        +   +++++   GIY++G+L+SL+AAIAY ++I 
Sbjct  1514  EGE--HVLKSDKLKSIDKNADLPAINSETQYDTIYHFMGIYLVGFLSSLAAAIAYFLYIN  1571

Query  4711  LLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHGLIL-  4887
                +PPSL HF F+CI GAFHW P+ +I +  MF+ +P + ++FA      Y  HGLIL 
Sbjct  1572  FSNQPPSLQHFSFVCICGAFHWIPFTVIAYATMFSEVPSNPITFAITFTIAYLLHGLILI  1631

Query  4888  ---SVFTFMLNHFVSRKGDTDKMTREK-WILHRMNVACHIRFAKLLSGTELFCVYLHWMG  5055
                +VFT +L H         K T+ K W+  R+N++CH+R AKLLSGTE FCVYL  +G
Sbjct  1632  ALTAVFTRLLIH-------NQKQTKFKTWLQCRLNISCHLRCAKLLSGTEAFCVYLRLLG  1684

Query  5056  AKIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGS  5235
             AKIG+HCSIRAINPV  P L+S+  GVHLGDFS+I+ G+H++ GY SG+I++++NSV GS
Sbjct  1685  AKIGKHCSIRAINPVSNPELMSIGAGVHLGDFSKIITGFHSSNGYTSGKIEVQDNSVTGS  1744

Query  5236  QGLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSEN  5352
             Q LILPGS I+K+VILGALS+AP+NS L+  G ++GS++
Sbjct  1745  QSLILPGSLIQKNVILGALSLAPMNSTLQEGGLYIGSQS  1783


 Score =   248 bits (632),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 118/230 (51%), Positives = 159/230 (69%), Gaps = 5/230 (2%)
 Frame = +1

Query  6475  LAAKLENKDMPKAT--LARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEM  6648
             LA  L  +D  K T  L R+WY T   +  QPFLQ  LP+FLL + IYAPLN +F+    
Sbjct  1788  LATTLHKQDSQKVTFTLTRKWYQTFSSLFIQPFLQTALPHFLLAISIYAPLNLIFHLKNT  1847

Query  6649  TQIQKQWLLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTV  6828
              ++   WL PL+W  SG+LA L+C ++KWV++G+  KG+  PIWS+ I  D+ WQAIRT+
Sbjct  1848  QKVPIFWLFPLFWILSGVLAALLCVIAKWVIIGRNKKGEKVPIWSKRIIFDSTWQAIRTL  1907

Query  6829  TGEYFMETATGTFLMGIWMRLMGSEVARDGVYIDSMGATLNPDMVRIEEYGSVGREALLF  7008
              G+YFME   G+F+   WM++MG +V  D VY+DSMGA LNP+MV+IE+ G V ++AL F
Sbjct  1908  IGDYFMEMTCGSFMFVTWMKMMGVDVNND-VYVDSMGALLNPEMVKIEKGGCVEKDALFF  1966

Query  7009  GHIYEG--GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             GH+YEG  GG VK+G I V   GFVGSRA+ MPG  +++  ++GALSLAM
Sbjct  1967  GHLYEGDEGGLVKFGEIKVGENGFVGSRAMVMPGVMLENEANVGALSLAM  2016



>gb|EEC77462.1| hypothetical protein OsI_16281 [Oryza sativa Indica Group]
Length=2414

 Score =  1481 bits (3834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 726/1222 (59%), Positives = 927/1222 (76%), Gaps = 31/1222 (3%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+    +DD F KLHP +P  TRIGIVGAGPSGLSAAYAL KLGY NV + EK H+  GM
Sbjct  1     MDPKRSIDDQFSKLHPSLPVDTRIGIVGAGPSGLSAAYALAKLGYRNVTLFEKCHTVSGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRV  660
             CESIDI+GR YDLGGQV+AANSAP I HLA+E+G++ EEMDTHKL+L+DS      D+ V
Sbjct  61    CESIDIEGRIYDLGGQVIAANSAPVITHLAEELGSDFEEMDTHKLSLIDSQTGNIRDLEV  120

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             AEDY+S++ +TLKLQDE   + R G++++S +ASD T EFLK  G+ S+PKSVAYGYTAS
Sbjct  121   AEDYVSMVSLTLKLQDEANKSGRAGLHALSGLASDPTHEFLKQNGINSMPKSVAYGYTAS  180

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF+QDMPYA+I EF RTSMAGKIRRFK GY S+W++LS+++P +  C+T+VL++KRNS
Sbjct  181   GYGFVQDMPYAFIQEFTRTSMAGKIRRFKHGYMSMWERLSKSLPFEVFCDTQVLNVKRNS  240

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
              G  V +++ NG  Q +EFDKII+SGA  F N +TYRS S        + ++++ LE++L
Sbjct  241   CGANVTIKNNNGEKQVLEFDKIILSGAVAFKNSKTYRSSSLTDGE--SEVVELNNLEREL  298

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             FSKVQTI+YYT+V++I+G EH+P GFYYFE FMEDP  IG+PVAMQ+F+ DTN+FLFWSY
Sbjct  299   FSKVQTIDYYTTVVKINGFEHIPKGFYYFEEFMEDPTTIGHPVAMQRFFADTNIFLFWSY  358

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GNS DI GS V +     V  MGG V+KVILQR FKYFPHV+ +DMKDGFYE+LE+QLQG
Sbjct  359   GNSADIKGSFVAKCVTDVVSSMGGNVQKVILQRRFKYFPHVSSKDMKDGFYERLESQLQG  418

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
               NTYYVGGL+AFELTERNASYS+  + KHFA D      PYVKRLFPL  +      + 
Sbjct  419   FQNTYYVGGLLAFELTERNASYSIMAVCKHFAIDGEGELTPYVKRLFPLSHNRNPSPPRD  478

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             L E+ GV+FP+L SLD YL++WGT  VTE   +YTW+NE+G +++RRTY+E+H NA  IA
Sbjct  479   LGELEGVEFPDLPSLDGYLQYWGTHKVTEKNVIYTWINEEGKLMNRRTYQELHGNASYIA  538

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
             QKLLTS KP IKPGD+VLLI++PGL+F+DAFFGC+RA VIP+P +PPDP Q  GGQALL 
Sbjct  539   QKLLTSTKPVIKPGDRVLLIHLPGLEFIDAFFGCIRAGVIPVPVLPPDPMQ-SGGQALLK  597

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSWVkkp  2277
             + NI+K+CN VAILST SYH  VR    KN++   K   K S  WPD+PW+HTDSW+K  
Sbjct  598   VENISKMCNAVAILSTSSYHAAVRAGYIKNIVTLAKRVQKCSAQWPDIPWIHTDSWIKNY  657

Query  2278  klfkkpkDEQ----GQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTS  2445
             +      +       +P   DLCFLQFTSGST D KGVMITH G+IHNVK M+KRY+STS
Sbjct  658   RRSSDSFNSDTVLFTKPQPSDLCFLQFTSGSTGDAKGVMITHEGLIHNVKTMKKRYRSTS  717

Query  2446  RTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAP  2625
             +T+LVSWLPQYHDMGLIGGL T LVSGG+ +LFSP+TF++NPLLWLQT++ +  THSA P
Sbjct  718   KTVLVSWLPQYHDMGLIGGLFTALVSGGTSVLFSPMTFIRNPLLWLQTINDYHGTHSAGP  777

Query  2626  NFAFELLVRRLESSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGY  2805
             NFAFEL++RRLE+ K + +DLSSM FLM AAEP+RQ T++RF+ELTQ FGLS  V+APGY
Sbjct  778   NFAFELVIRRLEAEKNKVYDLSSMVFLMIAAEPVRQKTVRRFIELTQPFGLSEGVLAPGY  837

Query  2806  GLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEG  2985
             GLAENCV+V+CA+GE  PVF+DWQGRVCCGY++Q +TD + I+I+ P++  E+ + G EG
Sbjct  838   GLAENCVYVTCAFGECKPVFIDWQGRVCCGYVEQDDTDTL-IRIVDPDSLTEHQEDGVEG  896

Query  2986  EIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLI  3165
             EIWISS S+G+GYWG  E+SQ+TF N + + P K++ RTGDLGR ID  LFITGR KDLI
Sbjct  897   EIWISSPSSGVGYWGNSEMSQRTFFNQLKNHPNKKFTRTGDLGRTIDGNLFITGRIKDLI  956

Query  3166  IVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEV  3345
             IVAG+NIY++D+EKTVESSSE++RPGCCAVVGIPE+VL  KGI    +SD++GLVVIAEV
Sbjct  957   IVAGRNIYSADVEKTVESSSEVLRPGCCAVVGIPEEVLAQKGISIPDSSDQVGLVVIAEV  1016

Query  3346  RDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLD  3525
             R+GK +  +V+++I  RV EEHGV +AS+  IKPR+I KTTSGKI+R+EC ++F+  TL 
Sbjct  1017  REGKAVSEEVVNNIKARVVEEHGVAVASVKLIKPRTICKTTSGKIRRFECMRQFVDNTLS  1076

Query  3526  VIEEQ-----------------MNGERSLPRNDGIIV----PANGKISKTDIVNFLKDLL  3642
             + +                   M  +RSL R    +     P +   +  +I  FL  ++
Sbjct  1077  LAKGNHVSKKKGLFRSLTTGTGMESKRSLLRQTVDLTISHWPKSQVKNSNEITEFLTQIV  1136

Query  3643  SQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFV  3822
             S+ TGI   KIS  ++L SYG +SI VVRAAQK+S F G+ +GAIDIF+A+CI +LA F+
Sbjct  1137  SEHTGISKDKISLTDSLPSYGFDSIAVVRAAQKLSDFLGVPVGAIDIFTASCISELASFL  1196

Query  3823  ESLLEKNHPMLTNSSETKISSS  3888
             E+L+ K+ P L    ++K+ +S
Sbjct  1197  ENLVHKSQPQLAPWPKSKVKNS  1218


 Score =  1265 bits (3273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 644/1204 (53%), Positives = 831/1204 (69%), Gaps = 24/1204 (2%)
 Frame = +1

Query  3586  PANGKISKTDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGIN  3765
             P +   +  +I+ FL  ++S QTGIP  KIS   +L SYG +SI VV+AAQK+S F G+ 
Sbjct  1211  PKSKVKNSKEIIEFLTKIVSDQTGIPKDKISPTNSLPSYGFDSIAVVQAAQKLSDFLGVP  1270

Query  3766  IGAIDIFSATCIDDLADFVESLLEKNHPMLTNSS----ETKISSSGIPSVVSTFDKITIW  3933
             +GAIDIF+A CI +LA F+E+L  K+   L   +    E +     + ++   F  +   
Sbjct  1271  VGAIDIFTAGCISELATFLENLAHKSQSQLAPGASCYIEDETQVDPMDAISPEFSVLGTG  1330

Query  3934  LIHLVALAYVSLLLIIPAYIS----VSMFKPLILANQSPWFFYFISLACAPFSWMLCIFL  4101
             ++ L+AL YV  +L++PAY++    +S+F  + L       +    +  AP  W+  I L
Sbjct  1331  ILQLLALTYVCFVLLLPAYLASSTYMSIFSTVSLVRSPLLSYLSSLV-MAPIVWIFYISL  1389

Query  4102  TCICTRLLGNALLQPNYVLNPEISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYW  4281
             T +   +LG + LQPNYVL P++S+WSV+FVKWWAL KAQ +++K+LAVHL+GT+FLNYW
Sbjct  1390  TSLSLSILGKSFLQPNYVLIPDVSIWSVDFVKWWALNKAQALAAKMLAVHLKGTIFLNYW  1449

Query  4282  FKILGAKIASSALIDTVDITDPLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRS  4461
             FK+ GA+I SS +IDTVDITDP L+++ + +V++EGAL+Q HEV N VLSF  + IG  +
Sbjct  1450  FKMQGARIGSSVVIDTVDITDPSLLTVADGAVLAEGALVQGHEVCNEVLSFRPIWIGCEA  1509

Query  4462  SIGPYAVLQKGSIVGDGAEVLAQNKKAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQL  4641
             SIGPYAVLQKG++V DGA V    K  A K ++       + +  I+K     +  +  L
Sbjct  1510  SIGPYAVLQKGTVVEDGAVVPPLQKTGAGKSTR----RTSRTSVSIKKEAAKANMILEHL  1565

Query  4642  FGIYMIGYLNSLSAAIAYLVWIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSL  4821
               IY +G L +LS AI Y ++  L  K  S  HF F CIAGAFHW P  I  +  +    
Sbjct  1566  VSIYAVGILGALSGAIVYTLYTHLSGKAASPLHFSFACIAGAFHWLPAAITAYAVIVQET  1625

Query  4822  PVSTLSFAGMVAAGYTAHGLILSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRF  5001
             P S LSFA   A    ++G+ILS+ T + +  ++ K  T +      I  R+ ++ H+RF
Sbjct  1626  PTSALSFALFTAFADLSYGVILSILTSITSRALAAKPGTKQNGIASLIHRRITISAHVRF  1685

Query  5002  AKLLSGTELFCVYLHWMGAKIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTT  5181
             AK+LSGTE FCVYL  +GAKIG+HCSIRAINPV  P L+SV DGVHLGDF  IVPG+++ 
Sbjct  1686  AKMLSGTEAFCVYLRLLGAKIGRHCSIRAINPVANPELISVGDGVHLGDFCNIVPGFYSK  1745

Query  5182  GGYISGRIDIRENSVIGSQGLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVM  5361
             GG+ S  I ++EN+V+GS  L+LPG  ++++VILGALSVAP N+VL   G +VGS++  M
Sbjct  1746  GGFTSAEIKVQENTVVGSGSLLLPGCVLQENVILGALSVAPENAVLRRGGVYVGSQSPAM  1805

Query  5362  VRNQTLPLDDRIEEMDPKYKKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLP  5541
             V+N  L  D+RIEEMD  YKK++G+LAANLA +T+ +KSRYFHRIG +G+G LR+Y  +P
Sbjct  1806  VKNTLLDEDERIEEMDQAYKKIVGNLAANLAITTMNVKSRYFHRIGVSGRGVLRMYEEIP  1865

Query  5542  GLPDHKIFGPGATYPVIIRHSNCLSSDDDARLDPRGAAIRILPHERtttttttplldltl  5721
               P HKIF  G ++PVI+RHSN LS+DDDARLD RGAA+RIL           PLLDLTL
Sbjct  1866  SFPRHKIFASGKSFPVIVRHSNSLSADDDARLDARGAAVRILSDN----DGEAPLLDLTL  1921

Query  5722  ktGKAFHARTIGDFATWLVCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICR  5901
             K+GKAF+ARTI DFATWLVCG  AREE VK +PHIRDA+WGSLR  +SYT LHYYSNICR
Sbjct  1922  KSGKAFYARTIADFATWLVCGLPAREEQVKRSPHIRDAVWGSLRSTDSYTVLHYYSNICR  1981

Query  5902  LFRFKDGQEMYVRFKLRPFDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDF  6081
             L RF DG+EMY +FKLRP D  + E+ G+V PRGILPPETGAIPRDE+D RPLLFLA+DF
Sbjct  1982  LLRFDDGREMYAKFKLRPADPDVPEDSGKVVPRGILPPETGAIPRDEDDTRPLLFLADDF  2041

Query  6082  KFRVSSPDKVRYVLQLQIQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEK  6261
             + RV SPD VRYV QLQ++ +P D   R+  LDCT+PWDE E PYI+VGE++I   L  +
Sbjct  2042  RRRVGSPDGVRYVFQLQLREVPTDAAARDVALDCTRPWDEAEFPYIDVGEVSIGCNLPTE  2101

Query  6262  ESEELEFNPFFRCNEIDVIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQ  6441
             E+E+LEFNPF RC E+DVI ATSC QSASIDHGRSLVYEICQ LRN +PLP +WR FL+Q
Sbjct  2102  ETEKLEFNPFLRCPEVDVIPATSCAQSASIDHGRSLVYEICQRLRNGEPLPASWRAFLEQ  2161

Query  6442  SDVKLDLSGCPLAA-----KLENKDMPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLV  6606
             SD K+DLSGCP+AA     +    D  K TLAR WY  LW    QP LQ ++PY +LGLV
Sbjct  2162  SDTKIDLSGCPVAAAATPTRSNAGDATKVTLARTWYQALWATLCQPLLQTLVPYSVLGLV  2221

Query  6607  IYAPLNCLFYTHEMTQIQKQWLLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSR  6786
             I+ PL  L      T+    WLLP +W  SG+ A   CA +KW LVG +  G T  IWS 
Sbjct  2222  IFLPLRGLLAVAAATRFPLYWLLPAFWAASGVAAMATCAAAKWALVGSRVDGDTVHIWSP  2281

Query  6787  GIFMDTIWQAIRTVTGEYFMETATGTFLMGIWMRLMGSEVAR-DGVYIDSMGATLNPDMV  6963
              +F+DT+WQA+R  T EYF E   G+     WMR+MG+ V+  DGVY+DSMGA LNP+MV
Sbjct  2282  AVFLDTVWQAVRAATAEYFAELTPGSAPFAAWMRVMGASVSPGDGVYVDSMGALLNPEMV  2341

Query  6964  RIEEYGSVGREALLFGHIYEG-GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGAL  7140
             R+E   +VGR+ALLFGH+YEG  G+VK+G +SV   GFVGSRAVAMP  T+D GG L AL
Sbjct  2342  RLERGAAVGRDALLFGHVYEGEAGKVKFGAVSVGEDGFVGSRAVAMPSVTVDDGGCLAAL  2401

Query  7141  SLAM  7152
              LAM
Sbjct  2402  GLAM  2405



>gb|EPS72678.1| hypothetical protein M569_02079, partial [Genlisea aurea]
Length=1238

 Score =  1481 bits (3833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 751/1247 (60%), Positives = 932/1247 (75%), Gaps = 31/1247 (2%)
 Frame = +1

Query  3463  TTSGKIKRYECAKRFISGTLDVIEEQMNGE---RSLPRNDGIIVPANGKISKTDIVNFLK  3633
             TTSGKIKRY+C KRF  G+LD I+ +       + +  +  I    +  I+KTDI  FLK
Sbjct  1     TTSGKIKRYDCLKRFADGSLDTIDTKNTASIQVKDIATDVRIDPGKDSIITKTDIKIFLK  60

Query  3634  DLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLA  3813
             +LLS+ TG+ ++KI TGE+L+SYGV+SIGVVRAA K+S F  + IGAIDIF+ATCI++LA
Sbjct  61    ELLSEMTGVSIAKICTGESLLSYGVDSIGVVRAAHKLSEFLKVPIGAIDIFTATCIEELA  120

Query  3814  DFVESLLEKNH-----PMLTNSSETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLI  3978
             DF    L K+       +  N ++ K +++  P    +  K+ IWL+ LVA+ YV  +L+
Sbjct  121   DFAYDQLNKSGLHSCGDVPINKAKQKKTTTVEPC---STQKLQIWLLQLVAVGYVCFMLV  177

Query  3979  IPAYISVSMFKPLILANQSPWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVL  4158
             +PAYIS S FK  I      +  Y + L  AP SWMLCI  TC+C  +LG   LQPNY L
Sbjct  178   LPAYISNSFFKSWI-CKGGDFLDYVMVLLLAPLSWMLCISSTCVCIAILGTPFLQPNYAL  236

Query  4159  NPEISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDI  4338
             NPE+S+W+VEFVKWWAL K QEI+SK LA+HLRGT+FLN WFKILGAKI++++LIDTVDI
Sbjct  237   NPEVSIWTVEFVKWWALSKVQEIASKNLAIHLRGTIFLNLWFKILGAKISTTSLIDTVDI  296

Query  4339  TDPLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAE  4518
             TDP LVSI E +V++EGA++QSH VKNG+LSFS ++IG R SIGPYA LQ G++V D  E
Sbjct  297   TDPSLVSIGENTVVAEGAMLQSHGVKNGILSFSAIKIGNRCSIGPYASLQSGTVVDDEDE  356

Query  4519  VLAQNKKAAAKISKPLNGHKGKVTRRIRKRNHGNHN--SVFQLFGIYMIGYLNSLSAAIA  4692
             V +     A + S            ++R+ N+  H+   +  LFGI+  G + SLSAAI 
Sbjct  357   VHSLTSSNAQRKSH-------SQMEKVRRHNNTPHHYAPIAHLFGIWATGCMGSLSAAIV  409

Query  4693  YLVWIWLLQKP-PSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYT  4869
             Y+++IWL  K  P++  F F C  GA+HW PY ++ + A+  S+P ++++FA  VA GYT
Sbjct  410   YILYIWLFHKQQPAIQEFAFACAFGAYHWLPYAVVAYLAILDSIPSNSVNFAIHVAIGYT  469

Query  4870  AHGLILSVFTFMLNHFVSRKGDTDKMTRE---KWILHRMNVACHIRFAKLLSGTELFCVY  5040
             A+G+IL + T  L + VS +G   K        W L R+ VA H RFAK LSGTE F  Y
Sbjct  470   AYGVILGLLTGSLRYCVSTRGVVRKSKLSLLLSWFLRRIVVASHTRFAKFLSGTEAFSWY  529

Query  5041  LHWMGAKIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIREN  5220
             L +MGAKIG+HCSIRAIN V +P L+S+ DGVHLGDFSRIVPGY++  GYISG + + EN
Sbjct  530   LGFMGAKIGKHCSIRAINAVSDPELLSIGDGVHLGDFSRIVPGYYSLDGYISGEVRVHEN  589

Query  5221  SVIGSQGLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTL-PLDDRI  5397
             SVIGSQGLILPGS +EKDVILGALSVAP N+VL+  G FVG+   VMV N      D+RI
Sbjct  590   SVIGSQGLILPGSVLEKDVILGALSVAPENTVLQRGGVFVGAPKAVMVNNGNFREFDERI  649

Query  5398  EEMDPKYKKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGPGA  5577
              EMD +YKKVLG+LAAN A STLK+ SRYFHRIGA+G+G+LRLYN LP LPDH IF P  
Sbjct  650   GEMDTQYKKVLGNLAANFAGSTLKVNSRYFHRIGASGRGTLRLYNKLPQLPDHDIFSPDK  709

Query  5578  TYPVIIRHSNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIG  5757
             +YP+I+RHSNCLSSDDDARLDPRGAAIRIL          + LLDLTLKTG AFH RTIG
Sbjct  710   SYPIIMRHSNCLSSDDDARLDPRGAAIRILSD---GGDVKSSLLDLTLKTGNAFHTRTIG  766

Query  5758  DFATWLVCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEMYV  5937
             DFA WLVCG AAREE+VKHAPHIRDAMWGSLR+ +SYTELHYYSNI RLFRFKDG+EMY 
Sbjct  767   DFAAWLVCGTAAREEYVKHAPHIRDAMWGSLRKLDSYTELHYYSNISRLFRFKDGKEMYA  826

Query  5938  RFKLRPFDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRY  6117
             +FKLRP DEK GE+ G+VEP G+LPPETG +PRDE+D+RP LFLA+DF+ RV SPD+VRY
Sbjct  827   KFKLRPCDEKFGEDTGKVEPTGVLPPETGTVPRDESDERPKLFLADDFQKRVLSPDRVRY  886

Query  6118  VLQLQIQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFR  6297
             VLQLQI+PIP DE  RE +LDCTKPWDE E P+ ++GEI IDQ+LTE+ESE LEFNPF R
Sbjct  887   VLQLQIRPIPSDEAKREVILDCTKPWDESEFPHFDIGEIVIDQLLTEEESESLEFNPFLR  946

Query  6298  CNEIDVIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGCPL  6477
             C+E+DVIRATSCNQSAS+DHGRS+VYEICQ+LRN+KPLPE+W+ FL+QSDVK++LSGCP+
Sbjct  947   CHEVDVIRATSCNQSASLDHGRSVVYEICQHLRNKKPLPESWKRFLEQSDVKVNLSGCPM  1006

Query  6478  AAKLENKDMPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQI  6657
             AA++E     + TL R W+VTLWLMS QP LQI LPYFL  LVIY P+    + ++   +
Sbjct  1007  AARIETNTTKEVTLTRPWHVTLWLMSLQPLLQIFLPYFLCSLVIYFPMKFTSHMNQSRDL  1066

Query  6658  QKQWLLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTVTGE  6837
             Q   LLP +W  SGIL G++CA+SKW+LVGKK  GK E IWS   FMDT WQAIRT+  +
Sbjct  1067  QLHTLLPFFWLSSGILFGILCAVSKWILVGKKRAGKFEAIWSVSTFMDTTWQAIRTLADD  1126

Query  6838  YFMETATGTFLMGIWMRLMGSEVARD-GVYIDSMGATLNPDMVRIEEYGSVGREALLFGH  7014
             YF+    G+ +  +WM+LMGS +A D GVYIDS GA LNP++V IE+YGS+GREALLFGH
Sbjct  1127  YFLGMCGGSVIFNLWMKLMGSSLAWDKGVYIDSQGAALNPELVEIEDYGSIGREALLFGH  1186

Query  7015  IYEG-GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             IYEG GG VKYG++++K GG +GSRA+AMPGAT+  GGSLGALSLAM
Sbjct  1187  IYEGEGGRVKYGKVTIKKGGSMGSRAMAMPGATVGVGGSLGALSLAM  1233



>ref|XP_004974067.1| PREDICTED: uncharacterized protein LOC101754518 [Setaria italica]
Length=2402

 Score =  1461 bits (3781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 721/1224 (59%), Positives = 921/1224 (75%), Gaps = 42/1224 (3%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M  G  +DD F KLHP +P  TRIGIVGAGPSGLS AYAL KLGY NV V EK  +  GM
Sbjct  1     MYQGKSIDDKFSKLHPSLPVDTRIGIVGAGPSGLSTAYALAKLGYRNVTVFEKCQNVSGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRV  660
             CESIDI+GRTYDLGGQV+AANSAP I HLAKE+G+E EEMD+HKLAL+DS      D+ V
Sbjct  61    CESIDIEGRTYDLGGQVIAANSAPVITHLAKELGSEFEEMDSHKLALIDSQTGNIRDLEV  120

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             AEDY+S+        DE   + R+G+++VS +ASD T EFLK  GL SVPKSVAYGYTAS
Sbjct  121   AEDYVSM--------DEANRSGRVGIHAVSGLASDPTLEFLKKHGLNSVPKSVAYGYTAS  172

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF+QDMPYA+I EF RTSMAGKIRRFK GY S+W+KLS+++P +  C TEVL +KR+S
Sbjct  173   GYGFVQDMPYAFIQEFTRTSMAGKIRRFKHGYMSLWEKLSKSLPFEVLCGTEVLRVKRDS  232

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
              G  V ++  N  ++  EFDKII+SGA  F N +TYRS S        + ++++  E++L
Sbjct  233   CGASVLIKKNNDEIEVREFDKIILSGAIAFKNCKTYRSSSLTDGE--NEVVELNDFEREL  290

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             FSKVQTI+YYT+V++I+G E++P GFYYF  +MEDP  +G+PVAMQ+F+ DT++FLFWSY
Sbjct  291   FSKVQTIDYYTTVVKIEGFENMPKGFYYFGEYMEDPTTLGHPVAMQRFFADTDIFLFWSY  350

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GNS DI GS V +     VI MGG V+KV+LQR FKYFPHV+ +DMK+GFYE++E++LQG
Sbjct  351   GNSADIKGSYVAKCVTDVVISMGGTVQKVLLQRRFKYFPHVSSEDMKNGFYERVESELQG  410

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
               NTYYVGGL+AFELTERNA YS++ + KHFA D  +PT PYVKRLFPL   +     + 
Sbjct  411   FQNTYYVGGLLAFELTERNALYSISTVCKHFAIDSDLPTIPYVKRLFPLSIRNPSPP-RD  469

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             + E+ GV+FP+L SLD YL +WGT  VT  K +YTW+NE+G +++RRTY+E+H NA  IA
Sbjct  470   IGELEGVEFPDLPSLDGYLEYWGTHKVTAKKVIYTWINEEGKIVNRRTYQELHDNASHIA  529

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
              +LLTS KP IKPGD+VLLI++PGL+FVDAFFGC+RA VIP+P +PPDP QRGG QALL 
Sbjct  530   YRLLTSTKPIIKPGDRVLLIHLPGLEFVDAFFGCIRAGVIPVPVLPPDPMQRGG-QALLK  588

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSWVkkp  2277
             + NI+K CN VAILST SYH  VR    KN++   KS  K S  WPDLPW+HTDSW+K  
Sbjct  589   VENISKACNAVAILSTSSYHAAVRAGYVKNIVTLAKSAQKCSAQWPDLPWIHTDSWIKNY  648

Query  2278  klfkkpkDEQG------QPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKS  2439
             +      + +       +P   +LCFLQFTSGST D KGVMITHGG+IHNVK+M+KRY+S
Sbjct  649   RRSPDSYNSESAESMITKPQPSELCFLQFTSGSTGDAKGVMITHGGLIHNVKMMKKRYRS  708

Query  2440  TSRTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSA  2619
             TS+T+L+SWLPQYHDMGLIGGL T LVSGG+ ILFSP+TF++NPLLWLQT++ +  THSA
Sbjct  709   TSKTVLISWLPQYHDMGLIGGLFTALVSGGTSILFSPMTFIRNPLLWLQTINDYHGTHSA  768

Query  2620  APNFAFELLVRRLESSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAP  2799
              PNFAFEL++RRLE+ K + +DLSSM F+M AAEP+RQ T+KRF+ELTQ FG S  V+AP
Sbjct  769   GPNFAFELVIRRLEAEKNKIYDLSSMIFIMIAAEPVRQKTIKRFIELTQPFGFSEGVLAP  828

Query  2800  GYGLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGK  2979
             GYGLAENCV+VSCA+GEG P+F+DWQGRVCCGY+  P+   + IKI+  ++  E+++ G 
Sbjct  829   GYGLAENCVYVSCAFGEGKPIFIDWQGRVCCGYV-DPDDPDITIKIVDADSLTEHEEDGA  887

Query  2980  EGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKD  3159
             EGEIWISS S+G+GYW  +E+SQKTF N + + P K + RTGDLGRII+ KLFITGR KD
Sbjct  888   EGEIWISSPSSGVGYWSNKEISQKTFCNQLKNYPSKNFTRTGDLGRIINGKLFITGRIKD  947

Query  3160  LIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIA  3339
             LIIVAG+NIY++D+EKTVE SS+++RPGCCAVVG+PE+VL  KGI    +SD++GLVVIA
Sbjct  948   LIIVAGRNIYSADVEKTVEGSSDVLRPGCCAVVGVPEEVLTQKGISIPDSSDQVGLVVIA  1007

Query  3340  EVRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGT  3519
             EVR+GK +  ++ D+I TRVAEEHGV IAS+  IKPR++SKTTSGKI+R+EC K+F+  T
Sbjct  1008  EVREGKAVSEEIADNIKTRVAEEHGVTIASVKLIKPRTLSKTTSGKIRRFECMKQFVDNT  1067

Query  3520  LDVIE-EQMNGERSLPRN------------------DGIIVPANGKISKT--DIVNFLKD  3636
             L +     ++ ++SL R+                  D +++P   +  K   +I+ FL  
Sbjct  1068  LSLANSNHISKKKSLFRSLTTGTGMEIRRSSLKQTVDPLVLPQPRRKVKNLMEIIEFLTQ  1127

Query  3637  LLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLAD  3816
             L+S Q GIP  KIS   +L SYG +SI VVRAAQK+S F G  +GAIDIF+A+CI +LA+
Sbjct  1128  LVSDQAGIPKEKISPTNSLPSYGFDSIAVVRAAQKLSDFLGTPVGAIDIFTASCISELAN  1187

Query  3817  FVESLLEKNHPMLTNSSETKISSS  3888
             F+E+L+ K+ P L      K+ +S
Sbjct  1188  FLENLVHKSQPQLAPQPRGKVKTS  1211


 Score =  1271 bits (3289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 644/1204 (53%), Positives = 843/1204 (70%), Gaps = 34/1204 (3%)
 Frame = +1

Query  3595  GKI-SKTDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIG  3771
             GK+ +  +I+ FLK ++S +TGIP  KIS  ++L SYG +SI VVR AQK+S F GI +G
Sbjct  1206  GKVKTSKEIIEFLKQIVSDKTGIPKDKISPTDSLPSYGFDSITVVRTAQKLSDFLGIPVG  1265

Query  3772  AIDIFSATCIDDLADFVESLLEKNHPMLTNSSETKISSSGIPSVVSTFDKIT-------I  3930
             AIDIF+A+CI +LA F+E+L+ K+ P +    E  +S S     + T D  T       I
Sbjct  1266  AIDIFTASCIAELASFLENLVHKSQPQM----EPDVSCSAEDENLETIDASTSDLSVFAI  1321

Query  3931  WLIHLVALAYVSLLLIIPAYISVSMFKP---LILANQSPWFFYFISLACAPFSWMLCIFL  4101
               + ++AL YV  +L++PAY + SM+     L+   +     Y  SL  AP +W+     
Sbjct  1322  GTLQILALTYVCFILLLPAYFASSMYMAMLSLVSMVKLSLLTYLSSLVLAPIAWICYALF  1381

Query  4102  TCICTRLLGNALLQPNYVLNPEISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYW  4281
             T +   +LG + LQPNYVL P +S+WSV+FVKWWAL KAQ +++K+LAVHL+GT+FLNYW
Sbjct  1382  TSLSLSILGKSFLQPNYVLTPGVSIWSVDFVKWWALNKAQSLAAKMLAVHLKGTIFLNYW  1441

Query  4282  FKILGAKIASSALIDTVDITDPLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRS  4461
             FK+ GA+I SS +IDTVDITDP L+++ + +V++EG LI  HEV+N VLSF  V+IG+ +
Sbjct  1442  FKMQGARIGSSVVIDTVDITDPSLLAVADGAVVAEGVLILGHEVRNEVLSFRHVKIGQNA  1501

Query  4462  SIGPYAVLQKGSIVGDGAEVLAQNKKAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQL  4641
             SIGPYAVLQKG++V +GA V   +K    K +   +     +   +R  N     ++  L
Sbjct  1502  SIGPYAVLQKGTVVHNGAVVPPLHKTEQGKSAYLASKTSAYMKEEVRTANM----ALEHL  1557

Query  4642  FGIYMIGYLNSLSAAIAYLVWIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSL  4821
               IY IG+L +LS+A  ++++        SL HF F CIAGAFHW P +I  +  +    
Sbjct  1558  VSIYAIGFLGALSSATVFMLYNHFSGATVSLQHFSFACIAGAFHWLPAVIAAYAVIVRET  1617

Query  4822  PVSTLSFAGMVAAGYTAHGLILSVFTFMLNH-FVSRKGDTDKMTREKWILHRMNVACHIR  4998
               S +SFA + A  Y ++G+ILS+ T + N    +R G    M     I  R+ +A H+R
Sbjct  1618  TTSPVSFALLTAFAYLSYGIILSLLTSITNKALATRSGAKKDMA--SLIQRRITIAAHLR  1675

Query  4999  FAKLLSGTELFCVYLHWMGAKIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHT  5178
             FAK+LSGTE FC+YL  +GAKIG+HCSIRAINPV  P L+S+ DGVHLGDF  IVPG+++
Sbjct  1676  FAKMLSGTEAFCMYLRLLGAKIGRHCSIRAINPVANPELISIGDGVHLGDFCNIVPGFYS  1735

Query  5179  TGGYISGRIDIRENSVIGSQGLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLV  5358
              G + S  I +++N+V+GS  L+LPGS ++++VILGA+SVAP  SVL+  G +VG+++L 
Sbjct  1736  KG-FTSAEIKVQDNTVVGSGSLLLPGSVLQENVILGAVSVAPQGSVLQRGGVYVGAQSLT  1794

Query  5359  MVRNQTLPLDDRIEEMDPKYKKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVL  5538
             +V+N     D+RIEEMDP YKK++G+LAANLA +T+ +KSRYFHRIG +G+G L++Y  +
Sbjct  1795  LVKNTLHTEDERIEEMDPLYKKIVGNLAANLAITTMNVKSRYFHRIGVSGRGVLKMYQDI  1854

Query  5539  PGLPDHKIFGPGATYPVIIRHSNCLSSDDDARLDPRGAAIRILPHERtttttttplldlt  5718
             P LP HKIFG G ++PVI+RHSN LS+DDDARLD RGAA+RIL  +        PLLDLT
Sbjct  1855  PSLPKHKIFGAGKSFPVIVRHSNSLSADDDARLDARGAAVRILTDD-----GEVPLLDLT  1909

Query  5719  lktGKAFHARTIGDFATWLVCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNIC  5898
             LK+GKAF+ARTI DF TWLVCG AAREE VK APHIRDA+WGSLR  +SYT LHYYSNIC
Sbjct  1910  LKSGKAFYARTIADFTTWLVCGLAAREEQVKQAPHIRDAVWGSLRNTDSYTVLHYYSNIC  1969

Query  5899  RLFRFKDGQEMYVRFKLRPFDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAED  6078
             RL RF+DG+EMY +FKLRP D+ + E+ G+V PRGILPPETGAIPR E+D RPLLFLA+D
Sbjct  1970  RLLRFEDGKEMYAKFKLRPVDKDVSEDSGQVVPRGILPPETGAIPRAEDDTRPLLFLADD  2029

Query  6079  FKFRVSSPDKVRYVLQLQIQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTE  6258
             F+ +V SPD VRYV QLQ++ +P D   R+  LDCT+PWDE E PYIEVGEI +   +  
Sbjct  2030  FRRKVGSPDGVRYVFQLQLRDVPADSAARDVALDCTRPWDEAEFPYIEVGEINLASNVPT  2089

Query  6259  KESEELEFNPFFRCNEIDVIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLD  6438
             +E+E+LEFNPF RC E+DVI ATSC QSASIDHGRSLVYEICQ LRN +PLP +WR FL+
Sbjct  2090  EETEKLEFNPFLRCPEVDVIPATSCTQSASIDHGRSLVYEICQRLRNGEPLPASWRAFLE  2149

Query  6439  QSDVKLDLSGCP-LAAKLENKDMP---KATLARQWYVTLWLMSGQPFLQIVLPYFLLGLV  6606
             QSD K+DLSGCP +AA   + ++    K TLAR WY  +W    QP LQ ++PYF +GLV
Sbjct  2150  QSDTKIDLSGCPVIAATRSSSNLSHGTKVTLARTWYQAVWATLCQPLLQTLVPYFTMGLV  2209

Query  6607  IYAPLNCLFYTHEMTQIQKQWLLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSR  6786
             I++PL  L      T     W LP++W  SG  A   CA +K  LVG++ +G T  IWS 
Sbjct  2210  IFSPLRALLAASTATGTPLYWTLPIFWVTSGAAAMAACAAAKGALVGRRAEGDTVHIWSP  2269

Query  6787  GIFMDTIWQAIRTVTGEYFMETATGTFLMGIWMRLMGSEV-ARDGVYIDSMGATLNPDMV  6963
              +F+DT+WQA+RT  GEYF E   G+    +WMR MG+ V A DGVY+DSMGA LNP+MV
Sbjct  2270  AVFLDTVWQAVRTAAGEYFAELTPGSVPFAVWMRAMGASVAAADGVYVDSMGALLNPEMV  2329

Query  6964  RIEEYGSVGREALLFGHIYEG-GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGAL  7140
             R+E   SVGR+ALLFGH+YEG GGEVK+G + +   GFVGSRAVAMPG  +D GG LGAL
Sbjct  2330  RLERGASVGRDALLFGHVYEGEGGEVKFGAVHIGEDGFVGSRAVAMPGVRVDDGGCLGAL  2389

Query  7141  SLAM  7152
              LAM
Sbjct  2390  GLAM  2393



>ref|XP_008669277.1| PREDICTED: uncharacterized protein LOC103646324 [Zea mays]
 ref|XP_008669278.1| PREDICTED: uncharacterized protein LOC103646324 [Zea mays]
 ref|XP_008669279.1| PREDICTED: uncharacterized protein LOC103646324 [Zea mays]
 ref|XP_008669280.1| PREDICTED: uncharacterized protein LOC103646324 [Zea mays]
Length=2412

 Score =  1452 bits (3758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 721/1226 (59%), Positives = 922/1226 (75%), Gaps = 38/1226 (3%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+ G  +DD F KLHP  P  TRIGIVGAGPSGLSAAYAL KLGY NV V E+ H+  GM
Sbjct  1     MDPGKSIDDKFSKLHPSFPVDTRIGIVGAGPSGLSAAYALAKLGYHNVTVFERCHNVSGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRV  660
             CESIDI+GRTYDLGGQV+AANSAP I HLAKE+G+E E+MDTHKLAL+DS      D+ V
Sbjct  61    CESIDIEGRTYDLGGQVIAANSAPVITHLAKELGSEFEDMDTHKLALIDSQTGNIRDLEV  120

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             AEDY+S++ +TLKLQDE   +  +G+++VS +ASD T +FL   G+ S+PKSV YGYTAS
Sbjct  121   AEDYVSMVSLTLKLQDEANRSGGVGIHAVSGLASDPTLDFLMQHGISSMPKSVVYGYTAS  180

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF+QDMPYA+IHEF RTSMAGKIRRFK GY S+W KLS+++P +  C TEVL +KRN+
Sbjct  181   GYGFVQDMPYAFIHEFTRTSMAGKIRRFKHGYMSLWDKLSQSLPFEVLCGTEVLRVKRNN  240

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
                 V +++ N  ++  EFDKII+SGA PF NG+TYRS S        + ++++ LE++L
Sbjct  241   CVASVIIKNNNDDVEVREFDKIILSGALPFKNGKTYRSLSMTDGE--NEVVELNDLEREL  298

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             FSKVQTI+YYT+V++I+G EH+P GF+YF  +MEDP  +G+PVAMQ+F+ DTN+FLFWSY
Sbjct  299   FSKVQTIDYYTTVVKIEGFEHIPKGFFYFGEYMEDPTTVGHPVAMQRFFADTNIFLFWSY  358

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GNS DI  S V +     V  MGG V++V+LQR FKYFPHV+ +DMK+GFYEK+E+QLQG
Sbjct  359   GNSADIKESYVAKCVTNVVTSMGGTVQRVLLQRRFKYFPHVSSEDMKNGFYEKVESQLQG  418

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAF--  1734
               NTY+VGGL+AFELTERNA YS++ + KHFA    +P  PYVKRLFPL   S+G+    
Sbjct  419   FQNTYFVGGLLAFELTERNAFYSISSVCKHFAIASELPKVPYVKRLFPL---SKGIPSPP  475

Query  1735  KQLDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFT  1914
             + + E+ GV+FP L SLD YL++WGT  VT  K +YTW+NE+G +++RRTY+E+H N   
Sbjct  476   RDIGELEGVEFPHLPSLDGYLQYWGTHRVTAEKFIYTWINEEGKIMNRRTYQELHDNVSY  535

Query  1915  IAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQAL  2094
             IA KLLTS KP IKPGD+VLLI++PGL+FVDAFFGC+RA VIP+P +PPDP QRGG QAL
Sbjct  536   IAYKLLTSTKPIIKPGDRVLLIHLPGLEFVDAFFGCIRAGVIPVPVLPPDPMQRGG-QAL  594

Query  2095  LHIANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSWVk  2271
             L + N++KVCN VAILST SYH  VR    KN++   KS  K S  WPDLPW+HTDSW+K
Sbjct  595   LKVENVSKVCNAVAILSTSSYHAAVRAGYIKNIVTLTKSAQKCSAQWPDLPWIHTDSWIK  654

Query  2272  kpklfkkpkDEQG------QPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRY  2433
               +      + +       +P   +LCFLQFTSGST D KGVMITHGG+IHNVK+M+KRY
Sbjct  655   NYRRSPGSFNSESVVPMITKPQPSELCFLQFTSGSTGDAKGVMITHGGLIHNVKMMKKRY  714

Query  2434  KSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATH  2613
             +STS+T+L+SWLPQYHDMGLIGGL T LVSGG+ ILFSP+TF++NPL+WL+T+S +  TH
Sbjct  715   RSTSKTVLISWLPQYHDMGLIGGLFTTLVSGGTSILFSPMTFIRNPLIWLKTISDYHGTH  774

Query  2614  SAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVM  2793
             SA PNFAFEL++RRLE+ K + +DLSSM FLM AAEP+RQ T+KRF+ELTQ  G S  V+
Sbjct  775   SAGPNFAFELVIRRLETEKNKMYDLSSMVFLMIAAEPVRQKTVKRFIELTQPLGFSEGVL  834

Query  2794  APGYGLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDP  2973
             APGYGLAENCV+VSCA+GE  P+F+DWQGR+CCGY+   +TD V I+I+ P+   E+ + 
Sbjct  835   APGYGLAENCVYVSCAFGECKPIFIDWQGRICCGYVDTNDTDVV-IRIVDPDYLTEHQED  893

Query  2974  GKEGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRT  3153
             G EGEIWISS S+G+GYW  +E SQ+TF N + + P  ++ RTGDLGRIID KLFITGR 
Sbjct  894   GAEGEIWISSSSSGVGYWNNKETSQRTFCNWLKNYPNIKFTRTGDLGRIIDGKLFITGRI  953

Query  3154  KDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVV  3333
             KDLIIVAG+NIY++D+EKTVE SS+++RPGCCAVVG+PEDVL  KGI    +SD++GLVV
Sbjct  954   KDLIIVAGRNIYSADVEKTVECSSDVLRPGCCAVVGVPEDVLTQKGISIPDSSDQVGLVV  1013

Query  3334  IAEVRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFIS  3513
             IAEVR+GK +  +++D I TRVAEEHGV IAS+  IKPR+ISKTTSGKI+R+EC K+F+ 
Sbjct  1014  IAEVREGKVISEEIVDSIRTRVAEEHGVTIASVKLIKPRTISKTTSGKIRRFECMKQFVD  1073

Query  3514  GTLDVIE-EQMNGERSLPRN------------------DGIIVPANGKISKT--DIVNFL  3630
              TL +    +++ ++SL R+                  D  I P      K   +I+ FL
Sbjct  1074  NTLSLASGSRISNKKSLFRSLTTGTGMDIRRPFLKHTVDPTIRPQPRSKVKNLMEIIEFL  1133

Query  3631  KDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDL  3810
               L+S Q GI   KIS  ++L SYG +SI VVRAAQK+S F G  +GAIDIF+A+ I +L
Sbjct  1134  MQLVSDQKGISKDKISPNDSLPSYGFDSIAVVRAAQKLSDFLGTPVGAIDIFTASSISEL  1193

Query  3811  ADFVESLLEKNHPMLTNSSETKISSS  3888
             A+ +E+L+ K+ P L     +K+  S
Sbjct  1194  ANSLENLVHKSQPQLAPQPRSKVKRS  1219


 Score =  1282 bits (3318),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 639/1196 (53%), Positives = 844/1196 (71%), Gaps = 27/1196 (2%)
 Frame = +1

Query  3610  TDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFS  3789
             +DI+ FL +++S Q G+P  KIS  ++L SYG +SI VVRAAQK+S F GI +GAIDIF+
Sbjct  1220  SDIIEFLTEIVSDQAGVPKDKISPTDSLPSYGFDSIAVVRAAQKLSDFLGIPVGAIDIFT  1279

Query  3790  ATCIDDLADFVESLLEKNHPMLTNSSETKISSSGIPSVVSTFDKITIW---LIHLVALAY  3960
             A+CI DLA F+E+L+ K+ P L            +    +T   ++++   ++ L+AL Y
Sbjct  1280  ASCIADLASFLENLVLKSQPQLKPDVSHSAEDENLVITDATDLDLSVFATGILQLLALTY  1339

Query  3961  VSLLLIIPAYISVSMFKPLILANQSPWFFYFISLAC---APFSWMLCIFLTCICTRLLGN  4131
             V  +L++PAY++ SM+K +I +           L+    AP +W+     T +    LG 
Sbjct  1340  VCFILLLPAYLASSMYKSMISSVSLVKSSLLSYLSSLVLAPVAWICYALFTSLSLSTLGK  1399

Query  4132  ALLQPNYVLNPEISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIAS  4311
               LQPNY+L P+IS+WSV+FVKWWAL KAQ +++K+LAVHL+GT+FLNYWFK+ GA+I S
Sbjct  1400  PFLQPNYILTPDISIWSVDFVKWWALNKAQSLAAKMLAVHLKGTIFLNYWFKMQGARIGS  1459

Query  4312  SALIDTVDITDPLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQK  4491
               +IDTVDITDP L+++ + +VI+EG LIQSHEV+N VLSF  V+IG+++S+GPYAV+QK
Sbjct  1460  HVVIDTVDITDPSLLAVADGAVIAEGVLIQSHEVRNEVLSFRHVKIGRKASVGPYAVIQK  1519

Query  4492  GSIVGDGAEVLAQNKKAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQ-LFGIYMIGYL  4668
             G++V  G  +    K    K + P +G          K   G  N  F+ L  IY +G+L
Sbjct  1520  GTVVHGGVVIPPLQKTEQGKSAYPPSGASAYT-----KDEEGTANIAFEHLVSIYAVGFL  1574

Query  4669  NSLSAAIAYLVWIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMF--TSLPVSTLSF  4842
              +LS A  ++++        SL HF F C+AGAFHW P ++  +  +   T    S + F
Sbjct  1575  GALSGATVFMLYTRFSGTTASLQHFSFACVAGAFHWLPAVLAAYAVIVRETKTTKSPVEF  1634

Query  4843  AGMVAAGYTAHGLILSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGT  5022
             A  +A  Y ++G+I+S+   + N  ++ +  T K    + I  R+ +A H+RFAK++SGT
Sbjct  1635  ALFIAFAYLSYGIIVSLLASVTNKALATRSGTKKKDVARLIQQRITIAAHLRFAKMISGT  1694

Query  5023  ELFCVYLHWMGAKIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGR  5202
             E FC+YL  +GAKIG+HCSIRAINPV +P L+S+ DGVHLGDF  IVPG+++ G + S  
Sbjct  1695  EAFCMYLRLLGAKIGRHCSIRAINPVADPQLISIGDGVHLGDFCNIVPGFYSKG-FTSAE  1753

Query  5203  IDIRENSVIGSQGLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLP  5382
             I +R+N+V+GS  L+LPGS ++++VILGALSVAP  SVL   G +VG+++L +V+N  L 
Sbjct  1754  IKVRDNTVVGSGSLLLPGSVLQENVILGALSVAPQGSVLLQGGVYVGAQSLTLVKNTLLA  1813

Query  5383  LDDRIEEMDPKYKKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKI  5562
              D+RI EMDP YKK++G+LAANLA +T+ +KSRYFHR G +G+G LR+Y  +P L +HKI
Sbjct  1814  EDERIVEMDPMYKKIVGNLAANLAITTMNVKSRYFHRTGVSGRGVLRMYQDIPSLTEHKI  1873

Query  5563  FGPGATYPVIIRHSNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFH  5742
             FG G ++PVI+RHSN LS+DDDARLD RGAA+RIL  +        PLLDLTLK+GKAF+
Sbjct  1874  FGAGKSFPVIVRHSNSLSADDDARLDARGAAVRILSDD-----GEVPLLDLTLKSGKAFY  1928

Query  5743  ARTIGDFATWLVCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDG  5922
             ARTI DFATWLVCG  ARE+ VK APHIRDA+WGSLR  +SYT+LHYYSNICRL RF+DG
Sbjct  1929  ARTIADFATWLVCGLPAREDQVKRAPHIRDAVWGSLRNTDSYTKLHYYSNICRLLRFEDG  1988

Query  5923  QEMYVRFKLRPFDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSP  6102
             ++MY +FKLRP D+ I E+ G+V PRGILPPETGAIPRDE D RPLLFLA+DF+ +V SP
Sbjct  1989  RQMYAKFKLRPADQAISEDSGQVVPRGILPPETGAIPRDEGDTRPLLFLADDFRRKVESP  2048

Query  6103  DKVRYVLQLQIQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEF  6282
             + VRYV QLQ++ +P D   RE  LDCT+PWDE E PYIEVGEI+I   L+ +E+E+LEF
Sbjct  2049  EGVRYVFQLQLRDVPADSATREIALDCTRPWDEDEFPYIEVGEISIGSNLSAEETEKLEF  2108

Query  6283  NPFFRCNEIDVIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDL  6462
             NPF RC E+DVI ATSC QSASIDHGRSLVYEICQ +RN +PLP +WR FL+QSD K+DL
Sbjct  2109  NPFLRCQEVDVISATSCKQSASIDHGRSLVYEICQRVRNGEPLPASWRAFLEQSDTKIDL  2168

Query  6463  SGCP-LAAKLENKDMPKA---TLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCL  6630
             SGCP +AAK  + D+ +A   TLAR WY  LW    QP LQ ++PYF++GLVI+ PL  L
Sbjct  2169  SGCPVIAAKRSSPDVRQATKVTLARTWYQALWATLCQPLLQTLVPYFVVGLVIFLPLRGL  2228

Query  6631  FYTHEMTQIQKQWLLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIW  6810
               T     +   W LP++W  SG+ A   CA +KW LVG++  G T  IW+  +F+DT+W
Sbjct  2229  LATM-AAGVPLYWTLPIFWATSGVAAMGACAAAKWALVGRRADGDTVHIWAPPVFLDTVW  2287

Query  6811  QAIRTVTGEYFMETATGTFLMGIWMRLMGSEVA-RDGVYIDSMGATLNPDMVRIEEYGSV  6987
             QA+RT T EYF E   G+ L   WMR MG+ VA  DGVY+DS GA LNP+MV +E   SV
Sbjct  2288  QAVRTATEEYFAELTPGSVLFAWWMRAMGASVAVSDGVYVDSTGALLNPEMVHLERGASV  2347

Query  6988  GREALLFGHIYEG-GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             GR+ALLFGH+YEG GGEVK+GR+ V   GFVGSRAVAMPG  +D GG LGAL LAM
Sbjct  2348  GRDALLFGHVYEGEGGEVKFGRVHVGEDGFVGSRAVAMPGVRVDDGGCLGALRLAM  2403



>tpg|DAA37344.1| TPA: putative AMP-dependent synthetase and ligase superfamily 
protein [Zea mays]
Length=2404

 Score =  1434 bits (3712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 715/1226 (58%), Positives = 914/1226 (75%), Gaps = 46/1226 (4%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+ G  +DD F KLHP  P  TRIGIVGAGPSGLSAAYAL KLGY NV V E+ H+  GM
Sbjct  1     MDPGKSIDDKFSKLHPSFPVDTRIGIVGAGPSGLSAAYALAKLGYHNVTVFERCHNVSGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRV  660
             CESIDI+GRTYDLGGQV+AANSAP I HLAKE+G+E E+MDTHKLAL+DS      D+ V
Sbjct  61    CESIDIEGRTYDLGGQVIAANSAPVITHLAKELGSEFEDMDTHKLALIDSQTGNIRDLEV  120

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             AEDY+S+        DE   +  +G+++VS +ASD T +FL   G+ S+PKSV YGYTAS
Sbjct  121   AEDYVSM--------DEANRSGGVGIHAVSGLASDPTLDFLMQHGISSMPKSVVYGYTAS  172

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF+QDMPYA+IHEF RTSMAGKIRRFK GY S+W KLS+++P +  C TEVL +KRN+
Sbjct  173   GYGFVQDMPYAFIHEFTRTSMAGKIRRFKHGYMSLWDKLSQSLPFEVLCGTEVLRVKRNN  232

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
                 V +++ N  ++  EFDKII+SGA PF NG+TYRS S        + ++++ LE++L
Sbjct  233   CVASVIIKNNNDDVEVREFDKIILSGALPFKNGKTYRSLSMTDGE--NEVVELNDLEREL  290

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             FSKVQTI+YYT+V++I+G EH+P GF+YF  +MEDP  +G+PVAMQ+F+ DTN+FLFWSY
Sbjct  291   FSKVQTIDYYTTVVKIEGFEHIPKGFFYFGEYMEDPTTVGHPVAMQRFFADTNIFLFWSY  350

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GNS DI  S V +     V  MGG V++V+LQR FKYFPHV+ +DMK+GFYEK+E+QLQG
Sbjct  351   GNSADIKESYVAKCVTNVVTSMGGTVQRVLLQRRFKYFPHVSSEDMKNGFYEKVESQLQG  410

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAF--  1734
               NTY+VGGL+AFELTERNA YS++ + KHFA    +P  PYVKRLFPL   S+G+    
Sbjct  411   FQNTYFVGGLLAFELTERNAFYSISSVCKHFAIASELPKVPYVKRLFPL---SKGIPSPP  467

Query  1735  KQLDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFT  1914
             + + E+ GV+FP L SLD YL++WGT  VT  K +YTW+NE+G +++RRTY+E+H N   
Sbjct  468   RDIGELEGVEFPHLPSLDGYLQYWGTHRVTAEKFIYTWINEEGKIMNRRTYQELHDNVSY  527

Query  1915  IAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQAL  2094
             IA KLLTS KP IKPGD+VLLI++PGL+FVDAFFGC+RA VIP+P +PPDP QRGG QAL
Sbjct  528   IAYKLLTSTKPIIKPGDRVLLIHLPGLEFVDAFFGCIRAGVIPVPVLPPDPMQRGG-QAL  586

Query  2095  LHIANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSWVk  2271
             L + N++KVCN VAILST SYH  VR    KN++   KS  K S  WPDLPW+HTDSW+K
Sbjct  587   LKVENVSKVCNAVAILSTSSYHAAVRAGYIKNIVTLTKSAQKCSAQWPDLPWIHTDSWIK  646

Query  2272  kpklfkkpkDEQG------QPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRY  2433
               +      + +       +P   +LCFLQFTSGST D KGVMITHGG+IHNVK+M+KRY
Sbjct  647   NYRRSPGSFNSESVVPMITKPQPSELCFLQFTSGSTGDAKGVMITHGGLIHNVKMMKKRY  706

Query  2434  KSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATH  2613
             +STS+T+L+SWLPQYHDMGLIGGL T LVSGG+ ILFSP+TF++NPL+WL+T+S +  TH
Sbjct  707   RSTSKTVLISWLPQYHDMGLIGGLFTTLVSGGTSILFSPMTFIRNPLIWLKTISDYHGTH  766

Query  2614  SAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVM  2793
             SA PNFAFEL++RRLE+ K + +DLSSM FLM AAEP+RQ T+KRF+ELTQ  G S  V+
Sbjct  767   SAGPNFAFELVIRRLETEKNKMYDLSSMVFLMIAAEPVRQKTVKRFIELTQPLGFSEGVL  826

Query  2794  APGYGLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDP  2973
             APGYGLAENCV+VSCA+GE  P+F+DWQGR+CCGY+   +TD V I+I+ P+   E+ + 
Sbjct  827   APGYGLAENCVYVSCAFGECKPIFIDWQGRICCGYVDTNDTDVV-IRIVDPDYLTEHQED  885

Query  2974  GKEGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRT  3153
             G EGEIWISS S+G+GYW  +E SQ+TF N + + P  ++ RTGDLGRIID KLFITGR 
Sbjct  886   GAEGEIWISSSSSGVGYWNNKETSQRTFCNWLKNYPNIKFTRTGDLGRIIDGKLFITGRI  945

Query  3154  KDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVV  3333
             KDLIIVAG+NIY++D+EKTVE SS+++RPGCCAVVG+PEDVL  KGI    +SD++GLVV
Sbjct  946   KDLIIVAGRNIYSADVEKTVECSSDVLRPGCCAVVGVPEDVLTQKGISIPDSSDQVGLVV  1005

Query  3334  IAEVRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFIS  3513
             IAEVR+GK +  +++D I TRVAEEHGV IAS+  IKPR+ISKTTSGKI+R+EC K+F+ 
Sbjct  1006  IAEVREGKVISEEIVDSIRTRVAEEHGVTIASVKLIKPRTISKTTSGKIRRFECMKQFVD  1065

Query  3514  GTLDV-----IEEQMNGERSLPRNDGIIV----------------PANGKISKTDIVNFL  3630
              TL +     I  + +  RSL    G+ +                P +   +  +I+ FL
Sbjct  1066  NTLSLASGSRISNKKSLFRSLTTGTGMDIRRPFLKHTVDPTIRPQPRSKVKNLMEIIEFL  1125

Query  3631  KDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDL  3810
               L+S Q GI   KIS  ++L SYG +SI VVRAAQK+S F G  +GAIDIF+A+ I +L
Sbjct  1126  MQLVSDQKGISKDKISPNDSLPSYGFDSIAVVRAAQKLSDFLGTPVGAIDIFTASSISEL  1185

Query  3811  ADFVESLLEKNHPMLTNSSETKISSS  3888
             A+ +E+L+ K+ P L     +K+  S
Sbjct  1186  ANSLENLVHKSQPQLAPQPRSKVKRS  1211


 Score =  1282 bits (3318),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 639/1196 (53%), Positives = 844/1196 (71%), Gaps = 27/1196 (2%)
 Frame = +1

Query  3610  TDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFS  3789
             +DI+ FL +++S Q G+P  KIS  ++L SYG +SI VVRAAQK+S F GI +GAIDIF+
Sbjct  1212  SDIIEFLTEIVSDQAGVPKDKISPTDSLPSYGFDSIAVVRAAQKLSDFLGIPVGAIDIFT  1271

Query  3790  ATCIDDLADFVESLLEKNHPMLTNSSETKISSSGIPSVVSTFDKITIW---LIHLVALAY  3960
             A+CI DLA F+E+L+ K+ P L            +    +T   ++++   ++ L+AL Y
Sbjct  1272  ASCIADLASFLENLVLKSQPQLKPDVSHSAEDENLVITDATDLDLSVFATGILQLLALTY  1331

Query  3961  VSLLLIIPAYISVSMFKPLILANQSPWFFYFISLAC---APFSWMLCIFLTCICTRLLGN  4131
             V  +L++PAY++ SM+K +I +           L+    AP +W+     T +    LG 
Sbjct  1332  VCFILLLPAYLASSMYKSMISSVSLVKSSLLSYLSSLVLAPVAWICYALFTSLSLSTLGK  1391

Query  4132  ALLQPNYVLNPEISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIAS  4311
               LQPNY+L P+IS+WSV+FVKWWAL KAQ +++K+LAVHL+GT+FLNYWFK+ GA+I S
Sbjct  1392  PFLQPNYILTPDISIWSVDFVKWWALNKAQSLAAKMLAVHLKGTIFLNYWFKMQGARIGS  1451

Query  4312  SALIDTVDITDPLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQK  4491
               +IDTVDITDP L+++ + +VI+EG LIQSHEV+N VLSF  V+IG+++S+GPYAV+QK
Sbjct  1452  HVVIDTVDITDPSLLAVADGAVIAEGVLIQSHEVRNEVLSFRHVKIGRKASVGPYAVIQK  1511

Query  4492  GSIVGDGAEVLAQNKKAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQ-LFGIYMIGYL  4668
             G++V  G  +    K    K + P +G          K   G  N  F+ L  IY +G+L
Sbjct  1512  GTVVHGGVVIPPLQKTEQGKSAYPPSGASAYT-----KDEEGTANIAFEHLVSIYAVGFL  1566

Query  4669  NSLSAAIAYLVWIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMF--TSLPVSTLSF  4842
              +LS A  ++++        SL HF F C+AGAFHW P ++  +  +   T    S + F
Sbjct  1567  GALSGATVFMLYTRFSGTTASLQHFSFACVAGAFHWLPAVLAAYAVIVRETKTTKSPVEF  1626

Query  4843  AGMVAAGYTAHGLILSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGT  5022
             A  +A  Y ++G+I+S+   + N  ++ +  T K    + I  R+ +A H+RFAK++SGT
Sbjct  1627  ALFIAFAYLSYGIIVSLLASVTNKALATRSGTKKKDVARLIQQRITIAAHLRFAKMISGT  1686

Query  5023  ELFCVYLHWMGAKIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGR  5202
             E FC+YL  +GAKIG+HCSIRAINPV +P L+S+ DGVHLGDF  IVPG+++ G + S  
Sbjct  1687  EAFCMYLRLLGAKIGRHCSIRAINPVADPQLISIGDGVHLGDFCNIVPGFYSKG-FTSAE  1745

Query  5203  IDIRENSVIGSQGLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLP  5382
             I +R+N+V+GS  L+LPGS ++++VILGALSVAP  SVL   G +VG+++L +V+N  L 
Sbjct  1746  IKVRDNTVVGSGSLLLPGSVLQENVILGALSVAPQGSVLLQGGVYVGAQSLTLVKNTLLA  1805

Query  5383  LDDRIEEMDPKYKKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKI  5562
              D+RI EMDP YKK++G+LAANLA +T+ +KSRYFHR G +G+G LR+Y  +P L +HKI
Sbjct  1806  EDERIVEMDPMYKKIVGNLAANLAITTMNVKSRYFHRTGVSGRGVLRMYQDIPSLTEHKI  1865

Query  5563  FGPGATYPVIIRHSNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFH  5742
             FG G ++PVI+RHSN LS+DDDARLD RGAA+RIL  +        PLLDLTLK+GKAF+
Sbjct  1866  FGAGKSFPVIVRHSNSLSADDDARLDARGAAVRILSDD-----GEVPLLDLTLKSGKAFY  1920

Query  5743  ARTIGDFATWLVCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDG  5922
             ARTI DFATWLVCG  ARE+ VK APHIRDA+WGSLR  +SYT+LHYYSNICRL RF+DG
Sbjct  1921  ARTIADFATWLVCGLPAREDQVKRAPHIRDAVWGSLRNTDSYTKLHYYSNICRLLRFEDG  1980

Query  5923  QEMYVRFKLRPFDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSP  6102
             ++MY +FKLRP D+ I E+ G+V PRGILPPETGAIPRDE D RPLLFLA+DF+ +V SP
Sbjct  1981  RQMYAKFKLRPADQAISEDSGQVVPRGILPPETGAIPRDEGDTRPLLFLADDFRRKVESP  2040

Query  6103  DKVRYVLQLQIQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEF  6282
             + VRYV QLQ++ +P D   RE  LDCT+PWDE E PYIEVGEI+I   L+ +E+E+LEF
Sbjct  2041  EGVRYVFQLQLRDVPADSATREIALDCTRPWDEDEFPYIEVGEISIGSNLSAEETEKLEF  2100

Query  6283  NPFFRCNEIDVIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDL  6462
             NPF RC E+DVI ATSC QSASIDHGRSLVYEICQ +RN +PLP +WR FL+QSD K+DL
Sbjct  2101  NPFLRCQEVDVISATSCKQSASIDHGRSLVYEICQRVRNGEPLPASWRAFLEQSDTKIDL  2160

Query  6463  SGCP-LAAKLENKDMPKA---TLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCL  6630
             SGCP +AAK  + D+ +A   TLAR WY  LW    QP LQ ++PYF++GLVI+ PL  L
Sbjct  2161  SGCPVIAAKRSSPDVRQATKVTLARTWYQALWATLCQPLLQTLVPYFVVGLVIFLPLRGL  2220

Query  6631  FYTHEMTQIQKQWLLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIW  6810
               T     +   W LP++W  SG+ A   CA +KW LVG++  G T  IW+  +F+DT+W
Sbjct  2221  LATM-AAGVPLYWTLPIFWATSGVAAMGACAAAKWALVGRRADGDTVHIWAPPVFLDTVW  2279

Query  6811  QAIRTVTGEYFMETATGTFLMGIWMRLMGSEVA-RDGVYIDSMGATLNPDMVRIEEYGSV  6987
             QA+RT T EYF E   G+ L   WMR MG+ VA  DGVY+DS GA LNP+MV +E   SV
Sbjct  2280  QAVRTATEEYFAELTPGSVLFAWWMRAMGASVAVSDGVYVDSTGALLNPEMVHLERGASV  2339

Query  6988  GREALLFGHIYEG-GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             GR+ALLFGH+YEG GGEVK+GR+ V   GFVGSRAVAMPG  +D GG LGAL LAM
Sbjct  2340  GRDALLFGHVYEGEGGEVKFGRVHVGEDGFVGSRAVAMPGVRVDDGGCLGALRLAM  2395



>emb|CAH66806.1| OSIGBa0135C13.1 [Oryza sativa Indica Group]
Length=2391

 Score =  1426 bits (3692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 706/1222 (58%), Positives = 906/1222 (74%), Gaps = 54/1222 (4%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+    +DD F KLHP +P  TRIGIVGAGPSGLSAAYAL KLGY NV + EK H+  GM
Sbjct  1     MDPKRSIDDQFSKLHPSLPVDTRIGIVGAGPSGLSAAYALAKLGYRNVTLFEKCHTVSGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRV  660
             CESIDI+                       +E+G++ EEMDTHKL+L+DS      D+ V
Sbjct  61    CESIDIE-----------------------EELGSDFEEMDTHKLSLIDSQTGNIRDLEV  97

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             AEDY+S++ +TLKLQDE   + R G++++S +ASD T EFLK  G+ S+PKSVAYGYTAS
Sbjct  98    AEDYVSMVSLTLKLQDEANKSGRAGLHALSGLASDPTHEFLKQNGINSMPKSVAYGYTAS  157

