BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8011_g1_i1 len=470 path=[1:0-469]

Length=470
                                                                      Score     E

sp|Q9SE00.1|PPAF1_IPOBA  RecName: Full=Purple acid phosphatase 1;...    254   3e-79   Ipomoea batatas [batate]
pdb|1XZW|A  Chain A, Sweet Potato Purple Acid PhosphatasePHOSPHAT...    236   6e-73   
emb|CAA07280.1|  purple acid phosphatase                                234   3e-72   Ipomoea batatas [batate]
ref|XP_011028930.1|  PREDICTED: purple acid phosphatase 2-like is...    226   3e-69   
ref|XP_011028929.1|  PREDICTED: purple acid phosphatase 2-like is...    226   2e-68   
ref|XP_002300736.2|  hypothetical protein POPTR_0002s03080g             224   9e-68   Populus trichocarpa [western balsam poplar]
ref|XP_011048850.1|  PREDICTED: purple acid phosphatase 2-like is...    219   5e-67   
ref|XP_009787761.1|  PREDICTED: purple acid phosphatase 2-like          221   8e-67   
ref|XP_009611298.1|  PREDICTED: purple acid phosphatase 2-like          221   1e-66   
dbj|BAC55156.1|  purple acid phosphatase                                220   3e-66   Nicotiana tabacum [American tobacco]
ref|XP_011048849.1|  PREDICTED: purple acid phosphatase 2-like is...    219   4e-66   
ref|XP_002307690.1|  Iron(III)-zinc(II) purple acid phosphatase p...    219   5e-66   Populus trichocarpa [western balsam poplar]
ref|XP_010271524.1|  PREDICTED: purple acid phosphatase                 217   4e-65   
ref|XP_002263937.1|  PREDICTED: purple acid phosphatase                 216   1e-64   Vitis vinifera
dbj|BAA97038.2|  acid phosphatase precursor                             215   3e-64   Tagetes patula [French marigold]
ref|XP_011083627.1|  PREDICTED: purple acid phosphatase 2-like          214   5e-64   
ref|XP_002264113.1|  PREDICTED: purple acid phosphatase                 214   7e-64   Vitis vinifera
ref|XP_002274392.1|  PREDICTED: purple acid phosphatase                 213   1e-63   Vitis vinifera
ref|XP_002510464.1|  Iron(III)-zinc(II) purple acid phosphatase p...    213   1e-63   Ricinus communis
dbj|BAJ53173.1|  JHL18I08.7                                             212   4e-63   
gb|AET86953.1|  PAP1                                                    212   5e-63   
gb|KHG20720.1|  Purple acid phosphatase 2                               211   7e-63   
ref|XP_002280873.1|  PREDICTED: purple acid phosphatase 2               211   9e-63   Vitis vinifera
gb|AGL44398.1|  calcineurin-like phosphoesterase                        205   1e-62   
ref|XP_006409435.1|  hypothetical protein EUTSA_v10022681mg             210   2e-62   
gb|ABV89751.1|  purple acid phosphatase 12 protein family isoform...    203   2e-62   Brassica napus [oilseed rape]
ref|XP_002880886.1|  secreted purple acid phosphatase precursor         210   3e-62   
ref|XP_010061253.1|  PREDICTED: purple acid phosphatase-like isof...    210   3e-62   
ref|XP_002280883.1|  PREDICTED: purple acid phosphatase 2 isoform X1    209   3e-62   Vitis vinifera
ref|XP_010105263.1|  Purple acid phosphatase 2                          211   6e-62   
ref|XP_002874764.1|  secreted purple acid phosphatase precursor         209   6e-62   
ref|XP_007042078.1|  Purple acid phosphatase 10                         209   7e-62   
ref|XP_009794994.1|  PREDICTED: purple acid phosphatase 2-like          208   1e-61   
gb|AAT37527.1|  purple acid phosphatase 2                               207   1e-61   Solanum tuberosum [potatoes]
emb|CBI38021.3|  unnamed protein product                                207   1e-61   
ref|XP_009335656.1|  PREDICTED: purple acid phosphatase 2               209   2e-61   
ref|XP_010030674.1|  PREDICTED: purple acid phosphatase 2-like          207   2e-61   
ref|XP_010320409.1|  PREDICTED: LOW QUALITY PROTEIN: purple acid ...    207   3e-61   
ref|XP_004148530.1|  PREDICTED: purple acid phosphatase 2-like          207   3e-61   
dbj|BAO58596.1|  purple acid phosphatase                                207   4e-61   
ref|XP_010315506.1|  PREDICTED: LOW QUALITY PROTEIN: purple acid ...    206   4e-61   
ref|XP_010028626.1|  PREDICTED: purple acid phosphatase-like            207   4e-61   
gb|KGN43158.1|  hypothetical protein Csa_7G004110                       207   5e-61   
ref|XP_007017664.1|  Purple acid phosphatase 12 isoform 1               206   5e-61   
gb|EYU37834.1|  hypothetical protein MIMGU_mgv1a005856mg                206   6e-61   
dbj|BAC55154.1|  purple acid phosphatase                                206   6e-61   Nicotiana tabacum [American tobacco]
ref|XP_006297613.1|  hypothetical protein CARUB_v10013635mg             204   7e-61   
ref|XP_002313026.2|  hypothetical protein POPTR_0009s12400g             206   8e-61   Populus trichocarpa [western balsam poplar]
ref|XP_010664753.1|  PREDICTED: purple acid phosphatase 2 isoform X2    206   8e-61   
gb|KFK40055.1|  hypothetical protein AALP_AA3G324700                    206   8e-61   
ref|XP_008448074.1|  PREDICTED: purple acid phosphatase 2               206   9e-61   
ref|XP_009777041.1|  PREDICTED: purple acid phosphatase 2 isoform X1    206   9e-61   
ref|XP_011088457.1|  PREDICTED: purple acid phosphatase 2               206   9e-61   
ref|XP_009777042.1|  PREDICTED: purple acid phosphatase 2 isoform X2    206   1e-60   
ref|XP_009614460.1|  PREDICTED: purple acid phosphatase 2-like          206   1e-60   
ref|XP_010489216.1|  PREDICTED: purple acid phosphatase 10              206   1e-60   
ref|XP_006362022.1|  PREDICTED: purple acid phosphatase 2-like          205   2e-60   
dbj|BAC55155.1|  purple acid phosphatase                                205   2e-60   Nicotiana tabacum [American tobacco]
gb|ABV89750.1|  purple acid phosphatase 12 protein family isoform...    203   2e-60   Brassica napus [oilseed rape]
gb|ABV89753.1|  purple acid phosphatase 12 protein family isoform...    203   2e-60   Brassica napus [oilseed rape]
ref|XP_004291401.1|  PREDICTED: purple acid phosphatase 2-like          205   2e-60   
gb|KFK32700.1|  hypothetical protein AALP_AA6G277500                    204   3e-60   
gb|EYU37832.1|  hypothetical protein MIMGU_mgv1a005923mg                204   3e-60   
ref|NP_179235.1|  purple acid phosphatase 10                            204   3e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008387992.1|  PREDICTED: purple acid phosphatase 2-like          206   4e-60   
ref|XP_010516721.1|  PREDICTED: purple acid phosphatase 10-like         204   4e-60   
ref|XP_011047731.1|  PREDICTED: purple acid phosphatase 2               204   4e-60   
gb|AAA91803.1|  secreted purple acid phosphatase precursor              204   5e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010467373.1|  PREDICTED: purple acid phosphatase 10-like         204   5e-60   
gb|ABV89749.1|  purple acid phosphatase 12 protein family isoform 5     204   7e-60   Brassica napus [oilseed rape]
ref|XP_010417871.1|  PREDICTED: fe(3+)-Zn(2+) purple acid phospha...    203   7e-60   
gb|ABV89758.1|  purple acid phosphatase 12 protein family isoform...    201   8e-60   Brassica napus [oilseed rape]
gb|ABV89741.1|  purple acid phosphatase 12 protein family isoform 2     203   9e-60   Brassica napus [oilseed rape]
emb|CDX77044.1|  BnaC04g38390D                                          203   1e-59   
ref|XP_006297614.1|  hypothetical protein CARUB_v10013635mg             203   1e-59   
ref|XP_004152670.1|  PREDICTED: purple acid phosphatase 2-like          203   1e-59   
emb|CDO97010.1|  unnamed protein product                                202   1e-59   
gb|ABV89743.1|  purple acid phosphatase 12 protein family isoform 3     202   1e-59   Brassica napus [oilseed rape]
ref|NP_180287.2|  Fe(3+)-Zn(2+) purple acid phosphatase 12              202   1e-59   Arabidopsis thaliana [mouse-ear cress]
emb|CDY48178.1|  BnaA04g15420D                                          203   2e-59   
gb|AAM15913.1|AF492664_1  purple acid phosphatase                       202   2e-59   Arabidopsis thaliana [mouse-ear cress]
gb|KHN22217.1|  Purple acid phosphatase 2                               199   2e-59   
emb|CDY48179.1|  BnaA04g15430D                                          202   2e-59   
ref|XP_010028629.1|  PREDICTED: purple acid phosphatase 2-like          202   2e-59   
ref|XP_006487338.1|  PREDICTED: purple acid phosphatase 2-like is...    202   2e-59   
ref|XP_006423401.1|  hypothetical protein CICLE_v10028369mg             202   2e-59   
ref|XP_008444763.1|  PREDICTED: purple acid phosphatase-like            202   2e-59   
ref|XP_010510800.1|  PREDICTED: fe(3+)-Zn(2+) purple acid phospha...    202   3e-59   
emb|CAA06921.1|  purple acid phosphatase                                202   3e-59   Ipomoea batatas [batate]
ref|XP_002512962.1|  Purple acid phosphatase precursor, putative        202   3e-59   Ricinus communis
sp|Q9SDZ9.1|PPAF2_IPOBA  RecName: Full=Purple acid phosphatase 2;...    202   3e-59   Ipomoea batatas [batate]
ref|XP_003527865.2|  PREDICTED: purple acid phosphatase 2-like          202   3e-59   
gb|ABV89757.1|  purple acid phosphatase 12 protein family isoform 7     202   3e-59   Brassica napus [oilseed rape]
gb|ABV89739.1|  purple acid phosphatase 12 protein family isoform 1     202   3e-59   Brassica napus [oilseed rape]
gb|KCW55390.1|  hypothetical protein EUGRSUZ_I01300                     201   3e-59   
ref|XP_010690820.1|  PREDICTED: purple acid phosphatase 2-like is...    201   4e-59   
emb|CDX89713.1|  BnaC03g46270D                                          201   4e-59   
ref|XP_009136307.1|  PREDICTED: purple acid phosphatase 10-like         201   5e-59   
emb|CDP07456.1|  unnamed protein product                                200   5e-59   
ref|XP_004230906.1|  PREDICTED: purple acid phosphatase 2               201   5e-59   
ref|XP_006487340.1|  PREDICTED: purple acid phosphatase 2-like          201   5e-59   
ref|XP_006581009.1|  PREDICTED: uncharacterized protein LOC100794...    199   6e-59   
ref|XP_002306126.2|  Fe(III)-Zn(II) purple acid phosphatase famil...    201   6e-59   Populus trichocarpa [western balsam poplar]
gb|KDP41744.1|  hypothetical protein JCGZ_26762                         201   8e-59   
ref|XP_006423399.1|  hypothetical protein CICLE_v10028320mg             201   9e-59   
emb|CDY02259.1|  BnaA03g39080D                                          199   9e-59   
gb|AAX20028.1|  purple acid phosphatase                                 200   1e-58   Medicago truncatula
emb|CDY26770.1|  BnaC09g08970D                                          200   1e-58   
ref|XP_009136308.1|  PREDICTED: purple acid phosphatase 10              200   1e-58   
ref|XP_006294169.1|  hypothetical protein CARUB_v10023164mg             200   1e-58   
ref|NP_001239689.1|  uncharacterized protein LOC100794124               199   1e-58   
ref|XP_002886226.1|  predicted protein                                  200   1e-58   
ref|XP_009140744.1|  PREDICTED: fe(3+)-Zn(2+) purple acid phospha...    200   1e-58   
emb|CDY02257.1|  BnaA03g39100D                                          200   1e-58   
gb|ACU17971.1|  unknown                                                 196   1e-58   Glycine max [soybeans]
ref|XP_007017662.1|  Purple acid phosphatase 10 isoform 1               200   2e-58   
gb|KDO49482.1|  hypothetical protein CISIN_1g045849mg                   196   2e-58   
ref|XP_009112387.1|  PREDICTED: purple acid phosphatase 10-like i...    199   2e-58   
gb|KCW55391.1|  hypothetical protein EUGRSUZ_I01302                     199   2e-58   
dbj|BAC55157.1|  purple acid phosphatase                                199   2e-58   Nicotiana tabacum [American tobacco]
ref|XP_009610724.1|  PREDICTED: purple acid phosphatase 2-like          199   2e-58   
ref|XP_010028628.1|  PREDICTED: purple acid phosphatase 2-like          200   2e-58   
ref|XP_006409436.1|  hypothetical protein EUTSA_v10022673mg             199   2e-58   
ref|XP_010028627.1|  PREDICTED: purple acid phosphatase 2-like          199   3e-58   
gb|ABV89745.1|  purple acid phosphatase 12 protein family isoform 4     200   3e-58   Brassica napus [oilseed rape]
ref|XP_006473581.1|  PREDICTED: purple acid phosphatase 2-like is...    199   3e-58   
gb|ABV89755.1|  purple acid phosphatase 12 protein family isoform 6     200   3e-58   Brassica napus [oilseed rape]
ref|XP_004172093.1|  PREDICTED: purple acid phosphatase 2-like          199   3e-58   
gb|AFB18640.1|  PAP10                                                   199   4e-58   
ref|XP_009112386.1|  PREDICTED: purple acid phosphatase 10-like i...    199   4e-58   
emb|CDY47461.1|  BnaA09g08700D                                          199   4e-58   
ref|XP_010672424.1|  PREDICTED: purple acid phosphatase-like            198   6e-58   
gb|AET86954.1|  PAP12                                                   197   1e-57   
ref|XP_006487339.1|  PREDICTED: purple acid phosphatase 2-like is...    197   1e-57   
ref|XP_007222938.1|  hypothetical protein PRUPE_ppa005293mg             197   1e-57   
ref|XP_010530813.1|  PREDICTED: purple acid phosphatase 10              197   2e-57   
ref|XP_011037173.1|  PREDICTED: purple acid phosphatase 2-like          197   2e-57   
gb|KHG11060.1|  Purple acid phosphatase 2                               197   2e-57   
gb|KHG20719.1|  Purple acid phosphatase 2                               197   2e-57   
gb|AGL44395.1|  calcineurin-like phosphoesterase                        198   2e-57   
gb|AAD20634.1|  purple acid phosphatase precursor                       197   3e-57   Anchusa officinalis
ref|XP_009140743.1|  PREDICTED: fe(3+)-Zn(2+) purple acid phospha...    197   3e-57   
gb|EPS60425.1|  hypothetical protein M569_14376                         196   3e-57   
ref|XP_010107842.1|  Purple acid phosphatase 2                          196   3e-57   
ref|NP_001242830.1|  uncharacterized protein LOC100815854 precursor     196   4e-57   
gb|KHN11683.1|  Purple acid phosphatase                                 196   4e-57   
ref|XP_006586710.1|  PREDICTED: uncharacterized protein LOC100815...    196   5e-57   
ref|XP_010690819.1|  PREDICTED: purple acid phosphatase 2-like is...    196   5e-57   
ref|XP_009762746.1|  PREDICTED: purple acid phosphatase 2-like          196   5e-57   
ref|XP_010549271.1|  PREDICTED: fe(3+)-Zn(2+) purple acid phospha...    196   5e-57   
sp|Q09131.2|PPAF_SOYBN  RecName: Full=Purple acid phosphatase; Al...    196   6e-57   Glycine max [soybeans]
gb|AFH08750.1|  purple acid phosphatase 14                              196   6e-57   
emb|CDX89726.1|  BnaC03g46400D                                          196   6e-57   
ref|XP_008236961.1|  PREDICTED: purple acid phosphatase-like            196   7e-57   
ref|XP_010690822.1|  PREDICTED: purple acid phosphatase 2               195   1e-56   
gb|KEH16424.1|  purple acid phosphatase superfamily protein             194   2e-56   
ref|NP_001240926.1|  uncharacterized protein LOC100807555 precursor     194   3e-56   
ref|XP_008796614.1|  PREDICTED: purple acid phosphatase 2-like          194   3e-56   
gb|KHG24062.1|  Purple acid phosphatase 2                               199   3e-56   
gb|KHG24063.1|  Purple acid phosphatase 2                               198   4e-56   
ref|XP_010473111.1|  PREDICTED: fe(3+)-Zn(2+) purple acid phospha...    193   6e-56   
ref|XP_008236963.1|  PREDICTED: purple acid phosphatase 2-like is...    193   6e-56   
ref|XP_008236964.1|  PREDICTED: purple acid phosphatase 2-like is...    192   8e-56   
ref|XP_009398390.1|  PREDICTED: purple acid phosphatase 2-like          192   1e-55   
ref|XP_004506328.1|  PREDICTED: purple acid phosphatase-like            192   1e-55   
ref|XP_007199139.1|  hypothetical protein PRUPE_ppa019514mg             192   1e-55   
ref|XP_007201003.1|  hypothetical protein PRUPE_ppa005275mg             192   1e-55   
ref|XP_008793996.1|  PREDICTED: purple acid phosphatase 2-like          192   2e-55   
gb|AFK42558.1|  unknown                                                 183   2e-55   
ref|XP_008236957.1|  PREDICTED: purple acid phosphatase-like            191   3e-55   
ref|XP_004292019.1|  PREDICTED: purple acid phosphatase 2-like          193   7e-55   
gb|KHG15250.1|  Purple acid phosphatase 2                               190   7e-55   
gb|KEH44359.1|  purple acid phosphatase superfamily protein             190   9e-55   
dbj|BAA92365.1|  purple acid phosphatase                                189   2e-54   Landoltia punctata
ref|XP_007131378.1|  hypothetical protein PHAVU_011G008700g             189   2e-54   
ref|XP_008237016.1|  PREDICTED: purple acid phosphatase 2-like          187   2e-54   
ref|XP_010933142.1|  PREDICTED: purple acid phosphatase-like            189   3e-54   
ref|XP_010910529.1|  PREDICTED: purple acid phosphatase-like            188   4e-54   
ref|XP_004290282.1|  PREDICTED: purple acid phosphatase 2-like          187   8e-54   
ref|XP_007017665.1|  Purple acid phosphatase 10 isoform 2               184   2e-53   
ref|XP_007199264.1|  hypothetical protein PRUPE_ppa022682mg             187   2e-53   
ref|XP_008377263.1|  PREDICTED: purple acid phosphatase-like            186   2e-53   
gb|AAK51700.1|AF317218_1  secreted acid phosphatase                     186   2e-53   Lupinus albus
gb|EPS60513.1|  hypothetical protein M569_14289                         183   2e-53   
dbj|BAA97745.1|  secretory acid phosphatase precursor                   186   2e-53   Lupinus albus
ref|NP_001136973.1|  uncharacterized protein LOC100217133 precursor     186   3e-53   Zea mays [maize]
ref|XP_008236959.1|  PREDICTED: purple acid phosphatase-like            186   3e-53   
gb|ACG26714.1|  purple acid phosphatase precursor                       186   6e-53   Zea mays [maize]
ref|XP_006838700.1|  hypothetical protein AMTR_s00002p00249280          185   6e-53   
ref|XP_009408475.1|  PREDICTED: purple acid phosphatase 2-like          184   1e-52   
ref|XP_007131385.1|  hypothetical protein PHAVU_011G009200g             183   1e-52   
ref|XP_009397025.1|  PREDICTED: purple acid phosphatase 2               183   3e-52   
ref|NP_001242198.1|  purple acid phosphatase 2-like                     182   3e-52   
ref|XP_007200121.1|  hypothetical protein PRUPE_ppa018522mg             184   3e-52   
ref|XP_009373026.1|  PREDICTED: LOW QUALITY PROTEIN: purple acid ...    183   3e-52   
ref|XP_008236962.1|  PREDICTED: purple acid phosphatase-like            183   5e-52   
ref|XP_008237014.1|  PREDICTED: purple acid phosphatase 2-like          182   7e-52   
ref|XP_007131379.1|  hypothetical protein PHAVU_011G008800g             181   8e-52   
ref|XP_006362021.1|  PREDICTED: purple acid phosphatase 2-like          182   8e-52   
ref|XP_007200250.1|  hypothetical protein PRUPE_ppa015069mg             182   1e-51   
gb|ADM16565.2|  purple acid phosphatase precursor                       181   1e-51   
pdb|4DSY|A  Chain A, Crystal Structure Of Red Kidney Bean Purple ...    180   3e-51   
pdb|1KBP|A  Chain A, Kidney Bean Purple Acid Phosphatase                180   3e-51   
pdb|2QFP|A  Chain A, Crystal Structure Of Red Kidney Bean Purple ...    180   3e-51   
sp|P80366.3|PPAF_PHAVU  RecName: Full=Fe(3+)-Zn(2+) purple acid p...    181   3e-51   Phaseolus vulgaris [French bean]
tpg|DAA57388.1|  TPA: hypothetical protein ZEAMMB73_877733              175   4e-51   
ref|NP_001044416.1|  Os01g0776600                                       178   3e-50   Oryza sativa Japonica Group [Japonica rice]
emb|CAD44185.1|  putative acid phosphatase                              178   3e-50   Lupinus luteus
ref|XP_006594791.1|  PREDICTED: purple acid phosphatase 2-like          178   3e-50   
ref|XP_004963326.1|  PREDICTED: purple acid phosphatase 2-like          177   4e-50   
ref|XP_008382344.1|  PREDICTED: purple acid phosphatase 2-like          179   4e-50   
ref|XP_004970155.1|  PREDICTED: purple acid phosphatase 2-like          177   6e-50   
ref|XP_007149618.1|  hypothetical protein PHAVU_005G084900g             177   8e-50   
ref|XP_010250242.1|  PREDICTED: bifunctional purple acid phosphat...    178   1e-49   
ref|XP_002458586.1|  hypothetical protein SORBIDRAFT_03g036210          177   1e-49   Sorghum bicolor [broomcorn]
ref|NP_001141970.1|  hypothetical protein precursor                     176   3e-49   Zea mays [maize]
ref|XP_006646385.1|  PREDICTED: purple acid phosphatase 2-like          177   5e-49   
ref|NP_001239650.1|  uncharacterized protein LOC100818438 precursor     174   6e-49   
ref|XP_006593472.1|  PREDICTED: uncharacterized protein LOC100818...    174   8e-49   
gb|KHN47108.1|  Bifunctional purple acid phosphatase 26                 174   8e-49   
dbj|BAJ85173.1|  predicted protein                                      174   1e-48   
ref|NP_001149655.1|  purple acid phosphatase                            172   3e-48   Zea mays [maize]
ref|XP_009373020.1|  PREDICTED: purple acid phosphatase 2-like          174   4e-48   
gb|ACN28207.1|  unknown                                                 172   5e-48   Zea mays [maize]
gb|EMT02488.1|  Purple acid phosphatase 2                               172   5e-48   
gb|KHN28032.1|  Purple acid phosphatase 2                               172   6e-48   
gb|ABK24726.1|  unknown                                                 172   7e-48   Picea sitchensis
ref|XP_004287267.1|  PREDICTED: bifunctional purple acid phosphat...    172   9e-48   
ref|XP_004508441.1|  PREDICTED: bifunctional purple acid phosphat...    171   9e-48   
emb|CDM84477.1|  unnamed protein product                                171   1e-47   
ref|XP_004508439.1|  PREDICTED: bifunctional purple acid phosphat...    171   1e-47   
gb|ABQ50886.1|  purple acid phosphatase                                 169   1e-47   Lolium multiflorum
ref|XP_002515485.1|  Iron(III)-zinc(II) purple acid phosphatase p...    171   1e-47   Ricinus communis
ref|NP_198334.1|  purple acid phosphatase 26                            171   2e-47   Arabidopsis thaliana [mouse-ear cress]
gb|AAW29950.1|  putative purple acid phosphatase                        171   2e-47   Arabidopsis thaliana [mouse-ear cress]
gb|EMS53150.1|  Purple acid phosphatase 2                               172   2e-47   
emb|CAD30328.1|  acid phosphatase                                       171   2e-47   Lupinus luteus
ref|XP_006371756.1|  hypothetical protein POPTR_0018s01990g             168   3e-47   
ref|XP_010687873.1|  PREDICTED: bifunctional purple acid phosphat...    170   3e-47   
ref|XP_003564342.1|  PREDICTED: purple acid phosphatase 2               170   4e-47   
ref|XP_007155070.1|  hypothetical protein PHAVU_003G170600g             169   4e-47   
gb|AFY06665.1|  purple acid phosphatase                                 169   6e-47   
gb|KDO49481.1|  hypothetical protein CISIN_1g044242mg                   164   8e-47   
ref|XP_008443931.1|  PREDICTED: bifunctional purple acid phosphat...    169   9e-47   
ref|XP_006371757.1|  hypothetical protein POPTR_0018s01990g             167   1e-46   
ref|XP_006371758.1|  hypothetical protein POPTR_0018s01990g             167   1e-46   
gb|AFY06664.1|  purple acid phosphatase                                 168   1e-46   
ref|XP_008795838.1|  PREDICTED: phosphoenolpyruvate phosphatase         169   1e-46   
ref|XP_006664780.1|  PREDICTED: purple acid phosphatase 2-like          168   1e-46   
ref|XP_009790276.1|  PREDICTED: bifunctional purple acid phosphat...    168   2e-46   
ref|XP_006381099.1|  hypothetical protein POPTR_0006s06250g             168   2e-46   
ref|XP_009790275.1|  PREDICTED: bifunctional purple acid phosphat...    168   2e-46   
ref|XP_008242841.1|  PREDICTED: bifunctional purple acid phosphat...    167   2e-46   
ref|XP_006389431.1|  hypothetical protein POPTR_0025s00640g             168   2e-46   
dbj|BAB88216.1|  secretory acid phosphatase precursor                   167   3e-46   Oryza sativa [red rice]
ref|XP_006450381.1|  hypothetical protein CICLE_v10008150mg             166   3e-46   
gb|KHG06954.1|  Bifunctional purple acid phosphatase 26 -like pro...    167   3e-46   
ref|XP_008242837.1|  PREDICTED: bifunctional purple acid phosphat...    167   3e-46   
ref|NP_001067369.1|  Os12g0637100                                       167   3e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006371754.1|  hypothetical protein POPTR_0018s01990g             167   4e-46   
gb|EMT18687.1|  Purple acid phosphatase 2                               167   4e-46   
ref|XP_011017864.1|  PREDICTED: bifunctional purple acid phosphat...    167   4e-46   
gb|EMT06363.1|  Purple acid phosphatase 2                               167   4e-46   
gb|EAY84038.1|  hypothetical protein OsI_39268                          167   5e-46   Oryza sativa Indica Group [Indian rice]
ref|XP_011036592.1|  PREDICTED: bifunctional purple acid phosphat...    167   5e-46   
ref|XP_004251734.1|  PREDICTED: bifunctional purple acid phosphat...    167   5e-46   
ref|XP_002324876.1|  hypothetical protein POPTR_0018s01990g             167   6e-46   Populus trichocarpa [western balsam poplar]
ref|XP_010913336.1|  PREDICTED: phosphoenolpyruvate phosphatase i...    167   6e-46   
ref|NP_001236677.1|  purple acid phosphatase-like protein               167   6e-46   
ref|XP_010913337.1|  PREDICTED: phosphoenolpyruvate phosphatase i...    167   6e-46   
ref|XP_010096988.1|  Bifunctional purple acid phosphatase 26            166   7e-46   
ref|XP_009604288.1|  PREDICTED: bifunctional purple acid phosphat...    166   7e-46   
gb|KDP30232.1|  hypothetical protein JCGZ_17014                         166   7e-46   
ref|XP_007202018.1|  hypothetical protein PRUPE_ppa004955mg             166   1e-45   
ref|XP_002440350.1|  hypothetical protein SORBIDRAFT_09g030100          166   1e-45   Sorghum bicolor [broomcorn]
emb|CDX89717.1|  BnaC03g46310D                                          166   1e-45   
ref|XP_006425589.1|  hypothetical protein CICLE_v10027113mg             166   1e-45   
ref|XP_008373401.1|  PREDICTED: bifunctional purple acid phosphat...    166   1e-45   
ref|XP_002870408.1|  ATPAP26/PAP26                                      166   1e-45   
ref|XP_011020214.1|  PREDICTED: bifunctional purple acid phosphat...    166   1e-45   
ref|XP_006483400.1|  PREDICTED: bifunctional purple acid phosphat...    166   1e-45   
ref|XP_006450380.1|  hypothetical protein CICLE_v10008150mg             166   1e-45   
ref|XP_007155069.1|  hypothetical protein PHAVU_003G170500g             165   2e-45   
ref|XP_006350121.1|  PREDICTED: bifunctional purple acid phosphat...    166   2e-45   
ref|XP_004150527.1|  PREDICTED: bifunctional purple acid phosphat...    165   2e-45   
ref|XP_010241604.1|  PREDICTED: bifunctional purple acid phosphat...    165   2e-45   
ref|XP_008440780.1|  PREDICTED: purple acid phosphatase 5               165   2e-45   
ref|XP_007155068.1|  hypothetical protein PHAVU_003G170500g             165   2e-45   
ref|XP_009108064.1|  PREDICTED: bifunctional purple acid phosphat...    165   2e-45   
ref|XP_008362886.1|  PREDICTED: bifunctional purple acid phosphat...    165   2e-45   
gb|KGN65112.1|  hypothetical protein Csa_1G225410                       165   2e-45   
emb|CDY71707.1|  BnaCnng74060D                                          160   2e-45   
emb|CBI25544.3|  unnamed protein product                                165   2e-45   
ref|XP_002264680.1|  PREDICTED: bifunctional purple acid phosphat...    165   2e-45   
ref|XP_010241603.1|  PREDICTED: bifunctional purple acid phosphat...    165   2e-45   
gb|EYU40133.1|  hypothetical protein MIMGU_mgv1a005618mg                165   3e-45   
ref|XP_002530765.1|  Iron(III)-zinc(II) purple acid phosphatase p...    165   3e-45   
gb|AGL44397.1|  calcineurin-like phosphoesterase                        165   3e-45   
ref|XP_008362885.1|  PREDICTED: bifunctional purple acid phosphat...    165   3e-45   
emb|CAN71549.1|  hypothetical protein VITISV_030234                     165   3e-45   
emb|CDY12397.1|  BnaC08g08080D                                          165   3e-45   
ref|XP_009108063.1|  PREDICTED: bifunctional purple acid phosphat...    165   4e-45   
ref|XP_007202017.1|  hypothetical protein PRUPE_ppa004955mg             164   4e-45   
dbj|BAJ94392.1|  predicted protein                                      164   4e-45   
ref|XP_010687874.1|  PREDICTED: bifunctional purple acid phosphat...    164   5e-45   
gb|KDO71056.1|  hypothetical protein CISIN_1g046207mg                   164   5e-45   
gb|KHG11290.1|  Bifunctional purple acid phosphatase 26 -like pro...    164   6e-45   
emb|CDY47560.1|  BnaA08g07270D                                          164   6e-45   
gb|KCW79137.1|  hypothetical protein EUGRSUZ_C00583                     162   6e-45   
gb|KCW79138.1|  hypothetical protein EUGRSUZ_C00583                     162   7e-45   
gb|EPS60634.1|  hypothetical protein M569_14168                         161   1e-44   
ref|XP_007011812.1|  Purple acid phosphatase 26 isoform 2               163   1e-44   
gb|EMT07067.1|  Bifunctional purple acid phosphatase 26                 164   1e-44   
gb|AGL44396.1|  calcineurin-like phosphoesterase                        163   1e-44   
gb|KDO84712.1|  hypothetical protein CISIN_1g040421mg                   162   1e-44   
ref|XP_007011811.1|  Purple acid phosphatase 26 isoform 1               163   1e-44   
gb|AGT17175.1|  acid phosphatase precursor                              163   1e-44   
ref|XP_007013583.1|  Purple acid phosphatase 26 isoform 2               163   2e-44   
ref|XP_007013582.1|  Purple acid phosphatase 26 isoform 1               163   2e-44   
ref|XP_010413945.1|  PREDICTED: purple acid phosphatase 5               162   2e-44   
ref|XP_011078424.1|  PREDICTED: bifunctional purple acid phosphat...    162   2e-44   
ref|XP_007013584.1|  Purple acid phosphatase 26 isoform 3               163   2e-44   
ref|XP_011078422.1|  PREDICTED: bifunctional purple acid phosphat...    163   2e-44   
dbj|BAJ99889.1|  predicted protein                                      163   2e-44   
ref|XP_010435390.1|  PREDICTED: bifunctional purple acid phosphat...    162   2e-44   
dbj|BAK03468.1|  predicted protein                                      162   2e-44   
ref|XP_010489510.1|  PREDICTED: purple acid phosphatase 5-like          162   2e-44   
ref|XP_010047261.1|  PREDICTED: bifunctional purple acid phosphat...    162   2e-44   
ref|XP_006474401.1|  PREDICTED: bifunctional purple acid phosphat...    162   2e-44   
ref|XP_008361111.1|  PREDICTED: bifunctional purple acid phosphat...    162   2e-44   
gb|EMS54176.1|  Purple acid phosphatase 2                               162   3e-44   
ref|XP_009112469.1|  PREDICTED: purple acid phosphatase 5-like          162   3e-44   
ref|XP_010435389.1|  PREDICTED: bifunctional purple acid phosphat...    162   3e-44   
ref|XP_006838701.1|  hypothetical protein AMTR_s00002p00249330          162   3e-44   
ref|XP_008336971.1|  PREDICTED: bifunctional purple acid phosphat...    162   3e-44   
ref|XP_006453106.1|  hypothetical protein CICLE_v10008153mg             162   3e-44   
gb|KDO73457.1|  hypothetical protein CISIN_1g011679mg                   162   4e-44   
ref|XP_004169273.1|  PREDICTED: LOW QUALITY PROTEIN: purple acid ...    162   4e-44   
ref|XP_010467619.1|  PREDICTED: purple acid phosphatase 5-like          162   4e-44   
ref|XP_009363959.1|  PREDICTED: bifunctional purple acid phosphat...    162   4e-44   
gb|AET86956.1|  PAP26                                                   162   4e-44   
ref|XP_006403101.1|  hypothetical protein EUTSA_v10003451mg             162   4e-44   
ref|XP_010450339.1|  PREDICTED: bifunctional purple acid phosphat...    161   4e-44   
ref|XP_009358556.1|  PREDICTED: bifunctional purple acid phosphat...    162   5e-44   
ref|XP_010050094.1|  PREDICTED: bifunctional purple acid phosphat...    162   5e-44   
gb|KDO73456.1|  hypothetical protein CISIN_1g011679mg                   162   5e-44   
ref|XP_006299600.1|  hypothetical protein CARUB_v10015778mg             161   5e-44   
ref|XP_010450337.1|  PREDICTED: bifunctional purple acid phosphat...    161   6e-44   
gb|AGT17000.1|  acid phosphatase precursor                              161   7e-44   
ref|XP_004149978.1|  PREDICTED: purple acid phosphatase 10-like         161   7e-44   
ref|XP_009102277.1|  PREDICTED: purple acid phosphatase 5-like is...    160   7e-44   
ref|XP_009102278.1|  PREDICTED: purple acid phosphatase 25-like i...    160   7e-44   
ref|XP_009363960.1|  PREDICTED: bifunctional purple acid phosphat...    161   7e-44   
gb|AGT16225.1|  purple acid phosphatase precursor                       161   8e-44   
ref|XP_004965755.1|  PREDICTED: phosphoenolpyruvate phosphatase-like    161   9e-44   
ref|XP_003563304.2|  PREDICTED: phosphoenolpyruvate phosphatase         162   9e-44   
ref|XP_010440689.1|  PREDICTED: bifunctional purple acid phosphat...    160   1e-43   
ref|XP_002886149.1|  ATPAP11/PAP11                                      160   1e-43   
ref|XP_010531065.1|  PREDICTED: purple acid phosphatase 25              160   1e-43   
ref|XP_010648745.1|  PREDICTED: bifunctional purple acid phosphat...    160   1e-43   
ref|XP_010440687.1|  PREDICTED: bifunctional purple acid phosphat...    160   1e-43   
gb|AFK47719.1|  unknown                                                 160   1e-43   
ref|XP_001778270.1|  predicted protein                                  160   1e-43   
ref|XP_003609435.1|  Purple acid phosphatase-like protein               160   2e-43   
gb|ACR23330.1|  mitochondrial acid phosphatase                          160   2e-43   
ref|XP_009102276.1|  PREDICTED: purple acid phosphatase 5-like is...    160   2e-43   
ref|XP_003579083.1|  PREDICTED: purple acid phosphatase 2-like          160   2e-43   
emb|CDY53278.1|  BnaC09g09650D                                          160   2e-43   
emb|CDY46314.1|  BnaA07g01870D                                          160   2e-43   
ref|XP_009392136.1|  PREDICTED: phosphoenolpyruvate phosphatase-like    160   2e-43   
gb|EEC81063.1|  hypothetical protein OsI_23873                          160   2e-43   
gb|AGT15919.1|  purple acid phosphatase precursor                       160   2e-43   
ref|XP_009799030.1|  PREDICTED: bifunctional purple acid phosphat...    160   3e-43   
gb|EYU34962.1|  hypothetical protein MIMGU_mgv1a005843mg                159   3e-43   
ref|NP_001147979.1|  purple acid phosphatase precursor                  159   3e-43   
ref|XP_009418189.1|  PREDICTED: phosphoenolpyruvate phosphatase-like    159   3e-43   
gb|ACF84615.1|  unknown                                                 159   4e-43   
ref|XP_009631333.1|  PREDICTED: bifunctional purple acid phosphat...    159   4e-43   
dbj|BAB88215.1|  putative secretory acid phosphatase precursor          159   5e-43   
ref|NP_001058182.1|  Os06g0643900                                       159   5e-43   
ref|XP_006467153.1|  PREDICTED: purple acid phosphatase 2-like          158   5e-43   
ref|XP_006283714.1|  hypothetical protein CARUB_v10004784mg             158   5e-43   
emb|CDP19119.1|  unnamed protein product                                158   7e-43   
ref|XP_006656291.1|  PREDICTED: phosphoenolpyruvate phosphatase-l...    158   1e-42   
dbj|BAA82130.1|  acid phosphatase                                       158   3e-42   
gb|EPS64420.1|  hypothetical protein M569_10360                         157   3e-42   
gb|KFK40196.1|  purple acid phosphatase                                 156   4e-42   
ref|XP_006359491.1|  PREDICTED: bifunctional purple acid phosphat...    156   5e-42   
ref|XP_004242741.1|  PREDICTED: bifunctional purple acid phosphat...    155   7e-42   
ref|NP_001275256.1|  purple acid phosphatase 3 precursor                155   7e-42   
ref|XP_010557615.1|  PREDICTED: bifunctional purple acid phosphat...    155   8e-42   
ref|XP_006409193.1|  hypothetical protein EUTSA_v10022710mg             154   1e-41   
ref|XP_006852875.1|  hypothetical protein AMTR_s00033p00208170          155   1e-41   
ref|XP_006412012.1|  hypothetical protein EUTSA_v10027366mg             155   1e-41   
ref|XP_004955085.1|  PREDICTED: purple acid phosphatase 2-like          154   2e-41   
ref|XP_006285738.1|  hypothetical protein CARUB_v10007211mg             154   2e-41   
emb|CDP10471.1|  unnamed protein product                                154   4e-41   
gb|EMS63219.1|  Bifunctional purple acid phosphatase 26                 153   6e-41   
ref|XP_010437359.1|  PREDICTED: purple acid phosphatase 25              152   1e-40   
ref|XP_010678958.1|  PREDICTED: purple acid phosphatase 5-like is...    151   1e-40   
ref|XP_002972138.1|  hypothetical protein SELMODRAFT_96478              152   1e-40   
ref|XP_010678957.1|  PREDICTED: purple acid phosphatase 6-like is...    151   1e-40   
ref|XP_002993027.1|  hypothetical protein SELMODRAFT_136432             152   1e-40   
dbj|BAJ92186.1|  predicted protein                                      152   2e-40   
emb|CDY24789.1|  BnaA08g15210D                                          151   2e-40   
ref|XP_009109316.1|  PREDICTED: purple acid phosphatase 6-like          151   3e-40   
emb|CDY59721.1|  BnaA03g59200D                                          151   4e-40   
ref|XP_009138418.1|  PREDICTED: purple acid phosphatase 6               151   4e-40   
emb|CDY59690.1|  BnaC07g51090D                                          151   4e-40   
ref|XP_010696563.1|  PREDICTED: bifunctional purple acid phosphat...    150   6e-40   
gb|ABE97169.1|  calcineurin-like phosphoesterase family protein         145   6e-40   
ref|XP_002971914.1|  hypothetical protein SELMODRAFT_96415              150   8e-40   
ref|XP_002993062.1|  hypothetical protein SELMODRAFT_187173             150   1e-39   
ref|NP_176033.1|  purple acid phosphatase 6                             149   1e-39   
gb|EYU25836.1|  hypothetical protein MIMGU_mgv1a026196mg                149   3e-39   
ref|XP_011093858.1|  PREDICTED: purple acid phosphatase 5-like is...    148   5e-39   
ref|XP_002534135.1|  Purple acid phosphatase precursor, putative        147   5e-39   
ref|XP_006664779.1|  PREDICTED: purple acid phosphatase 2-like          147   9e-39   
ref|XP_002867021.1|  ATPAP25/PAP25                                      147   1e-38   
ref|XP_010446806.1|  PREDICTED: purple acid phosphatase 25-like         147   1e-38   
ref|XP_006414050.1|  hypothetical protein EUTSA_v10025132mg             146   2e-38   
ref|NP_564619.1|  purple acid phosphatase 5                             145   2e-38   
gb|AAW29947.1|  putative purple acid phosphatase                        146   2e-38   
ref|XP_011093857.1|  PREDICTED: purple acid phosphatase 5-like          145   3e-38   
ref|XP_002894643.1|  ATPAP6/PAP6                                        145   3e-38   
ref|XP_010414981.1|  PREDICTED: purple acid phosphatase 6               145   3e-38   
ref|XP_001758586.1|  predicted protein                                  145   4e-38   
ref|XP_010511279.1|  PREDICTED: purple acid phosphatase 6-like          145   4e-38   
emb|CDX89724.1|  BnaC03g46380D                                          139   5e-38   
gb|AGT16393.1|  purple acid phosphatase precursor                       144   1e-37   
ref|NP_195353.1|  purple acid phosphatase 25                            144   2e-37   
sp|Q93WP4.1|PEPP_ALLCE  RecName: Full=Phosphoenolpyruvate phospha...    143   2e-37   
ref|XP_006301757.1|  hypothetical protein CARUB_v10022218mg             143   2e-37   
ref|XP_006360542.1|  PREDICTED: purple acid phosphatase 6-like          142   4e-37   
ref|XP_010480244.1|  PREDICTED: purple acid phosphatase 6-like          142   9e-37   
gb|EAY84039.1|  hypothetical protein OsI_39269                          142   9e-37   
dbj|BAK05953.1|  predicted protein                                      141   2e-36   
gb|KFK30263.1|  hypothetical protein AALP_AA7G238500                    140   2e-36   
gb|EEC69741.1|  hypothetical protein OsI_39267                          140   4e-36   
gb|EEE53671.1|  hypothetical protein OsJ_37000                          140   5e-36   
gb|ABA99978.1|  expressed protein                                       139   6e-36   
ref|XP_010432181.1|  PREDICTED: purple acid phosphatase 25-like         139   1e-35   
emb|CDY02258.1|  BnaA03g39090D                                          130   1e-35   
ref|XP_004963327.1|  PREDICTED: purple acid phosphatase 2-like          138   2e-35   
ref|XP_006435085.1|  hypothetical protein CICLE_v10003671mg             136   5e-35   
ref|XP_011017866.1|  PREDICTED: bifunctional purple acid phosphat...    136   7e-35   
ref|XP_010113480.1|  Purple acid phosphatase 25                         136   9e-35   
ref|XP_004243825.2|  PREDICTED: LOW QUALITY PROTEIN: purple acid ...    134   5e-34   
gb|AGV54598.1|  acid phosphatase                                        134   5e-34   
emb|CAN75519.1|  hypothetical protein VITISV_011076                     131   4e-33   
ref|XP_003578743.2|  PREDICTED: purple acid phosphatase 2-like          130   8e-33   
gb|ABK55715.1|  purple acid phosphatase-like protein                    124   1e-32   
ref|XP_010061256.1|  PREDICTED: purple acid phosphatase-like isof...    129   2e-32   
ref|XP_003560127.1|  PREDICTED: purple acid phosphatase 2-like is...    129   3e-32   
ref|XP_008357461.1|  PREDICTED: fe(3+)-Zn(2+) purple acid phospha...    125   3e-32   
ref|XP_002530767.1|  Purple acid phosphatase precursor, putative        129   4e-32   
ref|XP_007131383.1|  hypothetical protein PHAVU_011G009200g             127   5e-32   
ref|XP_007017663.1|  Purple acid phosphatase 10 isoform 2               125   5e-31   
ref|XP_010230374.1|  PREDICTED: purple acid phosphatase 2-like is...    124   8e-31   
gb|KHN36789.1|  Purple acid phosphatase 2                               122   6e-30   
ref|XP_006396900.1|  hypothetical protein EUTSA_v10029058mg             117   6e-30   
gb|KDP32671.1|  hypothetical protein JCGZ_13669                         122   8e-30   
ref|XP_009630255.1|  PREDICTED: LOW QUALITY PROTEIN: purple acid ...    121   2e-29   
gb|EMS66649.1|  Purple acid phosphatase 2                               113   2e-26   
emb|CDY35464.1|  BnaC03g61960D                                          112   3e-26   
ref|XP_009804739.1|  PREDICTED: LOW QUALITY PROTEIN: purple acid ...    112   3e-26   
ref|XP_011093859.1|  PREDICTED: purple acid phosphatase 2-like is...    109   3e-25   
ref|XP_002972261.1|  hypothetical protein SELMODRAFT_97551              107   1e-24   
gb|KGN58087.1|  hypothetical protein Csa_3G497890                       103   3e-24   
ref|XP_004171837.1|  PREDICTED: purple acid phosphatase 2-like          102   3e-24   
ref|XP_002984175.1|  hypothetical protein SELMODRAFT_120052             106   4e-24   
ref|XP_002970169.1|  hypothetical protein SELMODRAFT_93295              102   1e-22   
gb|EMT29608.1|  hypothetical protein F775_52563                       99.0    1e-21   
ref|XP_002978336.1|  hypothetical protein SELMODRAFT_108599           94.4    7e-20   
dbj|BAH20399.1|  AT2G16430                                            90.9    7e-19   
ref|NP_849960.1|  purple acid phosphatase 10                          89.0    3e-18   
emb|CDX89719.1|  BnaC03g46330D                                        85.5    4e-18   
gb|AAM16283.1|  truncated putative purple acid phosphatase            87.4    1e-17   
ref|XP_006423402.1|  hypothetical protein CICLE_v10028369mg           87.0    3e-17   
ref|NP_179405.1|  purple acid phosphatase 11                          86.7    7e-17   
ref|XP_010058879.1|  PREDICTED: purple acid phosphatase 2-like        82.8    7e-17   
ref|NP_190198.1|  purple acid phosphatase 19                          84.3    3e-16   
ref|XP_006396899.1|  hypothetical protein EUTSA_v10028786mg           82.8    4e-16   
gb|KHN22216.1|  Purple acid phosphatase 2                             84.0    5e-16   
ref|XP_009373021.1|  PREDICTED: purple acid phosphatase 2-like        81.6    1e-15   
ref|XP_008237012.1|  PREDICTED: purple acid phosphatase 2-like        80.5    3e-15   
gb|EMS61114.1|  Purple acid phosphatase 10                            77.0    5e-15   
ref|XP_009838177.1|  hypothetical protein H257_12603                  80.9    6e-15   
ref|XP_008867791.1|  hypothetical protein H310_04978                  77.0    1e-13   
ref|XP_008374980.1|  PREDICTED: uncharacterized protein LOC103438233  76.3    5e-13   
ref|XP_009405899.1|  PREDICTED: probable purple acid phosphatase 20   74.7    1e-12   
ref|XP_007202051.1|  hypothetical protein PRUPE_ppa005749mg           74.3    1e-12   
emb|CBI21090.3|  unnamed protein product                              70.9    3e-12   
ref|XP_002986278.1|  hypothetical protein SELMODRAFT_425237           73.2    3e-12   
ref|NP_001067372.1|  Os12g0637400                                     70.1    3e-12   
ref|XP_001743494.1|  hypothetical protein                             72.8    4e-12   
ref|XP_010910748.1|  PREDICTED: purple acid phosphatase-like          70.9    4e-12   
ref|XP_009352443.1|  PREDICTED: purple acid phosphatase 18-like       72.4    6e-12   
ref|XP_009334828.1|  PREDICTED: purple acid phosphatase 18-like       72.0    7e-12   
ref|XP_007204390.1|  hypothetical protein PRUPE_ppa005956mg           72.0    9e-12   