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF+QDMPYA+I EF RTSMAGKIRRFK GY S+W++LS+++P +  C+T+VL++KRNS
Sbjct  158   GYGFVQDMPYAFIQEFTRTSMAGKIRRFKHGYMSMWERLSKSLPFEVFCDTQVLNVKRNS  217

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
              G  V +++ NG  Q +EFDKII+SGA  F N +TYRS S        + ++++ LE++L
Sbjct  218   CGANVTIKNNNGEKQVLEFDKIILSGAVAFKNSKTYRSSSLTDGE--SEVVELNNLEREL  275

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             FSKVQTI+YYT+V++I+G EH+P GFYYFE FMEDP  IG+PVAMQ+F+ DTN+FLFWSY
Sbjct  276   FSKVQTIDYYTTVVKINGFEHIPKGFYYFEEFMEDPTTIGHPVAMQRFFADTNIFLFWSY  335

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GNS DI GS V +     V  MGG V+KVILQR FKYFPHV+ +DMKDGFYE+LE+QLQG
Sbjct  336   GNSADIKGSFVAKCVTDVVSSMGGNVQKVILQRRFKYFPHVSSKDMKDGFYERLESQLQG  395

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
               NTYYVGGL+AFELTERNASYS+  + KHFA D      PYVKRLFPL  +      + 
Sbjct  396   FQNTYYVGGLLAFELTERNASYSIMAVCKHFAIDGEGELTPYVKRLFPLSHNRNPSPPRD  455

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             L E+ GV+FP+L SLD YL++WGT  VTE   +YTW+NE+G +++RRTY+E+H NA  IA
Sbjct  456   LGELEGVEFPDLPSLDGYLQYWGTHKVTEKNVIYTWINEEGKLMNRRTYQELHGNASYIA  515

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
             QKLLTS KP IKPGD+VLLI++PGL+F+DAFFGC+RA VIP+P +PPDP Q  GGQALL 
Sbjct  516   QKLLTSTKPVIKPGDRVLLIHLPGLEFIDAFFGCIRAGVIPVPVLPPDPMQ-SGGQALLK  574

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSWVkkp  2277
             + NI+K+CN VAILST SYH  VR    KN++   K   K S  WPD+PW+ TDSW+K  
Sbjct  575   VENISKMCNAVAILSTSSYHAAVRAGYIKNIVTLAKRVQKCSAQWPDIPWIQTDSWIKNY  634

Query  2278  klfkkpkDEQ----GQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTS  2445
             +      +       +P   DLCFLQFTSGST D KGVMITH G+IHNVK M+KRY+STS
Sbjct  635   RRSSDSFNSDTVLFTKPQPSDLCFLQFTSGSTGDAKGVMITHEGLIHNVKTMKKRYRSTS  694

Query  2446  RTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAP  2625
             +T+LVSWLPQYHDMGLIGGL T LVSGG+ +LFSP+TF++NPLLWLQT++ +  THSA P
Sbjct  695   KTVLVSWLPQYHDMGLIGGLFTALVSGGTSVLFSPMTFIRNPLLWLQTINDYHGTHSAGP  754

Query  2626  NFAFELLVRRLESSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGY  2805
             NFAFEL++RRLE+ K + +DLSSM FLM AAEP+RQ T++RF+ELTQ FGLS  V+APGY
Sbjct  755   NFAFELVIRRLEAEKNKVYDLSSMVFLMIAAEPVRQKTVRRFIELTQPFGLSEGVLAPGY  814

Query  2806  GLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEG  2985
             GLAENCV+V+CA+GE  PVF+DWQGRVCCGY++Q +TD + I+I+ P++  E+ + G EG
Sbjct  815   GLAENCVYVTCAFGECKPVFIDWQGRVCCGYVEQDDTDTL-IRIVDPDSLTEHQEDGVEG  873

Query  2986  EIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLI  3165
             EIWISS S+G+GYWG  E+SQ+TF N + + P K++ RTGDLGR ID  LFITGR KDLI
Sbjct  874   EIWISSPSSGVGYWGNSEMSQRTFFNQLKNHPNKKFTRTGDLGRTIDGNLFITGRIKDLI  933

Query  3166  IVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEV  3345
             IVAG+NIY++D+EKTVESSSE++RPGCCAVVGIPE+VL  KGI    +SD++GLVVIAEV
Sbjct  934   IVAGRNIYSADVEKTVESSSEVLRPGCCAVVGIPEEVLAQKGISIPDSSDQVGLVVIAEV  993

Query  3346  RDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLD  3525
             R+GK +  +V+++I  RV EEHGV +AS+  IKPR+I KTTSGKI+R+EC ++F+  TL 
Sbjct  994   REGKAVSEEVVNNIKARVVEEHGVAVASVKLIKPRTICKTTSGKIRRFECMRQFVDNTLS  1053

Query  3526  VIEEQ-----------------MNGERSLPRNDGIIV----PANGKISKTDIVNFLKDLL  3642
             + +                   M  +RSL R    +     P +   +  +I  FL  ++
Sbjct  1054  LAKGNHVSKKKGLFRSLTTGTGMESKRSLLRQTVDLTISHWPKSQVKNSNEITEFLTQIV  1113

Query  3643  SQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFV  3822
             S+ TGI   KIS  ++L SYG +SI VVRAAQK+S F G+ +GAIDIF+A+CI +LA F+
Sbjct  1114  SEHTGISKDKISLTDSLPSYGFDSIAVVRAAQKLSDFLGVPVGAIDIFTASCISELASFL  1173

Query  3823  ESLLEKNHPMLTNSSETKISSS  3888
             E+L+ K+ P L    ++K+ +S
Sbjct  1174  ENLVHKSQPQLAPWPKSKVKNS  1195


 Score =  1266 bits (3275),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 644/1204 (53%), Positives = 831/1204 (69%), Gaps = 24/1204 (2%)
 Frame = +1

Query  3586  PANGKISKTDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGIN  3765
             P +   +  +I+ FL  ++S QTGIP  KIS   +L SYG +SI VV+AAQK+S F G+ 
Sbjct  1188  PKSKVKNSKEIIEFLTKIVSDQTGIPKDKISPTNSLPSYGFDSIAVVQAAQKLSDFLGVP  1247

Query  3766  IGAIDIFSATCIDDLADFVESLLEKNHPMLTNSS----ETKISSSGIPSVVSTFDKITIW  3933
             +GAIDIF+A CI +LA F+E+L  K+   L   +    E +     + ++   F  +   
Sbjct  1248  VGAIDIFTAGCISELATFLENLAHKSQSQLAPGASCYIEDETQVDPMDAISPEFSVLGTG  1307

Query  3934  LIHLVALAYVSLLLIIPAYIS----VSMFKPLILANQSPWFFYFISLACAPFSWMLCIFL  4101
             ++ L+AL YV  +L++PAY++    +S+F  + L       +    +  AP  W+  I L
Sbjct  1308  ILQLLALTYVCFVLLLPAYLASSTYMSIFSTVSLVRSPLLSYLSSLV-MAPIVWIFYISL  1366

Query  4102  TCICTRLLGNALLQPNYVLNPEISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYW  4281
             T +   +LG + LQPNYVL P++S+WSV+FVKWWAL KAQ +++K+LAVHL+GT+FLNYW
Sbjct  1367  TSLSLSILGKSFLQPNYVLIPDVSIWSVDFVKWWALNKAQALAAKMLAVHLKGTIFLNYW  1426

Query  4282  FKILGAKIASSALIDTVDITDPLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRS  4461
             FK+ GA+I SS +IDTVDITDP L+++ + +V++EGAL+Q HEV N VLSF  + IG  +
Sbjct  1427  FKMQGARIGSSVVIDTVDITDPSLLTVADGAVLAEGALVQGHEVCNEVLSFRPIWIGCEA  1486

Query  4462  SIGPYAVLQKGSIVGDGAEVLAQNKKAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQL  4641
             SIGPYAVLQKG++V DGA V    K  A K ++       + +  I+K     +  +  L
Sbjct  1487  SIGPYAVLQKGTVVEDGAVVPPLQKTGAGKSTR----RTSRTSVSIKKEAAKANMILEHL  1542

Query  4642  FGIYMIGYLNSLSAAIAYLVWIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSL  4821
               IY +G L +LS AI Y ++  L  K  S  HF F CIAGAFHW P  I  +  +    
Sbjct  1543  VSIYAVGILGALSGAIVYTLYTHLSGKAASPLHFSFACIAGAFHWLPAAITAYAVIVQET  1602

Query  4822  PVSTLSFAGMVAAGYTAHGLILSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRF  5001
             P S LSFA   A    ++G+ILS+ T + +  ++ K  T +      I  R+ ++ H+RF
Sbjct  1603  PTSALSFALFTAFADLSYGVILSILTSITSRALAAKPGTKQNGIASLIHRRITISAHVRF  1662

Query  5002  AKLLSGTELFCVYLHWMGAKIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTT  5181
             AK+LSGTE FCVYL  +GAKIG+HCSIRAINPV  P L+SV DGVHLGDF  IVPG+++ 
Sbjct  1663  AKMLSGTEAFCVYLRLLGAKIGRHCSIRAINPVANPELISVGDGVHLGDFCNIVPGFYSK  1722

Query  5182  GGYISGRIDIRENSVIGSQGLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVM  5361
             GG+ S  I ++EN+V+GS  L+LPG  ++++VILGALSVAP N+VL   G +VGS++  M
Sbjct  1723  GGFTSAEIKVQENTVVGSGSLLLPGCVLQENVILGALSVAPENAVLRRGGVYVGSQSPAM  1782

Query  5362  VRNQTLPLDDRIEEMDPKYKKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLP  5541
             V+N  L  D+RIEEMD  YKK++G+LAANLA +T+ +KSRYFHRIG +G+G LR+Y  +P
Sbjct  1783  VKNTLLDEDERIEEMDQAYKKIVGNLAANLAITTMNVKSRYFHRIGVSGRGVLRMYEEIP  1842

Query  5542  GLPDHKIFGPGATYPVIIRHSNCLSSDDDARLDPRGAAIRILPHERtttttttplldltl  5721
               P HKIF  G ++PVI+RHSN LS+DDDARLD RGAA+RIL           PLLDLTL
Sbjct  1843  SFPRHKIFASGKSFPVIVRHSNSLSADDDARLDARGAAVRILSDN----DGEAPLLDLTL  1898

Query  5722  ktGKAFHARTIGDFATWLVCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICR  5901
             K+GKAF+ARTI DFATWLVCG  AREE VK +PHIRDA+WGSLR  +SYT LHYYSNICR
Sbjct  1899  KSGKAFYARTIADFATWLVCGLPAREEQVKRSPHIRDAVWGSLRSTDSYTVLHYYSNICR  1958

Query  5902  LFRFKDGQEMYVRFKLRPFDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDF  6081
             L RF DG+EMY +FKLRP D  + E+ G+V PRGILPPETGAIPRDE+D RPLLFLA+DF
Sbjct  1959  LLRFDDGREMYAKFKLRPADPDVPEDSGKVVPRGILPPETGAIPRDEDDTRPLLFLADDF  2018

Query  6082  KFRVSSPDKVRYVLQLQIQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEK  6261
             + RV SPD VRYV QLQ++ +P D   R+  LDCT+PWDE E PYI+VGE++I   L  +
Sbjct  2019  RRRVGSPDGVRYVFQLQLREVPTDAAARDVALDCTRPWDEAEFPYIDVGEVSIGCNLPTE  2078

Query  6262  ESEELEFNPFFRCNEIDVIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQ  6441
             E+E+LEFNPF RC E+DVI ATSC QSASIDHGRSLVYEICQ LRN +PLP +WR FL+Q
Sbjct  2079  ETEKLEFNPFLRCPEVDVIPATSCAQSASIDHGRSLVYEICQRLRNGEPLPASWRAFLEQ  2138

Query  6442  SDVKLDLSGCPLAA-----KLENKDMPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLV  6606
             SD K+DLSGCP+AA     +    D  K TLAR WY  LW    QP LQ ++PY +LGLV
Sbjct  2139  SDTKIDLSGCPVAAAATPTRSNAGDATKVTLARTWYQALWATLCQPLLQTLVPYSVLGLV  2198

Query  6607  IYAPLNCLFYTHEMTQIQKQWLLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSR  6786
             I+ PL  L      T+    WLLP +W  SG+ A   CA +KW LVG +  G T  IWS 
Sbjct  2199  IFLPLRGLLAVAAATRFPLYWLLPAFWAASGVAAMATCAAAKWALVGSRVDGDTAHIWSP  2258

Query  6787  GIFMDTIWQAIRTVTGEYFMETATGTFLMGIWMRLMGSEVAR-DGVYIDSMGATLNPDMV  6963
              +F+DT+WQA+R  T EYF E   G+     WMR+MG+ V+  DGVY+DSMGA LNP+MV
Sbjct  2259  AVFLDTVWQAVRAATAEYFAELTPGSAPFAAWMRVMGASVSPGDGVYVDSMGALLNPEMV  2318

Query  6964  RIEEYGSVGREALLFGHIYEG-GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGAL  7140
             R+E   +VGR+ALLFGH+YEG  G+VK+G +SV   GFVGSRAVAMP  T+D GG L AL
Sbjct  2319  RLERGAAVGRDALLFGHVYEGEAGKVKFGAVSVGEDGFVGSRAVAMPSVTVDDGGCLAAL  2378

Query  7141  SLAM  7152
              LAM
Sbjct  2379  GLAM  2382



>ref|NP_001173978.1| Os04g0473900 [Oryza sativa Japonica Group]
 dbj|BAH92706.1| Os04g0473900 [Oryza sativa Japonica Group]
Length=2470

 Score =  1424 bits (3686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 705/1225 (58%), Positives = 906/1225 (74%), Gaps = 54/1225 (4%)
 Frame = +1

Query  301   EMESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGG  480
             EM+    +DD F KLHP +P  TRIGIVGAGPSGLSAAYAL KLGY NV + EK H+  G
Sbjct  79    EMDPKRSIDDQFSKLHPSLPVDTRIGIVGAGPSGLSAAYALAKLGYRNVTLFEKCHTVSG  138

Query  481   MCESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMR  657
             MCESIDI+                       +E+G++ EEMDTHKL+L+DS      D+ 
Sbjct  139   MCESIDIE-----------------------EELGSDFEEMDTHKLSLIDSQTGNIRDLE  175

Query  658   VAEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTA  837
             VAEDY+S++ +TLKLQDE   + R G++++S +ASD T EFLK  G+ S+PKSVAYGYTA
Sbjct  176   VAEDYVSMVSLTLKLQDEANKSGRAGLHALSGLASDPTHEFLKQNGINSMPKSVAYGYTA  235

Query  838   SGYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRN  1017
             SGYGF+QDMPYA+I EF RTSMAGKIRRFK GY S+W++LS+++P +  C+T+VL++KRN
Sbjct  236   SGYGFVQDMPYAFIQEFTRTSMAGKIRRFKHGYMSMWERLSKSLPFEVFCDTQVLNVKRN  295

Query  1018  SSGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKD  1197
             S G  V +++ NG  Q +EFDKII+SGA  F N +TYRS S        + ++++ LE++
Sbjct  296   SCGANVTIKNNNGEKQVLEFDKIILSGAVAFKNSKTYRSSSLTDGE--SEVVELNNLERE  353

Query  1198  LFSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWS  1377
             LFSKVQTI+YYT+V++I+G EH+P GFYYF  FMEDP  IG+PVAMQ+F+ DTN+FLFWS
Sbjct  354   LFSKVQTIDYYTTVVKINGFEHIPKGFYYFGEFMEDPTTIGHPVAMQRFFADTNIFLFWS  413

Query  1378  YGNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQ  1557
             YGNS DI GS V +     V  MGG V+KVILQR FKYFPHV+ +DMKDGFYE+LE+QLQ
Sbjct  414   YGNSADIKGSFVAKCVTDVVSSMGGNVQKVILQRRFKYFPHVSSKDMKDGFYERLESQLQ  473

Query  1558  GQLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFK  1737
             G  NTYYVGGL+AFELTERNASYS+  + KHFA D      PYVKRLFPL  +      +
Sbjct  474   GFQNTYYVGGLLAFELTERNASYSIMAVCKHFAIDGEGELTPYVKRLFPLSHNRNPSPPR  533

Query  1738  QLDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTI  1917
              L E+ GV+FP+L SLD YL++WGT  VTE   +YTW+NE+G +++RRTY+E+H NA  I
Sbjct  534   DLGELEGVEFPDLPSLDGYLQYWGTHKVTEKNVIYTWINEEGKLMNRRTYQELHGNASYI  593

Query  1918  AQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALL  2097
             AQKLLTS KP IKPGD+VLLI++PGL+F+DAFFGC+RA VIP+P +PPDP Q  GGQALL
Sbjct  594   AQKLLTSTKPVIKPGDRVLLIHLPGLEFIDAFFGCIRAGVIPVPVLPPDPMQ-SGGQALL  652

Query  2098  HIANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSWVkk  2274
              + NI+K+CN VAILST SYH  VR    KN++   K   K S  WPD+PW+HTDSW+K 
Sbjct  653   KVENISKMCNAVAILSTSSYHAAVRAGYIKNIVTLAKRVQKCSAQWPDIPWIHTDSWIKN  712

Query  2275  pklfkkpkDEQ----GQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKST  2442
              +      +       +P   DLCFLQFTSGST D KGVMITH G+IHNVK M+KRY+ST
Sbjct  713   YRRSSDSFNSDTVLFTKPQPSDLCFLQFTSGSTGDAKGVMITHEGLIHNVKTMKKRYRST  772

Query  2443  SRTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAA  2622
             S+T+LVSWLPQYHDMGLIGGL T LVSGG+ +LFSP+ F++NPLLWLQT++ +  THSA 
Sbjct  773   SKTVLVSWLPQYHDMGLIGGLFTALVSGGTSVLFSPMIFIRNPLLWLQTINDYHGTHSAG  832

Query  2623  PNFAFELLVRRLESSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPG  2802
             PNFAFEL++RRLE+ K + +DLSSM FLM AAEP+RQ T++RF+ELTQ FGLS  V+APG
Sbjct  833   PNFAFELVIRRLEAEKNKVYDLSSMVFLMIAAEPVRQKTVRRFIELTQPFGLSEGVLAPG  892

Query  2803  YGLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKE  2982
             YGLAENCV+V+CA+GE  PVF+DWQGRVCCGY++Q +TD + I+I+ P++  E+ + G E
Sbjct  893   YGLAENCVYVTCAFGECKPVFIDWQGRVCCGYVEQDDTDTL-IRIVDPDSLTEHQEDGVE  951

Query  2983  GEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDL  3162
             GEIWISS S+G+GYWG  E+SQ+TF N + + P K++ RTGDLGR ID  LFITGR KDL
Sbjct  952   GEIWISSPSSGVGYWGNSEMSQRTFFNQLKNHPNKKFTRTGDLGRTIDGNLFITGRIKDL  1011

Query  3163  IIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAE  3342
             IIVAG+NIY++D+EKTVESSSE++RPGCCAVVGIPE+VL  KGI    +SD++GLVVIAE
Sbjct  1012  IIVAGRNIYSADVEKTVESSSEVLRPGCCAVVGIPEEVLAQKGISIPDSSDQVGLVVIAE  1071

Query  3343  VRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTL  3522
             VR+GK +  +V+++I  RV EEHGV +AS+  IKPR+I KTTSGKI+R+EC ++F+  TL
Sbjct  1072  VREGKAVSKEVVNNIKARVVEEHGVAVASVKLIKPRTICKTTSGKIRRFECMRQFVDNTL  1131

Query  3523  DVIEEQ-----------------MNGERSLPRNDGIIV----PANGKISKTDIVNFLKDL  3639
              + +                   M  +RSL R    +     P +   +  +I  FL  +
Sbjct  1132  SLAKGNHVSKKKGLFRSLTTGTGMESKRSLLRQTVDLTISHWPKSQVKNSNEITEFLTQI  1191

Query  3640  LSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADF  3819
             +S+ TGI   KIS  ++L SYG +SI VVRAAQK+S F G+ +GAIDIF+A+CI +LA F
Sbjct  1192  VSEHTGISKDKISLTDSLPSYGFDSIAVVRAAQKLSDFLGVPVGAIDIFTASCISELASF  1251

Query  3820  VESLLEKNHPMLTNSSETKISSSGI  3894
             +E+L+ K+   L    ++K+ +S +
Sbjct  1252  LENLVHKSQTQLAPWPKSKVKNSKV  1276


 Score =  1266 bits (3276),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 643/1194 (54%), Positives = 829/1194 (69%), Gaps = 24/1194 (2%)
 Frame = +1

Query  3616  IVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSAT  3795
             I+ FL  ++S QTGIP  KIS  ++L SYG +SI VV+AAQK+S F G+ +GAIDIF+A 
Sbjct  1277  IIEFLTKIVSDQTGIPKDKISPMDSLPSYGFDSIAVVQAAQKLSDFLGVPVGAIDIFTAG  1336

Query  3796  CIDDLADFVESLLEKNHPMLTNSS----ETKISSSGIPSVVSTFDKITIWLIHLVALAYV  3963
             CI +LA F+E+L  K+   L   +    E +     + ++   F  +   ++ L+AL YV
Sbjct  1337  CISELATFLENLAHKSQSQLAPGASCYIEDETQVDPMDAISPEFSVLGTGILQLLALTYV  1396

Query  3964  SLLLIIPAYIS----VSMFKPLILANQSPWFFYFISLACAPFSWMLCIFLTCICTRLLGN  4131
               +L++PAY++    +S+F  + L       +    +  AP  W+  I LT +   +LG 
Sbjct  1397  CFVLLLPAYLASSTYMSIFSTVSLVRSPLLSYLSSLV-MAPIVWIFYISLTSLSLSILGK  1455

Query  4132  ALLQPNYVLNPEISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIAS  4311
             + LQPNYVL P++S+WSV+FVKWWAL KAQ +++K+LAVHL+GT+FLNYWFK+ GA+I S
Sbjct  1456  SFLQPNYVLIPDVSIWSVDFVKWWALNKAQALAAKMLAVHLKGTIFLNYWFKMQGARIGS  1515

Query  4312  SALIDTVDITDPLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQK  4491
             S +IDTVDITDP L+++ + +V++EGAL+Q HEV N VLSF  + IG  +SIGPYAVLQK
Sbjct  1516  SVVIDTVDITDPSLLTVADGAVLAEGALVQGHEVCNEVLSFRPIWIGCEASIGPYAVLQK  1575

Query  4492  GSIVGDGAEVLAQNKKAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLN  4671
             G++V DGA V    K  A K ++       + +  I+K     +  +  L  IY +G L 
Sbjct  1576  GTVVEDGAVVPPLQKTGAGKSTR----RTSRTSVSIKKEAAKANMILEHLVSIYAVGILG  1631

Query  4672  SLSAAIAYLVWIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGM  4851
             +LS AI Y ++  L  K  S  HF F CIAGAFHW P  I  +  +    P S LSFA  
Sbjct  1632  ALSGAIVYTLYTHLSGKAASPLHFSFACIAGAFHWLPAAITAYAVIVQETPTSALSFALF  1691

Query  4852  VAAGYTAHGLILSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELF  5031
              A    ++G+ILS+ T + +  ++ K  T +      I  R+ ++ H+RFAK+LSGTE F
Sbjct  1692  TAFADLSYGVILSILTSITSRALAAKPGTKQNGIASLIHRRITISAHVRFAKMLSGTEAF  1751

Query  5032  CVYLHWMGAKIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDI  5211
             CVYL  +GAKIG+HCSIRAINPV  P L+SV DGVHLGDF  IVPG+++ GG+ S  I +
Sbjct  1752  CVYLRLLGAKIGRHCSIRAINPVANPELISVGDGVHLGDFCNIVPGFYSKGGFTSAEIKV  1811

Query  5212  RENSVIGSQGLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDD  5391
             +EN+V+GS  L+LPG  ++++VILGALSVAP N+VL   G +VGS++  MV+N  L  D+
Sbjct  1812  QENTVVGSGSLLLPGCVLQENVILGALSVAPENAVLRRGGVYVGSQSPAMVKNTLLDEDE  1871

Query  5392  RIEEMDPKYKKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGP  5571
             RIEEMD  YKK++G+LAANLA +T+ +KSRYFHRIG +G+G LR+Y  +P  P HKIF  
Sbjct  1872  RIEEMDQAYKKIVGNLAANLAITTMNVKSRYFHRIGVSGRGVLRMYEEIPSFPRHKIFAS  1931

Query  5572  GATYPVIIRHSNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHART  5751
             G ++PVI+RHSN LS+DDDARLD RGAA+RIL           PLLDLTLK+GKAF+ART
Sbjct  1932  GKSFPVIVRHSNSLSADDDARLDARGAAVRILSDN----DGEAPLLDLTLKSGKAFYART  1987

Query  5752  IGDFATWLVCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEM  5931
             I DFATWLVCG  AREE VK +PHIRDA+WGSLR  +SYT LHYYSNICRL RF DG+EM
Sbjct  1988  IADFATWLVCGLPAREEQVKRSPHIRDAVWGSLRSTDSYTVLHYYSNICRLLRFDDGREM  2047

Query  5932  YVRFKLRPFDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKV  6111
             Y +FKLRP D  + E+ G+V PRGILPPETGAIPRDE+D RPLLFLA+DF+ RV SPD V
Sbjct  2048  YAKFKLRPADPDVPEDSGKVVPRGILPPETGAIPRDEDDTRPLLFLADDFRRRVGSPDGV  2107

Query  6112  RYVLQLQIQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPF  6291
             RYV QLQ++ +P D   R+  LDCT+PWDE E PYI+VGE++I + L  +E+E+LEFNPF
Sbjct  2108  RYVFQLQLREVPTDAAARDVALDCTRPWDEAEFPYIDVGEVSIGRNLPTEETEKLEFNPF  2167

Query  6292  FRCNEIDVIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGC  6471
              RC E+DVI ATSC QSASIDHGRSLVYEICQ LRN +PLP +WR FL+QSD K+DLSGC
Sbjct  2168  LRCPEVDVIPATSCAQSASIDHGRSLVYEICQRLRNGEPLPASWRAFLEQSDTKIDLSGC  2227

Query  6472  PLAA-----KLENKDMPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFY  6636
             P+AA     +    D  K TLAR WY  LW    QP LQ ++PY +LGLVI+ PL  L  
Sbjct  2228  PVAAAATPTRSNAGDATKVTLARTWYQALWATLCQPLLQTLVPYSVLGLVIFLPLRGLLA  2287

Query  6637  THEMTQIQKQWLLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQA  6816
                 T+    WLLP +W  SG+ A   CA +KW LVG +  G T  IWS  +F+DT+WQA
Sbjct  2288  VAAATRFPLYWLLPAFWAASGVAAMATCAAAKWALVGSRVDGDTVHIWSPAVFLDTVWQA  2347

Query  6817  IRTVTGEYFMETATGTFLMGIWMRLMGSEVAR-DGVYIDSMGATLNPDMVRIEEYGSVGR  6993
             +R  T EYF E   G+     WMR+MG+ V+  DGVY+DSMGA LNP+MVR+E   +VGR
Sbjct  2348  VRAATAEYFAELTPGSAPFAAWMRVMGASVSPGDGVYVDSMGALLNPEMVRLERGAAVGR  2407

Query  6994  EALLFGHIYEG-GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             +ALLFGH+YEG  G+VK+G +SV   GFVGSRAVAMP  T+D GG L AL LAM
Sbjct  2408  DALLFGHVYEGEAGKVKFGAVSVGEDGFVGSRAVAMPSVTVDDGGCLAALGLAM  2461



>emb|CAE02881.2| OSJNBb0022F23.18 [Oryza sativa Japonica Group]
 gb|EAZ31066.1| hypothetical protein OsJ_15162 [Oryza sativa Japonica Group]
Length=2391

 Score =  1422 bits (3680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 704/1224 (58%), Positives = 905/1224 (74%), Gaps = 54/1224 (4%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+    +DD F KLHP +P  TRIGIVGAGPSGLSAAYAL KLGY NV + EK H+  GM
Sbjct  1     MDPKRSIDDQFSKLHPSLPVDTRIGIVGAGPSGLSAAYALAKLGYRNVTLFEKCHTVSGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRV  660
             CESIDI+                       +E+G++ EEMDTHKL+L+DS      D+ V
Sbjct  61    CESIDIE-----------------------EELGSDFEEMDTHKLSLIDSQTGNIRDLEV  97

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             AEDY+S++ +TLKLQDE   + R G++++S +ASD T EFLK  G+ S+PKSVAYGYTAS
Sbjct  98    AEDYVSMVSLTLKLQDEANKSGRAGLHALSGLASDPTHEFLKQNGINSMPKSVAYGYTAS  157

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF+QDMPYA+I EF RTSMAGKIRRFK GY S+W++LS+++P +  C+T+VL++KRNS
Sbjct  158   GYGFVQDMPYAFIQEFTRTSMAGKIRRFKHGYMSMWERLSKSLPFEVFCDTQVLNVKRNS  217

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
              G  V +++ NG  Q +EFDKII+SGA  F N +TYRS S        + ++++ LE++L
Sbjct  218   CGANVTIKNNNGEKQVLEFDKIILSGAVAFKNSKTYRSSSLTDGE--SEVVELNNLEREL  275

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             FSKVQTI+YYT+V++I+G EH+P GFYYF  FMEDP  IG+PVAMQ+F+ DTN+FLFWSY
Sbjct  276   FSKVQTIDYYTTVVKINGFEHIPKGFYYFGEFMEDPTTIGHPVAMQRFFADTNIFLFWSY  335

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GNS DI GS V +     V  MGG V+KVILQR FKYFPHV+ +DMKDGFYE+LE+QLQG
Sbjct  336   GNSADIKGSFVAKCVTDVVSSMGGNVQKVILQRRFKYFPHVSSKDMKDGFYERLESQLQG  395

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
               NTYYVGGL+AFELTERNASYS+  + KHFA D      PYVKRLFPL  +      + 
Sbjct  396   FQNTYYVGGLLAFELTERNASYSIMAVCKHFAIDGEGELTPYVKRLFPLSHNRNPSPPRD  455

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             L E+ GV+FP+L SLD YL++WGT  VTE   +YTW+NE+G +++RRTY+E+H NA  IA
Sbjct  456   LGELEGVEFPDLPSLDGYLQYWGTHKVTEKNVIYTWINEEGKLMNRRTYQELHGNASYIA  515

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
             QKLLTS KP IKPGD+VLLI++PGL+F+DAFFGC+RA VIP+P +PPDP Q  GGQALL 
Sbjct  516   QKLLTSTKPVIKPGDRVLLIHLPGLEFIDAFFGCIRAGVIPVPVLPPDPMQ-SGGQALLK  574

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSWVkkp  2277
             + NI+K+CN VAILST SYH  VR    KN++   K   K S  WPD+PW+HTDSW+K  
Sbjct  575   VENISKMCNAVAILSTSSYHAAVRAGYIKNIVTLAKRVQKCSAQWPDIPWIHTDSWIKNY  634

Query  2278  klfkkpkDEQ----GQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTS  2445
             +      +       +P   DLCFLQFTSGST D KGVMITH G+IHNVK M+KRY+STS
Sbjct  635   RRSSDSFNSDTVLFTKPQPSDLCFLQFTSGSTGDAKGVMITHEGLIHNVKTMKKRYRSTS  694

Query  2446  RTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAP  2625
             +T+LVSWLPQYHDMGLIGGL T LVSGG+ +LFSP+ F++NPLLWLQT++ +  THSA P
Sbjct  695   KTVLVSWLPQYHDMGLIGGLFTALVSGGTSVLFSPMIFIRNPLLWLQTINDYHGTHSAGP  754

Query  2626  NFAFELLVRRLESSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGY  2805
             NFAFEL++RRLE+ K + +DLSSM FLM AAEP+RQ T++RF+ELTQ FGLS  V+APGY
Sbjct  755   NFAFELVIRRLEAEKNKVYDLSSMVFLMIAAEPVRQKTVRRFIELTQPFGLSEGVLAPGY  814

Query  2806  GLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEG  2985
             GLAENCV+V+CA+GE  PVF+DWQGRVCCGY++Q +TD + I+I+ P++  E+ + G EG
Sbjct  815   GLAENCVYVTCAFGECKPVFIDWQGRVCCGYVEQDDTDTL-IRIVDPDSLTEHQEDGVEG  873

Query  2986  EIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLI  3165
             EIWISS S+G+GYWG  E+SQ+TF N + + P K++ RTGDLGR ID  LFITGR KDLI
Sbjct  874   EIWISSPSSGVGYWGNSEMSQRTFFNQLKNHPNKKFTRTGDLGRTIDGNLFITGRIKDLI  933

Query  3166  IVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEV  3345
             IVAG+NIY++D+EKTVESSSE++RPGCCAVVGIPE+VL  KGI    +SD++GLVVIAEV
Sbjct  934   IVAGRNIYSADVEKTVESSSEVLRPGCCAVVGIPEEVLAQKGISIPDSSDQVGLVVIAEV  993

Query  3346  RDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLD  3525
             R+GK +  +V+++I  RV EEHGV +AS+  IKPR+I KTTSGKI+R+EC ++F+  TL 
Sbjct  994   REGKAVSKEVVNNIKARVVEEHGVAVASVKLIKPRTICKTTSGKIRRFECMRQFVDNTLS  1053

Query  3526  VIEEQ-----------------MNGERSLPRNDGIIV----PANGKISKTDIVNFLKDLL  3642
             + +                   M  +RSL R    +     P +   +  +I  FL  ++
Sbjct  1054  LAKGNHVSKKKGLFRSLTTGTGMESKRSLLRQTVDLTISHWPKSQVKNSNEITEFLTQIV  1113

Query  3643  SQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFV  3822
             S+ TGI   KIS  ++L SYG +SI VVRAAQK+S F G+ +GAIDIF+A+CI +LA F+
Sbjct  1114  SEHTGISKDKISLTDSLPSYGFDSIAVVRAAQKLSDFLGVPVGAIDIFTASCISELASFL  1173

Query  3823  ESLLEKNHPMLTNSSETKISSSGI  3894
             E+L+ K+   L    ++K+ +S +
Sbjct  1174  ENLVHKSQTQLAPWPKSKVKNSKV  1197


 Score =  1266 bits (3275),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 643/1194 (54%), Positives = 829/1194 (69%), Gaps = 24/1194 (2%)
 Frame = +1

Query  3616  IVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSAT  3795
             I+ FL  ++S QTGIP  KIS  ++L SYG +SI VV+AAQK+S F G+ +GAIDIF+A 
Sbjct  1198  IIEFLTKIVSDQTGIPKDKISPMDSLPSYGFDSIAVVQAAQKLSDFLGVPVGAIDIFTAG  1257

Query  3796  CIDDLADFVESLLEKNHPMLTNSS----ETKISSSGIPSVVSTFDKITIWLIHLVALAYV  3963
             CI +LA F+E+L  K+   L   +    E +     + ++   F  +   ++ L+AL YV
Sbjct  1258  CISELATFLENLAHKSQSQLAPGASCYIEDETQVDPMDAISPEFSVLGTGILQLLALTYV  1317

Query  3964  SLLLIIPAYIS----VSMFKPLILANQSPWFFYFISLACAPFSWMLCIFLTCICTRLLGN  4131
               +L++PAY++    +S+F  + L       +    +  AP  W+  I LT +   +LG 
Sbjct  1318  CFVLLLPAYLASSTYMSIFSTVSLVRSPLLSYLSSLV-MAPIVWIFYISLTSLSLSILGK  1376

Query  4132  ALLQPNYVLNPEISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIAS  4311
             + LQPNYVL P++S+WSV+FVKWWAL KAQ +++K+LAVHL+GT+FLNYWFK+ GA+I S
Sbjct  1377  SFLQPNYVLIPDVSIWSVDFVKWWALNKAQALAAKMLAVHLKGTIFLNYWFKMQGARIGS  1436

Query  4312  SALIDTVDITDPLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQK  4491
             S +IDTVDITDP L+++ + +V++EGAL+Q HEV N VLSF  + IG  +SIGPYAVLQK
Sbjct  1437  SVVIDTVDITDPSLLTVADGAVLAEGALVQGHEVCNEVLSFRPIWIGCEASIGPYAVLQK  1496

Query  4492  GSIVGDGAEVLAQNKKAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQLFGIYMIGYLN  4671
             G++V DGA V    K  A K ++       + +  I+K     +  +  L  IY +G L 
Sbjct  1497  GTVVEDGAVVPPLQKTGAGKSTR----RTSRTSVSIKKEAAKANMILEHLVSIYAVGILG  1552

Query  4672  SLSAAIAYLVWIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGM  4851
             +LS AI Y ++  L  K  S  HF F CIAGAFHW P  I  +  +    P S LSFA  
Sbjct  1553  ALSGAIVYTLYTHLSGKAASPLHFSFACIAGAFHWLPAAITAYAVIVQETPTSALSFALF  1612

Query  4852  VAAGYTAHGLILSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELF  5031
              A    ++G+ILS+ T + +  ++ K  T +      I  R+ ++ H+RFAK+LSGTE F
Sbjct  1613  TAFADLSYGVILSILTSITSRALAAKPGTKQNGIASLIHRRITISAHVRFAKMLSGTEAF  1672

Query  5032  CVYLHWMGAKIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDI  5211
             CVYL  +GAKIG+HCSIRAINPV  P L+SV DGVHLGDF  IVPG+++ GG+ S  I +
Sbjct  1673  CVYLRLLGAKIGRHCSIRAINPVANPELISVGDGVHLGDFCNIVPGFYSKGGFTSAEIKV  1732

Query  5212  RENSVIGSQGLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLDD  5391
             +EN+V+GS  L+LPG  ++++VILGALSVAP N+VL   G +VGS++  MV+N  L  D+
Sbjct  1733  QENTVVGSGSLLLPGCVLQENVILGALSVAPENAVLRRGGVYVGSQSPAMVKNTLLDEDE  1792

Query  5392  RIEEMDPKYKKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFGP  5571
             RIEEMD  YKK++G+LAANLA +T+ +KSRYFHRIG +G+G LR+Y  +P  P HKIF  
Sbjct  1793  RIEEMDQAYKKIVGNLAANLAITTMNVKSRYFHRIGVSGRGVLRMYEEIPSFPRHKIFAS  1852

Query  5572  GATYPVIIRHSNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHART  5751
             G ++PVI+RHSN LS+DDDARLD RGAA+RIL           PLLDLTLK+GKAF+ART
Sbjct  1853  GKSFPVIVRHSNSLSADDDARLDARGAAVRILSDN----DGEAPLLDLTLKSGKAFYART  1908

Query  5752  IGDFATWLVCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQEM  5931
             I DFATWLVCG  AREE VK +PHIRDA+WGSLR  +SYT LHYYSNICRL RF DG+EM
Sbjct  1909  IADFATWLVCGLPAREEQVKRSPHIRDAVWGSLRSTDSYTVLHYYSNICRLLRFDDGREM  1968

Query  5932  YVRFKLRPFDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKV  6111
             Y +FKLRP D  + E+ G+V PRGILPPETGAIPRDE+D RPLLFLA+DF+ RV SPD V
Sbjct  1969  YAKFKLRPADPDVPEDSGKVVPRGILPPETGAIPRDEDDTRPLLFLADDFRRRVGSPDGV  2028

Query  6112  RYVLQLQIQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPF  6291
             RYV QLQ++ +P D   R+  LDCT+PWDE E PYI+VGE++I + L  +E+E+LEFNPF
Sbjct  2029  RYVFQLQLREVPTDAAARDVALDCTRPWDEAEFPYIDVGEVSIGRNLPTEETEKLEFNPF  2088

Query  6292  FRCNEIDVIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSGC  6471
              RC E+DVI ATSC QSASIDHGRSLVYEICQ LRN +PLP +WR FL+QSD K+DLSGC
Sbjct  2089  LRCPEVDVIPATSCAQSASIDHGRSLVYEICQRLRNGEPLPASWRAFLEQSDTKIDLSGC  2148

Query  6472  PLAA-----KLENKDMPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFY  6636
             P+AA     +    D  K TLAR WY  LW    QP LQ ++PY +LGLVI+ PL  L  
Sbjct  2149  PVAAAATPTRSNAGDATKVTLARTWYQALWATLCQPLLQTLVPYSVLGLVIFLPLRGLLA  2208

Query  6637  THEMTQIQKQWLLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQA  6816
                 T+    WLLP +W  SG+ A   CA +KW LVG +  G T  IWS  +F+DT+WQA
Sbjct  2209  VAAATRFPLYWLLPAFWAASGVAAMATCAAAKWALVGSRVDGDTVHIWSPAVFLDTVWQA  2268

Query  6817  IRTVTGEYFMETATGTFLMGIWMRLMGSEVAR-DGVYIDSMGATLNPDMVRIEEYGSVGR  6993
             +R  T EYF E   G+     WMR+MG+ V+  DGVY+DSMGA LNP+MVR+E   +VGR
Sbjct  2269  VRAATAEYFAELTPGSAPFAAWMRVMGASVSPGDGVYVDSMGALLNPEMVRLERGAAVGR  2328

Query  6994  EALLFGHIYEG-GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             +ALLFGH+YEG  G+VK+G +SV   GFVGSRAVAMP  T+D GG L AL LAM
Sbjct  2329  DALLFGHVYEGEAGKVKFGAVSVGEDGFVGSRAVAMPSVTVDDGGCLAALGLAM  2382



>ref|XP_002448025.1| hypothetical protein SORBIDRAFT_06g019820 [Sorghum bicolor]
 gb|EES12353.1| hypothetical protein SORBIDRAFT_06g019820 [Sorghum bicolor]
Length=2387

 Score =  1376 bits (3562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 700/1226 (57%), Positives = 893/1226 (73%), Gaps = 61/1226 (5%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+ G  +DD F KLHP +P  TRI IVGAGPSGLSAAYAL KLGY NV V EK H   GM
Sbjct  1     MDLGKSIDDKFSKLHPSLPVDTRIVIVGAGPSGLSAAYALAKLGYHNVTVFEKCHHVSGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRV  660
             CESIDI                        +E+G+E EEMDTHKLAL+DS      D+ V
Sbjct  61    CESIDI-----------------------EEELGSEFEEMDTHKLALIDSQTGNIRDLEV  97

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             AEDY+S++ +TLKLQDE   + R+G+++VS +ASD T +FLK  G+ S+PKSV YGYTAS
Sbjct  98    AEDYVSMVSLTLKLQDEANRSGRVGIHAVSGLASDPTLDFLKQHGISSMPKSVVYGYTAS  157

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF+QDMPYA+IHEF RTSMAGKIRRFK GY S+W+KLS ++P +  C TEVL +KR++
Sbjct  158   GYGFVQDMPYAFIHEFTRTSMAGKIRRFKHGYMSLWEKLSRSLPFEVLCGTEVLRVKRDN  217

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
                 V  ++ NG ++  EFDKII+SGA PF NG+TYRS S        + ++++ LE++L
Sbjct  218   CVASVTFKNSNGDVEVREFDKIILSGALPFKNGKTYRSLSMTDGE--NEVVELNDLEREL  275

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             FSKV+TI+YYT+V++I+G EH+P GF+YF  +MEDP  +G+PVAMQ+F+ DTN+FLFWSY
Sbjct  276   FSKVRTIDYYTTVVKIEGFEHMPKGFFYFGEYMEDPTTVGHPVAMQRFFADTNIFLFWSY  335

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQG  1560
             GNS DI    V +     V  MGG V+KV+LQR FKYFPHV+ +DMK+GFYEK+E+QLQG
Sbjct  336   GNSADIKEPYVAKCVTDVVTSMGGTVQKVLLQRRFKYFPHVSSEDMKNGFYEKVESQLQG  395

Query  1561  QLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
               NTY+VGGL+AFELTERN  YS++ + KHFA    +P  PYVKRLFPL   +     + 
Sbjct  396   FQNTYFVGGLLAFELTERNVLYSISAVCKHFAIASELPMIPYVKRLFPLSKGNPSPP-RD  454

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             + E+ GV+FP L SLD YL++WGT  VT  K +YTW+NEKG +++RRTY+E+H NA  IA
Sbjct  455   IGELEGVEFPHLPSLDGYLQYWGTHRVTAEKFIYTWINEKGKIVNRRTYQELHDNASYIA  514

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
              +LLTS KP IKPGD+VLLI++PGL+FVDAFFGC+RA VIP+P +PPDP QRGG QALL 
Sbjct  515   YRLLTSTKPIIKPGDRVLLIHLPGLEFVDAFFGCIRAGVIPVPVLPPDPMQRGG-QALLK  573

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWPDLPWLHTDSWVkkp  2277
             + N++KVCN VAILST SYH  VR    KN++   +S  K S  WPDLPW+HTDSW+K  
Sbjct  574   VENVSKVCNAVAILSTSSYHAAVRAGYIKNIVTLAQSAQKCSAQWPDLPWIHTDSWIKNY  633

Query  2278  klfkkpkDEQG--------QPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRY  2433
             +      + +         QP   +LCFLQFTSGST D KGVMITH G+IHNVK+M+KRY
Sbjct  634   RRSPGSFNSESVVPMITKTQP--SELCFLQFTSGSTGDAKGVMITHSGLIHNVKMMKKRY  691

Query  2434  KSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATH  2613
             +STS+T+L+SWLPQYHDMGLIGGL T LVSGG+ ILFSP+TF++NPLLWL+T+S +  TH
Sbjct  692   RSTSKTVLISWLPQYHDMGLIGGLFTTLVSGGTSILFSPMTFIRNPLLWLETISDYHGTH  751

Query  2614  SAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVM  2793
             SA PNFAFEL++RRLE+ K + +DLSSM FLM AAEP+RQ T+KRF+ELTQ  G S  V+
Sbjct  752   SAGPNFAFELVIRRLEAEKNKTYDLSSMIFLMIAAEPVRQKTVKRFIELTQPLGFSEGVL  811

Query  2794  APGYGLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDP  2973
             APGYGLAENCV+V CA+GE  P+ +DWQGR+CCGY+  PN   V IKI+ P++  E+ + 
Sbjct  812   APGYGLAENCVYVCCAFGECKPISIDWQGRICCGYV-DPNDTDVVIKIVDPDSLTEHQED  870

Query  2974  GKEGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRT  3153
             G EGEIWISS S+G+GYW  +E SQ+TF N + + P  ++ RTGDLGRIID KLFITGR 
Sbjct  871   GAEGEIWISSSSSGVGYWNNKETSQRTFCNWLKNYPNIKFTRTGDLGRIIDGKLFITGRI  930

Query  3154  KDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVV  3333
             KDLIIVAG+NIY++D+EKTVE SS+++RPGCCAVVG+PE+VL  KGI    +SD++GLVV
Sbjct  931   KDLIIVAGRNIYSADVEKTVEGSSDVLRPGCCAVVGVPEEVLTQKGISIPDSSDQVGLVV  990

Query  3334  IAEVRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFIS  3513
             IAEVRDGK +  ++ D I TRVAEEHGV IAS+  IKPR+ISKTTSGKI+R+EC K+F+ 
Sbjct  991   IAEVRDGKVVSENIADSIRTRVAEEHGVTIASVKLIKPRTISKTTSGKIRRFECMKQFVD  1050

Query  3514  GTLDV-----IEEQMNGERSLPRNDGIIV----------------PANGKISKTDIVNFL  3630
              TL +     I ++ +  RSL    G+ +                P +   +  +IV FL
Sbjct  1051  NTLSLASGNHISKKKSLFRSLTTGTGMEIKRPFLKHTVDSTIHPQPRSKVKNFMEIVGFL  1110

Query  3631  KDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDL  3810
               L+S QTGI   KIS  ++L SYG +SI VVRAAQK+S F G  +GAIDIF+A+ I +L
Sbjct  1111  MQLVSDQTGISKDKISPNDSLPSYGFDSIAVVRAAQKLSDFLGTPVGAIDIFTASSISEL  1170

Query  3811  ADFVESLLEKNHPMLTNSSETKISSS  3888
             A+ +E+L+ K+ P L      K+  S
Sbjct  1171  ANSLENLVLKSQPQLAPQPRCKVKRS  1196


 Score =  1274 bits (3296),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 640/1194 (54%), Positives = 837/1194 (70%), Gaps = 25/1194 (2%)
 Frame = +1

Query  3610  TDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFS  3789
             ++I+ FL  ++S Q GIP  KIS  ++L SYG +SI VVR AQK+S F GI +GAIDIF+
Sbjct  1197  SEIIEFLTQIVSDQAGIPKDKISPTDSLPSYGFDSIAVVRTAQKLSDFLGIPVGAIDIFT  1256

Query  3790  ATCIDDLADFVESLLEKNHPMLT-NSSETKISSSGIPSVVSTFD--KITIWLIHLVALAY  3960
             A+CI +L  F+E+L  K+ P L  + S +    + + +  ++FD        + L+AL Y
Sbjct  1257  ASCIAELGSFLENLARKSQPQLEPDVSHSAEDENLVITDATSFDLSVFATGTLQLLALTY  1316

Query  3961  VSLLLIIPAYISVSMFKPLILANQSPWFFYFISLAC---APFSWMLCIFLTCICTRLLGN  4131
             V  +L++PAY++ SM+  +I +           L+    AP +W+     T +    LG 
Sbjct  1317  VCFILLLPAYLASSMYMSMISSVSLVKSSLLSYLSSLVLAPIAWICYALFTSLSLSTLGK  1376

Query  4132  ALLQPNYVLNPEISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIAS  4311
               LQPNYVL P+IS+WSV+FVKWWAL KAQ +++K+LAVHL+GTVFLNYWFK+ GA+I S
Sbjct  1377  PFLQPNYVLTPDISIWSVDFVKWWALNKAQSLAAKMLAVHLKGTVFLNYWFKMQGARIGS  1436

Query  4312  SALIDTVDITDPLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQK  4491
               +IDTVDITDP L+++ + +VI+EG LIQSHEV+N VLSF  ++IG+++SIGPYAV+QK
Sbjct  1437  DVVIDTVDITDPSLLAVADSAVIAEGVLIQSHEVRNEVLSFRHIKIGQKASIGPYAVIQK  1496

Query  4492  GSIVGDGAEVLAQNKKAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQ-LFGIYMIGYL  4668
             G+IV  G  +    K    K + P +G    +     K   G  N  F+ LF IY +G+L
Sbjct  1497  GTIVHGGVVIPPLQKTEQGKSAYPPSGASAYM-----KDEAGTANMAFEHLFSIYAVGFL  1551

Query  4669  NSLSAAIAYLVWIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAG  4848
              +LS A  ++++        SL HF F C+AGAFHW P +I  +  +      S + FA 
Sbjct  1552  GALSGATVFMLYTHFSGTTASLQHFSFACVAGAFHWLPAVIAAYAVIVRETTKSPVEFAL  1611

Query  4849  MVAAGYTAHGLILSVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTEL  5028
              +A  Y ++G+I+S+ T + N  ++ +  T K      I  R+ +A H+RFAK++SGTE 
Sbjct  1612  FIAFAYLSYGIIVSLLTSVANKALATRSGTKKKDMASLIQQRITIAAHLRFAKMISGTEA  1671

Query  5029  FCVYLHWMGAKIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRID  5208
             FC+YL  +GAKIG+HCSIRAINPV  P L+S+ DGVHLGDF  IVPG+++ G + S  I 
Sbjct  1672  FCMYLRLLGAKIGRHCSIRAINPVANPQLISIGDGVHLGDFCNIVPGFYSKG-FTSAEIK  1730

Query  5209  IRENSVIGSQGLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTLPLD  5388
             +++N+V+GS  L+LPGS ++++VILGALSVAP  S+L   G +VG+++L +V+N  L  D
Sbjct  1731  VQDNTVVGSGSLLLPGSVLQENVILGALSVAPQGSILLQGGVYVGAQSLTLVKNTLLTED  1790

Query  5389  DRIEEMDPKYKKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHKIFG  5568
             +RI EMDP YKK++G+LAANLA +T+ +KSRYFHRIG +G+G LR+Y  +P LP HKIFG
Sbjct  1791  ERIAEMDPMYKKIVGNLAANLAITTMNVKSRYFHRIGVSGRGVLRMYQDIPSLPKHKIFG  1850

Query  5569  PGATYPVIIRHSNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHAR  5748
              G ++PVI+RHSN LS+DDDARLD RGA++RIL  +        PLLDLTLK+G AF+AR
Sbjct  1851  AGKSFPVIVRHSNSLSADDDARLDARGASVRILSDD-----GEVPLLDLTLKSGNAFYAR  1905

Query  5749  TIGDFATWLVCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDGQE  5928
             TI DFATWLVCG  AREE VK APHIRDA+WGSLR  +SYT LHYYSNICRL RF+DG++
Sbjct  1906  TIADFATWLVCGLPAREEQVKRAPHIRDAVWGSLRNTDSYTMLHYYSNICRLLRFEDGRQ  1965

Query  5929  MYVRFKLRPFDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDK  6108
             MY +FKLRP D+ I E+ G+V PRGILPPETGAIPRDE D RPLLFLA+DF+ +V SP+ 
Sbjct  1966  MYAKFKLRPADQGISEDSGQVVPRGILPPETGAIPRDEGDTRPLLFLADDFRRKVESPEG  2025

Query  6109  VRYVLQLQIQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNP  6288
             VRYV QLQ++ +P D   R+  LDCT+PWDE E PYIEVGEI+I   L  +E+E+LEFNP
Sbjct  2026  VRYVFQLQLRDVPADSATRDIALDCTRPWDEAEFPYIEVGEISIGSNLPAEETEKLEFNP  2085

Query  6289  FFRCNEIDVIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSG  6468
             F RC E+DVI ATSC QSASIDHGRSLVYEICQ +RN +PLP +WR FL+QSD K+DLSG
Sbjct  2086  FLRCQEVDVISATSCKQSASIDHGRSLVYEICQRVRNGEPLPASWRAFLEQSDTKIDLSG  2145

Query  6469  CPLAAKLEN----KDMPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFY  6636
             CP+ A   +    +   K TLAR WY  LW    QP LQ ++PYF++GLVI+ PL  L  
Sbjct  2146  CPVIAVTRSSSDVRQATKVTLARTWYQALWATLCQPLLQTLVPYFVVGLVIFLPLRGLLA  2205

Query  6637  THEMTQIQKQWLLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQA  6816
                 T +   W LP++W  SG+ A   CA +KW LVG++  G T  IW+  +F+DT+WQA
Sbjct  2206  AMA-TGMPLYWALPIFWATSGVAAMGACAAAKWTLVGRRADGDTVHIWAPPVFLDTVWQA  2264

Query  6817  IRTVTGEYFMETATGTFLMGIWMRLMGSEVA-RDGVYIDSMGATLNPDMVRIEEYGSVGR  6993
             +RTVT EYF E   G+ L   WMR MG+ VA  DGVY+DSMGA LNP+MV +E   SVGR
Sbjct  2265  VRTVTAEYFAELTPGSVLFAGWMRAMGASVAVSDGVYVDSMGALLNPEMVHLERGASVGR  2324

Query  6994  EALLFGHIYEG-GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             +ALLFGHIYEG GGEVK+GR+ V   GFVGSRAVAMPG  +D GG LGAL LAM
Sbjct  2325  DALLFGHIYEGEGGEVKFGRVHVGEDGFVGSRAVAMPGVRVDDGGCLGALRLAM  2378



>emb|CDP14081.1| unnamed protein product [Coffea canephora]
Length=1562

 Score =  1335 bits (3455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 647/1017 (64%), Positives = 788/1017 (77%), Gaps = 58/1017 (6%)
 Frame = +1

Query  4120  LLGNALLQPNYVLNPEISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGA  4299
             L GN++LQ NY L+PEIS+WS+ FVKWW+LYKAQE++SKVLAVHLRGTVFLN+WF++LGA
Sbjct  592   LFGNSVLQSNYWLSPEISIWSLGFVKWWSLYKAQEVASKVLAVHLRGTVFLNHWFRMLGA  651

Query  4300  KIASSALIDTVDITDPLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYA  4479
             KIA+SA+IDT+DITDP LVSI EE VI+EGAL+QSHEV+NG+LS S +RIG++S +GPYA
Sbjct  652   KIATSAVIDTIDITDPSLVSIGEEDVIAEGALLQSHEVRNGILSLSPIRIGQKSFVGPYA  711

Query  4480  VLQKGSIVGDGAEVLAQNKKAAAKISKPLNGHKGKVTRRIRKRNHGNHNSVFQLFGIYMI  4659
             V+QKGS +GDGAEV A          K  + + GK+ +   ++  G+ +++ Q  GIYM+
Sbjct  712   VIQKGSTIGDGAEVFALQTYEGNGDFKNSSANVGKLCQETIRKPSGSESTI-QFLGIYMV  770

Query  4660  GYLNSLSAAIAYLVWIWLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLS  4839
               L+SLSAAI YL +IW+ +K  SL HF + CI GAFHW PY ++ + A+F         
Sbjct  771   SCLSSLSAAIIYLFYIWIFEKDISLDHFGYFCICGAFHWLPYTMVAYAAIF---------  821

Query  4840  FAGMVAAGYTAHGLILSVFTFMLNHFVSRKGDTDKMTREK----WILHRMNVACHIRFAK  5007
                                              D+   EK    W  HR+NVACH+RFAK
Sbjct  822   ---------------------------------DREANEKYLSSWFAHRLNVACHVRFAK  848

Query  5008  LLSGTELFCVYLHWMGAKIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGG  5187
              LSGTE F +YL  +GAKIGQ+CSIR+IN V++P L+S+ DGVHLGDFSRI PGY+   G
Sbjct  849   FLSGTEAFAMYLRLLGAKIGQNCSIRSINAVLDPKLISIGDGVHLGDFSRITPGYYCQDG  908

Query  5188  YISGRIDIRENSVIGSQGLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVR  5367
             Y  G+I+I+ENSV+GSQ LILPG+ IE+DVILGA+S+AP N+VL+  G ++GS+  VMVR
Sbjct  909   YTYGKIEIQENSVLGSQSLILPGAVIERDVILGAISIAPSNTVLQRGGVYLGSQAPVMVR  968

Query  5368  NQTLPLDDRIEEMDPKYKKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGL  5547
             N    LD+RIEEMD  YKKVLG+LAANLAA+TLK++SRYFHRIGAAGKGSL  Y  +PG 
Sbjct  969   NIMYSLDERIEEMDVNYKKVLGNLAANLAATTLKVRSRYFHRIGAAGKGSLVFYKTIPGF  1028

Query  5548  PDHKIFGPGATYPVIIRHSNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlkt  5727
             P+HKIF PG  YP+IIRHSNCLSSDDDAR DPRGAAIRIL   ++     T         
Sbjct  1029  PNHKIFSPGRCYPIIIRHSNCLSSDDDARRDPRGAAIRILSEGKSPFLDLTLKT------  1082

Query  5728  GKAFHARTIGDFATWLVCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLF  5907
             GKAFHARTIGDFATWLVC AAAREEHVKHAPH+RDAMWGSLR+P+SY ELHYYSN  RLF
Sbjct  1083  GKAFHARTIGDFATWLVCSAAAREEHVKHAPHVRDAMWGSLRQPDSYAELHYYSNFSRLF  1142

Query  5908  RFKDGQEMYVRFKLRPFDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKF  6087
             RF++GQEMYVRFKLRPFD+ I E+ G+VEP GILPP+TG+IPRDE D RPLLFLAEDF+ 
Sbjct  1143  RFENGQEMYVRFKLRPFDKNINEDSGKVEPMGILPPDTGSIPRDEKDTRPLLFLAEDFQC  1202

Query  6088  RVSSPDKVRYVLQLQIQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKES  6267
             RV+SPDKVRYVLQLQI+P+P+D  + E  LDCTKPWDE E PY+EVGEI ID++LT++ES
Sbjct  1203  RVNSPDKVRYVLQLQIRPVPEDASITEIALDCTKPWDETEFPYMEVGEIIIDEMLTKEES  1262

Query  6268  EELEFNPFFRCNEIDVIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSD  6447
             + LEFNPFFRC+E+DVIRATS NQSAS+DHGRS+VYEICQ+LRN KPLPE WRIFLD++D
Sbjct  1263  DGLEFNPFFRCHEVDVIRATSYNQSASLDHGRSVVYEICQHLRNSKPLPETWRIFLDRTD  1322

Query  6448  VKLDLSGCPLAAKLENKDMPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNC  6627
             VKLD SGCP+AA+LE K++ K TLAR WY TLWLMS QP LQI LPYFLLGLVI  P N 
Sbjct  1323  VKLDFSGCPMAARLEKKELSKVTLARTWYTTLWLMSVQPMLQIFLPYFLLGLVINIPFNS  1382

Query  6628  LFYTHEMTQIQKQWLLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTI  6807
             +F  +E  +I   W+LPL+W  SG+L GL+C L+KW+LVGKK +G+T  IWS+  +MDTI
Sbjct  1383  IFSINESKKI---WVLPLFWVFSGLLGGLLCTLTKWILVGKKEEGETVLIWSKATYMDTI  1439

Query  6808  WQAIRTVTGEYFMETATGTFLMGIWMRLMGSEVARD-GVYIDSMGATLNPDMVRIEEYGS  6984
             WQAIRT+  EY M   +G+FL GIWM+ +GSEVA D G Y+DS  A LNP+MV+IE+YGS
Sbjct  1440  WQAIRTLVAEYLMGMTSGSFLFGIWMKTLGSEVAWDQGAYVDSTEALLNPEMVKIEKYGS  1499

Query  6985  VGREALLFGHIYEG-GGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             V REALLFGHIYEG GG+VKY +I +++GGFVGSRAVAMPG T++SGG L ALSLAM
Sbjct  1500  VEREALLFGHIYEGEGGKVKYEKIDIEDGGFVGSRAVAMPGVTVESGGKLNALSLAM  1556


 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/658 (62%), Positives = 488/658 (74%), Gaps = 73/658 (11%)
 Frame = +1

Query  1894  VHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQ  2073
             + TNA  IA KLLTSQKP I PGDKVLL+Y+PGLDFVDAFFGCLRARV+P+P IPPDP Q
Sbjct  1     MDTNASVIAYKLLTSQKPTINPGDKVLLVYLPGLDFVDAFFGCLRARVVPVPVIPPDPLQ  60

Query  2074  RGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPDLPWLH  2253
             RGG QALLHI+NIAK                                KSS  WP+LPWLH
Sbjct  61    RGG-QALLHISNIAK-------------------------------SKSSLHWPNLPWLH  88

Query  2254  TDSWVkkp--klfkkpkDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRK  2427
             TD+W+KK          D+  +P S++LCFLQFTSGST + KGVMITH G+IHNVKLMR+
Sbjct  89    TDAWIKKSIISAEYNDMDDLSEPKSDELCFLQFTSGSTGEAKGVMITHRGLIHNVKLMRR  148

Query  2428  RYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRA  2607
             RY+STSRTILVSWLPQYHDMGLIGGLLT +VSG S ILFSP+TF+++PLLWLQ +S   A
Sbjct  149   RYRSTSRTILVSWLPQYHDMGLIGGLLTSMVSGASAILFSPMTFIRDPLLWLQVISTNHA  208

Query  2608  THSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSRE  2787
             TH+A PNFAFELLVR+LE +K +NFDLSS+ FLM+AAEPIR  TLKRF+ELTQ+FGLS+E
Sbjct  209   THTAGPNFAFELLVRKLELNKVQNFDLSSLVFLMTAAEPIRPATLKRFIELTQAFGLSQE  268

Query  2788  VMAPGYGLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKEND  2967
             VMAPGYGLAENCV+V  AYGE  P+ VDWQGRVCCGY   PN   VDI+I+ PETGKE +
Sbjct  269   VMAPGYGLAENCVYVCSAYGEDKPILVDWQGRVCCGYF-NPNDKDVDIRIVDPETGKELE  327

Query  2968  DPGKEGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITG  3147
                 EGE+W+SSLS+G+                        Y+RTGDLGR+I+ KLFITG
Sbjct  328   KSENEGEVWVSSLSSGL------------------------YLRTGDLGRVIEGKLFITG  363

Query  3148  RTKDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGL  3327
             R KDLII+AG+NIY+SDIEKTVESSSE++RPGCCA V +P ++L++KGI     SD++ L
Sbjct  364   RIKDLIIIAGRNIYSSDIEKTVESSSEILRPGCCAAVSVPSEILLAKGISVPDVSDQIAL  423

Query  3328  VVIAEVRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRF  3507
             VVIAEVR+ K    +V+  I TRVAEEHGV +A+ V IKPRSISKTTSGKI+R+ECAK+F
Sbjct  424   VVIAEVRETKFSSQEVVKKIETRVAEEHGVIVAATVLIKPRSISKTTSGKIRRFECAKKF  483

Query  3508  ISGTLDVIEEQMNGE-RSLPRNDGIIVPANGKISKTDIVNFLKDLLSQQTGIPVSKISTG  3684
             I GTL VI E  + + +S P             +K DI+ FLK LLS+QTGI  +KIST 
Sbjct  484   IDGTLSVIVEPASRDNKSTP-------------NKKDIIEFLKGLLSEQTGISSAKISTT  530

Query  3685  ETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEKNHPMLT  3858
             E+LVSYGV+SIGVVRAAQ++S F G+ +GAIDIF+ATCI+DLA+F E+LL K+  + T
Sbjct  531   ESLVSYGVDSIGVVRAAQRLSDFLGVQVGAIDIFTATCIEDLANFAENLLVKSRSIPT  588



>gb|EPS61869.1| hypothetical protein M569_12923 [Genlisea aurea]
Length=1198

 Score =  1310 bits (3391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 662/1209 (55%), Positives = 879/1209 (73%), Gaps = 60/1209 (5%)
 Frame = +1

Query  3652  TGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESL  3831
             TGI  +KIST E+L+ YG++SIGVV AAQK+S F  + + AIDIF+ATCI++LADF    
Sbjct  2     TGISTNKISTKESLLCYGIHSIGVVGAAQKLSDFLNVPVCAIDIFTATCIEELADFAYDR  61

Query  3832  LEKNHPMLTNSSET-----KISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPAYIS  3996
             L K   + ++++ +     +  S+ I     +  K+ IWL+ +VAL YV  +L++PAYIS
Sbjct  62    LSKKSNLDSSNAVSAKRGEQKQSTTIMEEPCSIRKLHIWLLQVVALGYVCFMLVLPAYIS  121

Query  3997  VSMFKPLILANQS-----PWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNY-VL  4158
             +S+FK  I +  S      +  Y + L  AP  WM+CIF TC+C  +LG   LQPNY   
Sbjct  122   ISLFKSWIPSEDSMQSGRHFLDYVMVLLLAPLCWMVCIFSTCVCIAILGTPFLQPNYDAS  181

Query  4159  NPEISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDI  4338
             + E+S+W+VEFVKWWAL K QEI+SK LA+HLRGT+FLN+WFKILGAKI++++LIDT+DI
Sbjct  182   HSEVSIWTVEFVKWWALSKVQEIASKNLAIHLRGTIFLNFWFKILGAKISNASLIDTIDI  241

Query  4339  TDPLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAE  4518
             TDP LVSI E SV++EGA++QSHE+KNG+LS S ++IGK+ S+GPYA+L++G++V D  E
Sbjct  242   TDPSLVSIGENSVLAEGAMLQSHEIKNGILSMSPIKIGKKCSVGPYALLRRGTVVEDEHE  301

Query  4519  VLAQNKKAAAKISKPLNGHKGKVTRRIRKRNHGNH----NSVFQLFGIYMIGYLNSLSAA  4686
             V A      +KI+                 +H N+      + QLFGI+  G + S SAA
Sbjct  302   VKALTSTVQSKIT-----------------SHNNNMLLCAPITQLFGIWATGCMGSSSAA  344

Query  4687  IAYLVWIWLLQKP-PSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAG  4863
             I Y+++IWL  K  P++  F F C  GA+HWFPYI+I +T+M T  P ++L FA  +A  
Sbjct  345   IVYILYIWLFHKQQPAIQEFAFACAFGAYHWFPYIMIAYTSMLTGNPTNSLVFAIYLATA  404

Query  4864  YTAHGLILSVFTFMLNHFVSRKGDTDKMTRE--KWILHRMNVACHIRFAKLLSGTELFCV  5037
             Y+ +G+ILS  T  + +++SR+G  ++       W LHR+ VA H RFAKLLSGTE FC 
Sbjct  405   YSLYGIILSFLTGSVRYYISRRGGVNQSRTPIISWFLHRIVVATHTRFAKLLSGTEAFCW  464

Query  5038  YLHWMGAKIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYH----TTGGYISGRI  5205
             YL  +G++IG HCSIRA N V  P L+S+ADGVHLGDF R+VPGY+    ++GGYIS ++
Sbjct  465   YLRLLGSEIGNHCSIRATNAVSNPELISLADGVHLGDFCRLVPGYYYNSSSSGGYISKKV  524