>sp|Q9SE00.1|PPAF1_IPOBA RecName: Full=Purple acid phosphatase 1; AltName: Full=Manganese(II) 
purple acid phosphatase 1; Flags: Precursor [Ipomoea 
batatas]
 gb|AAF19821.1|AF200825_1 purple acid phosphatase precursor [Ipomoea batatas]
Length=473

 Score =   254 bits (649),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 137/158 (87%), Gaps = 2/158 (1%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT--  296
            VTSSYVR SLSA PN EDVDMP DSDVF VP G NAPQQVHITQGDYEG+GVIISWTT  
Sbjct  27   VTSSYVRKSLSALPNAEDVDMPWDSDVFAVPSGYNAPQQVHITQGDYEGRGVIISWTTPY  86

Query  295  HKHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGH  116
             K G+  V YW+ENS++++ ++G VVTYKYYNYTS +IHHCTIKDLE+DTKYYY+LG G 
Sbjct  87   DKAGANKVVYWSENSKSQKRAMGTVVTYKYYNYTSAFIHHCTIKDLEYDTKYYYRLGFGD  146

Query  115  AKRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            AKR FWFVTPPKPGPDVPY FGLIGD+GQT+DSNTTLT
Sbjct  147  AKRQFWFVTPPKPGPDVPYVFGLIGDIGQTHDSNTTLT  184



>pdb|1XZW|A Chain A, Sweet Potato Purple Acid PhosphatasePHOSPHATE COMPLEX
 pdb|1XZW|B Chain B, Sweet Potato Purple Acid PhosphatasePHOSPHATE COMPLEX
Length=426

 Score =   236 bits (603),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 126/145 (87%), Gaps = 2/145 (1%)
 Frame = -2

Query  430  PNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT--HKHGSKAVHYWAE  257
            PN EDVDMP DSDVF VP G NAPQQVHITQGDYEG+GVIISWTT   K G+  V YW+E
Sbjct  2    PNAEDVDMPWDSDVFAVPSGYNAPQQVHITQGDYEGRGVIISWTTPYDKAGANKVFYWSE  61

Query  256  NSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKP  77
            NS++++ ++G VVTYKYYNYTS +IHHCTIKDLE+DTKYYY+LG G AKR FWFVTPPKP
Sbjct  62   NSKSQKRAMGTVVTYKYYNYTSAFIHHCTIKDLEYDTKYYYRLGFGDAKRQFWFVTPPKP  121

Query  76   GPDVPYTFGLIGDLGQTYDSNTTLT  2
            GPDVPY FGLIGD+GQT+DSNTTLT
Sbjct  122  GPDVPYVFGLIGDIGQTHDSNTTLT  146



>emb|CAA07280.1| purple acid phosphatase [Ipomoea batatas]
Length=427

 Score =   234 bits (598),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 120/138 (87%), Gaps = 1/138 (1%)
 Frame = -2

Query  412  DMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHKH-GSKAVHYWAENSRAKRF  236
            DMPLDSDVFRVP G N PQQVHITQGDYEGKGVIISW T +  GSK V YWAENS  KR 
Sbjct  1    DMPLDSDVFRVPPGYNVPQQVHITQGDYEGKGVIISWVTPEEPGSKTVVYWAENSSVKRR  60

Query  235  SVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPYT  56
            + G VVTYKYYNYTS YIHHCTIKDLE+DTKYYY+LG G AKR FWFVTPPKPGPDVPYT
Sbjct  61   ADGVVVTYKYYNYTSGYIHHCTIKDLEYDTKYYYELGLGDAKRQFWFVTPPKPGPDVPYT  120

Query  55   FGLIGDLGQTYDSNTTLT  2
            FGLIGDLGQTYDSNTTLT
Sbjct  121  FGLIGDLGQTYDSNTTLT  138



>ref|XP_011028930.1| PREDICTED: purple acid phosphatase 2-like isoform X2 [Populus 
euphratica]
Length=394

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 127/157 (81%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            +TSSYVR++  +      +DMPLDSDVFRVP G NAPQQVHITQGD+EGKGVI+SW T  
Sbjct  49   ITSSYVRDADFS------LDMPLDSDVFRVPPGYNAPQQVHITQGDHEGKGVIVSWVTQD  102

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GSK V YWAENS  K+ + G +VTYKYYNYTS YIHHCTI+DLE DTKYYY++G G+ 
Sbjct  103  EPGSKTVLYWAENSGLKKLAEGFIVTYKYYNYTSGYIHHCTIEDLEFDTKYYYEVGIGNT  162

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF+TPPKPGPDVPYTFGLIGDLGQT DSN TLT
Sbjct  163  TRQFWFLTPPKPGPDVPYTFGLIGDLGQTSDSNRTLT  199



>ref|XP_011028929.1| PREDICTED: purple acid phosphatase 2-like isoform X1 [Populus 
euphratica]
Length=488

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 127/157 (81%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            +TSSYVR++  +      +DMPLDSDVFRVP G NAPQQVHITQGD+EGKGVI+SW T  
Sbjct  49   ITSSYVRDADFS------LDMPLDSDVFRVPPGYNAPQQVHITQGDHEGKGVIVSWVTQD  102