Query  5206  DIRENSVIGSQGLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTL--  5379
             +IRENSV+GSQGLILPGS IE+DVILGALSVA  N+VL+  G FVG+   +MV+ ++   
Sbjct  525   EIRENSVVGSQGLILPGSVIERDVILGALSVAAENTVLQSGGVFVGAPKAIMVKKKSTLD  584

Query  5380  PLDDRIEEMDPKYKKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVLPGLPDHK  5559
              +D+RI ++D +YKKVLG+LAA+ A+STL++ +R  HR G +G+G LRL++ LP LPDH+
Sbjct  585   SIDERIADIDVQYKKVLGNLAASFASSTLEVSARVIHRAGVSGRGILRLFDRLPDLPDHE  644

Query  5560  IFGPGATYPVIIRHSNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAF  5739
             IF PG +Y VIIRHSN LS+DDDA+ D RGA+++IL  + +   T++ LLDL LKTG AF
Sbjct  645   IFSPGKSYSVIIRHSNALSTDDDAKPDGRGASMKILS-DHSDIITSSSLLDLILKTGNAF  703

Query  5740  HARTIGDFATWLVCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKD  5919
             HAR+IGDF  W   G AARE +VKHAPH+RDA+WGS++R ++YT+LHYYSN  RLFRFKD
Sbjct  704   HARSIGDFVIWHASGHAARELYVKHAPHVRDALWGSIKRTDTYTKLHYYSNTSRLFRFKD  763

Query  5920  GQEMYVRFKLRPFDEKIGEEY---GEVEPRGILPPE-TGAIPRDEND------KRPLLFL  6069
             G+EMYV+FKLRP+D++  E     G+VEP  I+P E    + RDE D      ++ LLFL
Sbjct  764   GREMYVKFKLRPYDDEEEELGEETGKVEPTSIIPTEFISPVSRDECDDKGGPKQQLLLFL  823

Query  6070  AEDFKFRVSSPDKVRYVLQLQIQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQV  6249
             A+DF+ RV SPD+VRY+LQLQ++PIP DE  RE  LDCTKPWDE + P+ +VGEI IDQ+
Sbjct  824   ADDFRERVLSPDRVRYILQLQMRPIPSDEAAREVALDCTKPWDEAKFPHFDVGEILIDQL  883

Query  6250  LTEKESEELEFNPFFRCNEIDVIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRI  6429
             L  +ESE LEFNPF RC  IDVIRATSC QSAS+DHGRS+VYEIC++LRN+KPLPE+WR 
Sbjct  884   LDREESESLEFNPFRRCRGIDVIRATSCTQSASLDHGRSVVYEICRHLRNKKPLPESWRR  943

Query  6430  FLDQSDVKLDLSGCPLAAKLEN---KDMPKATLARQWYVTLWLMSGQPFLQIVLPYFLLG  6600
             F+DQSDVK++ SGCP+A KLE     +  + TLAR W++TLWLMS QP LQI LP+FLLG
Sbjct  944   FVDQSDVKVNFSGCPMAGKLETSTGSNKEEVTLARPWHITLWLMSVQPLLQIFLPHFLLG  1003

Query  6601  LVIYAPLN-CLFYTHEMTQIQKQW--LLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTE  6771
             LVI+  +   L+  H++ +  + +  LLP +W  SGILAG++CAL KW LVG+K  GK E
Sbjct  1004  LVIFPSMKLALYLNHQIIKKSEMYLPLLPFFWLSSGILAGILCALCKWALVGRKKPGKVE  1063

Query  6772  PIWSRGIFMDTIWQAIRTVTGEYFMETATGTFLMGIWMRLMGSEVARD-GVYIDSMGATL  6948
              IWS  IFMDT WQ+IR V  +YF+   +G+ +  IWM+LMGS++A D GVY+DS GA L
Sbjct  1064  QIWSASIFMDTTWQSIRMVVEDYFLGMCSGSIIFNIWMKLMGSDIAWDKGVYVDSQGAAL  1123

Query  6949  NPDMVRIEEYGSVGREALLFGHIYEGG-GEVKYGRISVKNGGFVGSRAVAMPGATIDSGG  7125
             NP++V++E+YGS+GREALLFGH YEG  G VKYG + +K GG+VGSRAV MPGAT+  GG
Sbjct  1124  NPELVKVEDYGSIGREALLFGHTYEGDEGRVKYGNVVIKKGGYVGSRAVVMPGATVAVGG  1183

Query  7126  SLGALSLAM  7152
             +L  LSLAM
Sbjct  1184  ALNPLSLAM  1192



>gb|EPS61871.1| hypothetical protein M569_12922, partial [Genlisea aurea]
Length=930

 Score =  1184 bits (3063),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 573/932 (61%), Positives = 731/932 (78%), Gaps = 11/932 (1%)
 Frame = +1

Query  727   RIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTASGYGFIQDMPYAYIHEFIRTSMA  906
             +IGV+++S+IA +   EFLK++G   +PKSV  GYTASGYG++QDMPYAY+HEF RTSMA
Sbjct  1     KIGVHAISDIAPESATEFLKNQGFSKIPKSVICGYTASGYGYVQDMPYAYLHEFTRTSMA  60

Query  907   GKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNSSGVCVDVRHRNGALQAMEFDKI  1086
             GKIRRFKGGY S+W+KLS  +PI+  CNTEV+S++R+SS + + ++  N  ++  EFDKI
Sbjct  61    GKIRRFKGGYMSLWEKLSSRLPIEVCCNTEVISVRRDSSKIAIKIKTENEGIKQREFDKI  120

Query  1087  IISGAFPFHNGRTYRSPS--QKTAGLFCDKMDMSTLEKDLFSKVQTIEYYTSVLEIDGLE  1260
             IISGAFPF  G+TYRS +   K      D +D S LEK++FSKV+TI+YYT+V +I GLE
Sbjct  121   IISGAFPFTTGKTYRSTTSEHKQEEGSSDLIDASELEKEMFSKVETIDYYTTVFKIKGLE  180

Query  1261  HLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSYGNSIDILGSEVMELAKKAVI  1440
             H+P GFYYF+ FM DP+ +GNPVAMQ+FY DTN+FLFWSYGNS DI G EV +    AV 
Sbjct  181   HIPKGFYYFDEFMVDPSTMGNPVAMQRFYEDTNIFLFWSYGNSNDIQGGEVAKQIMAAVK  240

Query  1441  KMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQGQLNTYYVGGLMAFELTERNA  1620
             +MG +++ ++LQR FKYFPHV  +DMK+GFY+KLE  LQGQ NTY+VGGLMAFELTERN+
Sbjct  241   RMGAEIESMVLQRRFKYFPHVRSEDMKNGFYDKLELLLQGQNNTYFVGGLMAFELTERNS  300

Query  1621  SYSMALIRKHFANDLVVPTFPYVKRLFPLKSSSEGL--AFKQLDEIPGVKFPELSSLDSY  1794
             +YSMALIRKHFA++   P +PYVKRL  LKS  E       +LDE  GV+FP+L +LD+Y
Sbjct  301   AYSMALIRKHFADNSYEPRYPYVKRLLTLKSDQEDFINVVNKLDESMGVQFPDLPALDAY  360

Query  1795  LRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVL  1974
             L++WGT  V ++K LYTW+NE G ++ RRTYKE+++NA  IA+KL++ +KPA+K GD+VL
Sbjct  361   LKYWGTSDVIQSKVLYTWINEDGHIVARRTYKELNSNASKIAEKLISCKKPAMKTGDRVL  420

Query  1975  LIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFS  2154
             LIYVPGLDF+DAFFGCLRA ++P+P IPPDP+Q+G  Q+LLHI+NIAK CNPVAILST S
Sbjct  421   LIYVPGLDFIDAFFGCLRAGIVPVPVIPPDPSQKGR-QSLLHISNIAKSCNPVAILSTLS  479

Query  2155  YHVTVRIMSAKNMLFGKSKD-KSSNSWPDLPWLHTDSWVkkpklfkkpkDE--QGQPLSE  2325
             YH+ V+  SA N+   K +D KS   WP+LPWLHTD W+KK ++         + +  S+
Sbjct  480   YHIAVKAASASNIFALKGRDNKSYPCWPNLPWLHTDLWIKKSRISFSVSHTSFEYEAASQ  539

Query  2326  DLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGL  2505
             DLCFLQFTSGST +PKGVMIT GG+IHNVK+MR+RYKSTS T+LVSWLPQYHDMGLIGG+
Sbjct  540   DLCFLQFTSGSTGEPKGVMITQGGLIHNVKMMRRRYKSTSNTLLVSWLPQYHDMGLIGGI  599

Query  2506  LTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFD  2685
              T +VSGGS ILFSP+ F++ PLLWLQT+ ++RATHSA PNFAFELLVR+LE++K   FD
Sbjct  600   FTSMVSGGSAILFSPIAFIRKPLLWLQTIDRYRATHSAGPNFAFELLVRKLEANKSARFD  659

Query  2686  LSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAY-GEGLPV  2862
             LSSM FLM AAEP+R   L++F+ELTQ FG+S++V+APGYGLAENCV+V  AY GE   +
Sbjct  660   LSSMVFLMVAAEPVRAKALRKFIELTQPFGISQQVIAPGYGLAENCVYVCSAYGGEDNEI  719

Query  2863  FVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGIGYWGLEEL  3042
             ++DWQ RVCCGY+   N   V IKII  +T KE ++  +EGEIWISS SAG GYW  EE+
Sbjct  720   WIDWQDRVCCGYVNPNNEADVTIKIIKRDTDKECEN-SEEGEIWISSPSAGAGYWDREEI  778

Query  3043  SQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDIEKTVESS  3222
             S+ TF+N +   P +++IRTGDLGR ID KLFITGR KDL+IV G+NIY+SDIEKTVE+S
Sbjct  779   SKSTFDNYLNQYPTRKFIRTGDLGRTIDGKLFITGRIKDLMIVGGRNIYSSDIEKTVENS  838

Query  3223  SELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRD-GKPLPYDVMDHICTRV  3399
              ELV+PGCCA +G+P ++L SKGI      DE+GLV+IAEVR+    +  D++  I   V
Sbjct  839   CELVKPGCCAAIGVPNEILSSKGIQISEVPDEVGLVIIAEVRETNTTISNDMIKEIEKCV  898

Query  3400  AEEHGVPIASIVAIKPRSISKTTSGKIKRYEC  3495
             AEEHG+  ++IV IKP++ISKTTSGKIKRY+C
Sbjct  899   AEEHGIITSAIVFIKPKTISKTTSGKIKRYDC  930



>ref|XP_002970409.1| hypothetical protein SELMODRAFT_410953 [Selaginella moellendorffii]
 gb|EFJ28539.1| hypothetical protein SELMODRAFT_410953 [Selaginella moellendorffii]
Length=2385

 Score =  1113 bits (2880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 602/1234 (49%), Positives = 801/1234 (65%), Gaps = 70/1234 (6%)
 Frame = +1

Query  322   VDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGMCESIDI  501
             V +L  +LHP +  ++RI +VG GPSG+SAAYAL KLGY  V ++EKHH+ GGMCES+DI
Sbjct  6     VHELLEELHPSLSRSSRICVVGGGPSGVSAAYALWKLGYEQVTLIEKHHTVGGMCESVDI  65

Query  502   QGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRVAEDYIS  678
             QGR YDLGGQV+A  SAP I HLA+     +E+M  HKL+LVDS    Y D+ +A DYIS
Sbjct  66    QGRPYDLGGQVIARESAPNIKHLAQVARVGMEDMAAHKLSLVDSKTGTYQDLGIARDYIS  125

Query  679   VIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTASGYGFI-  855
             +I ITL LQ +  +T + GV+++S +A +   EF    G+  +P++VA GYTASGYGF  
Sbjct  126   MIQITLDLQAQAASTGKTGVHALSSLAPETAAEFAAKHGMGRIPEAVATGYTASGYGFPH  185

Query  856   -QDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNSSG--  1026
              QD+PYAY+HEF+RTSM GK+ R KGGYT +W+ ++  +P +   NT V  I+R  SG  
Sbjct  186   EQDIPYAYLHEFVRTSMFGKVCRIKGGYTGLWQGVARLLP-RVRLNTRVTEIRRRGSGRG  244

Query  1027  --VCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
               VC          + +EFDKI+ISGA PF             A    + M +   E  L
Sbjct  245   VTVCTSSSDGGEESEELEFDKIVISGAIPF-------------APPGAELMTLGDEEASL  291

Query  1201  FSKVQTIEYYTSVLEIDGLEH-LPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWS  1377
             FS+V+T++YYT+VLEI G E+  P GFYYF++ +ED   IG+PVAMQKFY DTN++LFWS
Sbjct  292   FSRVRTMDYYTTVLEISGFENKFPAGFYYFKDNVEDAKEIGHPVAMQKFYADTNIYLFWS  351

Query  1378  YGNSIDILGSEVM-ELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQL  1554
             YG +   +  E+M  L  + V ++GG V++++LQR + YFPH+  QDM+ G Y++LE+ L
Sbjct  352   YGTAQ--VSQEMMTALLLQDVARIGGTVERIVLQRKWNYFPHIGSQDMRSGLYDRLES-L  408

Query  1555  QGQLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLKS----SSE  1722
             QG  +TYYVGGL AFELTERNA+Y+M LI K+F       T   VK L    +     +E
Sbjct  409   QGCNDTYYVGGLFAFELTERNAAYAMNLIAKNFG------TPAKVKNLITGAAIKLDEAE  462

Query  1723  GLAFKQLDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHT  1902
             G   +   E  G +FP+L  LDSYL  +    V  +K LYTWL++KGD    RTY ++H 
Sbjct  463   GGDLEVTSEATGGEFPDLPCLDSYLHFYAKHSVARDKVLYTWLDDKGDESGSRTYAQLHN  522

Query  1903  NAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGG  2082
             NA TIA  L+T  K  +  GD+VLL+Y PGL+F++AFFGCLRA V+P+P IPPD   RG 
Sbjct  523   NANTIAHNLVT-HKVTLHDGDRVLLLYNPGLEFIEAFFGCLRANVLPVPLIPPDVASRGS  581

Query  2083  G----QALLHIANIAKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPDLPWL  2250
                   AL  + N+A  C   AILST +YH  VR  + ++ L  +S  + S  WP LPW+
Sbjct  582   SSSSSHALAKVENVAAACGAKAILSTVAYHTAVRASAIRDTLLSRSGGRPS--WPKLPWM  639

Query  2251  HTDSWVkkpklfkkpk-DEQGQPL-SEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMR  2424
             HTD WV K     +     +G+   SE  CFLQFTSGST DPKGV+ITH  +IHNVKLMR
Sbjct  640   HTDLWVSKQNKEAEDYFRGRGEAEESERCCFLQFTSGSTGDPKGVIITHAALIHNVKLMR  699

Query  2425  KRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWR  2604
             +RYKSTSRT+LVSWLPQYHDMGLIGGL T LVSGG+ IL SP  F++ PLLWL+ MSK+ 
Sbjct  700   RRYKSTSRTVLVSWLPQYHDMGLIGGLFTALVSGGTAILLSPTNFIRRPLLWLEAMSKYE  759

Query  2605  ATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSR  2784
             ATHSAAPNFAF+L+V ++       + LS + FLM +AEP+R +TLKRF++  +S GL  
Sbjct  760   ATHSAAPNFAFDLVVNKMNQQPGITYQLSCLKFLMVSAEPVRSSTLKRFLKTMESSGLKE  819

Query  2785  EVMAPGYGLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKEN  2964
             EV+APGYGLAENCVFVS A+G G P+ VDWQG+VCCGY+ + N D VD++I+ PETG E 
Sbjct  820   EVVAPGYGLAENCVFVSVAWGRGRPLVVDWQGKVCCGYVDRGNPD-VDVRIVDPETGVEV  878

Query  2965  DDPGKEGEIWISSLSAGIGYWGLEELSQKTFENDIL-STPGKRYIRTGDLGRIIDSKLFI  3141
              D G EGEIW+ S S G GYWG E LSQ TF   +       R++RTGDLGR++   LF+
Sbjct  879   GD-GVEGEIWVGSPSNGAGYWGNERLSQDTFHARLEGGEEANRFLRTGDLGRVVKGMLFV  937

Query  3142  TGRTKDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDEL  3321
             TGR KDLII+ G+N+Y SDIEKTVE+ S  +RPGCCA  G P   L SKGI      +  
Sbjct  938   TGRIKDLIIIRGRNVYPSDIEKTVEACSGSLRPGCCAAFGAPGRALHSKGIKVCDEDEVG  997

Query  3322  GLVVIAEVRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAK  3501
              +VV     + K  P  +  HI + VA EHG+ +AS+  +KPR+ISKT+SGKI+R +C K
Sbjct  998   VVVVAEVRDESKVDPEQLTAHISSMVASEHGLSVASVRLVKPRTISKTSSGKIRRLDCLK  1057

Query  3502  RFISGTLDVIEE---------QMNGERSLPRNDGIIV------PANGKISKTDIVNFLKD  3636
             +F    LD I           ++   R+     G+I        A+   SK ++ +FL +
Sbjct  1058  QFTEDRLDSISPTIEKTKKILRLRRSRTFSGTPGVIPPTPPPSAASVARSKAEVTSFLTE  1117

Query  3637  LLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLAD  3816
             +L+++ G+  +++ + ++   YG++S  VV AA K+SSF G+++ AIDI++A CI +LAD
Sbjct  1118  ILAEKLGLSQAQVLSTKSFADYGLDSSSVVWAAHKLSSFLGVHVAAIDIYTAGCISELAD  1177

Query  3817  FVESLLEKNHPMLTNSSETKISSSGIPSVVSTFD  3918
              VESL      +LT  S T  S   +P  +   D
Sbjct  1178  SVESL------VLTTKSSTS-SQPVVPPAIPETD  1204


 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/1265 (35%), Positives = 685/1265 (54%), Gaps = 152/1265 (12%)
 Frame = +1

Query  3556  SLPRNDGIIVPANGKISKTDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAA  3735
             ++P  D   V A G  SKT+I NF+  ++S++TGI +SK+S  ++  +YG++S+ VV A+
Sbjct  1199  AIPETD---VSAKGP-SKTEISNFICQIISERTGIDMSKLSPSQSFANYGLDSVAVVWAS  1254

Query  3736  QKISSFFGINIGAIDIFSATCIDDLADFVESLLEKNHPMLTNSSE-TKI-------SSSG  3891
             QK+S+F G+++ AIDI++A CI +L D V+ L+ K   ++T   + T+I       S  G
Sbjct  1255  QKLSNFLGVHVAAIDIYTAGCISELCDVVDGLVGKT--VVTQQQQGTEIDDKASLSSCRG  1312

Query  3892  IPSVVSTFD-------------------KITIWLIHLVALAYVSLLLIIPAYISVSMFKP  4014
              P     F+                   ++ I  + L+ + YV+  L++PA   +  F  
Sbjct  1313  GPYTDDDFEGEIVTDSQLESGILPSLQRQVCITFLQLLGIIYVAWTLLVPAAFILRQFTS  1372

Query  4015  LILANQSPWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPEISVWSVEFV  4194
             L+            ++ CAP  W+L +  T +   L G + L P   L   + +WS+ FV
Sbjct  1373  LVADRP-----VVATVLCAPLCWLLYMAATALAASL-GTSFLLPVLHLRTTVPLWSLNFV  1426

Query  4195  KWWALYKAQEISS-KVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDPLLVSIDEE  4371
             +WW  Y+ Q+ +S +++A  LRGTVF+N+W+++LGA+I S   ++T DITDP LV + + 
Sbjct  1427  RWWTCYRLQDFASARIVANQLRGTVFVNWWYRLLGAQIGSGVELETTDITDPWLVVLGDG  1486

Query  4372  SVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLAQNKKAAAK  4551
             + I EGA +Q HEVK G + F  +RIG+R SIGPY      S +G GA + A +     K
Sbjct  1487  AAIGEGATLQCHEVKAGAVQFKPIRIGRRCSIGPY------SFIGLGASLRATSVSPLGK  1540

Query  4552  IS-------KPLNGHKGKV-TRRIRKRNHGNHNSVFQLFGIYMIGYLNSLSAAIAYLVWI  4707
             +        + L     KV   R + +N     ++ Q  G+Y++  ++++S  + Y+V++
Sbjct  1541  VDGTSQLGVRHLEDDSSKVHPSRRQDKNSTMLYTLCQAAGLYVVSLVSAISGVVGYVVFV  1600

Query  4708  WLLQKPPSLHHFLFICIAGAFHWFPYIIITFTAMFTSLPVSTLSFAGMVAAGYTAHGLIL  4887
             WL+ K       L I  AGA         + T    S  +ST  +A   A       + L
Sbjct  1601  WLVDK-------LGILPAGARE-------SQTGYIVSSLLSTFPWAVTAA-------IPL  1639

Query  4888  SVFTFMLNHFVSRKGDTDKMTREKWILHRMNVACHIRFAKLLSGTELFCVYLHWMGAKIG  5067
             SVF              D  +   ++++   VA   +   L+      C+   ++G    
Sbjct  1640  SVFQ-------------DPSSIVDYLIY---VALQGKLLALV-----LCMGCAYIGYD--  1676

Query  5068  QHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGGYISGRIDIRENSVIGSQGLI  5247
                            L+ +  G HLGDF++++    T+      ++D+    V+G+Q ++
Sbjct  1677  ---------------LLDLGSGSHLGDFAKVI----TSDNGCYAKLDVGTGCVVGAQSVL  1717

Query  5248  LPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVRNQTL---PLDDRIEEMDPKY  5418
             +PGS +E+   LGALSVA     L+  G ++G EN  MV N        D RI  MD +Y
Sbjct  1718  MPGSCMEESSWLGALSVATSGFTLKQGGVYLGVENPTMVYNHASVAHEQDSRIVAMDAEY  1777

Query  5419  KKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLR-LYNVLPGLPDHKIFGPGATYPVII  5595
             +K + +L+A++  ++  +KSRYFHR G  GKG L  L ++    P H +F  G +Y V++
Sbjct  1778  RKTVANLSAHIGKTSHSVKSRYFHRAGICGKGRLTVLEDLDSSFPRHDVFSKGKSYSVVV  1837

Query  5596  RHSNCLSSDDDARLDPRGAAIRILPHERtttttttplldltlktGKAFHARTIGDFATWL  5775
             RHSN LSSDDDAR D RGA++RIL H+ ++   +   L L    G+AF+AR I DF TWL
Sbjct  1838  RHSNSLSSDDDARPDARGASLRILRHDHSSVHESLVDLTLKT--GQAFYARNIADFVTWL  1895

Query  5776  VCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNICRLFRFKDG--QEMYVRFKL  5949
                +  REE VK +PH  DA+W SLR  NSY ELHYYSN+ RLF+      +E YVRF++
Sbjct  1896  TTSSKRREEIVKDSPHRGDAVWDSLRLGNSYAELHYYSNVSRLFKSASSPKREWYVRFRM  1955

Query  5950  RPFDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDKVRYVLQL  6129
             RP D + G + G +   G+LPP+TGA+PR + D+R   +L +DF  R++SP  V YVLQL
Sbjct  1956  RPLDPQYGVDEGRIAREGVLPPDTGALPRRDKDERSPSYLRDDFARRLASPQGVDYVLQL  2015

Query  6130  QIQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNPFFRCNEI  6309
             Q++P+PD    R+  +DCT+ WDE+  PY++V  I +D+++    +E + FNP      +
Sbjct  2016  QLRPVPDSLAERDLAIDCTRAWDEQAFPYVDVAAIHLDELVDPALTEAMRFNPRNGVPSL  2075

Query  6310  DVIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKL-----------  6456
             D+I ATS  +SASIDHGRS+ Y+I QY+RN   LP AW+  L  SDV L           
Sbjct  2076  DMIPATSLRESASIDHGRSVAYDIAQYVRNGAELPGAWKALLRDSDVPLANDISNDGNIG  2135

Query  6457  --DLSGC--PLAAKLENKDMPKATLARQWYVTLWLM-SGQPFLQIVLPYFLLGLVIYAPL  6621
                LSGC  P  A L   +   AT   +  +   L+ S QP LQ++ P  LLGL   A L
Sbjct  2136  CPALSGCLPPNLAVLPETNCKTATATAKTRLKFGLIRSMQPLLQLLAPATLLGLSQLAAL  2195

Query  6622  NCLFYTHEMTQIQKQWLLPLWWGGSGILAGLVCAL----SKWVLVGKKYKGKTEP----I  6777
                         +  WL       S +++ LV +L    ++ +LVG + KG  E     +
Sbjct  2196  LPAALIASRAP-RSDWLFLALVLLSYMVSALVLSLGSISARRILVGGR-KGVQEKSRSEL  2253

Query  6778  WSRGIFMDTIWQAIRTVTGEYFMETATGTFLMGIWMRLMGSEVARDGVYIDSMGATLNPD  6957
             W      DT+WQ + +V   YF++   G+ L   ++R +G+ +   GVY+D++ A LNPD
Sbjct  2254  WGLRSLQDTVWQCVNSVACGYFLDLTKGSALSTGYLRQLGASIDTVGVYMDTLYA-LNPD  2312

Query  6958  MVRIEEYGSVGREALLFGHIYEGGGEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGA  7137
              + ++   S+GR+ALLFGH+YEGGG+V +G  SV    FVG+R++ +PG++++ G  L  
Sbjct  2313  RLSVKTGSSIGRDALLFGHVYEGGGDVHFGSNSVGEYAFVGARSLLLPGSSLEDGAELRP  2372

Query  7138  LSLAM  7152
             L LAM
Sbjct  2373  LGLAM  2377



>ref|XP_002978488.1| hypothetical protein SELMODRAFT_108866 [Selaginella moellendorffii]
 gb|EFJ20474.1| hypothetical protein SELMODRAFT_108866 [Selaginella moellendorffii]
Length=2439

 Score =  1070 bits (2767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/1229 (48%), Positives = 781/1229 (64%), Gaps = 87/1229 (7%)
 Frame = +1

Query  322   VDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGMCESIDI  501
             V +L  +LHP +P ++RI +VG GPSG+SAAYAL KLGY  V ++EKHH+ GGMCES+DI
Sbjct  6     VHELLEELHPSLPRSSRICVVGGGPSGVSAAYALWKLGYEQVTLIEKHHTVGGMCESVDI  65

Query  502   QGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRVAEDYIS  678
             Q                         VG  +E+M  HKL+LVDS    Y D+ +A DYIS
Sbjct  66    Q----------------------VARVG--MEDMAAHKLSLVDSKTGTYQDLGIARDYIS  101

Query  679   VIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTASGYGFI-  855
             +I ITL LQ +  +T + GV+++S +A +   EF    G+  +P++VA GYTASGYGF  
Sbjct  102   MIQITLDLQAQAASTGKTGVHALSSLAPETAAEFAAKHGMGRIPEAVATGYTASGYGFPH  161

Query  856   -QDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNSSG--  1026
              QD+PYAY+HEF+RTSM GK+ R KGGYT +W+ ++  +P +   NT V  I+R  SG  
Sbjct  162   EQDIPYAYLHEFVRTSMFGKVCRIKGGYTGLWQGVARLLP-RVRLNTRVTEIRRRGSGRG  220

Query  1027  --VCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
               VC          + +EFDKI+ISGA PF             A    + M +   E  L
Sbjct  221   VTVCTSSSDGGEESEELEFDKIVISGAIPF-------------APPGAELMTLGDEEASL  267

Query  1201  FSKVQTIEYYTSVLEIDGLEH-LPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWS  1377
             FS+V+T++YYT+VLEI   E+  P GFYYF++ +ED   IG+PVAMQKFY DTN++LFWS
Sbjct  268   FSRVRTMDYYTTVLEISRFENKFPAGFYYFKDNVEDAKEIGHPVAMQKFYADTNIYLFWS  327

Query  1378  YGNSIDILGSEVM-ELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQL  1554
             YGN+   +  E+M  L  + V ++GG V++++LQR + YFPH+  QDM+ G Y++LE+ L
Sbjct  328   YGNAQ--VSQEMMTALLLQDVARIGGTVERIVLQRKWNYFPHIGSQDMRSGLYDRLES-L  384

Query  1555  QGQLNTYYVGGLMAFELTERNASYSMALIRKHFANDLVVPTFPYVKRLFPLK-SSSEGLA  1731
             QG  +TYYVGGL AFELTERNA+Y+M LI K+F     V    +   L P+K   +EG  
Sbjct  385   QGCNDTYYVGGLFAFELTERNAAYAMNLIAKNFGTPAKVKVELF---LLPIKLDEAEGGD  441

Query  1732  FKQLDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAF  1911
              +   E  G +FP+L  LDSYL  +    V  +K LYTWL++KGD    RTY ++H NA 
Sbjct  442   LEVTSEATGGEFPDLPCLDSYLHFYAKHSVARDKVLYTWLDDKGDESGSRTYAQLHNNAN  501

Query  1912  TIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGG--  2085
             TIA  L+T  K  +  GD+VLL+Y PGL+F++AFFGCLRA V+P+P IPPD   RG    
Sbjct  502   TIAHNLVT-HKVTLHDGDRVLLLYNPGLEFIEAFFGCLRANVLPVPLIPPDVASRGSSSS  560

Query  2086  --QALLHIANIAKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPDLPWLHTD  2259
                AL  + N+A  C   AILST +YH  VR  + ++ L  +S  + S  WP LPW+HTD
Sbjct  561   SSHALAKVENVAAACGAKAILSTVAYHTAVRASAIRDTLLSRSGGRPS--WPKLPWMHTD  618

Query  2260  SWVkkpklfkkpk-DEQGQPL-SEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRY  2433
              WV K     +     +G+   SE  CFLQFTSGST DPKGV+ITH  +IHNVKLMR+RY
Sbjct  619   LWVSKQNKEAEDYFRGRGEAEESERCCFLQFTSGSTGDPKGVIITHSALIHNVKLMRRRY  678

Query  2434  KSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATH  2613
             KSTSRT+LVSWLPQYHDMGLIGGL T LVSGG+ IL SP  F++ PLLWL+ MSK+ ATH
Sbjct  679   KSTSRTVLVSWLPQYHDMGLIGGLFTALVSGGTAILLSPTNFIRRPLLWLEAMSKYGATH  738

Query  2614  SAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVM  2793
             SAAPNFAF+L+V ++       + LS + FLM +AEP+R +TLKRF++  +S GL  EV+
Sbjct  739   SAAPNFAFDLVVNKMNQQPGITYQLSCLKFLMVSAEPVRSSTLKRFLKTMESSGLKEEVV  798

Query  2794  APGYGLAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDP  2973
             APGYGLAENCVFVS A+G G P+ VDWQG+VCCGY+ + N D VD++I+ PETG E  D 
Sbjct  799   APGYGLAENCVFVSVAWGRGRPLVVDWQGKVCCGYVDRGNPD-VDVRIVDPETGVEVGD-  856

Query  2974  GKEGEIWISSLSAGIGYWGLEELSQKTFENDIL-STPGKRYIRTGDLGRIIDSKLFITGR  3150
             G EGEIW+ S S G GYWG E LSQ TF   +       R++RTGDLGR++   LF+TGR
Sbjct  857   GVEGEIWVRSPSNGAGYWGNERLSQDTFHARLEGGEEANRFLRTGDLGRVVKGMLFVTGR  916

Query  3151  TKDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLV  3330
              KDLII+ G+N+Y SDIEKTVE+ S  +RPGCCA  G P   L SKGI      +   +V
Sbjct  917   IKDLIIIRGRNVYPSDIEKTVEACSGSLRPGCCAAFGAPGRALHSKGIKVCDEDEVGVVV  976

Query  3331  VIAEVRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFI  3510
             V     + K  P  +  HI + VA EHG+ +AS+  +KPR+ISKT+SGKI+R +C K+F 
Sbjct  977   VAEVRDESKVDPEQLTAHISSMVASEHGLSVASVRLVKPRTISKTSSGKIRRLDCLKQFT  1036

Query  3511  SGTLDVIEEQMNGERSLPR---------------NDGIIVPANGKISKTDIVNFLKDLLS  3645
                LD I   +   + + R                      A+   SK  + +FL ++L+
Sbjct  1037  EDRLDSISPTIEKTKKILRLRRSRTFSGTPSVIPPTPPPSAASVARSKAGVTSFLTEILA  1096

Query  3646  QQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVE  3825
             ++ G+  +++ + ++   YG++S  VV AA K+SSF G+++ AIDI++A CI +LAD VE
Sbjct  1097  EKLGLSQAQVLSTKSFADYGLDSSSVVWAAHKLSSFLGVHVAAIDIYTAGCISELADSVE  1156

Query  3826  SLLEKNHPMLTNSSETKISSSGIPSVVST  3912
             SL      +LT  S T       P++  T
Sbjct  1157  SL------VLTTKSSTSSQPVVPPAIPET  1179


 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/1285 (36%), Positives = 709/1285 (55%), Gaps = 114/1285 (9%)
 Frame = +1

Query  3556  SLPRNDGIIVPANGKISKTDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAA  3735
             ++P  D   V A G  SKT+I NF+  ++S++TGI +SK+S  ++  +YG++S+ VV A+
Sbjct  1175  AIPETD---VSAKGP-SKTEISNFICQIISERTGIDLSKLSPSQSFANYGLDSVAVVWAS  1230

Query  3736  QKISSFFGINIGAIDIFSATCIDDLADFVESLLEKNHPMLTNSSE-TKI-------SSSG  3891
             QK+S+F G+++ AIDI++A CI +L D V+ L+ K   ++T   + T+I       S  G
Sbjct  1231  QKLSNFLGVHVAAIDIYTAGCISELCDVVDGLVGKT--VVTQQQQGTEIDDKASLSSCRG  1288

Query  3892  IPSVVSTFD-------------------KITIWLIHLVALAYVSLLLIIPAYISVSMFKP  4014
              P     F+                   ++ I L+ L+ + YV+  L++PA   +  F  
Sbjct  1289  GPYTDDDFEGEIVTDSQLESGILPSLQRQVCITLLQLLGIIYVAWTLLVPAAFILRQFTS  1348

Query  4015  LILANQSPWFFYFISLACAPFSWMLCIFLTCICTRLLGNALLQPNYVLNPEISVWSVEFV  4194
             L+            ++ CAP  W+L +  T +   L G + L P   L   + +WS+ FV
Sbjct  1349  LVADRP-----VVAAVLCAPLCWLLYMAATALAASL-GTSFLLPVLHLRTTVPLWSLNFV  1402

Query  4195  KWWALYKAQEISS-KVLAVHLRGTVFLNYWFKILGAKIASSALIDTVDITDPLLVSIDEE  4371
             +WW  Y+ Q+ +S +++A  LRGTVF+N+W+++LGA+I S   ++T DITDP LV + + 
Sbjct  1403  RWWTCYRLQDFASARIVATQLRGTVFVNWWYRLLGAQIGSGVELETTDITDPWLVVLGDG  1462

Query  4372  SVISEGALIQSHEVKNGVLSFSVVRIGKRSSIGPYAVLQKGSIVGDGAEVLAQNKKAAAK  4551
             + I EGA +Q HEVK G + F  +RIG+R SIGPY      S +G GA + A +      
Sbjct  1463  AAIGEGATLQCHEVKAGAVQFKPIRIGRRCSIGPY------SFIGLGASLRATSVSPLTS  1516

Query  4552  ISKPLNGHK-GKVTRRIRKRNHGNHNSVFQLFGIYMIGYLNSLSAAIAYLVWIWLLQK--  4722
                             ++ +N     ++ Q  G+Y++  ++++S  + Y+V++WL+ K  
Sbjct  1517  TGDCFFSFLLASYHLSLQDKNSTMLYTLCQAAGLYVVSLVSAISGVVGYVVFVWLVDKLG  1576

Query  4723  ------PPSLHHFLFICIAGAFHWF------------PYIIITFTAMFTSLPVSTLSFAG  4848
                     S   ++   +   F W             P  I+ +  ++ +L    L+   
Sbjct  1577  ILPAGARESQTGYIVSSLLSTFPWAVTAAIPLSVFQDPSSIVDYL-IYVALQGKLLALVL  1635

Query  4849  MVAAGYTAHGLILSVFTFMLNHFV----SRKGDTDKMTR---EKWILHRMNVACHIRFAK  5007
              +   Y  +G  L   T++L   +     RKG+  K +      W++ R+    H RF  
Sbjct  1636  CMGCAYIGYGASLCWMTWLLKWILVGKLERKGEVRKNSSFGYRLWLVRRLLATTHARFTF  1695

Query  5008  LLSGTELFCVYLHWMGAKIGQHCSIRAINPVVEPGLVSVADGVHLGDFSRIVPGYHTTGG  5187
             LL+GTE  C YL  +GAK+G   S+RAIN +++P L+ +  G HLGDF++++    T+  
Sbjct  1696  LLTGTEALCFYLRVLGAKVGDRASVRAINAILDPDLLDLGSGSHLGDFAKVI----TSDN  1751

Query  5188  YISGRIDIRENSVIGSQGLILPGSFIEKDVILGALSVAPLNSVLECCGTFVGSENLVMVR  5367
                 R+D+    V+G+Q +++PGS +E+   LGALSVA     L+  G ++G EN  MV 
Sbjct  1752  GCYARLDVGTGCVVGAQSVLMPGSCMEESSWLGALSVATSGFTLKQGGVYLGVENPTMVY  1811

Query  5368  NQTL---PLDDRIEEMDPKYKKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLR-LYNV  5535
             N        D RI  MD +Y+K + +L+A++  ++  +KSRYFHR G  GKG L  L ++
Sbjct  1812  NHASVAHEQDSRIVAMDAEYRKTVANLSAHIGKTSHSVKSRYFHRAGICGKGRLTVLEDL  1871

Query  5536  LPGLPDHKIFGPGATYPVIIRHSNCLSSDDDARLDPRGAAIRILPHERtttttttplldl  5715
                 P H +F  G +Y V++RHSN LSSDDDAR D RGA++RIL H+ ++   +   L L
Sbjct  1872  DSSFPRHDVFSKGKSYSVVVRHSNSLSSDDDARPDARGASLRILRHDHSSLHESLVDLTL  1931

Query  5716  tlktGKAFHARTIGDFATWLVCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNI  5895
                 G+AF+AR I DF TWL   +  REE VK +PH  DA+W SLR  NSY ELHYYSN+
Sbjct  1932  KT--GQAFYARNIADFVTWLTTSSKRREEIVKDSPHRGDAVWDSLRLGNSYAELHYYSNV  1989

Query  5896  CRLFRFKDG--QEMYVRFKLRPFDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFL  6069
              RLF+      +E YVRF++RP D + G + G +   G+LPP+TGA+PR + D+R   +L
Sbjct  1990  SRLFKSASSPKREWYVRFRMRPLDPQYGVDEGRIAREGVLPPDTGALPRRDKDERSPSYL  2049

Query  6070  AEDFKFRVSSPDKVRYVLQLQIQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQV  6249
              +DF  R++SP  V YVLQLQ++P+PD    R+  +DCT+ WDE+  PY++V  I +D++
Sbjct  2050  RDDFARRLASPQGVDYVLQLQLRPVPDSLAERDLAIDCTRAWDEQAFPYVDVAAIHLDEL  2109

Query  6250  LTEKESEELEFNPFFRCNEIDVIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRI  6429
             +    +E + FNP      +D+I ATS  +SASIDHGRS+ Y+I QY+RN   LP AW+ 
Sbjct  2110  VDPALTEAMRFNPRNGVPSLDMIPATSLRESASIDHGRSVAYDIAQYVRNGAELPGAWKA  2169

Query  6430  FLDQSDVKL-------------DLSGC--PLAAKLENKDMPKATLARQWYVTLWLM-SGQ  6561
              L  SDV L              LSGC  P  A L   +   AT   +  +   L+ S Q
Sbjct  2170  LLRDSDVPLANDISNDGNIGCPALSGCLPPNVAVLPETNCKTATATAKTRLKFGLIRSMQ  2229

Query  6562  PFLQIVLPYFLLGLVIYAPLNCLFYTHEMTQIQKQWLLPLWWGGSGILAGLVCAL----S  6729
             P LQ++ P  LLGL   A L            +  WL       S +++ LV +L    +
Sbjct  2230  PLLQLLAPATLLGLSQLAALLPAALIASRAP-RSDWLFLALVLLSYMVSALVLSLGSISA  2288

Query  6730  KWVLVGKKYKGKTEP----IWSRGIFMDTIWQAIRTVTGEYFMETATGTFLMGIWMRLMG  6897
             + +LVG + KG  E     +W      DT+WQ + +V   YF++   G+ L   ++R +G
Sbjct  2289  RRILVGGR-KGVQEKSRSELWGLRSLQDTVWQCVNSVACGYFLDLTRGSALSTGYLRQLG  2347

Query  6898  SEVARDGVYIDSMGATLNPDMVRIEEYGSVGREALLFGHIYEGGGEVKYGRISVKNGGFV  7077
             + +   GVY+D++ A LNPD + ++   S+GR+ALLFGH+YEGGG+V +G   V    FV
Sbjct  2348  ASIDTAGVYMDTLYA-LNPDRLSVKTGSSIGRDALLFGHVYEGGGDVHFGSNGVGEYAFV  2406

Query  7078  GSRAVAMPGATIDSGGSLGALSLAM  7152
             G+R++ +PG++++ G  L  L LAM
Sbjct  2407  GARSLLLPGSSLEDGAELRPLGLAM  2431



>gb|KDP20198.1| hypothetical protein JCGZ_07918 [Jatropha curcas]
Length=418

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/410 (66%), Positives = 328/410 (80%), Gaps = 2/410 (0%)
 Frame = +1

Query  5929  MYVRFKLRPFDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAEDFKFRVSSPDK  6108
             MYV+FKLRP DE+I E+ G+VEP GILPPETGAIPRD+ D RPLLFLAEDF  RVSSP  
Sbjct  1     MYVKFKLRPCDERITEDSGKVEPTGILPPETGAIPRDDKDTRPLLFLAEDFHRRVSSPGG  60

Query  6109  VRYVLQLQIQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTEKESEELEFNP  6288
             VRY+ QLQ++ +P DE  R+  LDCT+PWDE E PYI+VGEI IDQ LT +ESE LEFNP
Sbjct  61    VRYIFQLQVRAVPTDEATRDIALDCTRPWDETEFPYIDVGEIIIDQNLTSEESERLEFNP  120

Query  6289  FFRCNEIDVIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLDQSDVKLDLSG  6468
             + RC+E+DVIRATSC+QSASIDHGRSL+YEICQ+LRN +P PEAWRIF++QSDVK+DLSG
Sbjct  121   YLRCSEVDVIRATSCSQSASIDHGRSLIYEICQHLRNGEPFPEAWRIFIEQSDVKVDLSG  180

Query  6469  CPLAAKLENKDMPKATLARQWYVTLWLMSGQPFLQIVLPYFLLGLVIYAPLNCLFYTHEM  6648
             CP+AA LE KD  K TLAR WY T W +  QP LQ + PYFLLGLVI+ PLN +F   E 
Sbjct  181   CPMAAMLERKDSGKVTLARNWYQTSWAIFAQPLLQTLFPYFLLGLVIFTPLNWVFSLKES  240

Query  6649  TQIQKQWLLPLWWGGSGILAGLVCALSKWVLVGKKYKGKTEPIWSRGIFMDTIWQAIRTV  6828
              Q+  +WLLPL W  SGILA + C L KW+LVGKK +G+T  IWS+G+FMDTIWQA RTV
Sbjct  241   KQLSLRWLLPLVWVSSGILAAIACILVKWILVGKKKEGETVLIWSKGVFMDTIWQAFRTV  300

Query  6829  TGEYFMETATGTFLMGIWMRLMGSEVARD-GVYIDSMGATLNPDMVRIEEYGSVGREALL  7005
              GEYFME  +G+ L  +W++LMG+E+  D G YIDSMGA+LNP+MV I++ G VG+EALL
Sbjct  301   VGEYFMEMTSGSILFNLWLKLMGAEIELDQGAYIDSMGASLNPEMVEIQKGGCVGKEALL  360

Query  7006  FGHIYEGG-GEVKYGRISVKNGGFVGSRAVAMPGATIDSGGSLGALSLAM  7152
             FGHIYEG  G+VK+G+I V   GFVGSRA+AMPG  ++SGG+L +LSLAM
Sbjct  361   FGHIYEGDEGKVKFGKIRVGESGFVGSRAIAMPGVVVESGGNLSSLSLAM  410



>ref|XP_006386097.1| hypothetical protein POPTR_0003s220802g, partial [Populus trichocarpa]
 gb|ERP63894.1| hypothetical protein POPTR_0003s220802g, partial [Populus trichocarpa]
Length=386

 Score =   532 bits (1371),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 250/408 (61%), Positives = 314/408 (77%), Gaps = 25/408 (6%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+  V ++D F+KLHPC+P  TRIGIVG GPSG+SAAYAL KLGY NV VLEKHH+ GGM
Sbjct  1     MDPLVSIEDQFVKLHPCLPVNTRIGIVGGGPSGISAAYALAKLGYQNVTVLEKHHTVGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRV  660
             CES+DI+                        EVG+E+EEMD+HKLA +DS    Y D++V
Sbjct  61    CESVDIE------------------------EVGSELEEMDSHKLAHIDSSTGKYQDIKV  96

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
             A+DY++V+ +TL+LQD+ K + RIGV++VSE+A+D+TP +L+ +G KSVPKSVAYGYTAS
Sbjct  97    ADDYVAVMSLTLELQDKAKDSGRIGVHAVSELAADLTPTYLESRGFKSVPKSVAYGYTAS  156

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF+QDMPYAYIHEF RTSMAGKIRRFKGGYTS+W+K+SE++PI+  C T+VL+I+RNS
Sbjct  157   GYGFVQDMPYAYIHEFTRTSMAGKIRRFKGGYTSLWQKISESLPIEVNCKTDVLAIRRNS  216

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDL  1200
               V VDV+  NG +Q MEFDKIIISG+FPF NG TYR P++K+        D+S +E+  
Sbjct  217   DSVRVDVKRNNGEIQEMEFDKIIISGSFPFTNGNTYRFPAEKSTESETKVTDLSEVERYF  276

Query  1201  FSKVQTIEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSY  1380
             F KVQTI+YYT+VL+I GLE +P+GFYYF  +MEDPA IG+PVAMQKFY DT++FLFWSY
Sbjct  277   FRKVQTIDYYTTVLKIKGLEDMPVGFYYFGEYMEDPATIGHPVAMQKFYADTDIFLFWSY  336

Query  1381  GNSIDILGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKD  1524
             GNS DI G  V ELAKK V+ MG +V++ +LQR FKYFPHV  Q M D
Sbjct  337   GNSFDIKGPTVAELAKKVVMSMGAKVEEEVLQRRFKYFPHVGSQGMLD  384



>gb|EMS58940.1| Allene oxide synthase-lipoxygenase protein [Triticum urartu]
Length=435

 Score =   527 bits (1358),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 256/397 (64%), Positives = 313/397 (79%), Gaps = 11/397 (3%)
 Frame = +1

Query  5359  MVRNQTLPLDDRIEEMDPKYKKVLGSLAANLAASTLKLKSRYFHRIGAAGKGSLRLYNVL  5538
             MV+N  L  D+RIE MDP YKK++G+L+ANLA +T+ +KSRYFHRIG +G+G L++Y  +
Sbjct  1     MVKNTLLAEDERIEMMDPMYKKIVGNLSANLAITTMNVKSRYFHRIGVSGRGVLKMYEDI  60

Query  5539  PGLPDHKIFGPGATYPVIIRHSNCLSSDDDARLDPRGAAIRILPHERtttttttplldlt  5718
             P L  HKIFG G ++PVI+RHSN LS+DDDARLD RGAA+RIL  +        PLLDLT
Sbjct  61    PSLLKHKIFGAGKSFPVIVRHSNSLSADDDARLDARGAAVRILSDD-----GEVPLLDLT  115

Query  5719  lktGKAFHARTIGDFATWLVCGAAAREEHVKHAPHIRDAMWGSLRRPNSYTELHYYSNIC  5898
             LK+GKAF+ARTI DFATWLVCG  AREEHVK APH+RDA+WGSLR  NSYTELHYYSNIC
Sbjct  116   LKSGKAFYARTIADFATWLVCGLPAREEHVKRAPHVRDAVWGSLRDTNSYTELHYYSNIC  175

Query  5899  RLFRFKDGQEMYVRFKLRPFDEKIGEEYGEVEPRGILPPETGAIPRDENDKRPLLFLAED  6078
             RL RF +G+EMY +FKLRP D+ I EE G+V PRGILPPETGAIPRDE+D RPLLFLA+D
Sbjct  176   RLLRFDEGKEMYAKFKLRPVDQDIPEESGQVVPRGILPPETGAIPRDESDTRPLLFLADD  235

Query  6079  FKFRVSSPDKVRYVLQLQIQPIPDDERVRETLLDCTKPWDEKEVPYIEVGEITIDQVLTE  6258
             F+ RV  PD VRYV QLQ++ +P D+   +  LDCT+PWDE+E PYI++GEI+ID+ L  
Sbjct  236   FRRRVEVPDGVRYVFQLQLREVPSDDATCDVALDCTRPWDEEEFPYIDIGEISIDKNLPA  295

Query  6259  KESEELEFNPFFRCNEIDVIRATSCNQSASIDHGRSLVYEICQYLRNRKPLPEAWRIFLD  6438
             +E+E+LEFNPF RC E+DVI A+SC QSASIDHGRSL+YE+CQ LRN +PLP +W  FL+
Sbjct  296   EETEKLEFNPFLRCQEVDVIPASSCKQSASIDHGRSLIYEVCQRLRNGEPLPASWAAFLE  355

Query  6439  QSDVKLDLSGCPLAAKLE------NKDMPKATLARQW  6531
             QSD K++LSGCP+AA +       N    K TLAR W
Sbjct  356   QSDTKINLSGCPVAAAMHTRSDTANASETKVTLARTW  392



>gb|EXX53363.1| hypothetical protein RirG_244660 [Rhizophagus irregularis DAOM 
197198w]
Length=1637

 Score =   479 bits (1234),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 365/1237 (30%), Positives = 601/1237 (49%), Gaps = 165/1237 (13%)
 Frame = +1

Query  355   MPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGMCESIDIQGRTYDLGGQV  534
             +P  + IGI+GAGP+G+S A+ L K GY+N+ +LE      G   +   + R YD+G  +
Sbjct  13    IPKNSHIGIIGAGPAGISIAHFLRKEGYNNLTLLESSSHIAGKSATFFHENRGYDVGALM  72

Query  535   LAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWAYTDMRVAEDYISVIPITLKLQDEV  714
             +  N    +  LA E+   +E      L + +++    D      Y  ++P      +E 
Sbjct  73    VGHNYT-NVKSLASELDCPLETFTGRSLDIENNNILVNDTNKIGIYSKLLPNISHYLEEK  131

Query  715   KATNRI-----GVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTASGYGFIQD-MPYAY  876
             ++   I     G  S  E+ + +T +FLKD+ +  +  + +  YT++GYG+IQD +P AY
Sbjct  132   QSFLDISCPGHGQLSERELYAPIT-QFLKDRNMSYLKDAWSLAYTSAGYGYIQDDIPAAY  190

Query  877   IHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKR-----NSSGVCVDV  1041
               +FI  S    I  FK G+   W K+S+ + + +  N++V+SI R     N   + V  
Sbjct  191   FLKFIENS-ENTISYFKNGFQDFWSKMSKNLNVIY--NSKVISIDRSLKQKNLGPILVTT  247

Query  1042  RHR-NGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLFCDKMDMSTLEKDLFSKVQT  1218
             ++  N   Q + FD III+   P    +   +PS               LE  LFS+V T
Sbjct  248   KNALNNFEQTLAFDNIIIATN-PRQTEQFITTPS--------------PLESHLFSQVVT  292

Query  1219  IEYYTSVLEIDGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSYGNSIDI  1398
              ++YT +  +  L    +G      +  D   +G+  A    +     ++F++YGN  DI
Sbjct  293   FDFYTIIATVKNLS-TKVGMTTIPKYCSDKRYVGHTTAYYCAHEGVPTYIFYAYGNK-DI  350

Query  1399  LGSEVMELAKKAVIKMGGQVKKVILQRHFKYFPHVNCQDMKDGFYEKLETQLQGQLNTYY  1578
                +V EL K+ +I MGG+++++   + + +FPHV+   M  GFY K+E  +QG+  T+Y
Sbjct  351   GPEQVTELLKQDIISMGGELEEIHYNQRWDFFPHVSSLSMARGFYSKVEN-VQGEQGTFY  409

Query  1579  VGGLMAFELTERNASYSMALIRKHF------ANDLVVPTFPYVKRLFPLKSSSEGLAFKQ  1740
             VGG + FELTE   SYS  L+R+ F         L +P  P++     +K +S  L +  
Sbjct  410   VGGWLDFELTENCISYSRDLVRRFFNLSGKNEKSLHLPVLPHID----IKPAS-NLNWGM  464

Query  1741  LDEIPGVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             L  +   ++P+                   K  +TW++       + TY E++  A  +A
Sbjct  465   LLRLAAKRYPD-------------------KVAFTWVDVNLREEAKITYSELYKQARCVA  505

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLH  2100
               L        K GD +LL Y PGL F+   FGC+ A +I +P  PP+       + +  
Sbjct  506   YYL--RNNAGHKVGDPILLCYAPGLKFLPILFGCMLAGIIAVPIAPPNLAT--ADKDIAR  561

Query  2101  IANIAKVCNPVAILSTFSYHVTVRIMSAKNML-FGKSKDKSSNSWP-DLPWLHTDSWVkk  2274
                +A+      + S  +Y +  ++ +AK+   FGK  +     WP DL W+  ++ +  
Sbjct  562   FKYLAQTTGAKLVFSDKNYMLYTKLYAAKSYFGFGKKIE-----WPEDLIWVEGENIISS  616

Query  2275  pklfkkpkDEQ--GQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSR  2448
               LF    DE+   +  S+++  LQF+SGST DPKGVM+TH  ++HNV LM+        
Sbjct  617   HDLF----DEKLIDEIDSDNVAVLQFSSGSTGDPKGVMLTHKNLLHNVDLMQTEIDLGPD  672

Query  2449  TILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPN  2628
               +  W+PQ+HD+GLIGG L  +  G   ++ SP+TF++ P  WLQ ++ ++AT +AAPN
Sbjct  673   DTIAFWVPQFHDLGLIGGFLNTIRGGCKSVVMSPLTFLQKPESWLQMITNYQATFTAAPN  732

Query  2629  FAFELLVRRLESSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYG  2808
             FA+EL  R+ +++  +N +L+S+    + AEP+R +TLK F +     G    +    YG
Sbjct  733   FAYELAARKCDNNSIKNLNLNSIRGAFNGAEPVRWSTLKSFAKKFGPAGFKLSMFKCLYG  792

Query  2809  LAENCVF-VSCAYGEGLPVFVD------WQGRVCC--GYIKQPNTDG-------------  2922
             LAE+C + V       +P  +D       +GRV      +   N D              
Sbjct  793   LAEHCAYSVGFRNLHDIPTVIDIDPIPLREGRVKVRNNTLTNSNNDNSPANNIVSTGVPN  852

Query  2923  ----VDIKIISPETGKENDDPGKEGEIWISSLSAGIGYWGLEELSQKTF----ENDILS-  3075
                 V+++++  ET K+   P   GE+W+SS S G GY+G E+ S++TF    +ND    
Sbjct  853   LMMQVEVRVVDQET-KKLCSPNTIGEVWVSSPSVGKGYYGKEKNSEETFRAKLDNDDHGN  911

Query  3076  --TPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDIEKTVESSSELVRPGCC  3249
               T    ++RTGDLG + + +LFITGR KD+II+ GKN Y  DIE TV+ S   +RPGC 
Sbjct  912   WITDNGSFLRTGDLGFLYNGELFITGRQKDVIIINGKNHYPQDIELTVQESHNAIRPGCI  971

Query  3250  AVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGKPLPYDVMDHICTRVAE----EHGV  3417
               +   +          +  +D   L+V+ E+R  K +  +++  IC  +A      HG+
Sbjct  972   CAINHTD---------VENGTD--SLIVLVEIRQQKDIKQELLQEICDCIARVVPGNHGL  1020

Query  3418  PIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLD---------VIEEQMNGERSLPRN  3570
                 IV +K  SI KTTSGK++R +     ++G++D         ++++ MN        
Sbjct  1021  SCQRIVILKQHSIPKTTSGKLQRAKAKDLLLNGSMDKKIITSVGEIVQDPMN--------  1072

Query  3571  DGIIVPANGKISKTDIVNFLKDLLSQQTGIPVSKISTGET-------------LVSYGVN  3711
                +V    K  K   +  L + + Q+  + V K+S   +             + +YG +
Sbjct  1073  ---VVDIKEKKPKKKPLMTL-ETIQQKIAVNVHKVSKLASKLSIDQIDFKVNLITTYGFD  1128

Query  3712  SIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFV  3822
             S+  V+    +   FGI I    +     I DLA  +
Sbjct  1129  SLAAVQLTACLKDEFGIEIAPALLLDLPTISDLAGHI  1165



>emb|CDP14083.1| unnamed protein product [Coffea canephora]
Length=288

 Score =   400 bits (1028),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 186/287 (65%), Positives = 230/287 (80%), Gaps = 1/287 (0%)
 Frame = +1

Query  304   MESGVDVDDLFLKLHPCMPTTTRIGIVGAGPSGLSAAYALIKLGYSNVAVLEKHHSAGGM  483
             M+  V VDDLF +LHPC P  TRI IVGAGPSGLSAAYAL +LGY NV VLEK+ SAGGM
Sbjct  1     MDPSVSVDDLFSRLHPCFPVQTRIAIVGAGPSGLSAAYALSRLGYCNVTVLEKYQSAGGM  60

Query  484   CESIDIQGRTYDLGGQVLAANSAPTIFHLAKEVGAEIEEMDTHKLALVDSDWA-YTDMRV  660
             CES+DI GR YDLGGQVLAANSAPTIFHLAKE GAE+E++D    AL+DS      DM++
Sbjct  61    CESVDIDGRIYDLGGQVLAANSAPTIFHLAKETGAELEDLDKDIFALIDSRGGTIRDMKL  120

Query  661   AEDYISVIPITLKLQDEVKATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTAS  840
              +DY+S+I +TLKLQDE K T  +GV+ VS+IASD++P FL++ GLKS PKSV+YG+TAS
Sbjct  121   VDDYVSMISLTLKLQDEAKETGHLGVHGVSKIASDLSPAFLRNHGLKSFPKSVSYGFTAS  180

Query  841   GYGFIQDMPYAYIHEFIRTSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNS  1020
             GYGF++DMPYAY+HEF RTSMAGKI+RF+GGY   W+KL E +P++F  NTEV+S++RNS
Sbjct  181   GYGFVEDMPYAYVHEFTRTSMAGKIQRFRGGYMGFWQKLCERLPVEFCWNTEVISVRRNS  240

Query  1021  SGVCVDVRHRNGALQAMEFDKIIISGAFPFHNGRTYRSPSQKTAGLF  1161
              G+ ++V+  N  +Q MEFD+IIISGAFPF +G+ YRSPS    GL 
Sbjct  241   DGIILNVKDENEIVQVMEFDQIIISGAFPFKSGKIYRSPSTNLPGLL  287



>ref|XP_009845094.1| hypothetical protein H257_17844 [Aphanomyces astaci]
 gb|ETV65417.1| hypothetical protein H257_17844 [Aphanomyces astaci]
Length=757

 Score =   374 bits (959),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 251/744 (34%), Positives = 384/744 (52%), Gaps = 87/744 (12%)
 Frame = +1

Query  1795  LRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIK-----P  1959
             L HW T  V   K L+ ++++ G V D  TY +V + +  +A+ +LTS   + K      
Sbjct  12    LDHWAT--VQPKKNLFAFVDDNGQVTDSVTYDDVQSRSSNLAKWMLTSPSVSSKGLGLSK  69

Query  1960  GDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAI  2139
             GD VLL+Y PGLDF+ AF  CLRA V+ +P  PPDP +         IA    VC+    
Sbjct  70    GDIVLLVYPPGLDFIVAFLACLRAGVVAVPVYPPDPRK-----LRKDIAMFTTVCSNAGA  124

Query  2140  ---LSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPDLPWLHTDSWVkkpklfkkpkDE--  2304
                L+  +Y+   ++++ +  +    K      WPDL W+ +D  V              
Sbjct  125   KVALTNSTYNYAKKVVAIQQKVTFSEK----FPWPDLRWVESDGLVLTSPPPSPSSTPWL  180

Query  2305  QGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHD  2484
                P  +DL FLQ+TSGST++PKGVMI+HG + HN+ ++    ++T  +++VSWLPQYHD
Sbjct  181   LVPPSLDDLAFLQYTSGSTSEPKGVMISHGNLGHNLSMIASALEATDDSVVVSWLPQYHD  240

Query  2485  MGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLES  2664
             MGLIG  L +L +GG G+  SP +F+KNPL+W++ +S++RATH  APNFA+ L  R+  +
Sbjct  241   MGLIGAYLGVLFTGGHGVYMSPFSFIKNPLVWIRLISQYRATHLQAPNFAYALCARKFAT  300

Query  2665  SKEE---------------NFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAP  2799
             +                    DLSS+  +++ AEPI    +  F    + +GL R V+ P
Sbjct  301   ANPSQTSTSITTSNTTSSCKLDLSSVRHMINGAEPIDGDAIDAFYRAFEPYGLCRGVVRP  360

Query  2800  GYGLAENCVFVSCAYGEGLPVFVDWQG-------------------RVCCGYIKQPNTDG  2922
              YGLAE+ V+V  +  + L V VD +                     V CG    P +D 
Sbjct  361   TYGLAEHTVYVCDSSPQLLQVQVDKEALEHHDVFQPVADKARATKEMVGCG---APRSD-  416

Query  2923  VDIKIISPETGKENDDPGKEGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRT  3102
             VD++I+ P+T KE    G  GEIWI S S   GY+GL +L+++ F   I+S   + Y+RT
Sbjct  417   VDVRIVHPDTHKEL-AAGSVGEIWIRSPSTTQGYFGLNDLTREMFHATIVSNEPQHYMRT  475

Query  3103  GDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLV  3282
             GDLG +   +LF+ GR KDLIIV G+N Y  DIEKTVE   + +RPGC A   I      
Sbjct  476   GDLGVLYQGELFVCGRLKDLIIVRGRNHYPQDIEKTVEGFPD-IRPGCSAAFSI-----S  529

Query  3283  SKGILTQRASDELGLVVIAEVRDGKPLPYDVMDHICTRVAE----EHGVPIASIVAIKPR  3450
             + GI         GL V+AEVRD   +P   ++ +   V +    EHGV + ++  +   
Sbjct  530   TNGI-------HEGLGVVAEVRDAN-VPRAALEALAASVRQAVSVEHGVSVTALALVSTH  581

Query  3451  SISKTTSGKIKRYECAKRFISGTLD----VIEEQMNGERSLPRNDGI---IVPANGKISK  3609
             SI KTTSGKI R    + F+  TL     + +   N + +    D +   I PA   +  
Sbjct  582   SIPKTTSGKISRKRSKEAFVGQTLTELYRIFKPAANDDDNNEPEDKVPSTIQPAFASVPP  641

Query  3610  TDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFS  3789
             +++  FL+  ++Q   +P   I+    L   G++S+G+ +    + + +G+ +    ++ 
Sbjct  642   SEVKAFLRREMAQMLDVPPDTITDTTPLQQIGMDSMGLTQLQGIVHNQYGVQVPDQVLYG  701

Query  3790  ATCIDDLADFVESLLEKNHPMLTN  3861
                   L+   ++L   +HP   N
Sbjct  702   EHTT--LSHVYDALATASHPQPPN  723



>ref|XP_009845095.1| hypothetical protein, variant [Aphanomyces astaci]
 gb|ETV65418.1| hypothetical protein, variant [Aphanomyces astaci]
Length=700

 Score =   362 bits (930),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 241/683 (35%), Positives = 358/683 (52%), Gaps = 85/683 (12%)
 Frame = +1

Query  1795  LRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIK-----P  1959
             L HW T  V   K L+ ++++ G V D  TY +V + +  +A+ +LTS   + K      
Sbjct  12    LDHWAT--VQPKKNLFAFVDDNGQVTDSVTYDDVQSRSSNLAKWMLTSPSVSSKGLGLSK  69

Query  1960  GDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAI  2139
             GD VLL+Y PGLDF+ AF  CLRA V+ +P  PPDP +         IA    VC+    
Sbjct  70    GDIVLLVYPPGLDFIVAFLACLRAGVVAVPVYPPDPRKLRKD-----IAMFTTVCSNAGA  124

Query  2140  ---LSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPDLPWLHTDSWVkkpklfkkpkDE--  2304
                L+  +Y+   ++++ +  +    K      WPDL W+ +D  V              
Sbjct  125   KVALTNSTYNYAKKVVAIQQKVTFSEK----FPWPDLRWVESDGLVLTSPPPSPSSTPWL  180

Query  2305  QGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHD  2484
                P  +DL FLQ+TSGST++PKGVMI+HG + HN+ ++    ++T  +++VSWLPQYHD
Sbjct  181   LVPPSLDDLAFLQYTSGSTSEPKGVMISHGNLGHNLSMIASALEATDDSVVVSWLPQYHD  240

Query  2485  MGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLES  2664
             MGLIG  L +L +GG G+  SP +F+KNPL+W++ +S++RATH  APNFA+ L  R+  +
Sbjct  241   MGLIGAYLGVLFTGGHGVYMSPFSFIKNPLVWIRLISQYRATHLQAPNFAYALCARKFAT  300

Query  2665  SKEE---------------NFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAP  2799
             +                    DLSS+  +++ AEPI    +  F    + +GL R V+ P
Sbjct  301   ANPSQTSTSITTSNTTSSCKLDLSSVRHMINGAEPIDGDAIDAFYRAFEPYGLCRGVVRP  360

Query  2800  GYGLAENCVFVSCAYGEGLPVFVDWQG-------------------RVCCGYIKQPNTDG  2922
              YGLAE+ V+V  +  + L V VD +                     V CG    P +D 
Sbjct  361   TYGLAEHTVYVCDSSPQLLQVQVDKEALEHHDVFQPVADKARATKEMVGCG---APRSD-  416

Query  2923  VDIKIISPETGKENDDPGKEGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRT  3102
             VD++I+ P+T KE    G  GEIWI S S   GY+GL +L+++ F   I+S   + Y+RT
Sbjct  417   VDVRIVHPDTHKEL-AAGSVGEIWIRSPSTTQGYFGLNDLTREMFHATIVSNEPQHYMRT  475

Query  3103  GDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLV  3282
             GDLG +   +LF+ GR KDLIIV G+N Y  DIEKTVE   + +RPGC A   I      
Sbjct  476   GDLGVLYQGELFVCGRLKDLIIVRGRNHYPQDIEKTVEGFPD-IRPGCSAAFSIS-----  529

Query  3283  SKGILTQRASDELGLVVIAEVRDGKPLPYDVMDHICTRVAE----EHGVPIASIVAIKPR  3450
             + GI         GL V+AEVRD   +P   ++ +   V +    EHGV + ++  +   
Sbjct  530   TNGI-------HEGLGVVAEVRDAN-VPRAALEALAASVRQAVSVEHGVSVTALALVSTH  581

Query  3451  SISKTTSGKIKRYECAKRFISGTLD----VIEEQMNGERSLPRNDGI---IVPANGKISK  3609
             SI KTTSGKI R    + F+  TL     + +   N + +    D +   I PA   +  
Sbjct  582   SIPKTTSGKISRKRSKEAFVGQTLTELYRIFKPAANDDDNNEPEDKVPSTIQPAFASVPP  641

Query  3610  TDIVNFLKDLLSQQTGIPVSKIS  3678
             +++  FL+  ++Q   +P   I+
Sbjct  642   SEVKAFLRREMAQMLDVPPDTIT  664



>ref|XP_008616893.1| hypothetical protein SDRG_12598 [Saprolegnia diclina VS20]
 gb|EQC29589.1| hypothetical protein SDRG_12598 [Saprolegnia diclina VS20]
Length=730

 Score =   359 bits (921),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 238/711 (33%), Positives = 364/711 (51%), Gaps = 67/711 (9%)
 Frame = +1

Query  1780  SLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKL---LTSQKPA  1950
             +L + L  WG       KT+Y + ++ G +    TYKE+      +A+ +    +++   
Sbjct  4     TLLARLDRWG--AEQPEKTVYAFADDNGIITASLTYKELDERTLNLARWMRAPASAKGMG  61

Query  1951  IKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNP  2130
             + P +KVLL+Y PGLDF+ AF  CLRA V+ +P  PPD   R   + ++    +      
Sbjct  62    LSPDEKVLLVYPPGLDFIVAFVACLRAGVVAVPVYPPD--PRKLRKDIVMFTTVCSNAGA  119