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GSK V YWAENS  K+ + G +VTYKYYNYTS YIHHCTI+DLE DTKYYY++G G+ 
Sbjct  103  EPGSKTVLYWAENSGLKKLAEGFIVTYKYYNYTSGYIHHCTIEDLEFDTKYYYEVGIGNT  162

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF+TPPKPGPDVPYTFGLIGDLGQT DSN TLT
Sbjct  163  TRQFWFLTPPKPGPDVPYTFGLIGDLGQTSDSNRTLT  199



>ref|XP_002300736.2| hypothetical protein POPTR_0002s03080g [Populus trichocarpa]
 gb|EEE80009.2| hypothetical protein POPTR_0002s03080g [Populus trichocarpa]
Length=488

 Score =   224 bits (572),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 127/157 (81%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            +TSSYVR++  +      +DMPLDSDVFRVP G NAPQQVHITQGD+EGKGVI+SW T  
Sbjct  49   ITSSYVRDADFS------LDMPLDSDVFRVPPGYNAPQQVHITQGDHEGKGVIVSWVTQD  102

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GSK V YWAENS  K+ + G +VTYK+YNYTS YIHHCTI+DLE DTKYYY++G G+ 
Sbjct  103  EPGSKTVLYWAENSGLKKIAEGFIVTYKFYNYTSGYIHHCTIEDLEFDTKYYYEVGIGNT  162

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF+TPPKPGPDVPYTFGLIGDLGQT DSN TLT
Sbjct  163  TRQFWFLTPPKPGPDVPYTFGLIGDLGQTSDSNRTLT  199



>ref|XP_011048850.1| PREDICTED: purple acid phosphatase 2-like isoform X2 [Populus 
euphratica]
Length=372

 Score =   219 bits (559),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 126/157 (80%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TSSYVRN      +   +DMPLDSDVFRVP G NAPQQVHITQGD+EGKGVI+SW T  
Sbjct  28   ITSSYVRN------DDLSLDMPLDSDVFRVPPGYNAPQQVHITQGDHEGKGVIVSWVTPD  81

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GSK V YWAENS  K  + G ++ Y+Y+NYTS YIHHCTIKDLE DTKYYY++G G+ 
Sbjct  82   EPGSKTVLYWAENSELKNSADGFILKYRYFNYTSGYIHHCTIKDLEFDTKYYYEVGIGNT  141

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF+TPP+PGPDVPYTFGLIGDLGQT+DSN T+T
Sbjct  142  TRQFWFITPPRPGPDVPYTFGLIGDLGQTHDSNRTVT  178



>ref|XP_009787761.1| PREDICTED: purple acid phosphatase 2-like [Nicotiana sylvestris]
Length=468

 Score =   221 bits (564),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 128/157 (82%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TS+YVR   S      +VDMPL+SDVFRVP G NAPQQV+ITQGD+EGKGVI+SWTT  
Sbjct  30   ITSNYVRKYNS------NVDMPLNSDVFRVPPGYNAPQQVYITQGDHEGKGVIVSWTTPD  83

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GS +V YWAENS  K  + G VV+Y+YYNYTS YIHHCTIKDLE DTKYYY++G  + 
Sbjct  84   EPGSNSVLYWAENSNVKSSAEGFVVSYRYYNYTSGYIHHCTIKDLEFDTKYYYEVGLENT  143

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWFVTPPKPGPDVPYTFGLIGDLGQTYDSN+TLT
Sbjct  144  TRKFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNSTLT  180



>ref|XP_009611298.1| PREDICTED: purple acid phosphatase 2-like [Nicotiana tomentosiformis]
Length=468

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 126/157 (80%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TS+YVR   S      +VDMPL+SDVFRVP G NAP QV+ITQGD EGKGVI+SWTT  
Sbjct  30   ITSNYVRKYNS------NVDMPLNSDVFRVPPGYNAPHQVYITQGDLEGKGVIVSWTTPD  83

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GS +V YWAENS  K  + G VV+YKYYNYTS YIHHCTIKDLE D KYYY++G G+ 
Sbjct  84   EPGSNSVLYWAENSNVKSSAEGFVVSYKYYNYTSGYIHHCTIKDLEFDAKYYYEVGLGNT  143

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWFVTPPKPGPDVPYTFGLIGDLGQTYDSN+TLT
Sbjct  144  TRQFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNSTLT  180



>dbj|BAC55156.1| purple acid phosphatase [Nicotiana tabacum]
Length=468

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 127/157 (81%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TS+YVR   S      +VDMPL+SDVFRVP G NAPQQV+ITQGD+EGKGVI SWTT  
Sbjct  30   ITSNYVRKYNS------NVDMPLNSDVFRVPPGYNAPQQVYITQGDHEGKGVIASWTTPD  83

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GS +V YWAENS  K  + G VV+Y+YYNYTS YIHHCTIKDLE DTKYYY++G  + 
Sbjct  84   EPGSNSVLYWAENSNVKSSAEGFVVSYRYYNYTSGYIHHCTIKDLEFDTKYYYEVGLENT  143

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWFVTPPKPGPDVPYTFGLIGDLGQTYDSN+TLT
Sbjct  144  TRKFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNSTLT  180



>ref|XP_011048849.1| PREDICTED: purple acid phosphatase 2-like isoform X1 [Populus 
euphratica]
Length=467

 Score =   219 bits (559),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 126/157 (80%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TSSYVRN      +   +DMPLDSDVFRVP G NAPQQVHITQGD+EGKGVI+SW T  
Sbjct  28   ITSSYVRN------DDLSLDMPLDSDVFRVPPGYNAPQQVHITQGDHEGKGVIVSWVTPD  81

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GSK V YWAENS  K  + G ++ Y+Y+NYTS YIHHCTIKDLE DTKYYY++G G+ 
Sbjct  82   EPGSKTVLYWAENSELKNSADGFILKYRYFNYTSGYIHHCTIKDLEFDTKYYYEVGIGNT  141

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF+TPP+PGPDVPYTFGLIGDLGQT+DSN T+T
Sbjct  142  TRQFWFITPPRPGPDVPYTFGLIGDLGQTHDSNRTVT  178



>ref|XP_002307690.1| Iron(III)-zinc(II) purple acid phosphatase precursor family protein 
[Populus trichocarpa]
 gb|EEE94686.1| Iron(III)-zinc(II) purple acid phosphatase precursor family protein 
[Populus trichocarpa]
Length=467

 Score =   219 bits (559),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 126/157 (80%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TSSYVRN      +   +DMPLDSDVFRVP G NAPQQVHITQGD+EGKGVI+SW T  
Sbjct  28   ITSSYVRN------DDLSLDMPLDSDVFRVPPGYNAPQQVHITQGDHEGKGVIVSWVTPD  81

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GSK V YWAENS  K  + G ++ Y+Y+NYTS YIHHCTIKDLE DTKYYY++G G+ 
Sbjct  82   EPGSKTVLYWAENSELKNSADGFILKYRYFNYTSGYIHHCTIKDLEFDTKYYYEVGIGNT  141

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF+TPP+PGPDVPYTFGLIGDLGQT+DSN T+T
Sbjct  142  TRQFWFITPPRPGPDVPYTFGLIGDLGQTHDSNRTVT  178



>ref|XP_010271524.1| PREDICTED: purple acid phosphatase [Nelumbo nucifera]
Length=471

 Score =   217 bits (553),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 124/157 (79%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            +TS++VR +       + VDMPLDSDVFRVP G NAPQQVHITQGD+EGKGVIISW T  
Sbjct  33   ITSTFVRKA------EKTVDMPLDSDVFRVPPGYNAPQQVHITQGDHEGKGVIISWVTQD  86

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS AV YW+ENS+ K  + G VVTYK+YNYTS YIHHCTIK+L+ DTKYYY++G G  
Sbjct  87   EPGSSAVLYWSENSKHKYLAKGEVVTYKFYNYTSGYIHHCTIKNLKFDTKYYYEIGIGKT  146

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF TPPK GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  147  VRQFWFRTPPKVGPDVPYTFGLIGDLGQSFDSNRTLT  183



>ref|XP_002263937.1| PREDICTED: purple acid phosphatase [Vitis vinifera]
 emb|CBI38022.3| unnamed protein product [Vitis vinifera]
Length=472

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 124/157 (79%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TSS+VR         + +DMPLDSDVFRVP G NAPQQVHITQGD+EG+GVI+SW T  
Sbjct  33   ITSSFVRKV------EKTIDMPLDSDVFRVPLGYNAPQQVHITQGDHEGRGVIVSWVTVD  86

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GS  V YW+ENS+ K  + G +VTYK+YNYTS YIHHCTIK+LE +TKYYY +G GH 
Sbjct  87   EPGSNTVLYWSENSKRKNRAEGIMVTYKFYNYTSGYIHHCTIKNLEFNTKYYYVVGIGHT  146

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWFVTPPK GPDVPYTFGLIGDLGQ+YDSN TLT
Sbjct  147  PRKFWFVTPPKVGPDVPYTFGLIGDLGQSYDSNMTLT  183



>dbj|BAA97038.2| acid phosphatase precursor [Tagetes patula]
Length=466

 Score =   215 bits (547),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 129/158 (82%), Gaps = 9/158 (6%)
 Frame = -2

Query  469  VTSSYVR-NSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-  296
            ++SSY R N +SA       DMPL+SDVF +PHG NAPQQVHITQGD+EG+GVI+SW T 
Sbjct  27   ISSSYSRTNDISA-------DMPLNSDVFALPHGFNAPQQVHITQGDHEGRGVIVSWVTP  79

Query  295  HKHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGH  116
            ++ GS  V YWAENS  K+ +VG+ VTYKYYNY+S YIHHCTIK+LE++TKY+Y+LG+G+
Sbjct  80   NEPGSSKVIYWAENSNVKQHAVGSFVTYKYYNYSSPYIHHCTIKNLEYNTKYFYELGTGN  139

Query  115  AKRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
              R FWF TPP+ GPDVPYTFGLIGDLGQT+DSN TLT
Sbjct  140  VTRQFWFTTPPEVGPDVPYTFGLIGDLGQTFDSNRTLT  177



>ref|XP_011083627.1| PREDICTED: purple acid phosphatase 2-like [Sesamum indicum]
Length=469

 Score =   214 bits (545),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 124/157 (79%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TSSYVRN      N    DMPLDSDVF+ P G NAPQQ HITQGD+EGKGVI+SW T  
Sbjct  30   LTSSYVRN------NGLSQDMPLDSDVFKEPPGYNAPQQGHITQGDHEGKGVIVSWITPD  83

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GS +V YW  NSR K+ + G VV Y YYNYTS YIHHCTIK+L++DTKYYY+LG+G+ 
Sbjct  84   EPGSNSVLYWPANSRIKKTAHGVVVKYTYYNYTSGYIHHCTIKNLDYDTKYYYELGAGNV  143

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF+TPP+PGPDVPYTFGLIGDLGQTYDSN TLT
Sbjct  144  TRQFWFLTPPQPGPDVPYTFGLIGDLGQTYDSNRTLT  180



>ref|XP_002264113.1| PREDICTED: purple acid phosphatase [Vitis vinifera]
Length=472

 Score =   214 bits (544),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 123/157 (78%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TSS+VR         + +DMPLDSDVFRVP G NAPQQVHITQGD+EG+GVI+SW T  
Sbjct  33   ITSSFVRKV------EKTIDMPLDSDVFRVPLGYNAPQQVHITQGDHEGRGVIVSWVTVD  86

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GS  V YW+E S+ K  + G +VTYK+YNYTS YIHHCTIK+LE +TKYYY +G GH 
Sbjct  87   EPGSNTVLYWSEKSKRKNRAEGIMVTYKFYNYTSGYIHHCTIKNLEFNTKYYYVVGIGHT  146

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWFVTPPK GPDVPYTFGLIGDLGQ+YDSN TLT
Sbjct  147  PRKFWFVTPPKVGPDVPYTFGLIGDLGQSYDSNMTLT  183



>ref|XP_002274392.1| PREDICTED: purple acid phosphatase [Vitis vinifera]
 emb|CBI38023.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 121/157 (77%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            +TSS+VR +       + VDMPLDSDVF  P G NAPQQVHITQGD+ GK VI+SW T  
Sbjct  34   ITSSFVRQA------EKSVDMPLDSDVFAEPPGYNAPQQVHITQGDHSGKAVIVSWVTMA  87

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V YW+E S+ K  +  +VVTYKYYNY S YIHHCTI++LE DTKYYY++GSGH 
Sbjct  88   EPGSNTVLYWSEKSKVKMQAEASVVTYKYYNYASGYIHHCTIRNLEFDTKYYYEVGSGHV  147

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R FWFVTPP+ GPDVPYTFGLIGDLGQTYDSN TLT
Sbjct  148  RRKFWFVTPPEVGPDVPYTFGLIGDLGQTYDSNMTLT  184



>ref|XP_002510464.1| Iron(III)-zinc(II) purple acid phosphatase precursor, putative 
[Ricinus communis]
 gb|EEF52651.1| Iron(III)-zinc(II) purple acid phosphatase precursor, putative 
[Ricinus communis]
Length=469

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 126/158 (80%), Gaps = 9/158 (6%)
 Frame = -2

Query  469  VTSSYVRN-SLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-  296
            +TSS+VR+ +LS       +DMPLDSDVF VP G NAPQQVHITQGD+EG  VI+SW T 
Sbjct  30   ITSSFVRSGNLS-------LDMPLDSDVFEVPPGYNAPQQVHITQGDHEGNSVIVSWVTQ  82

Query  295  HKHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGH  116
            +  GS+ V YWAE+ + K  + G +V YKY+NYTS YIHHCTIKDLE DTKY+Y++GSG+
Sbjct  83   YGPGSRTVLYWAEHDKLKNHADGYIVRYKYFNYTSGYIHHCTIKDLEFDTKYFYEVGSGN  142

Query  115  AKRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
              R FWF+TPPKPGPDVPYTFGLIGDLGQTYDSN TLT
Sbjct  143  VTRKFWFITPPKPGPDVPYTFGLIGDLGQTYDSNRTLT  180



>dbj|BAJ53173.1| JHL18I08.7 [Jatropha curcas]
 gb|KDP38574.1| hypothetical protein JCGZ_04499 [Jatropha curcas]
Length=471

 Score =   212 bits (539),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 122/157 (78%), Gaps = 9/157 (6%)
 Frame = -2

Query  466  TSSYVR-NSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            TSS+VR ++LS       +DMPLDSDVFRVP G NAPQQVHITQGDYE   VI+SW T  
Sbjct  33   TSSFVRTDNLS-------LDMPLDSDVFRVPPGYNAPQQVHITQGDYEANSVIVSWVTPD  85

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GS +V YWAENS  K    G VV YKY+NYTS YIHHCTIKDLE DTKY Y++G+G+A
Sbjct  86   EPGSSSVQYWAENSEIKNSVEGLVVRYKYFNYTSGYIHHCTIKDLEFDTKYQYQVGTGNA  145

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWFVTPPK GPDVPYTFGLIGDLGQT+DSN TL 
Sbjct  146  IRQFWFVTPPKSGPDVPYTFGLIGDLGQTHDSNRTLA  182



>gb|AET86953.1| PAP1 [Gossypium hirsutum]
Length=481

 Score =   212 bits (539),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 123/156 (79%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TSS+VRNS  +       DMPLDSDVFRVP G NAPQQVHITQGD+ G  VI+SW T  +
Sbjct  32   TSSFVRNSDLSR------DMPLDSDVFRVPPGYNAPQQVHITQGDHLGNAVIVSWVTPDE  85

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS +V YWAENS  K  + G V+TYKY+NYTS +IHHCTI+DLE DTKYYY++G G++ 
Sbjct  86   PGSNSVFYWAENSELKNSAQGIVLTYKYFNYTSGFIHHCTIRDLEFDTKYYYEVGIGNSS  145

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWFVTPP  GPDVPYTFGLIGDLGQT+DSN+TLT
Sbjct  146  RRFWFVTPPAIGPDVPYTFGLIGDLGQTHDSNSTLT  181



>gb|KHG20720.1| Purple acid phosphatase 2 [Gossypium arboreum]
Length=474

 Score =   211 bits (538),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 123/156 (79%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TSS+VRNS  +       DMPLDSDVFRVP G NAPQQVHITQGD+ G  VI+SW T  +
Sbjct  32   TSSFVRNSDLSR------DMPLDSDVFRVPPGYNAPQQVHITQGDHLGNAVIVSWVTPDE  85

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS +V YWAENS  K  + G V+TYKY+NYTS +IHHCTI+DLE DTKYYY++G G++ 
Sbjct  86   PGSNSVFYWAENSELKNSAQGIVLTYKYFNYTSGFIHHCTIRDLEFDTKYYYEVGIGNSS  145

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWFVTPP  GPDVPYTFGLIGDLGQT+DSN+TLT
Sbjct  146  RRFWFVTPPAIGPDVPYTFGLIGDLGQTHDSNSTLT  181



>ref|XP_002280873.1| PREDICTED: purple acid phosphatase 2 [Vitis vinifera]
 emb|CAN60822.1| hypothetical protein VITISV_037054 [Vitis vinifera]
 emb|CBI19779.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   211 bits (537),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 125/158 (79%), Gaps = 9/158 (6%)
 Frame = -2

Query  469  VTSSYVR-NSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-  296
            VTSS+VR  ++SA       DMPLDSDVF+VP G NAPQQVHITQGDYEG  V++SWTT 
Sbjct  28   VTSSFVRTKNISA-------DMPLDSDVFQVPPGYNAPQQVHITQGDYEGNAVLVSWTTP  80

Query  295  HKHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGH  116
             + GS  V YWAENS+ K  + G V+TYKY+NYTS YIHHCTIK+L  DTKYYY++G G+
Sbjct  81   DEPGSSTVLYWAENSKTKSHAKGIVLTYKYFNYTSGYIHHCTIKNLTFDTKYYYEVGIGN  140

Query  115  AKRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            + R FWFVTPP+ GPDVPYTFGLIGDLGQTY SN TLT
Sbjct  141  STRQFWFVTPPRAGPDVPYTFGLIGDLGQTYHSNRTLT  178



>gb|AGL44398.1| calcineurin-like phosphoesterase [Manihot esculenta]
Length=263

 Score =   205 bits (521),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 110/137 (80%), Gaps = 1/137 (1%)
 Frame = -2

Query  409  MPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HKHGSKAVHYWAENSRAKRFS  233
            MPLDSDVFRVP G NAPQQVHITQGDYE   VI+ W T  + GS+ + YWAENS  K   
Sbjct  1    MPLDSDVFRVPPGYNAPQQVHITQGDYEANSVIVFWVTPDEPGSRTMIYWAENSELKNRV  60

Query  232  VGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPYTF  53
             G VV YKY+NYTS YIHHCTIKDLE DTKYYY++G+G A R FWF+TPPK GPDVPYTF
Sbjct  61   DGLVVKYKYFNYTSGYIHHCTIKDLEFDTKYYYQVGTGKASRRFWFITPPKSGPDVPYTF  120

Query  52   GLIGDLGQTYDSNTTLT  2
            GLIGDLGQT+DSN TLT
Sbjct  121  GLIGDLGQTHDSNQTLT  137



>ref|XP_006409435.1| hypothetical protein EUTSA_v10022681mg [Eutrema salsugineum]
 gb|ESQ50888.1| hypothetical protein EUTSA_v10022681mg [Eutrema salsugineum]
Length=463

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 116/156 (74%), Gaps = 6/156 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            +TS +VR         + +DMPLDSDVFRVPHG NAPQQVHITQGD EGK VI+SW T  
Sbjct  28   ITSKFVRKV------EKSIDMPLDSDVFRVPHGYNAPQQVHITQGDVEGKAVIVSWVTQS  81

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW ENS  K  + G   TYK+YNYTS YIHHCTI+ LE+D+KYYY +G G  +
Sbjct  82   KGSNTVLYWKENSSKKLKAHGKTNTYKFYNYTSRYIHHCTIRHLEYDSKYYYVVGVGETE  141

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF TPP+ GPDVPYTFGLIGDLGQT+DSN TLT
Sbjct  142  RKFWFFTPPQVGPDVPYTFGLIGDLGQTFDSNITLT  177



>gb|ABV89751.1| purple acid phosphatase 12 protein family isoform 5 premature 
2 [Brassica napus]
 gb|ABV89754.1| purple acid phosphatase 12 protein family isoform 5 premature 
2 [Brassica napus]
Length=246

 Score =   203 bits (517),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 118/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TS YVR     S  P+D  MPLDSDVF+VP G N PQQVHITQG++EG GVIISW T  
Sbjct  30   ITSEYVR----GSDLPDD--MPLDSDVFKVPPGRNTPQQVHITQGNHEGNGVIISWVTPS  83

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
               S  V YW+EN ++K+ +   + TY+++NYTS YIHHC I DLE D KYYY++GSG  
Sbjct  84   APCSNTVRYWSENGKSKKLAEATMNTYRFFNYTSGYIHHCLIDDLEFDMKYYYEIGSGKW  143

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R FWF TPPKPGPDVPYTFGLIGDLGQTYDSN TL+
Sbjct  144  RRRFWFFTPPKPGPDVPYTFGLIGDLGQTYDSNRTLS  180



>ref|XP_002880886.1| secreted purple acid phosphatase precursor [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH57145.1| secreted purple acid phosphatase precursor [Arabidopsis lyrata 
subsp. lyrata]
Length=469

 Score =   210 bits (534),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 123/157 (78%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTH-  293
            +TS YVR    AS  P+D  MPLDSDVF  P G N+PQQVH+TQG++EG GVIISW T  
Sbjct  30   ITSEYVR----ASDLPDD--MPLDSDVFAFPPGPNSPQQVHLTQGNHEGNGVIISWVTPV  83

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            K GS  VHYW+EN ++K+ + G V TY+++NYTS YIHHC I DL+ DTKYYY++GSG  
Sbjct  84   KPGSNTVHYWSENEKSKKQAEGTVNTYRFFNYTSGYIHHCLINDLKFDTKYYYEIGSGRW  143

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF TPPKPGPDVPYTFGLIGDLGQTYDSN+TL+
Sbjct  144  SRRFWFFTPPKPGPDVPYTFGLIGDLGQTYDSNSTLS  180



>ref|XP_010061253.1| PREDICTED: purple acid phosphatase-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010061254.1| PREDICTED: purple acid phosphatase-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW68181.1| hypothetical protein EUGRSUZ_F01849 [Eucalyptus grandis]
Length=476

 Score =   210 bits (534),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 122/158 (77%), Gaps = 9/158 (6%)
 Frame = -2

Query  469  VTSSYVRNS-LSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-  296
            +TSSYVR++ LSA       DMPLDSDVFRVP G NAPQQVHITQGDY GKGVI+SW T 
Sbjct  31   ITSSYVRSANLSA-------DMPLDSDVFRVPPGYNAPQQVHITQGDYVGKGVIVSWVTP  83

Query  295  HKHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGH  116
             + GS  V YWAE S  +  + G V TYKY+NYTS YIHHC I+DLE+DTKYYY++G G+
Sbjct  84   DEPGSNTVVYWAEGSTTESRAEGIVTTYKYFNYTSGYIHHCAIEDLEYDTKYYYEVGIGN  143

Query  115  AKRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
              R FWFVTPP  GPD+PY FGLIGDLGQTYDSN TLT
Sbjct  144  TTRQFWFVTPPGIGPDIPYVFGLIGDLGQTYDSNRTLT  181



>ref|XP_002280883.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Vitis vinifera]
 ref|XP_010664743.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Vitis vinifera]
 ref|XP_010664744.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Vitis vinifera]
 ref|XP_010664745.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Vitis vinifera]
 ref|XP_010664746.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Vitis vinifera]
 ref|XP_010664747.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Vitis vinifera]
 ref|XP_010664748.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Vitis vinifera]
 ref|XP_010664749.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Vitis vinifera]
 ref|XP_010664751.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Vitis vinifera]
 ref|XP_010664752.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Vitis vinifera]
 emb|CBI19778.3| unnamed protein product [Vitis vinifera]
Length=468

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 122/158 (77%), Gaps = 9/158 (6%)
 Frame = -2

Query  469  VTSSYVR-NSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-  296
            VTSS+ R N++SA       DMPLDSDVFRVP G NAPQQVHITQGDYEG  VIISW T 
Sbjct  28   VTSSFARTNNISA-------DMPLDSDVFRVPPGYNAPQQVHITQGDYEGNAVIISWITP  80

Query  295  HKHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGH  116
             + GS  V YWAEN + K  + G V+TYKY+ YTS YIHHCTI++L  DTKYYY++G G+
Sbjct  81   DEPGSNTVLYWAENGKHKSHANGIVLTYKYFKYTSGYIHHCTIRNLVFDTKYYYEVGIGN  140

Query  115  AKRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
              R FWFVTPP+ GPDVPYTFGLIGDLGQTYDSN TLT
Sbjct  141  TTRQFWFVTPPRAGPDVPYTFGLIGDLGQTYDSNRTLT  178



>ref|XP_010105263.1| Purple acid phosphatase 2 [Morus notabilis]
 gb|EXC04198.1| Purple acid phosphatase 2 [Morus notabilis]
Length=594

 Score =   211 bits (538),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 122/159 (77%), Gaps = 11/159 (7%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDV--DMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT  296
            +TSSYVRN        ED+  DMPLDSDVFRVP G NAPQQVHITQGD+ GKGVI+SW T
Sbjct  32   ITSSYVRN--------EDLVHDMPLDSDVFRVPPGYNAPQQVHITQGDHVGKGVIVSWVT  83

Query  295  -HKHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSG  119
              + GS  V YWAENS  K  + G V+TYKY+NYTS YIHHCTI DLE DTKYYY++G G
Sbjct  84   PDEAGSSTVLYWAENSELKNSAQGIVLTYKYFNYTSGYIHHCTINDLEFDTKYYYEVGIG  143

Query  118  HAKRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            ++ R FWF TPP  GPDVPYTFGLIGDLGQT DSN TLT
Sbjct  144  NSTRKFWFRTPPSVGPDVPYTFGLIGDLGQTPDSNRTLT  182


 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 51/81 (63%), Gaps = 1/81 (1%)
 Frame = -2

Query  352  VHITQGDYEGKGVIISWTT-HKHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHH  176
            VHITQGD+ GK VI+SW    + GS  V YWAEN   K  + G V+TYK++NYTS YIHH
Sbjct  471  VHITQGDHVGKDVIVSWAIPDEAGSSTVFYWAENDDRKNSAQGIVLTYKFFNYTSGYIHH  530

Query  175  CTIKDLEHDTKYYYKLGSGHA  113
            C I +LE       +  SGH 
Sbjct  531  CIISELEPSYSASREARSGHG  551



>ref|XP_002874764.1| secreted purple acid phosphatase precursor [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH51023.1| secreted purple acid phosphatase precursor [Arabidopsis lyrata 
subsp. lyrata]
Length=469

 Score =   209 bits (531),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 122/157 (78%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTH-  293
            +TS YVR    AS  P+D  MPLDSDVF +P G N+PQQVH+TQG++EG GVIISW T  
Sbjct  30   ITSEYVR----ASDLPDD--MPLDSDVFALPPGPNSPQQVHVTQGNHEGNGVIISWVTPV  83