Query  2131  VAILSTFSYHVTVRIMSAKN-MLFGKSKDKSSNSWPDLPWLHTDSWVkkpklfkkpkDEQ  2307
                L+  SY+   +I+  K  M F +        WPDL W+ TD  V  P          
Sbjct  120   KTALTCASYNHVKKILDIKQKMTFSERY-----PWPDLAWVETDRLVHAPAPSSSTL---  171

Query  2308  GQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDM  2487
               P ++ + FLQ+TSGST+DPKGVMI+HG +  N+ L+     + +  ++VSWLPQYHDM
Sbjct  172   AAPSADAIAFLQYTSGSTSDPKGVMISHGNLTSNLHLIVDALAARTDAVVVSWLPQYHDM  231

Query  2488  GLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESS  2667
             GLIG  L IL +GG+G+  SP +F+KNP LW++ M+K +ATH  APNFA+ L  R+ + S
Sbjct  232   GLIGAYLGILFAGGNGVYLSPFSFIKNPSLWIELMAKHKATHLQAPNFAYALCARKFKPS  291

Query  2668  KEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYG  2847
                + DLSS+  +++ AEP+    ++ F       GL R V+ P YGLAE+ V+V C   
Sbjct  292   SPSSLDLSSVRHMINGAEPVDVHAIEAFYATFSPLGLPRGVVRPTYGLAEHTVYV-CDSS  350

Query  2848  EGLPVFV----------------------DWQGRVCCGYIKQPNTDGVDIKIISPETGKE  2961
               L                          D +  V CG  K      VD++I++ +T + 
Sbjct  351   PSLTHLRVVKSVLESEDKMERATAATPANDVKDMVGCGEPK------VDMRIVNADTRRT  404

Query  2962  NDDPGKEGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFI  3141
               D G  GEIWI S S   GY+ L  L+Q+ F   ++  P   Y+RTGDLG + + +LF+
Sbjct  405   QPD-GTVGEIWIRSSSTTQGYFNLPALTQEMFHASLVDAPEVHYMRTGDLGVLCERQLFV  463

Query  3142  TGRTKDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDEL  3321
              GR KDLIIV G+N Y  DIEK+VE + + +RPGC A   +                D+ 
Sbjct  464   CGRLKDLIIVRGRNHYPQDIEKSVE-AFDAIRPGCSAAFSV-----------ALNGQDDE  511

Query  3322  GLVVIAEVRDGKPLPY-DVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECA  3498
              L V+AEVR     P  ++ + I + +A EHGV +  +V ++ RSI KTTSGKI R  C 
Sbjct  512   VLCVLAEVRPEASQPLSELANAIRSAIAAEHGVQLTGVVFVESRSIPKTTSGKISRRRCK  571

Query  3499  KRFISGTLDVIEEQMNGERSLPRNDGIIVPANGK--------ISKTDIVNFLKDLLSQQT  3654
               F+  +L  +   +N +   P    +  P   K        +    +  FL   ++Q  
Sbjct  572   TAFLGQSLSELHRSINLDDRSPDETAVNHPPGPKRTYPPFESVPAASVTTFLCSEIAQLL  631

Query  3655  GIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDD  3807
              +P + ++   TL   G++S+G+ +    I++ +G++     ++S T   D
Sbjct  632   NVPKTHVTNATTLHELGMDSMGLTQLQGIIANEYGVHAPEEVLYSETTTID  682



>ref|XP_004517015.1| PREDICTED: uncharacterized protein LOC101494376, partial [Cicer 
arietinum]
Length=652

 Score =   353 bits (907),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 189/364 (52%), Positives = 247/364 (68%), Gaps = 13/364 (4%)
 Frame = +1

Query  3598  KISKTDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAI  3777
             +ISK DIV FLK ++S+QTG+ ++ IS    L SYG++SIGVV+A QK+S F G  + AI
Sbjct  285   RISKNDIVEFLKGIISEQTGVAINSISVTGNLTSYGIDSIGVVKATQKLSDFLGTPVAAI  344

Query  3778  DIFSATCIDDLADFVESLLEKNHPMLT----NSSETKISSSGIPSVVSTFDKITIWLIHL  3945
             D+F+A+CI +LA+F E LL K  P L+    N  E  I  + +   VS   + +I L+  
Sbjct  345   DVFTASCITELANFSEDLLSKTQPQLSSNESNVPEADIDCTELVVEVSKSRQWSIRLLQF  404

Query  3946  VALAYVSLLLIIPAYISVSMF-KPLILANQS----PWFFYFISLACAPFSWMLCIFLTCI  4110
              AL Y+S++L  PAY+S++ F    + A++S    PW  Y ISL  AP +W+ CI  TCI
Sbjct  405   FALIYISIMLASPAYLSITAFLNSNLCASKSVAGVPWLNYMISLIFAPLAWIHCIASTCI  464

Query  4111  CTRLLGNALLQPNYVLNPEISVWSVEFVKWWALYKAQEISSKVLAVHLRGTVFLNYWFKI  4290
             C  L G++LL  NY L  EIS++SV+FVKWWALYK+QEISSKVLAVHLRGTVFL YWF++
Sbjct  465   CISLFGSSLLGLNYELTSEISIYSVDFVKWWALYKSQEISSKVLAVHLRGTVFLKYWFEM  524

Query  4291  LGAKIASSALIDTVDITDPLLVSIDEESVISEGALIQSHEVKNGVLSFSVVRIGKRSSIG  4470
             LGAKI SS LIDTVDITDP LVSI +E+VI+EG L+QSHEVKNG+LS   +RIGK SSIG
Sbjct  525   LGAKIGSSVLIDTVDITDPALVSIGDEAVIAEGVLVQSHEVKNGILSLRPIRIGKCSSIG  584

Query  4471  PYAVLQKGSIVGDGAEVLAQNKKAAA----KISKPLNGHKGKVTRRIRKRNHGNHNSVFQ  4638
             PYAV+QKGS++G+ AEV A  K        K +K  N  K    R+  +    N   +F 
Sbjct  585   PYAVVQKGSVIGESAEVQALQKVGGGEHVLKPNKLNNIDKVCYIRQCLQNMFYNQAYIFM  644

Query  4639  LFGI  4650
             L+ +
Sbjct  645   LYNL  648


 Score = 99.8 bits (247),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 63/89 (71%), Gaps = 0/89 (0%)
 Frame = +1

Query  3598  KISKTDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAI  3777
             +ISK DIV FLK ++S+QTG+ ++ IS    L SYG++SIGVV+A QK+S F G  + AI
Sbjct  95    RISKNDIVEFLKGIISEQTGVAINSISVTGNLTSYGIDSIGVVKATQKLSDFLGTPVAAI  154

Query  3778  DIFSATCIDDLADFVESLLEKNHPMLTNS  3864
             D+F+A+CI +LA F E LL K  P L  +
Sbjct  155   DVFTASCIQELASFSEDLLSKTRPQLVRT  183


 Score = 99.8 bits (247),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 63/89 (71%), Gaps = 0/89 (0%)
 Frame = +1

Query  3598  KISKTDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAI  3777
             +ISK DIV FLK ++S+QTG+ ++ IS    L SYG++SIGVV+A QK+S F G  + AI
Sbjct  190   RISKNDIVEFLKGIISEQTGVAINSISVTGNLTSYGIDSIGVVKATQKLSDFLGTPVAAI  249

Query  3778  DIFSATCIDDLADFVESLLEKNHPMLTNS  3864
             D+F+A+CI +LA F E LL K  P L  +
Sbjct  250   DVFTASCIQELASFSEDLLSKTRPQLVRT  278


 Score = 98.6 bits (244),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 62/88 (70%), Gaps = 0/88 (0%)
 Frame = +1

Query  3601  ISKTDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAID  3780
             ISK DIV FLK ++S+QTG+ ++ IS    L SYG++SIGVV+A QK+S F G  + AID
Sbjct  1     ISKNDIVEFLKGIISEQTGVAINSISVTGNLTSYGIDSIGVVKATQKLSDFLGTPVAAID  60

Query  3781  IFSATCIDDLADFVESLLEKNHPMLTNS  3864
             +F+A+CI +LA F E LL K  P L  +
Sbjct  61    VFTASCIQELASFSEDLLSKTRPQLVRT  88



>ref|XP_008871071.1| hypothetical protein H310_07478 [Aphanomyces invadans]
 gb|ETW00046.1| hypothetical protein H310_07478 [Aphanomyces invadans]
Length=733

 Score =   342 bits (877),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 232/697 (33%), Positives = 355/697 (51%), Gaps = 73/697 (10%)
 Frame = +1

Query  1795  LRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTS-----QKPAIKP  1959
             L HW        K L+ ++++ G V D   Y++VHT +  +A+ +LTS     Q   +  
Sbjct  9     LDHWAAH--QPKKNLFAFVDDNGRVTDSLLYEDVHTRSANLAKWMLTSPSVSSQGLGLSR  66

Query  1960  GDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAI  2139
             GD VLL+Y PGLDF+ AF  CLRA V+ +P  PPD   R   + ++    +         
Sbjct  67    GDIVLLVYPPGLDFIVAFLACLRAGVVAVPVYPPD--PRKLRKDIVMFTTVCSNSGAKIA  124

Query  2140  LSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPDLPWLHTDSWVkkpklfkkpkDEQGQPL  2319
             L+  +Y+   +++  K  +    K     +WPDL W+ T+  ++                
Sbjct  125   LTNSAYNYAKKVLDIKQKVTFSEK----FAWPDLHWMETNGQLESTAPPPLAIPPP---S  177

Query  2320  SEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIG  2499
               DL FLQ+TSGST+DPKGVMI+HG + HN+ L+     +T  +I+VSWLPQYHDMGLIG
Sbjct  178   PNDLAFLQYTSGSTSDPKGVMISHGNLGHNLTLISTALSATDDSIVVSWLPQYHDMGLIG  237

Query  2500  GLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEEN  2679
               L +L +GG G+  SP +F+KNP  WL+ +S+  ATH  APNFA+ L  R+  +     
Sbjct  238   AYLGVLFTGGHGVYMSPFSFIKNPSGWLRLISQHHATHLQAPNFAYALCARKFVAGTAP-  296

Query  2680  FDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLP  2859
              DLSS+  +++ AEPI    +  F ++ + FGL   V+ P YGLAE+ V+V  +    L 
Sbjct  297   LDLSSVRHMINGAEPIDGDAVDAFYKVFKPFGLCDGVIRPTYGLAEHTVYVCDSSPHLLR  356

Query  2860  VFVDWQG--------------------RVCCGYIKQPNTDGVDIKIISPETGKENDDPGK  2979
             V VD                        V CG  +     GVD++I+ P +   +   G 
Sbjct  357   VVVDKDALEHHDKFVPIEGTSSGGVKEMVGCGKPRP----GVDLRIVHPAS-HASVPTGT  411

Query  2980  EGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKR-YIRTGDLGRIIDSKLFITGRTK  3156
              GEIWI S S   GY+GL+EL+++ F   I + P    ++RTGDLG +   +LF+ GR K
Sbjct  412   VGEIWIRSSSTTQGYFGLDELTREMFGATIANEPTDHFFMRTGDLGVLYQGELFVCGRLK  471

Query  3157  DLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVI  3336
             DLIIV G+N Y  DIEKTVE   + +RPGC A              ++ +  + LG  V+
Sbjct  472   DLIIVRGRNHYPQDIEKTVEGFPD-IRPGCSAAFS-----------MSLQGQEVLG--VV  517

Query  3337  AEVRD---GKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRF  3507
             AEVR     +P    +   I   V+ EHGV ++++  +   +I KTTSGKI R      F
Sbjct  518   AEVRGAQMAQPTLEAIAASIRQAVSVEHGVLVSAMALVATHTIPKTTSGKISRRRAKVDF  577

Query  3508  IS----------GTLDVIEEQMNGERSLPRNDGIIVPANGKISKTDIVNFLKDLLSQQTG  3657
             +            T+D  ++  +   +LP     I+P    +   ++ +FL+  ++Q   
Sbjct  578   VDRKLTELYRLVKTVDTNDDPQDDAAALPPT---ILPEFSSVPPAEVKSFLRREIAQMLD  634

Query  3658  IPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINI  3768
                  I+    L   G++S+G+ +    + + +G+ +
Sbjct  635   ASHDTITDATELQQVGMDSMGLTQLQGIVQNQYGLQV  671



>ref|XP_002909646.1| putative fatty-acid-CoA ligase, putative [Phytophthora infestans 
T30-4]
 gb|EEY58460.1| putative fatty-acid-CoA ligase, putative [Phytophthora infestans 
T30-4]
Length=736

 Score =   332 bits (851),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 235/691 (34%), Positives = 356/691 (52%), Gaps = 84/691 (12%)
 Frame = +1

Query  1888  KEVHTNAFTIAQKLLTSQKP-----AIKPGDKVLLIYVPGLDFVDAFFGCLRARVipipt  2052
             KE++     +A  LL+S +       +  GD+VLL+Y PGLDF+ AF  CL+A V+ +P 
Sbjct  19    KELNRRVQNLAWLLLSSTQQHSRGLGLSQGDRVLLVYPPGLDFIVAFLACLKAGVVAVPV  78

Query  2053  ippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSW  2232
              PPD   R   + +    ++ + C     L+   Y    +I + K+    K     +  W
Sbjct  79    YPPD--PRKMKKDISMFVSVTQNCQAKTALTCSMYFNVKKIAAIKD----KCTFSGAAQW  132

Query  2233  PD-LPWLHTDSWVkkpklfkkpkDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHN  2409
             P+ L W+ TD  V    +          P ++   FLQ+TSGST+ PKGV+++HG + HN
Sbjct  133   PEHLSWVVTDDLVDTKGIDPTKHWLTQSPSTDSTAFLQYTSGSTSAPKGVVLSHGNLNHN  192

Query  2410  VKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQT  2589
             ++ +     +   T++VSWLPQYHDMGLIG  L  + +GG+G+  SP +F+++P LWL+ 
Sbjct  193   LRTISSALHAGRDTVVVSWLPQYHDMGLIGAYLGTIFNGGTGVYLSPFSFIRDPCLWLRL  252

Query  2590  MSKWRATHSAAPNFAFELLVRRLES-----SKEENFDLSSMHFLMSAAEPIRQTTLKRFV  2754
             +SK RATH  APNFA+ LL R+ +      +  +  DLSS+  +++ AEPI+   +  F 
Sbjct  253   VSKHRATHLQAPNFAYSLLARKSDRLTVGLASGQQVDLSSVRHMINGAEPIQGEAMDNFY  312

Query  2755  ELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFVDWQ----GRV--------CCGY  2898
                  FGL   V+ P YGLAE+ V+V C  G+   ++VD Q     RV          G 
Sbjct  313   RAFSPFGLPEGVVKPTYGLAEHTVYV-CGGGQQR-LWVDKQELESNRVFRVVEKTNTSGL  370

Query  2899  IKQ------PNTD--GVDIKIISPETGKENDDPGKEGEIWISSLSAGIGYWGLE--ELSQ  3048
             +K+      P+    G+D+ I   ETG+E  + G+ GEIWISS S   GY+G E  ELS 
Sbjct  371   VKEMIGCGVPSRKDYGIDVCIADAETGEEKPE-GETGEIWISSASKAQGYYGDEMSELSV  429

Query  3049  KTFENDILS-TPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDIEKTVESSS  3225
             + F+  ++  T GK +++TGDLG I + +LFI GR KDL+I+ G+N Y  D+E T E+  
Sbjct  430   EIFQAKVVGDTEGKTFLKTGDLGVIYNQELFICGRMKDLVIIRGRNHYPQDLEATAETHE  489

Query  3226  ELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRD-GKPLPYDVMDHICTRVA  3402
             EL RPGCCA      D            +D+  L V+AE+RD        +   I + +A
Sbjct  490   EL-RPGCCAAFSYVAD----------GNADDEQLAVVAELRDPAMTSKASLCGKIRSAIA  538

Query  3403  EEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTL-------DVIEE--------  3537
              EHGV +  +V + PRSI KTTSGKI R  C K     TL       D+I E        
Sbjct  539   REHGVKVTLVVLLAPRSIPKTTSGKISRSRCKKALEEKTLKELYRNEDMIAEIPVEDGGG  598

Query  3538  -----------QMNGERSLPRNDGIIVPANGKISKT---DIVNFLKDLLSQQTGIPVSKI  3675
                         +NG R  P + G        I+      +  FL + L++  G+  ++I
Sbjct  599   DEAVAGETMNRNVNGPRVAPTHSGATSNLPSIITGVPPDQVHAFLVEELARTLGVETAQI  658

Query  3676  STGETLVSYGVNSIGVVRAAQKISSFFGINI  3768
             +    L   G++S+ + +    I+  + +++
Sbjct  659   NDDTPLQELGLDSMALTQLQGVIAQRYQVHV  689



>ref|WP_036450920.1| long-chain acyl-CoA synthetase, partial [Mycobacterium marinum]
Length=670

 Score =   330 bits (845),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 225/689 (33%), Positives = 346/689 (50%), Gaps = 67/689 (10%)
 Frame = +1

Query  1828  NKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVD  2007
             +    +++N++G V +  +  +V T    +AQ     Q   + PGD+ +L+Y PGLDFV 
Sbjct  17    DAAALSFVNDRGLVTESMSRADVVTEMNKVAQ--FVRQDCGLAPGDRAVLVYPPGLDFVC  74

Query  2008  AFFGCLRARVipiptippdptQ-RGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSA  2184
                GC+ A VI +P  PPDP   +  G+A   +A     C   A+L++  Y    ++  A
Sbjct  75    GLLGCMAAGVIAVPVFPPDPINPQKSGEAFRRVA---LDCGATAVLTSHHYADARQLDVA  131

Query  2185  KNMLFGKSKDKSSNSWPD-LPWLHTDSWVkkpklfkkpkDEQG----QPLSEDLCFLQFT  2349
               +  G + D+    WP+ LPW  T                +      P  +    LQ+T
Sbjct  132   APV--GTAFDED---WPNALPWHVTSRGASGRGKSAPRAVSEAISEWAPSPQTPALLQYT  186

Query  2350  SGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGG  2529
             SGST+DPKGV+ITHG V+H  +  R+          V W+P YHD GLI G+L+ L    
Sbjct  187   SGSTSDPKGVVITHGNVVHQAEFNRRFIGLGPGHRAVFWVPPYHDFGLISGILSALAGNF  246

Query  2530  SGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLM  2709
                + SP++F++ P LW + M + RAT + APNF FEL +R+  + +   +DLS +  ++
Sbjct  247   DLTMMSPMSFIQRPALWFEVMDRVRATVTVAPNFGFELAMRKTTAEQRAGWDLSPLQVIV  306

Query  2710  SAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPV---------  2862
             SAAEP+R+ T +RF E   + G+ RE   P YGLAE+ V ++ +    L V         
Sbjct  307   SAAEPVREDTTRRFFEAFAASGIRREAFCPCYGLAEHTVGITVSGRSSLRVDRSQLETRQ  366

Query  2863  ------FVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGIGY  3024
                     D Q  + CG   QP TD VD++I+ PE      + G+ GEIW  S S   GY
Sbjct  367   LAVPSDAPDAQVLMGCG---QP-TDDVDVRIVDPELCVPLGE-GQVGEIWADSPSKAAGY  421

Query  3025  WGLEELSQKTFENDILSTPGKR-YIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDI  3201
             WGL   S+ TF+  +    G R Y+RTGDLG + D +L++ GR KDL+I+AG+NIY  DI
Sbjct  422   WGLSAKSRATFQAALAGVEGGRGYLRTGDLGFLHDGELYVCGRIKDLLILAGRNIYPQDI  481

Query  3202  EKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVR-DGKP-LPYDV  3375
             E ++      +RPG  A   + +              +   L V+ EVR DG P L   V
Sbjct  482   EDSLRDCHPAIRPGGFAAFAVAD-------------GNSETLAVLVEVRTDGSPDLLAGV  528

Query  3376  MDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLD----VIEEQM  3543
             +  I   V ++H +    +V   P S+SKTTSGK++R  C  RF+ GTL     +++ + 
Sbjct  529   VAAIRAAVLKDHQLRCGVVVLGPPGSVSKTTSGKVQRSRCRARFLDGTLQAQALLVDRRT  588

Query  3544  NGERSLPRNDGIIVPANGKISKTDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGV  3723
             + E           P     +   +++ +    ++  GI  + +    +L   G+NSIGV
Sbjct  589   DDE-----------PVGAAPTTEQLLSVVCGQAAEVLGIGAASVDIDRSLGDQGLNSIGV  637

Query  3724  VRAAQKISSFFGINIGAIDIFSATCIDDL  3810
                A +++   G ++  +DIF+   + DL
Sbjct  638   TELASRLTQVLGQDVQPVDIFNHPTVGDL  666



>ref|WP_020724738.1| Long-chain-fatty-acid--CoA ligase [Mycobacterium marinum]
 gb|EPQ75637.1| Long-chain-fatty-acid--CoA ligase [Mycobacterium marinum MB2]
Length=1007

 Score =   338 bits (868),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 239/754 (32%), Positives = 378/754 (50%), Gaps = 67/754 (9%)
 Frame = +1

Query  1831  KTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDA  2010
              T  +++NEKG V +  +  +V ++   +A+ L       ++PGD+ +L Y  GLDFV  
Sbjct  18    NTAISFVNEKGRVAESMSRADVVSDMGEVAEFL--RHHCGLEPGDRAILAYPSGLDFVRG  75

Query  2011  FFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAKN  2190
               GCL A V+P+P  PPDP      + +  +  +       A+L++  Y    R+ +A++
Sbjct  76    LIGCLAAGVVPVPIYPPDPINPQ--KTVDRMQRVVASSGAKAVLTSRRYANARRLGTARS  133

Query  2191  MLFGKSKDKSSNSWP-DLPW-LHTDSWVkkpklfkkpkDEQGQ---PLSEDLCFLQFTSG  2355
             ++ G     S+  WP DLPW + +     +           G+   P  +    LQ+TSG
Sbjct  134   IVTG-----STVGWPGDLPWHITSRGIGGRRMRGPGTPGAPGRGWSPSPDAPALLQYTSG  188

Query  2356  STTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSG  2535
             ST+DPKGV+ITHG + H V   R+          V WLP YHD GLI  +L+ L   G  
Sbjct  189   STSDPKGVVITHGNLAHQVDFNRRLLGLGLDARGVFWLPPYHDFGLISVILSGLAGSGEV  248

Query  2536  ILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSA  2715
              L SP+TF++ P LW   M + RATH+AAPNFA+EL VR+  + +   +DLSS+  +MSA
Sbjct  249   TLMSPLTFLQRPALWFDVMDRVRATHTAAPNFAYELAVRKTTAEQRAAWDLSSLQVVMSA  308

Query  2716  AEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYG-------------EGL  2856
             AEP+R+ T  RF++     GL R+   P YGLAE+ V V+  +G             + L
Sbjct  309   AEPVREDTTSRFLDAFSGTGLRRDAFCPAYGLAEHTVAVTM-FGRSTLSVDRHQLETQRL  367

Query  2857  PVFVDWQGR---VCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGIGYW  3027
              V  D  G    + CG +     D VD++I+ PE      D G+ GEIW+ S S   GYW
Sbjct  368   AVPADGPGSQVLIGCGQV----ADDVDVRIVDPELHVPLAD-GQVGEIWVDSPSKAAGYW  422

Query  3028  GLEELSQKTFENDILSTPGKR-YIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDIE  3204
             GL + S+ TF   +  +   R Y+RTGDLG + D +L++ GR KDL+I+AG+NI+  DIE
Sbjct  423   GLPDKSRDTFGARLAGSDDSRSYLRTGDLGLLHDGELYVCGRLKDLLILAGRNIHPQDIE  482

Query  3205  KTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRD--GKPLPYDVM  3378
             +++      +RPG  A   +              A D  GL V+ EV+      +   V 
Sbjct  483   ESLRDCHPAIRPGGIAAFAVD----------AGDAGDVEGLAVLVEVKADIATEMLSGVA  532

Query  3379  DHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLD-----VIEEQM  3543
             D +   V + H +  +++V   P S+SKTTSGK++R  C  R + GTL+     V   + 
Sbjct  533   DEVQAVVLKNHQLRCSAVVVAPPGSVSKTTSGKVQRARCRTRLLDGTLEAEALLVARLED  592

Query  3544  NGERSLPRND----GIIVPANG---KISKTDIVNFLKDLLSQQTGIPVSKISTGETLVSY  3702
              G   +P ++    G +V + G         ++  ++D ++   GI  +++   + L   
Sbjct  593   AGPPDVPDDELGTAGPVVTSAGAWPAAPGDPLLASVRDQVAAVFGIRAARVDIDQPLSEQ  652

Query  3703  GVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFV---ESLLEKNHP---MLTNS  3864
             G++S+G V+ A ++S  F  ++  +D+F    +  LA  +   E    ++HP   +L + 
Sbjct  653   GLDSVGFVKLASRLSQAFDRDVPPVDVFKHPTVRGLAHMLRDAEVAGCEHHPPQALLQHP  712

Query  3865  SETKISSSGIPSVVSTFDKITIWLIHLVALAYVS  3966
             +  +   +G     ST D     L   +    +S
Sbjct  713   NPARCGPAGDGDDASTRDSFEALLKGAITTGRIS  746



>emb|CCI45818.1| unnamed protein product [Albugo candida]
Length=1093

 Score =   339 bits (869),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 246/709 (35%), Positives = 368/709 (52%), Gaps = 92/709 (13%)
 Frame = +1

Query  1831  KTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDK----------VLLI  1980
             KTL T++++ G  +  RT +E+ ++   +A  L T   P+ +  +           VLL+
Sbjct  41    KTLLTFVDDAGIPVATRTAQELDSDIKALAVLLRT---PSSQHSNGFGLSGNSTSVVLLV  97

Query  1981  YVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYH  2160
             Y PGLDF+ AF  CL A VI +P  PPDP  R   + L     IA  C     L++ +Y 
Sbjct  98    YPPGLDFIIAFLACLTAGVIAVPVYPPDP--RKLKKDLTMFVAIAHNCGATVALTSANYA  155

Query  2161  VTVRIMSAKNMLFGKSKDKSSNSWPD-LPWLHTDSWVkkpklfkkpk----DEQGQPLSE  2325
                +I   +  L      K    WPD L W  +D+ + +  + +K +     E   P + 
Sbjct  156   HAKKITQLQEKLTRHQGLK----WPDTLQWSVSDTLLSRMSIKQKMQLWRNREVEGPTTS  211

Query  2326  DLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGL  2505
             D+ FLQ+TSGST+ PKGVM+TH  + HN+K++     +   TI+VSWLPQYHDMGLIG  
Sbjct  212   DIAFLQYTSGSTSMPKGVMLTHANLNHNLKIISSALCAGKDTIVVSWLPQYHDMGLIGAY  271

Query  2506  LTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRR---LESSKEE  2676
             L  L +GGSG+  SP TF+KNP++WLQ +S+++ATH  APNFAF L  R+   + S K +
Sbjct  272   LGTLFNGGSGVYMSPFTFIKNPMIWLQLISQYKATHLQAPNFAFSLCARKSDTIASLKYK  331

Query  2677  NFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGL  2856
               +LSS+  +++ AEP++  ++  F    + +GL+  V+   YGLAE+ V+V C  G+  
Sbjct  332   EINLSSVRHMINGAEPVKGDSIDAFYRAFEPYGLATNVIKATYGLAEHTVYV-CG-GDST  389

Query  2857  PVFVDWQ-----------------------GRVCCGYIKQPNTD--GVDIKIISPETGKE  2961
              + +D Q                         + CG   +PN    GV++ I+ P+T  +
Sbjct  390   RLVIDKQLLETQKQIQPIDNNTADGNTSVKEMISCG---KPNRKDYGVEVCIVDPDTCHK  446

Query  2962  NDDPGKEGEIWISSLSAGIGYWG------LEELSQKTFENDILSTPGKRYIRTGDLGRII  3123
                PG  GEIWISS S  +GY+G       EE  Q     D        Y+RTGDLG + 
Sbjct  447   M-QPGNVGEIWISSPSKALGYFGESNTTMSEEAFQARITTDTEVETSSLYLRTGDLGFLH  505

Query  3124  DSKLFITGRTKDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQ  3303
             D +L+I GR KDLIIV G+N Y  D+E TVES  E +RPGC A        L++K    Q
Sbjct  506   DEELYICGRLKDLIIVRGRNHYPQDLEFTVESFPE-IRPGCTAAFS----SLITKNATNQ  560

Query  3304  RASDELGLVVIAEVRDGKPLPYDVMDH---ICTR----VAEEHGVPIASIVAIKPRSISK  3462
                +E  L+++AE+RD K      M H   +C++    + +EHGV    ++ + P SI K
Sbjct  561   SVEEE--LIIVAELRDPK------MQHKASLCSKIRSAIVQEHGVKATVMILLPPHSIPK  612

Query  3463  TTSGKIKRYECAKRFISGTL-------DVIEEQMNGERSLPRNDGIIVPANGKISKTDIV  3621
             TTSGKI R  C + +   TL       D++  + N E     +    VP   + +  DI+
Sbjct  613   TTSGKISRSRCQQSYEQNTLPELYRNEDILLSE-NLEDDFDPDTTAKVPQQAEEADEDIL  671

Query  3622  NFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINI  3768
              FL   ++Q   +   +I +   L + G++S+ + +    I+  F I I
Sbjct  672   EFLVSEVAQVLEVEKRQIVSNAPLQNLGLDSMALAQLQGIITQRFQIQI  720



>ref|WP_012393673.1| long-chain acyl-CoA synthetase [Mycobacterium marinum]
 ref|YP_001850180.1| long-chain acyl-CoA synthetase [Mycobacterium marinum M]
 gb|ACC40325.1| long-chain acyl-CoA synthetase [Mycobacterium marinum M]
Length=1018

 Score =   337 bits (864),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 242/756 (32%), Positives = 380/756 (50%), Gaps = 71/756 (9%)
 Frame = +1

Query  1831  KTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDA  2010
              T  +++NEKG V +  +  +V ++   +A+ L       ++PGD+ +L Y  GLDFV  
Sbjct  29    NTAISFVNEKGRVAESMSRADVVSDMGEVAEFL--RHHCGLEPGDRAILAYPSGLDFVRG  86

Query  2011  FFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAKN  2190
               GCL A V+P+P  PPDP      + +  +  +       A+L++  Y    R+ +A++
Sbjct  87    LIGCLAAGVVPVPIYPPDPINPQ--KTVDRMQRVVASSGAKAVLTSRRYANARRLGTARS  144

Query  2191  MLFGKSKDKSSNSWP-DLPWLHTDSWVkkpklfkkpkDEQG-----QPLSEDLCFLQFTS  2352
             ++ G     S+  WP DLPW H  S     +  + P           P  +    LQ+TS
Sbjct  145   IVTG-----STVGWPGDLPW-HITSRGIGGRRMRGPGTPGAPGRGWSPSPDAPALLQYTS  198

Query  2353  GSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGS  2532
             GST+DPKGV+ITHG + H V   R+          V WLP YHD GLI  +L+ L   G 
Sbjct  199   GSTSDPKGVVITHGNLAHQVDFNRRLLGLGLDARGVFWLPPYHDFGLISVILSGLAGSGE  258

Query  2533  GILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMS  2712
               L SP+TF++ P LW   M + RATH+AAPNFA+EL VR+  + +   +DLSS+  +MS
Sbjct  259   VTLMSPLTFLQRPALWFDVMDRVRATHTAAPNFAYELAVRKTTAEQRAAWDLSSLQVVMS  318

Query  2713  AAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYG-------------EG  2853
             AAEP+R+ T  RF++     GL R+   P YGLAE+ V V+  +G             + 
Sbjct  319   AAEPVREDTTSRFLDAFSGTGLRRDAFCPAYGLAEHTVAVTM-FGRSTLSVDRHQLETQR  377

Query  2854  LPVFVDWQGR---VCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGIGY  3024
             L V  D  G    + CG +     D VD++I+ PE      D G+ GEIW+ S S   GY
Sbjct  378   LAVPADGPGSQALIGCGQV----ADDVDVRIVDPELHVPLAD-GQVGEIWVDSPSKAAGY  432

Query  3025  WGLEELSQKTFENDILSTPGKR-YIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDI  3201
             WGL + S+ TF   +  +   R Y+RTGDLG + D +L++ GR KDL+I+AG+NI+  DI
Sbjct  433   WGLPDKSRDTFGARLAGSDDSRSYLRTGDLGLLHDGELYVCGRLKDLLILAGRNIHPQDI  492

Query  3202  EKTVESSSELVRPGCCAVVGIPE-DVLVSKGILTQRASDELGLVVIAEVRD--GKPLPYD  3372
             E+++      +RPG  A   +   DV            D  GL V+ EV+      +   
Sbjct  493   EESLRDCHPAIRPGGIAAFAVDAGDV-----------GDVEGLAVLVEVKADIATEMLSG  541

Query  3373  VMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLD-----VIEE  3537
             V D +   V + H +  +++V   P S+SKTTSGK++R  C  R + GTL+     V   
Sbjct  542   VADEVQAVVLKNHQLRCSAVVVAPPGSVSKTTSGKVQRARCRTRLLDGTLEAEALLVARL  601

Query  3538  QMNGERSLPRND----GIIVPANG---KISKTDIVNFLKDLLSQQTGIPVSKISTGETLV  3696
             +  G   +P ++    G +V + G         ++  ++D ++   GI  +++   + L 
Sbjct  602   EDAGPPDVPDDELGTAGPVVTSAGAWPAAPGDPLLASVRDQVAAVFGIRAARVDIDQPLS  661

Query  3697  SYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFV---ESLLEKNHP---MLT  3858
               G++S+G V+ A ++S  F  ++  +D+F+   +  LA  +   E    ++HP   +L 
Sbjct  662   EQGLDSVGFVKLASRLSQAFDRDVPPVDVFNHPTVRGLAHMLRDAEVAGCEHHPPQALLQ  721

Query  3859  NSSETKISSSGIPSVVSTFDKITIWLIHLVALAYVS  3966
             + +  +   +G     ST D     L   +    +S
Sbjct  722   HPNPARCGPAGHGDDASTRDSFEALLKGAITTGRIS  757



>gb|AFK47604.1| unknown [Lotus japonicus]
Length=260

 Score =   312 bits (800),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 148/232 (64%), Positives = 185/232 (80%), Gaps = 6/232 (3%)
 Frame = +1

Query  715   KATNRIGVYSVSEIASDVTPEFLKDKGLKSVPKSVAYGYTASGYGFIQDMPYAYIHEFIR  894
             K   RIGV++VSEIA+D+TP +L+  GLKS+PKSVAYG TASGYGF+QDM YAYIHEF R
Sbjct  29    KIAGRIGVHAVSEIAADLTPGYLEHHGLKSIPKSVAYGCTASGYGFVQDMSYAYIHEFTR  88

Query  895   TSMAGKIRRFKGGYTSVWKKLSEAMPIKFECNTEVLSIKRNSSGVCVDVRHRNGALQAME  1074
              SMAGKIRRFKGGYTS+W+K++E++P K   N EVL+I+RNS GV V+V+  N  ++ +E
Sbjct  89    ISMAGKIRRFKGGYTSLWQKIAESLPSKLRYNFEVLAIRRNSDGVTVNVKSSN-EVETLE  147

Query  1075  FDKIIISGAFPFHNGRTYRSPSQKTAGLFCDK--MDMSTLEKDLFSKVQTIEYYTSVLEI  1248
             FDKIIISG+FP + GR YRSPS     + C+K  MD S LEKDLFSKV+T +Y T+ L+I
Sbjct  148   FDKIIISGSFPLNYGRIYRSPS---TSIECEKEVMDTSDLEKDLFSKVETNDYSTTALKI  204

Query  1249  DGLEHLPMGFYYFENFMEDPAAIGNPVAMQKFYTDTNVFLFWSYGNSIDILG  1404
              GLEH P+GFYYF  +MEDP+  GNPVAM+KFY DT++ LFWSYGN++DI G
Sbjct  205   KGLEHFPVGFYYFNEYMEDPSTTGNPVAMKKFYADTDILLFWSYGNAVDIKG  256



>ref|XP_009514487.1| hypothetical protein PHYSODRAFT_469747 [Phytophthora sojae]
 gb|EGZ27212.1| hypothetical protein PHYSODRAFT_469747 [Phytophthora sojae]
Length=739

 Score =   329 bits (843),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 234/678 (35%), Positives = 348/678 (51%), Gaps = 80/678 (12%)
 Frame = +1

Query  1915  IAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQAL  2094
             +A     S+   +K GD+VLL+Y PGLDF+  F  CLRA V+ +P  PPD   R   + +
Sbjct  33    VASTQQHSKGLGLKQGDRVLLVYPPGLDFIVTFLACLRAGVVAVPVYPPD--PRKMKKDI  90

Query  2095  LHIANIAKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPD-LPWLHTDSWVk  2271
                  + + C     L T S +  V+ +SA    F  S    +  WP+ L W+ TD  V 
Sbjct  91    SMFVTVTQNCQAKTAL-TCSMYYNVKKISAIKEKFTFS---GAAQWPEHLSWVVTDDLVD  146

Query  2272  kpklfkkpkDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRT  2451
                +          P +    FLQ+TSGST+ PKGV+++HG + HN++ +     +   T
Sbjct  147   AKGIDPAKHWLTQSPSANSTAFLQYTSGSTSAPKGVVLSHGNLNHNLRTISSALHAGRDT  206

Query  2452  ILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNF  2631
             ++VSWLPQYHDMGLIG  L  + +GG+G+  SP +F+++P LWL+ +SK  ATH  APNF
Sbjct  207   VVVSWLPQYHDMGLIGAYLGTIFNGGTGVYLSPFSFIRDPCLWLRLVSKHCATHLQAPNF  266

Query  2632  AFELLVRRLES-----SKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMA  2796
             A+ LL R+ +      S  E  DLSS+  +++ AEPI+   +  F      FGL   V+ 
Sbjct  267   AYSLLARKSDRLTAGLSSGETVDLSSVRHIINGAEPIQGEAMDNFHRAFSPFGLPEGVVK  326

Query  2797  PGYGLAENCVFVSCAYGEGLPVFVDWQG-------RV-----CCGYIKQ------PNTD-  2919
             P YGLAE+ V+V C  G+   ++VD Q        RV       G +K+      P+   
Sbjct  327   PTYGLAEHTVYV-CGGGKQR-LWVDKQALESDRIFRVVEKTSAAGLVKEMIGCGVPSRKD  384

Query  2920  -GVDIKIISPETGKENDDPGKEGEIWISSLSAGIGYWGLE--ELSQKTFENDILSTP-GK  3087
              G+D++I+  E+G+E  + G+ GE+WISS S   GY+G E  E S + F+  +     GK
Sbjct  385   YGIDVRIVDAESGQEKPE-GETGEVWISSASKAQGYYGDEMGEFSAEAFQAKVAGDEDGK  443

Query  3088  RYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIP  3267
              Y+RTGDLG I + +LFI GR KDL+I+ G+N Y  D+E T E+  EL RPGCCA     
Sbjct  444   TYLRTGDLGVIYNDELFICGRMKDLVIIRGRNHYPQDLEATAETHEEL-RPGCCAAFSY-  501

Query  3268  EDVLVSKGILTQRASDELGLVVIAEVRD-GKPLPYDVMDHICTRVAEEHGVPIASIVAIK  3444
                  S G       +E  L V+AE+RD        +   I T +A EHGV +  +V + 
Sbjct  502   -----SNG----GNDEEEKLAVVAELRDPAMTSKASLCGKIRTAIAREHGVKVTLVVLLA  552

Query  3445  PRSISKTTSGKIKRYECAKRFISGTL-----------DVIEEQMNGERSLPR-------N  3570
             PR+I KTTSGKI R  C K      L           DV  E   G+ ++         N
Sbjct  553   PRTIPKTTSGKISRSRCKKALEDKALEELYRNEDMIADVPVEDDGGDEAVAGETMDRNVN  612

Query  3571  DGIIVPANGKISKTDIVN------------FLKDLLSQQTGIPVSKISTGETLVSYGVNS  3714
                + P +G   K+++ +            FL + L+   G+  S+I+    L   G++S
Sbjct  613   GPRVAPTDGGAPKSNLPSVITGVPPDQVHAFLVNELAHTLGVEPSQINNNTPLQELGLDS  672

Query  3715  IGVVRAAQKISSFFGINI  3768
             + + +    I+  + +++
Sbjct  673   MALTQLQGVIAQKYQVHV  690



>ref|WP_038581590.1| long-chain acyl-CoA synthetase, partial [Mycobacterium marinum]
Length=670

 Score =   327 bits (837),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 225/689 (33%), Positives = 345/689 (50%), Gaps = 67/689 (10%)
 Frame = +1

Query  1828  NKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVD  2007
             +    +++N++G V +  +  +V T    +AQ     Q   + PGD+ +L+Y PGLDFV 
Sbjct  17    DAAALSFVNDRGLVTESMSRADVVTEMNKVAQ--FVRQDRGLAPGDRAVLVYPPGLDFVC  74

Query  2008  AFFGCLRARVipiptippdptQ-RGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSA  2184
                GC+ A VI +P  PPDP   +  G+A   +A     C   A+L++  Y    ++   
Sbjct  75    GLLGCMAAGVIAVPVFPPDPINPQKSGEAFRRVA---LDCGATAVLTSHHYADARQLDVP  131

Query  2185  KNMLFGKSKDKSSNSWPD-LPWLHTDSWVkkpklfkkpkDEQGQ----PLSEDLCFLQFT  2349
              ++  G + D+    W + LPW  T                +      P  +    LQ+T
Sbjct  132   ASV--GTAFDED---WRNALPWHVTSRGASGRGTGAPRAVSEAASEWAPSPQTPALLQYT  186

Query  2350  SGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGG  2529
             SGST+DPKGV+ITHG V+H  +  R+          V W+P YHD GLI G+L+ L    
Sbjct  187   SGSTSDPKGVVITHGNVVHQAEFNRRFIGLGPGHRAVFWVPPYHDFGLISGILSALAGNF  246

Query  2530  SGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLM  2709
                + SP++F++ P LW + M + RAT + APNF FEL +R+  + +   +DLS +  ++
Sbjct  247   DLTMMSPMSFIQRPALWFEVMDRVRATVTVAPNFGFELAMRKTTAEQRAGWDLSPLQVIV  306

Query  2710  SAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPV---------  2862
             SAAEP+R+ T +RF E   + G+ RE   P YGLAE+ V ++ +    L V         
Sbjct  307   SAAEPVREDTTRRFFEAFAASGIRREAFCPCYGLAEHTVGITVSGRSSLRVDRSQLETRQ  366

Query  2863  ------FVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGIGY  3024
                     D Q  + CG   QP TD VD++I+ PE      + G+ GEIW  S S   GY
Sbjct  367   LAVPSDAPDAQVLMGCG---QP-TDDVDVRIVDPELCVPLGE-GQVGEIWADSPSKAAGY  421

Query  3025  WGLEELSQKTFENDILSTPGKR-YIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDI  3201
             WGL   S+ TF+  +    G R Y+RTGDLG + D +L++ GR KDL+I+AG+NIY  DI
Sbjct  422   WGLSAKSRATFQAALAGVEGGRGYLRTGDLGFLHDGELYVCGRIKDLLILAGRNIYPQDI  481

Query  3202  EKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVR-DGKP-LPYDV  3375
             E ++      +RPG  A   + +              +   L V+AEVR DG P L   V
Sbjct  482   EDSLRDCHPAIRPGGFAAFAVAD-------------GNSETLAVLAEVRTDGSPDLLAGV  528

Query  3376  MDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLD----VIEEQM  3543
             +  I   V ++H +    +V   P S+SKTTSGK++R  C  RF+ GTL     +++ + 
Sbjct  529   VAAIRAAVLKDHQLRCGVVVLGPPGSVSKTTSGKVQRSRCRARFLDGTLQAQALLVDRRT  588

Query  3544  NGERSLPRNDGIIVPANGKISKTDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGV  3723
             + E           P     +   +++ +    ++  GI    +    +L   G+NSIGV
Sbjct  589   DDE-----------PVGAAPTTEQLLSVVCGQAAEVLGIGAVSVDIDRSLGDQGLNSIGV  637

Query  3724  VRAAQKISSFFGINIGAIDIFSATCIDDL  3810
                A ++S   G ++  +DIF+   + DL
Sbjct  638   TELASRLSQVLGQDVQPVDIFNHPTVGDL  666



>ref|WP_036455948.1| long-chain acyl-CoA synthetase, partial [Mycobacterium marinum]
Length=670

 Score =   326 bits (835),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 227/691 (33%), Positives = 347/691 (50%), Gaps = 71/691 (10%)
 Frame = +1

Query  1828  NKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVD  2007
             +    +++N++G V +  +  +V T    +AQ     Q   + PGD+ +L+Y PGLDFV 
Sbjct  17    DAAALSFVNDRGLVTESMSRADVVTEMNKVAQ--FVRQDCGLAPGDRAVLVYPPGLDFVC  74

Query  2008  AFFGCLRARVipiptippdptQ-RGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSA  2184
                GC+ A VI +P  PPDP   +  G+A   +A     C   A+L++  Y    ++  A
Sbjct  75    GLLGCMAAGVIAVPVFPPDPINPQKSGEAFRRVA---LDCGATAVLTSHHYADARQLDVA  131

Query  2185  KNMLFGKSKDKSSNSWPD-LPWLHTDSWVkkpklfkkpkDEQG----QPLSEDLCFLQFT  2349
               +  G + D+    W + LPW  T                +      P  +    LQ+T
Sbjct  132   APV--GTAFDED---WRNALPWHVTSRGASGRGTGAPRAVSEAISEWAPSPQTPALLQYT  186

Query  2350  SGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGG  2529
             SGST+DPKGV+ITHG V+H  +  R+          V W+P YHD GLI G+L+ L    
Sbjct  187   SGSTSDPKGVVITHGNVVHQAEFNRRFIGLGPGHRAVFWVPPYHDFGLISGILSALAGNF  246

Query  2530  SGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLM  2709
                + SP++F++ P LW + M + RAT + APNF FEL +R+  + +   +DLS +  ++
Sbjct  247   DLTMMSPMSFIQRPALWFEVMDRVRATVTVAPNFGFELAMRKTTAEQRAGWDLSPLQVIV  306

Query  2710  SAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPV---------  2862
             SAAEP+R+ T +RF E   + G+ RE   P YGLAE+ V ++ +    L V         
Sbjct  307   SAAEPVREDTTRRFFEAFAASGIRREAFCPCYGLAEHTVGITVSGRSSLRVDRCQLETRQ  366

Query  2863  ------FVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGIGY  3024
                     D Q  + CG   QP TD VD++I+ PE      + G+ GEIW  S S   GY
Sbjct  367   LAVPSDAPDAQVLMGCG---QP-TDDVDVRIVDPELCVPLGE-GQVGEIWADSPSKAAGY  421

Query  3025  WGLEELSQKTFENDILSTPGKR-YIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDI  3201
             WGL   S+ TF+  +    G R Y+RTGDLG + D +L++ GR KDL+I+AG+NIY  DI
Sbjct  422   WGLSAKSRATFQAALAGVEGGRGYLRTGDLGFLHDGELYVCGRIKDLLILAGRNIYPQDI  481

Query  3202  EKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVR-DGKP-LPYDV  3375
             E ++      +RPG  A   + +              +   L V+ EVR DG P L   V
Sbjct  482   EDSLRDCHPAIRPGGFAAFAVAD-------------GNSETLAVLVEVRTDGSPDLLAGV  528

Query  3376  MDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLD----VIEEQM  3543
             +  I   V ++H +    +V   P S+SKTTSGK++R  C  RF+ GTL     +++ + 
Sbjct  529   VAAIRAAVLKDHQLRCGVVVLGPPGSVSKTTSGKVQRSRCRARFLDGTLQAQALLVDRRT  588

Query  3544  NGER--SLPRNDGIIVPANGKISKTDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSI  3717
             + E   + PR + ++    G+ ++               GI  + +    +L   G+NSI
Sbjct  589   DDEPVGAAPRTEQLLSVVCGQAAEV-------------LGIGAASVDIDRSLGDQGLNSI  635

Query  3718  GVVRAAQKISSFFGINIGAIDIFSATCIDDL  3810
             GV   A ++S   G ++  +DIF+   + DL
Sbjct  636   GVTELASRLSQVLGQDVQPVDIFNHPTVGDL  666



>emb|CDM75951.1| long-chain acyl-CoA synthetase [Mycobacterium marinum E11]
Length=1018

 Score =   335 bits (858),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 240/755 (32%), Positives = 379/755 (50%), Gaps = 69/755 (9%)
 Frame = +1

Query  1831  KTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDA  2010
              T  +++NEKG V +  +  +V ++   +A+ L       ++PGD+ +L Y  GLDFV  
Sbjct  29    NTAISFVNEKGRVAESMSRADVVSDMGEVAEFL--RHHCGLEPGDRAILAYPSGLDFVRG  86

Query  2011  FFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAKN  2190
               GCL A V+P+P  PPDP      + +  +  +       A+L++  Y     + +A++
Sbjct  87    LIGCLAAGVVPVPIYPPDPINPQ--KTVDRMQRVVASSGAKAVLTSRRYANARWLGTARS  144

Query  2191  MLFGKSKDKSSNSWP-DLPWLHTDSWVkkpklfkkpkDEQG-----QPLSEDLCFLQFTS  2352
             ++ G     S+  WP DLPW H  S     +  + P           P  +    LQ+TS
Sbjct  145   IVTG-----STVGWPGDLPW-HITSRGIGGRRMRGPGTPGAPGRGWSPSPDAPALLQYTS  198

Query  2353  GSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGS  2532
             GST+DPKGV+ITHG + H V   R+          V WLP YHD GLI  +L+ L   G 
Sbjct  199   GSTSDPKGVVITHGNLAHQVDFNRRLLGLGLDARGVFWLPPYHDFGLISVILSGLAGSGE  258

Query  2533  GILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMS  2712
               L SP+TF++ P LW   M + RATH+AAPNFA+EL VR+  + +   +DLSS+  +MS
Sbjct  259   VTLMSPLTFLQRPALWFDVMDRVRATHTAAPNFAYELAVRKTTAEQRAAWDLSSLQVVMS  318

Query  2713  AAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYG-------------EG  2853
             AAEP+R+ T  RF++     GL R+   P YGLAE+ V V+  +G             + 
Sbjct  319   AAEPVREDTTSRFLDAFSGTGLRRDAFCPSYGLAEHTVAVTM-FGRSTLSVDRHQLETQR  377

Query  2854  LPVFVDWQGR---VCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGIGY  3024
             L V  D  G    + CG +     D VD++I+ PE      D G+ GEIW+ S S   GY
Sbjct  378   LAVPADGPGSQVLIGCGQV----ADDVDVRIVDPELHVPLAD-GQVGEIWVDSPSKAAGY  432

Query  3025  WGLEELSQKTFENDILSTPGKR-YIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDI  3201
             WGL + S+ TF   +  +   R Y+RTGDLG + D +L++ GR KDL+I+AG+NI+  DI
Sbjct  433   WGLPDKSRDTFGARLAGSDDSRSYLRTGDLGLLHDGELYVCGRLKDLLILAGRNIHPQDI  492

Query  3202  EKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRD--GKPLPYDV  3375
             E+++      +RPG  A   +              A +  GL V+ EV+      +   V
Sbjct  493   EESLRDCHPAIRPGGIAAFAVD----------AGDAGEVEGLAVLVEVKADIATEMLSGV  542

Query  3376  MDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLD-----VIEEQ  3540
              D +   V + H +  +++V   P S+SKTTSGK++R  C  R + GTL+     V   +
Sbjct  543   ADEVQAVVLKNHQLRCSAVVVAPPGSVSKTTSGKVQRARCRTRLLDGTLEAEALLVARLE  602

Query  3541  MNGERSLPRND----GIIVPANG---KISKTDIVNFLKDLLSQQTGIPVSKISTGETLVS  3699
               G   +P ++    G +V + G     S   ++  ++D ++   GI  +++   + L  
Sbjct  603   DAGPPDVPDDELGTAGPVVTSAGAWPAASGDPLLASVRDQVAAVFGIRAARVDIDQPLSE  662

Query  3700  YGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFV---ESLLEKNHP---MLTN  3861
              G++S+G V+ A ++S  F  ++  +D+F+   +  LA  +   E    ++HP   +L +
Sbjct  663   QGLDSVGFVKLASRLSQAFDRDVPPVDVFNHPTVRGLAHMLRDAEVAGCEHHPPQALLQH  722

Query  3862  SSETKISSSGIPSVVSTFDKITIWLIHLVALAYVS  3966
              +  +   +G     ST D     L   +    +S
Sbjct  723   PNPARCGPAGDGDDASTRDSFEALLKGAITTGRIS  757



>ref|WP_036427282.1| long-chain acyl-CoA synthetase, partial [Mycobacterium sp. 012931]
Length=670

 Score =   326 bits (835),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 225/689 (33%), Positives = 344/689 (50%), Gaps = 67/689 (10%)
 Frame = +1

Query  1828  NKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVD  2007
             +    +++N++G V +  +   V T    +AQ     Q   + PGD+ +L+Y PGLDFV 
Sbjct  17    DAAALSFVNDRGLVTESMSRAGVVTEMNKVAQ--FVRQDCGLAPGDRAVLVYPPGLDFVC  74

Query  2008  AFFGCLRARVipiptippdptQ-RGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSA  2184
                GC+ A VI +P  PPDP   +  G+A   +A     C   A+L++  Y    ++  A
Sbjct  75    GLLGCMAAGVIAVPVFPPDPINPQKSGEAFRRVA---LDCGATAVLTSHHYADARQLDVA  131

Query  2185  KNMLFGKSKDKSSNSWPD-LPWLHTDSWVkkpklfkkpkDEQG----QPLSEDLCFLQFT  2349
               +  G + D+    WP+ LPW  T                +      P  +    LQ+T
Sbjct  132   APV--GTAFDED---WPNALPWHVTSRGASGRGKSAPRAVSEAISEWAPSPQTPALLQYT  186

Query  2350  SGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGG  2529
             SGST+DPKGV+ITHG V+H  +  R+          V W+P YHD GLI G+L+ L    
Sbjct  187   SGSTSDPKGVVITHGNVVHQAEFNRRFIGLGPGHRAVFWVPPYHDFGLISGILSALAGNF  246

Query  2530  SGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLM  2709
                + SP++F++ P LW + M + RAT + APNF FEL +R+  + +   +DLS +  ++
Sbjct  247   DLTMMSPMSFIQRPALWFEVMDRVRATVTVAPNFGFELAMRKTTAEQRAGWDLSPLQVIV  306

Query  2710  SAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPV---------  2862
             SAAEP+R+ T +RF E   +  + RE   P YGLAE+ V ++ +    L V         
Sbjct  307   SAAEPVREDTTRRFFEAFAASWIRREAFCPCYGLAEHTVGITVSGRSSLRVDRCQLETRQ  366

Query  2863  ------FVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGIGY  3024
                     D Q  + CG   QP TD VD++I+ PE      D G+ GEIW  S S   GY
Sbjct  367   LAVPSDAPDAQVLMGCG---QP-TDDVDVRIVDPELCVPLGD-GQVGEIWADSPSKAAGY  421

Query  3025  WGLEELSQKTFENDILSTPGKR-YIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDI  3201
             WGL   S+ TF+  +    G R Y+RTGDLG + D +L++ GR KDL+I+AG+NIY  DI
Sbjct  422   WGLSAKSRATFQAALAGVEGGRGYLRTGDLGVLHDGELYVCGRIKDLLILAGRNIYPQDI  481

Query  3202  EKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVR-DGKP-LPYDV  3375
             E ++      +RPG  A   + +              +   L V+ EVR DG P L   V
Sbjct  482   EDSLRDCHPAIRPGGFAAFAVAD-------------GNSETLAVLVEVRTDGSPDLLAGV  528

Query  3376  MDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLD----VIEEQM  3543
             +  I   V ++H +    +V   P S+SKTTSGK++R  C  RF+ GTL     +++ + 
Sbjct  529   VAAIRAAVLKDHQLCCGVVVLGPPGSVSKTTSGKVQRSRCRARFLDGTLQAQALLVDRRT  588

Query  3544  NGERSLPRNDGIIVPANGKISKTDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGV  3723
             + E           P     +   +++ +    ++  GI  + +    +L   G+NSIGV
Sbjct  589   DDE-----------PVGAAPTTEQLLSVVCGQAAEVLGIGAASVDIDRSLGDQGLNSIGV  637

Query  3724  VRAAQKISSFFGINIGAIDIFSATCIDDL  3810
                A +++   G ++  +DIF+   + DL
Sbjct  638   TELASRLTQVLGQDVQPVDIFNHPTVGDL  666



>ref|WP_038579250.1| long-chain acyl-CoA synthetase [Mycobacterium marinum]
Length=1007

 Score =   334 bits (857),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 238/754 (32%), Positives = 379/754 (50%), Gaps = 67/754 (9%)
 Frame = +1

Query  1831  KTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDA  2010
              T  +++NEKG V +  +  +V ++   +A+ L       ++PGD+ +L Y  GLDFV  
Sbjct  18    NTAISFVNEKGRVAESMSRADVVSDMGEVAEFL--RHHCGLEPGDRAILAYPSGLDFVRG  75

Query  2011  FFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAKN  2190
               GCL A V+P+P  PPDP      + +  +  +       A+L++  Y     + +A++
Sbjct  76    LIGCLAAGVVPVPIYPPDPINPQ--KTVDRMQRVVASSGAKAVLTSRRYANARWLGTARS  133

Query  2191  MLFGKSKDKSSNSWP-DLPW-LHTDSWVkkpklfkkpkDEQGQ---PLSEDLCFLQFTSG  2355
             ++ G     S+  WP DLPW + +     +           G+   P  +    LQ+TSG
Sbjct  134   IVTG-----STVGWPGDLPWHITSRGIGGRRMRGPGTPGAPGRGWSPSPDAPALLQYTSG  188

Query  2356  STTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSG  2535
             ST+DPKGV+ITHG + H V   R+          V WLP YHD GLI  +L+ L   G  
Sbjct  189   STSDPKGVVITHGNLAHQVDFNRRLLGLGLDARGVFWLPPYHDFGLISVILSGLAGSGEV  248

Query  2536  ILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSA  2715
              L SP+TF++ P LW   M + RATH+AAPNFA+EL VR+  + +   +DLSS+  +MSA
Sbjct  249   TLMSPLTFLQRPALWFDVMDRVRATHTAAPNFAYELAVRKTTAEQRAAWDLSSLQVVMSA  308

Query  2716  AEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYG-------------EGL  2856
             AEP+R+ T  RF++     GL R+   P YGLAE+ V V+  +G             + L
Sbjct  309   AEPVREDTTSRFLDAFSGTGLRRDAFCPSYGLAEHTVAVTM-FGRSTLSVDRHQLETQRL  367

Query  2857  PVFVDWQGR---VCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGIGYW  3027
              V  D  G    + CG +     D VD++I+ PE      D G+ GEIW+ S S   GYW
Sbjct  368   AVPADGPGSQVLIGCGQV----ADDVDVRIVDPELHVPLAD-GQVGEIWVDSPSKAAGYW  422

Query  3028  GLEELSQKTFENDILSTPGKR-YIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDIE  3204
             GL + S+ TF   +  +   R Y+RTGDLG + D +L++ GR KDL+I+AG+NI+  DIE
Sbjct  423   GLPDKSRDTFGARLAGSDDSRSYLRTGDLGLLHDGELYVCGRLKDLLILAGRNIHPQDIE  482

Query  3205  KTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRD--GKPLPYDVM  3378
             +++      +RPG  A   +              A +  GL V+ EV+      +   V 
Sbjct  483   ESLRDCHPAIRPGGIAAFAVD----------AGDAGEVEGLAVLVEVKADIATEMLSGVA  532

Query  3379  DHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLD-----VIEEQM  3543
             D +   V + H +  +++V   P S+SKTTSGK++R  C  R + GTL+     V   + 
Sbjct  533   DEVQAVVLKNHQLRCSAVVVAPPGSVSKTTSGKVQRARCRTRLLDGTLEAEALLVARLED  592

Query  3544  NGERSLPRND----GIIVPANG---KISKTDIVNFLKDLLSQQTGIPVSKISTGETLVSY  3702
              G   +P ++    G +V + G     S   ++  ++D ++   GI  +++   + L   
Sbjct  593   AGPPDVPDDELGTAGPVVTSAGAWPAASGDPLLASVRDQVAAVFGIRAARVDIDQPLSEQ  652

Query  3703  GVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFV---ESLLEKNHP---MLTNS  3864
             G++S+G V+ A ++S  F  ++  +D+F+   +  LA  +   E    ++HP   +L + 
Sbjct  653   GLDSVGFVKLASRLSQAFDRDVPPVDVFNHPTVRGLAHMLRDAEVAGCEHHPPQALLQHP  712

Query  3865  SETKISSSGIPSVVSTFDKITIWLIHLVALAYVS  3966
             +  +   +G     ST D     L   +    +S
Sbjct  713   NPARCGPAGDGDDASTRDSFEALLKGAITTGRIS  746



>ref|WP_015355244.1| long-chain acyl-CoA synthetase [Mycobacterium liflandii]
 ref|YP_007368447.1| long-chain acyl-CoA synthetase [Mycobacterium liflandii 128FXT]
 gb|AGC61940.1| long-chain acyl-CoA synthetase [Mycobacterium liflandii 128FXT]
Length=929

 Score =   332 bits (852),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 240/755 (32%), Positives = 377/755 (50%), Gaps = 70/755 (9%)
 Frame = +1

Query  1831  KTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDA  2010
              T  +++NEKG V +  +  +V ++   +A+ L       ++PGD+ +L Y  GLDFV  
Sbjct  18    NTAISFVNEKGRVAESMSRADVVSDMGEVAEFL--RHHCGLEPGDRAILAYPSGLDFVRG  75

Query  2011  FFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAKN  2190
               GCL A V+P+P  PPDP      + +  +  +       A+L++  Y    R+ +A++
Sbjct  76    LIGCLAAGVVPVPIYPPDPINPQ--KTVDRMQRVVASSGAKAVLTSRRYANARRLGTARS  133

Query  2191  MLFGKSKDKSSNSWP-DLPWLHTDSWVkkpklfkkpkDEQG-----QPLSEDLCFLQFTS  2352
             ++ G     S+  WP DLPW H  S     +  + P           P  +    LQ+TS
Sbjct  134   IVTG-----STVGWPGDLPW-HITSRGIGGRRMRGPGTPGAPGRGWSPSPDAPALLQYTS  187

Query  2353  GSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGS  2532
             GST+DPKGV+ITHG + H V   R+          V WLP YHD GLI  +L+ L   G 
Sbjct  188   GSTSDPKGVVITHGNLAHQVDFNRRLLGLGLDARGVFWLPPYHDFGLISVILSGLAGSGE  247

Query  2533  GILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMS  2712
               L SP+TF++ P LW   M + RATH+AAPNFA+EL VR+  + +   +DLSS+  +MS
Sbjct  248   VTLMSPLTFLQRPALWFDVMDRVRATHTAAPNFAYELAVRKTTAEQRAAWDLSSLQVVMS  307

Query  2713  AAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYG-------------EG  2853
             AAEP+R+ T  RF++     GL R+   P YGLAE  V V+  +G             + 
Sbjct  308   AAEPVREDTTSRFLDAFSGTGLRRDAFCPAYGLAERTVAVTM-FGRSTLSVDRHQLETQR  366

Query  2854  LPVFVDWQGR---VCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGIGY  3024
             L V  D  G    + CG +     D VD++I+ PE      D G+ GEIW+ S S    Y
Sbjct  367   LAVPADGPGSQMLIGCGQV----ADDVDVRIVDPELHVPLAD-GQVGEIWVDS-SKAASY  420

Query  3025  WGLEELSQKTFENDILSTPGKR-YIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDI  3201
             WGL + S+ TF   +  +   R Y+RTGDLG + D +L++ GR KDL+I+AG+NI+  DI
Sbjct  421   WGLPDKSRDTFGARLAGSDDSRSYLRTGDLGLLHDGELYVCGRLKDLLILAGRNIHPQDI  480

Query  3202  EKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRD--GKPLPYDV  3375
             E+++      +RPG  A   +              A D  GL V+ EV+      +   V
Sbjct  481   EESLRDCHPAIRPGGIAAFAVD----------AGDAGDVEGLAVLVEVKADIATEMLSGV  530

Query  3376  MDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLD-----VIEEQ  3540
              D +   V + H +  +++V   P S+SKTTSGK++R  C  R + GTL+     V   +
Sbjct  531   ADEVQAVVLKNHQLRCSAVVVAPPGSVSKTTSGKVQRARCRTRLLDGTLEAEELLVARLE  590

Query  3541  MNGERSLPRND----GIIVPANG---KISKTDIVNFLKDLLSQQTGIPVSKISTGETLVS  3699
               G   +P ++    G +V + G         ++  ++D ++   GI  +++   + L  
Sbjct  591   DAGPPDVPDDELGTAGPVVTSAGAWPAAPGDPLLASVRDQVAAVFGIRAARVDIDQPLSE  650

Query  3700  YGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFV---ESLLEKNHP---MLTN  3861
              G++S+G V+ A ++S  F  ++  +D+F+   +  LA  +   E    ++HP   +L +
Sbjct  651   QGLDSVGFVKLASRLSQAFDRDVPPVDVFNHPTVRGLAHMLRDAEVAGCEHHPPQALLQH  710

Query  3862  SSETKISSSGIPSVVSTFDKITIWLIHLVALAYVS  3966
              +  +   +G     ST D     L   +    +S
Sbjct  711   PNPARCGPAGDGDDASTRDSFEALLKGAITTGRIS  745



>ref|WP_025667239.1| hypothetical protein, partial [Aquimarina megaterium]
Length=1157

 Score =   336 bits (861),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 236/746 (32%), Positives = 381/746 (51%), Gaps = 87/746 (12%)
 Frame = +1

Query  1825  ENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFV  2004
             ENK +Y +L    +  D RT+ ++H+NA  IA ++LT     + PG++VLL+Y  GL+F 
Sbjct  30    ENKVVYRFLENGEEETDIRTFGQLHSNAMIIASRILT----LVSPGERVLLLYPSGLNFT  85

Query  2005  DAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSA  2184
             DAFFGCL A VI +P  PP   +R G      + NIA  C+   IL+    H   +    
Sbjct  86    DAFFGCLMAGVIAVPAFPPTGKRRIG-----RLENIATDCDIKLILTEEKVHAKCKSWFE  140

Query  2185  KNMLFGKSKDKSSNSWPDLPWLHTDS-WVkkpklfkkpkDEQGQPLSEDLCFLQFTSGST  2361
               +            + ++ W  TD   V    +     D      SED+ FLQ+TSGST
Sbjct  141   HEI------------FSEVLWCVTDEPQVTHRSVELPSVD------SEDVAFLQYTSGST  182

Query  2362  TDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGIL  2541
              +PKGVM++H  +IHN +L+R+        I VSWLP YHDMGLIG +L  +  G   I+
Sbjct  183   GNPKGVMVSHKNIIHNTELIRQCLNLKKDFIGVSWLPIYHDMGLIGNILEAVAMGIEMII  242

Query  2542  FSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAAE  2721
               P  F++ P+ W Q +SK++A +S  PNFAF+L V +++     N DLSS+  + + AE
Sbjct  243   LPPQAFIQKPIRWFQIISKYKANYSGGPNFAFDLCVHQIKDDDLNNIDLSSLSIMYNGAE  302

Query  2722  PIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFVDW------QGR  2883
             PIR  T+K F+   +  G+++E + P YG+AE  + V+ +       F++       +G+
Sbjct  303   PIRAQTIKDFLITFEKIGITKEAICPCYGMAETTLAVTFSKLNKETSFLELDINEFEKGK  362

Query  2884  VCCGYIKQ-------------PNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGIGY  3024
             +  G  ++             P    + I I++P T ++  +  + GEIW+   S   GY
Sbjct  363   ISSGSQQKSSSHEVKALVGNGPMLQDMRIVIVNPNTKRKCLEE-EIGEIWVKGPSVAKGY  421

Query  3025  WGLEELSQKTFENDILSTPGK------RYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNI  3186
             WG  +LS++ F+ +IL   G+      +Y+RTGD+G I +S+L+++GR K+++I+ G N 
Sbjct  422   WGKPDLSEEMFQAEILDEKGEPLEGSSQYLRTGDMGFINNSELYVSGRLKEMMIINGVNH  481

Query  3187  YTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGKPLP  3366
             Y  DIEKTV+ S   ++    A   I                 E  LVV  E++      
Sbjct  482   YPQDIEKTVQESHTDLQVNAGAAFSIT-------------IEGENKLVVAQEIKRTSLRS  528

Query  3367  YDV---MDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVIEE  3537
             YDV      I   + E H + + +I+ + P  +SKTTSGKI+R    K + S TL+ ++E
Sbjct  529   YDVDSIRKTIAKSILETHDLSVFAILLLTPGGVSKTTSGKIQRLIIKKAYESDTLEKVKE  588

Query  3538  Q-----MNGERSLPRNDGIIVPANGKISKT---DIVNFLKDLLSQQTGIPVSKISTGETL  3693
                   + G+    ++D   V  N +  K+    I+N +  +L ++T  P+ +I    + 
Sbjct  589   TWIASGIKGDIKEAKSDS-TVSENLEAKKSLDPKIINRIMMILGEETEFPLYQIQPNTSF  647

Query  3694  VSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEKNHPMLTNSSET  3873
                G++SI  +R A KIS +F I+  +  +     I++ A F+ S LE       N ++ 
Sbjct  648   FELGISSIQSIRIAGKISEYFQIDTPSSLLLEYPSIEECAGFLSSELEN----AKNKNQA  703

Query  3874  KISSSGIPS----VVSTFDKITIWLI  3939
             K + + I      +  T+ + ++WLI
Sbjct  704   KDTIAKIKDKLIRIPLTYAQESLWLI  729



>ref|WP_020728309.1| Long-chain-fatty-acid--CoA ligase [Mycobacterium marinum]
 gb|EPQ79502.1| Long-chain-fatty-acid--CoA ligase [Mycobacterium marinum str. 
Europe]
Length=1007

 Score =   332 bits (852),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 237/754 (31%), Positives = 378/754 (50%), Gaps = 67/754 (9%)
 Frame = +1

Query  1831  KTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDA  2010
              T  +++NEKG V +  +  +V ++   +A+ L       ++PGD+ +L Y  GLDFV  
Sbjct  18    NTAISFVNEKGRVAESMSRADVVSDMGEVAEFL--RHHCGLEPGDRAILAYPSGLDFVRG  75

Query  2011  FFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAKN  2190
               GCL A V+P+P  PPDP      + +  +  +       A+L++  Y     + +A++
Sbjct  76    LIGCLAAGVVPVPIYPPDPINPQ--KTVDRMQRVVASSGAKAVLTSRRYANARWLGTARS  133

Query  2191  MLFGKSKDKSSNSWP-DLPW-LHTDSWVkkpklfkkpkDEQGQ---PLSEDLCFLQFTSG  2355
             ++ G     S+  WP DLPW + +     +           G+   P  +    LQ+TSG
Sbjct  134   IVTG-----STVGWPGDLPWHITSRGIGGRRMRGPGTPGAPGRGWSPSPDAPALLQYTSG  188

Query  2356  STTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSG  2535
             ST+DPKGV+ITHG + H V   R+          V WLP YHD GLI  +L+ L   G  
Sbjct  189   STSDPKGVVITHGNLAHQVDFNRRLLGLGLDARGVFWLPPYHDFGLISVILSGLAGSGEV  248

Query  2536  ILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSA  2715
              L SP+TF++ P LW   M + RATH+AAPNFA+EL VR+  + +   +DLSS+  +MSA
Sbjct  249   TLMSPLTFLQRPALWFDVMDRVRATHTAAPNFAYELAVRKTTAEQRAAWDLSSLQVVMSA  308

Query  2716  AEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYG-------------EGL  2856
             AEP+R+ T  RF++     GL R+   P YGLAE+ V V+  +G             + L
Sbjct  309   AEPVREDTTSRFLDAFSGTGLRRDAFCPSYGLAEHTVAVTM-FGRSTLSVDRHQLETQRL  367

Query  2857  PVFVDWQGR---VCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGIGYW  3027
              V  D  G    + CG +     D VD++I+ PE      D G+ GEIW+ S S   GYW
Sbjct  368   AVPADGPGSQVLIGCGQV----ADDVDVRIVDPELHVPLAD-GQVGEIWVDSPSKAAGYW  422

Query  3028  GLEELSQKTFENDILSTPGKR-YIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDIE  3204
             GL + S+ TF   +  +   R Y+RTGDLG + D +L++ GR KDL+I+AG+NI+  DIE
Sbjct  423   GLPDKSRDTFGARLAGSDDSRSYLRTGDLGLLHDGELYVCGRLKDLLILAGRNIHPQDIE  482

Query  3205  KTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRD--GKPLPYDVM  3378
             +++      +RPG  A   +              A +  GL V+ EV+      +   V 
Sbjct  483   ESLRDCHPAIRPGGIAAFAVD----------AGDAGEVEGLAVLVEVKADIATEMLSGVA  532

Query  3379  DHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLD-----VIEEQM  3543
             D +   V + H +  +++V   P S+SKTTSGK++R  C  R + GTL+     V   + 
Sbjct  533   DEVQAVVLKNHQLRCSAVVVAPPGSVSKTTSGKVQRARCRTRLLDGTLEAEALLVARLED  592

Query  3544  NGERSLPRND----GIIVPANG---KISKTDIVNFLKDLLSQQTGIPVSKISTGETLVSY  3702
              G   +P ++    G +V + G         ++  ++D ++   GI  +++   + L   
Sbjct  593   AGPPDVPDDELGTAGPVVTSAGAWPAAPGDPLLASVRDQVAAVFGIRAARVDIDQPLSEQ  652

Query  3703  GVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFV---ESLLEKNHP---MLTNS  3864
             G++S+G V+ A ++S  F  ++  +D+F+   +  LA  +   E    ++HP   +L + 
Sbjct  653   GLDSVGFVKLASRLSQAFDRDVPPVDVFNHPTVRGLAHMLRDAEVAGCEHHPPQALLQHP  712

Query  3865  SETKISSSGIPSVVSTFDKITIWLIHLVALAYVS  3966
             +  +   +G     ST D     L   +    +S
Sbjct  713   NPARCGPAGDGDDASTRDSFEALLKGAITTGRIS  746



>ref|WP_020788067.1| Long-chain-fatty-acid--CoA ligase [Mycobacterium sp. 012931]
 gb|EPQ48552.1| Long-chain-fatty-acid--CoA ligase [Mycobacterium sp. 012931]
Length=1006

 Score =   332 bits (852),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 241/765 (32%), Positives = 381/765 (50%), Gaps = 70/765 (9%)
 Frame = +1

Query  1831  KTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDA  2010
              T  +++NEKG V +  +  +V ++   +A+ L       ++PGD+ +L Y  GLDFV  
Sbjct  18    NTAISFVNEKGRVAESMSRADVVSDMGEVAEFL--RHHCGLEPGDRAILAYPSGLDFVRG  75

Query  2011  FFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAKN  2190
               GCL A V+P+P  PPDP      + +  +  +       A+L++  Y    R+ +A++
Sbjct  76    LIGCLAAGVVPVPIYPPDPINPQ--KTVDRMQRVVASSGAKAVLTSRRYANARRLGTARS  133

Query  2191  MLFGKSKDKSSNSWP-DLPWLHTDSWVkkpklfkkpkDEQG-----QPLSEDLCFLQFTS  2352
             ++ G     S+  WP DLPW H  S     +  + P           P  +    LQ+TS
Sbjct  134   IVTG-----STVGWPGDLPW-HITSRGIGGRRMRGPGTPGAPGRGWSPSPDAPALLQYTS  187

Query  2353  GSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGS  2532
             GST+DPKGV+ITHG + H V   R+          V WLP YHD GLI  +L+ L   G 
Sbjct  188   GSTSDPKGVVITHGNLAHQVDFNRRLLGLGLDARGVFWLPPYHDFGLISVILSGLAGSGE  247

Query  2533  GILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMS  2712
               L SP+TF++ P LW   M + RATH+AAP FA+EL VR+  + +   +DLSS+  +MS
Sbjct  248   VTLMSPLTFLQRPALWFDVMDRVRATHTAAPKFAYELAVRKTTAEQRAAWDLSSLQVVMS  307

Query  2713  AAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYG-------------EG  2853
             AAEP+R+ T  RF++     GL R+   P YGLAE+ V V+  +G             + 
Sbjct  308   AAEPVREDTTSRFLDAFSGTGLRRDAFCPAYGLAEHTVAVTM-FGRSTLSVDRHQLETQR  366

Query  2854  LPVFVDWQGR---VCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGIGY  3024
             L V  D  G    + CG +     D VD++I+ PE      D G+ GEIW+ S S    Y
Sbjct  367   LAVPADGPGSQMLIGCGQV----ADDVDVRIVDPELHVPLAD-GQVGEIWVDS-SKAASY  420

Query  3025  WGLEELSQKTFENDILSTPGKR-YIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDI  3201
             WGL + S+ TF   +  +   R Y+RTGDLG + D +L++ GR KDL+I+AG+NI+  DI
Sbjct  421   WGLPDKSRDTFGARLAGSDDSRSYLRTGDLGLLHDGELYVCGRLKDLLILAGRNIHPQDI  480

Query  3202  EKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRD--GKPLPYDV  3375
             E+++      +RPG  A   +              A D  GL V+ EV+      +   V
Sbjct  481   EESLRDCHPAIRPGGIAAFAVD----------AGDAGDVEGLAVLVEVKADIATEMLSGV  530

Query  3376  MDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLD-----VIEEQ  3540
              D +   V + H +  +++V   P S+SKTTSGK++R  C  R + GTL+     V   +
Sbjct  531   ADEVQAVVLKNHQLRCSAVVVAPPGSVSKTTSGKVQRARCRTRLLDGTLEAEELLVARLE  590

Query  3541  MNGERSLPRND----GIIVPANG---KISKTDIVNFLKDLLSQQTGIPVSKISTGETLVS  3699
               G   +P ++    G +V + G         ++  ++D ++   GI  +++   + L  
Sbjct  591   DAGPPDVPDDELGTAGPVVTSAGAWPAAPGDPLLASVRDQVAAVFGIRAARVDIDQPLSE  650

Query  3700  YGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFV---ESLLEKNHP---MLTN  3861
              G++S+G V+ A ++S  F  ++  +D+F+   +  LA  +   E    ++HP   +L +
Sbjct  651   QGLDSVGFVKLASRLSQAFDRDVPPVDVFNHPTVRGLAHMLRDAEVAGCEHHPPQALLQH  710

Query  3862  SSETKISSSGIPSVVSTFDKITIWLIHLVALAYVSLLLIIPAYIS  3996
              +  +   +G     ST D     L   +    +S  + +P   S
Sbjct  711   PNPARCGPAGDGDAASTRDSFEALLKGAITTGRISEGMHLPRSAS  755



>ref|WP_036394663.1| long-chain acyl-CoA synthetase [Mycobacterium kansasii]
 gb|EUA15866.1| alpha/beta hydrolase family protein [Mycobacterium kansasii 662]
 gb|AIR19675.1| long-chain acyl-CoA synthetase [Mycobacterium kansasii 662]
 gb|AIR29254.1| long-chain acyl-CoA synthetase [Mycobacterium kansasii 824]
Length=1009

 Score =   330 bits (847),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 231/712 (32%), Positives = 357/712 (50%), Gaps = 67/712 (9%)
 Frame = +1

Query  1828  NKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVD  2007
             + T  +++NE+G V +  T  +V T    +A  L   Q+  + PGD+ +L+Y PGLDFV 
Sbjct  17    DATAISFVNERGRVTESMTRADVVTEMNEVADLLW--QRCGLAPGDRAVLVYPPGLDFVR  74

Query  2008  AFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAK  2187
                GCL A V+P+P  PPDP       ++     +   C    +L++  Y     + +AK
Sbjct  75    GLVGCLAAGVLPVPIYPPDPINPQ--NSIEGFQRVVADCGAKVVLTSRRYTGARWLGAAK  132

Query  2188  NMLFGKSKDKSSNSWP-DLPWLHTDSWVkkpkl----fkkpkDEQGQPLSEDLCFLQFTS  2352
             + + G S D     WP DLPW  T   +   +            +  P  +    LQ+TS
Sbjct  133   SFVAGSSVD-----WPSDLPWQVTSRGIGSRRTRGFDSSPRTAHEWAPSRDTPALLQYTS  187

Query  2353  GSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGS  2532
             GST+DPKGV+ITHG + H  +L R+       T  V WLP YHD GLI  +L+ L     
Sbjct  188   GSTSDPKGVVITHGNLAHQFELNRRLLGLGLETRGVFWLPPYHDFGLISVILSTLTGNSE  247

Query  2533  GILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMS  2712
               + SP++F++ P LW   M++ RATH+AAPNFA++L V +  + +   +DLSS+  +MS
Sbjct  248   LTMMSPLSFIQRPALWFDVMNRVRATHTAAPNFAYDLAVHKTTTEQRAQWDLSSLKVVMS  307

Query  2713  AAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPV----------  2862
             AAEP+R+ T +RF+E     GL  E   P YGLAE+ V V+      L V          
Sbjct  308   AAEPVREETKRRFLEAFAVTGLRPEAFCPAYGLAEHTVAVTIFGRSTLRVDRHQLEMERR  367

Query  2863  -----FVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGIGYW  3027
                    D Q  V CG +    T  VD++I+ PE      D G+ GEIW+ S S   GYW
Sbjct  368   AVPADGADSQVLVSCGEL----TGDVDVRIVDPELCVGLSD-GQVGEIWVDSPSKAAGYW  422

Query  3028  GLEELSQKTFENDILS-TPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDIE  3204
             G  + S+ TF   +     G  Y+RTGDLG + D +L++ GR KDL+IVAG+NI+  D+E
Sbjct  423   GSPDESRATFAARLTGMNDGHSYLRTGDLGFLHDGELYVCGRVKDLLIVAGRNIHPQDVE  482

Query  3205  KTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVR--DGKPLPYDVM  3378
              T+ +    +RPG  A   I              A +   L V+ EVR    + +   V+
Sbjct  483   DTLRNCHRAIRPGGIAAFAI-------------DAGNTEALAVLVEVRADASRAVLSSVV  529

Query  3379  DHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVI---------  3531
             + +   V + H +  +++V   P S+SKTTSGK++R  C  R++ G+L+           
Sbjct  530   EKVRAVVLKNHQLRCSAVVVGPPGSVSKTTSGKVQRSRCRARWLDGSLEAQALLVERFED  589

Query  3532  EEQMNGERSLPRNDGI------IVP-ANGKISKTD-IVNFLKDLLSQQTGIPVSKISTGE  3687
             EE M+   +  R   +      + P A  +   TD ++  ++  ++   GI V+ +   +
Sbjct  590   EEPMDAGSAEAREGEVGASGRMMAPIARNEAQTTDELLAMVRGQVAAVFGIGVANVDIDQ  649

Query  3688  TLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEKN  3843
              L + G+NS+G V  A ++S   G  +  +++F+   +  LA  +     +N
Sbjct  650   PLGAQGLNSVGFVMLASRLSQVVGREVPPMEVFNHPSVRGLATMLSDGEGRN  701



>ref|WP_015328289.1| acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [Cylindrospermum 
stagnale]
 ref|YP_007317760.1| acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [Cylindrospermum 
stagnale PCC 7417]
 gb|AFZ28242.1| acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II [Cylindrospermum 
stagnale PCC 7417]
Length=618

 Score =   319 bits (817),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 216/602 (36%), Positives = 303/602 (50%), Gaps = 77/602 (13%)
 Frame = +1

Query  1840  YTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFG  2019
             YT+L       D  TY+++   A  IA +L    +  + P ++ LL+Y PGL+F+ AFFG
Sbjct  35    YTFLENGEKESDCLTYQQLDKKARAIAAQL----QSFLAPSERALLLYQPGLEFISAFFG  90

Query  2020  CLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAKNMLF  2199
             CL A V+ +P  PP        Q+L  +  I         L+T S    +    AKN   
Sbjct  91    CLYAGVVAVPAYPPRQ-----NQSLSRLQAIVSDAQVSLTLTTQSLLANIEKRLAKNPEL  145

Query  2200  GKSKDKSSNSWPDLPWLHTDSWVkkpklfkkpkDEQGQPLSE-DLCFLQFTSGSTTDPKG  2376
             G  +           W+ TD+            + Q   L E DL FLQ+TSGST  PKG
Sbjct  146   GAVQ-----------WVATDN-----LNSDLASNWQEPTLCESDLAFLQYTSGSTGTPKG  189

Query  2377  VMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVT  2556
             VM++HG ++HN +++ K +  T  TI V WLP +HDMGLIG +L  L  G S IL SPV 
Sbjct  190   VMVSHGNLLHNQRMIEKAFGHTKETIFVGWLPLFHDMGLIGNVLQPLYLGISCILISPVA  249

Query  2557  FMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAAEPIRQT  2736
             F++ PL WLQT+S+++AT S  PNFA++L VR++   +    DLS      + +EP+R  
Sbjct  250   FLQKPLRWLQTISRYKATTSGGPNFAYDLCVRKITPEQRSTLDLSRWEVAFNGSEPVRAE  309

Query  2737  TLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPV------------------  2862
             TL  F     S G   E   P YG+AE  +FVS      LP                   
Sbjct  310   TLAEFTTTFASCGFRDEAFYPCYGMAETTLFVSGGLKTALPTVLCVDGTALEQNRVVAVS  369

Query  2863  --FVDWQGRVCCGY--IKQPNTDGVDIKIISPE--TGKENDDPGKEGEIWISSLSAGIGY  3024
               + D +  + CG+  ++Q       I I+ P   T +  D   + GEIW+   S   GY
Sbjct  370   NEYKDGRKIIGCGHTWLEQ------KIVIVDPNSLTLRRAD---QVGEIWVHGSSVAGGY  420

Query  3025  WGLEELSQKTFENDI--LSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSD  3198
             W   +L+Q+TF   +    T  K ++RTGDLG + D +LFITGR KD+II+ G+N Y  D
Sbjct  421   WNRPDLTQQTFNAQLQDTDTESKPFLRTGDLGFLHDGELFITGRLKDVIIIRGRNYYPQD  480

Query  3199  IEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGKPLPYD--  3372
             IE TVE S   +RP C +V  I  +     GI          LVV+ E+        D  
Sbjct  481   IELTVEKSHPALRPSCGSVFTIEVN-----GIEQ--------LVVVQELERSYLRKLDTS  527

Query  3373  -VMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVIEEQMNG  3549
              V+ +IC  +  E+ + I SI+ IK  SI KT+SGKI+R +C  +F+ G LDV+ E    
Sbjct  528   EVLRNICQAITAEYSLQIYSILLIKTASIPKTSSGKIQRQDCRSKFLVGDLDVVSEWSEN  587

Query  3550  ER  3555
              R
Sbjct  588   PR  589



>ref|WP_011320792.1| beta-ketoacyl synthase [Anabaena variabilis]
 ref|YP_324603.1| beta-ketoacyl synthase [Anabaena variabilis ATCC 29413]
 gb|ABA23708.1| Beta-ketoacyl synthase [Anabaena variabilis ATCC 29413]
Length=1656

 Score =   333 bits (854),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 234/709 (33%), Positives = 345/709 (49%), Gaps = 71/709 (10%)
 Frame = +1

Query  1771  ELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPA  1950
             E S+L   LR+      T+  T YT+L +        TY+E+   A  IA +LL    P 
Sbjct  8     EFSTLVDLLRYRAQNQPTQ--TAYTFLVDGETESISLTYQELDQKARAIATQLLQRGVP-  64

Query  1951  IKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNP  2130
                G + LL+Y PG++F+ AFFGCL A  I +P  PP   Q+     +  +  I      
Sbjct  65    ---GSRALLLYPPGMEFIPAFFGCLYAGFIAVPAYPPRRNQK-----MSRLQAIVSDAEA  116

Query  2131  VAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPDLPWLHTDSWVkkpklfkkpkDEQG  2310
             V  L+T +   ++ +  A+N                +PW+ TD+      L     ++  
Sbjct  117   VVALTTSTELTSMALQLAENPTLTA-----------IPWITTDN------LNANIAEDWQ  159

Query  2311  QPL--SEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHD  2484
             QP   S+ L FLQ+TSGST  PKGVMITHG ++HN +L+   Y+ T  +  V WLP YHD
Sbjct  160   QPNINSDTLAFLQYTSGSTGTPKGVMITHGNLLHNSQLIYNFYQHTPNSQGVIWLPPYHD  219

Query  2485  MGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLES  2664
             MGLIGG+L  L  G    L +PV F++ P  WLQ +S ++AT S  P+FA++L+ R++  
Sbjct  220   MGLIGGVLQPLYGGFPVTLMAPVAFLQKPFRWLQAISHYKATTSGGPDFAYDLVCRQITP  279

Query  2665  SKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAY  2844
              +  + DLSS     + AEPIR  TL RF E     G  RE   P YG+AE  + VS  +
Sbjct  280   EQLASLDLSSWEVAFTGAEPIRAQTLDRFAETFAPCGFRREAFYPCYGMAETTLIVSGGW  339

Query  2845  GEGLPVF-------------------VDWQGRVCCGYIKQPNTDGVDIKIISPETGKEND  2967
                 P+                       +  V CG      T    + I++PE+     
Sbjct  340   KSEAPIVRHIDTTALLQNQVIDTTTAAGGKAIVGCGKSSPDQT----VLIVNPESLTSCA  395

Query  2968  DPGKEGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITG  3147
             D G+ GEIW+S  S   GYW   E +Q TF   +       ++RTGDLG + D +LFITG
Sbjct  396   D-GQVGEIWVSGSSVAQGYWNRPEQTQHTFHAYLADNTTGPFLRTGDLGFLQDGELFITG  454

Query  3148  RTKDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGL  3327
             R KDLII+ G+N Y  DIE TVES    +RP   A   +               ++   L
Sbjct  455   RLKDLIIIMGRNHYPQDIEFTVESCHPALRPAGGAAFAV-------------EVNNVEKL  501

Query  3328  VVIAEVRDG--KPLPYD-VMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECA  3498
             V++ EV     + L  D V+  I   VAE H +   +I  IK  S+ KT+SGK++R  C 
Sbjct  502   VIVQEVERSYLRKLNADEVIGAIRKAVAEHHDLQTHTIALIKTNSLPKTSSGKVRRSNCK  561

Query  3499  KRFISGTLDVIEEQMNGERSLPRNDGIIVPANGKISKTDIV-NFLKDLLSQQTGIPVSKI  3675
                 +G+LD+I +     ++   ++ +I P   K   T+ V  +L   +S+Q  +P   I
Sbjct  562   AELEAGSLDIIAQWSADAQNHSPSEKLIAPQVEKTVNTEAVATWLLTKVSEQLQVPAQTI  621

Query  3676  STGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFV  3822
             +  E L  YG+ S+  VR + ++  + G  +    ++    I  LA ++
Sbjct  622   NVNEPLAQYGLGSLAAVRISGELQEWLGRELPTTLLYDYPSIAALAQYL  670



>gb|ETR67816.1| AMP-dependent synthetase and ligase [Candidatus Magnetoglobus 
multicellularis str. Araruama]
Length=610

 Score =   316 bits (810),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 213/625 (34%), Positives = 337/625 (54%), Gaps = 48/625 (8%)
 Frame = +1

Query  1957  PGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVA  2136
             PGD+VLL++ PGL+++ AFF C+ A+VI +P+ PPDPT     ++L  +  +    NP  
Sbjct  7     PGDRVLLLFPPGLEYITAFFACMYAKVIAVPSYPPDPTNLH--RSLQRLNLMISDSNPTM  64

Query  2137  ILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPDLPW------LHTDSWVkkpklfkkpk  2298
             ILS  S+   ++ +S+KN    KS     N   ++ +      L + +WV    L +   
Sbjct  65    ILSEQSFIRKIKNISSKN----KSSQDEFNISSEIDFSKLYQKLMSITWVAVDNLPENYL  120

Query  2299  DE-QGQPLS-EDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLP  2472
             ++ +  P   +D+ FLQ+TSGST DPKGV I+H  ++HN+K++ K    ++   + SWLP
Sbjct  121   NQFKDIPYDPDDILFLQYTSGSTGDPKGVCISHRNLMHNLKMIAKSIPCSNNDAIFSWLP  180

Query  2473  QYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVR  2652
              YHDMGLIGG+++   +G +  L SP  F+K P+LWL+ +SK+R   S  PNF +EL VR
Sbjct  181   MYHDMGLIGGVISNAYAGTTLYLMSPTAFLKQPILWLENISKYRCKFSFGPNFGYELCVR  240

Query  2653  RLESSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFV  2832
             ++      + D+S   +  + AEPI   T+  F +  +  G   +   P YGLAE+ + V
Sbjct  241   KINPENCHDIDVSCWEYAGNGAEPISYDTIVSFGKKFKDIGFQMKSFCPCYGLAESTLMV  300

Query  2833  SCAYGEGLPVFVDWQG------RVCCGYIKQPNTDGVDIKIISPET---GKENDDPGKE-  2982
             S  + + LP ++          ++   Y  +        +I++ ET         P KE 
Sbjct  301   STTHVDILPAYLKISKDQLEHLKLSKNYFSESKILVSSGEILTDETVIIVNTKGIPCKEN  360

Query  2983  --GEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTK  3156
               GEIWI+S S   GYW  EELS +TF+    S     ++RTGD G I +  L++TGR K
Sbjct  361   EIGEIWIASESVAQGYWQKEELSNQTFQAQTPSY-NNYFLRTGDAGFINNGHLYVTGRIK  419

Query  3157  DLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVI  3336
             DLII+ G+NIY  DIEK  E S + +RPGCCA   + ++             +E  LVV+
Sbjct  420   DLIIIRGQNIYPQDIEKISEMSHQAIRPGCCAAFSVIKN-------------NEEQLVVV  466

Query  3337  AEVRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISG  3516
              EVR G     ++ D+I   + + HG+   ++V I P++I+KT+SGKI+R  C   F+ G
Sbjct  467   QEVRKGDWDFLEISDNISHAITKYHGIVPYAVVLIPPKTIAKTSSGKIRRNFCKNSFLKG  526

Query  3517  TLDVIEEQMNGERSLPRNDGIIVPANGKI-SKTDIVNFLKDLLSQQTGIPVSKISTGETL  3693
              L     +   +R     D    P+N K+ S  +I++ L   LS+   I    ++  + L
Sbjct  527   NLSPFYVK---KREFNNIDNKTPPSNEKVRSYFEILHHLCLGLSKIISIHPEDMNLEQPL  583

Query  3694  VSYGVNSIGVVRAAQKISSFFGINI  3768
             +  G++S+ ++    ++  FFG +I
Sbjct  584   LEKGLDSVAII----ELMRFFGRSI  604



>gb|EPQ47290.1| Long-chain-fatty-acid--CoA ligase [Mycobacterium sp. 012931]
Length=943

 Score =   325 bits (833),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 229/694 (33%), Positives = 346/694 (50%), Gaps = 68/694 (10%)
 Frame = +1

Query  1849  LNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLR  2028
             +N++G V +  +   V T    +AQ     Q   + PGD+ +L+Y PGLDFV    GC+ 
Sbjct  1     MNDRGLVTESMSRAGVVTEMNKVAQ--FVRQDCGLAPGDRAVLVYPPGLDFVCGLLGCMA  58

Query  2029  ARVipiptippdptQ-RGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAKNMLFGK  2205
             A VI +P  PPDP   +  G+A   +A     C   A+L++  Y    ++  A  +  G 
Sbjct  59    AGVIAVPVFPPDPINPQKSGEAFRRVA---LDCGATAVLTSHHYADARQLDVAAPV--GT  113

Query  2206  SKDKSSNSWPD-LPWLHTDSWVkkpklfkkpkDEQG----QPLSEDLCFLQFTSGSTTDP  2370
             + D+    WP+ LPW  T                +      P  +    LQ+TSGST+DP
Sbjct  114   AFDED---WPNALPWHVTSRGASGRGKSAPRAVSEAISEWAPSPQTPALLQYTSGSTSDP  170

Query  2371  KGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSP  2550
             KGV+ITHG V+H  +  R+          V W+P YHD GLI G+L+ L       + SP
Sbjct  171   KGVVITHGNVVHQAEFNRRFIGLGPGHRAVFWVPPYHDFGLISGILSALAGNFDLTMMSP  230

Query  2551  VTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAAEPIR  2730
             ++F++ P LW + M + RAT + APNF FEL +R+  + +   +DLS +  ++SAAEP+R
Sbjct  231   MSFIQRPALWFEVMDRVRATVTVAPNFGFELAMRKTTAEQRAGWDLSPLQVIVSAAEPVR  290

Query  2731  QTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPV---------------F  2865
             + T +RF E   +  + RE   P YGLAE+ V ++ +    L V                
Sbjct  291   EDTTRRFFEAFAASWIRREAFCPCYGLAEHTVGITVSGRSSLRVDRCQLETRQLAVPSDA  350

Query  2866  VDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGIGYWGLEELS  3045
              D Q  + CG   QP TD VD++I+ PE      D G+ GEIW  S S   GYWGL   S
Sbjct  351   PDAQVLMGCG---QP-TDDVDVRIVDPELCVPLGD-GQVGEIWADSPSKAAGYWGLSAKS  405

Query  3046  QKTFENDILSTPGKR-YIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDIEKTVESS  3222
             + TF+  +    G R Y+RTGDLG + D +L++ GR KDL+I+AG+NIY  DIE ++   
Sbjct  406   RATFQAALAGVEGGRGYLRTGDLGVLHDGELYVCGRIKDLLILAGRNIYPQDIEDSLRDC  465

Query  3223  SELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVR-DGKP-LPYDVMDHICTR  3396
                +RPG  A   + +              +   L V+ EVR DG P L   V+  I   
Sbjct  466   HPAIRPGGFAAFAVAD-------------GNSETLAVLVEVRTDGSPDLLAGVVAAIRAA  512

Query  3397  VAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLD----VIEEQMNGERSLP  3564
             V ++H +    +V   P S+SKTTSGK++R  C  RF+ GTL     +++ + + E    
Sbjct  513   VLKDHQLCCGVVVLGPPGSVSKTTSGKVQRSRCRARFLDGTLQAQALLVDRRTDDE----  568

Query  3565  RNDGIIVPANGKISKTDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKI  3744
                    P     +   +++ +    ++  GI  + +    +L   G+NSIGV   A ++
Sbjct  569   -------PVGAAPTTEQLLSVVCGQAAEVLGIGAASVDIDRSLGDQGLNSIGVTELASRL  621

Query  3745  SSFFGINIGAIDIFSATCIDDLADFVESLLEKNH  3846
             +   G ++  +DIF+   + DL   + SL EK  
Sbjct  622   TQVLGQDVQPVDIFNHPTVGDLVQIL-SLGEKTR  654



>gb|ETL44185.1| hypothetical protein L916_05437 [Phytophthora parasitica]
 gb|ETP20652.1| hypothetical protein F441_05640 [Phytophthora parasitica CJ01A1]
Length=755

 Score =   320 bits (819),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 241/713 (34%), Positives = 373/713 (52%), Gaps = 84/713 (12%)
 Frame = +1

Query  1822  TENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKP-----AIKPGDKVLLIYV  1986
             T +KT+ ++ ++KG V    T  E++     +A  LL S +       +  GD+VLL+Y 
Sbjct  16    TPSKTMLSFADDKGVVTASLTCAELNKRMQNLAGLLLASTQQHSKGLGLNQGDRVLLVYP  75

Query  1987  PGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVT  2166
             PGLDF+  F  CL+A V+ +P  PPD   R   + +    ++ + C     L T S +  
Sbjct  76    PGLDFIVVFLACLKAGVVAVPVYPPD--PRKMKKDISMFVSVTQNCQAKTAL-TCSMYYN  132

Query  2167  VRIMSAKNMLFGKSKDKSSNSWPD-LPWLHTDSWVkkpklfkkpkDEQGQPLSEDLCFLQ  2343
             V+ +SA    F  S    +  WP+ L W+ TD  V    +          P ++   FLQ
Sbjct  133   VKKISAIKEKFTFS---GAAQWPEHLNWVVTDDLVDTKGIDPAKHWLTQSPSADSTAFLQ  189

Query  2344  FTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVS  2523
             +TSGST+ PKGV+++HG + HN++ +    ++   T++VSWLPQYHDMGLIG  L  + +
Sbjct  190   YTSGSTSAPKGVVLSHGNLNHNLRTISSALQAGRDTVVVSWLPQYHDMGLIGAYLGTIFN  249

Query  2524  GGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLES-----SKEENFDL  2688
             GG G+  SP +F+++P LWL+ +SK RATH  APNFA+ LL R+ +      +  ++ DL
Sbjct  250   GGKGVYLSPFSFIRDPCLWLRLVSKHRATHLQAPNFAYSLLARKSDRLTVGLASGQHVDL  309

Query  2689  SSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFV  2868
             SS+  +++ AEPI+   +  F      FGL   V+ P YGLAE+ V+V C  G+   ++V
Sbjct  310   SSVRHMINGAEPIQGEAIDNFYRAFSPFGLPEGVVKPTYGLAEHTVYV-CGGGQQR-LWV  367

Query  2869  DWQ----GRV--------CCGYIKQ------PNTD--GVDIKIISPETGKENDDPGKEGE  2988
             D Q     RV          G +K+      P+    G+D++I+  ET +E    G+ GE
Sbjct  368   DKQELESNRVFRVVEKTNTAGLVKEMIGCGVPSRKDYGIDVRIVDAET-EEEKPEGETGE  426

Query  2989  IWISSLSAGIGYWG--LEELSQKTFENDIL-STPGKRYIRTGDLGRIIDSKLFITGRTKD  3159
             IWISS S   GY+G  + E S + F+  ++  T GK +++TGDLG I + +LFI GR KD
Sbjct  427   IWISSASKARGYYGDEMREFSAEAFQAKVVGDTEGKTFLKTGDLGVIYNQELFICGRMKD  486

Query  3160  LIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIA  3339
             L+I+ G+N Y  D+E + ES  EL RPGCCA              L    +D+  L V+A
Sbjct  487   LVIIRGRNHYPQDLEASAESHEEL-RPGCCAAF----------SYLADGNADDEQLAVVA  535

Query  3340  EVRD-GKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISG  3516
             E+RD        +   I + +A EHGV +  +V + PRSI KTTSGKI R  C K     
Sbjct  536   ELRDPAMTSKASLCGKIRSAIAREHGVKVTLVVLLAPRSIPKTTSGKISRSRCKKALEEK  595

Query  3517  TL-----------DVIEEQMNGE-----RSLPRN-DGIIVPANGKISKTDIVN-------  3624
             TL           DV  E   G+      ++ RN +G  V +    SK+++ +       
Sbjct  596   TLEELYRNEDMIADVPVEDDGGDDAVAGETMNRNVNGPRVASTDDGSKSNLPSVITGVPP  655

Query  3625  -----FLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINI  3768
                  FL + L++  G+  ++I+    L   G++S+ + +    I+  + +++
Sbjct  656   DQVHAFLVEELARTLGVEPTQINDDTPLQELGLDSMALTQLQGVIAQKYQVHV  708



>gb|ETM50539.1| hypothetical protein L914_05443 [Phytophthora parasitica]
Length=755

 Score =   319 bits (818),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 241/713 (34%), Positives = 373/713 (52%), Gaps = 84/713 (12%)
 Frame = +1

Query  1822  TENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKP-----AIKPGDKVLLIYV  1986
             T +KT+ ++ ++KG V    T  E++     +A  LL S +       +  GD+VLL+Y 
Sbjct  16    TPSKTMLSFADDKGVVTASLTCAELNKRMQNLAGLLLASTQQHSKGLGLNQGDRVLLVYP  75

Query  1987  PGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVT  2166
             PGLDF+  F  CL+A V+ +P  PPD   R   + +    ++ + C     L T S +  
Sbjct  76    PGLDFIVVFLACLKAGVVAVPVYPPD--PRKMKKDISMFVSVTQNCQAKTAL-TCSMYYN  132

Query  2167  VRIMSAKNMLFGKSKDKSSNSWPD-LPWLHTDSWVkkpklfkkpkDEQGQPLSEDLCFLQ  2343
             V+ +SA    F  S    +  WP+ L W+ TD  V    +          P ++   FLQ
Sbjct  133   VKKISAIKEKFTFS---GAAQWPEHLNWVVTDDLVDTKGIDPAKHWLTQSPSADSTAFLQ  189

Query  2344  FTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVS  2523
             +TSGST+ PKGV+++HG + HN++ +    ++   T++VSWLPQYHDMGLIG  L  + +
Sbjct  190   YTSGSTSAPKGVVLSHGNLNHNLRTISSALQAGRDTVVVSWLPQYHDMGLIGAYLGTIFN  249

Query  2524  GGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLES-----SKEENFDL  2688
             GG G+  SP +F+++P LWL+ +SK RATH  APNFA+ LL R+ +      +  ++ DL
Sbjct  250   GGKGVYLSPFSFIRDPCLWLRLVSKHRATHLQAPNFAYSLLARKSDRLTVGLASGQHVDL  309

Query  2689  SSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFV  2868
             SS+  +++ AEPI+   +  F      FGL   V+ P YGLAE+ V+V C  G+   ++V
Sbjct  310   SSVRHMINGAEPIQGEAIDNFYRAFSPFGLPEGVVKPTYGLAEHTVYV-CGGGQQR-LWV  367

Query  2869  DWQ----GRV--------CCGYIKQ------PNTD--GVDIKIISPETGKENDDPGKEGE  2988
             D Q     RV          G +K+      P+    G+D++I+  ET +E    G+ GE
Sbjct  368   DKQELESNRVFRVVEKTNTAGLVKEMIGCGVPSRKDYGIDVRIVDAET-EEEKPEGETGE  426

Query  2989  IWISSLSAGIGYWG--LEELSQKTFENDIL-STPGKRYIRTGDLGRIIDSKLFITGRTKD  3159
             IWISS S   GY+G  + E S + F+  ++  T GK +++TGDLG I + +LFI GR KD
Sbjct  427   IWISSASKARGYYGDEMREFSAEAFQAKVVGDTEGKTFLKTGDLGVIYNQELFICGRMKD  486

Query  3160  LIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIA  3339
             L+I+ G+N Y  D+E + ES  EL RPGCCA              L    +D+  L V+A
Sbjct  487   LVIIRGRNHYPQDLEASAESHEEL-RPGCCAAF----------SYLADGNADDEQLAVVA  535

Query  3340  EVRD-GKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISG  3516
             E+RD        +   I + +A EHGV +  +V + PRSI KTTSGKI R  C K     
Sbjct  536   ELRDPAMTSKASLCGKIRSAIAREHGVKVTLVVLLAPRSIPKTTSGKISRSRCKKALEEK  595

Query  3517  TL-----------DVIEEQMNGE-----RSLPRN-DGIIVPANGKISKTDIVN-------  3624
             TL           DV  E   G+      ++ RN +G  V +    SK+++ +       
Sbjct  596   TLEELYRNEDMIADVPVEDDGGDVAVAGETMNRNVNGPRVASTDDGSKSNLPSVITGVPP  655

Query  3625  -----FLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINI  3768
                  FL + L++  G+  ++I+    L   G++S+ + +    I+  + +++
Sbjct  656   DQVHAFLVEELARTLGVEPTQINDDTPLQELGLDSMALTQLQGVIAQKYQVHV  708



>ref|WP_038071981.1| AMP-dependent synthetase [Tolypothrix bouteillei]
Length=602

 Score =   315 bits (806),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 213/596 (36%), Positives = 301/596 (51%), Gaps = 68/596 (11%)
 Frame = +1

Query  1825  ENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFV  2004
             +++  YT++ +    L   TY+E+   +  IA KL    +     G + LL+Y  GL+F+
Sbjct  20    KSQRAYTFIKDADTELASLTYEELDRLSRAIAAKL----QSIGASGQRALLLYPSGLEFI  75

Query  2005  DAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSA  2184
              AFFGCL A V+ +P  PP   Q+     +  +  I     P  +L+T +    +     
Sbjct  76    AAFFGCLYAGVVAVPAYPPRRNQK-----MSRLEAIVADAQPQVLLTTEALLSNI-----  125

Query  2185  KNMLFGKSKDKSSNSWPDLPWLHTDSWVkkpklfkkpkDEQGQPLSED-LCFLQFTSGST  2361
                   KS+   +    DL    TDS         + +  Q   LS + L FLQ+TSGST
Sbjct  126   ------KSRFSENEGLADLQCFATDS-----IDRSQAESWQETALSSNTLAFLQYTSGST  174

Query  2362  TDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGIL  2541
               PKGVM++HG V+HN +L++K ++  S++I+V WLP +HDMGLIG LL  L  G   IL
Sbjct  175   GTPKGVMVSHGNVLHNEQLIQKGFEQNSQSIVVGWLPLFHDMGLIGNLLQPLYLGIPCIL  234

Query  2542  FSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAAE  2721
              SP  F + PL WLQ +S ++AT S  PNFA++L V ++   ++   DLSS     + AE
Sbjct  235   MSPEAFFQRPLRWLQAISHYKATTSGGPNFAYDLCVHKITPEEKATLDLSSWQVAFNGAE  294

Query  2722  PIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFVDWQGR------  2883
             P+R  T+K+F E   S G   E   P YG+AE  + VS       PV    Q        
Sbjct  295   PVRAETMKKFAEAFASCGFRHEAFYPCYGMAETTLIVSGGCASAPPVLQTVQKAALEKNQ  354

Query  2884  ---------------VCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGI  3018
                            V CG   QP  D + + I  PET      P + GEIW+S  S   
Sbjct  355   VVLADSTKDNFTQTIVGCG---QPLED-LKVVIAHPET-MTRCKPNEVGEIWVSGSSVAQ  409

Query  3019  GYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSD  3198
             GYW   E +++TF   +  T    ++RTGDLG + D +LF+TGR KD+II+ G+N Y  D
Sbjct  410   GYWNRPEQTEETFRAQLQDTGEGPFLRTGDLGFLHDGELFVTGRVKDMIIIRGQNHYPQD  469

Query  3199  IEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDG---KPLPY  3369
             IE TVE S   +R GC AV              T     E  LVV+ EV      K    
Sbjct  470   IELTVEKSHPALRAGCGAV-------------FTVEVKGEERLVVVQEVERNYLRKLNVN  516

Query  3370  DVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVIEE  3537
             +V+  I   VA EHG+ + + V +K  SI KT+SGKI+R  C   F+ G+L+V+E+
Sbjct  517   EVVGSINQAVAAEHGLQVYATVLVKTGSIPKTSSGKIQRNTCRSEFLRGSLNVLED  572



>ref|WP_012394783.1| polyketide synthase [Mycobacterium marinum]
 ref|YP_001851389.1| polyketide synthase and peptide synthetase [Mycobacterium marinum 
M]
 gb|ACC41534.1| polyketide synthase and peptide synthetase [Mycobacterium marinum 
M]
Length=2831

 Score =   334 bits (856),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 229/730 (31%), Positives = 354/730 (48%), Gaps = 69/730 (9%)
 Frame = +1

Query  1828  NKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVD  2007
             +    +++N++G V +  +  +V T    +AQ     Q   + PGD+ +L+Y PGLDFV 
Sbjct  17    DAAALSFVNDRGLVTESMSRVDVVTEMNKVAQ--FVRQDCGLAPGDRAVLVYPPGLDFVC  74

Query  2008  AFFGCLRARVipipt--ippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMS  2181
                GC+ A VI +P     P   Q+ G         +A  C   A+L++  Y    ++  
Sbjct  75    GLLGCMAAGVIAVPVFPPDPINPQKSGAA----FRRVALDCGATAVLTSHHYADARQLEV  130

Query  2182  AKNMLFGKSKDKSSNSWPD-LPWLHTDSWVkkpklfkkpkDEQG----QPLSEDLCFLQF  2346
             A  +  G + D+    WP+ LPW  T                +      P  +    LQ+
Sbjct  131   AAPV--GTAFDED---WPNALPWHVTSRGASGRGKSAPRAVSEAISEWAPSPQTPALLQY  185

Query  2347  TSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSG  2526
             TSGST+DPKGV+ITHG V+H  +  R+          V W+P YHD GLI G+L+ L   
Sbjct  186   TSGSTSDPKGVVITHGNVVHQAEFNRRFIGLGPGHRAVFWVPPYHDFGLISGILSALAGN  245

Query  2527  GSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFL  2706
                 + SP++F++ P LW + M + RAT + APNF FEL +R+  + +   +DLS +  +
Sbjct  246   FDLTMMSPMSFIQRPALWFEVMDRVRATVTVAPNFGFELAMRKTTAEQRAGWDLSPLQVI  305

Query  2707  MSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPV--------  2862
             +SAAEP+R+ T +RF E   + G+ RE   P YGLAE+ V ++ +    L V        
Sbjct  306   VSAAEPVREDTTRRFFEAFAASGIRREAFCPCYGLAEHTVGITVSGRSSLRVDRSQLEAR  365

Query  2863  -------FVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGIG  3021
                      D Q  + CG   QP TD VD++I+ PE      D G+ GEIW  S S   G
Sbjct  366   QLAVPSDAPDAQVLMGCG---QP-TDDVDVRIVDPELCVPLGD-GQVGEIWADSPSKAAG  420

Query  3022  YWGLEELSQKTFENDILSTPGKR-YIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSD  3198
             YWGL   S+ TF+  +    G R Y+RTGDLG + D +L++ GR KDL+I+AG+NIY  D
Sbjct  421   YWGLSAKSRATFQAALAGVEGGRGYLRTGDLGFLHDGELYVCGRIKDLLILAGRNIYPQD  480

Query  3199  IEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVR-DGKP-LPYD  3372
             IE ++      +RPG  A   + +              +   L V+ EVR DG P L   
Sbjct  481   IEDSLRDCHPAIRPGGFAAFAVVD-------------GNSETLAVLVEVRTDGSPDLLAG  527

Query  3373  VMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLD----VIEEQ  3540
             V+  I   V ++H +    +V   P S+SKTTSGK++R  C  RF+ GTL     +++ +
Sbjct  528   VVAAIRAAVLKDHQLRCGVVVLGPPGSVSKTTSGKVQRSRCRARFLDGTLQAQALLVDRR  587

Query  3541  MNGERSLPRNDGIIVPANGKISKTDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIG  3720
              + E           P     +   +++ +    ++  GI  + +    +L   G+NSIG
Sbjct  588   TDDE-----------PVGAAPTTEQLLSVVCGQAAEVLGIGAASVDIDRSLGDQGLNSIG  636

Query  3721  VVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEKNHPMLTNSSETKISSSGIPS  3900
             V   A +++   G ++  +DIF+   + DL   +    +  H           ++SG  +
Sbjct  637   VTELASRLTQVLGQDVQPVDIFNHPTVGDLVQILSPGEKTRHQRGVRERLGHHAASGAGA  696

Query  3901  VVSTFDKITI  3930
             V    D + I
Sbjct  697   VALPADPVAI  706



>gb|ETL97359.1| hypothetical protein L917_05321 [Phytophthora parasitica]
 gb|ETO79645.1| hypothetical protein F444_05683 [Phytophthora parasitica P1976]
Length=755

 Score =   318 bits (816),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 222/603 (37%), Positives = 329/603 (55%), Gaps = 55/603 (9%)
 Frame = +1

Query  1822  TENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKP-----AIKPGDKVLLIYV  1986
             T +KT+ ++ ++KG V    T  E++     +A  LL S +       +  GD+VLL+Y 
Sbjct  16    TPSKTMLSFADDKGVVTASLTCAELNKRMQNLAGLLLASTQQHSKGLGLNQGDRVLLVYP  75

Query  1987  PGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVT  2166
             PGLDF+  F  CL+A V+ +P  PPD   R   + +    ++ + C     L T S +  
Sbjct  76    PGLDFIVVFLACLKAGVVAVPVYPPD--PRKMKKDISMFVSVTQNCQAKTAL-TCSMYYN  132

Query  2167  VRIMSAKNMLFGKSKDKSSNSWPD-LPWLHTDSWVkkpklfkkpkDEQGQPLSEDLCFLQ  2343
             V+ +SA    F  S    +  WP+ L W+ TD  V    +          P ++   FLQ
Sbjct  133   VKKISAIKEKFTFS---GAAQWPEHLNWVVTDDLVDTKGIDPAKHWLTQSPSADSTAFLQ  189

Query  2344  FTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVS  2523
             +TSGST+ PKGV+++HG + HN++ +    ++   T++VSWLPQYHDMGLIG  L  + +
Sbjct  190   YTSGSTSAPKGVVLSHGNLNHNLRTISSALQAGRDTVVVSWLPQYHDMGLIGAYLGTIFN  249

Query  2524  GGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLES-----SKEENFDL  2688
             GG G+  SP +F+++P LWL+ +SK RATH  APNFA+ LL R+ +      +  ++ DL
Sbjct  250   GGKGVYLSPFSFIRDPCLWLRLVSKHRATHLQAPNFAYSLLARKSDRLTVGLASGQHVDL  309

Query  2689  SSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFV  2868
             SS+  +++ AEPI+   +  F      FGL   V+ P YGLAE+ V+V C  G+   ++V
Sbjct  310   SSVRHMINGAEPIQGEAIDNFYRAFSPFGLPEGVVKPTYGLAEHTVYV-CGGGQQR-LWV  367

Query  2869  DWQ----GRV--------CCGYIKQ------PNTD--GVDIKIISPETGKENDDPGKEGE  2988
             D Q     RV          G +K+      P+    G+D++I+  ET +E    G+ GE
Sbjct  368   DKQELESNRVFRVVEKTNTAGLVKEMIGCGVPSRKDYGIDVRIVDAET-EEEKPEGETGE  426

Query  2989  IWISSLSAGIGYWG--LEELSQKTFENDIL-STPGKRYIRTGDLGRIIDSKLFITGRTKD  3159
             IWISS S   GY+G  + E S + F+  ++  T GK +++TGDLG I + +LFI GR KD
Sbjct  427   IWISSASKARGYYGDEMREFSAEAFQAKVVGDTEGKTFLKTGDLGVIYNQELFICGRMKD  486

Query  3160  LIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIA  3339
             L+I+ G+N Y  D+E + ES  EL RPGCCA              L    +D+  L V+A
Sbjct  487   LVIIRGRNHYPQDLEASAESHEEL-RPGCCAAF----------SYLADGNADDEQLAVVA  535

Query  3340  EVRD-GKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISG  3516
             E+RD        +   I + +A EHGV +  +V + PRSI KTTSGKI R  C K     
Sbjct  536   ELRDPAMTSKASLCGKIRSAIAREHGVKVTLVVLLSPRSIPKTTSGKISRSRCKKALEEK  595

Query  3517  TLD  3525
             TL+
Sbjct  596   TLE  598



>ref|XP_008903130.1| hypothetical protein PPTG_10236 [Phytophthora parasitica INRA-310]
 gb|ETI50883.1| hypothetical protein F443_05633 [Phytophthora parasitica P1569]
 gb|ETN11321.1| hypothetical protein PPTG_10236 [Phytophthora parasitica INRA-310]
Length=755

 Score =   318 bits (816),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 227/635 (36%), Positives = 341/635 (54%), Gaps = 56/635 (9%)
 Frame = +1

Query  1822  TENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKP-----AIKPGDKVLLIYV  1986
             T +KT+ ++ ++KG V    T  E++     +A  LL S +       +  GD+VLL+Y 
Sbjct  16    TPSKTMLSFADDKGVVTASLTCAELNKRMQNLAGLLLASTQQHSKGLGLNQGDRVLLVYP  75

Query  1987  PGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVT  2166
             PGLDF+  F  CL+A V+ +P  PPD   R   + +    ++ + C     L T S +  
Sbjct  76    PGLDFIVVFLACLKAGVVAVPVYPPD--PRKMKKDISMFVSVTQNCQAKTAL-TCSMYYN  132

Query  2167  VRIMSAKNMLFGKSKDKSSNSWPD-LPWLHTDSWVkkpklfkkpkDEQGQPLSEDLCFLQ  2343
             V+ +SA    F  S    +  WP+ L W+ TD  V    +          P ++   FLQ
Sbjct  133   VKKISAIKEKFTFS---GAAQWPEHLNWVVTDDLVDTKGIDPAKHWLTQSPSADSTAFLQ  189

Query  2344  FTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVS  2523
             +TSGST+ PKGV+++HG + HN++ +    ++   T++VSWLPQYHDMGLIG  L  + +
Sbjct  190   YTSGSTSAPKGVVLSHGNLNHNLRTISSALQAGRDTVVVSWLPQYHDMGLIGAYLGTIFN  249

Query  2524  GGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLES-----SKEENFDL  2688
             GG G+  SP +F+++P LWL+ +SK RATH  APNFA+ LL R+ +      +  ++ DL
Sbjct  250   GGKGVYLSPFSFIRDPCLWLRLVSKHRATHLQAPNFAYSLLARKSDRLTVGLASGQHVDL  309

Query  2689  SSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFV  2868
             SS+  +++ AEPI+   +  F      FGL   V+ P YGLAE+ V+V C  G+   ++V
Sbjct  310   SSVRHMINGAEPIQGEAIDNFYRAFSPFGLPEGVVKPTYGLAEHTVYV-CGGGQQR-LWV  367

Query  2869  DWQ----GRV--------CCGYIKQ------PNTD--GVDIKIISPETGKENDDPGKEGE  2988
             D Q     RV          G +K+      P+    G+D++I+  ET +E    G+ GE
Sbjct  368   DKQELESNRVFRVVEKTNTAGLVKEMIGCGVPSRKDYGIDVRIVDAET-EEEKPEGETGE  426

Query  2989  IWISSLSAGIGYWG--LEELSQKTFENDIL-STPGKRYIRTGDLGRIIDSKLFITGRTKD  3159
             IWISS S   GY+G  + E S + F+  ++  T GK +++TGDLG I + +LFI GR KD
Sbjct  427   IWISSASKARGYYGDEMREFSAEAFQAKVVGDTEGKTFLKTGDLGVIYNQELFICGRMKD  486

Query  3160  LIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIA  3339
             L+I+ G+N Y  D+E + ES  EL RPGCCA              L    +D+  L V+A
Sbjct  487   LVIIRGRNHYPQDLEASAESHEEL-RPGCCAAF----------SYLADGNADDEQLAVVA  535

Query  3340  EVRD-GKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISG  3516
             E+RD        +   I + +A EHGV +  +V + PRSI KTTSGKI R  C K     
Sbjct  536   ELRDPAMTSKASLCGKIRSAIAREHGVKVTLVVLLSPRSIPKTTSGKISRSRCKKALEEK  595

Query  3517  TLDVIEEQMNGERSLP-RNDGIIVPANGKISKTDI  3618
             TL+ +    +    +P  +DG  V   G+    ++
Sbjct  596   TLEELYRNEDMIADVPVEDDGGDVAVAGETMNRNV  630



>gb|ETK90786.1| hypothetical protein L915_05492 [Phytophthora parasitica]
Length=755

 Score =   318 bits (816),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 227/635 (36%), Positives = 341/635 (54%), Gaps = 56/635 (9%)
 Frame = +1

Query  1822  TENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKP-----AIKPGDKVLLIYV  1986
             T +KT+ ++ ++KG V    T  E++     +A  LL S +       +  GD+VLL+Y 
Sbjct  16    TPSKTMLSFADDKGVVTASLTCAELNKRMQNLAGLLLASTQQHSKGLGLNQGDRVLLVYP  75

Query  1987  PGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVT  2166
             PGLDF+  F  CL+A V+ +P  PPD   R   + +    ++ + C     L T S +  
Sbjct  76    PGLDFIVVFLACLKAGVVAVPVYPPD--PRKMKKDISMFVSVTQNCQAKTAL-TCSMYYN  132

Query  2167  VRIMSAKNMLFGKSKDKSSNSWPD-LPWLHTDSWVkkpklfkkpkDEQGQPLSEDLCFLQ  2343
             V+ +SA    F  S    +  WP+ L W+ TD  V    +          P ++   FLQ
Sbjct  133   VKKISAIKEKFTFS---GAAQWPEHLNWVVTDDLVDTKGIDPAKHWLTQSPSADSTAFLQ  189

Query  2344  FTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVS  2523
             +TSGST+ PKGV+++HG + HN++ +    ++   T++VSWLPQYHDMGLIG  L  + +
Sbjct  190   YTSGSTSAPKGVVLSHGNLNHNLRTISSALQAGRDTVVVSWLPQYHDMGLIGAYLGTIFN  249

Query  2524  GGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLES-----SKEENFDL  2688
             GG G+  SP +F+++P LWL+ +SK RATH  APNFA+ LL R+ +      +  ++ DL
Sbjct  250   GGKGVYLSPFSFIRDPCLWLRLVSKHRATHLQAPNFAYSLLARKSDRLTVGLASGQHVDL  309

Query  2689  SSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFV  2868
             SS+  +++ AEPI+   +  F      FGL   V+ P YGLAE+ V+V C  G+   ++V
Sbjct  310   SSVRHMINGAEPIQGEAIDNFYRAFSPFGLPEGVVKPTYGLAEHTVYV-CGGGQQR-LWV  367

Query  2869  DWQ----GRV--------CCGYIKQ------PNTD--GVDIKIISPETGKENDDPGKEGE  2988
             D Q     RV          G +K+      P+    G+D++I+  ET +E    G+ GE
Sbjct  368   DKQELESNRVFRVVEKTNTAGLVKEMIGCGVPSRKDYGIDVRIVDAET-EEEKPEGETGE  426

Query  2989  IWISSLSAGIGYWG--LEELSQKTFENDIL-STPGKRYIRTGDLGRIIDSKLFITGRTKD  3159
             IWISS S   GY+G  + E S + F+  ++  T GK +++TGDLG I + +LFI GR KD
Sbjct  427   IWISSASKARGYYGDEMREFSAEAFQAKVVGDTEGKTFLKTGDLGVIYNQELFICGRMKD  486

Query  3160  LIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIA  3339
             L+I+ G+N Y  D+E + ES  EL RPGCCA              L    +D+  L V+A
Sbjct  487   LVIIRGRNHYPQDLEASAESHEEL-RPGCCAAF----------SYLADGNADDEQLAVVA  535

Query  3340  EVRD-GKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISG  3516
             E+RD        +   I + +A EHGV +  +V + PRSI KTTSGKI R  C K     
Sbjct  536   ELRDPAMTSKASLCGKIRSAIAREHGVKVTLVVLLAPRSIPKTTSGKISRSRCKKALEEK  595

Query  3517  TLDVIEEQMNGERSLP-RNDGIIVPANGKISKTDI  3618
             TL+ +    +    +P  +DG  V   G+    ++
Sbjct  596   TLEELYRNEDMIADVPVEDDGGDVAVAGETMNRNV  630



>ref|WP_012409759.1| AMP-dependent synthetase and ligase [Nostoc punctiforme]
 ref|YP_001866726.1| AMP-dependent synthetase and ligase [Nostoc punctiforme PCC 73102]
 gb|ACC81783.1| AMP-dependent synthetase and ligase [Nostoc punctiforme PCC 73102]
Length=609

 Score =   314 bits (804),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 212/592 (36%), Positives = 311/592 (53%), Gaps = 72/592 (12%)
 Frame = +1

Query  1840  YTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFG  2019
             YT+L       D  TY+E+H  +  IA  L    +     G++ LL Y PGLDF+ AFFG
Sbjct  33    YTFLKNGEQEADSLTYQELHLRSRAIAGSL----QALNLVGERALLFYQPGLDFIAAFFG  88

Query  2020  CLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAKNMLF  2199
             CL A V+ +P  PP   Q      L  +  I        +L+T +      + + + +  
Sbjct  89    CLYAGVVAVPAYPPRKNQN-----LSRLQAITADAQAQIVLTTTTLLNNRELFAEQELEL  143

Query  2200  GKSKDKSSNSWPDLPWLHTDSWVkkpklfkkpkDEQGQPLSED-LCFLQFTSGSTTDPKG  2376
             G+           L WL TD         +  +  Q   L E+ L FLQ+TSGST +PKG
Sbjct  144   GQ-----------LQWLTTD-----VLTNELTQSWQQLKLEENSLAFLQYTSGSTGNPKG  187

Query  2377  VMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVT  2556
             VM++HG ++HN + + + +  +S +  + WLP YHDMGLIGG+L  L +G   +L SPV 
Sbjct  188   VMVSHGNLLHNSRAIAQCFGHSSNSKGLIWLPPYHDMGLIGGILQPLYAGFPVVLMSPVD  247

Query  2557  FMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAAEPIRQT  2736
             F++ P+ WLQ +S+++AT S  PNFA+EL +R+      E+ DLSS     + AEPIR  
Sbjct  248   FLQKPIRWLQAISRYKATTSGGPNFAYELCLRKATPEHLESLDLSSWDLAFTGAEPIRAQ  307

Query  2737  TLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVF-----------------  2865
             TL++F +     G +++   P YG+AE  + VS      LP+                  
Sbjct  308   TLEQFTKTFAPCGFNQKAFYPCYGMAETTLIVSGGEKTELPILCKVDPAALEQNRVVNVI  367

Query  2866  ---VDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGIGYWGLE  3036
                +D +  V CG     +   + I I++PE+     +  + GEIWIS  S   GYW   
Sbjct  368   DEQIDARTLVGCG----QSCQDMSIVIVNPESLSVCSEK-QIGEIWISGSSVTQGYWNQA  422

Query  3037  ELSQKTF--ENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDIEKT  3210
             EL++K F    D+   P   ++RTGDLG + D +LF+TGR KD+II+ G+N Y  DIE T
Sbjct  423   ELTEKNFYAYADMGEGP---FLRTGDLGFLQDDELFVTGRIKDIIIIRGQNHYPQDIELT  479

Query  3211  VESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRD---GKPLPYDVMD  3381
             VE S   +R GC A   +      SKG  ++R      LVV+AEV      K    +V++
Sbjct  480   VEKSHPALRVGCLAAFAVE-----SKG--SER------LVVVAEVERTYLKKLNIQEVVN  526

Query  3382  HICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVIEE  3537
              I   V  EHG+ + ++V +K  SI KT+SGKI+RY C   F+SG+LDV+++
Sbjct  527   KIRQTVVTEHGLDVFAVVLVKTGSIPKTSSGKIRRYVCRTAFLSGSLDVVQD  578



>gb|ETP48590.1| hypothetical protein F442_05675 [Phytophthora parasitica P10297]
Length=755

 Score =   317 bits (813),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 241/713 (34%), Positives = 372/713 (52%), Gaps = 84/713 (12%)
 Frame = +1

Query  1822  TENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKP-----AIKPGDKVLLIYV  1986
             T +KT+ ++ ++KG V    T  E++     +A  LL S +       +  GD+VLL+Y 
Sbjct  16    TPSKTMLSFADDKGVVTASLTCAELNKRMQNLAGLLLASTQQHSKGLGLNQGDRVLLVYP  75

Query  1987  PGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVT  2166
             PGLDF+  F  CL+A V+ +P  PPD   R   + +    ++ + C     L T S +  
Sbjct  76    PGLDFIVVFLACLKAGVVAVPVYPPD--PRKMKKDISMFVSVTQNCQAKTAL-TCSMYYN  132

Query  2167  VRIMSAKNMLFGKSKDKSSNSWPD-LPWLHTDSWVkkpklfkkpkDEQGQPLSEDLCFLQ  2343
             V+ +SA    F  S    +  WP+ L W+ TD  V    +          P ++   FLQ
Sbjct  133   VKKISAIKEKFTFS---GAAQWPEHLNWVVTDDLVDTKGIDPAKHWLTQSPSADSTAFLQ  189

Query  2344  FTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVS  2523
             +TSGST+ PKGV+++HG + HN++ +    ++   T++VSWLPQYHDMGLIG  L  + +
Sbjct  190   YTSGSTSAPKGVVLSHGNLNHNLRTISSALQAGRDTVVVSWLPQYHDMGLIGAYLGTIFN  249

Query  2524  GGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLES-----SKEENFDL  2688
             GG G+  SP +F+++P LWL+ +SK RATH  APNFA+ LL R+ +      +  ++ DL
Sbjct  250   GGKGVYLSPFSFIRDPCLWLRLVSKHRATHLQAPNFAYSLLARKSDRLTVGLASGQHVDL  309

Query  2689  SSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFV  2868
             SS+  +++ AEPI+   +  F      FGL   V+ P YGLAE+ V+V C  G+   ++V
Sbjct  310   SSVRHMINGAEPIQGEAIDNFYRAFSPFGLPEGVVKPTYGLAEHTVYV-CGGGQQR-LWV  367

Query  2869  DWQ----GRV--------CCGYIKQ------PNTD--GVDIKIISPETGKENDDPGKEGE  2988
             D Q     RV          G +K+      P+    G+DI+I+  ET +E    G+ GE
Sbjct  368   DKQELESNRVFRVVEKTNTAGLVKEMIGCGVPSRKDYGIDIRIVDAET-EEEKPEGETGE  426

Query  2989  IWISSLSAGIGYWG--LEELSQKTFENDIL-STPGKRYIRTGDLGRIIDSKLFITGRTKD  3159
             IWISS S   GY+G  + E S + F+  ++  T GK +++TGDLG I + +LFI GR KD
Sbjct  427   IWISSASKARGYYGDEMREFSAEAFQAKVVGDTEGKTFLKTGDLGVIYNQELFICGRMKD  486

Query  3160  LIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIA  3339
             L+I+ G+N Y  D+E + ES  EL RPGCCA              L    +D+  L V+A
Sbjct  487   LVIIRGRNHYPQDLEASAESHEEL-RPGCCAAF----------SYLADGNADDEQLAVMA  535

Query  3340  EVRD-GKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISG  3516
             E+RD        +   I + +A EHGV +  +V + P SI KTTSGKI R  C K     
Sbjct  536   ELRDPAMTSKASLCGKIRSAIAREHGVKVTLVVLLAPHSIPKTTSGKISRSRCKKALEEK  595

Query  3517  TL-----------DVIEEQMNGE-----RSLPRN-DGIIVPANGKISKTDIVN-------  3624
             TL           DV  E   G+      ++ RN +G  V +    SK+++ +       
Sbjct  596   TLEELYRNEDMIADVPVEDDGGDVAVAGETMNRNVNGPRVASTDDGSKSNLPSVITGVPP  655

Query  3625  -----FLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINI  3768
                  FL + L++  G+  ++I+    L   G++S+ + +    I+  + +++
Sbjct  656   DQVHAFLVEELARTLGVEPTQINDDTPLQELGLDSMALTQLQGVIAQKYQVHV  708



>ref|WP_030765902.1| hypothetical protein [Streptomyces sp. NRRL F-2664]
Length=585

 Score =   312 bits (800),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 194/587 (33%), Positives = 301/587 (51%), Gaps = 60/587 (10%)
 Frame = +1

Query  1828  NKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVD  2007
             +  L+T+L +  +     T+  +   A  +A  L  +    ++PG + LL++ PG DFV 
Sbjct  27    DHPLFTFLPDGEEAEAPLTFAALDAKARAVAASLHAAH---VEPGSRALLLFQPGQDFVV  83

Query  2008  AFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAK  2187
              FFGCL A V+ +P   P P QR  G  LL +A IA+   P A+L+T      +      
Sbjct  84    GFFGCLYAGVVAVPAYLPHPAQRARG--LLRLAGIAEDAQPAAVLTTAGIRAAI------  135

Query  2188  NMLFGKSKDKSSNSWPDL---PWLHTDSWVkkpklfkkpkDEQGQPLSEDLCFLQFTSGS  2358
                     + ++ + P++    WL  D+  +              P  + + FLQ+TSGS
Sbjct  136   --------ETTARTIPEVQETAWLAVDTIAEGAGAGWSAP----SPEPKSVAFLQYTSGS  183

Query  2359  TTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGI  2538
             T  PKGVM+THG + HN+ L+R        T++V WLP YHDMGLI  ++   + G   +
Sbjct  184   TGRPKGVMVTHGNLTHNIDLIRTSLGMDESTVVVGWLPPYHDMGLISMIIVPAMLGIHSV  243

Query  2539  LFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAA  2718
                 V F+++P+ WL+ +S +R T SAAPNFAF+L  R++        DLSS     + A
Sbjct  244   SMPTVAFLQSPVRWLRAISTYRGTLSAAPNFAFDLCTRKVADEDRATLDLSSWKVATNGA  303

Query  2719  EPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFVDWQGR-----  2883
             EPIR  +++RF E   S G   E + P YGLAE+ + VS A  E   VF  +        
Sbjct  304   EPIRADSMRRFSEAFASTGFRPETIIPVYGLAESTLLVSGAPLERPWVFRSFDEHQLERG  363

Query  2884  ---------------VCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGI  3018
                            V CG  +      +D+ ++ P+  +    PG+ GEIW++  S  +
Sbjct  364   AAVRVADDSPAARVLVSCGTSRT-----LDVAVVDPQA-RTRCQPGRVGEIWVAGDSVAV  417

Query  3019  GYWGLEELSQKTFENDILSTPGK-RYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTS  3195
             GYW   +LS++ FE  ++   G+  Y+RTGDLG + +  LF+ GR KD+IIV G+N Y  
Sbjct  418   GYWQRPDLSREAFEATLVDGDGRGPYMRTGDLGFLTEDGLFVCGRIKDVIIVGGRNHYPH  477