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            K GS  VHYW EN ++K+   G V TY+++NYTS YIHHC I DLE DTKYYY++GSG  
Sbjct  84   KPGSNTVHYWFENEKSKKQEEGTVNTYRFFNYTSGYIHHCLIDDLEFDTKYYYEIGSGKW  143

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF TPP+PGPDVPYTFGLIGDLGQTYDSN+TL+
Sbjct  144  SRRFWFFTPPEPGPDVPYTFGLIGDLGQTYDSNSTLS  180



>ref|XP_007042078.1| Purple acid phosphatase 10 [Theobroma cacao]
 gb|EOX97909.1| Purple acid phosphatase 10 [Theobroma cacao]
Length=470

 Score =   209 bits (531),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 120/156 (77%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHKH  287
            TS YVRN        + VDMPLDSDVF +P G NAPQQVHITQGD+ GK VI+SW T   
Sbjct  33   TSVYVRNV------EKTVDMPLDSDVFGLPSGYNAPQQVHITQGDHVGKAVIVSWVTDDE  86

Query  286  -GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW+ENS+ K+ + G V TYK+YNYTS YIHHCTI++LE++TKYYY +G GH  
Sbjct  87   PGSSTVLYWSENSKQKKMAEGKVKTYKFYNYTSGYIHHCTIRNLEYNTKYYYMVGVGHTM  146

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF TPP+ GPDVPYTFGLIGDLGQT+DSN+TLT
Sbjct  147  RKFWFTTPPEVGPDVPYTFGLIGDLGQTFDSNSTLT  182



>ref|XP_009794994.1| PREDICTED: purple acid phosphatase 2-like [Nicotiana sylvestris]
Length=461

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 121/157 (77%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            +TSSYVR   S+       DMPLDSDVFRVPHG NAPQQVH+TQGD+ GKGVI+SW T  
Sbjct  26   ITSSYVRKVESSE------DMPLDSDVFRVPHGYNAPQQVHLTQGDHVGKGVIVSWVTMD  79

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V YW  NS+ K+ + G V TYKY+ Y S YIHHCTI++L+++TKYYY +G+GH+
Sbjct  80   EPGSNKVLYWEFNSKIKQIAKGTVSTYKYHTYNSGYIHHCTIQNLKYNTKYYYMVGTGHS  139

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R FWFVTPP  GPDV YTFGLIGDLGQTYDSN TLT
Sbjct  140  RRTFWFVTPPPVGPDVSYTFGLIGDLGQTYDSNMTLT  176



>gb|AAT37527.1| purple acid phosphatase 2 [Solanum tuberosum]
Length=447

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 118/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            VTSS+VR         + +DMPLDSDVFRVP G NAPQQVHITQGD+ GK VI+SW T  
Sbjct  8    VTSSFVRKI------EKTIDMPLDSDVFRVPPGYNAPQQVHITQGDHVGKAVIVSWVTMD  61

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V YW+E S+ K  + G V TYK+YNYTS YIHHC IK+L+ DTKYYYK+G GH 
Sbjct  62   EPGSSTVVYWSEKSKLKNKANGKVTTYKFYNYTSGYIHHCNIKNLKFDTKYYYKIGIGHV  121

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF TPP+ GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  122  ARTFWFTTPPEAGPDVPYTFGLIGDLGQSFDSNKTLT  158



>emb|CBI38021.3| unnamed protein product [Vitis vinifera]
Length=426

 Score =   207 bits (526),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 113/137 (82%), Gaps = 1/137 (1%)
 Frame = -2

Query  409  MPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HKHGSKAVHYWAENSRAKRFS  233
            MPLDSDVFRVP G NAPQQVHITQGD+EG+GVI+SW T  + GS  V YW+E S+ K  +
Sbjct  1    MPLDSDVFRVPLGYNAPQQVHITQGDHEGRGVIVSWVTVDEPGSNTVLYWSEKSKRKNRA  60

Query  232  VGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPYTF  53
             G +VTYK+YNYTS YIHHCTIK+LE +TKYYY +G GH  R FWFVTPPK GPDVPYTF
Sbjct  61   EGIMVTYKFYNYTSGYIHHCTIKNLEFNTKYYYVVGIGHTPRKFWFVTPPKVGPDVPYTF  120

Query  52   GLIGDLGQTYDSNTTLT  2
            GLIGDLGQ+YDSN TLT
Sbjct  121  GLIGDLGQSYDSNMTLT  137



>ref|XP_009335656.1| PREDICTED: purple acid phosphatase 2 [Pyrus x bretschneideri]
Length=531

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 125/158 (79%), Gaps = 8/158 (5%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TSSYVRN      +   +DMPLDSDVFRVP G NAPQQVHITQGD+EGKGVI+SW T  
Sbjct  90   ITSSYVRN------DDLSLDMPLDSDVFRVPPGYNAPQQVHITQGDHEGKGVIVSWVTPD  143

Query  292  KHGSKAVHYWAENSRAKRFSVGA-VVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGH  116
            + GS  V YWAEN+ + + S  A V+TYKY+NYTS YIHHCTI +LE DTKYYY++G+G+
Sbjct  144  EPGSSTVIYWAENNTSLKKSAQATVLTYKYFNYTSGYIHHCTIDNLEFDTKYYYEVGTGN  203

Query  115  AKRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
              R FWFVTPP+ GPDV YTFGLIGDLGQT+DSN TLT
Sbjct  204  TARRFWFVTPPRVGPDVAYTFGLIGDLGQTHDSNDTLT  241



>ref|XP_010030674.1| PREDICTED: purple acid phosphatase 2-like [Eucalyptus grandis]
Length=472

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 119/155 (77%), Gaps = 7/155 (5%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TS++VR    A      VDMP+DSDVFRVP G NAPQQVHITQGD+EGKGVI+SW T  +
Sbjct  36   TSTFVRKEEKA------VDMPIDSDVFRVPPGYNAPQQVHITQGDHEGKGVIVSWVTPDE  89

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW+ENS  K+   G V  YKYYNYTS YIHHCT+ +L +DTKYYY++G GH  
Sbjct  90   PGSSVVRYWSENSEHKKTKKGKVNRYKYYNYTSGYIHHCTLNNLMYDTKYYYEVGIGHTV  149

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTL  5
            R FWF+TPP+ GPDVPYTFGLIGDLGQ+YDSN TL
Sbjct  150  RQFWFMTPPEVGPDVPYTFGLIGDLGQSYDSNRTL  184



>ref|XP_010320409.1| PREDICTED: LOW QUALITY PROTEIN: purple acid phosphatase 2-like 
[Solanum lycopersicum]
Length=470

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 122/157 (78%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            ++S YVRN  S      + DM L+SDVF+VP G NAPQQV+ITQGD+EG GVI+SWTT  
Sbjct  30   ISSDYVRNYNS------NGDMLLNSDVFQVPTGYNAPQQVYITQGDHEGNGVIVSWTTTD  83

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS AV Y AENS  K F+ G VV+YKY+NYTS YIHHCTIKDLE DTKYYY++G G+ 
Sbjct  84   EPGSNAVLYRAENSNVKSFAEGFVVSYKYHNYTSGYIHHCTIKDLEFDTKYYYEVGLGNT  143

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF TPPK GPDVPYTFGLIGDLGQTYDSN+T T
Sbjct  144  TREFWFATPPKSGPDVPYTFGLIGDLGQTYDSNSTXT  180



>ref|XP_004148530.1| PREDICTED: purple acid phosphatase 2-like [Cucumis sativus]
 ref|XP_004165228.1| PREDICTED: purple acid phosphatase 2-like [Cucumis sativus]
Length=477

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 117/139 (84%), Gaps = 1/139 (1%)
 Frame = -2

Query  415  VDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HKHGSKAVHYWAENSRAKR  239
            VDMPLDSDVF VP G NAPQQVHITQGD+EGK VI+SW T +K GS  V YW+E S+ K+
Sbjct  50   VDMPLDSDVFAVPPGFNAPQQVHITQGDHEGKAVIVSWVTPNKPGSNEVLYWSEKSKEKK  109

Query  238  FSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPY  59
             + G V TYK+YNYTS YIHHCTIK+L++DTKYYY++G G++ R FWFVTPP+ GPDVPY
Sbjct  110  QAFGKVYTYKFYNYTSGYIHHCTIKNLKYDTKYYYEIGIGYSPRTFWFVTPPEVGPDVPY  169

Query  58   TFGLIGDLGQTYDSNTTLT  2
            TFG+IGDLGQ++DSN TLT
Sbjct  170  TFGVIGDLGQSFDSNVTLT  188



>dbj|BAO58596.1| purple acid phosphatase [Populus nigra]
Length=468

 Score =   207 bits (526),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 120/156 (77%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TSS+VR         + VDMPLDSDVFRVP G NAPQQVHITQGD+ GK VI+SW T ++
Sbjct  30   TSSFVRKV------EKTVDMPLDSDVFRVPPGDNAPQQVHITQGDHVGKAVIVSWVTANE  83

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GSK V YW+ENS  K  +   V TYK+YNYTS YIHHCTI++LE +TKYYY +G GH +
Sbjct  84   PGSKKVIYWSENSEHKEEANSKVYTYKFYNYTSGYIHHCTIRNLEFNTKYYYVVGVGHTE  143

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF TPP  GPDVPYTFGLIGDLGQ+YDSNTTLT
Sbjct  144  RKFWFTTPPAVGPDVPYTFGLIGDLGQSYDSNTTLT  179



>ref|XP_010315506.1| PREDICTED: LOW QUALITY PROTEIN: purple acid phosphatase 2-like 
[Solanum lycopersicum]
Length=465

 Score =   206 bits (525),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 118/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            VTSS+VR   +       +DMPLDSDVFR+P G NAPQQVHITQGD+EGK VI+SW T  
Sbjct  26   VTSSFVRKVENT------IDMPLDSDVFRIPPGYNAPQQVHITQGDHEGKAVIVSWVTMD  79

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V YW+E S+ K  + G V  YK+YNYTS YIHHCTIK L+ DTKYYYK+G GH 
Sbjct  80   ETGSSTVVYWSEKSKLKNKANGKVTNYKFYNYTSGYIHHCTIKHLKFDTKYYYKIGIGHV  139

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWFVTPP+ GPDV YTFGL+GDLGQ++DSN TLT
Sbjct  140  ARTFWFVTPPEVGPDVAYTFGLVGDLGQSFDSNKTLT  176



>ref|XP_010028626.1| PREDICTED: purple acid phosphatase-like [Eucalyptus grandis]
 gb|KCW55388.1| hypothetical protein EUGRSUZ_I01297 [Eucalyptus grandis]
Length=466

 Score =   207 bits (526),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 113/140 (81%), Gaps = 2/140 (1%)
 Frame = -2

Query  415  VDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HKHGSKAVHYWAENSRAKR  239
            VDMP DSDVF  P G NAPQQVHITQGD+ GKGVI+SW T H+ GS  VHYW+E +  K+
Sbjct  42   VDMPFDSDVFAAPTGHNAPQQVHITQGDHVGKGVIVSWVTPHEPGSNKVHYWSEKTGRKK  101

Query  238  FSVGAVV-TYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVP  62
             S   VV TYKYYNYTS YIHHCTIKDLE DTKY+Y +GSGH +R FWFVTPP+ GPDVP
Sbjct  102  HSENTVVKTYKYYNYTSGYIHHCTIKDLEPDTKYHYVVGSGHVRRQFWFVTPPEVGPDVP  161

Query  61   YTFGLIGDLGQTYDSNTTLT  2
            YTFGLIGDLGQT DSN TLT
Sbjct  162  YTFGLIGDLGQTLDSNVTLT  181



>gb|KGN43158.1| hypothetical protein Csa_7G004110 [Cucumis sativus]
Length=508

 Score =   207 bits (528),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 117/139 (84%), Gaps = 1/139 (1%)
 Frame = -2

Query  415  VDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HKHGSKAVHYWAENSRAKR  239
            VDMPLDSDVF VP G NAPQQVHITQGD+EGK VI+SW T +K GS  V YW+E S+ K+
Sbjct  67   VDMPLDSDVFAVPPGFNAPQQVHITQGDHEGKAVIVSWVTPNKPGSNEVLYWSEKSKEKK  126

Query  238  FSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPY  59
             + G V TYK+YNYTS YIHHCTIK+L++DTKYYY++G G++ R FWFVTPP+ GPDVPY
Sbjct  127  QAFGKVYTYKFYNYTSGYIHHCTIKNLKYDTKYYYEIGIGYSPRTFWFVTPPEVGPDVPY  186

Query  58   TFGLIGDLGQTYDSNTTLT  2
            TFG+IGDLGQ++DSN TLT
Sbjct  187  TFGVIGDLGQSFDSNVTLT  205



>ref|XP_007017664.1| Purple acid phosphatase 12 isoform 1 [Theobroma cacao]
 gb|EOY14889.1| Purple acid phosphatase 12 isoform 1 [Theobroma cacao]
Length=465

 Score =   206 bits (525),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 120/156 (77%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TSS+VRN   +       DMPLDSDVFR+P G NAPQQVHITQGD+ GKGVI+SW T  +
Sbjct  31   TSSFVRNDQLSH------DMPLDSDVFRIPPGYNAPQQVHITQGDHLGKGVIVSWVTPDE  84

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YWAENS  K  + G V+TYKY+NYTS YIHHCTI +LE DTKYYY++G G+  
Sbjct  85   PGSNLVLYWAENSELKHQAEGIVLTYKYFNYTSGYIHHCTITNLESDTKYYYEVGIGNTS  144

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF TPP+ GPDVPYTFGLIGDLGQT+DSN TLT
Sbjct  145  REFWFRTPPEVGPDVPYTFGLIGDLGQTHDSNRTLT  180



>gb|EYU37834.1| hypothetical protein MIMGU_mgv1a005856mg [Erythranthe guttata]
Length=467

 Score =   206 bits (524),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 118/156 (76%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TSS+VR    +       DMPLDSDVF VP G NAPQQVHITQGD+ GK VI+SW T  +
Sbjct  29   TSSFVRKDEKSG------DMPLDSDVFNVPPGHNAPQQVHITQGDHIGKAVIVSWVTVEE  82

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YWAENS  K  + G V  YK+YNYTS YIHHCTI++LE+DTKYYY++G GH  
Sbjct  83   PGSNTVLYWAENSGHKHKAKGKVTKYKFYNYTSGYIHHCTIRNLEYDTKYYYEVGIGHTT  142

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF TPP+ GPDVPYTFGLIGDLGQTYDSN+TLT
Sbjct  143  RTFWFTTPPEVGPDVPYTFGLIGDLGQTYDSNSTLT  178



>dbj|BAC55154.1| purple acid phosphatase [Nicotiana tabacum]
Length=461

 Score =   206 bits (524),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 120/157 (76%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            +TSSYVR   S+       DMPLDSDVFRVPHG NAPQQVH+TQGD+ GKGVI+SW T  
Sbjct  26   ITSSYVRKVESSE------DMPLDSDVFRVPHGYNAPQQVHLTQGDHVGKGVIVSWVTMD  79

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V YW  NS+ K+ + G V TYKY+ Y S YIHHCTI++L+++TKYYY +G+GH+
Sbjct  80   EPGSNKVLYWEFNSKIKQIAKGTVSTYKYHTYNSGYIHHCTIQNLKYNTKYYYMVGTGHS  139

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R FWFVTPP  GPDV YTFGLIGDLGQTYD N TLT
Sbjct  140  RRTFWFVTPPPVGPDVSYTFGLIGDLGQTYDPNMTLT  176



>ref|XP_006297613.1| hypothetical protein CARUB_v10013635mg [Capsella rubella]
 gb|EOA30511.1| hypothetical protein CARUB_v10013635mg [Capsella rubella]
Length=374

 Score =   204 bits (518),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 116/157 (74%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            +TS YVR         + +DMPLDSDVFRVP G NAPQQVHITQGD EGK VI+SW T +
Sbjct  27   ITSRYVRKV------EKTIDMPLDSDVFRVPCGYNAPQQVHITQGDVEGKAVIVSWVTQE  80

Query  289  -HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V YW ENS  K  + G   TYKYYNYTS YIHHC I++LE+DTKYYY +G G  
Sbjct  81   AKGSNKVIYWKENSSKKYKAHGKTNTYKYYNYTSGYIHHCPIRNLEYDTKYYYVVGVGET  140

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R FWF TPP+ GPDVPYTFGLIGD+GQT+DSN TLT
Sbjct  141  ERQFWFFTPPEIGPDVPYTFGLIGDIGQTFDSNITLT  177



>ref|XP_002313026.2| hypothetical protein POPTR_0009s12400g [Populus trichocarpa]
 gb|EEE86981.2| hypothetical protein POPTR_0009s12400g [Populus trichocarpa]
Length=489

 Score =   206 bits (525),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 120/156 (77%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TSS+VR         + VDMPLDSDVFRVP G NAPQQVHITQGD+ GK VI+SW T ++
Sbjct  51   TSSFVRKV------EKTVDMPLDSDVFRVPPGYNAPQQVHITQGDHVGKAVIVSWVTANE  104

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GSK V YW+ENS  K  +   V TYK+YNYTS YIHHCTI++LE +TKYYY +G GH +
Sbjct  105  PGSKKVIYWSENSEHKEEANSKVYTYKFYNYTSGYIHHCTIRNLEFNTKYYYVVGVGHTE  164

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF TPP  GPDVPYTFGLIGDLGQ+YDSNTTLT
Sbjct  165  RKFWFTTPPAVGPDVPYTFGLIGDLGQSYDSNTTLT  200



>ref|XP_010664753.1| PREDICTED: purple acid phosphatase 2 isoform X2 [Vitis vinifera]
Length=467

 Score =   206 bits (523),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 122/158 (77%), Gaps = 10/158 (6%)
 Frame = -2

Query  469  VTSSYVR-NSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-  296
            VTSS+ R N++SA       DMPLDSDVFRVP G NAPQQVHITQGDYEG  VIISW T 
Sbjct  28   VTSSFARTNNISA-------DMPLDSDVFRVPPGYNAPQQVHITQGDYEGNAVIISWITP  80

Query  295  HKHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGH  116
             + GS  V YWAEN + K  + G V+TYKY+ YTS YIHHCTI++L  DTKYYY++G G+
Sbjct  81   DEPGSNTVLYWAENGKHKSHANGIVLTYKYFKYTSGYIHHCTIRNL-FDTKYYYEVGIGN  139

Query  115  AKRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
              R FWFVTPP+ GPDVPYTFGLIGDLGQTYDSN TLT
Sbjct  140  TTRQFWFVTPPRAGPDVPYTFGLIGDLGQTYDSNRTLT  177



>gb|KFK40055.1| hypothetical protein AALP_AA3G324700 [Arabis alpina]
Length=470

 Score =   206 bits (524),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 117/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            +TS +VR         + VDMPLDSDVFRVPHG NAPQQVHITQGD EGK VI+SW T +
Sbjct  31   ITSKFVRKI------EKSVDMPLDSDVFRVPHGYNAPQQVHITQGDVEGKAVIVSWVTQE  84

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V YW ENS  K  + G   TYKYYNYTS YIHHC I++LE+DTKYYY +G G  
Sbjct  85   APGSNTVVYWKENSSKKYKAHGKSNTYKYYNYTSGYIHHCPIRNLEYDTKYYYVVGVGQT  144

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R FWF TPP+ GPDVPYTFGLIGDLGQT+DSN TLT
Sbjct  145  ERKFWFFTPPEVGPDVPYTFGLIGDLGQTFDSNITLT  181



>ref|XP_008448074.1| PREDICTED: purple acid phosphatase 2 [Cucumis melo]
Length=471

 Score =   206 bits (523),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 115/139 (83%), Gaps = 1/139 (1%)
 Frame = -2

Query  415  VDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HKHGSKAVHYWAENSRAKR  239
            VDMPLDSDVF VP G NAPQQVHITQGD+EGK VI+SW T  K GS  V YW E S+ K+
Sbjct  44   VDMPLDSDVFAVPPGFNAPQQVHITQGDHEGKAVIVSWITPDKPGSNEVLYWTEKSKQKK  103

Query  238  FSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPY  59
             + G V TYK+YNYTS YIHHCTIK+L+++TKYYY++G G++ R FWFVTPP+ GPDVPY
Sbjct  104  LAFGKVYTYKFYNYTSGYIHHCTIKNLKYNTKYYYEVGIGYSPRTFWFVTPPEVGPDVPY  163

Query  58   TFGLIGDLGQTYDSNTTLT  2
            TFG+IGDLGQ++DSN TLT
Sbjct  164  TFGIIGDLGQSFDSNVTLT  182



>ref|XP_009777041.1| PREDICTED: purple acid phosphatase 2 isoform X1 [Nicotiana sylvestris]
Length=471

 Score =   206 bits (523),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 117/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            VTSS++R         + VDMPLDSDVFR P G NAPQQVHITQGD+EGK VI+SW T  
Sbjct  31   VTSSFIRKV------EKTVDMPLDSDVFRAPPGYNAPQQVHITQGDHEGKAVIVSWVTMD  84

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V YW+E S+ K  + G V TYK+YNYTS YIHH TI+ LE +TKYYYK+G GH 
Sbjct  85   EPGSSTVLYWSEKSKQKNTAKGKVTTYKFYNYTSGYIHHSTIRHLEFNTKYYYKIGVGHT  144

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWFVTPP  GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  145  ARTFWFVTPPPVGPDVPYTFGLIGDLGQSFDSNKTLT  181



>ref|XP_011088457.1| PREDICTED: purple acid phosphatase 2 [Sesamum indicum]
Length=467

 Score =   206 bits (523),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 118/156 (76%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TSS+VR         + VDMPLDSDVF VP G NAPQQVHITQGD+ GK VI+SW T  +
Sbjct  29   TSSFVRKV------EKTVDMPLDSDVFEVPPGYNAPQQVHITQGDHIGKAVIVSWVTVDE  82

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YWA NS+ K  + G +  YK+YNYTS YIHHCTIK+LE+DTKYYY++G GH +
Sbjct  83   PGSNTVLYWAANSKLKNKAKGTLTKYKFYNYTSGYIHHCTIKNLEYDTKYYYEVGIGHTR  142

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF TPP  GPDVPYTFGLIGDLGQ+YDSN TLT
Sbjct  143  RTFWFTTPPAVGPDVPYTFGLIGDLGQSYDSNRTLT  178



>ref|XP_009777042.1| PREDICTED: purple acid phosphatase 2 isoform X2 [Nicotiana sylvestris]
Length=470

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 117/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            VTSS++R         + VDMPLDSDVFR P G NAPQQVHITQGD+EGK VI+SW T  
Sbjct  31   VTSSFIRKV------EKTVDMPLDSDVFRAPPGYNAPQQVHITQGDHEGKAVIVSWVTMD  84

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V YW+E S+ K  + G V TYK+YNYTS YIHH TI+ LE +TKYYYK+G GH 
Sbjct  85   EPGSSTVLYWSEKSKQKNTAKGKVTTYKFYNYTSGYIHHSTIRHLEFNTKYYYKIGVGHT  144

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWFVTPP  GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  145  ARTFWFVTPPPVGPDVPYTFGLIGDLGQSFDSNKTLT  181



>ref|XP_009614460.1| PREDICTED: purple acid phosphatase 2-like [Nicotiana tomentosiformis]
Length=466

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 117/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            VTSS+VR         + +DMPLDSDVFR P G NAPQQVHITQGD+EGK VI+SW T  
Sbjct  26   VTSSFVRKV------EKTIDMPLDSDVFRAPPGYNAPQQVHITQGDHEGKAVIVSWVTMD  79

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V YW+E S+ K  + G V TYK+YNYTS YIHH TI+ LE +TKYYYK+G GH 
Sbjct  80   EPGSSTVLYWSEKSKQKNNAKGKVTTYKFYNYTSGYIHHSTIRHLEFNTKYYYKIGIGHT  139

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWFVTPP  GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  140  ARTFWFVTPPPVGPDVPYTFGLIGDLGQSFDSNKTLT  176



>ref|XP_010489216.1| PREDICTED: purple acid phosphatase 10 [Camelina sativa]
Length=470

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 118/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            +TSS+VR         + +DMPLDSDVFRVP G NAPQQVHITQGD EGK VI+SW T +
Sbjct  31   ITSSFVRKL------EKTIDMPLDSDVFRVPCGYNAPQQVHITQGDVEGKAVIVSWVTQE  84

Query  289  -HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V YW ENS  K  + G   TYKYYNYTS YIHHC I++LE+DTKYYY +G G  
Sbjct  85   AKGSNKVVYWKENSSKKHKAYGKTNTYKYYNYTSGYIHHCPIRNLEYDTKYYYVVGVGET  144

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R+FWF TPP+ GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  145  ERMFWFFTPPEIGPDVPYTFGLIGDLGQSFDSNITLT  181



>ref|XP_006362022.1| PREDICTED: purple acid phosphatase 2-like [Solanum tuberosum]
Length=465

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 118/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            VTSS+VR         + +DMPLDSDVFRVP G NAPQQVHITQGD+ GK +I+SW T  
Sbjct  26   VTSSFVRKV------EKTIDMPLDSDVFRVPPGYNAPQQVHITQGDHVGKALIVSWVTMD  79

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V YW+E S+ K  + G V TYK+YNYTS YIHHCTI+ L+ DT YYYK+G GH 
Sbjct  80   EPGSSTVVYWSEKSKLKNKANGKVTTYKFYNYTSGYIHHCTIEHLKFDTIYYYKIGIGHV  139

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWFVTPP+ GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  140  ARTFWFVTPPEAGPDVPYTFGLIGDLGQSFDSNKTLT  176



>dbj|BAC55155.1| purple acid phosphatase [Nicotiana tabacum]
Length=470

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 117/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            VTSS++R         + VDMPLDSDVFR P G NAPQQVHITQGD+EGK VI+SW T  
Sbjct  31   VTSSFIRKV------EKTVDMPLDSDVFRAPPGYNAPQQVHITQGDHEGKTVIVSWVTMD  84

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V YW+E S+ K  + G V TYK+YNYTS YIHH TI+ LE +TKYYYK+G GH 
Sbjct  85   EPGSSTVLYWSEKSKQKNTAKGKVTTYKFYNYTSGYIHHSTIRHLEFNTKYYYKIGVGHT  144

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWFVTPP  GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  145  ARTFWFVTPPPVGPDVPYTFGLIGDLGQSFDSNKTLT  181



>gb|ABV89750.1| purple acid phosphatase 12 protein family isoform 5 premature 
1 [Brassica napus]
Length=397

 Score =   203 bits (516),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 118/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TS YVR S    P+    DMPLDSDVF+VP G N PQQVHITQG++EG GVIISW T  
Sbjct  30   ITSEYVRGS--DLPD----DMPLDSDVFKVPPGRNTPQQVHITQGNHEGNGVIISWVTPS  83

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
               S  V YW+EN ++K+ +   + TY+++NYTS YIHHC I DLE D KYYY++GSG  
Sbjct  84   APCSNTVRYWSENGKSKKLAEATMNTYRFFNYTSGYIHHCLIDDLEFDMKYYYEIGSGKW  143

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R FWF TPPKPGPDVPYTFGLIGDLGQTYDSN TL+
Sbjct  144  RRRFWFFTPPKPGPDVPYTFGLIGDLGQTYDSNRTLS  180



>gb|ABV89753.1| purple acid phosphatase 12 protein family isoform 5 premature 
1 [Brassica napus]
Length=397