Query  3196  DIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGKPLPYDV  3375
             DIE+T ES+   +RPGC A  G+  D  V + ++      E G     E ++G      V
Sbjct  478   DIERTAESAHPAIRPGCVAAFGVAADG-VEEVVVAAELRREAGDGTDREAQEG------V  530

Query  3376  MDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISG  3516
             ++ +   VA+EH + +  +V +   S+ KT+SGK++R E  K +++G
Sbjct  531   VNAVLRAVAQEHRLTVREVVLLPAGSLPKTSSGKLQRRETRKEYLAG  577



>ref|WP_039755014.1| AMP-dependent synthetase, partial [Hassallia byssoidea]
Length=597

 Score =   312 bits (800),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 207/610 (34%), Positives = 307/610 (50%), Gaps = 59/610 (10%)
 Frame = +1

Query  1765  FPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQK  1944
              PE S+L   LR        +++  YT++ +    L   TY E+   A  IA KL    +
Sbjct  2     LPEFSTLVDVLRERSQQ--QQDQRAYTFIKDADTELSSLTYAELDRQARAIAAKL----Q  55

Query  1945  PAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVC  2124
                  G + LL+Y  GL+F+ AFFGCL A V+ +P  PP   Q+     +  I  I    
Sbjct  56    SIGATGQRALLLYPSGLEFIAAFFGCLYASVVAVPAYPPRRNQK-----MSRIEAIVADA  110

Query  2125  NPVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPDLPWLHTDSWVkkpklfkkpkDE  2304
              P  +L+T +    +    A+N    +    +++   ++     +SW +           
Sbjct  111   QPQVLLTTEALLSNIESRFAENPELARLDCLATD---NIDEHQAESWQRTALE-------  160

Query  2305  QGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHD  2484
                  S  L FLQ+TSGST  PKGVM++HG ++HN  L+ K ++ T  +  V WLP YHD
Sbjct  161   -----SSALAFLQYTSGSTGTPKGVMVSHGNLLHNSTLIHKGFEHTPNSKGVIWLPPYHD  215

Query  2485  MGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLES  2664
             MGLIGG+L  L  G   IL SP  F++ PL WL  +S+++ T S  P+FA+EL V ++  
Sbjct  216   MGLIGGVLQPLYGGFPVILMSPENFLQKPLRWLTAISQYKGTTSGGPSFAYELCVNKITD  275

Query  2665  SKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAY  2844
              +    DLSS     + AE IR  T++RFVE     G  RE   P YG+AE  + VS  +
Sbjct  276   EERATLDLSSWQVAFNGAEQIRPETMERFVEAFAPCGFRREAFYPCYGMAETTLIVSGGH  335

Query  2845  GEGLPVFVD------WQGRVCCGYIKQPNTDGV--------DIKII--SPETGKENDDPG  2976
                 PV  +       Q RV     ++  +  V        DIK++  +PET      P 
Sbjct  336   ASAAPVLQNVQKEALEQNRVVTTSKEKSGSQTVVGCGQALKDIKVVIANPET-MTRCKPN  394

Query  2977  KEGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTK  3156
             + GEIW+S  S   GYW   E +++TF+  +L T    ++RTGDLG + + +LF+TGR K
Sbjct  395   EIGEIWVSGPSVAQGYWNKLEQTKQTFQAQLLDTEEGPFLRTGDLGFLQNGELFVTGRIK  454

Query  3157  DLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVI  3336
             D+II+ G+N Y  DIE TVE S   +R GC A   +                 E  LV++
Sbjct  455   DVIIIRGQNHYPQDIELTVERSHPALRRGCGAAFAV-------------EVKGEERLVIV  501

Query  3337  AEVRDGKPLPYDVMD---HICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRF  3507
              EV        DV +   +I   VA  HG+ + + V ++  +I KT+S KI+R+ C   F
Sbjct  502   HEVERSYLRKLDVNEVVGNIRHAVATHHGLQVYAAVLVRTGTICKTSSNKIQRHACRSGF  561

Query  3508  ISGTLDVIEE  3537
             +SG+LDV+++
Sbjct  562   VSGSLDVVQD  571



>ref|WP_036478874.1| beta-ketoacyl synthase [Myxosarcina sp. GI1]
Length=2784

 Score =   331 bits (849),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 215/688 (31%), Positives = 353/688 (51%), Gaps = 71/688 (10%)
 Frame = +1

Query  1840  YTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFG  2019
             +T+L +    LD  TY+++   A  IA  L          G++ LL+Y PGL+F+ AF G
Sbjct  32    FTFLADSETELDSLTYQQLDERARAIAASLQGYNAL----GERALLLYQPGLEFITAFLG  87

Query  2020  CLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTV----RIMSAK  2187
             CL A V+ +P  PP      G +++  +  IA+       L+T  +  ++    +I + +
Sbjct  88    CLYAGVVVVPAYPPR-----GDRSIDRLLVIARDAQAKFALTTQDWQDSIENKFKIEAPQ  142

Query  2188  NML-FGKSKDKSSNSWPDLPWLHTDSWVkkpklfkkpkDEQGQPLSEDLCFLQFTSGSTT  2364
               L F  +   SS+   +  W    +                    +DL FLQ+TSGST 
Sbjct  143   QQLQFIATDAVSSDRATEWQWFSLQA--------------------DDLAFLQYTSGSTG  182

Query  2365  DPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGILF  2544
              PKGV+++HG ++ N   + + +++ +    +SWLP YHDMGLIGG++  L +G S  L 
Sbjct  183   KPKGVIVSHGNIMANSLSINRCFQNRADQTGLSWLPPYHDMGLIGGIIQPLYAGMSMYLM  242

Query  2545  SPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAAEP  2724
             +PVTF++ P  WL+T+S +R + S  PNFA++L V R++  + +  DLS      S AEP
Sbjct  243   APVTFLQRPYRWLKTISNYRISFSGGPNFAYDLCVDRVKPEQLDTLDLSCWELAFSGAEP  302

Query  2725  IRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFVDWQGR-------  2883
             +R  T++RF    QS G  +E   P YG+AE+ + ++       P+   +  +       
Sbjct  303   VRAATIERFALYFQSSGFRKEAFYPCYGMAESTLIITGGDKAAAPIVRSFDSKAIEEDRA  362

Query  2884  ------------VCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGIGYW  3027
                         V  G     N  G  + I+ P + ++  D G+ GEIW  S S   GYW
Sbjct  363   IKAKDDNNATSLVSSGR----NISGQTLAIVDPHSLEKCQD-GEIGEIWAKSDSVARGYW  417

Query  3028  GLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDIEK  3207
               EEL+   F+ +I  T    ++RTGDLG + D +LF+TGR KDLII+ G+N Y  DIE 
Sbjct  418   QQEELTAACFQAEIADTNESGFLRTGDLGFLQDGELFVTGRLKDLIIIRGRNYYPQDIEL  477

Query  3208  TVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGKPLPYDVMDHI  3387
             TV+ + E VR G CA   + E     K ++T     E+G   + ++      P  +   I
Sbjct  478   TVDKAHEAVRSGNCAAFAV-EVTGTEKLVITT----EVGRTYLRKLD-----PQGISKAI  527

Query  3388  CTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVIEEQMNGERSLPR  3567
                +A+ H + +A IV +K  SI KT+SGKIKR+ C   F+ GTL+V+ E    + ++  
Sbjct  528   RQAIAQHHELQVAEIVLLKTGSIPKTSSGKIKRHACKTGFLQGTLNVVGEW---KSTVKE  584

Query  3568  NDGIIVPANGKISKTDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKIS  3747
             +  + V  +    +T+I+N+L D ++Q  G+  ++I   E L + G++S+  V+ +  + 
Sbjct  585   SSSVTVSPHFGNRQTEIINWLVDNIAQTLGVAATEIELSEPLANSGLSSLQAVQLSADLE  644

Query  3748  SFFGINIGAIDIFSATCIDDLADFVESL  3831
              + G+++    ++  + I  LA ++  L
Sbjct  645   DWLGVSLSPTLVYDYSTITQLAKYLSEL  672



>ref|WP_012831237.1| thioester reductase domain-containing protein [Haliangium ochraceum]
 ref|YP_003270538.1| thioester reductase domain-containing protein [Haliangium ochraceum 
DSM 14365]
 gb|ACY18645.1| thioester reductase domain protein [Haliangium ochraceum DSM 
14365]
Length=1067

 Score =   323 bits (828),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 217/700 (31%), Positives = 342/700 (49%), Gaps = 90/700 (13%)
 Frame = +1

Query  1828  NKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVD  2007
             ++T +T+L +     +  +Y E+   A  IA  L    +     G++V+L++ PGLDF+ 
Sbjct  22    DRTAFTFLQDGEQPSETCSYAELDRAARDIAVNL----REHGMAGERVMLLFPPGLDFIR  77

Query  2008  AFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSA-  2184
              FFGCL A  +  P  PP   +      L  +  I + C   AIL+       V   +A 
Sbjct  78    GFFGCLYAGAVATPVYPPQDIRH-----LDRLQAIIEDCEAKAILTVPGLADLVGAAAAT  132

Query  2185  -------KNMLFGKSKDKSSNSWPDLPWLHTDSWVkkpklfkkpkDEQGQPLSEDLCFLQ  2343
                    + +  G      +++W D P +  D                      DL FLQ
Sbjct  133   LPALRRLEVLTTGAVNQARADTWSD-PGIGAD----------------------DLAFLQ  169

Query  2344  FTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVS  2523
             +TSGST +PKGV ++HG ++HN  L+   ++     + ++WLP YHDMGLIG ++  L  
Sbjct  170   YTSGSTGEPKGVALSHGNLLHNQTLIAAGFRDEVEMVGLNWLPMYHDMGLIGHVVQPLYQ  229

Query  2524  GGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHF  2703
             G   IL SP+ F+K P  WL+ +S++  T S  PNFA+EL VRR+   + E  DLSS   
Sbjct  230   GIHNILMSPLDFLKRPGRWLEAISRYGVTTSGGPNFAYELCVRRIAPEQREGLDLSSWTL  289

Query  2704  LMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFVDWQGR  2883
               S AEP+R  T++RF E    +G   E   P YGLAE  +FVS       PV   + G 
Sbjct  290   AYSGAEPVRARTIERFSEAFAPYGFRPEAFYPCYGLAEATLFVSGGRRREQPVISRFNGD  349

Query  2884  VCCGY----IKQPNT-------------DGVDIKIISPETGKENDDPGKEGEIWISSLSA  3012
                G     +K P++             + + ++I++P+T +   D G+ GEIW+   S 
Sbjct  350   QLTGNRAIPVKGPSSGEERSLVGCGQIPESLRVRIVAPDTCEPLAD-GQVGEIWVQGDSV  408

Query  3013  GIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYT  3192
                YW   E +++TF   +  +    Y+RTGDLG ++D +L+++ R KDL+I+ G+N Y 
Sbjct  409   AGRYWNNPEATEQTFNGRLSGSGEGPYLRTGDLGFLLDGELYLSSRLKDLLIIRGRNHYP  468

Query  3193  SDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGKPLPYD  3372
              DIE+TVE++    R GCCA               T     E  LVV+ EV   K +P +
Sbjct  469   QDIEQTVEAAHPSFRAGCCAA-------------FTTDVDGEEQLVVVQEVNTQKFVPAE  515

Query  3373  ---VMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVI---E  3534
                ++  +  RVA+EHG+ +  +V ++PR++ KT+SGKI+R  C +++ S  L VI   E
Sbjct  516   ATTIVTEVSQRVAKEHGIHLYELVLVEPRTLPKTSSGKIRRSACREQWQSDHLKVIHKGE  575

Query  3535  EQMNGERSLPRNDGIIVPANGKIS--KTDIVNFLKDLLSQQTGIPVSKISTGETLVSYGV  3708
                 G  +L R     +P    +   +T +    KD+L       VS ++  +     G 
Sbjct  576   ATQGGGEALER-----LPGEAPLGDIETKLAGMWKDILG------VSSVARDDNFFHLGA  624

Query  3709  NSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVES  3828
             +SI  V  A  +   FG+N+ A   +    +  +A+ + +
Sbjct  625   DSIKSVELAYALEEGFGLNLPAAVFYEYPTLRTMAEAIAA  664



>ref|WP_036418848.1| fatty acyl-AMP ligase, partial [Mycobacterium gastri]
Length=569

 Score =   311 bits (796),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 217/613 (35%), Positives = 309/613 (50%), Gaps = 69/613 (11%)
 Frame = +1

Query  1774  LSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAI  1953
             + +L  YLR W       ++TLY +++ +G  L+  TY         +A  L    +  +
Sbjct  1     MDTLIDYLRMWEVR--RPDQTLYRFVDAEGRELEHYTYHSFAERTRELAAYLFA--EAGL  56

Query  1954  KPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPV  2133
             +PGD+ LL+Y PGL+ V AFF C R  VI +P  PP P     G A L    IA+ C   
Sbjct  57    RPGDRALLVYPPGLEMVAAFFACARIGVIAVPVSPPLPMAFEAGLAKLSF--IARDCQAK  114

Query  2134  AILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPDLPWLHTD-SWVkkpklfkkpkDEQG  2310
              +LST  +    R++       G      +   P+LPW  TD +W           +  G
Sbjct  115   VVLSTKQFEYDYRLLLGHRQ--GGLPWPGAARPPELPWFATDGTW-----------EFGG  161

Query  2311  QPLSE---DLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYH  2481
              P+++    + FLQ+TSGST+DPKGV+++H  VI N              + VSWLPQ+H
Sbjct  162   APVADTPGPVLFLQYTSGSTSDPKGVIVSHANVIANGSAF------AGGEVAVSWLPQHH  215

Query  2482  DMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVR--R  2655
             DMGLI   L IL+ GG+    SP  F++ P  WL+ +S+ RATHS APNFA E  +R  +
Sbjct  216   DMGLISAYLFILLLGGTTHAMSPADFLQRPSAWLRLISQVRATHSPAPNFALEYCLREDK  275

Query  2656  LESSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVS  2835
             L + +    DLSS+  L+  AEP+R  T  RF +    +GL  + +A  YGLAEN + VS
Sbjct  276   LPTDELTGIDLSSLDSLLVGAEPLRANTFARFRQRFAGYGLRPDALAGAYGLAENTLIVS  335

Query  2836  C-----------AYGE-------GLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKE  2961
                         A G+        LP   +    V CG   +P    V ++I+ P + ++
Sbjct  336   IRGRQTLALNKRALGQNLARVEKALPDNNNQAHVVSCG---KPVAGNV-VRIVDPRS-RQ  390

Query  2962  NDDPGKEGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFI  3141
                 G+ GE+W+   S G GYW   EL+ +TF   I     + Y+RTGDLG + + +LF+
Sbjct  391   ALGEGRIGEVWLDGPSKGGGYWHRPELTAETFAARITGDAERTYLRTGDLGFLYEGELFV  450

Query  3142  TGRTKDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDEL  3321
              GR+KDLIIV G N Y SDIE  VE S+  VR GC A      +             ++ 
Sbjct  451   CGRSKDLIIVRGVNCYPSDIEAVVERSAAQVRNGCVAAFSFEHE-------------EQE  497

Query  3322  GLVVIAEVRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAK  3501
              LVV+AEVRD   LP      +   +     V   +IV   PRSI KTTSGKI+R +  +
Sbjct  498   ALVVVAEVRDQHSLPDP--KALARSIRRYCHVDPHTIVFSPPRSIPKTTSGKIRRAQTRR  555

Query  3502  RFISGTLDVIEEQ  3540
              ++ G L V+  +
Sbjct  556   LWLDGKLPVLRSE  568



>ref|WP_030656773.1| MULTISPECIES: hypothetical protein [Streptomyces]
Length=585

 Score =   310 bits (795),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 198/591 (34%), Positives = 294/591 (50%), Gaps = 68/591 (12%)
 Frame = +1

Query  1828  NKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVD  2007
             +  L+T+L +  +     T+  +   A  +A  L T+    ++PG + LL++ PG DFV 
Sbjct  27    DHPLFTFLPDGEEAEPTLTFAALDAKARAVAASLQTAH---VEPGSRALLLFQPGQDFVV  83

Query  2008  AFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAK  2187
             AFFGCL A V+ +P   P P QR  G  LL +A IA+   P A+L+T      +   +  
Sbjct  84    AFFGCLYAGVVAVPAYLPHPAQRARG--LLRLAGIAEDAQPSAVLTTAGIQAAIETTART  141

Query  2188  NMLFGKSKDKSSNSWPDLPWLHTDSWVkkpklfkkpkDEQGQPLSE--DLCFLQFTSGST  2361
                              +P +   +W+    L          P  E   + FLQ+TSGST
Sbjct  142   -----------------IPEVQETAWLAVDTLEDGTGAGWSAPSPEPKSVAFLQYTSGST  184

Query  2362  TDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGIL  2541
               PKGVM+THG + HN  L+R        T++V WLP YHDMGLI  ++   + G   + 
Sbjct  185   GRPKGVMVTHGNLTHNTDLIRTSLGMDGSTVVVGWLPPYHDMGLISMIIVPAMMGIHSVS  244

Query  2542  FSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAAE  2721
                V F+++P+ WL+ +S +R T SAAPNFAF+L  R++        DLSS     + AE
Sbjct  245   MPTVAFLQSPVRWLRAISTYRGTLSAAPNFAFDLCTRKVTDEDRATLDLSSWLVATNGAE  304

Query  2722  PIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFVDWQGR------  2883
             PIR  ++KRF E   S G   E + P YGLAE  + VS     G P+   W  R      
Sbjct  305   PIRAESMKRFSEAFASTGFRPETIVPVYGLAEATLLVS-----GAPIERPWVFRSFDENE  359

Query  2884  -------------------VCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSL  3006
                                V CG  +      +D+ ++ P+  +    PGK GEIW++  
Sbjct  360   LERGSAVAVPDDSPDARVLVSCGVSRS-----LDVAVVDPQ-ARTRCRPGKVGEIWVAGD  413

Query  3007  SAGIGYWGLEELSQKTFENDILSTPGK-RYIRTGDLGRIIDSKLFITGRTKDLIIVAGKN  3183
             S  +GYW   +LS++ FE  +     +  Y+RTGDLG   +  LF+ GR KD+IIV G+N
Sbjct  414   SVAVGYWQRPDLSREAFEATLADGDDQGPYMRTGDLGFRTEDGLFVCGRIKDVIIVGGRN  473

Query  3184  IYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGKPL  3363
              Y  DIE+T ES+   VRPGC A  G+  D  V + ++      E G     E R+G   
Sbjct  474   HYPHDIERTAESAHPAVRPGCVAAFGVTTDG-VEQVVVAAELRREAGDGSDREAREG---  529

Query  3364  PYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISG  3516
                V++ +   VA+EH + +  +V +   ++ KT+SGK++R E  K +++G
Sbjct  530   ---VVNAVLRAVAQEHRLTVREVVLLPAGTLPKTSSGKLQRRETRKEYLAG  577



>ref|WP_026723805.1| AMP-dependent synthetase [Fischerella sp. PCC 9431]
 gb|AHF22416.1| HapA [Hapalosiphon welwitschii UTEX B 1830]
Length=708

 Score =   314 bits (804),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 201/576 (35%), Positives = 303/576 (53%), Gaps = 71/576 (12%)
 Frame = +1

Query  1882  TYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptipp  2061
             TY+ +   A ++A   L S K     G++ LL+Y PGL+F++AFFGCL A V  +P  PP
Sbjct  47    TYQALDQKARSLA-AFLHSMKAT---GERALLLYPPGLEFIEAFFGCLYAGVTAVPVYPP  102

Query  2062  dptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPDL  2241
                QR     +  +  I K       L+T S    +              + S    P+L
Sbjct  103   RRNQR-----MTRLQAIVKDAEASFALTTTSVLTNI--------------EHSIKQEPEL  143

Query  2242  PWLHTDSWVkkpklfkkpkDEQGQPL---SEDLCFLQFTSGSTTDPKGVMITHGGVIHNV  2412
               LH        +       E  QPL   S+ L FLQ+TSGST  PKGVM++HG ++ N 
Sbjct  144   AALH----YIATENITNNFAEDWQPLKINSDTLAFLQYTSGSTGTPKGVMVSHGNLLSNS  199

Query  2413  KLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTM  2592
               + + +  TS +++V+WLP +HDMGLI G +  L  G    + +P +F+  P+ WL+ +
Sbjct  200   ADLDRGWDHTSESVIVTWLPTFHDMGLIYGAIQPLYKGIPCYMMAPTSFLMRPMRWLEAI  259

Query  2593  SKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSF  2772
             S+++ATHS APNFA++L V ++ S +    DLSS    ++ AEP+R   LKRF EL +  
Sbjct  260   SRYKATHSGAPNFAYQLCVDKVTSEQLATLDLSSWRMALNGAEPVRADVLKRFAELFKPC  319

Query  2773  GLSREVMAPGYGLAENCVFVSCAYGEGLPVFVDWQGR--------------------VCC  2892
             G +     PGYGLAE  + V+    + LP F   Q                      V C
Sbjct  320   GFNLRTFCPGYGLAEATLKVTATRAKDLPTFYTVQSEALRQNRVVEAQEQEPGSVTLVGC  379

Query  2893  GYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGIGYWGLEELSQKTFENDIL  3072
             GY +        I I+ PE+      PG+ GEIW+S  +   GYW   + +++TF+  ++
Sbjct  380   GYTE----IDTKIAIVHPES-LTTCSPGEVGEIWVSGTTVAQGYWMRNQATEQTFQAYLV  434

Query  3073  STPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDIEKTVESSSELVRPGCCA  3252
              T    ++RTGDLG ++D +LFITGR KD+II+ G+N Y  DIE TV++S   +RP C A
Sbjct  435   DTGEGPFLRTGDLGFLLDGELFITGRIKDVIIIRGQNYYPQDIELTVQTSHSALRPNCGA  494

Query  3253  VVGIPEDVLVSKGILTQRASDELGLVVIAEVRDG--KPLPYD-VMDHICTRVAEEHGVPI  3423
                +       +G+  +R      LV++ EV     + L  D V+  I   V+E+H + +
Sbjct  495   AFSME-----VEGV--ER------LVIVQEVERSYLRQLNVDQVVRGIRQAVSEQHQLQV  541

Query  3424  ASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVI  3531
              ++V +K  SI KT+SGKI+R+ C   F++G+LDV+
Sbjct  542   YAVVLLKTASIPKTSSGKIQRHACRDGFLNGSLDVV  577



>ref|WP_033336012.1| AMP-dependent synthetase, partial [Scytonema hofmanni]
Length=679

 Score =   313 bits (802),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 227/688 (33%), Positives = 345/688 (50%), Gaps = 69/688 (10%)
 Frame = +1

Query  1855  EKGDVL-DRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRA  2031
             E G++  DR TY+ +   A  IA +L   Q   ++ G++ LL+Y PGL+FV AFFGCL A
Sbjct  32    EDGEIASDRLTYQSLDRQARAIAAQL---QSLGLE-GERALLLYSPGLEFVSAFFGCLYA  87

Query  2032  RVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSK  2211
              V+ +P  PP        + L  + +I     P  IL+  S       +S     F  ++
Sbjct  88    EVVAVPAYPPRR-----DRFLERLLSIIADAQPKIILTDTS------TLSDLERRFSTNQ  136

Query  2212  DKSSNSWPDLPWLHTDSWVkkpklfkkpkDEQGQP---LSEDLCFLQFTSGSTTDPKGVM  2382
             +  +     L WL TD+            ++Q Q     ++ L FLQ+TSGST  PKGVM
Sbjct  137   ELKA-----LFWLTTDT-------IPSQLEQQWQKPAIANDTLAFLQYTSGSTAMPKGVM  184

Query  2383  ITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFM  2562
             +THG ++HN + + + ++ T  +  V WLP YHDMGLIGG+L  + +G    L SPV F+
Sbjct  185   VTHGNLLHNSEHIYRCFQHTPHSQGVIWLPPYHDMGLIGGVLQPVYAGFPVTLMSPVAFL  244

Query  2563  KNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAAEPIRQTTL  2742
             + P+ WL+ +S+++AT S  PNFA+EL + ++   +  N DLSS     + AEPIR  TL
Sbjct  245   QKPIRWLEAISQFKATTSGGPNFAYELCISKITPEQRVNLDLSSWEVAFNGAEPIRAETL  304

Query  2743  KRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVF--VDW----QGRVCCGYIK  2904
             +RFVE     G  RE   P YG+AE  + VS       P+   VD     Q +V CG  +
Sbjct  305   ERFVEAFAPCGFRREAFYPCYGMAEGTLIVSGGLKTAAPIISQVDRKAIEQNQVVCGESE  364

Query  2905  QPNT------DGVDIKII--SPETGKENDDPGKEGEIWISSLSAGIGYWGLEELSQKTFE  3060
                T        +D KI+   P+T  +    G+ GEIW+S  S  +GYW   E S++TF+
Sbjct  365   NSQTLVGLGRAWLDQKIVIADPKTLTQCSS-GRVGEIWVSGSSVALGYWNQPEASEQTFQ  423

Query  3061  NDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDIEKTVESSSELVRP  3240
               +  T  + ++RTGDLG + D +LFITGR KDLII+ G N Y  DIE TVE S   +R 
Sbjct  424   AYLADTQTRPFLRTGDLGFLQDGELFITGRLKDLIIIRGHNYYPQDIELTVEQSHPALRI  483

Query  3241  GCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGKPLPYDVMDHICTRVAEEHGVP  3420
                A   I  D +    I  +     L  + I +          V+  I   ++E + + 
Sbjct  484   AGGAAFTIEVDGVERLAIAQEVERHYLRQLDINQ----------VVGAIRQAISEAYELQ  533

Query  3421  IASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVIEEQMNGERSLPRNDGIIVPAN--  3594
             + +IV +K  +I KT+SGKI+R+ C   F+ GTL+++    N +   P +  +   A   
Sbjct  534   VYAIVLLKTGTIPKTSSGKIQRHSCRTGFLKGTLEIV---GNWQEPPPMDVDLQASAEFW  590

Query  3595  --------GKISKTDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISS  3750
                       I+   I  +L   LS++  I   +I   E    YG++S   +    ++  
Sbjct  591   RQSFDAEPSSITAEQIQAWLVFRLSKELKIASEEIDIQEAFAYYGLDSSVAIAITGELID  650

Query  3751  FFGINIGAIDIFSATCIDDLADFVESLL  3834
             + G  +     +    I++LA ++  LL
Sbjct  651   WLGYEVEPTLFWEYPNIEELARYLAQLL  678



>gb|ETM50540.1| hypothetical protein, variant 1 [Phytophthora parasitica]
Length=735

 Score =   315 bits (806),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 238/708 (34%), Positives = 369/708 (52%), Gaps = 84/708 (12%)
 Frame = +1

Query  1837  LYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKP-----AIKPGDKVLLIYVPGLDF  2001
             + ++ ++KG V    T  E++     +A  LL S +       +  GD+VLL+Y PGLDF
Sbjct  1     MLSFADDKGVVTASLTCAELNKRMQNLAGLLLASTQQHSKGLGLNQGDRVLLVYPPGLDF  60

Query  2002  VDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMS  2181
             +  F  CL+A V+ +P  PPD   R   + +    ++ + C     L T S +  V+ +S
Sbjct  61    IVVFLACLKAGVVAVPVYPPD--PRKMKKDISMFVSVTQNCQAKTAL-TCSMYYNVKKIS  117

Query  2182  AKNMLFGKSKDKSSNSWPD-LPWLHTDSWVkkpklfkkpkDEQGQPLSEDLCFLQFTSGS  2358
             A    F  S    +  WP+ L W+ TD  V    +          P ++   FLQ+TSGS
Sbjct  118   AIKEKFTFS---GAAQWPEHLNWVVTDDLVDTKGIDPAKHWLTQSPSADSTAFLQYTSGS  174

Query  2359  TTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGI  2538
             T+ PKGV+++HG + HN++ +    ++   T++VSWLPQYHDMGLIG  L  + +GG G+
Sbjct  175   TSAPKGVVLSHGNLNHNLRTISSALQAGRDTVVVSWLPQYHDMGLIGAYLGTIFNGGKGV  234

Query  2539  LFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLES-----SKEENFDLSSMHF  2703
               SP +F+++P LWL+ +SK RATH  APNFA+ LL R+ +      +  ++ DLSS+  
Sbjct  235   YLSPFSFIRDPCLWLRLVSKHRATHLQAPNFAYSLLARKSDRLTVGLASGQHVDLSSVRH  294

Query  2704  LMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFVDWQ--  2877
             +++ AEPI+   +  F      FGL   V+ P YGLAE+ V+V C  G+   ++VD Q  
Sbjct  295   MINGAEPIQGEAIDNFYRAFSPFGLPEGVVKPTYGLAEHTVYV-CGGGQQR-LWVDKQEL  352

Query  2878  --GRV--------CCGYIKQ------PNTD--GVDIKIISPETGKENDDPGKEGEIWISS  3003
                RV          G +K+      P+    G+D++I+  ET +E    G+ GEIWISS
Sbjct  353   ESNRVFRVVEKTNTAGLVKEMIGCGVPSRKDYGIDVRIVDAET-EEEKPEGETGEIWISS  411

Query  3004  LSAGIGYWG--LEELSQKTFENDIL-STPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVA  3174
              S   GY+G  + E S + F+  ++  T GK +++TGDLG I + +LFI GR KDL+I+ 
Sbjct  412   ASKARGYYGDEMREFSAEAFQAKVVGDTEGKTFLKTGDLGVIYNQELFICGRMKDLVIIR  471

Query  3175  GKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRD-  3351
             G+N Y  D+E + ES  EL RPGCCA              L    +D+  L V+AE+RD 
Sbjct  472   GRNHYPQDLEASAESHEEL-RPGCCAAF----------SYLADGNADDEQLAVVAELRDP  520

Query  3352  GKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTL---  3522
                    +   I + +A EHGV +  +V + PRSI KTTSGKI R  C K     TL   
Sbjct  521   AMTSKASLCGKIRSAIAREHGVKVTLVVLLAPRSIPKTTSGKISRSRCKKALEEKTLEEL  580

Query  3523  --------DVIEEQMNGE-----RSLPRN-DGIIVPANGKISKTDIVN------------  3624
                     DV  E   G+      ++ RN +G  V +    SK+++ +            
Sbjct  581   YRNEDMIADVPVEDDGGDVAVAGETMNRNVNGPRVASTDDGSKSNLPSVITGVPPDQVHA  640

Query  3625  FLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINI  3768
             FL + L++  G+  ++I+    L   G++S+ + +    I+  + +++
Sbjct  641   FLVEELARTLGVEPTQINDDTPLQELGLDSMALTQLQGVIAQKYQVHV  688



>ref|WP_023370149.1| long-chain acyl-CoA synthetase [Mycobacterium kansasii]
 ref|YP_008751054.1| long-chain acyl-CoA synthetase [Mycobacterium kansasii ATCC 12478]
 gb|AGZ51909.1| long-chain acyl-CoA synthetase [Mycobacterium kansasii ATCC 12478]
 gb|KEP44189.1| long-chain acyl-CoA synthetase [Mycobacterium kansasii]
Length=976

 Score =   320 bits (820),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 221/675 (33%), Positives = 339/675 (50%), Gaps = 65/675 (10%)
 Frame = +1

Query  1939  QKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIAK  2118
             Q+  + PGD+ +L+Y PGLDFV    GCL A V+P+P  PPDP       ++     +  
Sbjct  19    QRCGLAPGDRAVLVYPPGLDFVRGLVGCLAAGVLPVPIYPPDPINPQ--NSIEGFQRVVA  76

Query  2119  VCNPVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWP-DLPWLHTDSWVkkpkl----  2283
              C    +L++  Y     + +AK+ + G S D     WP DLPW  T   +   +     
Sbjct  77    DCGAKVVLTSRRYTGARWLGAAKSFVAGSSVD-----WPSDLPWQVTSRGIGSRRTRGFD  131

Query  2284  fkkpkDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVS  2463
                    +  P  +    LQ+TSGST+DPKGV+ITHG + H  +L R+       T  V 
Sbjct  132   SSPRTAHEWAPSRDTPALLQYTSGSTSDPKGVVITHGNLAHQFELNRRLLGLGLETRGVF  191

Query  2464  WLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFEL  2643
             WLP YHD GLI  +L+ L       + SP++F++ P LW   M++ RATH+AAPNFA++L
Sbjct  192   WLPPYHDFGLISVILSTLTGNSELTMMSPLSFIQRPALWFDVMNRVRATHTAAPNFAYDL  251

Query  2644  LVRRLESSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENC  2823
              V +  + +   +DLSS+  +MSAAEP+R+ T +RF+E     GL  E   P YGLAE+ 
Sbjct  252   AVHKTTTEQRAQWDLSSLKVVMSAAEPVREETKRRFLEAFAVTGLRPEAFCPAYGLAEHT  311

Query  2824  VFVSCAYGEGLPV---------------FVDWQGRVCCGYIKQPNTDGVDIKIISPETGK  2958
             V V+      L V                 D Q  V CG +    T  VD++I+ PE   
Sbjct  312   VAVTIFGRSTLRVDRHQLEMERRAVPADGADSQVLVSCGEL----TGDVDVRIVDPELCV  367

Query  2959  ENDDPGKEGEIWISSLSAGIGYWGLEELSQKTFENDILS-TPGKRYIRTGDLGRIIDSKL  3135
                D G+ GEIW+ S S   GYWG  + S+ TF   +     G  Y+RTGDLG + D +L
Sbjct  368   GLSD-GQVGEIWVDSPSKAAGYWGSPDESRATFAARLTGMNDGHSYLRTGDLGFLHDGEL  426

Query  3136  FITGRTKDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASD  3315
             ++ GR KDL+IVAG+NI+  D+E T+ +    +RPG  A   I              A +
Sbjct  427   YVCGRVKDLLIVAGRNIHPQDVEDTLRNCHRAIRPGGIAAFAI-------------DAGN  473

Query  3316  ELGLVVIAEVR--DGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRY  3489
                L V+ EVR    + +   V++ +   V + H +  +++V   P S+SKTTSGK++R 
Sbjct  474   TEALAVLVEVRADASRAVLSSVVEKVRAVVLKNHQLRCSAVVVGPPGSVSKTTSGKVQRS  533

Query  3490  ECAKRFISGTLDVI---------EEQMNGERSLPRNDGI------IVP-ANGKISKTD-I  3618
              C  R++ G+L+           EE M+   +  R   +      + P A  +   TD +
Sbjct  534   RCRARWLDGSLEAQALLVERFEDEEPMDAGSAEAREGEVGASGRMMAPIARNEAQTTDEL  593

Query  3619  VNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATC  3798
             +  ++  ++   GI V+ +   + L + G+NS+G V  A ++S   G  +  +++F+   
Sbjct  594   LAMVRGQVAAVFGIGVANVDIDQPLGAQGLNSVGFVMLASRLSQVVGREVPPMEVFNHPS  653

Query  3799  IDDLADFVESLLEKN  3843
             +  LA  +     +N
Sbjct  654   VRGLATMLSDGEGRN  668



>ref|WP_016876567.1| hypothetical protein [Chlorogloeopsis fritschii]
Length=682

 Score =   313 bits (801),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 227/734 (31%), Positives = 358/734 (49%), Gaps = 101/734 (14%)
 Frame = +1

Query  1762  KFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQ  1941
             + P++S+L   L +W     T  KT YT+L +         Y E++  A  IA +L    
Sbjct  9     RIPKVSTLVDLLEYWAIQQPT--KTAYTFLKDGETEELSLNYYELNRKAKAIAAQL----  62

Query  1942  KPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQR--------GGGQALL  2097
             +     G++VLL+Y  GL+F+ AF GCL A  I +P  PP   Q+           QA L
Sbjct  63    QGLKATGERVLLLYPSGLEFIAAFLGCLYAGAIAVPVYPPRRNQKMSRLQGIVADAQAKL  122

Query  2098  HIANIAKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPDLPWLHTDSWVkkp  2277
              +   + V N     S  S    ++ +S  N+    + D          W   D      
Sbjct  123   ALTTTSLVSNIENWFSQDSELAKLKCVSTDNIASHMTFD----------WQKPD------  166

Query  2278  klfkkpkDEQGQPLSED-LCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTI  2454
                          L++D L FLQ+TSGST  PKGVM+THG ++HN ++++   +   +TI
Sbjct  167   -------------LNQDTLAFLQYTSGSTGMPKGVMVTHGNLLHNEQMIQTACEHGEKTI  213

Query  2455  LVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFA  2634
              V WLP +HDMGLIG +L  L  G + IL SP  F++ P+ WL  +S++RAT S  PNFA
Sbjct  214   FVGWLPLFHDMGLIGNILQPLYIGRNCILMSPEAFIQKPVRWLLAISRYRATISGGPNFA  273

Query  2635  FELLVRRLESSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLA  2814
             +EL + ++   +  + DLSS     + AEPIR  TL++F       G  +    P YG+A
Sbjct  274   YELCIHQITPEERNSLDLSSWEIAFNGAEPIRAQTLEKFATTFAECGFRKSAFYPCYGMA  333

Query  2815  ENCVFVSCAYGEGLPVF------------------VDWQGRVCCG--YIKQPNTDGVDIK  2934
             E  +FVS       P+                   ++ Q  V CG  ++ +       I 
Sbjct  334   ETTLFVSGGIKTAPPIIESFDKAALEQNQAIAKAGLETQTLVGCGRAWLDE------KIA  387

Query  2935  IISPETGKENDDPGKEGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLG  3114
             I +PE+     + G+ GEIW+SS S   GYW   E +++TF   +  T    ++RTGDLG
Sbjct  388   IANPESLTSCAN-GQVGEIWVSSKSVAKGYWNQPEQTEQTFRGYLTDTNEGPFLRTGDLG  446

Query  3115  RIIDSKLFITGRTKDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIP----EDVLV  3282
              +++ +LF+TGR KDLII+ G+N Y  DIE TVE S   +R GC A   I     E ++V
Sbjct  447   FLLNGELFVTGRIKDLIIIRGRNYYPQDIELTVEQSHPALRLGCGAAFSIAIDGEEQLVV  506

Query  3283  SKGILTQRASDELGLVVIAEVRDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISK  3462
             ++ +  Q  S+  G  ++A +R                V+++H + +  +V +K  S+ K
Sbjct  507   AQEVKRQFFSNLNGDEIVAAIRQA--------------VSQQHQLRVYGVVLLKTGSLPK  552

Query  3463  TTSGKIKRYECAKRFISGTLDVIEEQMNGERSLPRNDGIIVPANGKISKTDIVNFLK---  3633
             T+SGKIKR  C   F++G L  +   ++  R  P +      +  K ++T  +++L    
Sbjct  553   TSSGKIKRQGCRACFVAGELLEVYRWLDNFREQPTSK----ESFSKTTETKELSWLAIDI  608

Query  3634  -----DLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATC  3798
                    L++Q GI  + I+  +    YG++SI  +  A  + ++ GI+I    +F +  
Sbjct  609   KIGIVSRLAKQLGISPAAINPRQPFSYYGLSSIQFINIATDLENWLGISIPPDRLFDSPS  668

Query  3799  IDDLADFVESLLEK  3840
             I+ LA  +  +L +
Sbjct  669   IEALAHEITQMLNR  682



>ref|WP_026724079.1| AMP-dependent synthetase [Fischerella sp. PCC 9431]
Length=607

 Score =   310 bits (795),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 206/593 (35%), Positives = 309/593 (52%), Gaps = 68/593 (11%)
 Frame = +1

Query  1828  NKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVD  2007
             N+  YT++          TYKE+   A  IA KL    +  +  G + LLIY  GL+F+ 
Sbjct  26    NQIAYTFIQPGKIEAKNLTYKELDQQARAIAAKL----QSIVAIGSRALLIYPSGLEFIA  81

Query  2008  AFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAK  2187
             AFFGCL A+V+ +P  PP   Q      +  +  I     P  +L+  S   T+ +   +
Sbjct  82    AFFGCLYAKVVAVPAYPPRRNQN-----MSRLQAIMADAQPTVVLTVGSLLRTIEVHFTQ  136

Query  2188  NMLFGKSKDKSSNSWPDLPWLHTDSWVkkpklfkkpkDEQGQPLSEDLCFLQFTSGSTTD  2367
             N               +L W+ TD+             E+ +  S  L FLQ+TSGST  
Sbjct  137   NPKL-----------TELYWIATDN----LDNDLAQTWERPELCSNSLAFLQYTSGSTAT  181

Query  2368  PKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGILFS  2547
             PKGVM++HG +++N  L+R  +  +S +  V WLP YHDMGLIGG+L  L  G    L S
Sbjct  182   PKGVMVSHGNLLYNSALIRNCFDHSSTSQGVIWLPPYHDMGLIGGVLQPLYCGFPVTLMS  241

Query  2548  PVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAAEPI  2727
             P+ F++ PL WLQ +S ++AT S  PNFA+EL +R++   + EN DLSS     + AE I
Sbjct  242   PLEFLRKPLNWLQAISDYKATTSGGPNFAYELCIRKITLEQRENLDLSSWEVAFNGAETI  301

Query  2728  RQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFVD------WQGRVC  2889
             R  TL++FV   + +G  +E   P YG+AE  + +S     G PV          Q +V 
Sbjct  302   RSETLEQFVTTFEPYGFRKETFYPCYGMAEATLLISGGLKAGSPVVYHINESALEQNQVV  361

Query  2890  CGYIKQPNTDGV------------DIKIISPETGKENDDPGKEGEIWISSLSAGIGYWGL  3033
              G    P  +GV             + I+ PE   +   P + GEIW+S L    GYW  
Sbjct  362   PGV---PGQEGVQKIVGCGQTWSNQVVIVDPELLTQC-KPNQVGEIWVSGLGVAQGYWNK  417

Query  3034  EELSQKTFENDILSTPGKR--YIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDIEK  3207
                +++ F   +    G R  ++RTGDLG + + +LF+TGR KD+II+ G+N Y  DIE 
Sbjct  418   TLETEQNFHAYL----GDRGPFLRTGDLGFLDNGELFVTGRIKDVIIIRGRNYYPQDIEL  473

Query  3208  TVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRD---GKPLPYDVM  3378
             TVE S   +RP   A   +  D+   KG  ++R      LV++ E+      K    +V+
Sbjct  474   TVEKSHLALRPNNGAAFSV--DI---KG--SER------LVIVHEIERSYLNKLNVNEVV  520

Query  3379  DHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVIEE  3537
              +IC  V E+H + + ++V +KP SI KT+SGKI+R+ C  +F++G+L+V+++
Sbjct  521   GNICQAVVEQHDLQVYAMVLVKPGSIPKTSSGKIQRHTCRTKFLTGSLNVVKD  573



>gb|ETL44186.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETP20653.1| hypothetical protein, variant 1 [Phytophthora parasitica CJ01A1]
Length=735

 Score =   314 bits (805),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 238/708 (34%), Positives = 369/708 (52%), Gaps = 84/708 (12%)
 Frame = +1

Query  1837  LYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKP-----AIKPGDKVLLIYVPGLDF  2001
             + ++ ++KG V    T  E++     +A  LL S +       +  GD+VLL+Y PGLDF
Sbjct  1     MLSFADDKGVVTASLTCAELNKRMQNLAGLLLASTQQHSKGLGLNQGDRVLLVYPPGLDF  60

Query  2002  VDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMS  2181
             +  F  CL+A V+ +P  PPD   R   + +    ++ + C     L T S +  V+ +S
Sbjct  61    IVVFLACLKAGVVAVPVYPPD--PRKMKKDISMFVSVTQNCQAKTAL-TCSMYYNVKKIS  117

Query  2182  AKNMLFGKSKDKSSNSWPD-LPWLHTDSWVkkpklfkkpkDEQGQPLSEDLCFLQFTSGS  2358
             A    F  S    +  WP+ L W+ TD  V    +          P ++   FLQ+TSGS
Sbjct  118   AIKEKFTFS---GAAQWPEHLNWVVTDDLVDTKGIDPAKHWLTQSPSADSTAFLQYTSGS  174

Query  2359  TTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGI  2538
             T+ PKGV+++HG + HN++ +    ++   T++VSWLPQYHDMGLIG  L  + +GG G+
Sbjct  175   TSAPKGVVLSHGNLNHNLRTISSALQAGRDTVVVSWLPQYHDMGLIGAYLGTIFNGGKGV  234

Query  2539  LFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLES-----SKEENFDLSSMHF  2703
               SP +F+++P LWL+ +SK RATH  APNFA+ LL R+ +      +  ++ DLSS+  
Sbjct  235   YLSPFSFIRDPCLWLRLVSKHRATHLQAPNFAYSLLARKSDRLTVGLASGQHVDLSSVRH  294

Query  2704  LMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFVDWQ--  2877
             +++ AEPI+   +  F      FGL   V+ P YGLAE+ V+V C  G+   ++VD Q  
Sbjct  295   MINGAEPIQGEAIDNFYRAFSPFGLPEGVVKPTYGLAEHTVYV-CGGGQQR-LWVDKQEL  352

Query  2878  --GRV--------CCGYIKQ------PNTD--GVDIKIISPETGKENDDPGKEGEIWISS  3003
                RV          G +K+      P+    G+D++I+  ET +E    G+ GEIWISS
Sbjct  353   ESNRVFRVVEKTNTAGLVKEMIGCGVPSRKDYGIDVRIVDAET-EEEKPEGETGEIWISS  411

Query  3004  LSAGIGYWG--LEELSQKTFENDIL-STPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVA  3174
              S   GY+G  + E S + F+  ++  T GK +++TGDLG I + +LFI GR KDL+I+ 
Sbjct  412   ASKARGYYGDEMREFSAEAFQAKVVGDTEGKTFLKTGDLGVIYNQELFICGRMKDLVIIR  471

Query  3175  GKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRD-  3351
             G+N Y  D+E + ES  EL RPGCCA              L    +D+  L V+AE+RD 
Sbjct  472   GRNHYPQDLEASAESHEEL-RPGCCAAF----------SYLADGNADDEQLAVVAELRDP  520

Query  3352  GKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTL---  3522
                    +   I + +A EHGV +  +V + PRSI KTTSGKI R  C K     TL   
Sbjct  521   AMTSKASLCGKIRSAIAREHGVKVTLVVLLAPRSIPKTTSGKISRSRCKKALEEKTLEEL  580

Query  3523  --------DVIEEQMNGE-----RSLPRN-DGIIVPANGKISKTDIVN------------  3624
                     DV  E   G+      ++ RN +G  V +    SK+++ +            
Sbjct  581   YRNEDMIADVPVEDDGGDDAVAGETMNRNVNGPRVASTDDGSKSNLPSVITGVPPDQVHA  640

Query  3625  FLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINI  3768
             FL + L++  G+  ++I+    L   G++S+ + +    I+  + +++
Sbjct  641   FLVEELARTLGVEPTQINDDTPLQELGLDSMALTQLQGVIAQKYQVHV  688



>ref|WP_014397899.1| AMP-dependent synthetase and ligase [Corallococcus coralloides]
 ref|YP_005371062.1| AMP-dependent synthetase and ligase [Corallococcus coralloides 
DSM 2259]
 gb|AFE08734.1| AMP-dependent synthetase and ligase [Corallococcus coralloides 
DSM 2259]
Length=571

 Score =   309 bits (792),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 201/588 (34%), Positives = 301/588 (51%), Gaps = 68/588 (12%)
 Frame = +1

Query  1840  YTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFG  2019
             + ++N  G    R T+ ++   A  +A +L    +  + PGD+ LL++ PGL+F+ AFFG
Sbjct  22    FIFVNSDGSEQSRLTFAQLDREARGVAAEL----RQRLVPGDRALLLFPPGLEFISAFFG  77

Query  2020  CLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAKNMLF  2199
             CL A VI +P  P         +A   +  + ++          S    V +MS      
Sbjct  78    CLYAGVIGVPAYPI--------RAERDVPRLREIVRSAGARVALSTQFLVEMMS------  123

Query  2200  GKSKDKSSNSWPDLPWLHTDSWVkkpklfkkpkDEQGQPLSEDLCFLQFTSGSTTDPKGV  2379
             G   D    S   + WL TD+            +       + L FLQ+TSGST  P+GV
Sbjct  124   GFVADVPEFS--AMQWLSTDAMELTRLADTWRAEAV---TGDHLAFLQYTSGSTGKPRGV  178

Query  2380  MITHGGVIHNVKLMRKRYKSTSR-TILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVT  2556
             M++H  ++HN +++++ ++     TI+  WLP YHDMGLIG +L  L  G   IL SP+ 
Sbjct  179   MVSHQNLLHNERMIQEYFQHDRESTIVAGWLPVYHDMGLIGNVLQPLFLGRPCILMSPLD  238

Query  2557  FMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAAEPIRQT  2736
             F++ P +WLQT+S+++ T S  PNFA+EL +RR+ + + +  DLS+     + AEPIR  
Sbjct  239   FLQRPAIWLQTISQYKVTTSGGPNFAYELCIRRINAEQRQQLDLSTWSLAFNGAEPIRGD  298

Query  2737  TLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFV----------------  2868
              L+RF E+    G   E   P YGLAE  + V+       PV                  
Sbjct  299   VLRRFAEVFGPQGFKLEAFYPCYGLAEATLIVTGGRKAAAPVSFSVARDALERRQLAPLP  358

Query  2869  --DWQGR--VCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGIGYWGLE  3036
               D + R  + CG I  P+     + I+ PET +    P + GE+W+   S   GYW   
Sbjct  359   PEDPRARELIGCGSIA-PDQ---QLLIVDPETSRPC-APEQVGEVWVRGPSVARGYWEQP  413

Query  3037  ELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDIEKTVE  3216
             E +QKTF   +  T  +R++RTGDLG +   +LFITGR KD+II+ G+N Y  DIE TVE
Sbjct  414   EATQKTFGGVLADTQEERFLRTGDLGFLRGGELFITGRLKDVIIIRGRNHYPEDIELTVE  473

Query  3217  SSSELVRPGCCAVVGIP---EDVLVSKGILTQRASDELG--LVVIAEVRDGKPLPYDVMD  3381
              SS+ VRPGC A   +    E+ LV    +++   D+ G    VIA++R+          
Sbjct  474   RSSKAVRPGCGAAFAVDVAGEEQLVLVQEISRAVIDQGGDLQAVIADIREA---------  524

Query  3382  HICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLD  3525
                  ++  HGV + S V I P  I KT+SGKI+R+ C  +F+ G+L+
Sbjct  525   -----ISANHGVRLHSAVLIPPGVIPKTSSGKIQRHACRTKFLEGSLE  567



>gb|ETL97360.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETO79646.1| hypothetical protein, variant 1 [Phytophthora parasitica P1976]
Length=735

 Score =   314 bits (804),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 219/598 (37%), Positives = 325/598 (54%), Gaps = 55/598 (9%)
 Frame = +1

Query  1837  LYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKP-----AIKPGDKVLLIYVPGLDF  2001
             + ++ ++KG V    T  E++     +A  LL S +       +  GD+VLL+Y PGLDF
Sbjct  1     MLSFADDKGVVTASLTCAELNKRMQNLAGLLLASTQQHSKGLGLNQGDRVLLVYPPGLDF  60

Query  2002  VDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMS  2181
             +  F  CL+A V+ +P  PPD   R   + +    ++ + C     L T S +  V+ +S
Sbjct  61    IVVFLACLKAGVVAVPVYPPD--PRKMKKDISMFVSVTQNCQAKTAL-TCSMYYNVKKIS  117

Query  2182  AKNMLFGKSKDKSSNSWPD-LPWLHTDSWVkkpklfkkpkDEQGQPLSEDLCFLQFTSGS  2358
             A    F  S    +  WP+ L W+ TD  V    +          P ++   FLQ+TSGS
Sbjct  118   AIKEKFTFS---GAAQWPEHLNWVVTDDLVDTKGIDPAKHWLTQSPSADSTAFLQYTSGS  174

Query  2359  TTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGI  2538
             T+ PKGV+++HG + HN++ +    ++   T++VSWLPQYHDMGLIG  L  + +GG G+
Sbjct  175   TSAPKGVVLSHGNLNHNLRTISSALQAGRDTVVVSWLPQYHDMGLIGAYLGTIFNGGKGV  234

Query  2539  LFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLES-----SKEENFDLSSMHF  2703
               SP +F+++P LWL+ +SK RATH  APNFA+ LL R+ +      +  ++ DLSS+  
Sbjct  235   YLSPFSFIRDPCLWLRLVSKHRATHLQAPNFAYSLLARKSDRLTVGLASGQHVDLSSVRH  294

Query  2704  LMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFVDWQ--  2877
             +++ AEPI+   +  F      FGL   V+ P YGLAE+ V+V C  G+   ++VD Q  
Sbjct  295   MINGAEPIQGEAIDNFYRAFSPFGLPEGVVKPTYGLAEHTVYV-CGGGQQR-LWVDKQEL  352

Query  2878  --GRV--------CCGYIKQ------PNTD--GVDIKIISPETGKENDDPGKEGEIWISS  3003
                RV          G +K+      P+    G+D++I+  ET +E    G+ GEIWISS
Sbjct  353   ESNRVFRVVEKTNTAGLVKEMIGCGVPSRKDYGIDVRIVDAET-EEEKPEGETGEIWISS  411

Query  3004  LSAGIGYWG--LEELSQKTFENDIL-STPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVA  3174
              S   GY+G  + E S + F+  ++  T GK +++TGDLG I + +LFI GR KDL+I+ 
Sbjct  412   ASKARGYYGDEMREFSAEAFQAKVVGDTEGKTFLKTGDLGVIYNQELFICGRMKDLVIIR  471

Query  3175  GKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRD-  3351
             G+N Y  D+E + ES  EL RPGCCA              L    +D+  L V+AE+RD 
Sbjct  472   GRNHYPQDLEASAESHEEL-RPGCCAAF----------SYLADGNADDEQLAVVAELRDP  520

Query  3352  GKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLD  3525
                    +   I + +A EHGV +  +V + PRSI KTTSGKI R  C K     TL+
Sbjct  521   AMTSKASLCGKIRSAIAREHGVKVTLVVLLSPRSIPKTTSGKISRSRCKKALEEKTLE  578



>gb|ETK90787.1| hypothetical protein, variant 1 [Phytophthora parasitica]
Length=735

 Score =   313 bits (803),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 224/630 (36%), Positives = 337/630 (53%), Gaps = 56/630 (9%)
 Frame = +1

Query  1837  LYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKP-----AIKPGDKVLLIYVPGLDF  2001
             + ++ ++KG V    T  E++     +A  LL S +       +  GD+VLL+Y PGLDF
Sbjct  1     MLSFADDKGVVTASLTCAELNKRMQNLAGLLLASTQQHSKGLGLNQGDRVLLVYPPGLDF  60

Query  2002  VDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMS  2181
             +  F  CL+A V+ +P  PPD   R   + +    ++ + C     L T S +  V+ +S
Sbjct  61    IVVFLACLKAGVVAVPVYPPD--PRKMKKDISMFVSVTQNCQAKTAL-TCSMYYNVKKIS  117

Query  2182  AKNMLFGKSKDKSSNSWPD-LPWLHTDSWVkkpklfkkpkDEQGQPLSEDLCFLQFTSGS  2358
             A    F  S    +  WP+ L W+ TD  V    +          P ++   FLQ+TSGS
Sbjct  118   AIKEKFTFS---GAAQWPEHLNWVVTDDLVDTKGIDPAKHWLTQSPSADSTAFLQYTSGS  174

Query  2359  TTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGI  2538
             T+ PKGV+++HG + HN++ +    ++   T++VSWLPQYHDMGLIG  L  + +GG G+
Sbjct  175   TSAPKGVVLSHGNLNHNLRTISSALQAGRDTVVVSWLPQYHDMGLIGAYLGTIFNGGKGV  234

Query  2539  LFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLES-----SKEENFDLSSMHF  2703
               SP +F+++P LWL+ +SK RATH  APNFA+ LL R+ +      +  ++ DLSS+  
Sbjct  235   YLSPFSFIRDPCLWLRLVSKHRATHLQAPNFAYSLLARKSDRLTVGLASGQHVDLSSVRH  294

Query  2704  LMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFVDWQ--  2877
             +++ AEPI+   +  F      FGL   V+ P YGLAE+ V+V C  G+   ++VD Q  
Sbjct  295   MINGAEPIQGEAIDNFYRAFSPFGLPEGVVKPTYGLAEHTVYV-CGGGQQR-LWVDKQEL  352

Query  2878  --GRV--------CCGYIKQ------PNTD--GVDIKIISPETGKENDDPGKEGEIWISS  3003
                RV          G +K+      P+    G+D++I+  ET +E    G+ GEIWISS
Sbjct  353   ESNRVFRVVEKTNTAGLVKEMIGCGVPSRKDYGIDVRIVDAET-EEEKPEGETGEIWISS  411

Query  3004  LSAGIGYWG--LEELSQKTFENDIL-STPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVA  3174
              S   GY+G  + E S + F+  ++  T GK +++TGDLG I + +LFI GR KDL+I+ 
Sbjct  412   ASKARGYYGDEMREFSAEAFQAKVVGDTEGKTFLKTGDLGVIYNQELFICGRMKDLVIIR  471

Query  3175  GKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRD-  3351
             G+N Y  D+E + ES  EL RPGCCA              L    +D+  L V+AE+RD 
Sbjct  472   GRNHYPQDLEASAESHEEL-RPGCCAAF----------SYLADGNADDEQLAVVAELRDP  520

Query  3352  GKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVI  3531
                    +   I + +A EHGV +  +V + PRSI KTTSGKI R  C K     TL+ +
Sbjct  521   AMTSKASLCGKIRSAIAREHGVKVTLVVLLAPRSIPKTTSGKISRSRCKKALEEKTLEEL  580

Query  3532  EEQMNGERSLP-RNDGIIVPANGKISKTDI  3618
                 +    +P  +DG  V   G+    ++
Sbjct  581   YRNEDMIADVPVEDDGGDVAVAGETMNRNV  610



>ref|XP_008903136.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310]
 gb|ETI50884.1| hypothetical protein, variant 1 [Phytophthora parasitica P1569]
 gb|ETN11322.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310]
Length=735

 Score =   313 bits (803),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 224/630 (36%), Positives = 337/630 (53%), Gaps = 56/630 (9%)
 Frame = +1

Query  1837  LYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKP-----AIKPGDKVLLIYVPGLDF  2001
             + ++ ++KG V    T  E++     +A  LL S +       +  GD+VLL+Y PGLDF
Sbjct  1     MLSFADDKGVVTASLTCAELNKRMQNLAGLLLASTQQHSKGLGLNQGDRVLLVYPPGLDF  60

Query  2002  VDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMS  2181
             +  F  CL+A V+ +P  PPD   R   + +    ++ + C     L T S +  V+ +S
Sbjct  61    IVVFLACLKAGVVAVPVYPPD--PRKMKKDISMFVSVTQNCQAKTAL-TCSMYYNVKKIS  117

Query  2182  AKNMLFGKSKDKSSNSWPD-LPWLHTDSWVkkpklfkkpkDEQGQPLSEDLCFLQFTSGS  2358
             A    F  S    +  WP+ L W+ TD  V    +          P ++   FLQ+TSGS
Sbjct  118   AIKEKFTFS---GAAQWPEHLNWVVTDDLVDTKGIDPAKHWLTQSPSADSTAFLQYTSGS  174

Query  2359  TTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGI  2538
             T+ PKGV+++HG + HN++ +    ++   T++VSWLPQYHDMGLIG  L  + +GG G+
Sbjct  175   TSAPKGVVLSHGNLNHNLRTISSALQAGRDTVVVSWLPQYHDMGLIGAYLGTIFNGGKGV  234

Query  2539  LFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLES-----SKEENFDLSSMHF  2703
               SP +F+++P LWL+ +SK RATH  APNFA+ LL R+ +      +  ++ DLSS+  
Sbjct  235   YLSPFSFIRDPCLWLRLVSKHRATHLQAPNFAYSLLARKSDRLTVGLASGQHVDLSSVRH  294

Query  2704  LMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFVDWQ--  2877
             +++ AEPI+   +  F      FGL   V+ P YGLAE+ V+V C  G+   ++VD Q  
Sbjct  295   MINGAEPIQGEAIDNFYRAFSPFGLPEGVVKPTYGLAEHTVYV-CGGGQQR-LWVDKQEL  352

Query  2878  --GRV--------CCGYIKQ------PNTD--GVDIKIISPETGKENDDPGKEGEIWISS  3003
                RV          G +K+      P+    G+D++I+  ET +E    G+ GEIWISS
Sbjct  353   ESNRVFRVVEKTNTAGLVKEMIGCGVPSRKDYGIDVRIVDAET-EEEKPEGETGEIWISS  411

Query  3004  LSAGIGYWG--LEELSQKTFENDIL-STPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVA  3174
              S   GY+G  + E S + F+  ++  T GK +++TGDLG I + +LFI GR KDL+I+ 
Sbjct  412   ASKARGYYGDEMREFSAEAFQAKVVGDTEGKTFLKTGDLGVIYNQELFICGRMKDLVIIR  471

Query  3175  GKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRD-  3351
             G+N Y  D+E + ES  EL RPGCCA              L    +D+  L V+AE+RD 
Sbjct  472   GRNHYPQDLEASAESHEEL-RPGCCAAF----------SYLADGNADDEQLAVVAELRDP  520

Query  3352  GKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVI  3531
                    +   I + +A EHGV +  +V + PRSI KTTSGKI R  C K     TL+ +
Sbjct  521   AMTSKASLCGKIRSAIAREHGVKVTLVVLLSPRSIPKTTSGKISRSRCKKALEEKTLEEL  580

Query  3532  EEQMNGERSLP-RNDGIIVPANGKISKTDI  3618
                 +    +P  +DG  V   G+    ++
Sbjct  581   YRNEDMIADVPVEDDGGDVAVAGETMNRNV  610



>emb|CDM77165.1| polyketide synthase and peptide synthetase [Mycobacterium marinum 
E11]
Length=2802

 Score =   328 bits (841),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 229/701 (33%), Positives = 350/701 (50%), Gaps = 68/701 (10%)
 Frame = +1

Query  1828  NKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVD  2007
             +    +++N++G V +  +  +V T    +AQ     Q   + PGD+ +L+Y PGLDFV 
Sbjct  17    DAAALSFVNDRGLVTESMSRADVVTEMNKVAQ--FVRQDRGLAPGDRAVLVYPPGLDFVC  74

Query  2008  AFFGCLRARVipiptippdptQ-RGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSA  2184
                GC+ A VI +P  PPDP   +  G+A      +A  C   A+L++  Y    ++   
Sbjct  75    GLLGCMAAGVIAVPVFPPDPINPQKSGEAFR---RVALDCGATAVLTSHHYADARQLDVP  131

Query  2185  KNMLFGKSKDKSSNSWPD-LPWLHTDSWVkkpklfkkpkDEQGQ----PLSEDLCFLQFT  2349
              ++  G + D+    W + LPW  T                +      P  +    LQ+T
Sbjct  132   ASV--GTAFDED---WRNALPWHVTSRGASGRGTGAPRAVSEAASEWAPSPQTPALLQYT  186

Query  2350  SGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGG  2529
             SGST+DPKGV+ITHG V+H  +  R+          V W+P YHD GLI G+L+ L    
Sbjct  187   SGSTSDPKGVVITHGNVVHQAEFNRRFIGLGPGHRAVFWVPPYHDFGLISGILSALAGNF  246

Query  2530  SGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLM  2709
                + SP++F++ P LW + M + RAT + APNF FEL +R+  + +   +DLS +  ++
Sbjct  247   DLTMMSPMSFIQRPALWFEVMDRVRATVTVAPNFGFELAMRKTTAEQRAGWDLSPLQVIV  306

Query  2710  SAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPV---------  2862
             SAAEP+R+ T +RF E   + G+ RE   P YGLAE+ V ++ +    L V         
Sbjct  307   SAAEPVREDTTRRFFEAFAASGIRREAFCPCYGLAEHTVGITVSGRSSLRVDRSQLETRQ  366

Query  2863  ------FVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGIGY  3024
                     D Q  + CG   QP TD VD++I+ PE      + G+ GEIW  S S   GY
Sbjct  367   LAVPSDAPDAQVLMGCG---QP-TDDVDVRIVDPELCVPLGE-GQVGEIWADSPSKAAGY  421

Query  3025  WGLEELSQKTFENDILSTPGKR-YIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDI  3201
             WGL   S+ TF+  +    G R Y+RTGDLG + D +L++ GR KDL+I+AG+NIY  DI
Sbjct  422   WGLSAKSRATFQAALAGVEGGRGYLRTGDLGFLHDGELYVCGRIKDLLILAGRNIYPQDI  481

Query  3202  EKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVR-DGKP-LPYDV  3375
             E ++      +RPG  A   + +              +   L V+AEVR DG P L   V
Sbjct  482   EDSLRDCHPAIRPGGFAAFAVAD-------------GNSETLAVLAEVRTDGSPDLLAGV  528

Query  3376  MDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLD----VIEEQM  3543
             +  I   V ++H +    +V   P S+SKTTSGK++R  C  RF+ GTL     +++ + 
Sbjct  529   VAAIRAAVLKDHQLRCGVVVLGPPGSVSKTTSGKVQRSRCRARFLDGTLQAQALLVDRRT  588

Query  3544  NGERSLPRNDGIIVPANGKISKTDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGV  3723
             + E           P     +   +++ +    ++  GI    +    +L   G+NSIGV
Sbjct  589   DDE-----------PVGAAPTTEQLLSVVCGQAAEVLGIGAVSVDIDRSLGDQGLNSIGV  637

Query  3724  VRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEKNH  3846
                A ++S   G ++  +DIF+   + DL   + SL EK  
Sbjct  638   TELASRLSQVLGQDVQPVDIFNHPTVGDLVQIL-SLGEKTR  677



>gb|EYU70387.1| AMP-dependent synthetase [Streptomyces sp. PCS3-D2]
Length=588

 Score =   309 bits (791),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 201/597 (34%), Positives = 303/597 (51%), Gaps = 80/597 (13%)
 Frame = +1

Query  1828  NKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVD  2007
             +  L+T+L +  +     T+  + T A  +A  L  ++   ++PG + LL++ PG DFV 
Sbjct  28    DHPLFTFLPDGEEAEPPLTFAALDTRARAVAASLHAAR---VEPGSRALLLFEPGQDFVV  84

Query  2008  AFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAK  2187
             AFFGCL A V+ +P   P P QR  G  LL +A IA+   P A+L+T      V      
Sbjct  85    AFFGCLYAGVVAVPAYLPHPAQRARG--LLRLAGIAEDAQPAAVLTTAGIRAAV------  136

Query  2188  NMLFGKSKDKSSNSWPDL---PWLHTDSWVkkpklfkkpkDEQGQPLSEDLCFLQFTSGS  2358
                     + ++ + P++    WL  D+                 P  + + FLQ+TSGS
Sbjct  137   --------EPAARTIPEVQETAWLAVDTIADATGTGWSAP----SPEPKSVAFLQYTSGS  184

Query  2359  TTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGI  2538
             T  PKGVM+THG + HN  L+R        T++V WLP YHDMGLI  ++   + G   +
Sbjct  185   TGRPKGVMVTHGNLTHNTDLIRTSLGMDGSTVVVGWLPPYHDMGLISMIIVPAMLGIHSV  244

Query  2539  LFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAA  2718
                 V F+++P+ WL+ +S +R T SAAPNFAF+L  R++ +      DLSS     + A
Sbjct  245   SMPTVAFLQSPVRWLRAISTYRGTLSAAPNFAFDLCTRKVTAEDRARLDLSSWSVATNGA  304

Query  2719  EPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCA-----------------YG  2847
             EP+R  ++KRF E   S G   E + P YGLAE+ + VS A                  G
Sbjct  305   EPVRADSMKRFSEAFASTGFRPETIVPVYGLAESTLLVSGAPLERPWVFRAFDEDALERG  364

Query  2848  EGLPVFVDWQGR---VCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGI  3018
               + V  D  G    V CG  +      +D+ ++ P T +    PG+ GEIW++  S  +
Sbjct  365   TAVNVPDDSPGARVLVSCGVSRT-----LDVAVVDPRT-RTRCGPGRVGEIWVAGDSIAV  418

Query  3019  GYWGLEELSQKTFENDILSTPGK-----RYIRTGDLGRIIDSKLFITGRTKDLIIVAGKN  3183
             GYW   +L+++ FE    +TP        Y+RTGDLG      LF+ GR KD+IIV G+N
Sbjct  419   GYWQRPDLTREAFE----ATPADGEDEGPYLRTGDLGFRTQDGLFVCGRIKDVIIVGGRN  474

Query  3184  IYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGKPL  3363
              Y  DIE+T ES+   +RPGC A  G+  D            +++  +VV AE+R G   
Sbjct  475   HYPHDIERTAESAHPSIRPGCVAAFGVDAD-----------GAEQ--VVVAAELRRGAGE  521

Query  3364  PYD------VMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISG  3516
               D      V+D +   VA+EH + +  +V +   ++ KT+SGK++R E  K +++G
Sbjct  522   APDREDRQAVVDAVLRAVAQEHRLTVREVVLLPAGTLPKTSSGKLQRRETRKEYLAG  578



>ref|WP_034240913.1| hypothetical protein [Aquimarina sp. 22II-S11-z7]
 gb|EZH74456.1| hypothetical protein ATO12_11855 [Aquimarina sp. 22II-S11-z7]
Length=7139

 Score =   328 bits (842),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 237/745 (32%), Positives = 383/745 (51%), Gaps = 85/745 (11%)
 Frame = +1

Query  1825  ENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFV  2004
             ENK +Y +L    +  D RT+ ++H+NA TIA ++LT     + PG++VLL+Y  GL+F 
Sbjct  30    ENKVVYRFLENGEEETDVRTFGQLHSNAMTIASRILT----LVSPGERVLLLYPSGLNFT  85

Query  2005  DAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSA  2184
             DAFFGCL A VI +P  PP   +R G      + NIA  C+   IL+    H   +    
Sbjct  86    DAFFGCLMAGVIAVPAFPPTGKRRIG-----RLENIATDCDIKLILTEEKVHAKCKSWFE  140

Query  2185  KNMLFGKSKDKSSNSWPDLPWLHTDS-WVkkpklfkkpkDEQGQPLSEDLCFLQFTSGST  2361
               +            + ++ W  TD   V    +     D      SED+ FLQ+TSGST
Sbjct  141   HEI------------FSEVLWSVTDEPHVAHKPVELPSVD------SEDVAFLQYTSGST  182

Query  2362  TDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGIL  2541
              +PKGVM++H  ++HN +L+R+        I VSWLP YHDMGLIG +L  +  G   I+
Sbjct  183   GNPKGVMVSHKNIMHNTELIRQCLNLKKDFIGVSWLPIYHDMGLIGNILEAVAMGIEMII  242

Query  2542  FSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAAE  2721
               P  F++ P+ W Q +SK++A +S  PNFAF+L + +++    ++ DLSS+  + + AE
Sbjct  243   LPPQAFIQKPIRWFQVISKYKANYSGGPNFAFDLCINQIKDDDLDSIDLSSLSTMYNGAE  302

Query  2722  PIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFVDW---------  2874
             PIR  T+K F+   +  G+++E + P YG+AE  + V+ +  +    F++          
Sbjct  303   PIRAQTIKDFLVAFEKTGITKEAICPCYGMAETTLAVTFSRLDKETSFLELDINEFEKGK  362

Query  2875  ------------QGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGI  3018
                         + +V  G    P    + I I++P T K N    + GEIW+   S  I
Sbjct  363   ISSGSQQKSSSNEVKVLVG--NGPILQDMRIAIVNPNT-KRNCSEEEIGEIWVKGPSVAI  419

Query  3019  GYWGLEELSQKTFENDILSTPGK------RYIRTGDLGRIIDSKLFITGRTKDLIIVAGK  3180
             GYWG  +LS++ F+ +IL   G+      +Y+RTGD+G + +++L+++GR K+++I+ G 
Sbjct  420   GYWGKPDLSEEIFQAEILDEKGQPLEENCQYLRTGDMGFMNNNELYVSGRLKEMMIINGV  479

Query  3181  NIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGKP  3360
             N Y  DIEKTV+ S   ++    A   I                 E  LV+  E++    
Sbjct  480   NHYPQDIEKTVQESHTDLQVNAGAAFSIA-------------IGSENKLVIAQEIKRTSL  526

Query  3361  LPYD---VMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVI  3531
               YD   +   I   + E H + + +IV + P  +SKTTSGKI+R    K + S  L+ +
Sbjct  527   RSYDFDSIRKTITKSILETHDLSVFAIVLLTPGGVSKTTSGKIQRLVIKKAYESNALEKV  586

Query  3532  EEQ--MNGERSLPRND--GIIVPANGKISKT---DIVNFLKDLLSQQTGIPVSKISTGET  3690
             +E   ++G +   + D    IV  N +  KT    I+N +  +L ++T  P+ +I    +
Sbjct  587   KETWIVSGSKRGIKKDKSNSIVSENLEDKKTLDPKIINRIMMILGEETEFPLYQIQPNTS  646

Query  3691  LVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEKNHPMLTNSSE  3870
                 G++SI  +R A KIS +F I++ +  +     I++ ADF+ + LE N      + +
Sbjct  647   FFELGISSIQSIRIAGKISEYFEIDVPSSLLLEYPSIEECADFLSTELE-NAKNKNQAKD  705

Query  3871  T--KISSSGIPSVVSTFDKITIWLI  3939
             T  KI    I  +  T+ + ++WLI
Sbjct  706   TIVKIKDELI-KIPLTYAQESLWLI  729



>ref|WP_037915584.1| hypothetical protein [Streptomyces sp. PCS3-D2]
Length=584

 Score =   308 bits (790),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 201/597 (34%), Positives = 303/597 (51%), Gaps = 80/597 (13%)
 Frame = +1

Query  1828  NKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVD  2007
             +  L+T+L +  +     T+  + T A  +A  L  ++   ++PG + LL++ PG DFV 
Sbjct  24    DHPLFTFLPDGEEAEPPLTFAALDTRARAVAASLHAAR---VEPGSRALLLFEPGQDFVV  80

Query  2008  AFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAK  2187
             AFFGCL A V+ +P   P P QR  G  LL +A IA+   P A+L+T      V      
Sbjct  81    AFFGCLYAGVVAVPAYLPHPAQRARG--LLRLAGIAEDAQPAAVLTTAGIRAAV------  132

Query  2188  NMLFGKSKDKSSNSWPDL---PWLHTDSWVkkpklfkkpkDEQGQPLSEDLCFLQFTSGS  2358
                     + ++ + P++    WL  D+                 P  + + FLQ+TSGS
Sbjct  133   --------EPAARTIPEVQETAWLAVDTIADATGTGWSAP----SPEPKSVAFLQYTSGS  180

Query  2359  TTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGI  2538
             T  PKGVM+THG + HN  L+R        T++V WLP YHDMGLI  ++   + G   +
Sbjct  181   TGRPKGVMVTHGNLTHNTDLIRTSLGMDGSTVVVGWLPPYHDMGLISMIIVPAMLGIHSV  240

Query  2539  LFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAA  2718
                 V F+++P+ WL+ +S +R T SAAPNFAF+L  R++ +      DLSS     + A
Sbjct  241   SMPTVAFLQSPVRWLRAISTYRGTLSAAPNFAFDLCTRKVTAEDRARLDLSSWSVATNGA  300

Query  2719  EPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCA-----------------YG  2847
             EP+R  ++KRF E   S G   E + P YGLAE+ + VS A                  G
Sbjct  301   EPVRADSMKRFSEAFASTGFRPETIVPVYGLAESTLLVSGAPLERPWVFRAFDEDALERG  360

Query  2848  EGLPVFVDWQGR---VCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGI  3018
               + V  D  G    V CG  +      +D+ ++ P T +    PG+ GEIW++  S  +
Sbjct  361   TAVNVPDDSPGARVLVSCGVSRT-----LDVAVVDPRT-RTRCGPGRVGEIWVAGDSIAV  414

Query  3019  GYWGLEELSQKTFENDILSTPGK-----RYIRTGDLGRIIDSKLFITGRTKDLIIVAGKN  3183
             GYW   +L+++ FE    +TP        Y+RTGDLG      LF+ GR KD+IIV G+N
Sbjct  415   GYWQRPDLTREAFE----ATPADGEDEGPYLRTGDLGFRTQDGLFVCGRIKDVIIVGGRN  470

Query  3184  IYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGKPL  3363
              Y  DIE+T ES+   +RPGC A  G+  D            +++  +VV AE+R G   
Sbjct  471   HYPHDIERTAESAHPSIRPGCVAAFGVDAD-----------GAEQ--VVVAAELRRGAGE  517

Query  3364  PYD------VMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISG  3516
               D      V+D +   VA+EH + +  +V +   ++ KT+SGK++R E  K +++G
Sbjct  518   APDREDRQAVVDAVLRAVAQEHRLTVREVVLLPAGTLPKTSSGKLQRRETRKEYLAG  574



>ref|WP_016866913.1| hypothetical protein [Fischerella muscicola]
Length=1861

 Score =   327 bits (837),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 238/740 (32%), Positives = 356/740 (48%), Gaps = 86/740 (12%)
 Frame = +1

Query  1828  NKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVD  2007
             ++T +T+L +        TY E+   +  IA +L   Q   +K G++ LL+Y PGLD++ 
Sbjct  30    HQTAFTFLEDGETQESSLTYHELDRRSRAIASQL---QALNLK-GERALLLYPPGLDYLS  85

Query  2008  AFFGCLRARVipiptippdptQRGGG-QALLHIANIAKVCNPVAILSTFSYHVTVRIMSA  2184
             AFFGCL A V+ +P  PP   ++    QA+   A  +      AIL T        I++ 
Sbjct  86    AFFGCLYAGVVAVPAYPPQNKRKAPRIQAISTDAQASIALTTTAILPTLQ-----SILAQ  140

Query  2185  KNMLFGKSKDKSSNSWPDLPWLHTDSWVkkpklfkkpkDEQGQPLSEDLCFLQFTSGSTT  2364
             +  L       + N   DL     DSW            +Q    ++ + FLQ+TSGST 
Sbjct  141   QTNLENIRWLVTDNLAQDL----EDSW------------QQPDINADTIAFLQYTSGSTG  184

Query  2365  DPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGILF  2544
              PKGVM++HG ++HN     +    +  +  VSWLP YHDMGLIGG+L  L  G S IL 
Sbjct  185   IPKGVMLSHGNLLHNAAATYQFMGHSPNSKFVSWLPVYHDMGLIGGILQPLYGGFSCILM  244

Query  2545  SPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAAEP  2724
             SP +F++ PL WLQ +S+++ T S APNFA+E  + ++   +    DLSS     + AEP
Sbjct  245   SPASFLQRPLRWLQAISRYKGTTSGAPNFAYEYCIHKITPEQRSCLDLSSWSVAFNGAEP  304

Query  2725  IRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVF-------------  2865
             +RQ TL+RF       G  RE   P YG+AE  + VS      LP+              
Sbjct  305   VRQDTLERFALTFAECGFRREAFYPCYGMAEATLMVSGGSKTALPIVKKVQKCALANNQV  364

Query  2866  ---------VDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGI  3018
                       D Q  V CG           I I +PET      P + GEIW+S LS G 
Sbjct  365   IEVSADTQDKDIQTFVSCGQ----TIPQQQIVIANPETLTRF-SPNQVGEIWVSGLSVGQ  419

Query  3019  GYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSD  3198
             GYW  +E +++TF   +  T    ++RTGDLG + + +LFITGR KDLII+ G+N+Y  D
Sbjct  420   GYWHRQEETEQTFRAYLKDTGEGPFLRTGDLGFLDNGELFITGRAKDLIIIRGRNLYPQD  479

Query  3199  IEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVR-DGKPLPYDV  3375
             IE T E S   +R    A   +  D             DE  LVV+ E+    KP   +V
Sbjct  480   IELTAERSHPSLRSSSTAAFSVEVD-------------DEEQLVVVQELEFRAKPDIDEV  526

Query  3376  MDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVIEEQMN---  3546
                I   V EEH V + ++V IKP +I KT+SGKI+R      F++G LDV+   ++   
Sbjct  527   TTAIRQAVTEEHEVQVHAVVLIKPGTIPKTSSGKIQRRATKAAFLAGELDVVGSSISENT  586

Query  3547  ----GERSLPRNDGIIVPANGKISKTDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNS  3714
                  E  L R    ++    + S+  + ++L++ +++  G  + +I   + L S G++S
Sbjct  587   AYLGKENRLQRQ--TLLALTPEESQPLLESYLREQVARALGAALKEIHPQQPLSSLGLDS  644

Query  3715  IGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEKNHPMLTNSSETKISSSGI  3894
             + V     +I +   + +   D F       L+  + + L       T +S   IS + +
Sbjct  645   LRVFELKNQIETDLEVTVSVADFFEGLSTRSLSTKILTQLA------TTTSIPSISVTQV  698

Query  3895  PSVVS----TFDKITIWLIH  3942
                 S    +F +  +W IH
Sbjct  699   QKTTSVHPLSFSQQGLWFIH  718



>ref|XP_002185164.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC43296.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=738

 Score =   313 bits (802),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 211/597 (35%), Positives = 327/597 (55%), Gaps = 69/597 (12%)
 Frame = +1

Query  1861  GDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVi  2040
             G +    TY+E+ T    +A+ L+      I+ G+ V+L+Y P LDF+ AF  CL+A V+
Sbjct  39    GSLQKELTYQELETETTKVAKHLIGK---GIEKGECVVLVYPPSLDFMIAFLACLKANVV  95

Query  2041  piptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKDKS  2220
              +P  PP+P +R     L   ANI + C     L+   Y+   ++   ++ +F K + + 
Sbjct  96    AVPVFPPNPLRR---DTLAMFANIVQGCGAKHALTNTEYNHAKKMAGIRD-VFTKFQ-RP  150

Query  2221  SNSWPDLPWLHTDSWVkkpklfkkpkDEQGQPLSE--DLCFLQFTSGSTTDPKGVMITHG  2394
             ++ WPD     T   +K+P+          QP S+   + FLQ+TSGST++PKGVMITHG
Sbjct  151   TSGWPDDLDWTTTDTLKEPRNSVNLP----QPPSDRSQVAFLQYTSGSTSEPKGVMITHG  206

Query  2395  GVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPL  2574
              + HN+ ++    ++   T++VSWLPQYHDMGLIG  L +L  GG+G   SP++F++ P+
Sbjct  207   NLAHNLTIITNDSQAKDDTVVVSWLPQYHDMGLIGSYLGVLFCGGTGYYLSPLSFLQRPM  266

Query  2575  LWLQTMSKWRATHSAAPNFAFELLVRR--LESSKEENFDLSSMHFLMSAAEPIRQTTLKR  2748
             +W++ +S++RATH  APNFAF+L  R+  +++S  E  DLSS+  +++AAEP+ + ++  
Sbjct  267   VWIEAVSRYRATHLQAPNFAFKLTARKFSIDASNTE-LDLSSVRHVINAAEPVDEESIDN  325

Query  2749  FVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFV---------------DWQGR  2883
             F  +   +G +  V+ P YGLAE+ VFV     + L V                 D Q  
Sbjct  326   FYRIFGKYGFA-NVIYPTYGLAEHTVFVCSGGKQRLTVDKAKLEIDAKVVILEDDDHQST  384

Query  2884  --------VCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGIGYWGLEE  3039
                     + CG+   P+   VD++I+ PE+ K        GEIWI S S   GY+   +
Sbjct  385   DIKAVSKLIGCGF---PSRQNVDVQIVDPESCKALAG-NLVGEIWIRSPSKAAGYFNKPK  440

Query  3040  LSQKTFENDILSTPGKR-------YIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSD  3198
              +++ F   ++S  G         Y+RTGDLG +   +LFI GR KDLIIV G+N Y  D
Sbjct  441   ETKEDFHAGLVSDDGSSIGNAVGGYLRTGDLGFLHKHELFICGRLKDLIIVGGRNYYPQD  500

Query  3199  IEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGKPLPY---  3369
             IE T E+SS+LVR GC A   I           T    +E+ LV+  E+++   L     
Sbjct  501   IEATAEASSDLVRLGCSAAFTIDP---------THEGGEEVALVM--ELKEAPSLKATQT  549

Query  3370  ---DVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVI  3531
                 + + I + + +EH + +  IV + PR++ KT+SGKI R  C K FI+G+L +I
Sbjct  550   VCESLANQIKSAINQEHSLGLTDIVFLHPRTVPKTSSGKIARSWCRKGFIAGSLKII  606



>ref|WP_003919359.1| fatty acyl-AMP ligase [Mycobacterium xenopi]
 gb|EID16609.1| AMP-binding protein [Mycobacterium xenopi RIVM700367]
Length=1082

 Score =   320 bits (820),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 225/616 (37%), Positives = 313/616 (51%), Gaps = 81/616 (13%)
 Frame = +1

Query  1774  LSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAI  1953
             + +L  YLR W       ++ L+ +++ +G  L+  TY+        +A  L    + A+
Sbjct  1     METLIDYLRAWE--AQRPDQILFRFVDVEGRELEHYTYQSFAERTRELAAYLFA--EAAL  56

Query  1954  KPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPV  2133
             +PGD+ LL+Y PGL+ V AFF C R  VI +P  PP P     G A L    IA+ C   
Sbjct  57    RPGDRALLVYPPGLEMVAAFFACARLGVIAVPVSPPLPVAFEAGLAKLSF--IARDCQAK  114

Query  2134  AILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPD------LPWLHTDSWVkkpklfkkp  2295
             A+LST       R      +L G  +   +  WPD      LPW  TD            
Sbjct  115   AVLSTKQLEYDYR------LLLGHRQ--GALPWPDVERPLELPWFATDG----------T  156

Query  2296  kDEQGQPLSED---LCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSW  2466
             +D  G P+++    + FLQ+TSGST+DPKGV+++H  VI N          T   + VSW
Sbjct  157   QDFGGAPVADTPGRVLFLQYTSGSTSDPKGVIVSHANVIANASAF------TGDEVCVSW  210

Query  2467  LPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELL  2646
             LPQ+HDMGLI   L +L+ GG+    SPV F++ P  WL+ +S  RATH+ APNFA E  
Sbjct  211   LPQHHDMGLISAYLFVLLKGGTTHALSPVDFLQRPSAWLRLISDARATHTPAPNFALEYC  270

Query  2647  VR--RLESSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAEN  2820
             +R  +L +S+    DLSS+  ++  AEP+R  T  RF +    +GL  + +   YGLAEN
Sbjct  271   LREDKLPASELAGIDLSSLDSMVIGAEPLRANTFARFRQRFAPYGLRPDALTGAYGLAEN  330

Query  2821  CVFVS------------------CAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISP  2946
              + VS                      + LP   +    V CG   +P  DG  ++I+ P
Sbjct  331   TLIVSLRGRQTVTLNKRALEKNLARVEKALPENHNQAPVVSCG---KP-LDGNVVRIVDP  386

Query  2947  ETGKENDDPGKEGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIID  3126
              T +++   G+ GE+W+   S G GYW   E + +TFE  I       Y+RTGDLG + +
Sbjct  387   HT-RQDLGEGRIGEVWVDGASKGGGYWRCPEKTAETFEARIAGDEEHTYLRTGDLGFLYE  445

Query  3127  SKLFITGRTKDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQR  3306
              +LF+ GRTKDLIIV G N Y SDIE  VE S+  VR GC A   +            + 
Sbjct  446   GELFVCGRTKDLIIVRGVNCYPSDIEAVVERSASQVRGGCVAAFSV------------EN  493

Query  3307  ASDELGLVVIAEVRDGKPLPYDVMDHICTRVAEEH-GVPIASIVAIKPRSISKTTSGKIK  3483
             A  E  LVV+AEVRD   LP D       R    H  V   +IV + PRSI KTTSGKI+
Sbjct  494   AGQE-ALVVVAEVRDEHALP-DA--KALARAIRRHCHVDPHTIVFVPPRSIPKTTSGKIR  549

Query  3484  RYECAKRFISGTLDVI  3531
             R +  + ++  TL V+
Sbjct  550   RAQTRQLWLDKTLPVL  565



>ref|WP_030031952.1| hypothetical protein [Streptomyces flavotricini]
Length=585

 Score =   308 bits (788),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 192/592 (32%), Positives = 298/592 (50%), Gaps = 70/592 (12%)
 Frame = +1

Query  1828  NKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVD  2007
             +  L+T+L +  +     T+  +   A  +A  L T+    ++PG + LL++ PG DFV 
Sbjct  27    DHPLFTFLPDGEEAEPSLTFAALDAKARAVATSLHTAH---VEPGSRALLLFQPGQDFVV  83

Query  2008  AFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAK  2187
             AFFGCL A V+ +P   P P QR  G  LL +A IA+   P A+L+T      +      
Sbjct  84    AFFGCLYAGVVAVPAYLPHPAQRARG--LLRLAGIAEDAQPAAVLTTAGIQAAI------  135

Query  2188  NMLFGKSKDKSSNSWPDL---PWLHTDSWVkkpklfkkpkDEQGQPLSEDLCFLQFTSGS  2358
                     + ++ + P++    WL  D+                 P  + + FLQ+TSGS
Sbjct  136   --------ETTARTIPEVQETAWLAVDTIAHGAGAGWSAP----SPEPKSVAFLQYTSGS  183

Query  2359  TTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGI  2538
             T  PKGVM+THG + HN  L+R        T++V WLP YHDMGLI  ++   + G   +
Sbjct  184   TGRPKGVMVTHGNLTHNTDLIRTSLGMDESTVVVGWLPPYHDMGLISMIIVPAMMGIHSV  243

Query  2539  LFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAA  2718
                 V F+++P+ WL+ MS +  T SAAPNFAF+L  R++   +    DLSS     + A
Sbjct  244   SMPTVAFLQSPVRWLRAMSTYGGTLSAAPNFAFDLCTRKVTEEERATLDLSSWAVATNGA  303

Query  2719  EPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFVDWQGR-----  2883
             EP+R  ++KRF E   S G   E + P YGLAE+ + VS     G PV   W  R     
Sbjct  304   EPVRAESMKRFAEAFASTGFRPETIVPVYGLAESTLLVS-----GAPVERPWVFRSFDDG  358

Query  2884  --------------------VCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISS  3003
                                 V CG  +      +D+ ++ P+  +    PG+ GEIW++ 
Sbjct  359   ELERGTAVVVPDDSPGARVLVSCGVSRT-----LDVAVVDPQ-ARTRRRPGQVGEIWVAG  412

Query  3004  LSAGIGYWGLEELSQKTFENDILSTPGK-RYIRTGDLGRIIDSKLFITGRTKDLIIVAGK  3180
              S  +GYW   +L++++FE  +     +  Y+RTGDLG   +  LF+ GR KD+IIV G+
Sbjct  413   DSVAVGYWQRPDLTRESFEATLAGEEDRGPYMRTGDLGFQTEDGLFVCGRIKDVIIVGGR  472

Query  3181  NIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGKP  3360
             N Y  DIE+T ES+   +RPGC A  G+  D    + ++      E G     E ++G  
Sbjct  473   NHYPHDIERTAESAHPAIRPGCVAAFGVDADG-AEQVVVAAELRREAGDGSDREAQEG--  529

Query  3361  LPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISG  3516
                 V++ +   V++EH + +  +V +   ++ KT+SGK++R E  K +++G
Sbjct  530   ----VVNAVLRAVSQEHRLTVREVVLLPAGTLPKTSSGKLQRRETRKEYLAG  577



>ref|WP_013321938.1| beta-ketoacyl synthase [Cyanothece sp. PCC 7822]
 ref|YP_003887107.1| beta-ketoacyl synthase [Cyanothece sp. PCC 7822]
 gb|ADN13832.1| Beta-ketoacyl synthase [Cyanothece sp. PCC 7822]
Length=2775

 Score =   327 bits (838),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 227/722 (31%), Positives = 354/722 (49%), Gaps = 88/722 (12%)
 Frame = +1

Query  1828  NKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVD  2007
             +KT++T+L +        TY+++   A  IA +L + Q      G++ LL+Y PGL+F+ 
Sbjct  21    DKTIFTFLGDGESETLSLTYQQLDQQARAIAVQLQSLQAA----GERALLLYQPGLEFIS  76

Query  2008  AFFGCLRARVipiptippdptQR-GGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSA  2184
             AFFGCL   VIP+P  PP   +     QA++  A          I+ST    +T   +S 
Sbjct  77    AFFGCLYGGVIPVPAYPPRANRSIERLQAIVSDAEAKFALTTQGIVSTIEGKLTQSQIST  136

Query  2185  KNMLFGKSKDKS---SNSWPDLPWLHTDSWVkkpklfkkpkDEQGQPLSEDLCFLQFTSG  2355
             + +    + +     SN W   P L  D                       L FLQ+TSG
Sbjct  137   EAIQCVTTDNLELSLSNQW-RRPNLKPDQ----------------------LAFLQYTSG  173

Query  2356  STTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSG  2535
             ST +PKGVM++HG ++HN  L+   ++ T  +   SWLP YHDMGLIGG+L  + +    
Sbjct  174   STGNPKGVMVSHGNLMHNAALINGYFRDTPSSRGASWLPPYHDMGLIGGILQPIYADVYV  233

Query  2536  ILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSA  2715
             +L  PVTF++ PL WL+ +S++R T S APNFA+EL   ++   + EN DLS      S 
Sbjct  234   VLMPPVTFLQRPLRWLEVISRYRITTSGAPNFAYELCATQITPEQRENLDLSCWELAFSG  293

Query  2716  AEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFVDWQGR----  2883
             AEP+R  TL +F E     G  +E   P YG+AE  + VS       P+  D+  +    
Sbjct  294   AEPVRAQTLAQFAEAFAPCGFRKEAFYPCYGMAETTLIVSGGTRGVYPLLKDFDAKGIEK  353

Query  2884  ----------------VCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAG  3015
                             V CG I    + G  + I++P+T K+ D+  + GEIW++S S  
Sbjct  354   NQVIPSSPLEPNNLTLVSCGKI----SGGQKVIIVNPDTLKQCDN-YQIGEIWVNSESVA  408

Query  3016  IGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTS  3195
              GYW   +L++  F      T    ++RTGDLG + D +LF+TGR KDLII+ G+N Y  
Sbjct  409   KGYWKRPQLTEAIFNAYTADTQEGPFLRTGDLGFLEDGELFVTGRLKDLIIIRGRNHYPQ  468

Query  3196  DIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDG---KPLP  3366
             DIE T E S   +R  C A   +                +E  LV+  EV+     K   
Sbjct  469   DIEMTAEKSHPALRESCGAAFSV-------------EVGEEERLVITYEVKRSYIRKLNV  515

Query  3367  YDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVIEEQMN  3546
              +V   I   V + H +   +IV +K  SI KT+SGKI+R+ C   F+ G+L+ +  Q +
Sbjct  516   EEVTSAIRKAVTQTHELQPYAIVLLKTGSIPKTSSGKIQRHACKAEFLEGSLNSV-GQWS  574

Query  3547  GERSLPRNDGIIVPANGKISKTDIV----------NFLKDLLSQQTGIPVSKISTGETLV  3696
               ++LP+    ++  N +  +  I+          N+L   ++Q+ G+  ++I   E   
Sbjct  575   AAQTLPKTSKQLLEVNSRKKRGHIIKSNPQQEIIENWLVTNIAQRLGLSPTEIEITEPFA  634

Query  3697  SYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADF-----VESLLEKNHPMLTN  3861
             SYG++S+  VR   ++  +  + +     +    ++ LA +     VE+ L  + P+ T+
Sbjct  635   SYGLDSVQAVRITAELEDWLKVKLSPTLAYDHPTVESLAKYLASGTVETTLATSKPLKTS  694

Query  3862  SS  3867
             SS
Sbjct  695   SS  696



>gb|ETP48591.1| hypothetical protein, variant 1 [Phytophthora parasitica P10297]
Length=735

 Score =   312 bits (800),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 238/708 (34%), Positives = 368/708 (52%), Gaps = 84/708 (12%)
 Frame = +1

Query  1837  LYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKP-----AIKPGDKVLLIYVPGLDF  2001
             + ++ ++KG V    T  E++     +A  LL S +       +  GD+VLL+Y PGLDF
Sbjct  1     MLSFADDKGVVTASLTCAELNKRMQNLAGLLLASTQQHSKGLGLNQGDRVLLVYPPGLDF  60

Query  2002  VDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMS  2181
             +  F  CL+A V+ +P  PPD   R   + +    ++ + C     L T S +  V+ +S
Sbjct  61    IVVFLACLKAGVVAVPVYPPD--PRKMKKDISMFVSVTQNCQAKTAL-TCSMYYNVKKIS  117

Query  2182  AKNMLFGKSKDKSSNSWPD-LPWLHTDSWVkkpklfkkpkDEQGQPLSEDLCFLQFTSGS  2358
             A    F  S    +  WP+ L W+ TD  V    +          P ++   FLQ+TSGS
Sbjct  118   AIKEKFTFS---GAAQWPEHLNWVVTDDLVDTKGIDPAKHWLTQSPSADSTAFLQYTSGS  174

Query  2359  TTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGI  2538
             T+ PKGV+++HG + HN++ +    ++   T++VSWLPQYHDMGLIG  L  + +GG G+
Sbjct  175   TSAPKGVVLSHGNLNHNLRTISSALQAGRDTVVVSWLPQYHDMGLIGAYLGTIFNGGKGV  234

Query  2539  LFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLES-----SKEENFDLSSMHF  2703
               SP +F+++P LWL+ +SK RATH  APNFA+ LL R+ +      +  ++ DLSS+  
Sbjct  235   YLSPFSFIRDPCLWLRLVSKHRATHLQAPNFAYSLLARKSDRLTVGLASGQHVDLSSVRH  294

Query  2704  LMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFVDWQ--  2877
             +++ AEPI+   +  F      FGL   V+ P YGLAE+ V+V C  G+   ++VD Q  
Sbjct  295   MINGAEPIQGEAIDNFYRAFSPFGLPEGVVKPTYGLAEHTVYV-CGGGQQR-LWVDKQEL  352

Query  2878  --GRV--------CCGYIKQ------PNTD--GVDIKIISPETGKENDDPGKEGEIWISS  3003
                RV          G +K+      P+    G+DI+I+  ET +E    G+ GEIWISS
Sbjct  353   ESNRVFRVVEKTNTAGLVKEMIGCGVPSRKDYGIDIRIVDAET-EEEKPEGETGEIWISS  411

Query  3004  LSAGIGYWG--LEELSQKTFENDIL-STPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVA  3174
              S   GY+G  + E S + F+  ++  T GK +++TGDLG I + +LFI GR KDL+I+ 
Sbjct  412   ASKARGYYGDEMREFSAEAFQAKVVGDTEGKTFLKTGDLGVIYNQELFICGRMKDLVIIR  471

Query  3175  GKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRD-  3351
             G+N Y  D+E + ES  EL RPGCCA              L    +D+  L V+AE+RD 
Sbjct  472   GRNHYPQDLEASAESHEEL-RPGCCAAF----------SYLADGNADDEQLAVMAELRDP  520

Query  3352  GKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTL---  3522
                    +   I + +A EHGV +  +V + P SI KTTSGKI R  C K     TL   
Sbjct  521   AMTSKASLCGKIRSAIAREHGVKVTLVVLLAPHSIPKTTSGKISRSRCKKALEEKTLEEL  580

Query  3523  --------DVIEEQMNGE-----RSLPRN-DGIIVPANGKISKTDIVN------------  3624
                     DV  E   G+      ++ RN +G  V +    SK+++ +            
Sbjct  581   YRNEDMIADVPVEDDGGDVAVAGETMNRNVNGPRVASTDDGSKSNLPSVITGVPPDQVHA  640

Query  3625  FLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINI  3768
             FL + L++  G+  ++I+    L   G++S+ + +    I+  + +++
Sbjct  641   FLVEELARTLGVEPTQINDDTPLQELGLDSMALTQLQGVIAQKYQVHV  688



>ref|WP_035087278.1| hypothetical protein [Aquimarina muelleri]
Length=3813

 Score =   327 bits (838),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 238/740 (32%), Positives = 370/740 (50%), Gaps = 87/740 (12%)
 Frame = +1

Query  1813  LGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPG  1992
             L  + NK LY +L +     D RTY E++  +  IA  +L      + PGD+VLL+Y  G
Sbjct  25    LTQSPNKVLYRFLLDGEAESDSRTYLELYNRSKRIASHILIH----VNPGDRVLLLYPSG  80

Query  1993  LDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVR  2172
             LDFVDAFFGC+ A VI +P  PP   +R G      +  I   C+   I++T   +    
Sbjct  81    LDFVDAFFGCMLAGVIAVPAFPPQGKRRIG-----RLEKIVSDCDANLIMTTEDIYSKSN  135

Query  2173  IMSAKNMLFGKSKDKSSNSWPDLPWLHTDSWVkkpklfkkpkDEQGQPLSEDLCFLQFTS  2352
                  N +F K           + WL T+   +         +E      ED+ FLQ+TS
Sbjct  136   SWFDNNEVFAK-----------VEWLKTNVLEEDIDKKFPLVNE------EDVAFLQYTS  178

Query  2353  GSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGS  2532
             GST DPKGVM+TH  +IHN KL++     TS+TI VSWLP YHDMGLIG +L     G  
Sbjct  179   GSTGDPKGVMVTHSNIIHNSKLIQNCNHHTSQTIGVSWLPIYHDMGLIGNILQSFYVGFE  238

Query  2533  GILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMS  2712
              I+  P  F++ P+ WL+T+SK++AT S  PNFA++L V +++       DLSS     +
Sbjct  239   MIIMPPTAFVQKPVKWLKTISKYKATLSGGPNFAYDLCVNQIKKEDLIGIDLSSWLIAYN  298

Query  2713  AAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFVDWQ-----  2877
              +EPIR  T+  F +  +  G  R  + P YG+AE  + VS    + +P  +        
Sbjct  299   GSEPIRTETMGNFADSFEHLGFQRTSLTPCYGMAETTLIVSSCVFKKVPETLKLDKANFS  358

Query  2878  -GRVCCGYIKQPNTD------------GVDIKIISPETGKENDDPGKEGEIWISSLSAGI  3018
              G++     K P  D             +D+ I++P+T K+  +    GEIWIS  S   
Sbjct  359   SGKIALFNEKTPEADLIEFVGNGPVLEDLDVIIVNPDT-KQACEANAIGEIWISGPSVTK  417

Query  3019  GYWGLEELSQKTF------ENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAGK  3180
             GYW  ++LS++ F        +I+      Y+RTGD+G +   +L+I+GR K+++I+ G 
Sbjct  418   GYWNKKDLSKEIFSAYIRDNKNIVDKNKGPYLRTGDMGFLNKGQLYISGRLKEMMIINGV  477

Query  3181  NIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGKP  3360
             N +  DIE+TV+ S   ++    A+  I  D             ++L +V   E++    
Sbjct  478   NHFPQDIEQTVQRSHSDLQNNAGAIFSITVD-----------GKEQLAMV--QEIKRTSI  524

Query  3361  LPYD---VMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLD-V  3528
               YD   ++  I   V +EH + I SIV + P ++ KT+SGKIKR      F S T+  V
Sbjct  525   RSYDFGAIIKSIYESVFQEHELAIHSIVLVSPGNVPKTSSGKIKRVATKIVFESDTISGV  584

Query  3529  IEEQMNGE------RSLPRNDGIIVPANGKISKTDIVNFLKDLLSQQTGIPVSKISTGET  3690
             I+  + GE      +S  +N     P     S   +  +L+  +S++  I +S++S  ++
Sbjct  585   IDRWVTGEVIKEKKKSSVKNKQ--EPKTTDHSADLLKEWLQKTISEELKIDISRVSIYKS  642

Query  3691  LVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEKNHPMLTNSSE  3870
                 G+ SI  +R +  +S F G  I  + I+S   I+ LA+++     KN P +++S+E
Sbjct  643   FAELGITSIQGIRLSGMLSEFMGEEISPVLIYSYPDINSLANYL-----KNIPEISDSNE  697

Query  3871  TKISSSGIPSVVSTFDKITI  3930
              +      P V+S  + I I
Sbjct  698   IR------PDVLSKNEPIAI  711



>ref|WP_027413623.1| hypothetical protein [Aquimarina muelleri]
Length=6843

 Score =   327 bits (839),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 224/702 (32%), Positives = 365/702 (52%), Gaps = 72/702 (10%)
 Frame = +1

Query  1822  TENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDF  2001
             T +KTLY +L    +  D RTY E++  A T+A  +L      + PGD+VLL+Y  GLDF
Sbjct  29    TPDKTLYRFLENGEEQTDSRTYLELYDRATTVASHIL----EYVNPGDRVLLLYPSGLDF  84

Query  2002  VDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMS  2181
             +DAFFGCL A VI +P  PP   +R G      +  I + CN + +L+  + H       
Sbjct  85    MDAFFGCLLAGVIAVPAFPPQGKRRIG-----RLEKIVEDCNAMLVLTQEAIH-------  132

Query  2182  AKNMLFGKSKDKSSNS-WPDLPWLHTDSWVkkpklfkkpkDEQGQPLSEDLCFLQFTSGS  2358
                    KSK   S+  + ++ WL TD       L +K   +    + E + FLQ+TSGS
Sbjct  133   ------AKSKKWFSDEVFSEIEWLETDK------LDQKISKDFPNIVPETVAFLQYTSGS  180

Query  2359  TTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGI  2538
             T +PKGV++ H  VI N KL +K +++T  ++ +SWLP YHDMGLIG ++     G   +
Sbjct  181   TGNPKGVIVDHSNVIDNSKLFKKCFQNTPDSVGISWLPIYHDMGLIGNIIQAFYVGFELV  240

Query  2539  LFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAA  2718
             +  P  F++ P+ WLQ  S ++ T S  PNFA++L V ++     E  DLSS    ++ +
Sbjct  241   MMPPTAFVQKPIRWLQAFSNYKGTISCGPNFAYDLCVNQIRKEDLEGIDLSSWRVAINGS  300

Query  2719  EPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVS-CAY-------GEGLPVFVDW  2874
             EPIR  T + F+    ++GL +E + PGYGLAE  + VS C++       G     F D 
Sbjct  301   EPIRPETFENFIARYSAYGLKKEALFPGYGLAEATLTVSGCSFNSAPIILGLDKKAFNDK  360

Query  2875  QGRVCCGYIKQ----------PNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGIGY  3024
             + ++    I+           P  +G+ +KI+ P T K+  D  K GE+W+S  S   GY
Sbjct  361   EVKIVEKPIENNEVHRIMGNGPVIEGLIVKIVDPHT-KKLCDKNKIGEVWVSGASVAKGY  419

Query  3025  WGLEELSQKTFEN--DILSTPGKR----YIRTGDLGRIIDSKLFITGRTKDLIIVAGKNI  3186
             W  E +S++ F+   +I +  GK     Y+RTGD+G I +  L+I+GR K+++++ G N 
Sbjct  420   WKKEAISKEIFQAYIEIDTKEGKDVEGPYLRTGDMGFIHNDDLYISGRLKEMMVINGVNH  479

Query  3187  YTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGKPLP  3366
             +  DIE++V+ SS  ++      + I     + KG  +Q+      LV++ E++      
Sbjct  480   FPQDIERSVQYSSSDLQNNAGVALSI-----LHKG--SQQ------LVIVQEIKRTSIKK  526

Query  3367  YD---VMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVIEE  3537
             YD   ++ +IC  V E H +P+  IV + P  I KT+SGKI+R   A  +    +D + E
Sbjct  527   YDFPSIVKNICDAVYETHNLPVYGIVLVSPGRIPKTSSGKIQRVATASFYKENIVDGVLE  586

Query  3538  Q--MNGERSLPRNDGIIVPANGKISKTDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVN  3711
             +   N   S+ +++         ++ T I  + +  +++Q  + ++++S  ++    G+N
Sbjct  587   RWDSNEVNSVQKSNKATEEKVVSLADTPIEKWFRKAIAKQLELSLNQVSLDKSFAELGIN  646

Query  3712  SIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLE  3837
             S+  VR +  +S +   +     IF    +   A  VE  LE
Sbjct  647   SLLGVRLSGMLSEYLNRSFSPTLIFEFPTLRACASSVEKKLE  688


 Score = 64.7 bits (156),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 110/509 (22%), Positives = 198/509 (39%), Gaps = 93/509 (18%)
 Frame = +1

Query  2329  LCFLQFTSGSTTDPKGVMITHGGVIHNV-KLMRKRYKSTSRTILVSWLPQYHDMGLIGGL  2505
             L ++ +TSGST  PKGVMI+H G+++ +   +RK  + T R  L     Q+ +      +
Sbjct  2808  LAYIIYTSGSTGQPKGVMISHSGIVNTIMSQVRKLTEDTKRHCL-----QFANQSFDASI  2862

Query  2506  LTILVS--GGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEEN  2679
               IL++   GS +        K+  L+++ + +   T +  P    +LL   +E      
Sbjct  2863  WEILIALFSGSSLYIIGELVKKDTRLFIEFIQENAITWATLPPAYLKLL--NIE------  2914

Query  2680  FDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGE---  2850
              +L S+  L++A E       K F ++           +  YG  E  +  +   GE   
Sbjct  2915  -ELESIDTLITAGEEAPILKAKEFAKIGN--------YSNAYGPTETSICATVFNGEIFD  2965

Query  2851  GLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGIGYWG  3030
              +P             I +P T+   + I+S +   +    G  GE+ ++ +    GY  
Sbjct  2966  NVP-------------IGKPITN-TKVYILSEDLHLQPQ--GVIGELCVAGVGVAKGYLN  3009

Query  3031  LEELSQKTFENDILSTPGKRYIRTGDLGR-IIDSKLFITGRTKDLIIVAGKNIYTSDIEK  3207
              E L+++ F  D  S+    Y RTGDL R + D  +   GR  D + + G  I   +IE 
Sbjct  3010  RETLTKEKFITDPFSSGWSMY-RTGDLARWLPDGNIEFVGRKDDQVKIRGHRIELGEIEY  3068

Query  3208  TVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGKPLPYDVMDHI  3387
              +   S +    CC +                  SDE G   +     G  +  D  D  
Sbjct  3069  ALTKISTV--SSCCVIA----------------KSDEQGTKYLV----GYLVTEDTFDKK  3106

Query  3388  CTRVAEEHGVP--IASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVIEEQMNGERSL  3561
               +   +H +P  +   + +   ++  T++GK+ + +       G             SL
Sbjct  3107  KIQEKLKHTLPDYMVPRLWVTLDTMPLTSNGKVDKAKLPDELAVG------------ESL  3154

Query  3562  PRNDGIIVPANGKISKTDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQK  3741
              +      P   K+ +  +    + LL+      V KI   +     G +S+   R    
Sbjct  3155  LK----YAPPRNKVEE-QLAQIWEQLLN------VKKIGIHDDFFDLGGHSLLATRLVSI  3203

Query  3742  ISSFFGINIGAIDIFSATCIDDLADFVES  3828
             I     + I   D+F+ T + +LA F+ +
Sbjct  3204  IRQEIQVEITIRDVFAYTVLSELALFIST  3232


 Score = 63.5 bits (153),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 123/515 (24%), Positives = 208/515 (40%), Gaps = 99/515 (19%)
 Frame = +1

Query  2317  LSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLI  2496
             L E L ++ +TSGST +PKGVM+TH  +   V      Y +    IL   LP +     +
Sbjct  5918  LPECLAYIIYTSGSTGNPKGVMVTHANLTGLVFSKIAYYGTVEGMIL---LPSFVFDPSV  5974

Query  2497  GGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRR-----LE  2661
               +   L++GG  I+ S                   A H A+     ++L+++     L 
Sbjct  5975  SVIFGTLLTGGRLIIPSK-----------------EAIHDAS---QMKILLQQNVDLLLC  6014

Query  2662  SSKEENFDLS-------SMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAEN  2820
              S   NF LS        +  ++   E + +  ++R  E  +S  +  E     YG  E 
Sbjct  6015  VSSYYNFLLSEGLLNNTQLRGVIVGGEQLNKKVVERHYESYRSITMYNE-----YGPTEC  6069

Query  2821  CVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWIS  3000
              V+ S +  +   V +D         I +P      I I+  E  ++    G  GE+ IS
Sbjct  6070  TVWASVSEVQENEV-ID---------IGRP-VSNTQIYILDQE--QQLVPRGVVGELCIS  6116

Query  3001  SLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGR-IIDSKLFITGRTKDLIIVAG  3177
              +    GY   EEL+++ F  +   T GK+  RTGDL R + D K+   GRT D + + G
Sbjct  6117  GVGLSNGYLNREELTKEKFVPNPFVT-GKQMYRTGDLARWLPDGKIAFIGRTDDQVKIRG  6175

Query  3178  KNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGK  3357
               I   +IE  +    ++    CC VV   ED         Q A   +  +V+ E  D K
Sbjct  6176  YRIELGEIETALLKVVDI--ENCCVVV--KED--------DQGAKQLVAYIVVEEEFDIK  6223

Query  3358  PLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVIEE  3537
              +  ++   +      E+ +P   ++ I   ++  T++GKI +           LD+   
Sbjct  6224  AVKQELKLSL-----PEYMIP---VLWIPLETMPLTSNGKIDKKALPD------LDM---  6266

Query  3538  QMNGERSLPRNDGIIVPANGKISKTDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSI  3717
                   SL   +  + P N    +T IV         Q  + V +I   +     G +SI
Sbjct  6267  ------SLSLKESYVAPRNELEKQTSIV--------WQELLGVEEIGIHDNFFELGGDSI  6312

Query  3718  GVVRAAQKISSFFGINIGAIDIFSATCIDDLADFV  3822
               ++   +++   G  +   D+F    I  LA+++
Sbjct  6313  ITIQVVSRMNR-LGYTMQPRDLFEYQTISGLANYI  6346



>ref|WP_026149071.1| amino acid adenylation protein [Leptolyngbya boryana]
Length=1781

 Score =   325 bits (833),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 239/732 (33%), Positives = 356/732 (49%), Gaps = 80/732 (11%)
 Frame = +1

Query  1753  PGVKFPEL----SSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIA  1920
             P   FPE     S+L + LR+        ++  +T+L +        TYKE+   +  IA
Sbjct  5     PSDAFPETFWCESTLVALLRYRAMH--QPDRLAFTFLLDGETEAVSFTYKELDRQSRAIA  62

Query  1921  QKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQ--AL  2094
              +L   Q   +  G++ LL+Y PGLD++ AFFGCL A V+ +P  PP   QR   +  A+
Sbjct  63    ARL---QAMGLG-GERALLLYPPGLDYLAAFFGCLYAGVVAVPAYPPHN-QRNTPRIAAI  117

Query  2095  LHIANIAKVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPDLPWLHTDSWVkk  2274
             L  A  A      AIL              +++L  K    +      + WL TD+    
Sbjct  118   LSDAQAAIALTTTAILDRM-----------QSLLAEKMNGDT------IQWLTTDN----  156

Query  2275  pklfkkpkDEQGQPLSED--LCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSR  2448
               L     +   +PL E+  L FLQ+TSGST  PKGVM++H  ++HN     +  + +  
Sbjct  157   --LEYSIAETWQEPLIENNTLAFLQYTSGSTGTPKGVMLSHSNLLHNAAATYRYMEHSPS  214

Query  2449  TILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPN  2628
             +  VSWLP YHDMGLIGG+L  L  G   IL SP +F++ P  WLQ +S+++ T S APN
Sbjct  215   STFVSWLPAYHDMGLIGGILQPLYGGFPCILMSPASFLQRPYRWLQAISRYQGTTSGAPN  274

Query  2629  FAFELLVRRLESSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYG  2808
             FA++L V ++ + + +  DLS      + AEPIR ++L+RF       G  RE   P YG
Sbjct  275   FAYDLCVEKITAEQRQTLDLSHWSVAFNGAEPIRHSSLERFAATFAECGFRREAFYPCYG  334

Query  2809  LAENCVFVSCAYGEGLPVFVDWQGRVCCGYIKQPNTDGVD-----------------IKI  2937
             +AE  + VS       PV    Q +      +    D  D                 I I
Sbjct  335   MAEATLMVSGGVQATAPVIKTVQ-KAALERSQVVEADAGDAEVWTLIGCGKTIPEQHIVI  393

Query  2938  ISPETGKENDDPGKEGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGR  3117
             + PET  +   PG+ GEIW+S  S G GYW   E S +TF+  +  T    ++RTGDLG 
Sbjct  394   VHPET-LDRCQPGEVGEIWVSGSSVGQGYWNRPEESAQTFQAYLSDTHAGPFLRTGDLGF  452

Query  3118  IIDSKLFITGRTKDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGIL  3297
             + D +LFITGR KDLII+ G+N+Y  D+E T E S   +R G  A   I           
Sbjct  453   LHDGELFITGRAKDLIIIRGRNLYPQDLEFTAERSHPTLRIGSSAAFAIA----------  502

Query  3298  TQRASDELGLVVIAEVR-DGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSG  3474
                  D   LVV+ EV    KP   +V   I   +AE H V   ++V IK  +I KT+SG
Sbjct  503   ---LYDAERLVVVQEVEFRQKPNVQEVTQAIRQAIAEAHEVQAYAVVLIKAGTIPKTSSG  559

Query  3475  KIKRYECAKRFISGTL-----DVIE--EQMNGERSLPRNDGIIVPANGKISKTDIVNFLK  3633
             KI+R  C   F++G L      ++E  E  N E SL R D  +   +    +T + ++++
Sbjct  560   KIQRRACKAAFLAGNLAEIGSSILEMVEVENLETSLTRAD--LFAFDSAERETQLTDYVR  617

Query  3634  DLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLA  3813
               +++   I  +++     L  +G++S+ +     +I   FG+ I   D+F    I +L 
Sbjct  618   QQVARVLRIAATQVDVQHPLSRFGLDSLMIFEIKSRIELDFGVEIAIADLFEGASIAELV  677

Query  3814  DFVESLLEKNHP  3849
               + + L  ++P
Sbjct  678   AQILNQLTTSNP  689



>gb|ETW21740.1| hypothetical protein MGAST_24130, partial [Mycobacterium gastri 
'Wayne']
Length=560

 Score =   306 bits (785),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 212/595 (36%), Positives = 302/595 (51%), Gaps = 67/595 (11%)
 Frame = +1

Query  1828  NKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVD  2007
             ++TLY +++ +G  L+  TY         +A  L    +  ++PGD+ LL+Y PGL+ V 
Sbjct  8     DQTLYRFVDAEGRELEHYTYHSFAERTRELAAYLFA--EAGLRPGDRALLVYPPGLEMVA  65

Query  2008  AFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAK  2187
             AFF C R  VI +P  PP P     G A L    IA+ C    +LST  +    R++   
Sbjct  66    AFFACARIGVIAVPVSPPLPMAFEAGLAKLSF--IARDCQAKVVLSTKQFEYDYRLLLGH  123

Query  2188  NMLFGKSKDKSSNSWPDLPWLHTD-SWVkkpklfkkpkDEQGQPLSE---DLCFLQFTSG  2355
                 G      +   P+LPW  TD +W           +  G P+++    + FLQ+TSG
Sbjct  124   RQ--GGLPWPGAARPPELPWFATDGTW-----------EFGGAPVADTPGPVLFLQYTSG  170

Query  2356  STTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSG  2535
             ST+DPKGV+++H  VI N              + VSWLPQ+HDMGLI   L IL+ GG+ 
Sbjct  171   STSDPKGVIVSHANVIANGSAF------AGGEVAVSWLPQHHDMGLISAYLFILLLGGTT  224

Query  2536  ILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVR--RLESSKEENFDLSSMHFLM  2709
                SP  F++ P  WL+ +S+ RATHS APNFA E  +R  +L + +    DLSS+  L+
Sbjct  225   HAMSPADFLQRPSAWLRLISQVRATHSPAPNFALEYCLREDKLPTDELTGIDLSSLDSLL  284

Query  2710  SAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSC-----------AYGE--  2850
               AEP+R  T  RF +    +GL  + +A  YGLAEN + VS            A G+  
Sbjct  285   VGAEPLRANTFARFRQRFAGYGLRPDALAGAYGLAENTLIVSIRGRQTLALNKRALGQNL  344

Query  2851  -----GLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAG  3015
                   LP   +    V CG   +P    V ++I+ P + ++    G+ GE+W+   S G
Sbjct  345   ARVEKALPDNNNQAHVVSCG---KPVAGNV-VRIVDPRS-RQALGEGRIGEVWLDGPSKG  399

Query  3016  IGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTS  3195
              GYW   EL+ +TF   I     + Y+RTGDLG + + +LF+ GR+KDLIIV G N Y S
Sbjct  400   GGYWHRPELTAETFAARITGDAERTYLRTGDLGFLYEGELFVCGRSKDLIIVRGVNCYPS  459

Query  3196  DIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGKPLPYDV  3375
             DIE  VE S+  VR GC A      +             ++  LVV+AEVRD   LP   
Sbjct  460   DIEAVVERSAAQVRNGCVAAFSFEHE-------------EQEALVVVAEVRDQHSLPDP-  505

Query  3376  MDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVIEEQ  3540
                +   +     V   +IV   PRSI KTTSGKI+R +  + ++ G L V+  +
Sbjct  506   -KALARSIRRYCHVDPHTIVFSPPRSIPKTTSGKIRRAQTRRLWLDGKLPVLRSE  559



>gb|ETM50541.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETM50542.1| hypothetical protein, variant 3 [Phytophthora parasitica]
Length=712

 Score =   311 bits (796),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 229/666 (34%), Positives = 351/666 (53%), Gaps = 79/666 (12%)
 Frame = +1

Query  1948  AIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCN  2127
              +  GD+VLL+Y PGLDF+  F  CL+A V+ +P  PPD   R   + +    ++ + C 
Sbjct  20    GLNQGDRVLLVYPPGLDFIVVFLACLKAGVVAVPVYPPD--PRKMKKDISMFVSVTQNCQ  77

Query  2128  PVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPD-LPWLHTDSWVkkpklfkkpkDE  2304
                 L T S +  V+ +SA    F  S    +  WP+ L W+ TD  V    +       
Sbjct  78    AKTAL-TCSMYYNVKKISAIKEKFTFS---GAAQWPEHLNWVVTDDLVDTKGIDPAKHWL  133

Query  2305  QGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHD  2484
                P ++   FLQ+TSGST+ PKGV+++HG + HN++ +    ++   T++VSWLPQYHD
Sbjct  134   TQSPSADSTAFLQYTSGSTSAPKGVVLSHGNLNHNLRTISSALQAGRDTVVVSWLPQYHD  193

Query  2485  MGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLES  2664
             MGLIG  L  + +GG G+  SP +F+++P LWL+ +SK RATH  APNFA+ LL R+ + 
Sbjct  194   MGLIGAYLGTIFNGGKGVYLSPFSFIRDPCLWLRLVSKHRATHLQAPNFAYSLLARKSDR  253

Query  2665  -----SKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVF  2829
                  +  ++ DLSS+  +++ AEPI+   +  F      FGL   V+ P YGLAE+ V+
Sbjct  254   LTVGLASGQHVDLSSVRHMINGAEPIQGEAIDNFYRAFSPFGLPEGVVKPTYGLAEHTVY  313

Query  2830  VSCAYGEGLPVFVDWQ----GRV--------CCGYIKQ------PNTD--GVDIKIISPE  2949
             V C  G+   ++VD Q     RV          G +K+      P+    G+D++I+  E
Sbjct  314   V-CGGGQQR-LWVDKQELESNRVFRVVEKTNTAGLVKEMIGCGVPSRKDYGIDVRIVDAE  371

Query  2950  TGKENDDPGKEGEIWISSLSAGIGYWG--LEELSQKTFENDIL-STPGKRYIRTGDLGRI  3120
             T +E    G+ GEIWISS S   GY+G  + E S + F+  ++  T GK +++TGDLG I
Sbjct  372   T-EEEKPEGETGEIWISSASKARGYYGDEMREFSAEAFQAKVVGDTEGKTFLKTGDLGVI  430

Query  3121  IDSKLFITGRTKDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILT  3300
              + +LFI GR KDL+I+ G+N Y  D+E + ES  EL RPGCCA              L 
Sbjct  431   YNQELFICGRMKDLVIIRGRNHYPQDLEASAESHEEL-RPGCCAAF----------SYLA  479

Query  3301  QRASDELGLVVIAEVRD-GKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGK  3477
                +D+  L V+AE+RD        +   I + +A EHGV +  +V + PRSI KTTSGK
Sbjct  480   DGNADDEQLAVVAELRDPAMTSKASLCGKIRSAIAREHGVKVTLVVLLAPRSIPKTTSGK  539

Query  3478  IKRYECAKRFISGTL-----------DVIEEQMNGE-----RSLPRN-DGIIVPANGKIS  3606
             I R  C K     TL           DV  E   G+      ++ RN +G  V +    S
Sbjct  540   ISRSRCKKALEEKTLEELYRNEDMIADVPVEDDGGDVAVAGETMNRNVNGPRVASTDDGS  599

Query  3607  KTDIVN------------FLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISS  3750
             K+++ +            FL + L++  G+  ++I+    L   G++S+ + +    I+ 
Sbjct  600   KSNLPSVITGVPPDQVHAFLVEELARTLGVEPTQINDDTPLQELGLDSMALTQLQGVIAQ  659

Query  3751  FFGINI  3768
              + +++
Sbjct  660   KYQVHV  665



>gb|ETL44187.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETL44188.1| hypothetical protein, variant 3 [Phytophthora parasitica]
 gb|ETP20654.1| hypothetical protein, variant 2 [Phytophthora parasitica CJ01A1]
 gb|ETP20655.1| hypothetical protein, variant 3 [Phytophthora parasitica CJ01A1]
Length=712

 Score =   310 bits (795),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 229/666 (34%), Positives = 351/666 (53%), Gaps = 79/666 (12%)
 Frame = +1

Query  1948  AIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCN  2127
              +  GD+VLL+Y PGLDF+  F  CL+A V+ +P  PPD   R   + +    ++ + C 
Sbjct  20    GLNQGDRVLLVYPPGLDFIVVFLACLKAGVVAVPVYPPD--PRKMKKDISMFVSVTQNCQ  77

Query  2128  PVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPD-LPWLHTDSWVkkpklfkkpkDE  2304
                 L T S +  V+ +SA    F  S    +  WP+ L W+ TD  V    +       
Sbjct  78    AKTAL-TCSMYYNVKKISAIKEKFTFS---GAAQWPEHLNWVVTDDLVDTKGIDPAKHWL  133

Query  2305  QGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHD  2484
                P ++   FLQ+TSGST+ PKGV+++HG + HN++ +    ++   T++VSWLPQYHD
Sbjct  134   TQSPSADSTAFLQYTSGSTSAPKGVVLSHGNLNHNLRTISSALQAGRDTVVVSWLPQYHD  193

Query  2485  MGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLES  2664
             MGLIG  L  + +GG G+  SP +F+++P LWL+ +SK RATH  APNFA+ LL R+ + 
Sbjct  194   MGLIGAYLGTIFNGGKGVYLSPFSFIRDPCLWLRLVSKHRATHLQAPNFAYSLLARKSDR  253

Query  2665  -----SKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVF  2829
                  +  ++ DLSS+  +++ AEPI+   +  F      FGL   V+ P YGLAE+ V+
Sbjct  254   LTVGLASGQHVDLSSVRHMINGAEPIQGEAIDNFYRAFSPFGLPEGVVKPTYGLAEHTVY  313

Query  2830  VSCAYGEGLPVFVDWQ----GRV--------CCGYIKQ------PNTD--GVDIKIISPE  2949
             V C  G+   ++VD Q     RV          G +K+      P+    G+D++I+  E
Sbjct  314   V-CGGGQQR-LWVDKQELESNRVFRVVEKTNTAGLVKEMIGCGVPSRKDYGIDVRIVDAE  371

Query  2950  TGKENDDPGKEGEIWISSLSAGIGYWG--LEELSQKTFENDIL-STPGKRYIRTGDLGRI  3120
             T +E    G+ GEIWISS S   GY+G  + E S + F+  ++  T GK +++TGDLG I
Sbjct  372   T-EEEKPEGETGEIWISSASKARGYYGDEMREFSAEAFQAKVVGDTEGKTFLKTGDLGVI  430

Query  3121  IDSKLFITGRTKDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILT  3300
              + +LFI GR KDL+I+ G+N Y  D+E + ES  EL RPGCCA              L 
Sbjct  431   YNQELFICGRMKDLVIIRGRNHYPQDLEASAESHEEL-RPGCCAAF----------SYLA  479

Query  3301  QRASDELGLVVIAEVRD-GKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGK  3477
                +D+  L V+AE+RD        +   I + +A EHGV +  +V + PRSI KTTSGK
Sbjct  480   DGNADDEQLAVVAELRDPAMTSKASLCGKIRSAIAREHGVKVTLVVLLAPRSIPKTTSGK  539

Query  3478  IKRYECAKRFISGTL-----------DVIEEQMNGE-----RSLPRN-DGIIVPANGKIS  3606
             I R  C K     TL           DV  E   G+      ++ RN +G  V +    S
Sbjct  540   ISRSRCKKALEEKTLEELYRNEDMIADVPVEDDGGDDAVAGETMNRNVNGPRVASTDDGS  599

Query  3607  KTDIVN------------FLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQKISS  3750
             K+++ +            FL + L++  G+  ++I+    L   G++S+ + +    I+ 
Sbjct  600   KSNLPSVITGVPPDQVHAFLVEELARTLGVEPTQINDDTPLQELGLDSMALTQLQGVIAQ  659

Query  3751  FFGINI  3768
              + +++
Sbjct  660   KYQVHV  665



>ref|WP_014396740.1| long-chain-fatty-acid--CoA ligase [Corallococcus coralloides]
 ref|YP_005369901.1| long-chain-fatty-acid--CoA ligase [Corallococcus coralloides 
DSM 2259]
 gb|AFE09749.1| Long-chain-fatty-acid--CoA ligase [Corallococcus coralloides 
DSM 2259]
Length=10504

 Score =   326 bits (835),  Expect = 1e-85, Method: Composition-based stats.
 Identities = 230/684 (34%), Positives = 345/684 (50%), Gaps = 82/684 (12%)
 Frame = +1

Query  1831  KTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDA  2010
             + LYT+L++ G      +Y  +   A  IA  L    +   KPG++V+L+Y PGL++V  
Sbjct  32    QPLYTFLDDAGQEDGTLSYAGLDARARRIAVAL----RKVAKPGERVMLLYPPGLEYVAG  87

Query  2011  FFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAKN  2190
             FFGCL A +I +P  PPDP +    + L  +  I +  N   +L+T        I+S   
Sbjct  88    FFGCLYAGLIAVPAYPPDPMRLE--RTLPRLRAIIQDANATVVLTTSG------ILSMTE  139

Query  2191  MLFGKSKDKSSNSWPDLPWLHTDSWVkkpklfkkpkDEQGQPL--SEDLCFLQFTSGSTT  2364
              +F ++        PDL  LH   WV   ++    + E   P   +  L FLQ+TSGST 
Sbjct  140   FVFEQA--------PDLRSLH---WVGTDEIPAGGEAEWTPPEVDASTLAFLQYTSGSTG  188

Query  2365  DPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGILF  2544
              PKGVM++HG + HN+ L+   ++    +  V WLP YHDMGLIGG+LT L +     L 
Sbjct  189   SPKGVMLSHGNLAHNLALITDAFELGPTSSAVIWLPPYHDMGLIGGILTPLYATFHAALM  248

Query  2545  SPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAAEP  2724
             SP+T +KNP +WL+ +++++AT S  PNFAF+L VRR+ + + ++ DLSS     + AEP
Sbjct  249   SPLTMLKNPRVWLEAITRYKATISGGPNFAFDLCVRRIPAEERQSLDLSSWKVAFTGAEP  308

Query  2725  IRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLP---------------  2859
             IR  TL RF +     G  RE   P YGLAE  + VS    E  P               
Sbjct  309   IRPATLDRFEQAFGPHGFKREFFFPCYGLAEATLLVSGGRVEAPPVSCALDAPALEQRRA  368

Query  2860  VFVDW---QGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGIGYWG  3030
             V VD    + RV  G   +    G  + I+ P+T +E   PG  GEIW+   S  +GYW 
Sbjct  369   VLVDAAKPEARVLVGCGDE--RPGHPVVIVDPQT-REACAPGGVGEIWVRGPSVALGYWN  425

Query  3031  LEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDIEKT  3210
               E + + F+  +  T    ++RTGDLG + D +L++TGR KDLII+ G+N Y  DIE+T
Sbjct  426   KPEATAEAFQARVKGTDEGPFLRTGDLGFMRDGELYVTGRAKDLIIIRGRNHYPQDIEQT  485

Query  3211  VESSSELVRPGCCAVVGI----PEDVLVSKGILTQRASDELGLVVIAEVRDGKPLPYDVM  3378
             VE S   +R G  A V +     E ++V + I  ++A +    V +AE           +
Sbjct  486   VEESHPALRAGSVAAVSLEVAGEERLVVVQEIDLRKAGNLRKQVDMAEA---------AV  536

Query  3379  DHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVI---------  3531
               I  RVAE H V + ++  I+P SI KT+SGKI+R+ C  +F++  L  +         
Sbjct  537   KEIRQRVAERHEVQVHAVALIEPGSIPKTSSGKIQRHACKAQFLADELRTVLVWREPGFE  596

Query  3532  -------EEQMNGERSLPRNDGIIVPANGKISKTDIVNFLKDLLSQQTGIPVSKISTGET  3690
                     E      +  R D   VP   + + T    +L + +++Q  +P   +   E 
Sbjct  597   EAEETEAAESSEPAAAPVRED---VPEAARATLT----WLVERVAEQLKVPAKTVDVREP  649

Query  3691  LVSYGVNSIGVVRAAQKISSFFGI  3762
             +  YG++S+  V  A  +    GI
Sbjct  650   ITRYGLDSLSAVELAHAVEKGLGI  673


 Score = 61.6 bits (148),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 115/512 (22%), Positives = 205/512 (40%), Gaps = 88/512 (17%)
 Frame = +1

Query  2320  SEDLCFLQFTSGSTTDPKGVMITHGGVIHNV--KLMRKRYKSTSRTILVSWLPQYHDMGL  2493
             + +L ++ +TSGST  PKG ++ H G+++        KR    SR +      QY     
Sbjct  6595  AHNLAYVIYTSGSTGRPKGTLLQHEGLVNTALRAAAAKRVGPGSRVL------QYAASSF  6648

Query  2494  IGGLLTIL--VSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSA--APNFAFELLVRRLE  2661
                +  I   ++ G+ ++ +P   +  P   L+T+ K +   +A   P+   +L    LE
Sbjct  6649  DASVWEIFSTLAAGATLVLAPRDRLM-PDEPLRTLLKEQGITTATLTPSVLAQLSTEGLE  6707

Query  2662  SSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCA  2841
               +           ++SA E +        VEL + +G  R +M   YG  E  V  +  
Sbjct  6708  GLRS----------VVSAGEALS-------VELARKWGAGR-LMINAYGPTEATVCATLT  6749

Query  2842  YGEGLPVFVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGIG  3021
              G   P       R+  G   +P  +    ++   +  +     G  GE++I  ++   G
Sbjct  6750  EGGVNP------ERITIG---KPWANA---QVYVLDAAQRPVPVGVAGELYIGGVALARG  6797

Query  3022  YWGLEELSQKTFENDILST-PGKRYIRTGDLGR-IIDSKLFITGRTKDLIIVAGKNIYTS  3195
             Y G  +L+ + F     S  PG R  RTGD  R +   +L   GR    + V G  I   
Sbjct  6798  YQGRPDLTAEKFVPHPFSQEPGARVYRTGDRVRWLATGELEYLGRIDFQVKVRGFRIELG  6857

Query  3196  DIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGKPLPYDV  3375
             ++E  +   +++      A V + EDV   K ++    + E   + +AE+R         
Sbjct  6858  EVESVLLHHTDIRE----AAVVVREDVPGDKRLVAYVVAQEDTELDVAELR---------  6904

Query  3376  MDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVIEEQMNGER  3555
               H+   V  E+ VP A +V     ++  T +GK+ R     + +    D   E+   E 
Sbjct  6905  -RHLKGEVP-EYMVPSAFVVL---EALPMTPAGKVDR-----KALPAPSDARMERSEAEF  6954

Query  3556  SLPRNDGIIVPANGKISK--TDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVR  3729
             + PR      P    ++   T+I++             V ++   +     G +S+   +
Sbjct  6955  AAPR-----TPTEKMLATVWTEILD-------------VKRVGVRDNFFDLGGHSLLATQ  6996

Query  3730  AAQKISSFFGINIGAIDIFSATCIDDLADFVE  3825
              A +I   FG+ +    +F A  I DLA  V+
Sbjct  6997  VASRIREAFGVELPLRALFEAPTIADLAQRVD  7028



>ref|WP_009784043.1| Beta-ketoacyl synthase [Lyngbya sp. PCC 8106]
 gb|EAW37309.1| Beta-ketoacyl synthase [Lyngbya sp. PCC 8106]
Length=588

 Score =   306 bits (784),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 211/627 (34%), Positives = 316/627 (50%), Gaps = 82/627 (13%)
 Frame = +1

Query  1768  PELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKP  1947
             PE+++L   LR+  T      +  Y +L +   +    TY+ +   +  IA  L    + 
Sbjct  7     PEINTLIDLLRNRATH--ESEQVGYRFLLDGETLEVSLTYQALDQQSRAIAAHL----QS  60

Query  1948  AIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCN  2127
               +PG++ LL+Y PGLD++ AFFGCL A V+ +P  PP P      ++L  I  I     
Sbjct  61    ICQPGERALLLYQPGLDYISAFFGCLYAGVVAVPAYPPRP-----NRSLERIEAILADAK  115