 Score =   203 bits (516),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 118/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TS YVR S    P+    DMPLDSDVF+VP G N PQQVHITQG++EG GVIISW T  
Sbjct  30   ITSEYVRGS--DLPD----DMPLDSDVFKVPPGRNTPQQVHITQGNHEGNGVIISWVTPS  83

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
               S  V YW+EN ++K+ +   + TY+++NYTS YIHHC I DLE D KYYY++GSG  
Sbjct  84   APCSNTVRYWSENGKSKKLAEATMNTYRFFNYTSGYIHHCLIDDLEFDMKYYYEIGSGKW  143

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R FWF TPPKPGPDVPYTFGLIGDLGQTYDSN TL+
Sbjct  144  RRRFWFFTPPKPGPDVPYTFGLIGDLGQTYDSNRTLS  180



>ref|XP_004291401.1| PREDICTED: purple acid phosphatase 2-like [Fragaria vesca subsp. 
vesca]
Length=474

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 124/160 (78%), Gaps = 12/160 (8%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDV--DMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT  296
            +TSSY+RN        +D+  DMPLDSDVFR P G NAPQQVHITQGD+EGKGVI+SW T
Sbjct  35   ITSSYLRN--------DDLVHDMPLDSDVFRAPPGYNAPQQVHITQGDHEGKGVIVSWVT  86

Query  295  -HKHGSKAVHYWAENS-RAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGS  122
             ++ GS  V YWAENS   K+ + G V+TY Y+NYTS YIHHCTI +LE  TKYYY++G+
Sbjct  87   PNEPGSSTVVYWAENSSNLKKTAYGIVLTYNYFNYTSGYIHHCTISNLEFGTKYYYEVGT  146

Query  121  GHAKRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            G+  R FWF+TPPK GPDVPYTFGLIGD+GQT DSN TLT
Sbjct  147  GNTTRRFWFITPPKAGPDVPYTFGLIGDIGQTPDSNRTLT  186



>gb|KFK32700.1| hypothetical protein AALP_AA6G277500 [Arabis alpina]
Length=464

 Score =   204 bits (520),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 117/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTH-  293
            +TS Y+R    A+  P+D  MPLDSDVF VP G N PQQVH+TQG+YEG GVIISW T  
Sbjct  25   ITSGYLR----AADLPDD--MPLDSDVFTVPSGPNTPQQVHVTQGNYEGNGVIISWVTPV  78

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            K GS  V YW EN + K  +   + TYK++NYTS YIHHC I DLE D KYYY++GSG  
Sbjct  79   KPGSNTVRYWKENGKPKSQAEATINTYKFFNYTSGYIHHCIIDDLEFDMKYYYEIGSGKW  138

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R FWF TPPKPGPDVPYTFGLIGDLGQTYDSN TL+
Sbjct  139  RRRFWFFTPPKPGPDVPYTFGLIGDLGQTYDSNRTLS  175



>gb|EYU37832.1| hypothetical protein MIMGU_mgv1a005923mg [Erythranthe guttata]
Length=464

 Score =   204 bits (519),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 120/157 (76%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            VTSS+VR         + VDMPLDSDVF+VP G NAPQQVHITQGD+ GK VI+SW T  
Sbjct  28   VTSSFVRKV------EKTVDMPLDSDVFKVPPGYNAPQQVHITQGDHVGKAVIVSWVTVE  81

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GS  V YWAE S  K  + G++  YK+YNYTS +IHHCTI++LEH+TKYYY++G G+ 
Sbjct  82   EPGSNTVLYWAEKSAHKNKAKGSLTRYKFYNYTSGFIHHCTIRNLEHETKYYYEVGIGNT  141

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF TPP+ GPDVPYTFGLIGDLGQ+YDSN TLT
Sbjct  142  TRTFWFTTPPEVGPDVPYTFGLIGDLGQSYDSNRTLT  178



>ref|NP_179235.1| purple acid phosphatase 10 [Arabidopsis thaliana]
 sp|Q9SIV9.1|PPA10_ARATH RecName: Full=Purple acid phosphatase 10; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAM15911.1|AF492662_1 purple acid phosphatase [Arabidopsis thaliana]
 gb|AAD22297.1| putative purple acid phosphatase precursor [Arabidopsis thaliana]
 gb|AAM13235.1| putative purple acid phosphatase precursor [Arabidopsis thaliana]
 gb|AAP49523.1| At2g16430 [Arabidopsis thaliana]
 gb|AEC06496.1| purple acid phosphatase 10 [Arabidopsis thaliana]
Length=468

 Score =   204 bits (519),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 118/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            +TS YVR  L A+     VDMPLDSDVFRVP G NAPQQVHITQGD EGK VI+SW T +
Sbjct  29   ITSRYVR-KLEAT-----VDMPLDSDVFRVPCGYNAPQQVHITQGDVEGKAVIVSWVTQE  82

Query  289  -HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V YW ENS  K  + G   TYK+YNYTS +IHHC I++LE+DTKYYY LG G  
Sbjct  83   AKGSNKVIYWKENSTKKHKAHGKTNTYKFYNYTSGFIHHCPIRNLEYDTKYYYVLGVGQT  142

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R FWF TPP+ GPDVPYTFGLIGDLGQ+YDSN TLT
Sbjct  143  ERKFWFFTPPEIGPDVPYTFGLIGDLGQSYDSNITLT  179



>ref|XP_008387992.1| PREDICTED: purple acid phosphatase 2-like [Malus domestica]
Length=531

 Score =   206 bits (523),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 124/158 (78%), Gaps = 8/158 (5%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TSSYVRN      +   +DMPLDSDVF+VP G N PQQVHITQGD+EGKGVI+SW T  
Sbjct  90   ITSSYVRN------DDLSLDMPLDSDVFQVPPGYNVPQQVHITQGDHEGKGVIVSWVTPD  143

Query  292  KHGSKAVHYWAENSRAKRFSVGA-VVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGH  116
            + GS  V YWAEN+ + + S  A V+TYKY+NYTS YIHHCTI +LE DTKYYY++G+G+
Sbjct  144  EPGSSTVIYWAENNTSLKKSAQATVLTYKYFNYTSGYIHHCTIDNLEFDTKYYYEVGTGN  203

Query  115  AKRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
              R FWFVTPP+ GPDV YTFGLIGDLGQT+DSN TLT
Sbjct  204  TARRFWFVTPPRVGPDVAYTFGLIGDLGQTHDSNDTLT  241



>ref|XP_010516721.1| PREDICTED: purple acid phosphatase 10-like [Camelina sativa]
Length=470

 Score =   204 bits (519),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 118/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            +TSS+VR         + +DMPL+SDVFRVP G NAPQQVHITQGD EGK VI+SW T +
Sbjct  31   ITSSFVRKL------EKTIDMPLNSDVFRVPCGYNAPQQVHITQGDVEGKAVIVSWVTQE  84

Query  289  -HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V YW ENS  K  + G   TYKYYNYTS YIHHC I++LE+DTKYYY +G G  
Sbjct  85   AKGSNKVVYWKENSSKKHKAYGKTNTYKYYNYTSGYIHHCPIRNLEYDTKYYYLVGVGET  144

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R+FWF TPP+ GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  145  ERMFWFFTPPEIGPDVPYTFGLIGDLGQSFDSNITLT  181



>ref|XP_011047731.1| PREDICTED: purple acid phosphatase 2 [Populus euphratica]
Length=487

 Score =   204 bits (520),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 120/156 (77%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TSS+VR         + VDMPLDSDVFRVP G NAPQQVHITQGD+ GK VI+SW T ++
Sbjct  49   TSSFVRKV------EKTVDMPLDSDVFRVPPGYNAPQQVHITQGDHVGKAVIVSWVTANE  102

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS+ V YW+ENS  K  +   V TY++YNYTS YIHHCTI++LE +TKYYY +G GH +
Sbjct  103  PGSRKVIYWSENSEHKEEASSKVYTYEFYNYTSGYIHHCTIRNLEFNTKYYYVVGVGHTE  162

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF TPP  GPDVPYTFGLIGDLGQ+YDSNTTLT
Sbjct  163  RKFWFTTPPAVGPDVPYTFGLIGDLGQSYDSNTTLT  198



>gb|AAA91803.1| secreted purple acid phosphatase precursor [Arabidopsis thaliana]
Length=469

 Score =   204 bits (518),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 119/156 (76%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTH-K  290
            TS YVR     S  P+D  MPLDSDVF VP G N+PQQVH+TQG++EG GVIISW T  K
Sbjct  31   TSEYVR----GSDLPDD--MPLDSDVFEVPPGPNSPQQVHVTQGNHEGNGVIISWVTPVK  84

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GSK V YW EN ++++ +   V TY+++NYTS YIHHC I DLE DTKYYY++GSG   
Sbjct  85   PGSKTVRYWCENKKSRKQAEATVNTYRFFNYTSGYIHHCLIDDLEFDTKYYYEIGSGKWS  144

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF TPPK GPDVPYTFGLIGDLGQTYDSN+TL+
Sbjct  145  RRFWFFTPPKSGPDVPYTFGLIGDLGQTYDSNSTLS  180



>ref|XP_010467373.1| PREDICTED: purple acid phosphatase 10-like [Camelina sativa]
Length=482

 Score =   204 bits (519),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 118/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            +TSS+VR         + +DMPLDSDVFRVP G NAPQQVHITQGD EGK VI+SW T +
Sbjct  43   ITSSFVRKL------EKTIDMPLDSDVFRVPCGYNAPQQVHITQGDVEGKAVIVSWVTQE  96

Query  289  -HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V YW ENS  K  + G   TYKYYNYTS YIHHC I++LE+D+KYYY +G G  
Sbjct  97   AKGSNKVVYWKENSSKKHKAYGKTNTYKYYNYTSGYIHHCPIRNLEYDSKYYYVVGVGET  156

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R+FWF TPP+ GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  157  ERMFWFFTPPEIGPDVPYTFGLIGDLGQSFDSNITLT  193



>gb|ABV89749.1| purple acid phosphatase 12 protein family isoform 5 [Brassica 
napus]
 gb|ABV89752.1| purple acid phosphatase 12 protein family isoform 5 [Brassica 
napus]
Length=475

 Score =   204 bits (518),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 118/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TS YVR     S  P+D  MPLDSDVF+VP G N PQQVHITQG++EG GVIISW T  
Sbjct  30   ITSEYVR----GSDLPDD--MPLDSDVFKVPPGRNTPQQVHITQGNHEGNGVIISWVTPS  83

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
               S  V YW+EN ++K+ +   + TY+++NYTS YIHHC I DLE D KYYY++GSG  
Sbjct  84   APCSNTVRYWSENGKSKKLAEATMNTYRFFNYTSGYIHHCLIDDLEFDMKYYYEIGSGKW  143

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R FWF TPPKPGPDVPYTFGLIGDLGQTYDSN TL+
Sbjct  144  RRRFWFFTPPKPGPDVPYTFGLIGDLGQTYDSNRTLS  180



>ref|XP_010417871.1| PREDICTED: fe(3+)-Zn(2+) purple acid phosphatase 12 [Camelina 
sativa]
Length=470

 Score =   203 bits (517),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 117/156 (75%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTH-K  290
            TS YVR     +  P+D  MPLDSDVF VP G N PQQVHITQG++EG GVIISW T  K
Sbjct  32   TSEYVR----GTDLPDD--MPLDSDVFTVPPGPNTPQQVHITQGNHEGNGVIISWVTPVK  85

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW EN + K+ +   V TY+++NYTS YIHHC I DLE DTKYYY++GSG  +
Sbjct  86   PGSNTVRYWCENEKTKKEAEATVNTYRFFNYTSGYIHHCLIDDLEFDTKYYYEIGSGKWR  145

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF TPPK GPDVPYTFGLIGDLGQTYDSNTTL+
Sbjct  146  RRFWFFTPPKSGPDVPYTFGLIGDLGQTYDSNTTLS  181



>gb|ABV89758.1| purple acid phosphatase 12 protein family isoform 7 premature 
[Brassica napus]
 gb|ABV89760.1| purple acid phosphatase 12 protein family isoform 7 premature 
[Brassica napus]
Length=366

 Score =   201 bits (510),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 118/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TS YVR S    P+    DMPLDSDVF+VP G N PQQVHITQG++EG GVIISW T  
Sbjct  30   ITSEYVRGS--DLPD----DMPLDSDVFKVPPGPNTPQQVHITQGNHEGNGVIISWVTPS  83

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
               S  V YW+EN ++K+ +   + TY+++NYTS YIHHC I DLE D KYYY++GSG  
Sbjct  84   APCSNTVRYWSENGKSKKQAEATMNTYRFFNYTSGYIHHCLIDDLEFDMKYYYEIGSGKW  143

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R FWF TPPKPGPDVPYTFGLIGDLGQTYDSN TL+
Sbjct  144  RRRFWFFTPPKPGPDVPYTFGLIGDLGQTYDSNRTLS  180



>gb|ABV89741.1| purple acid phosphatase 12 protein family isoform 2 [Brassica 
napus]
 gb|ABV89742.1| purple acid phosphatase 12 protein family isoform 2 [Brassica 
napus]
Length=469

 Score =   203 bits (516),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 118/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TS YVR S    P+    DMPLDSDVF+VP G N PQQVHITQG++EG GVIISW T  
Sbjct  30   ITSEYVRGS--DLPD----DMPLDSDVFKVPPGPNTPQQVHITQGNHEGNGVIISWVTPS  83

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
               S  V YW+EN ++K+ +   + TY+++NYTS YIHHC I DLE D KYYY++GSG  
Sbjct  84   APCSNTVRYWSENGKSKKLAEATMNTYRFFNYTSGYIHHCLIDDLEFDMKYYYEIGSGKW  143

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R FWF TPPKPGPDVPYTFGLIGDLGQTYDSN TL+
Sbjct  144  RRRFWFFTPPKPGPDVPYTFGLIGDLGQTYDSNRTLS  180



>emb|CDX77044.1| BnaC04g38390D [Brassica napus]
Length=481

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 117/157 (75%), Gaps = 1/157 (1%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TS YVR+    S      DMPLDSDVF+VP G N PQQVHITQG++EG GVIISW T  
Sbjct  30   ITSGYVRSRGGRSYVFVPDDMPLDSDVFKVPPGPNTPQQVHITQGNHEGNGVIISWVTPS  89

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
               S  V YW+EN ++K+ +V  + TY+++NYTS YIHHC I DLE D KYYY++GS   
Sbjct  90   APCSNTVRYWSENGKSKKLAVATINTYRFFNYTSGYIHHCLIDDLEFDMKYYYEIGSRKW  149

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R FWF TPPKPGPDVPYTFGLIGDLGQTYDSN TL+
Sbjct  150  QRRFWFFTPPKPGPDVPYTFGLIGDLGQTYDSNRTLS  186



>ref|XP_006297614.1| hypothetical protein CARUB_v10013635mg [Capsella rubella]
 gb|EOA30512.1| hypothetical protein CARUB_v10013635mg [Capsella rubella]
Length=466

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 116/157 (74%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            +TS YVR         + +DMPLDSDVFRVP G NAPQQVHITQGD EGK VI+SW T +
Sbjct  27   ITSRYVRKV------EKTIDMPLDSDVFRVPCGYNAPQQVHITQGDVEGKAVIVSWVTQE  80

Query  289  -HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V YW ENS  K  + G   TYKYYNYTS YIHHC I++LE+DTKYYY +G G  
Sbjct  81   AKGSNKVIYWKENSSKKYKAHGKTNTYKYYNYTSGYIHHCPIRNLEYDTKYYYVVGVGET  140

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R FWF TPP+ GPDVPYTFGLIGD+GQT+DSN TLT
Sbjct  141  ERQFWFFTPPEIGPDVPYTFGLIGDIGQTFDSNITLT  177



>ref|XP_004152670.1| PREDICTED: purple acid phosphatase 2-like [Cucumis sativus]
 gb|KGN62641.1| hypothetical protein Csa_2G363020 [Cucumis sativus]
Length=477

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 117/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TS +VR+      +   +DMPLDSDVFR P G NAPQQVHITQGD EGK VIISW T  
Sbjct  30   ITSGFVRD------DDASLDMPLDSDVFRPPPGKNAPQQVHITQGDSEGKSVIISWVTPD  83

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            K GS  V YWAENS  +  + G   +YKY+NYTS YIHHCTI++LE+DTKY+Y +G G  
Sbjct  84   KPGSNRVVYWAENSGIRNHAEGYFTSYKYFNYTSGYIHHCTIENLEYDTKYFYVIGFGSL  143

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF TPPK GPDVPYTFGLIGDLGQTYDSN TLT
Sbjct  144  SRRFWFTTPPKVGPDVPYTFGLIGDLGQTYDSNRTLT  180



>emb|CDO97010.1| unnamed protein product [Coffea canephora]
Length=471

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 118/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TSS+VR    A      VDMPL +DVFRVP G NAPQQVHITQGD EGK VI+SW T  
Sbjct  32   ITSSFVRVDRKA------VDMPLHADVFRVPPGYNAPQQVHITQGDLEGKAVIVSWVTVD  85

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GS  V YW++N+  K  + G V  YKY+NYTS YIHH TIK L+HDTKYYY++G  H 
Sbjct  86   ERGSDTVLYWSDNATEKLKAKGTVTKYKYFNYTSGYIHHATIKHLQHDTKYYYEVGIDHT  145

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWFVTPPK GPDVPYTFGLIGDLGQ++DSN+TLT
Sbjct  146  SRTFWFVTPPKVGPDVPYTFGLIGDLGQSFDSNSTLT  182



>gb|ABV89743.1| purple acid phosphatase 12 protein family isoform 3 [Brassica 
napus]
 gb|ABV89744.1| purple acid phosphatase 12 protein family isoform 3 [Brassica 
napus]
 emb|CDX77047.1| BnaC04g38420D [Brassica napus]
Length=469

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 118/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TS YVR S    P+    DMPLDSDVF+V  G N PQQVHITQG++EG GVIISW T  
Sbjct  30   ITSEYVRGS--DLPD----DMPLDSDVFKVSPGPNTPQQVHITQGNHEGNGVIISWVTPS  83

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V YW+EN ++K+ +   + TY+++NYTS YIHHC I DLE D KYYY++GSG  
Sbjct  84   APGSNTVRYWSENGKSKKLAEATMNTYRFFNYTSGYIHHCLIDDLEFDMKYYYEIGSGKW  143

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R FWF TPPKPGPDVPYTFGLIGDLGQTYDSN TL+
Sbjct  144  QRRFWFFTPPKPGPDVPYTFGLIGDLGQTYDSNRTLS  180



>ref|NP_180287.2| Fe(3+)-Zn(2+) purple acid phosphatase 12 [Arabidopsis thaliana]
 sp|Q38924.3|PPA12_ARATH RecName: Full=Fe(3+)-Zn(2+) purple acid phosphatase 12; Short=PAP; 
AltName: Full=Iron(III)-zinc(II) purple acid phosphatase 
12; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL57700.1| At2g27190/T22O13.4 [Arabidopsis thaliana]
 gb|AAM91429.1| At2g27190/T22O13.4 [Arabidopsis thaliana]
 gb|AEC07951.1| Fe(3+)-Zn(2+) purple acid phosphatase 12 [Arabidopsis thaliana]
Length=469

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 118/156 (76%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTH-K  290
            TS YVR     S  P+D  MPLDSDVF VP G N+PQQVH+TQG++EG GVIISW T  K
Sbjct  31   TSEYVR----GSDLPDD--MPLDSDVFEVPPGPNSPQQVHVTQGNHEGNGVIISWVTPVK  84

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GSK V YW EN ++++ +   V TY+++NYTS YIHHC I DLE DTKYYY++GSG   
Sbjct  85   PGSKTVQYWCENEKSRKQAEATVNTYRFFNYTSGYIHHCLIDDLEFDTKYYYEIGSGKWS  144

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF  PPK GPDVPYTFGLIGDLGQTYDSN+TL+
Sbjct  145  RRFWFFIPPKSGPDVPYTFGLIGDLGQTYDSNSTLS  180



>emb|CDY48178.1| BnaA04g15420D [Brassica napus]
Length=481

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 116/157 (74%), Gaps = 1/157 (1%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TS YVR+    S      DMPLDSDVF+VP G N PQQVHITQG++EG GVIISW T  
Sbjct  30   ITSGYVRSRRGRSDVFVPDDMPLDSDVFKVPPGPNTPQQVHITQGNHEGNGVIISWVTPS  89

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
               S  V YW+EN ++K+ +   + TY+++NYTS YIHHC I DLE D KYYY++GS   
Sbjct  90   APCSNTVRYWSENGKSKKLAEATINTYRFFNYTSGYIHHCLIDDLEFDMKYYYEIGSWKW  149

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R FWF TPPKPGPDVPYTFGLIGDLGQTYDSN TL+
Sbjct  150  RRRFWFFTPPKPGPDVPYTFGLIGDLGQTYDSNRTLS  186



>gb|AAM15913.1|AF492664_1 purple acid phosphatase [Arabidopsis thaliana]
 gb|AAD26885.1| purple acid phosphatase precursor [Arabidopsis thaliana]
Length=469

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 118/156 (76%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTH-K  290
            TS YVR     S  P+D  MPLDSDVF VP G N+PQQVH+TQG++EG GVIISW T  K
Sbjct  31   TSEYVR----GSDLPDD--MPLDSDVFEVPPGHNSPQQVHVTQGNHEGNGVIISWVTPVK  84

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GSK V YW EN ++++ +   V TY+++NYTS YIHHC I DLE DTKYYY++GSG   
Sbjct  85   PGSKTVQYWCENEKSRKQAEATVNTYRFFNYTSGYIHHCLIDDLEFDTKYYYEIGSGKWS  144

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF  PPK GPDVPYTFGLIGDLGQTYDSN+TL+
Sbjct  145  RRFWFFIPPKSGPDVPYTFGLIGDLGQTYDSNSTLS  180



>gb|KHN22217.1| Purple acid phosphatase 2 [Glycine soja]
Length=345

 Score =   199 bits (506),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 118/156 (76%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TS ++RN   +      +DMP+DSD FRVP G NAPQQVHITQGD+ GKGVIISW + H+
Sbjct  35   TSDFLRNDYLS------LDMPIDSDTFRVPPGYNAPQQVHITQGDHVGKGVIISWISPHE  88

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YWAENS  K  + G  +TYKY+NYTS YIHHCT+ +LE DTKYYY++G G+  
Sbjct  89   PGSSTVIYWAENSEFKWQAHGFFLTYKYFNYTSGYIHHCTVHNLEFDTKYYYEVGIGNTT  148

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF TPP  GPDVPYTFGLIGDLGQTY+SN TLT
Sbjct  149  RQFWFKTPPPVGPDVPYTFGLIGDLGQTYNSNRTLT  184



>emb|CDY48179.1| BnaA04g15430D [Brassica napus]
Length=469

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 118/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TS YVR S    P+    DMPLDSDVF+VP G N PQQVHITQG++EG GVIISW T  
Sbjct  30   ITSEYVRGS--DLPD----DMPLDSDVFKVPPGPNTPQQVHITQGNHEGNGVIISWVTPS  83

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
               S  V YW+EN ++K+ +   + TY+++NYTS YIHHC I DLE D KYYY++GSG  
Sbjct  84   APCSNTVRYWSENGKSKKLAEATMNTYRFFNYTSGYIHHCFIDDLEFDMKYYYEIGSGKW  143

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R FWF TPPKPGPDVPYTFGLIGDLGQTYDSN TL+
Sbjct  144  QRRFWFFTPPKPGPDVPYTFGLIGDLGQTYDSNRTLS  180



>ref|XP_010028629.1| PREDICTED: purple acid phosphatase 2-like [Eucalyptus grandis]
 gb|KCW55392.1| hypothetical protein EUGRSUZ_I01304 [Eucalyptus grandis]
Length=472

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 122/156 (78%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISW-TTHK  290
            TS++VR         + VDMPL+SDVFRVP G NAPQQVHITQGD+ GKGVI+SW T+ +
Sbjct  36   TSTFVRKV------EKTVDMPLNSDVFRVPPGYNAPQQVHITQGDHVGKGVIVSWVTSDE  89

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW+ENS  K+ + G V  YK+YNYTS YIHHCT+K+L ++TKYYY++G GH  
Sbjct  90   PGSSTVRYWSENSEHKKKAKGKVNHYKFYNYTSGYIHHCTLKNLMYNTKYYYEVGIGHTV  149

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF+TPP+ GPDVPYTFGLIGDLGQT+DSN TLT
Sbjct  150  RQFWFITPPEVGPDVPYTFGLIGDLGQTFDSNRTLT  185



>ref|XP_006487338.1| PREDICTED: purple acid phosphatase 2-like isoform X1 [Citrus 
sinensis]
Length=468

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 118/156 (76%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TSS+VR         + +DMPLD+DVF+VP G NAPQQVHITQGD  GK VI+SW T  +
Sbjct  30   TSSFVRKV------EKTIDMPLDADVFQVPPGYNAPQQVHITQGDLVGKAVIVSWVTVDE  83

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             G+  V YW+ENS  K  + G V TYKYYNYTS YIHHCTI+ LE +TKYYY +G GH +
Sbjct  84   PGTNTVVYWSENSEQKEQAEGKVYTYKYYNYTSGYIHHCTIRHLEFNTKYYYVVGIGHTE  143

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWFVTPP+ GPDVPY+FGLIGDLGQ+YDSN TLT
Sbjct  144  RQFWFVTPPEVGPDVPYSFGLIGDLGQSYDSNVTLT  179



>ref|XP_006423401.1| hypothetical protein CICLE_v10028369mg [Citrus clementina]
 gb|ESR36641.1| hypothetical protein CICLE_v10028369mg [Citrus clementina]
Length=468

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 118/156 (76%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TSS+VR         + +DMPLD+DVF+VP G NAPQQVHITQGD  GK VI+SW T  +
Sbjct  30   TSSFVRKV------EKTIDMPLDADVFQVPPGYNAPQQVHITQGDLVGKAVIVSWVTVDE  83

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             G+  V YW+ENS  K  + G V TYKYYNYTS YIHHCTI+ LE +TKYYY +G GH +
Sbjct  84   PGTNTVVYWSENSEQKEQAEGKVYTYKYYNYTSGYIHHCTIRHLEFNTKYYYVVGIGHTE  143

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWFVTPP+ GPDVPY+FGLIGDLGQ+YDSN TLT
Sbjct  144  RQFWFVTPPEVGPDVPYSFGLIGDLGQSYDSNVTLT  179



>ref|XP_008444763.1| PREDICTED: purple acid phosphatase-like [Cucumis melo]
Length=477

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 117/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TS +VR+  ++S      DMPLDSDVFR P G NAPQQVHITQGD EGK VIISW T  
Sbjct  30   ITSRFVRDDDASS------DMPLDSDVFRPPPGKNAPQQVHITQGDSEGKSVIISWVTPD  83

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            K GS  V YWAENS  +  + G  V+YKY+NYTS YIHHCTI DLE+DTKY+Y +G G  
Sbjct  84   KPGSNRVVYWAENSDTRNHAEGYFVSYKYFNYTSGYIHHCTINDLEYDTKYFYVIGFGSL  143

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF TPPK GPDVPYTFGLIGDLGQT+ SN TLT
Sbjct  144  SRRFWFTTPPKVGPDVPYTFGLIGDLGQTHHSNRTLT  180