Query  2128  PVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPDLPWLHTDSWVkkpklfkkpkDEQ  2307
                 L++ S      I+S  N    + +   S     L W+ TD+        +   D  
Sbjct  116   ATVALTSQS------ILSLINRQLEQVQSLQS-----LHWVATDT-------LETFADHW  157

Query  2308  GQPL--SEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYH  2481
              +P+  S+ L FLQ+TSGST  PKGVMITHG ++ N+  + + +  + ++  V WLP YH
Sbjct  158   QEPVLTSDTLAFLQYTSGSTATPKGVMITHGNLLQNLAAIHRCFGHSPQSQGVIWLPPYH  217

Query  2482  DMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLE  2661
             DMGLIGG+L  L  G   +L SP+ F++ PL WL+ +S+++AT S  PNFA++L VR++ 
Sbjct  218   DMGLIGGVLQPLYGGFGVVLMSPLMFLQRPLRWLEAISRYQATTSGGPNFAYDLCVRKIT  277

Query  2662  SSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCA  2841
              ++ E  DLSS     + AEPI    ++RF E    +G  RE   P YGLAE  + VS  
Sbjct  278   PAQREGLDLSSWELAFNGAEPIYDEVIERFTEAFAPYGFRREAFYPCYGLAEATLIVSGG  337

Query  2842  YGEGLPVFVDWQGRVCCGYIKQPNTDGV------------------DIKIISPETGKEND  2967
                  PV    Q         Q   DGV                  +I I+ P+T K   
Sbjct  338   EKNAQPVLATVQATAL--EQNQVVYDGVTPENRRMVVGCGQSLKDHNIVIVDPQTLKLCK  395

Query  2968  DPGKEGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITG  3147
             D  + GEIW+   S   GYWG  E +++ F+  +  +    ++RTGDLG + + +LF+TG
Sbjct  396   D-HQVGEIWVCGPSIAQGYWGKTEETKQNFQATLAESSLGPFLRTGDLGFLANGELFVTG  454

Query  3148  RTKDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGL  3327
             R KD+II+ G+N Y  D+E++VE S  LVRP C A   +               + E  L
Sbjct  455   RLKDVIIINGRNYYPQDLERSVEQSHSLVRPNCSASFSV-------------EVNGEERL  501

Query  3328  VVIAEV----RDGK--PLPYD-----------VMDHICTRVAEEHGVPIASIVAIKPRSI  3456
             V++AEV    R+ +    P D           V   I   V++ H + + +I  +KP  I
Sbjct  502   VIVAEVERHYRENRWADTPSDNGATQSSKVKAVYQSIRRAVSQHHDLQVYAIALLKPGGI  561

Query  3457  SKTTSGKIKRYECAKRFISGTLDVIEE  3537
              KT+SGKI+R+ C   F++ TL+ IEE
Sbjct  562   PKTSSGKIQRHVCRASFLAQTLNTIEE  588



>ref|WP_012412907.1| amino acid adenylation domain-containing protein [Nostoc punctiforme]
 ref|YP_001869921.1| amino acid adenylation domain-containing protein [Nostoc punctiforme 
PCC 73102]
 gb|ACC85410.1| amino acid adenylation domain protein [Nostoc punctiforme PCC 
73102]
Length=1801

 Score =   323 bits (828),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 221/701 (32%), Positives = 340/701 (49%), Gaps = 77/701 (11%)
 Frame = +1

Query  1831  KTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDA  2010
             KT + +L +      + TY+E+   A  IA +L T       PGD+VLL+Y  G +F+ A
Sbjct  30    KTAFLFLQDGETEAAKITYRELDQKAQAIAAQLQT----LTTPGDRVLLLYPSGFEFIAA  85

Query  2011  FFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAKN  2190
             F GCL A V+ +P  PP   Q+     +L +  IA       ++ST S    +   +   
Sbjct  86    FVGCLYAGVVAVPAYPPRRNQK-----MLRLQAIAIDAQATLVVSTTSVLGNINSQAENP  140

Query  2191  MLFGKSKDKSSNSWPD---LPWLHTDSWVkkpklfkkpkDEQGQPLSEDLCFLQFTSGST  2361
                G     + N  P    +P+  T                      + L FLQ+TSGST
Sbjct  141   GFLGLKCVATDNLIPIEDFIPYRAT---------------------PDTLAFLQYTSGST  179

Query  2362  TDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGIL  2541
               PKGVM+ HG ++HN +L++  ++ T +TI V WLP +HDMGLIG  L  L  G   I 
Sbjct  180   GTPKGVMLNHGNLLHNQRLIQTAFEHTEQTIFVGWLPLFHDMGLIGNTLQPLYLGIPCIF  239

Query  2542  FSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAAE  2721
              SP  F+  PL WL  +SK++AT S  PNFA++L   ++ S +    DLS+     + AE
Sbjct  240   MSPTAFLMRPLQWLMAISKYKATTSGGPNFAYDLCASKITSEERSTLDLSTWQVAFNGAE  299

Query  2722  PIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFVDWQGRVCCGYI  2901
             PIR  T++RF       G  RE   P YG+AE  + VS       PV   +Q      ++
Sbjct  300   PIRAETIERFASTFADCGFRREAFYPCYGMAETTLIVSGGLVAPPPVLQTFQKAALEQHL  359

Query  2902  KQPNTDGVD----------------IKIISPE-TGKENDDPGKEGEIWISSLSAGIGYWG  3030
               P ++  D                + I+ PE   + N D  + GEIW+SS S   GYW 
Sbjct  360   VVPASNSDDATQTLVGCGQPLQDMRVVIVHPERMTRCNSD--EIGEIWVSSASVTQGYWN  417

Query  3031  LEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDIEKT  3210
               + +Q+TF+  +  T    ++RTGDLG + D +LF+TGR KDLII+ G+N Y  DIE T
Sbjct  418   QIDSTQRTFQAYLQDTGAGPFLRTGDLGFLKDGELFVTGRLKDLIIIRGRNYYPQDIEST  477

Query  3211  VESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGKPLPYDVMD---  3381
             V+ S   +R  C A   +  D              E  LVVI EV        +V +   
Sbjct  478   VQKSHLSLRANCGAAFSVEID-------------GEERLVVIQEVERAYYRNLEVEEVVG  524

Query  3382  HICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVIE-------EQ  3540
              I + V+EEH + + ++V +KP  I KT+SGK++ Y C   F++ TLD I        + 
Sbjct  525   AIRSAVSEEHELQVYAVVLLKPGGILKTSSGKVQHYACKAGFLANTLDAIGSSILEKFDS  584

Query  3541  MNGERSLPRNDGIIVPANGKISKTDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIG  3720
               G   +   + +  PA  +  + +  ++L+ L+++   I  SK++  E L   G++S+ 
Sbjct  585   FEGIELINVEELLATPAEDRTRQLE--SYLQKLIARMLKIYPSKLNIREPLTVLGIDSLL  642

Query  3721  VVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEKN  3843
               + A +I     +++     F +  I DL + +E++L++ 
Sbjct  643   ATQIAYRIREQLKVDLPIQSFFDSATIGDLTEHIETILQEQ  683



>ref|WP_017721460.1| hypothetical protein [Oscillatoria sp. PCC 10802]
Length=729

 Score =   310 bits (794),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 220/717 (31%), Positives = 340/717 (47%), Gaps = 92/717 (13%)
 Frame = +1

Query  1831  KTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDA  2010
             +T YT+L +        TY+E+   A  IA KL    +   +PG++ LL+Y PGL+F++A
Sbjct  27    RTAYTFLRDGETEEVSLTYRELEQRAQAIAAKL----QFLAEPGERALLLYPPGLEFIEA  82

Query  2011  FFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAKN  2190
             FFGCL A V+ +P  PP        Q+L  +  I         L+T +    +    A++
Sbjct  83    FFGCLLAGVVAVPAYPPR-----ANQSLSRLQAIVADAQATLALTTTAVFSNIERKLAQS  137

Query  2191  MLFGKSKDKSSNSWPDLPWLHTDSWVkkpklfkkpkDEQGQPLSEDLCFLQFTSGSTTDP  2370
              L    +  +++S   +P      W++                   L  LQ+TSGST +P
Sbjct  138   ALLQALRCLATDS---IPSDSAQQWLEPAVS------------RHTLALLQYTSGSTGNP  182

Query  2371  KGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSP  2550
             KGVM++H  ++HN   +R+ +K T  +  VSWLP YHDMGLIGG+L  L  G   +L SP
Sbjct  183   KGVMLSHRNLLHNSAAIRQCFKDTPDSKGVSWLPPYHDMGLIGGILQPLYVGAQMVLMSP  242

Query  2551  VTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAAEPIR  2730
               F++ PL WL  +S++RAT S  PNFA++L +R++   +  N DL       + AEP+R
Sbjct  243   ADFLQRPLRWLMAISRYRATTSGGPNFAYDLCLRKIPPEQRANLDLRGWEVAFNGAEPVR  302

Query  2731  QTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFVD------WQGRVCC  2892
               TL++F    Q  G       P YG+AE  + VS    E  PV          Q RV  
Sbjct  303   AETLEQFAVAFQPCGFRASAFYPCYGMAETTLIVSGGTKEAAPVLKTVQEDALQQNRVVA  362

Query  2893  GYIKQPNTDGV-------------DIKIISPETGKENDDPGKEGEIWISSLSAGIGYWGL  3033
                   N+D                I I  PET   +  P + GEIW+S  S   GYW  
Sbjct  363   AV---RNSDAARTLVSCGQTCLEQKIVIAHPET-LTSCSPLEVGEIWVSGASVAQGYWNQ  418

Query  3034  EELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDIEKTV  3213
                +++TF   +  T    ++RTGDLG + D +LF+TGR KDLII+ G+N Y  DIE+T 
Sbjct  419   PLETERTFRAYLADTGEGPFLRTGDLGFLQDGELFVTGRIKDLIIIRGRNYYPQDIERTA  478

Query  3214  ESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDG--KPLPYD-VMDH  3384
             + S   +R GC A   +  D              E  LV+  EV     + L  D V+ +
Sbjct  479   QESHPALRAGCGAAFSVDVD-------------REERLVIAFEVERQYLRKLDADAVVKN  525

Query  3385  ICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVIEEQMNG-----  3549
             I   VAE+H + + +I+ +K  SI KT+SGKI+RY C   F++ +L+V+ +  N      
Sbjct  526   IRQAVAEQHDLEVYAILLLKTNSIPKTSSGKIQRYACRTGFLNNSLEVVSDWTNNPRMKA  585

Query  3550  ------------ERSLP----------RNDGIIVPANGKISK--TDIVNFLKDLLSQQTG  3657
                         ER L            N+     +  K+ +    I ++L   +++   
Sbjct  586   EYRHLIEEVEFLERQLQNRQLNSASGGENNAAGTASCQKVCERAEAIRDWLVSKITELLK  645

Query  3658  IPVSKISTGETLVSYGVNSIGVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVES  3828
             +   +I   + L SYG++S+  V  + ++  + G  +    ++    I+ +A  + S
Sbjct  646   LNPHEIDVRQPLTSYGLDSVAAVTLSGQMEDWLGCRLSPTLLYDHPTIESIAQHLSS  702



>ref|WP_030715083.1| hypothetical protein [Streptomyces sp. NRRL F-2580]
Length=582

 Score =   305 bits (782),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 195/555 (35%), Positives = 282/555 (51%), Gaps = 76/555 (14%)
 Frame = +1

Query  1951  IKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNP  2130
             ++PG + LL++ PG DFV AFFGCL A V+ +P   P P QR  G  LL +A IA+   P
Sbjct  63    VEPGSRALLLFTPGQDFVVAFFGCLYAGVVAVPAYLPHPAQRARG--LLRLAGIAEDAQP  120

Query  2131  VAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPDLPWLHTDSWVkkpklfkkpkDE--  2304
              A+L+T      +   +                   +P +   +W+    + ++   E  
Sbjct  121   AAVLTTADIQAFIETTART-----------------IPEIRGTAWLAVDTIPEENGAEWS  163

Query  2305  QGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHD  2484
                P  + L FLQ+TSGST  PKGVM+TH  + HN+ L+R      S T++V WLP YHD
Sbjct  164   AAAPDPDSLAFLQYTSGSTGQPKGVMVTHRNLAHNIDLIRTSLGVDSSTVVVGWLPPYHD  223

Query  2485  MGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLES  2664
             MGLI  ++   + G   +L   V F+++P+ WL+ +S +R T SAAPNFAF+L  R++  
Sbjct  224   MGLISMIILPAMVGIHSVLMPTVAFLQSPVRWLRAISTYRGTLSAAPNFAFDLCTRKVTD  283

Query  2665  SKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAY  2844
                   DLSS     + AEPIR  ++ RF E   S G   E + P YGLAE+ + VS   
Sbjct  284   EDRATLDLSSWSVATNGAEPIRADSMIRFAEAFASTGFRPETIIPVYGLAESTLLVS---  340

Query  2845  GEGLPVFVDWQGR-------------------------VCCGYIKQPNTDGVDIKIISPE  2949
               G P+   W  R                         V CG  +      +D+ ++ PE
Sbjct  341   --GAPLARPWTFRSFDENELERGFAEIVPEDGPDARVLVSCGVSRT-----LDVAVVDPE  393

Query  2950  TGKENDDPGKEGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDS  3129
                    PG+ GEIW++  S  +GYW   +LS++ FE  +  +    Y+RTGDLG   + 
Sbjct  394   KHIRC-LPGQVGEIWVAGESVAVGYWQRPDLSREAFEATLGDSGEGPYMRTGDLGFQTED  452

Query  3130  KLFITGRTKDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRA  3309
              LF+ GR KD+IIV G+N Y  DIE+T ES+   +RPGC A  G+     VS G      
Sbjct  453   GLFVCGRIKDVIIVGGRNHYPHDIERTAESAHPAIRPGCVAAFGV-----VSDG------  501

Query  3310  SDELGLVVIAEVR----DGKPL--PYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTS  3471
               E  +VV AE+R    DGK    P  V + +   V +EH +    IV +   ++ KT+S
Sbjct  502   --EETVVVAAELRREAADGKDAAEPESVANAVRRAVMQEHRLTARDIVLLPAGTLPKTSS  559

Query  3472  GKIKRYECAKRFISG  3516
             GK++R E  K +++G
Sbjct  560   GKLQRGETRKEYLAG  574



>ref|XP_008903131.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
 ref|XP_008903132.1| hypothetical protein, variant 3 [Phytophthora parasitica INRA-310]
 gb|ETI50885.1| hypothetical protein, variant 2 [Phytophthora parasitica P1569]
 gb|ETI50886.1| hypothetical protein, variant 3 [Phytophthora parasitica P1569]
 gb|ETN11323.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
 gb|ETN11324.1| hypothetical protein, variant 3 [Phytophthora parasitica INRA-310]
Length=712

 Score =   309 bits (792),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 215/588 (37%), Positives = 319/588 (54%), Gaps = 51/588 (9%)
 Frame = +1

Query  1948  AIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCN  2127
              +  GD+VLL+Y PGLDF+  F  CL+A V+ +P  PPD   R   + +    ++ + C 
Sbjct  20    GLNQGDRVLLVYPPGLDFIVVFLACLKAGVVAVPVYPPD--PRKMKKDISMFVSVTQNCQ  77

Query  2128  PVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPD-LPWLHTDSWVkkpklfkkpkDE  2304
                 L T S +  V+ +SA    F  S    +  WP+ L W+ TD  V    +       
Sbjct  78    AKTAL-TCSMYYNVKKISAIKEKFTFS---GAAQWPEHLNWVVTDDLVDTKGIDPAKHWL  133

Query  2305  QGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHD  2484
                P ++   FLQ+TSGST+ PKGV+++HG + HN++ +    ++   T++VSWLPQYHD
Sbjct  134   TQSPSADSTAFLQYTSGSTSAPKGVVLSHGNLNHNLRTISSALQAGRDTVVVSWLPQYHD  193

Query  2485  MGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLES  2664
             MGLIG  L  + +GG G+  SP +F+++P LWL+ +SK RATH  APNFA+ LL R+ + 
Sbjct  194   MGLIGAYLGTIFNGGKGVYLSPFSFIRDPCLWLRLVSKHRATHLQAPNFAYSLLARKSDR  253

Query  2665  -----SKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVF  2829
                  +  ++ DLSS+  +++ AEPI+   +  F      FGL   V+ P YGLAE+ V+
Sbjct  254   LTVGLASGQHVDLSSVRHMINGAEPIQGEAIDNFYRAFSPFGLPEGVVKPTYGLAEHTVY  313

Query  2830  VSCAYGEGLPVFVDWQ----GRV--------CCGYIKQ------PNTD--GVDIKIISPE  2949
             V C  G+   ++VD Q     RV          G +K+      P+    G+D++I+  E
Sbjct  314   V-CGGGQQR-LWVDKQELESNRVFRVVEKTNTAGLVKEMIGCGVPSRKDYGIDVRIVDAE  371

Query  2950  TGKENDDPGKEGEIWISSLSAGIGYWG--LEELSQKTFENDILS-TPGKRYIRTGDLGRI  3120
             T +E    G+ GEIWISS S   GY+G  + E S + F+  ++  T GK +++TGDLG I
Sbjct  372   T-EEEKPEGETGEIWISSASKARGYYGDEMREFSAEAFQAKVVGDTEGKTFLKTGDLGVI  430

Query  3121  IDSKLFITGRTKDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILT  3300
              + +LFI GR KDL+I+ G+N Y  D+E + ES  EL RPGCCA              L 
Sbjct  431   YNQELFICGRMKDLVIIRGRNHYPQDLEASAESHEEL-RPGCCAAF----------SYLA  479

Query  3301  QRASDELGLVVIAEVRD-GKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGK  3477
                +D+  L V+AE+RD        +   I + +A EHGV +  +V + PRSI KTTSGK
Sbjct  480   DGNADDEQLAVVAELRDPAMTSKASLCGKIRSAIAREHGVKVTLVVLLSPRSIPKTTSGK  539

Query  3478  IKRYECAKRFISGTLDVIEEQMNGERSLP-RNDGIIVPANGKISKTDI  3618
             I R  C K     TL+ +    +    +P  +DG  V   G+    ++
Sbjct  540   ISRSRCKKALEEKTLEELYRNEDMIADVPVEDDGGDVAVAGETMNRNV  587



>gb|ETK90788.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETK90789.1| hypothetical protein, variant 3 [Phytophthora parasitica]
Length=712

 Score =   309 bits (791),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 215/588 (37%), Positives = 319/588 (54%), Gaps = 51/588 (9%)
 Frame = +1

Query  1948  AIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCN  2127
              +  GD+VLL+Y PGLDF+  F  CL+A V+ +P  PPD   R   + +    ++ + C 
Sbjct  20    GLNQGDRVLLVYPPGLDFIVVFLACLKAGVVAVPVYPPD--PRKMKKDISMFVSVTQNCQ  77

Query  2128  PVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPD-LPWLHTDSWVkkpklfkkpkDE  2304
                 L T S +  V+ +SA    F  S    +  WP+ L W+ TD  V    +       
Sbjct  78    AKTAL-TCSMYYNVKKISAIKEKFTFS---GAAQWPEHLNWVVTDDLVDTKGIDPAKHWL  133

Query  2305  QGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHD  2484
                P ++   FLQ+TSGST+ PKGV+++HG + HN++ +    ++   T++VSWLPQYHD
Sbjct  134   TQSPSADSTAFLQYTSGSTSAPKGVVLSHGNLNHNLRTISSALQAGRDTVVVSWLPQYHD  193

Query  2485  MGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLES  2664
             MGLIG  L  + +GG G+  SP +F+++P LWL+ +SK RATH  APNFA+ LL R+ + 
Sbjct  194   MGLIGAYLGTIFNGGKGVYLSPFSFIRDPCLWLRLVSKHRATHLQAPNFAYSLLARKSDR  253

Query  2665  -----SKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVF  2829
                  +  ++ DLSS+  +++ AEPI+   +  F      FGL   V+ P YGLAE+ V+
Sbjct  254   LTVGLASGQHVDLSSVRHMINGAEPIQGEAIDNFYRAFSPFGLPEGVVKPTYGLAEHTVY  313

Query  2830  VSCAYGEGLPVFVDWQ----GRV--------CCGYIKQ------PNTD--GVDIKIISPE  2949
             V C  G+   ++VD Q     RV          G +K+      P+    G+D++I+  E
Sbjct  314   V-CGGGQQR-LWVDKQELESNRVFRVVEKTNTAGLVKEMIGCGVPSRKDYGIDVRIVDAE  371

Query  2950  TGKENDDPGKEGEIWISSLSAGIGYWG--LEELSQKTFENDILS-TPGKRYIRTGDLGRI  3120
             T +E    G+ GEIWISS S   GY+G  + E S + F+  ++  T GK +++TGDLG I
Sbjct  372   T-EEEKPEGETGEIWISSASKARGYYGDEMREFSAEAFQAKVVGDTEGKTFLKTGDLGVI  430

Query  3121  IDSKLFITGRTKDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILT  3300
              + +LFI GR KDL+I+ G+N Y  D+E + ES  EL RPGCCA              L 
Sbjct  431   YNQELFICGRMKDLVIIRGRNHYPQDLEASAESHEEL-RPGCCAAF----------SYLA  479

Query  3301  QRASDELGLVVIAEVRD-GKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGK  3477
                +D+  L V+AE+RD        +   I + +A EHGV +  +V + PRSI KTTSGK
Sbjct  480   DGNADDEQLAVVAELRDPAMTSKASLCGKIRSAIAREHGVKVTLVVLLAPRSIPKTTSGK  539

Query  3478  IKRYECAKRFISGTLDVIEEQMNGERSLP-RNDGIIVPANGKISKTDI  3618
             I R  C K     TL+ +    +    +P  +DG  V   G+    ++
Sbjct  540   ISRSRCKKALEEKTLEELYRNEDMIADVPVEDDGGDVAVAGETMNRNV  587



>ref|WP_007167737.1| fatty acyl-AMP ligase [Mycobacterium parascrofulaceum]
 gb|EFG76404.1| AMP-binding enzyme [Mycobacterium parascrofulaceum ATCC BAA-614]
Length=1079

 Score =   317 bits (812),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 220/607 (36%), Positives = 307/607 (51%), Gaps = 67/607 (11%)
 Frame = +1

Query  1816  GVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGL  1995
              +T +KTL+ +++++G   +  TY+        +A  L  + +  ++PGD+ LL+Y PGL
Sbjct  13    ALTPDKTLFRFVDDEGREQEHYTYQSFAERTRELAAYL--TAEAGLRPGDRALLVYPPGL  70

Query  1996  DFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRI  2175
             + V AF+ C R  VI +P  PP P     G  L  +A IA+ C   A+LST  +    R+
Sbjct  71    EMVAAFYACARIGVIAVPVSPPLPMSFESG--LAKLAFIARDCQARAVLSTKQFEYDYRL  128

Query  2176  MSAKNMLFGKSKDKSSNSWPDLPWLHTDSWVkkpklfkkpkDEQGQPLSED---LCFLQF  2346
             M   N L   S  +     P+LPW  TD            +D  G P+ +    + FLQ+
Sbjct  129   M--LNHLDDGSPWQGDRRPPELPWFGTDG----------TQDFGGTPVPDTPGPVLFLQY  176

Query  2347  TSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSG  2526
             TSGST+DPKGV+++H  VI N              +LVSWLPQ+HDMGLI   L I + G
Sbjct  177   TSGSTSDPKGVVVSHANVIANASAF------AGGEVLVSWLPQHHDMGLISAYLFIPLIG  230

Query  2527  GSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVR--RLESSKEENFDLSSMH  2700
             G+    SP+ F+K P  WL+ +S  RATH+  PNFA EL +R  +L SS+ E  DLSS+ 
Sbjct  231   GTTHAMSPLDFLKRPSSWLRLISDVRATHTPVPNFALELCLREDKLPSSELEGIDLSSLE  290

Query  2701  FLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSC-----------AYG  2847
              ++  AEP+R +T  RF E     GL    +   YG+AEN + VS            A  
Sbjct  291   NIVVGAEPLRASTFARFRERFAPHGLQPNALTGAYGMAENTLIVSLCGRQTLALNKRALE  350

Query  2848  EGLPVFVDWQGR-------VCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSL  3006
               L      Q R       V CG   +P  DG  ++I+ PE+G    + G+ GE+W+   
Sbjct  351   NNLARVEKAQPRNSNQAPVVSCG---KP-IDGNVVRIVDPESGSALGE-GRVGEVWLDGP  405

Query  3007  SAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNI  3186
             S G GYW    L+ + F   I       Y+RTGDLG + + +LF+ GR+KDLIIV G N 
Sbjct  406   SKGGGYWNRPALTAEAFAARIPGDDDHTYLRTGDLGFLYEGELFVCGRSKDLIIVRGVNC  465

Query  3187  YTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGKPLP  3366
             Y SDIE  VE S+  VR GC A   +  D             ++  L V+AEVRD   LP
Sbjct  466   YPSDIEGIVERSAAQVRGGCVAAFAVERD-------------EQEVLTVVAEVRDQHALP  512

Query  3367  YDVMDHICTRVAEEHG-VPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVIEEQM  3543
                      R    HG +   +IV + P SI KTTSGKI+R    + ++ G L V+    
Sbjct  513   D---GKALARAIRRHGHIDPHTIVFVPPHSIPKTTSGKIRRSSTRQLWLDGKLPVLSVYT  569

Query  3544  NGERSLP  3564
             +    LP
Sbjct  570   HQPHDLP  576



>ref|WP_008185335.1| AMP-forming acyl-CoA synthetase [Moorea producens]
 gb|EGJ32276.1| AMP-forming acyl-CoA synthetase [Moorea producens 3L]
Length=592

 Score =   305 bits (782),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 211/605 (35%), Positives = 304/605 (50%), Gaps = 79/605 (13%)
 Frame = +1

Query  1840  YTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFG  2019
             YT+L +        TY+++   A  IA  L    +    PG+  LL+Y PGLD++ AFFG
Sbjct  28    YTFLVDGETEQVSLTYQQLEQQAQAIAFHL----QSIYSPGETALLLYPPGLDYICAFFG  83

Query  2020  CLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAKNMLF  2199
             CL A V+ +P  PP P      ++L+ +  I K       L+T +      I+S     F
Sbjct  84    CLYAGVVAVPAYPPRP-----NRSLVRVQGIVKDSLARVALTTQA------ILSNLERRF  132

Query  2200  GKSKDKSSNSWPDLPWLHTDSWVkkpklfkkpkDEQGQPL--SEDLCFLQFTSGSTTDPK  2373
              ++        P+L  LH   W+    +         QP      L FLQ+TSGST  PK
Sbjct  133   TEA--------PELKTLH---WLATENINGNLAQSWQQPAIDGSTLAFLQYTSGSTAAPK  181

Query  2374  GVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPV  2553
             GVMI+H  ++HN   + K +  T  +  V WLP YHDMGLIGG+L  L  G    L SP+
Sbjct  182   GVMISHSNLVHNSAAIYKYFGHTDHSSGVIWLPMYHDMGLIGGILQPLYGGFPATLMSPL  241

Query  2554  TFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAAEPIRQ  2733
              F+++P+ WL+ +S +RAT S  PN A++L VR+++  +  N DLSS     + AEPI  
Sbjct  242   MFLQSPIRWLKVISHYRATSSGGPNLAYDLCVRKIKPEQLTNLDLSSWDLAFNGAEPINF  301

Query  2734  TTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYG---------EG--------LPV  2862
               L+RF    +S G  RE   P YG+AE  + VS             EG        +P 
Sbjct  302   AILERFATKFESCGFRREAFYPCYGMAEATLMVSGGVKSAPIVLRTVEGAALEQNHVVPA  361

Query  2863  FVDWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGIGYWGLEEL  3042
              V+ +G +      Q   D   I I+ PET     DPG+ GEIW+S  S   GYW     
Sbjct  362   SVEQEGTLTLVGCGQSLPDQ-QIVIVHPET-LTRCDPGQVGEIWVSGPSIAQGYWNQPAT  419

Query  3043  SQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDIEKTVESS  3222
             +++ F   + S   K ++RTGDLG ++D +LFITGR KDLII+ G+N Y  DIE TVE++
Sbjct  420   TERNFRVTLASMGEKPFLRTGDLGFMLDGELFITGRLKDLIIINGRNHYPQDIEWTVENT  479

Query  3223  SELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEV-------------------  3345
               L+RP C A   +               + E  LVVIAEV                   
Sbjct  480   HSLLRPTCSAAFSV-------------NIAGEEQLVVIAEVERSYWKSTRLAASDPGNGA  526

Query  3346  RDGKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLD  3525
             +D      +++  I   V + H +P+ + + +KP +I KT+SGKI+R+ C + F++GTL 
Sbjct  527   KDHALDSKELIRLIRRAVLQHHDLPVHTALLLKPGTIPKTSSGKIQRHACRQSFMAGTLA  586

Query  3526  VIEEQ  3540
             VI ++
Sbjct  587   VINDR  591



>gb|ETL97361.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETL97362.1| hypothetical protein, variant 3 [Phytophthora parasitica]
 gb|ETO79647.1| hypothetical protein, variant 2 [Phytophthora parasitica P1976]
 gb|ETO79648.1| hypothetical protein, variant 3 [Phytophthora parasitica P1976]
Length=712

 Score =   309 bits (791),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 211/560 (38%), Positives = 309/560 (55%), Gaps = 50/560 (9%)
 Frame = +1

Query  1936  SQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIA  2115
             S+   +  GD+VLL+Y PGLDF+  F  CL+A V+ +P  PPD   R   + +    ++ 
Sbjct  16    SKGLGLNQGDRVLLVYPPGLDFIVVFLACLKAGVVAVPVYPPD--PRKMKKDISMFVSVT  73

Query  2116  KVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPD-LPWLHTDSWVkkpklfkk  2292
             + C     L T S +  V+ +SA    F  S    +  WP+ L W+ TD  V    +   
Sbjct  74    QNCQAKTAL-TCSMYYNVKKISAIKEKFTFS---GAAQWPEHLNWVVTDDLVDTKGIDPA  129

Query  2293  pkDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLP  2472
                    P ++   FLQ+TSGST+ PKGV+++HG + HN++ +    ++   T++VSWLP
Sbjct  130   KHWLTQSPSADSTAFLQYTSGSTSAPKGVVLSHGNLNHNLRTISSALQAGRDTVVVSWLP  189

Query  2473  QYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVR  2652
             QYHDMGLIG  L  + +GG G+  SP +F+++P LWL+ +SK RATH  APNFA+ LL R
Sbjct  190   QYHDMGLIGAYLGTIFNGGKGVYLSPFSFIRDPCLWLRLVSKHRATHLQAPNFAYSLLAR  249

Query  2653  RLES-----SKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAE  2817
             + +      +  ++ DLSS+  +++ AEPI+   +  F      FGL   V+ P YGLAE
Sbjct  250   KSDRLTVGLASGQHVDLSSVRHMINGAEPIQGEAIDNFYRAFSPFGLPEGVVKPTYGLAE  309

Query  2818  NCVFVSCAYGEGLPVFVDWQ----GRV--------CCGYIKQ------PNTD--GVDIKI  2937
             + V+V C  G+   ++VD Q     RV          G +K+      P+    G+D++I
Sbjct  310   HTVYV-CGGGQQR-LWVDKQELESNRVFRVVEKTNTAGLVKEMIGCGVPSRKDYGIDVRI  367

Query  2938  ISPETGKENDDPGKEGEIWISSLSAGIGYWG--LEELSQKTFENDIL-STPGKRYIRTGD  3108
             +  ET +E    G+ GEIWISS S   GY+G  + E S + F+  ++  T GK +++TGD
Sbjct  368   VDAET-EEEKPEGETGEIWISSASKARGYYGDEMREFSAEAFQAKVVGDTEGKTFLKTGD  426

Query  3109  LGRIIDSKLFITGRTKDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSK  3288
             LG I + +LFI GR KDL+I+ G+N Y  D+E + ES  EL RPGCCA            
Sbjct  427   LGVIYNQELFICGRMKDLVIIRGRNHYPQDLEASAESHEEL-RPGCCAAF----------  475

Query  3289  GILTQRASDELGLVVIAEVRD-GKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKT  3465
               L    +D+  L V+AE+RD        +   I + +A EHGV +  +V + PRSI KT
Sbjct  476   SYLADGNADDEQLAVVAELRDPAMTSKASLCGKIRSAIAREHGVKVTLVVLLSPRSIPKT  535

Query  3466  TSGKIKRYECAKRFISGTLD  3525
             TSGKI R  C K     TL+
Sbjct  536   TSGKISRSRCKKALEEKTLE  555



>gb|KFA92020.1| hypothetical protein Q664_18055 [Cystobacter violaceus Cb vi76]
Length=1168

 Score =   318 bits (815),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 222/729 (30%), Positives = 347/729 (48%), Gaps = 78/729 (11%)
 Frame = +1

Query  1840  YTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFG  2019
             YT+L +      R TY  +   A  I   L   Q+   + G++VLL+Y PGLD+V AF G
Sbjct  29    YTFLVDGETEEARLTYAGLDARARAIGGLL---QERGAR-GERVLLLYPPGLDYVTAFVG  84

Query  2020  CLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAK----  2187
             C+ A                       IA  A   +P+ +  T    +   I  A+    
Sbjct  85    CIYAGA---------------------IAVPAYPPDPMRLGRTLP-RLEALISDARARFA  122

Query  2188  --NMLFGKSKDKSSNSWPDLPWLHTDSWVkkpklfkkpkDEQGQP--LSEDLCFLQFTSG  2355
               N L     D  +  +P L  L   +WV   ++          P    E L FLQ+TSG
Sbjct  123   LTNELIRSMADGLAEQFPGLAGL---TWVATDEVPADAASAWKDPGLTRESLAFLQYTSG  179

Query  2356  STTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSG  2535
             ST  P+GVM++HG ++HN   +++ ++ +  ++ V WLP YHDMGLIGG+L  L +G   
Sbjct  180   STGTPRGVMLSHGNLLHNSTAIQRGFEPSPGSVGVIWLPPYHDMGLIGGVLQPLFAGIPV  239

Query  2536  ILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSA  2715
             +L SP+ F+K P+ WL+ +S++R THS  PNFA++L VR+    +    DLS+     + 
Sbjct  240   VLMSPLDFLKRPVRWLEAISRYRGTHSGGPNFAYDLCVRKTTPEQRAALDLSTWRLAFNG  299

Query  2716  AEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFVDWQ----GR  2883
             AEP+R +T+ RF E     G  RE   P YGLAE  + V+       PV  DW+    GR
Sbjct  300   AEPVRASTMDRFAEAFAVSGFRREAFYPCYGLAEGTLLVTGGRMGARPVVHDWKQEGSGR  359

Query  2884  VC----CGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGIGYWGLEELSQK  3051
             V     CG     +    ++ I  PET     + G+ GEIW+   S   GYWG  E +++
Sbjct  360   VSQLVGCGT----SVLDQELLIAHPETLAPVPE-GQVGEIWVRGGSIAQGYWGRPEQTEQ  414

Query  3052  TFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDIEKTVESSSEL  3231
             +F      T    ++RTGDLG ++  +LF+ GR KDLII+ G+N+Y  D+E+T E+S   
Sbjct  415   SFRARRSDTGDGPWLRTGDLGFLVGGELFVAGRIKDLIILRGRNLYPQDLEQTAEASHPA  474

Query  3232  VRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGK-PLPYDVMDHICTRVAEE  3408
             +RPGC A  G+  DV             +  LV++ EV   K P P + ++ I   +AE+
Sbjct  475   LRPGCSAAFGL--DV-----------EGQEQLVLVHEVDRAKLPEPAEAVEAIRRAIAEQ  521

Query  3409  HGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVIEEQ--MNGERSLP------  3564
             H V    +V +    I KT+SGKI+R  C   +++G L+++ E   +    + P      
Sbjct  522   HEVAPGRVVLVPAGHIPKTSSGKIQRGTCRAMYLAGELELVTESAVLQAASTAPAEPPAL  581

Query  3565  -RNDGIIVPANGKISKTDIVNFLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQK  3741
              R   +  P   +     +   L+  L++   +PVS +     L ++G++SI  +     
Sbjct  582   TREALLGAPETERPRL--LGEHLRHRLARALAVPVSALDEARPLTAFGLDSIHAIELKGA  639

Query  3742  ISSFFGINIGAIDIFSATCIDDLADFVESLLEKNHPMLTNSSETKISSSGIPSVVSTFDK  3921
             +    GI++    +     +  L       LE  HP  +     + +S G    +S   +
Sbjct  640   LEEELGIHLPMALLLDGVSLGTL---TTRALEALHPAPSAPPPLEPASHGPHPPLSYGQE  696

Query  3922  ITIWLIHLV  3948
               ++L  L 
Sbjct  697   RLLFLEQLA  705



>ref|WP_002735558.1| AMP-binding enzyme family protein [Microcystis aeruginosa]
 gb|ELP53462.1| AMP-binding enzyme family protein [Microcystis aeruginosa TAIHU98]
Length=726

 Score =   309 bits (791),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 212/612 (35%), Positives = 308/612 (50%), Gaps = 61/612 (10%)
 Frame = +1

Query  1756  GVKFPELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLT  1935
             G  F ++S+    L H         +T Y +L        R TY+++   A  +A +L  
Sbjct  12    GEIFQDISTFVDILSHRALQQA--EQTAYIFLANGETETARLTYQQLDQKAKALAAQL--  67

Query  1936  SQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIA  2115
               +  + PG++ LL+Y  G +F+ AFF CL A VI +P  PP   Q+     L  +  I 
Sbjct  68    --QLQMSPGERALLLYPSGEEFIIAFFACLYAGVIAVPVYPPRRNQK-----LSRLRAIT  120

Query  2116  KVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPDLPWLHTDSWVkkpklfkkp  2295
             +       L+T S   T+    + +         ++N+ PD      ++W          
Sbjct  121   RDAQAKLALTTTSLLSTIEEKFSSDPELVTVPCLATNNIPDE---QAENW----------  167

Query  2296  kDEQGQPLS-EDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLP  2472
                Q   LS ED+ FLQ+TSGST  PKGVM++H  ++HN KL+   +  T+ TI+V WLP
Sbjct  168   ---QKLNLSLEDIAFLQYTSGSTGMPKGVMVSHKNLLHNEKLIASAFGHTTETIVVGWLP  224

Query  2473  QYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVR  2652
              +HDMGLIG +L  +  G   ++  P  F++ PL WLQ +S+++AT S  PNFA+EL   
Sbjct  225   LFHDMGLIGNVLQPIYVGFPSVIMPPEAFIQKPLRWLQAISRYKATSSGGPNFAYELCAS  284

Query  2653  RLESSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFV  2832
             +++  + EN DLS      + AEP+R  TL++F       G  RE   P YG+AE  +FV
Sbjct  285   KIKPQERENLDLSCWDVAFNGAEPVRAITLEKFANTFADSGFEREAFYPCYGMAETTLFV  344

Query  2833  SCAYGEGLPVF--VD----WQGRVCCGYIKQPNTD----------GVDIKIISPETGKEN  2964
             S       PV   VD     +        + PN               I I++PE+  E 
Sbjct  345   SGGIKSQSPVIEAVDKLALLENSAVTINCQHPNAQLLVGCGHAWLSEKIVIVNPESLTEC  404

Query  2965  DDPGKEGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFIT  3144
              D G+ GEIW+SS S   GYW     +++TF+  +  T    ++RTGDLG ++  +LFIT
Sbjct  405   RD-GEIGEIWVSSDSVAQGYWNRPGQTEETFKAYLADTQVGPFLRTGDLGFLLAGELFIT  463

Query  3145  GRTKDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELG  3324
             GR KDLIIV G+N Y  DIE TVE S   +R GC AV  +               + +  
Sbjct  464   GRLKDLIIVQGRNHYPQDIEATVEKSHLGLRQGCGAVFSV-------------EIAGQER  510

Query  3325  LVVIAEVRDGKPLPYD---VMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYEC  3495
             LVV+ EV        D   V++ I   VAEEH + + ++  +K  SI KT+SGKI+R  C
Sbjct  511   LVVVQEVERSYLRKLDSPAVIEQIIRSVAEEHQLDVYAVALLKTASIPKTSSGKIQRIAC  570

Query  3496  AKRFISGTLDVI  3531
                F++GTLDVI
Sbjct  571   RTAFLAGTLDVI  582



>ref|WP_019505670.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=595

 Score =   305 bits (781),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 204/609 (33%), Positives = 310/609 (51%), Gaps = 71/609 (12%)
 Frame = +1

Query  1828  NKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIY--VPGLDF  2001
             N+T YT+L +  +     TY+E+   A  IA +LLT     +KPGD+ LL+Y    GL+F
Sbjct  20    NQTAYTFLADGENESGSCTYQELDLQARAIAVQLLTK----VKPGDRALLVYPYTAGLEF  75

Query  2002  VDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILST--FSYHVTVRI  2175
             + +F GCL A VI +   P     R   ++L    +    C     L+T  F+  V  + 
Sbjct  76    IASFLGCLYAGVIAVTDYP-----RQHIKSLNQYQDRIIDCQAAIALTTQEFADRVKGQF  130

Query  2176  MSAKNMLFGKSKDKSSNSWPDLPWLHTDSWVkkpklfkkpkDEQGQPLSEDLCFLQFTSG  2355
             ++  +M     K K+      LPW+ +D       L    K +Q    S  L +LQ+TSG
Sbjct  131   IANPSMAL---KLKA------LPWIASDR----VDLDLAAKWQQPNITSNTLAYLQYTSG  177

Query  2356  STTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSG  2535
             ST  PKGVMITHG V+HN +++ + +    RT ++ WLP +HDMGL+GG++  L +G   
Sbjct  178   STGQPKGVMITHGNVLHNSEVIYQSFGHHDRTKILMWLPMFHDMGLVGGVMQPLYTGLPA  237

Query  2536  ILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSA  2715
             +L SP+   + P LWLQ MS+++ T S  PNFA++LL +++   +  + DLS+     + 
Sbjct  238   VLMSPIALAQKPFLWLQAMSRYQITTSGGPNFAYDLLCQKVTDEQRASLDLSNWEVAFAG  297

Query  2716  AEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFV---------  2868
             AEP+R  TL +FVEL Q  G  +E   P YG+AE  +F++       P+           
Sbjct  298   AEPVRAETLAKFVELYQPCGFRKEAFYPCYGMAEATLFITGGNARKQPIITHIDKTALTE  357

Query  2869  -----------DWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAG  3015
                        + +  V CGY    +  G +I I+ PET    D     GEIW       
Sbjct  358   DQVVSVTPDHPNAKAVVSCGY----SWLGDEIIIVDPETKTLCDGV---GEIWTVGKGIA  410

Query  3016  IGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTS  3195
             +GYW  +E ++ TF+  + + P + Y+RTGDLG I D +L+ITGR KD++I+ G+N Y  
Sbjct  411   LGYWQRDEQTKNTFQATLANNPDQTYLRTGDLGFIKDGELYITGRIKDMMILWGRNHYPQ  470

Query  3196  DIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVR--DGKPL-P  3366
              IE+TVES    +RP   A   I               + E  LV+  E+   D + L  
Sbjct  471   HIEETVESCHPALRPNHGAAFSI-------------EVNGEEQLVIAHEINRTDLRNLNA  517

Query  3367  YDVMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVIEEQMN  3546
              +V+  I   V E++   + ++  +K  SI KT+SGKI+R  C   F+ G+L+ +     
Sbjct  518   EEVIGAIRLAVGEQNLANVFAVALLKTGSIPKTSSGKIQRRACQSMFLDGSLNTVAHWQQ  577

Query  3547  GERSLPRND  3573
              E  +P  D
Sbjct  578   SE--IPDTD  584



>ref|WP_015198212.1| amino acid adenylation protein [Calothrix parietina]
 ref|YP_007137547.1| amino acid adenylation protein [Calothrix sp. PCC 6303]
 gb|AFZ01575.1| amino acid adenylation domain protein [Calothrix sp. PCC 6303]
Length=1803

 Score =   322 bits (825),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 238/737 (32%), Positives = 354/737 (48%), Gaps = 79/737 (11%)
 Frame = +1

Query  1828  NKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVD  2007
             N+T +T+L +      + TY+E+   A  +A KL    +     G + LL+Y  GLDF+ 
Sbjct  46    NQTAFTYLLDGETEQLKLTYQELDRLARRVAAKL----QELDLTGQRALLLYPAGLDFLI  101

Query  2008  AFFGCLRARVipiptippdptQRGGG--QALLHIANIAKVCNPVAILSTFSYHVTVRIMS  2181
             AFFGCL A V+ +   PP   QR     QA+   A  A       ILST        +M+
Sbjct  102   AFFGCLYAGVVAVTAYPPRN-QRNTPRIQAISADAQAAIALTTTEILSTVQ-----SLMT  155

Query  2182  AKNMLFGKSKDKSSNSWPDLPWLHTDSWVkkpklfkkpkDEQGQPLSEDLCFLQFTSGST  2361
              K  L              L WL TD+  +  +   +  +      +  L FLQ+TSGST
Sbjct  156   EKTEL------------QSLQWLTTDNLTEGLEDCWQKPNIN----TNTLAFLQYTSGST  199

Query  2362  TDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGIL  2541
               PKGVMI+HG ++HN +   +  + +  +  V+WLP YHDMGLIGG+L  L  G   ++
Sbjct  200   GIPKGVMISHGNLLHNAQTTYQFMEHSPESKFVTWLPMYHDMGLIGGILQPLYGGFPCLI  259

Query  2542  FSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAAE  2721
               P +F++ P  WLQ +S+++ T S  PNFA++L V+++   ++   DLSS     + AE
Sbjct  260   MPPASFLQRPYRWLQAISRYQGTTSGGPNFAYDLCVQKITPEQKATLDLSSWSVAFNGAE  319

Query  2722  PIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFV-----------  2868
             PIR  TL+RF E     G  RE   P YG+AE  + +S       P              
Sbjct  320   PIRHDTLERFAEAFSQCGFRREAFYPCYGMAETTLMISGVQKATSPQVKSVLRSALESNR  379

Query  2869  -----------DWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAG  3015
                        D    V CG I      G  + II+PET K + +  + GEIW+S LS G
Sbjct  380   VVKSSVTGGNEDPHHFVSCGRI----IPGQKVIIINPETLK-SCEADEIGEIWVSGLSVG  434

Query  3016  IGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTS  3195
              GYW  +E +  TF+  +  T    ++RTGDLG + D +LFITGR KDLII+ G+N+Y  
Sbjct  435   QGYWNRQEETADTFDAYVSDTREGPFLRTGDLGFLQDEELFITGRAKDLIIIRGRNLYPQ  494

Query  3196  DIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVR-DGKPLPYD  3372
             DIE T E S   +RPG  A               T   SDE  LV++ E+    +P   +
Sbjct  495   DIELTAERSHSSLRPGASAA-------------FTVEVSDEEKLVIVQELEFRARPNIEE  541

Query  3373  VMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVIEEQ-MNG  3549
             V++ I   V EEH V + ++V IKP SI KT+SGKI+R     +F +G L+++    +  
Sbjct  542   VVNAIRQAVTEEHEVLVYAVVLIKPGSIPKTSSGKIQRCTTCTQFENGELNIVSSNILKN  601

Query  3550  ERSLPRNDGIIVPANGKISKTDIVNFLKDLLSQQTG----IPVSKISTGETLVSYGVNSI  3717
             + +  ++  +       +S  +    L+  L +Q G    I  S I   E L S G++S+
Sbjct  602   KNTTSKSTQLQGSQLLSLSPKECQALLESYLIEQQGRVLAIASSDIHPEEPLTSLGLDSL  661

Query  3718  GVVRAAQKISSFFGINIGAIDIFSATCIDDLADFVESLLEKNHPMLTNSSETKISSSGIP  3897
              V     +I +   + I   D+FS      L   V  +L++       S       +  P
Sbjct  662   KVFDLKNQIETDLEVEISVTDLFSGMSTRSL---VTKILDQVATKELPSPPVTHHRNNPP  718

Query  3898  SVVS--TFDKITIWLIH  3942
             ++    +F +  +W IH
Sbjct  719   TLTYPLSFTQQGLWFIH  735



>gb|ETP48595.1| hypothetical protein, variant 5 [Phytophthora parasitica P10297]
 gb|ETP48596.1| hypothetical protein, variant 6 [Phytophthora parasitica P10297]
Length=712

 Score =   308 bits (790),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 230/670 (34%), Positives = 352/670 (53%), Gaps = 79/670 (12%)
 Frame = +1

Query  1936  SQKPAIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIA  2115
             S+   +  GD+VLL+Y PGLDF+  F  CL+A V+ +P  PPD   R   + +    ++ 
Sbjct  16    SKGLGLNQGDRVLLVYPPGLDFIVVFLACLKAGVVAVPVYPPD--PRKMKKDISMFVSVT  73

Query  2116  KVCNPVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPD-LPWLHTDSWVkkpklfkk  2292
             + C     L T S +  V+ +SA    F  S    +  WP+ L W+ TD  V    +   
Sbjct  74    QNCQAKTAL-TCSMYYNVKKISAIKEKFTFS---GAAQWPEHLNWVVTDDLVDTKGIDPA  129

Query  2293  pkDEQGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLP  2472
                    P ++   FLQ+TSGST+ PKGV+++HG + HN++ +    ++   T++VSWLP
Sbjct  130   KHWLTQSPSADSTAFLQYTSGSTSAPKGVVLSHGNLNHNLRTISSALQAGRDTVVVSWLP  189

Query  2473  QYHDMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVR  2652
             QYHDMGLIG  L  + +GG G+  SP +F+++P LWL+ +SK RATH  APNFA+ LL R
Sbjct  190   QYHDMGLIGAYLGTIFNGGKGVYLSPFSFIRDPCLWLRLVSKHRATHLQAPNFAYSLLAR  249

Query  2653  RLES-----SKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAE  2817
             + +      +  ++ DLSS+  +++ AEPI+   +  F      FGL   V+ P YGLAE
Sbjct  250   KSDRLTVGLASGQHVDLSSVRHMINGAEPIQGEAIDNFYRAFSPFGLPEGVVKPTYGLAE  309

Query  2818  NCVFVSCAYGEGLPVFVDWQ----GRV--------CCGYIKQ------PNTD--GVDIKI  2937
             + V+V C  G+   ++VD Q     RV          G +K+      P+    G+DI+I
Sbjct  310   HTVYV-CGGGQQR-LWVDKQELESNRVFRVVEKTNTAGLVKEMIGCGVPSRKDYGIDIRI  367

Query  2938  ISPETGKENDDPGKEGEIWISSLSAGIGYWG--LEELSQKTFENDIL-STPGKRYIRTGD  3108
             +  ET +E    G+ GEIWISS S   GY+G  + E S + F+  ++  T GK +++TGD
Sbjct  368   VDAET-EEEKPEGETGEIWISSASKARGYYGDEMREFSAEAFQAKVVGDTEGKTFLKTGD  426

Query  3109  LGRIIDSKLFITGRTKDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSK  3288
             LG I + +LFI GR KDL+I+ G+N Y  D+E + ES  EL RPGCCA            
Sbjct  427   LGVIYNQELFICGRMKDLVIIRGRNHYPQDLEASAESHEEL-RPGCCAAF----------  475

Query  3289  GILTQRASDELGLVVIAEVRD-GKPLPYDVMDHICTRVAEEHGVPIASIVAIKPRSISKT  3465
               L    +D+  L V+AE+RD        +   I + +A EHGV +  +V + P SI KT
Sbjct  476   SYLADGNADDEQLAVMAELRDPAMTSKASLCGKIRSAIAREHGVKVTLVVLLAPHSIPKT  535

Query  3466  TSGKIKRYECAKRFISGTL-----------DVIEEQMNGE-----RSLPRN-DGIIVPAN  3594
             TSGKI R  C K     TL           DV  E   G+      ++ RN +G  V + 
Sbjct  536   TSGKISRSRCKKALEEKTLEELYRNEDMIADVPVEDDGGDVAVAGETMNRNVNGPRVAST  595

Query  3595  GKISKTDIVN------------FLKDLLSQQTGIPVSKISTGETLVSYGVNSIGVVRAAQ  3738
                SK+++ +            FL + L++  G+  ++I+    L   G++S+ + +   
Sbjct  596   DDGSKSNLPSVITGVPPDQVHAFLVEELARTLGVEPTQINDDTPLQELGLDSMALTQLQG  655

Query  3739  KISSFFGINI  3768
              I+  + +++
Sbjct  656   VIAQKYQVHV  665



>ref|WP_030388422.1| hypothetical protein [Streptomyces sp. NRRL S-241]
Length=578

 Score =   304 bits (779),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 199/593 (34%), Positives = 301/593 (51%), Gaps = 74/593 (12%)
 Frame = +1

Query  1828  NKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVD  2007
             +  L+T+L +  +     T+  + T A  +A  L    +  ++PG + LL+++PG +FV 
Sbjct  22    DHDLFTFLPDGEEAEPSLTFSMLDTRARAVAATL----RAQVEPGSRALLLFMPGQEFVV  77

Query  2008  AFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAK  2187
             A+FGCL A V+ +P   P P QR  G  LL +A IA+   P AIL+T     ++      
Sbjct  78    AYFGCLYAGVVAVPAYLPHPAQRARG--LLRLAGIAEDARPAAILTTSGIQASI------  129

Query  2188  NMLFGKSKDKSSNSWPDLP---WLHTDSWVkkpklfkkpkDEQGQ------PLSEDLCFL  2340
                     + ++ S P+L    WL  D+            D  G       P  + + FL
Sbjct  130   --------ETAARSIPELQETVWLAVDA----------IADRSGAGWSAPAPDPDSIAFL  171

Query  2341  QFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILV  2520
             Q+TSGST  PKGVM+TH  + HN  L+R        T++V WLP YHDMGLI  ++   +
Sbjct  172   QYTSGSTGQPKGVMVTHRNLAHNTDLIRTSLGLDGSTVVVGWLPPYHDMGLISMIVAPAM  231

Query  2521  SGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMH  2700
              G   +    V F+++P+ WL+ +SK+R T SAAPNFAF+L  R++        DLSS  
Sbjct  232   LGIHSVSMPTVAFLQSPVRWLRAISKYRGTLSAAPNFAFDLCTRKVTEEDRATLDLSSWA  291

Query  2701  FLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFVDW-Q  2877
                + AEP+R  +++RF     S G   E + P YGLAE+ + VS A  E   +F  + +
Sbjct  292   VATNGAEPVRADSMQRFSAAFASCGFRPETIVPVYGLAESTLLVSGAPLEQPWIFRSFDE  351

Query  2878  GRVCCGYIK-----QPN---------TDGVDIKIISPETGKENDDPGKEGEIWISSLSAG  3015
               +  G+ +      PN         +  +D+ I+ P+       PG+ GEIW++  S  
Sbjct  352   SELEEGHARIVPQDSPNARVLVSCGISRTLDVAIVDPKR-HTRCAPGEVGEIWVAGESVA  410

Query  3016  IGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTS  3195
             +GYW   +LS++TFE          Y+RTGDLG   +  LF+ GR KD+IIV G+N Y  
Sbjct  411   VGYWQRPDLSRETFEASPSDGGQGPYMRTGDLGFRTEDGLFVCGRIKDVIIVGGRNHYPH  470

Query  3196  DIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGKPLPYD-  3372
             DIE+T ES+   +RPGC A  G+  D              E  +VV AE+R G     D 
Sbjct  471   DIERTAESAHPAIRPGCVAAFGVTTD-------------GEESVVVAAELRPGAADGKDR  517

Query  3373  -----VMDHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISG  3516
                  V + +   VA+EH +    +V +   ++ KT+SGK++R E  K +++G
Sbjct  518   AGAEAVANAVRQAVAQEHRLTARDVVLLPAGTLPKTSSGKLQRAETRKEYLAG  570



>ref|WP_030832649.1| MULTISPECIES: hypothetical protein [Streptomyces]
Length=585

 Score =   304 bits (779),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 196/586 (33%), Positives = 295/586 (50%), Gaps = 58/586 (10%)
 Frame = +1

Query  1828  NKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVD  2007
             +  L+T+L +  +     T+  +   A  +A  L   Q   ++PG + LL++ PG DFV 
Sbjct  27    DHPLFTFLPDGEEAEPSLTFAALDAKARAVAASL---QAAHVEPGSRALLLFQPGQDFVV  83

Query  2008  AFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAK  2187
             AFFGCL A V+ +P   P P QR  G  LL +A IA+   P A+L+T      +   +  
Sbjct  84    AFFGCLYAGVVAVPAYLPHPAQRARG--LLRLAGIAEDAQPAAVLTTAGIRAAIETTART  141

Query  2188  NMLFGKSKDKSSNSWPDLPWLHTDSWVkkpklfkkpkDEQGQPLSE--DLCFLQFTSGST  2361
                              +P +   +W+    + +        P  E   + FLQ+TSGST
Sbjct  142   -----------------IPEVQETAWLAVDTIEEGTGAGWSAPSPEPKSVAFLQYTSGST  184

Query  2362  TDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGIL  2541
               PKGVM+THG + HN  L+R        T++V WLP YHDMGLI  ++     G   + 
Sbjct  185   GRPKGVMVTHGNLTHNTDLIRTSLGMDGSTVVVGWLPPYHDMGLISMIIVPAAMGIHSVS  244

Query  2542  FSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAAE  2721
                V F+++P+ WL+ +S +R T SAAPNFAF+L  R++        DLSS     + AE
Sbjct  245   MPTVAFLQSPVRWLRAISTYRGTLSAAPNFAFDLCTRKVTDEDRATLDLSSWLVATNGAE  304

Query  2722  PIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGE---------------GL  2856
             PIR  +++RF E   S G   E + P YGLAE+ + VS A  E               G 
Sbjct  305   PIRAESMQRFSEAFASTGFRPETIVPVYGLAESTLLVSGAPIERPWVFRSFDENELERGA  364

Query  2857  PVFV-----DWQGRVCCGYIKQPNTDGVDIKIISPETGKENDDPGKEGEIWISSLSAGIG  3021
              V V     D +  V CG  +      +D+ ++ P+  +    PG+ GEIW++  S  +G
Sbjct  365   AVAVPDDSPDARVLVSCGVSRS-----LDVVVVDPQ-ARTRCRPGQVGEIWVAGDSVAVG  418

Query  3022  YWGLEELSQKTFENDILSTPGK-RYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSD  3198
             YW   +LS++ FE  +     +  Y+RTGDLG      LF+ GR KD+IIV G+N Y  D
Sbjct  419   YWQRPDLSREAFEATLADGDDQGPYMRTGDLGFQTQDGLFVCGRIKDVIIVGGRNHYPHD  478

Query  3199  IEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDGKPLPYDVM  3378
             IE+T ES+   VRPGC A  G+  D  V + ++      E G     E ++G      V+
Sbjct  479   IERTAESAHPAVRPGCVAAFGVTTDG-VEQVVVAAELRREAGDGSDREAQEG------VV  531

Query  3379  DHICTRVAEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISG  3516
             + +   VA+EH + +  +V +   ++ KT+SGK++R E  K +++G
Sbjct  532   NAVLRAVAQEHRLTVREVVLLPAGTLPKTSSGKLQRRETRKEYLAG  577



>ref|WP_026736727.1| AMP-dependent synthetase [Fischerella sp. PCC 9605]
Length=613

 Score =   305 bits (782),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 210/586 (36%), Positives = 300/586 (51%), Gaps = 58/586 (10%)
 Frame = +1

Query  1840  YTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKPAIKPGDKVLLIYVPGLDFVDAFFG  2019
             YT+L       ++ TY E+H  A  IA  L +        G++ LL+Y PGLDF+ AFFG
Sbjct  35    YTFLKSGETEAEKLTYGELHLQAQAIAASLQSLNAG----GERALLLYQPGLDFIAAFFG  90

Query  2020  CLRARVipiptippdptQRGGGQALLHIANIAKVCNPVAILSTFSYHVTVRIMSAKNMLF  2199
             CL A VI +P  PP   Q      L  +  IA       +L++ S    ++  S K  L 
Sbjct  91    CLYAGVIAVPAYPPRKNQN-----LSRLQAIAADAQAKVVLTSTSLLDNLQASSNKEGL-  144

Query  2200  GKSKDKSSNSWPDLPWLHTDSWVkkpklfkkpkDEQGQPLSED-LCFLQFTSGSTTDPKG  2376
                          L WL TD               Q Q L+ D + FLQ+TSGST +PKG
Sbjct  145   ---------GISGLHWLATDGLSHDVAQTW-----QPQELNGDTVAFLQYTSGSTGNPKG  190

Query  2377  VMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHDMGLIGGLLTILVSGGSGILFSPVT  2556
             V+++H  ++ N   ++K +  T+ +  + WLP YHDMGLIGG+L  L SG   +L + V 
Sbjct  191   VIVSHHNLLSNSATIQKLFGHTTNSQGLIWLPPYHDMGLIGGILQPLYSGFPVVLMASVD  250

Query  2557  FMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLESSKEENFDLSSMHFLMSAAEPIRQT  2736
             F++ P+ WLQ +S+++AT S  PNFA++L +R++     EN DLSS     + AEP+R  
Sbjct  251   FLQKPIRWLQAISRYKATTSGGPNFAYDLCIRKVTPEHLENLDLSSWEVAFTGAEPVRAE  310

Query  2737  TLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCAYGEGLPVFVD------WQGRVCCGY  2898
             TL++F       G  +E   P YG+AE  + VS      LP+  +       Q RV    
Sbjct  311   TLEQFASTFAPCGFRKEAFYPCYGMAETTLIVSGGEKTALPITCNVEAAALEQNRVVKNQ  370

Query  2899  IKQPNTDGV----------DIKIISPETGKENDDPGKEGEIWISSLSAGIGYWGLEELSQ  3048
               Q +T  +           I I++PE+      P + GEIW++  S   GYW   E ++
Sbjct  371   GTQEDTRTMVGCGQSPPEQKIVIVNPES-LTLCPPEQVGEIWVAGPSVARGYWNQTEQTE  429

Query  3049  KTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRTKDLIIVAGKNIYTSDIEKTVESSSE  3228
             KTF   +  T    ++RTGDLG +   +LFITGR KD+II+ G+N Y  DIE TVE S  
Sbjct  430   KTFRAYLADTSEGPFLRTGDLGFLQGGELFITGRLKDVIIIRGQNHYPQDIELTVEKSHP  489

Query  3229  LVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVVIAEVRDG---KPLPYDVMDHICTRV  3399
              +RPGC +   I       KG  ++R      LV++ EV      K    +V+  I   V
Sbjct  490   ALRPGCGSAFAID-----FKG--SER------LVIVQEVERSYLRKLNVQEVVGSIRQAV  536

Query  3400  AEEHGVPIASIVAIKPRSISKTTSGKIKRYECAKRFISGTLDVIEE  3537
               EHG+ + + V +K  SI KT+SGKI+R  C   F+SG LDV+E+
Sbjct  537   VAEHGLEVFATVLVKTGSIPKTSSGKIRRQACRAAFLSGNLDVVED  582



>ref|WP_023069135.1| AMP-binding enzyme family protein [Lyngbya aestuarii]
 gb|ERT04614.1| AMP-binding enzyme family protein [Lyngbya aestuarii BL J]
Length=588

 Score =   304 bits (779),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 211/625 (34%), Positives = 314/625 (50%), Gaps = 78/625 (12%)
 Frame = +1

Query  1768  PELSSLDSYLRHWGTLGVTENKTLYTWLNEKGDVLDRRTYKEVHTNAFTIAQKLLTSQKP  1947
             PE+++L   LR   T    +    +    E  +V    TY+ +   +  IA  L    + 
Sbjct  7     PEINTLVDLLRARATHESEQVGYRFLLDGETQEV--SLTYQALDQQSRAIAAHL----QS  60

Query  1948  AIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCN  2127
               +PG++ LL+Y PGLD++ AFFGCL A V+ +P  PP P      ++L  I  I     
Sbjct  61    ICQPGERALLLYQPGLDYISAFFGCLYAGVVAVPAYPPRP-----NRSLERIEAILADSK  115

Query  2128  PVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPDLPWLHTDSWVkkpklfkkpkDEQ  2307
                 L++ S      I+S  N    + +     S   L W+ TD+        +   D  
Sbjct  116   ATVALTSQS------ILSLINRQLEQVQ-----SLQTLHWVATDT-------LETFADHW  157

Query  2308  GQPL--SEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYH  2481
              +P+  S+ L FLQ+TSGST  PKGVMI HG ++ N+  + + +  + ++  V WLP YH
Sbjct  158   QEPVLTSDSLAFLQYTSGSTATPKGVMIAHGNLLQNLAAIHRCFGHSPQSQGVIWLPPYH  217

Query  2482  DMGLIGGLLTILVSGGSGILFSPVTFMKNPLLWLQTMSKWRATHSAAPNFAFELLVRRLE  2661
             DMGLIGG+L  L  G   +L SP+ F++ PL WL+ +S+ +AT S  PNFA++L VR++ 
Sbjct  218   DMGLIGGVLQPLYGGFGVVLMSPLMFLQRPLRWLEAISRDQATTSGGPNFAYDLCVRKIA  277

Query  2662  SSKEENFDLSSMHFLMSAAEPIRQTTLKRFVELTQSFGLSREVMAPGYGLAENCVFVSCA  2841
              ++ E  DLSS     + AEPI    ++RF E    +G  RE   P YGLAE  + VS  
Sbjct  278   PAQREGLDLSSWELAFNGAEPIYDEVIERFTEAFAPYGFRREAFYPCYGLAEATLIVSGG  337

Query  2842  YGEGLPVFVD------WQGRVCCGYIKQPNTDGV----------DIKIISPETGKENDDP  2973
                  PV          Q +V    +   N   V           I I+ P+T K   D 
Sbjct  338   EKNAQPVLATVQATALAQNQVVYDQVTPENRRTVVGCGQSLADHKIVIVDPQTLKLCKD-  396

Query  2974  GKEGEIWISSLSAGIGYWGLEELSQKTFENDILSTPGKRYIRTGDLGRIIDSKLFITGRT  3153
              + GEIW+   S   GYWG  E S++ F+  +  +    ++RTGDLG + +S+LF+TGR 
Sbjct  397   HQVGEIWVCGPSIAQGYWGKTEESKQNFQATLAESSSGPFLRTGDLGFLANSELFVTGRL  456

Query  3154  KDLIIVAGKNIYTSDIEKTVESSSELVRPGCCAVVGIPEDVLVSKGILTQRASDELGLVV  3333
             KD+II+ G+N Y  D+E++VE S  LVRP C A   +  D              E  LV+
Sbjct  457   KDVIIINGRNYYPQDLERSVEQSHSLVRPNCSASFSVEVD-------------GEERLVI  503

Query  3334  IAEV----RDGK--PLPYD-----------VMDHICTRVAEEHGVPIASIVAIKPRSISK  3462
             +AEV    R+ +    P +           V+  I   V++ H + + +I  +KP  I K
Sbjct  504   VAEVERHYRENRWADTPSENGATQSSKVKAVIQSIRRAVSQHHDLQVYAIALLKPGGIPK  563

Query  3463  TTSGKIKRYECAKRFISGTLDVIEE  3537
             T+SGKI+R+ C   F++ TL+ IEE
Sbjct  564   TSSGKIQRHVCRASFLAQTLNTIEE  588



>gb|ETP48592.1| hypothetical protein, variant 2 [Phytophthora parasitica P10297]
 gb|ETP48593.1| hypothetical protein, variant 3 [Phytophthora parasitica P10297]
 gb|ETP48594.1| hypothetical protein, variant 4 [Phytophthora parasitica P10297]
Length=721

 Score =   308 bits (789),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 229/666 (34%), Positives = 351/666 (53%), Gaps = 79/666 (12%)
 Frame = +1

Query  1948  AIKPGDKVLLIYVPGLDFVDAFFGCLRARVipiptippdptQRGGGQALLHIANIAKVCN  2127
              +  GD+VLL+Y PGLDF+  F  CL+A V+ +P  PPD   R   + +    ++ + C 
Sbjct  29    GLNQGDRVLLVYPPGLDFIVVFLACLKAGVVAVPVYPPD--PRKMKKDISMFVSVTQNCQ  86

Query  2128  PVAILSTFSYHVTVRIMSAKNMLFGKSKDKSSNSWPD-LPWLHTDSWVkkpklfkkpkDE  2304
                 L T S +  V+ +SA    F  S    +  WP+ L W+ TD  V    +       
Sbjct  87    AKTAL-TCSMYYNVKKISAIKEKFTFS---GAAQWPEHLNWVVTDDLVDTKGIDPAKHWL  142

Query  2305  QGQPLSEDLCFLQFTSGSTTDPKGVMITHGGVIHNVKLMRKRYKSTSRTILVSWLPQYHD  2484
                P ++   FLQ+TSGST+ PKGV+++HG + HN++ +