>ref|XP_010510800.1| PREDICTED: fe(3+)-Zn(2+) purple acid phosphatase 12-like [Camelina 
sativa]
Length=470

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 118/156 (76%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTH-K  290
            TS YVR     +  P+D  MPLDSDVF VP G N PQQVHITQG++EG GVI+SW T  K
Sbjct  32   TSEYVR----GTDLPDD--MPLDSDVFTVPPGPNTPQQVHITQGNHEGNGVIVSWVTPIK  85

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW EN + K+ +   V TY+++NYTS +IHHC I DLE DTKYYY++GSG  +
Sbjct  86   PGSNTVRYWCENEKTKKEAEATVNTYRFFNYTSGFIHHCLIDDLEFDTKYYYEIGSGKWR  145

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF+TPPK GPDVPYTFGLIGDLGQTYDSN+TL+
Sbjct  146  RRFWFITPPKSGPDVPYTFGLIGDLGQTYDSNSTLS  181



>emb|CAA06921.1| purple acid phosphatase [Ipomoea batatas]
Length=465

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 122/157 (78%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TSS++R         + VDMPLDSDVFRVP G NAPQQVHITQGD+ GK +I+SW T  
Sbjct  26   ITSSFIRKV------EKTVDMPLDSDVFRVPPGYNAPQQVHITQGDHVGKAMIVSWVTVD  79

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GS  V YW+ENS+ K+ + G + TY Y+NYTS YIHHCTI++LE++TKYYY++G G+ 
Sbjct  80   EPGSSKVVYWSENSQHKKVAKGNIRTYTYFNYTSGYIHHCTIRNLEYNTKYYYEVGIGNT  139

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF TPP+ GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  140  TRSFWFTTPPEVGPDVPYTFGLIGDLGQSFDSNRTLT  176



>ref|XP_002512962.1| Purple acid phosphatase precursor, putative [Ricinus communis]
 gb|EEF49465.1| Purple acid phosphatase precursor, putative [Ricinus communis]
Length=467

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 120/156 (77%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHKH  287
            TSS+VR      P  + VDMPLDSDVF+VP G NAPQQVHITQGD++GK VI+SW T   
Sbjct  29   TSSFVR------PVEKTVDMPLDSDVFQVPPGYNAPQQVHITQGDHDGKAVIVSWVTEDE  82

Query  286  -GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW+++S  K+ + G   TYK+YNYTS YIHHCTI++LE++TKYYY +G GH  
Sbjct  83   PGSSNVLYWSKSSPHKKQAKGKYTTYKFYNYTSGYIHHCTIRNLEYNTKYYYAVGIGHTT  142

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWFVTPP  GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  143  RQFWFVTPPAVGPDVPYTFGLIGDLGQSFDSNKTLT  178



>sp|Q9SDZ9.1|PPAF2_IPOBA RecName: Full=Purple acid phosphatase 2; AltName: Full=Manganese(II) 
purple acid phosphatase 2; Flags: Precursor [Ipomoea 
batatas]
 gb|AAF19822.1|AF200826_1 purple acid phosphatase precursor [Ipomoea batatas]
Length=465

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 122/157 (78%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TSS++R         + VDMPLDSDVFRVP G NAPQQVHITQGD+ GK +I+SW T  
Sbjct  26   ITSSFIRKV------EKTVDMPLDSDVFRVPPGYNAPQQVHITQGDHVGKAMIVSWVTVD  79

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GS  V YW+ENS+ K+ + G + TY Y+NYTS YIHHCTI++LE++TKYYY++G G+ 
Sbjct  80   EPGSSKVVYWSENSQHKKVARGNIRTYTYFNYTSGYIHHCTIRNLEYNTKYYYEVGIGNT  139

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF TPP+ GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  140  TRSFWFTTPPEVGPDVPYTFGLIGDLGQSFDSNRTLT  176



>ref|XP_003527865.2| PREDICTED: purple acid phosphatase 2-like [Glycine max]
Length=474

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 122/157 (78%), Gaps = 9/157 (6%)
 Frame = -2

Query  466  TSSYVRN-SLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            T+++VR+ SLS       VDMP+DSDVFRVP G NAPQQVHITQGD+ GKGVIISW T H
Sbjct  35   TTTFVRDDSLS-------VDMPIDSDVFRVPPGYNAPQQVHITQGDHVGKGVIISWITPH  87

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GS  V YWAENS  +  + G  + YKY+NYTS YIHHCTI +LE DTKYYY++G G+ 
Sbjct  88   EPGSSTVKYWAENSEFELKAHGFYLAYKYFNYTSGYIHHCTIHNLEFDTKYYYEVGIGNT  147

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF TPP  GP+VPYTFGLIGDLGQTY+SNTTLT
Sbjct  148  TRQFWFKTPPPVGPNVPYTFGLIGDLGQTYNSNTTLT  184



>gb|ABV89757.1| purple acid phosphatase 12 protein family isoform 7 [Brassica 
napus]
 gb|ABV89759.1| purple acid phosphatase 12 protein family isoform 7 [Brassica 
napus]
Length=469

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 118/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TS YVR S    P+    DMPLDSDVF+VP G N PQQVHITQG++EG GVIISW T  
Sbjct  30   ITSEYVRGS--DLPD----DMPLDSDVFKVPPGPNTPQQVHITQGNHEGNGVIISWVTPS  83

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
               S  V YW+EN ++K+ +   + TY+++NYTS YIHHC I DLE D KYYY++GSG  
Sbjct  84   APCSNTVRYWSENGKSKKQAEATMNTYRFFNYTSGYIHHCLIDDLEFDMKYYYEIGSGKW  143

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R FWF TPPKPGPDVPYTFGLIGDLGQTYDSN TL+
Sbjct  144  RRRFWFFTPPKPGPDVPYTFGLIGDLGQTYDSNRTLS  180



>gb|ABV89739.1| purple acid phosphatase 12 protein family isoform 1 [Brassica 
napus]
 gb|ABV89740.1| purple acid phosphatase 12 protein family isoform 1 [Brassica 
napus]
Length=469

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 118/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TS YVR S    P+    DMPLDSDVF+VP G N PQQVHITQG++EG GVIISW T  
Sbjct  30   ITSEYVRGS--DLPD----DMPLDSDVFKVPPGPNTPQQVHITQGNHEGNGVIISWVTPS  83

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
               S  V YW+EN ++K+ +   + TY+++NYTS YIHHC I DLE D KYYY++GSG  
Sbjct  84   APCSNTVRYWSENGKSKKQAEATMNTYRFFNYTSGYIHHCLIDDLEFDMKYYYEIGSGKW  143

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R FWF TPPKPGPDVPYTFGLIGDLGQTYDSN TL+
Sbjct  144  RRRFWFFTPPKPGPDVPYTFGLIGDLGQTYDSNRTLS  180



>gb|KCW55390.1| hypothetical protein EUGRSUZ_I01300 [Eucalyptus grandis]
Length=424

 Score =   201 bits (510),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 110/136 (81%), Gaps = 1/136 (1%)
 Frame = -2

Query  409  MPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HKHGSKAVHYWAENSRAKRFS  233
            MP+DSDVFRVP G NAPQQVHITQGD+EGKGVI+SW T  + GS  V YW+ENS  K+  
Sbjct  1    MPIDSDVFRVPPGYNAPQQVHITQGDHEGKGVIVSWVTPDEPGSSVVRYWSENSEHKKTK  60

Query  232  VGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPYTF  53
             G V  YKYYNYTS YIHHCT+ +L +DTKYYY++G GH  R FWF+TPP+ GPDVPYTF
Sbjct  61   KGKVNRYKYYNYTSGYIHHCTLNNLMYDTKYYYEVGIGHTVRQFWFMTPPEVGPDVPYTF  120

Query  52   GLIGDLGQTYDSNTTL  5
            GLIGDLGQ+YDSN TL
Sbjct  121  GLIGDLGQSYDSNRTL  136



>ref|XP_010690820.1| PREDICTED: purple acid phosphatase 2-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=469

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 121/156 (78%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTH-K  290
            +SS+VR         + VDMPLDSDVFR P G NAPQQVHITQGD+EGKGVI+SW T   
Sbjct  33   SSSFVRKV------EKSVDMPLDSDVFRPPPGHNAPQQVHITQGDHEGKGVIVSWVTPIS  86

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS +V YW+ +S+ K  + G V  YKYYNYTS YIHHCTI++LE++TKYYYK+G+G   
Sbjct  87   PGSSSVVYWSGSSKHKYKAKGIVTKYKYYNYTSGYIHHCTIRNLEYNTKYYYKVGTGKYA  146

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWFVTPP+ GPDVPYTFG+IGDLGQT+DSN TLT
Sbjct  147  RTFWFVTPPEVGPDVPYTFGVIGDLGQTFDSNKTLT  182



>emb|CDX89713.1| BnaC03g46270D [Brassica napus]
Length=470

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 116/156 (74%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK-  290
            TSSYVR  L A+     +DMPLDSDVFRVP G NAPQQVHITQGD EGK VI+SW T K 
Sbjct  32   TSSYVRR-LEAT-----LDMPLDSDVFRVPPGCNAPQQVHITQGDLEGKAVIVSWVTQKA  85

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW E+S     + G   TYK+YNYTS +IHHC I +LE+DTKYYY +G G  K
Sbjct  86   RGSNTVLYWKEHSCKMLKARGKSKTYKFYNYTSGHIHHCPISNLEYDTKYYYMVGVGQTK  145

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF TPPK GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  146  RKFWFFTPPKAGPDVPYTFGLIGDLGQSFDSNITLT  181



>ref|XP_009136307.1| PREDICTED: purple acid phosphatase 10-like [Brassica rapa]
Length=465

 Score =   201 bits (511),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 118/156 (76%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK-  290
            TS +VR  L A+      DMPLDSDVFRVP G NAPQQVHITQGD EGK VI+SW T K 
Sbjct  27   TSRFVRR-LEAT-----ADMPLDSDVFRVPPGCNAPQQVHITQGDLEGKAVIVSWVTQKA  80

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW E+S     + G   TYK+Y+YTS +IHHCTI++LE+DTKYYY +G G  +
Sbjct  81   KGSNMVLYWKEHSSKMLKAHGKSKTYKFYHYTSGHIHHCTIRNLEYDTKYYYMVGVGQTE  140

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF+TPPKPGPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  141  RKFWFLTPPKPGPDVPYTFGLIGDLGQSFDSNITLT  176



>emb|CDP07456.1| unnamed protein product [Coffea canephora]
Length=426

 Score =   200 bits (509),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 111/136 (82%), Gaps = 1/136 (1%)
 Frame = -2

Query  409  MPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHKH-GSKAVHYWAENSRAKRFS  233
            MPLDSDVFRVP G NAPQQVHITQGD EG+GVI+SW T    GS  V YW ENS+    +
Sbjct  1    MPLDSDVFRVPPGYNAPQQVHITQGDSEGRGVIVSWITADEPGSNIVLYWPENSKHIFRA  60

Query  232  VGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPYTF  53
             G V+TYKYYNYTS +IHHCTI+DLE+DTKY Y++G G+  R FWFVTPPK GPDVPYTF
Sbjct  61   DGIVLTYKYYNYTSGFIHHCTIEDLEYDTKYNYEVGIGNTTRQFWFVTPPKVGPDVPYTF  120

Query  52   GLIGDLGQTYDSNTTL  5
            GLIGDLGQT+DSNTT+
Sbjct  121  GLIGDLGQTFDSNTTV  136



>ref|XP_004230906.1| PREDICTED: purple acid phosphatase 2 [Solanum lycopersicum]
Length=470

 Score =   201 bits (511),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 116/157 (74%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            VTSS+VR         + +DMPLDSDVF VP G NAPQQVHITQGD+ GK VI+SW T  
Sbjct  31   VTSSFVRKV------EKTIDMPLDSDVFSVPPGYNAPQQVHITQGDHVGKAVIVSWVTMD  84

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V YW+E S+ K  + G V +Y YYNYTS YIHHC IK+L+ DTKYYYK+G GH 
Sbjct  85   EPGSSTVVYWSEKSKHKCKASGKVTSYTYYNYTSGYIHHCNIKNLKFDTKYYYKIGIGHI  144

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF TPP+ GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  145  SRTFWFTTPPEVGPDVPYTFGLIGDLGQSFDSNKTLT  181



>ref|XP_006487340.1| PREDICTED: purple acid phosphatase 2-like [Citrus sinensis]
Length=468

 Score =   201 bits (511),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 118/156 (76%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TSS++R    A      +D+PLD+DVF+VP G NAPQQVHITQGD  GK VI+SW T  +
Sbjct  30   TSSFIRKVEKA------IDLPLDADVFQVPPGYNAPQQVHITQGDLVGKAVIVSWVTVDE  83

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             G+  V YW+ENS  K  + G + TYKYYNYTS YIHHCTI+ LE +TKYYY +G GH +
Sbjct  84   PGTNTVVYWSENSEQKEQAEGKIYTYKYYNYTSGYIHHCTIRHLEFNTKYYYVVGIGHTE  143

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWFVTPP+ GPDVPY+FGLIGDLGQ+YDSN TLT
Sbjct  144  RQFWFVTPPEVGPDVPYSFGLIGDLGQSYDSNVTLT  179



>ref|XP_006581009.1| PREDICTED: uncharacterized protein LOC100794124 isoform X1 [Glycine 
max]
Length=416

 Score =   199 bits (507),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 118/156 (76%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TS ++RN   +      +DMP+DSD FRVP G NAPQQVHITQGD+ GKGVIISW + H+
Sbjct  35   TSDFLRNDYLS------LDMPIDSDTFRVPPGYNAPQQVHITQGDHVGKGVIISWISPHE  88

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YWAENS  K  + G  +TYKY+NYTS YIHHCT+ +LE DTKYYY++G G+  
Sbjct  89   PGSSTVIYWAENSEFKWQAHGFFLTYKYFNYTSGYIHHCTVHNLEFDTKYYYEVGIGNTT  148

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF TPP  GPDVPYTFGLIGDLGQTY+SN TLT
Sbjct  149  RQFWFKTPPPVGPDVPYTFGLIGDLGQTYNSNRTLT  184



>ref|XP_002306126.2| Fe(III)-Zn(II) purple acid phosphatase family protein [Populus 
trichocarpa]
 gb|EEE86637.2| Fe(III)-Zn(II) purple acid phosphatase family protein [Populus 
trichocarpa]
Length=490

 Score =   201 bits (512),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 119/156 (76%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TSS+VR         + +DMPLDSDVF+VP G NAPQQVHITQGD+ GKGVI+SW T  +
Sbjct  52   TSSFVRKV------EKTIDMPLDSDVFKVPPGYNAPQQVHITQGDHVGKGVIVSWVTADE  105

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW+E+S+ K+ + G   TYK+YNYTS YIHHC I++LE +TKYYY +G G+  
Sbjct  106  SGSNTVIYWSESSKQKKEAEGKTYTYKFYNYTSGYIHHCIIRNLEFNTKYYYVVGVGNTT  165

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF+TPP  GPDVPYTFGLIGDLGQTYDSN TLT
Sbjct  166  RQFWFITPPAVGPDVPYTFGLIGDLGQTYDSNRTLT  201



>gb|KDP41744.1| hypothetical protein JCGZ_26762 [Jatropha curcas]
Length=466

 Score =   201 bits (510),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 116/155 (75%), Gaps = 6/155 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHKH  287
            TSS+VR      P  + VDMPLDSDVFRVP G NAPQQVHITQGD++GK VI+SW T + 
Sbjct  29   TSSFVR------PVEKTVDMPLDSDVFRVPSGDNAPQQVHITQGDHDGKAVIVSWVTDEP  82

Query  286  GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKR  107
            GS  V YW ENS  K+ + G   TY++YNY S YIHHCTI++LE++TKYYY +G  +  R
Sbjct  83   GSSNVLYWRENSTNKKIAKGKYNTYRFYNYNSGYIHHCTIRNLEYNTKYYYLVGLHNTTR  142

Query  106  VFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             FWF TPP  GPDVPYTFGLIGDLGQ++DSN  LT
Sbjct  143  QFWFTTPPAVGPDVPYTFGLIGDLGQSFDSNRPLT  177



>ref|XP_006423399.1| hypothetical protein CICLE_v10028320mg [Citrus clementina]
 gb|ESR36639.1| hypothetical protein CICLE_v10028320mg [Citrus clementina]
Length=484

 Score =   201 bits (511),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 119/156 (76%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TSS++R    A      +D+PLD+DVF+VP G NAPQQVHITQGD  GK VI+SW T  +
Sbjct  46   TSSFIRKVEKA------IDLPLDADVFQVPPGYNAPQQVHITQGDLVGKAVIVSWVTVDE  99

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             G+  V YW+EN++ K  + G + TYKYYNYTS YIHHCTI+ LE +TKYYY +G GH +
Sbjct  100  PGTNTVVYWSENNKQKEQAEGKIYTYKYYNYTSGYIHHCTIRHLEFNTKYYYVVGIGHTE  159

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWFVTPP+ GPDVPY+FGLIGDLGQ+YDSN TLT
Sbjct  160  RQFWFVTPPEVGPDVPYSFGLIGDLGQSYDSNVTLT  195



>emb|CDY02259.1| BnaA03g39080D [Brassica napus]
Length=426

 Score =   199 bits (507),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 109/137 (80%), Gaps = 1/137 (1%)
 Frame = -2

Query  409  MPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK-HGSKAVHYWAENSRAKRFS  233
            MPLDSDVFRVP G NAPQQVHITQGD EGK VI+SW T K  GS  V YW E+S     +
Sbjct  1    MPLDSDVFRVPPGCNAPQQVHITQGDLEGKAVIVSWVTQKAKGSNMVLYWKEHSSKMLKA  60

Query  232  VGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPYTF  53
             G   TYK+YNYTS +IHHCTI++LE+DTKYYY +G G  +R FWF+TPPKPGPDVPYTF
Sbjct  61   HGKSKTYKFYNYTSGHIHHCTIRNLEYDTKYYYMVGVGQTERKFWFLTPPKPGPDVPYTF  120

Query  52   GLIGDLGQTYDSNTTLT  2
            GLIGDLGQ++DSN TLT
Sbjct  121  GLIGDLGQSFDSNITLT  137



>gb|AAX20028.1| purple acid phosphatase [Medicago truncatula]
 gb|KEH29467.1| purple acid phosphatase superfamily protein [Medicago truncatula]
Length=465

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 121/156 (78%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHKH  287
            TS++VR         + +DMPLDSDVF VP G NAPQQVHITQGD+ GK VI+SW T   
Sbjct  26   TSTFVRKV------EKTIDMPLDSDVFDVPSGYNAPQQVHITQGDHVGKAVIVSWVTEDE  79

Query  286  -GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS AV YW++NS+ KR + G +VTY+++NYTS +IHH TI++LE++TKYYY++G G+  
Sbjct  80   PGSNAVRYWSKNSKQKRLAKGKIVTYRFFNYTSGFIHHTTIRNLEYNTKYYYEVGLGNTT  139

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF TPP+ GPDVPYTFGLIGDLGQ+YDSN TL+
Sbjct  140  RQFWFTTPPEIGPDVPYTFGLIGDLGQSYDSNKTLS  175



>emb|CDY26770.1| BnaC09g08970D [Brassica napus]
Length=467

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 119/156 (76%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHKH  287
            TSSYVR  L A+     VDMPLDSDVFR P G NAPQQVHITQGD EGK VI+SW T + 
Sbjct  31   TSSYVRR-LEAT-----VDMPLDSDVFRFPPGYNAPQQVHITQGDVEGKAVIVSWVTQEA  84

Query  286  -GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS AV YW ENS  K  + G   TYK+YNYTS +IHHCTI++LE+DTKYYY +G G  +
Sbjct  85   PGSDAVLYWKENSSKKLKAYGKSKTYKFYNYTSGHIHHCTIRNLEYDTKYYYVVGVGQTE  144

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R F+F TPP+ GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  145  REFYFFTPPEVGPDVPYTFGLIGDLGQSFDSNITLT  180



>ref|XP_009136308.1| PREDICTED: purple acid phosphatase 10 [Brassica rapa]
Length=466

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 116/157 (74%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            +TS +VR         + +DMPL SDVFRVP G NAPQQVHITQGD EGK VI+SW T +
Sbjct  27   ITSKFVRKV------EKSIDMPLHSDVFRVPPGHNAPQQVHITQGDVEGKAVIVSWVTQE  80

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V YW E+S  K  + G   TYK+YNYTS YIHHCTI++LE+D+KYYY +G G  
Sbjct  81   APGSNTVLYWKEHSSKKHKAHGKTNTYKFYNYTSGYIHHCTIRNLEYDSKYYYMVGVGQT  140

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R FWF TPPK GPDVPYTFGLIGDLGQT+DSN TLT
Sbjct  141  ERKFWFFTPPKVGPDVPYTFGLIGDLGQTFDSNITLT  177



>ref|XP_006294169.1| hypothetical protein CARUB_v10023164mg [Capsella rubella]
 gb|EOA27067.1| hypothetical protein CARUB_v10023164mg [Capsella rubella]
Length=463

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 118/156 (76%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTH-K  290
            TS YVR     +  P+D  MPL+SDVF VP G N PQQVHITQG++EG GVI+SW T  K
Sbjct  25   TSEYVR----GTDLPDD--MPLNSDVFTVPPGPNTPQQVHITQGNHEGNGVIVSWVTPVK  78

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW EN ++K+ +   V TY+++NYTS YIHHC I DLE DTKYYY++GSG  +
Sbjct  79   PGSNTVRYWCENEKSKKQAEATVNTYRFFNYTSGYIHHCLIDDLEFDTKYYYEIGSGKWR  138

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF TPPK GPDVPYTFGLIGDLGQTYDSN+TL+
Sbjct  139  RQFWFFTPPKSGPDVPYTFGLIGDLGQTYDSNSTLS  174



>ref|NP_001239689.1| uncharacterized protein LOC100794124 [Glycine max]
 gb|ADM32495.1| phytase [Glycine max]
Length=444

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 118/156 (76%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TS ++RN   +      +DMP+DSD FRVP G NAPQQVHITQGD+ GKGVIISW + H+
Sbjct  5    TSDFLRNDYLS------LDMPIDSDTFRVPPGYNAPQQVHITQGDHVGKGVIISWISPHE  58

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YWAENS  K  + G  +TYKY+NYTS YIHHCT+ +LE DTKYYY++G G+  
Sbjct  59   PGSSTVIYWAENSEFKWQAHGFFLTYKYFNYTSGYIHHCTVHNLEFDTKYYYEVGIGNTT  118

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF TPP  GPDVPYTFGLIGDLGQTY+SN TLT
Sbjct  119  RQFWFKTPPPVGPDVPYTFGLIGDLGQTYNSNRTLT  154



>ref|XP_002886226.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62485.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=475

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 119/164 (73%), Gaps = 14/164 (9%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            VTS YVR  L A+     VDMPLDSDVFRVP G NAPQQVHITQGD EGK VI+SW T +
Sbjct  29   VTSRYVRK-LEAT-----VDMPLDSDVFRVPCGYNAPQQVHITQGDVEGKAVIVSWVTQE  82

Query  289  -HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLE-------HDTKYYY  134
              GS  V YW ENS  K  + G   TYK+YNYTS YIHHC I++LE       +DTKYYY
Sbjct  83   AKGSNKVIYWKENSSKKHKAYGKTNTYKFYNYTSGYIHHCPIRNLEVVVFLLQYDTKYYY  142

Query  133  KLGSGHAKRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             +G G  +R+FWF TPP+ GPDVPYTFGLIGDLGQ+YDSN TLT
Sbjct  143  VVGVGQTERMFWFFTPPEIGPDVPYTFGLIGDLGQSYDSNITLT  186



>ref|XP_009140744.1| PREDICTED: fe(3+)-Zn(2+) purple acid phosphatase 12 [Brassica 
rapa]
Length=469

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 117/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TS YVR S    P+    DMPLDSDVF+VP G N PQQVHITQG++EG GVIISW T  
Sbjct  30   ITSEYVRGS--DLPD----DMPLDSDVFKVPPGPNTPQQVHITQGNHEGNGVIISWVTPS  83

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
               S  V YW+EN ++K+ +   + TY+++NYTS YIHHC I DLE D KYYY++GS   
Sbjct  84   APCSNTVRYWSENGKSKKLAEATMNTYRFFNYTSGYIHHCLIDDLEFDMKYYYEIGSWKW  143

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R FWF TPPKPGPDVPYTFGLIGDLGQTYDSN TL+
Sbjct  144  RRRFWFFTPPKPGPDVPYTFGLIGDLGQTYDSNRTLS  180



>emb|CDY02257.1| BnaA03g39100D [Brassica napus]
Length=466

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 116/157 (74%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            +TS +VR         + +DMPL SDVFRVP G NAPQQVHITQGD EGK VI+SW T +
Sbjct  27   ITSKFVRKV------EKSIDMPLHSDVFRVPPGHNAPQQVHITQGDVEGKAVIVSWVTQE  80

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V YW E+S  K  + G   TYK+YNYTS YIHHCTI++LE+D+KYYY +G G  
Sbjct  81   APGSNTVLYWKEHSSKKHKAHGKTNTYKFYNYTSGYIHHCTIRNLEYDSKYYYMVGVGQT  140

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R FWF TPPK GPDVPYTFGLIGDLGQT+DSN TLT
Sbjct  141  ERKFWFFTPPKVGPDVPYTFGLIGDLGQTFDSNITLT  177



>gb|ACU17971.1| unknown [Glycine max]
Length=307

 Score =   196 bits (497),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 112/139 (81%), Gaps = 1/139 (1%)
 Frame = -2

Query  415  VDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HKHGSKAVHYWAENSRAKR  239
            VDMPLDSDVF +P G NAPQQVHITQGD  GK VI+SW T  + GS  V YW+ENS  K+
Sbjct  36   VDMPLDSDVFAIPPGYNAPQQVHITQGDLVGKAVIVSWVTVDEPGSSEVRYWSENSDQKK  95

Query  238  FSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPY  59
               G +VTY+++NYTS +IHH TI++LE++TKYYY++G G+  R FWFVTPP+ GPDVPY
Sbjct  96   IVEGKLVTYRFFNYTSGFIHHTTIRNLEYNTKYYYEVGLGNTTRQFWFVTPPEIGPDVPY  155

Query  58   TFGLIGDLGQTYDSNTTLT  2
            TFGLIGDLGQ++DSN TL+
Sbjct  156  TFGLIGDLGQSFDSNKTLS  174



>ref|XP_007017662.1| Purple acid phosphatase 10 isoform 1 [Theobroma cacao]
 gb|EOY14887.1| Purple acid phosphatase 10 isoform 1 [Theobroma cacao]
Length=467

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 119/157 (76%), Gaps = 8/157 (5%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TSS+VR   S        DMPLDSDVF+VP G N PQQVHITQGD +G+GVIISW T  
Sbjct  29   ITSSFVRKEYSP-------DMPLDSDVFQVPPGYNEPQQVHITQGDADGRGVIISWITPD  81

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GS  V YW+ENS+ K  + G  V YK++NYTS YIHHCTI  LE++TKY+Y++G G+ 
Sbjct  82   EPGSNTVLYWSENSKHKNRADGTFVRYKFFNYTSGYIHHCTINKLEYNTKYFYEVGIGNT  141

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF+TPP+ GPDVPYTFGLIGDLGQT+DSN TLT
Sbjct  142  TRQFWFITPPRAGPDVPYTFGLIGDLGQTHDSNVTLT  178



>gb|KDO49482.1| hypothetical protein CISIN_1g045849mg, partial [Citrus sinensis]
Length=320

 Score =   196 bits (497),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 109/137 (80%), Gaps = 1/137 (1%)
 Frame = -2

Query  409  MPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HKHGSKAVHYWAENSRAKRFS  233
            MPLD+DVF+VP G NAPQQVHITQGD  GK VI+SW T  + G+  V YW+ENS  K  +
Sbjct  1    MPLDADVFQVPPGYNAPQQVHITQGDLVGKAVIVSWVTVDEPGTNTVVYWSENSEQKEQA  60

Query  232  VGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPYTF  53
             G V TYKYYNYTS YIHHCTI+ LE +TKYYY +G GH +R FWFVTPP+ GPDVPY+F
Sbjct  61   EGKVYTYKYYNYTSGYIHHCTIRHLEFNTKYYYVVGIGHTERQFWFVTPPEVGPDVPYSF  120

Query  52   GLIGDLGQTYDSNTTLT  2
            GLIGDLGQ+YDSN TLT
Sbjct  121  GLIGDLGQSYDSNVTLT  137



>ref|XP_009112387.1| PREDICTED: purple acid phosphatase 10-like isoform X2 [Brassica 
rapa]
Length=462

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 119/156 (76%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHKH  287
            TS+YVR  L A+     VDMPLDSDVFRVP G NAPQQVHITQGD EGK VI+SW T + 
Sbjct  26   TSNYVRR-LEAT-----VDMPLDSDVFRVPPGYNAPQQVHITQGDVEGKAVIVSWVTQEA  79

Query  286  -GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW ENS  K  + G   TYK+YNYTS +IHHCTI++LE+DTKYYY +G G  +
Sbjct  80   PGSDTVLYWKENSSKKLKAYGKSKTYKFYNYTSGHIHHCTIRNLEYDTKYYYVVGVGQTE  139

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R F+F TPP+ GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  140  REFYFFTPPEVGPDVPYTFGLIGDLGQSFDSNITLT  175



>gb|KCW55391.1| hypothetical protein EUGRSUZ_I01302 [Eucalyptus grandis]
Length=474

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 120/156 (77%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TS++VR         + VDMPLDSDVFRVP G NAPQQVHITQGD+ GKG+I+SW T  +
Sbjct  38   TSTFVRKV------EKTVDMPLDSDVFRVPPGYNAPQQVHITQGDHVGKGMIMSWVTPDE  91

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW+ENS  K+ + G V  YK+YNYTS YIHHCT+ +L ++TKYYY++G GH  
Sbjct  92   PGSSVVLYWSENSEHKKKAKGKVNRYKFYNYTSGYIHHCTLNNLMYNTKYYYEVGIGHTV  151

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF+TPP+ GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  152  RQFWFITPPEVGPDVPYTFGLIGDLGQSFDSNVTLT  187



>dbj|BAC55157.1| purple acid phosphatase [Nicotiana tabacum]
Length=470

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 117/156 (75%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHKH  287
            TSS+VR         + +DMP+DSDVF VP G NAPQQVHITQGD+ GK +I+SW T   
Sbjct  32   TSSFVRKV------EKTIDMPMDSDVFSVPPGYNAPQQVHITQGDHVGKAMIVSWVTMDE  85

Query  286  -GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW+ NS+ K  + GAV TY++YNYTS YIHHC IK L+ +TKYYY++G GH  
Sbjct  86   PGSSTVLYWSNNSKQKNKATGAVTTYRFYNYTSGYIHHCIIKHLKFNTKYYYEVGIGHNP  145

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWFVTPP+ GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  146  RTFWFVTPPQVGPDVPYTFGLIGDLGQSFDSNRTLT  181



>ref|XP_009610724.1| PREDICTED: purple acid phosphatase 2-like [Nicotiana tomentosiformis]
Length=470

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 117/156 (75%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHKH  287
            TSS+VR         + +DMP+DSDVF VP G NAPQQVHITQGD+ GK +I+SW T   
Sbjct  32   TSSFVRKV------EKTIDMPMDSDVFSVPPGYNAPQQVHITQGDHVGKAMIVSWVTMDE  85

Query  286  -GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW+ NS+ K  + GAV TY++YNYTS YIHHC IK L+ +TKYYY++G GH  
Sbjct  86   PGSSTVLYWSNNSKQKNKATGAVTTYRFYNYTSGYIHHCIIKHLKFNTKYYYEVGIGHNP  145

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWFVTPP+ GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  146  RTFWFVTPPQVGPDVPYTFGLIGDLGQSFDSNRTLT  181



>ref|XP_010028628.1| PREDICTED: purple acid phosphatase 2-like [Eucalyptus grandis]
Length=497

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 120/156 (77%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TS++VR         + VDMPLDSDVFRVP G NAPQQVHITQGD+ GKG+I+SW T  +
Sbjct  61   TSTFVRKV------EKTVDMPLDSDVFRVPPGYNAPQQVHITQGDHVGKGMIMSWVTPDE  114

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW+ENS  K+ + G V  YK+YNYTS YIHHCT+ +L ++TKYYY++G GH  
Sbjct  115  PGSSVVLYWSENSEHKKKAKGKVNRYKFYNYTSGYIHHCTLNNLMYNTKYYYEVGIGHTV  174

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF+TPP+ GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  175  RQFWFITPPEVGPDVPYTFGLIGDLGQSFDSNVTLT  210



>ref|XP_006409436.1| hypothetical protein EUTSA_v10022673mg [Eutrema salsugineum]
 gb|ESQ50889.1| hypothetical protein EUTSA_v10022673mg [Eutrema salsugineum]
Length=470

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 117/156 (75%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK-  290
            TS YVR  L A+     VDMPLDSDVF VP G NAPQQVHITQGD EGK VI+SW T + 
Sbjct  32   TSRYVRR-LEAT-----VDMPLDSDVFCVPSGYNAPQQVHITQGDVEGKAVIVSWVTQEA  85

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW ENS  K  + G   TYK+YNYTS +IHHCTI++LE+D+KYYY +G G  +
Sbjct  86   KGSNTVLYWKENSSKKLKAHGKSTTYKFYNYTSGHIHHCTIRNLEYDSKYYYVVGVGQTE  145

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF TPP+ GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  146  RKFWFFTPPQVGPDVPYTFGLIGDLGQSFDSNITLT  181



>ref|XP_010028627.1| PREDICTED: purple acid phosphatase 2-like [Eucalyptus grandis]
 gb|KCW55389.1| hypothetical protein EUGRSUZ_I01298 [Eucalyptus grandis]
Length=475

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 120/156 (77%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TS++VR         + VDMPLDSDVFRVP G NAPQQVHITQGD+ GKGVI+SW T  +
Sbjct  39   TSTFVRKV------EKTVDMPLDSDVFRVPPGYNAPQQVHITQGDHVGKGVIVSWVTPDE  92

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW++NS  K+ + G V  Y++YNYTS YIHHCT+ DL ++TKYYY++G GH  
Sbjct  93   PGSSVVLYWSKNSEHKKKAKGKVNRYEFYNYTSGYIHHCTLNDLMYNTKYYYEVGIGHTV  152

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF+TPP+ GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  153  RQFWFITPPEVGPDVPYTFGLIGDLGQSFDSNVTLT  188



>gb|ABV89745.1| purple acid phosphatase 12 protein family isoform 4 [Brassica 
napus]
 gb|ABV89747.1| purple acid phosphatase 12 protein family isoform 4 [Brassica 
napus]
Length=526

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 109/138 (79%), Gaps = 1/138 (1%)
 Frame = -2

Query  412  DMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HKHGSKAVHYWAENSRAKRF  236
            DMPLDSDVF+VP G N PQQVHITQG++EG GVIISW T     S  V YW+EN ++K+ 
Sbjct  94   DMPLDSDVFKVPPGPNTPQQVHITQGNHEGNGVIISWVTPSAPCSNTVRYWSENGKSKKL  153

Query  235  SVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPYT  56
            +V  + TY+++NYTS YIHHC I DLE D KYYY++GS   +R FWF TPPKPGPDVPYT
Sbjct  154  AVATINTYRFFNYTSGYIHHCLIDDLEFDMKYYYEIGSRKWQRRFWFFTPPKPGPDVPYT  213

Query  55   FGLIGDLGQTYDSNTTLT  2
            FGLIGDLGQTYDSN TL+
Sbjct  214  FGLIGDLGQTYDSNRTLS  231



>ref|XP_006473581.1| PREDICTED: purple acid phosphatase 2-like isoform X1 [Citrus 
sinensis]
Length=471

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 112/138 (81%), Gaps = 1/138 (1%)
 Frame = -2

Query  412  DMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HKHGSKAVHYWAENSRAKRF  236
            DMPLDSDVFRVP G NAPQQVHITQGD+EGKGVI+SW T  + GS  V YWAENS  K+ 
Sbjct  45   DMPLDSDVFRVPPGYNAPQQVHITQGDHEGKGVIVSWVTPDEPGSNTVLYWAENSTLKQQ  104

Query  235  SVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPYT  56
            + G V+TY Y+NYTS+ IHHCTI+DLE DTKYYY++G G+A R F F TPP  GPDVPYT
Sbjct  105  AHGIVLTYNYFNYTSNCIHHCTIEDLEFDTKYYYEVGVGNATRQFSFTTPPGVGPDVPYT  164

Query  55   FGLIGDLGQTYDSNTTLT  2
            FGLIGDLGQTY SN TLT
Sbjct  165  FGLIGDLGQTYYSNRTLT  182



>gb|ABV89755.1| purple acid phosphatase 12 protein family isoform 6 [Brassica 
napus]
 gb|ABV89756.1| purple acid phosphatase 12 protein family isoform 6 [Brassica 
napus]
Length=526

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 109/138 (79%), Gaps = 1/138 (1%)
 Frame = -2

Query  412  DMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HKHGSKAVHYWAENSRAKRF  236
            DMPLDSDVF+VP G N PQQVHITQG++EG GVIISW T     S  V YW+EN ++K+ 
Sbjct  94   DMPLDSDVFKVPPGPNTPQQVHITQGNHEGNGVIISWVTPSAPCSNTVRYWSENGKSKKL  153

Query  235  SVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPYT  56
            +V  + TY+++NYTS YIHHC I DLE D KYYY++GS   +R FWF TPPKPGPDVPYT
Sbjct  154  AVATINTYRFFNYTSGYIHHCLIDDLEFDMKYYYEIGSRKWQRRFWFFTPPKPGPDVPYT  213

Query  55   FGLIGDLGQTYDSNTTLT  2
            FGLIGDLGQTYDSN TL+
Sbjct  214  FGLIGDLGQTYDSNRTLS  231



>ref|XP_004172093.1| PREDICTED: purple acid phosphatase 2-like [Cucumis sativus]
Length=477

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 116/157 (74%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TS +VR+      +   +DMPLDSDVFR P G NAPQQVHITQGD EGK VIISW T  
Sbjct  30   ITSGFVRD------DDASLDMPLDSDVFRPPPGKNAPQQVHITQGDSEGKSVIISWVTPD  83

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            K GS  V YW ENS  +  + G   +YKY+NYTS YIHHCTI++LE+D+KY+Y +G G  
Sbjct  84   KPGSNRVVYWDENSGIRNHAEGYFTSYKYFNYTSGYIHHCTIENLEYDSKYFYVIGFGSL  143

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF TPPK GPDVPYTFGLIGDLGQTYDSN TLT
Sbjct  144  SRRFWFTTPPKVGPDVPYTFGLIGDLGQTYDSNRTLT  180



>gb|AFB18640.1| PAP10 [Gossypium hirsutum]
Length=465

 Score =   199 bits (505),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 116/156 (74%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHKH  287
            TS YVR         + VDMPL SDVF+ P G NAPQQVHITQGD+ GK VI+SW T   
Sbjct  31   TSIYVRKE------EKTVDMPLHSDVFQAPLGYNAPQQVHITQGDHVGKAVIVSWVTQDE  84

Query  286  -GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW+E S+ K  +VG + TYKYYNYTS +IHHCT+K+LE++TKYYY +G G + 
Sbjct  85   PGSNTVVYWSEGSKEKMKAVGKISTYKYYNYTSGFIHHCTVKNLEYNTKYYYVVGEGTSM  144

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF TPP+ GPDVPYTFGLIGDLGQT+DSN TLT
Sbjct  145  RKFWFTTPPEVGPDVPYTFGLIGDLGQTFDSNVTLT  180



>ref|XP_009112386.1| PREDICTED: purple acid phosphatase 10-like isoform X1 [Brassica 
rapa]
Length=468

 Score =   199 bits (505),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 119/156 (76%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHKH  287
            TS+YVR  L A+     VDMPLDSDVFRVP G NAPQQVHITQGD EGK VI+SW T + 
Sbjct  32   TSNYVRR-LEAT-----VDMPLDSDVFRVPPGYNAPQQVHITQGDVEGKAVIVSWVTQEA  85

Query  286  -GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW ENS  K  + G   TYK+YNYTS +IHHCTI++LE+DTKYYY +G G  +
Sbjct  86   PGSDTVLYWKENSSKKLKAYGKSKTYKFYNYTSGHIHHCTIRNLEYDTKYYYVVGVGQTE  145

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R F+F TPP+ GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  146  REFYFFTPPEVGPDVPYTFGLIGDLGQSFDSNITLT  181



>emb|CDY47461.1| BnaA09g08700D [Brassica napus]
Length=468

 Score =   199 bits (505),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 119/156 (76%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHKH  287
            TS+YVR  L A+     VDMPLDSDVFRVP G NAPQQVHITQGD EGK VI+SW T + 
Sbjct  32   TSNYVRR-LEAT-----VDMPLDSDVFRVPPGYNAPQQVHITQGDVEGKAVIVSWVTQEA  85

Query  286  -GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW ENS  K  + G   TYK+YNYTS +IHHCTI++LE+DTKYYY +G G  +
Sbjct  86   PGSDTVLYWKENSSKKLKAYGKSKTYKFYNYTSGHIHHCTIRNLEYDTKYYYVVGVGQTE  145

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R F+F TPP+ GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  146  REFYFFTPPEVGPDVPYTFGLIGDLGQSFDSNITLT  181



>ref|XP_010672424.1| PREDICTED: purple acid phosphatase-like [Beta vulgaris subsp. 
vulgaris]
Length=471

 Score =   198 bits (504),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 120/156 (77%), Gaps = 6/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TSS+ R     + N   +DMPL SDVF++P G NAPQQVHITQGD+ G+ VI+SWTT  +
Sbjct  32   TSSFCR-----TKNDISLDMPLSSDVFQLPPGYNAPQQVHITQGDHIGRAVIVSWTTPDE  86

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YWAENS  K+ + G V+TYKY NYTS YIHHCTI  LE DTKYYY++GSG++ 
Sbjct  87   PGSNTVTYWAENSTEKKHAEGIVLTYKYVNYTSGYIHHCTIAGLEFDTKYYYEVGSGNSS  146

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF+TPP+ G DVPYTFGLIGDLGQT+DSN T+T
Sbjct  147  RQFWFITPPESGLDVPYTFGLIGDLGQTHDSNRTVT  182



>gb|AET86954.1| PAP12 [Gossypium hirsutum]
Length=467

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 118/157 (75%), Gaps = 8/157 (5%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +T ++VR   S        DMPLDSDVF+VP G NAPQQVHITQGD +G GVIISW T  
Sbjct  29   ITGNFVRKKYSP-------DMPLDSDVFQVPSGYNAPQQVHITQGDMDGSGVIISWITPD  81

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GS  V+YW+ENS  K  + G  V YK++NYTS YIHHCTI +LE++TKY Y++G G +
Sbjct  82   EPGSNMVYYWSENSNHKYKAEGIFVRYKFFNYTSGYIHHCTINNLEYNTKYMYEIGRGDS  141

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWFVTPP+ GPDVPYTFGLIGDLGQT+DSN TLT
Sbjct  142  IRQFWFVTPPRTGPDVPYTFGLIGDLGQTHDSNVTLT  178



>ref|XP_006487339.1| PREDICTED: purple acid phosphatase 2-like isoform X2 [Citrus 
sinensis]
Length=426

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 109/137 (80%), Gaps = 1/137 (1%)
 Frame = -2

Query  409  MPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HKHGSKAVHYWAENSRAKRFS  233
            MPLD+DVF+VP G NAPQQVHITQGD  GK VI+SW T  + G+  V YW+ENS  K  +
Sbjct  1    MPLDADVFQVPPGYNAPQQVHITQGDLVGKAVIVSWVTVDEPGTNTVVYWSENSEQKEQA  60

Query  232  VGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPYTF  53
             G V TYKYYNYTS YIHHCTI+ LE +TKYYY +G GH +R FWFVTPP+ GPDVPY+F
Sbjct  61   EGKVYTYKYYNYTSGYIHHCTIRHLEFNTKYYYVVGIGHTERQFWFVTPPEVGPDVPYSF  120

Query  52   GLIGDLGQTYDSNTTLT  2
            GLIGDLGQ+YDSN TLT
Sbjct  121  GLIGDLGQSYDSNVTLT  137



>ref|XP_007222938.1| hypothetical protein PRUPE_ppa005293mg [Prunus persica]
 gb|EMJ24137.1| hypothetical protein PRUPE_ppa005293mg [Prunus persica]
Length=468

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 119/158 (75%), Gaps = 8/158 (5%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TSSYVRN      +   +DMPLDSDVF+VP G NAPQQVHITQGD+EG+GVI+SW T  
Sbjct  28   ITSSYVRN------DDLSLDMPLDSDVFQVPPGYNAPQQVHITQGDHEGRGVIVSWVTPD  81

Query  292  KHGSKAVHYWAEN-SRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGH  116
            + GS  V YWAEN +  K  + G ++TY Y+NY S YIHHCTI +LE DTKYYY++G G+
Sbjct  82   EPGSSTVLYWAENNTNLKNQAQGTLLTYHYFNYISGYIHHCTIHNLEFDTKYYYEVGIGN  141

Query  115  AKRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
              R FWF TPP  GPDV YTFGLIGDLGQT+DSN TLT
Sbjct  142  TTRRFWFTTPPGVGPDVAYTFGLIGDLGQTHDSNRTLT  179



>ref|XP_010530813.1| PREDICTED: purple acid phosphatase 10 [Tarenaya hassleriana]
Length=466

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 108/139 (78%), Gaps = 1/139 (1%)
 Frame = -2

Query  415  VDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHKH-GSKAVHYWAENSRAKR  239
            VDMPLDSDVF+ P G NAPQQVHITQGD EGK VIISW T +  G+  V YW ENS  K 
Sbjct  43   VDMPLDSDVFKAPPGFNAPQQVHITQGDTEGKAVIISWVTQQERGTNTVLYWKENSSEKL  102

Query  238  FSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPY  59
             + G    YK+YNYTS YIHHCTI++LEH++KYYY +G G  +R FWF TPP+ GPDVPY
Sbjct  103  KAEGKANRYKFYNYTSGYIHHCTIRNLEHNSKYYYVVGVGQTERQFWFHTPPELGPDVPY  162

Query  58   TFGLIGDLGQTYDSNTTLT  2
            TFGLIGDLGQ++DSN TLT
Sbjct  163  TFGLIGDLGQSFDSNLTLT  181



>ref|XP_011037173.1| PREDICTED: purple acid phosphatase 2-like [Populus euphratica]
Length=467

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 118/156 (76%), Gaps = 8/156 (5%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TSS+VR         + +DMPLDSDVF+VP G NAPQQVHITQGD+ GKGVI+SW T  +
Sbjct  30   TSSFVRKV------EKTIDMPLDSDVFKVPPGYNAPQQVHITQGDHVGKGVIVSWVTADE  83

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW+E+S+ K  + G   TYK+YNYTS YIHHC I++LE +TKYYY +G G+  
Sbjct  84   SGSNTVIYWSESSKKKE-AEGKTYTYKFYNYTSGYIHHCIIRNLEFNTKYYYVVGVGNTT  142

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWFVTPP  GPDVPYTFGLIGDLGQTYDSN TLT
Sbjct  143  RQFWFVTPPAVGPDVPYTFGLIGDLGQTYDSNRTLT  178



>gb|KHG11060.1| Purple acid phosphatase 2 [Gossypium arboreum]
Length=467

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 117/157 (75%), Gaps = 8/157 (5%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +T ++VR   S        DMPLDSDVF+VP G NAPQQVHITQGD +G GVIISW T  
Sbjct  29   ITGNFVRKKYSP-------DMPLDSDVFQVPSGYNAPQQVHITQGDMDGSGVIISWITPD  81

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GS  V+YW ENS  K  + G  V YK++NYTS YIHHCTI +LE++TKY Y++G G +
Sbjct  82   EPGSNMVYYWPENSNHKNKAEGIFVRYKFFNYTSGYIHHCTINNLEYNTKYIYEIGRGDS  141

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWFVTPP+ GPDVPYTFGLIGDLGQT+DSN TLT
Sbjct  142  IRQFWFVTPPRIGPDVPYTFGLIGDLGQTHDSNVTLT  178



>gb|KHG20719.1| Purple acid phosphatase 2 [Gossypium arboreum]
Length=467

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 119/157 (76%), Gaps = 8/157 (5%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +T +++R   S        DMPLDSDVF+VP G NAPQQVHITQGD +G+GVIISW T  
Sbjct  29   ITGNFLRKEYSP-------DMPLDSDVFQVPPGYNAPQQVHITQGDTDGRGVIISWITPD  81

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GS  V YW+ENS+ K  + G  V YK++NYTS YIHHCTIK+LE++TKY Y++G G+ 
Sbjct  82   EPGSDTVLYWSENSKNKNRAEGIFVRYKFFNYTSGYIHHCTIKNLEYNTKYMYEIGIGYT  141

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF TPP+ GPDVPYTFGLIGDLGQT+DSN TLT
Sbjct  142  IRRFWFKTPPRTGPDVPYTFGLIGDLGQTHDSNVTLT  178



>gb|AGL44395.1| calcineurin-like phosphoesterase [Manihot esculenta]
Length=533

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 114/157 (73%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TSSYVRN  ++       DMPLDSDVF VP G NAPQQVHITQGDYEG  VIISW T  
Sbjct  87   LTSSYVRNDEASE------DMPLDSDVFAVPPGYNAPQQVHITQGDYEGNSVIISWVTPD  140

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GS  V YW +NS  +  +    V YKYYNYTS YIHHC IK+LE DTKY Y +G G+ 
Sbjct  141  EPGSDEVLYWPDNSGLRIIAKSFHVRYKYYNYTSGYIHHCPIKNLEFDTKYNYVVGIGNT  200

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF TPPK GPDVPYTFGLIGDLGQTYDSN TLT
Sbjct  201  TRQFWFTTPPKSGPDVPYTFGLIGDLGQTYDSNRTLT  237



>gb|AAD20634.1| purple acid phosphatase precursor [Anchusa officinalis]
Length=470

 Score =   197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 117/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            +TS +VR   +A+      DMPL+SDVFRVP G NAPQQVHITQGD EG+ +IISW    
Sbjct  30   ITSRFVRKLAAAT------DMPLNSDVFRVPPGYNAPQQVHITQGDLEGEAMIISWVRMD  83

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V YW + S  K  + G +  YKYYNYTS +IHHCTI+ L+H+TKY+Y++G GH 
Sbjct  84   EPGSSKVLYWIDGSNQKHSANGKITKYKYYNYTSGFIHHCTIRRLKHNTKYHYEVGIGHT  143

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF+TPP+ GPDVPYTFGLIGDLGQ+YDSN+TLT
Sbjct  144  VRSFWFMTPPEVGPDVPYTFGLIGDLGQSYDSNSTLT  180



>ref|XP_009140743.1| PREDICTED: fe(3+)-Zn(2+) purple acid phosphatase 12-like [Brassica 
rapa]
Length=526

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 107/138 (78%), Gaps = 1/138 (1%)
 Frame = -2

Query  412  DMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HKHGSKAVHYWAENSRAKRF  236
            DMPLDSDVF+VP G N PQQVHITQG++EG GVIISW T     S  V YW+EN + K+ 
Sbjct  94   DMPLDSDVFKVPPGPNTPQQVHITQGNHEGNGVIISWVTPSAPCSNTVRYWSENGKLKKL  153

Query  235  SVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPYT  56
            +   + TY+++NYTS YIHHC I DLE D KYYY++GS   +R FWF TPPKPGPDVPYT
Sbjct  154  AEATINTYRFFNYTSGYIHHCLIDDLEFDMKYYYEIGSWKWRRRFWFFTPPKPGPDVPYT  213

Query  55   FGLIGDLGQTYDSNTTLT  2
            FGLIGDLGQTYDSN TL+
Sbjct  214  FGLIGDLGQTYDSNRTLS  231



>gb|EPS60425.1| hypothetical protein M569_14376, partial [Genlisea aurea]
Length=454

 Score =   196 bits (498),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 115/156 (74%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TSS+ R   S  P+   VDMP+DSDVF VP G NAPQQVHITQGD++G+ VI+SWTT  +
Sbjct  22   TSSFTR---SQEPS---VDMPIDSDVFAVPRGYNAPQQVHITQGDHDGRAVIVSWTTVDE  75

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YWA  S  K+ + G +  YKYYNYTS +IHH TIK LE+DTKYYYK+G  H  
Sbjct  76   PGSVVVEYWAATSEVKKHAEGLITKYKYYNYTSGFIHHATIKGLEYDTKYYYKIGLDHTP  135

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWFVTPP   PD PYTFGLIGDLGQTYDSN TLT
Sbjct  136  RTFWFVTPPPVSPDEPYTFGLIGDLGQTYDSNRTLT  171



>ref|XP_010107842.1| Purple acid phosphatase 2 [Morus notabilis]
 gb|EXC17242.1| Purple acid phosphatase 2 [Morus notabilis]
Length=470

 Score =   196 bits (499),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 118/157 (75%), Gaps = 8/157 (5%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TS++VR     +      DMPLDSDVF+VPHG NAPQQVHITQGD  GK VI+SW T  +
Sbjct  31   TSTFVRKVEKTN------DMPLDSDVFQVPHGYNAPQQVHITQGDQVGKAVIVSWVTVEE  84

Query  289  HGSKAVHYWAE-NSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
             GS  V YW+E + + K+ + G   TYK+YNYTS YIHHCTI++LE +TKYYY +G GH 
Sbjct  85   PGSSKVLYWSEWHRKQKKVAEGKFTTYKFYNYTSGYIHHCTIRNLEFNTKYYYVVGVGHT  144

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R FWF TPP+ GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  145  ERKFWFTTPPEVGPDVPYTFGLIGDLGQSFDSNRTLT  181



>ref|NP_001242830.1| uncharacterized protein LOC100815854 precursor [Glycine max]
 gb|ACU18684.1| unknown [Glycine max]
Length=460

 Score =   196 bits (498),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 112/139 (81%), Gaps = 1/139 (1%)
 Frame = -2

Query  415  VDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHKH-GSKAVHYWAENSRAKR  239
            VDMPLDSDVF VP G NAPQQVHITQGD  GK VI+SW T    GS  VHYW+ENS  K+
Sbjct  36   VDMPLDSDVFAVPPGYNAPQQVHITQGDLVGKAVIVSWVTADEPGSSEVHYWSENSDKKK  95

Query  238  FSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPY  59
             + G +VTY+++NY+S +IHH TI++LE+ TKYYY++G G+  R FWFVTPP+ GPDVPY
Sbjct  96   IAEGKLVTYRFFNYSSGFIHHTTIRNLEYKTKYYYEVGLGNTTRQFWFVTPPEIGPDVPY  155

Query  58   TFGLIGDLGQTYDSNTTLT  2
            TFGLIGDLGQ++DSN TL+
Sbjct  156  TFGLIGDLGQSFDSNKTLS  174



>gb|KHN11683.1| Purple acid phosphatase [Glycine soja]
Length=464

 Score =   196 bits (498),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 113/139 (81%), Gaps = 1/139 (1%)
 Frame = -2

Query  415  VDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HKHGSKAVHYWAENSRAKR  239
            VDMPLDSDVF VP G NAPQQVHITQGD  GK VI+SW T  + GS  VHYW+ENS  K+
Sbjct  36   VDMPLDSDVFAVPPGYNAPQQVHITQGDLVGKAVIVSWVTVDEPGSSEVHYWSENSDKKK  95

Query  238  FSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPY  59
             + G +VTY+++NY+S +IHH TI++LE+ TKYYY++G G+  R FWFVTPP+ GPDVPY
Sbjct  96   IAEGKLVTYRFFNYSSGFIHHTTIRNLEYKTKYYYEVGLGNTTRQFWFVTPPEIGPDVPY  155

Query  58   TFGLIGDLGQTYDSNTTLT  2
            TFGLIGDLGQ++DSN TL+
Sbjct  156  TFGLIGDLGQSFDSNKTLS  174



>ref|XP_006586710.1| PREDICTED: uncharacterized protein LOC100815854 isoform X1 [Glycine 
max]
Length=464

 Score =   196 bits (497),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 113/139 (81%), Gaps = 1/139 (1%)
 Frame = -2

Query  415  VDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HKHGSKAVHYWAENSRAKR  239
            VDMPLDSDVF VP G NAPQQVHITQGD  GK VI+SW T  + GS  VHYW+ENS  K+
Sbjct  36   VDMPLDSDVFAVPPGYNAPQQVHITQGDLVGKAVIVSWVTVDEPGSSEVHYWSENSDKKK  95

Query  238  FSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPY  59
             + G +VTY+++NY+S +IHH TI++LE+ TKYYY++G G+  R FWFVTPP+ GPDVPY
Sbjct  96   IAEGKLVTYRFFNYSSGFIHHTTIRNLEYKTKYYYEVGLGNTTRQFWFVTPPEIGPDVPY  155

Query  58   TFGLIGDLGQTYDSNTTLT  2
            TFGLIGDLGQ++DSN TL+
Sbjct  156  TFGLIGDLGQSFDSNKTLS  174



>ref|XP_010690819.1| PREDICTED: purple acid phosphatase 2-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=472

 Score =   196 bits (498),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 121/159 (76%), Gaps = 10/159 (6%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTH-K  290
            +SS+VR         + VDMPLDSDVFR P G NAPQQVHITQGD+EGKGVI+SW T   
Sbjct  33   SSSFVRKV------EKSVDMPLDSDVFRPPPGHNAPQQVHITQGDHEGKGVIVSWVTPIS  86

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS +V YW+ +S+ K  + G V  YKYYNYTS YIHHCTI++LE++TKYYYK+G+G   
Sbjct  87   PGSSSVVYWSGSSKHKYKAKGIVTKYKYYNYTSGYIHHCTIRNLEYNTKYYYKVGTGKYA  146

Query  109  RVFWFVTPPKPGPDVPYTFGLI---GDLGQTYDSNTTLT  2
            R FWFVTPP+ GPDVPYTFG+I   GDLGQT+DSN TLT
Sbjct  147  RTFWFVTPPEVGPDVPYTFGVIDFAGDLGQTFDSNKTLT  185



>ref|XP_009762746.1| PREDICTED: purple acid phosphatase 2-like [Nicotiana sylvestris]
Length=490

 Score =   196 bits (499),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 116/157 (74%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            +TSS+VR         + +DMP+DSDVF VP G NAPQQVHITQGD+ GK +I+SW T  
Sbjct  51   ITSSFVRKV------EKTIDMPMDSDVFSVPPGYNAPQQVHITQGDHVGKAMIVSWVTMD  104

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V YW+ NS+ K  + G V TY++YNYTS YIHHC IK L+ +TKYYY++G  H 
Sbjct  105  EPGSSTVLYWSNNSKQKNKAKGTVTTYRFYNYTSGYIHHCIIKHLKFNTKYYYEVGISHN  164

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWFVTPP+ GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  165  PRTFWFVTPPQVGPDVPYTFGLIGDLGQSFDSNRTLT  201



>ref|XP_010549271.1| PREDICTED: fe(3+)-Zn(2+) purple acid phosphatase 12 [Tarenaya 
hassleriana]
Length=471

 Score =   196 bits (498),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 107/141 (76%), Gaps = 4/141 (3%)
 Frame = -2

Query  412  DMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HKHGSKAVHYWAEN---SRA  245
            DMP  SDVF +P G N+PQQVHITQG YEG GVIISW T  + GS  V YW+EN   SR 
Sbjct  42   DMPSHSDVFSLPSGYNSPQQVHITQGSYEGDGVIISWVTPDETGSDIVRYWSENGGRSRR  101

Query  244  KRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDV  65
            K      VVTYK++NYTS YIHHCTI  LE DTKYYY++G G  +R FWFVTPPKPGPDV
Sbjct  102  KLAKSAVVVTYKFFNYTSGYIHHCTIDGLEFDTKYYYEIGDGETRRQFWFVTPPKPGPDV  161

Query  64   PYTFGLIGDLGQTYDSNTTLT  2
            PY FGLIGDLGQTYDSN TL+
Sbjct  162  PYIFGLIGDLGQTYDSNRTLS  182



>sp|Q09131.2|PPAF_SOYBN RecName: Full=Purple acid phosphatase; AltName: Full=Zinc(II) 
purple acid phosphatase; Flags: Precursor [Glycine max]
 gb|AAF19820.1|AF200824_1 purple acid phosphatase precursor [Glycine max]
Length=464

 Score =   196 bits (497),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 113/139 (81%), Gaps = 1/139 (1%)
 Frame = -2

Query  415  VDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HKHGSKAVHYWAENSRAKR  239
            VDMPLDSDVF VP G NAPQQVHITQGD  GK VI+SW T  + GS  VHYW+ENS  K+
Sbjct  36   VDMPLDSDVFAVPPGYNAPQQVHITQGDLVGKAVIVSWVTVDEPGSSEVHYWSENSDKKK  95

Query  238  FSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPY  59
             + G +VTY+++NY+S +IHH TI++LE+ TKYYY++G G+  R FWFVTPP+ GPDVPY
Sbjct  96   IAEGKLVTYRFFNYSSGFIHHTTIRNLEYKTKYYYEVGLGNTTRQFWFVTPPEIGPDVPY  155

Query  58   TFGLIGDLGQTYDSNTTLT  2
            TFGLIGDLGQ++DSN TL+
Sbjct  156  TFGLIGDLGQSFDSNKTLS  174



>gb|AFH08750.1| purple acid phosphatase 14 [Glycine max]
Length=464

 Score =   196 bits (497),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 113/139 (81%), Gaps = 1/139 (1%)
 Frame = -2

Query  415  VDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HKHGSKAVHYWAENSRAKR  239
            VDMPLDSDVF VP G NAPQQVHITQGD  GK VI+SW T  + GS  VHYW+ENS  K+
Sbjct  36   VDMPLDSDVFAVPPGYNAPQQVHITQGDLVGKAVIVSWVTVDEPGSSEVHYWSENSDKKK  95

Query  238  FSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPY  59
             + G +VTY+++NY+S +IHH TI++LE+ TKYYY++G G+  R FWFVTPP+ GPDVPY
Sbjct  96   IAEGKLVTYRFFNYSSGFIHHTTIRNLEYKTKYYYEVGLGNTTRQFWFVTPPEIGPDVPY  155

Query  58   TFGLIGDLGQTYDSNTTLT  2
            TFGLIGDLGQ++DSN TL+
Sbjct  156  TFGLIGDLGQSFDSNKTLS  174



>emb|CDX89726.1| BnaC03g46400D [Brassica napus]
Length=466

 Score =   196 bits (497),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 115/157 (73%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            +TS +VR         + +DMPL SDVFRV  G NAPQQVHITQGD EGK VI+SW T +
Sbjct  27   ITSKFVRKV------EKSIDMPLHSDVFRVHPGHNAPQQVHITQGDVEGKAVIVSWVTQE  80

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V YW E+S  K  + G   TYK+YNYTS YIHHCTI++LE+D+KYYY +G G  
Sbjct  81   APGSNTVLYWKEHSSKKHKAHGTTNTYKFYNYTSGYIHHCTIRNLEYDSKYYYVVGVGQT  140

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R FWF TPPK GPDVPYTFGLIGDLGQT+DSN TLT
Sbjct  141  ERKFWFFTPPKVGPDVPYTFGLIGDLGQTFDSNITLT  177



>ref|XP_008236961.1| PREDICTED: purple acid phosphatase-like [Prunus mume]
Length=476

 Score =   196 bits (497),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 119/156 (76%), Gaps = 8/156 (5%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TSS+VR    A      VDMPLDSDVF+VP G NAPQQVHITQGD  GK +I+SW T  +
Sbjct  38   TSSFVRKVEKA------VDMPLDSDVFKVPPGYNAPQQVHITQGDQLGKALIVSWVTVEE  91

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS AV YW+  S+ ++ S G V TYK+YNYTS YIHH TI++L+ +TKYYY +G GH +
Sbjct  92   PGSNAVLYWSAYSKKQK-SEGKVTTYKFYNYTSGYIHHTTIRNLKFNTKYYYVVGIGHTE  150

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF+TPP+ GPDVPYTFGLIGDLGQT+DSN TLT
Sbjct  151  RQFWFITPPEVGPDVPYTFGLIGDLGQTFDSNATLT  186



>ref|XP_010690822.1| PREDICTED: purple acid phosphatase 2 [Beta vulgaris subsp. vulgaris]
Length=474

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 115/156 (74%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TS +VR         + +DM LDSDVF VP G NAPQQVHITQGD +G+ +I+SW T  +
Sbjct  36   TSKFVRKV------EKTIDMSLDSDVFSVPSGYNAPQQVHITQGDQKGRAMIVSWVTMEE  89

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW ENS+ KR + G +  YKY++YTS YIHHCTIK+LE+DTKYYY++G G   
Sbjct  90   RGSDEVVYWKENSKEKRSAKGKMSKYKYHDYTSGYIHHCTIKNLEYDTKYYYEVGVGQTP  149

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF TPPK GPDV YTFGLIGDLGQ+YDSN TLT
Sbjct  150  RTFWFKTPPKVGPDVRYTFGLIGDLGQSYDSNATLT  185



>gb|KEH16424.1| purple acid phosphatase superfamily protein [Medicago truncatula]
Length=471

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 113/141 (80%), Gaps = 1/141 (1%)
 Frame = -2

Query  421  EDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHKH-GSKAVHYWAENSRA  245
            + +DMPLDSDVFRVP G NAPQQVHITQGD+ GK VI+SW T    GS AV YW+ENS+ 
Sbjct  41   KSIDMPLDSDVFRVPPGYNAPQQVHITQGDHVGKAVIVSWVTEDEPGSDAVRYWSENSKH  100

Query  244  KRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDV  65
            K+ + G + TY+Y+NY+S +IHH TI++L+++TKYYY++G  +  R FWF TPP  GPDV
Sbjct  101  KKLAKGKIETYRYFNYSSGFIHHVTIRNLKYNTKYYYEVGLRNTTRQFWFTTPPAIGPDV  160

Query  64   PYTFGLIGDLGQTYDSNTTLT  2
            PYTFGLIGDLGQT+DSN TL+
Sbjct  161  PYTFGLIGDLGQTFDSNRTLS  181



>ref|NP_001240926.1| uncharacterized protein LOC100807555 precursor [Glycine max]
 gb|ADM32496.1| phytase [Glycine max]
 gb|KHN32421.1| Purple acid phosphatase [Glycine soja]
Length=464

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 112/139 (81%), Gaps = 1/139 (1%)
 Frame = -2

Query  415  VDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HKHGSKAVHYWAENSRAKR  239
            VDMPLDSDVF +P G NAPQQVHITQGD  GK VI+SW T  + GS  V YW+ENS  K+
Sbjct  36   VDMPLDSDVFAIPPGYNAPQQVHITQGDLVGKAVIVSWVTVDEPGSSEVRYWSENSDQKK  95

Query  238  FSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPY  59
               G +VTY+++NYTS +IHH TI++LE++TKYYY++G G+  R FWFVTPP+ GPDVPY
Sbjct  96   IVEGKLVTYRFFNYTSGFIHHTTIRNLEYNTKYYYEVGLGNTTRQFWFVTPPEIGPDVPY  155

Query  58   TFGLIGDLGQTYDSNTTLT  2
            TFGLIGDLGQ++DSN TL+
Sbjct  156  TFGLIGDLGQSFDSNKTLS  174



>ref|XP_008796614.1| PREDICTED: purple acid phosphatase 2-like [Phoenix dactylifera]
Length=469

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 114/157 (73%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            VTSS+VR +       + VDMPLDSDVFRVP G NAPQQVHITQGD +G  V +SW T  
Sbjct  31   VTSSFVRKT------GKTVDMPLDSDVFRVPSGDNAPQQVHITQGDRDGTAVTVSWVTCD  84

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V Y    ++ + F+ G    YK+YNYTS YIHHCT+++L+HDTKYYY LG GH 
Sbjct  85   EPGSSTVLYGTTKNKIEFFAEGKYTRYKFYNYTSGYIHHCTLRNLKHDTKYYYALGIGHT  144

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF TPPK GPDVPYTFGLIGDLGQT+DSN TL+
Sbjct  145  LRQFWFRTPPKVGPDVPYTFGLIGDLGQTFDSNRTLS  181



>gb|KHG24062.1| Purple acid phosphatase 2 [Gossypium arboreum]
Length=933

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 116/156 (74%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHKH  287
            TS YVR         + VDMPL SDVF+ P G NAPQQVHITQGD+ GK VI+SW T   
Sbjct  31   TSIYVRKE------EKTVDMPLHSDVFQAPLGYNAPQQVHITQGDHVGKAVIVSWVTQDE  84

Query  286  -GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW+E S+ K  +VG + TYKYYNYTS +IHHCT+K+LE++TKYYY +G G + 
Sbjct  85   PGSNTVVYWSEGSKEKMKAVGKISTYKYYNYTSGFIHHCTVKNLEYNTKYYYVVGEGASM  144

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF TPP+ GPDVPYTFGLIGDLGQT+DSN TLT
Sbjct  145  RKFWFTTPPEVGPDVPYTFGLIGDLGQTFDSNVTLT  180


 Score =   192 bits (489),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 108/138 (78%), Gaps = 1/138 (1%)
 Frame = -2

Query  412  DMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHKH-GSKAVHYWAENSRAKRF  236
            DMPL SDVFR P G NAPQQVHITQGD+ GK VI+SW T    GS  V YW+ENS  KR 
Sbjct  508  DMPLHSDVFRAPSGYNAPQQVHITQGDHVGKAVIVSWVTQDEPGSNTVVYWSENSNEKRK  567

Query  235  SVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPYT  56
            + G V TYK++NYTS YIHHC I++LE++TKYYY +G+G + R FWF TPP+ GPD PYT
Sbjct  568  AEGKVKTYKFHNYTSGYIHHCIIRNLEYNTKYYYMVGNGDSIRKFWFTTPPRAGPDAPYT  627

Query  55   FGLIGDLGQTYDSNTTLT  2
            FG+IGDLGQT+DSN+T+ 
Sbjct  628  FGIIGDLGQTFDSNSTVA  645



>gb|KHG24063.1| Purple acid phosphatase 2 [Gossypium arboreum]
Length=910

 Score =   198 bits (504),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 116/156 (74%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHKH  287
            TS YVR         + VDMPL SDVF+ P G NAPQQVHITQGD+ GK VI+SW T   
Sbjct  31   TSIYVRKE------EKTVDMPLHSDVFQAPLGYNAPQQVHITQGDHVGKAVIVSWVTQDE  84

Query  286  -GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW+E S+ K  +VG + TYKYYNYTS +IHHCT+K+LE++TKYYY +G G + 
Sbjct  85   PGSNTVVYWSEGSKEKMKAVGKISTYKYYNYTSGFIHHCTVKNLEYNTKYYYVVGEGASM  144

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF TPP+ GPDVPYTFGLIGDLGQT+DSN TLT
Sbjct  145  RKFWFTTPPEVGPDVPYTFGLIGDLGQTFDSNVTLT  180


 Score =   192 bits (488),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 108/138 (78%), Gaps = 1/138 (1%)
 Frame = -2

Query  412  DMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHKH-GSKAVHYWAENSRAKRF  236
            DMPL SDVFR P G NAPQQVHITQGD+ GK VI+SW T    GS  V YW+ENS  KR 
Sbjct  485  DMPLHSDVFRAPSGYNAPQQVHITQGDHVGKAVIVSWVTQDEPGSNTVVYWSENSNEKRK  544

Query  235  SVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPYT  56
            + G V TYK++NYTS YIHHC I++LE++TKYYY +G+G + R FWF TPP+ GPD PYT
Sbjct  545  AEGKVKTYKFHNYTSGYIHHCIIRNLEYNTKYYYMVGNGDSIRKFWFTTPPRAGPDAPYT  604

Query  55   FGLIGDLGQTYDSNTTLT  2
            FG+IGDLGQT+DSN+T+ 
Sbjct  605  FGIIGDLGQTFDSNSTVA  622



>ref|XP_010473111.1| PREDICTED: fe(3+)-Zn(2+) purple acid phosphatase 12-like [Camelina 
sativa]
Length=471

 Score =   193 bits (491),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 117/156 (75%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTH-K  290
            TS YVR     +  P+D  MPLDSDVF VP G N PQQVHITQG++EG GVIISW T  K
Sbjct  33   TSEYVR----GTDLPDD--MPLDSDVFAVPPGPNTPQQVHITQGNHEGNGVIISWVTPVK  86

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW E  ++K+ +   V TY+++NYTS YIHHC I DLE DTKYYY++GSG  +
Sbjct  87   PGSNTVRYWCEKEKSKKEAEATVNTYRFFNYTSGYIHHCLIDDLEFDTKYYYEIGSGKWR  146

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF TPPK GPDVPYTFGLIGDLGQTYDSNTTL+
Sbjct  147  RRFWFFTPPKSGPDVPYTFGLIGDLGQTYDSNTTLS  182



>ref|XP_008236963.1| PREDICTED: purple acid phosphatase 2-like isoform X1 [Prunus 
mume]
Length=477

 Score =   193 bits (491),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 121/157 (77%), Gaps = 8/157 (5%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TS +VR +       + VDMP +SD F+VPHG NAPQQVHITQGD++GK +I+SW T  
Sbjct  38   ITSPFVRKA------EKTVDMPYESDAFQVPHGYNAPQQVHITQGDHKGKAMIVSWVTVD  91

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GS  V +W+E  + KR + G   TY Y++YTS YIHHCTI++LE++TKYYY +G GH 
Sbjct  92   EKGSSKVLFWSEGQK-KRMAEGKAKTYTYHDYTSGYIHHCTIRNLEYNTKYYYVVGIGHT  150

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R+FWFVTPP+ GPDV YTFGL+GDLGQT+DSN+TLT
Sbjct  151  ERLFWFVTPPEVGPDVTYTFGLMGDLGQTFDSNSTLT  187



>ref|XP_008236964.1| PREDICTED: purple acid phosphatase 2-like isoform X2 [Prunus 
mume]
Length=463

 Score =   192 bits (489),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 121/157 (77%), Gaps = 8/157 (5%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TS +VR +       + VDMP +SD F+VPHG NAPQQVHITQGD++GK +I+SW T  
Sbjct  24   ITSPFVRKA------EKTVDMPYESDAFQVPHGYNAPQQVHITQGDHKGKAMIVSWVTVD  77

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GS  V +W+E  + KR + G   TY Y++YTS YIHHCTI++LE++TKYYY +G GH 
Sbjct  78   EKGSSKVLFWSEGQK-KRMAEGKAKTYTYHDYTSGYIHHCTIRNLEYNTKYYYVVGIGHT  136

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R+FWFVTPP+ GPDV YTFGL+GDLGQT+DSN+TLT
Sbjct  137  ERLFWFVTPPEVGPDVTYTFGLMGDLGQTFDSNSTLT  173



>ref|XP_009398390.1| PREDICTED: purple acid phosphatase 2-like [Musa acuminata subsp. 
malaccensis]
Length=466

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 117/157 (75%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            VTSS+VRN+  A      +DMP+DSDVFRVP G NAPQQVHITQG+++G  +I+SW T  
Sbjct  30   VTSSFVRNAKKA------IDMPIDSDVFRVPPGYNAPQQVHITQGNHDGSAMIVSWVTEA  83

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V Y  ++++    + G    Y++YNYTS YIHHCTI+ L+HDTKYYY +G GH 
Sbjct  84   EPGSSKVLYGTDSNKLIFSAEGKHTRYEFYNYTSGYIHHCTIRKLKHDTKYYYAVGIGHT  143

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF TPPK GPDVPYTFGLIGDLGQ+YDSN+TLT
Sbjct  144  VRKFWFTTPPKVGPDVPYTFGLIGDLGQSYDSNSTLT  180



>ref|XP_004506328.1| PREDICTED: purple acid phosphatase-like [Cicer arietinum]
Length=473

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 117/156 (75%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHKH  287
            TSS++R         + +DMPLDSDVF VP G NAPQQVHITQGD  GK VI+SW T   
Sbjct  34   TSSFLRQV------EKTMDMPLDSDVFDVPQGYNAPQQVHITQGDLVGKAVIVSWVTEDE  87

Query  286  -GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS AV YW+ENS  K+ + G + TY+++NYTS +IHH TI+ L+++TKYYY++G  +  
Sbjct  88   PGSNAVRYWSENSHRKKLAKGKIQTYRFFNYTSGFIHHATIRKLKYNTKYYYEVGLENTT  147

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF+TPP+ GPDVPYTFGLIGDLGQ++DSN TL+
Sbjct  148  RQFWFITPPEIGPDVPYTFGLIGDLGQSFDSNKTLS  183



>ref|XP_007199139.1| hypothetical protein PRUPE_ppa019514mg [Prunus persica]
 gb|EMJ00338.1| hypothetical protein PRUPE_ppa019514mg [Prunus persica]
Length=474

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 119/156 (76%), Gaps = 8/156 (5%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TS +VR +       + VDMP +SD F+VPHG NAPQQVHITQGD++GK +I+SW T  +
Sbjct  36   TSPFVRKA------EKTVDMPYESDAFQVPHGYNAPQQVHITQGDHKGKAMIVSWVTVDE  89

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V +W+E  + KR + G   TY Y++YTS YIHHCTI++LE++TKYYY +G GH  
Sbjct  90   KGSSKVLFWSEGQK-KRMAEGKAKTYTYHDYTSGYIHHCTIRNLEYNTKYYYVVGIGHTV  148

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R+FWFVTPP+ GPDVPYTFGL+GDLGQT+DSN TLT
Sbjct  149  RLFWFVTPPEVGPDVPYTFGLMGDLGQTFDSNLTLT  184



>ref|XP_007201003.1| hypothetical protein PRUPE_ppa005275mg [Prunus persica]
 gb|EMJ02202.1| hypothetical protein PRUPE_ppa005275mg [Prunus persica]
Length=469

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 118/156 (76%), Gaps = 8/156 (5%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TSS+VR         + VDMPLDSDVF+VP G NAPQQVHITQGD  GK VI+SW T  +
Sbjct  33   TSSFVRKV------EKTVDMPLDSDVFKVPPGYNAPQQVHITQGDQLGKAVIVSWVTVEE  86

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW+  S+ ++ S G V TYK+YNYTS YIHH TI++L+ +TKYYY +G GH +
Sbjct  87   PGSNTVLYWSAYSKKQK-SEGKVTTYKFYNYTSGYIHHTTIRNLKFNTKYYYVVGIGHTE  145

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF+TPP+ GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  146  RQFWFITPPEVGPDVPYTFGLIGDLGQSFDSNKTLT  181



>ref|XP_008793996.1| PREDICTED: purple acid phosphatase 2-like [Phoenix dactylifera]
Length=471

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 119/157 (76%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            VTSS+VR +       + VDMPLDSDVFRVP G NAPQQVHITQGD +G  +I+SW T  
Sbjct  33   VTSSFVRKT------EKTVDMPLDSDVFRVPPGYNAPQQVHITQGDQDGAAIIVSWVTQD  86

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS AV Y  + ++ + ++ G    YK+YNYTS YIHHCTI++L+HDTKYYY +G G+ 
Sbjct  87   EPGSSAVLYGTDKNKLEFYAEGKYTRYKFYNYTSGYIHHCTIRNLKHDTKYYYAVGIGNK  146

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R F+F+TPPK GPDVPYTFGLIGDLGQ++DSN+TL+
Sbjct  147  LRQFYFMTPPKVGPDVPYTFGLIGDLGQSFDSNSTLS  183



>gb|AFK42558.1| unknown [Lotus japonicus]
Length=173

 Score =   183 bits (464),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 112/146 (77%), Gaps = 7/146 (5%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TS++VR         + VDMP DSDVF VP G NAPQQVHITQGD EGK +I+SW T  +
Sbjct  34   TSTFVRKV------EKTVDMPFDSDVFAVPPGYNAPQQVHITQGDLEGKALIVSWVTVDE  87

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  VHYW+E+S+ K+ + G VVTY+++NYTS +IHH TI+ L+H+TKY+Y++G G+  
Sbjct  88   PGSSEVHYWSEHSKEKKKADGKVVTYRFFNYTSGFIHHTTIRQLKHNTKYHYEIGIGNTT  147

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLG  32
            R FWF+TPP+ GPDVPYTFGLIGDLG
Sbjct  148  RQFWFITPPEVGPDVPYTFGLIGDLG  173



>ref|XP_008236957.1| PREDICTED: purple acid phosphatase-like [Prunus mume]
Length=469

 Score =   191 bits (485),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 118/156 (76%), Gaps = 8/156 (5%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TSS+VR         + VDMPLDSDVF+VP G NAPQQVHITQGD  GK +I+SW T  +
Sbjct  33   TSSFVRKV------EKTVDMPLDSDVFKVPPGYNAPQQVHITQGDQLGKALIVSWVTVEE  86

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW+  S+ ++ S G V TYK+YNYTS YIHH TI++L+ +TKYYY +G GH +
Sbjct  87   PGSNTVLYWSAYSKKQK-SEGKVTTYKFYNYTSGYIHHTTIRNLKFNTKYYYVVGIGHTE  145

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF+TPP+ GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  146  RQFWFITPPEVGPDVPYTFGLIGDLGQSFDSNKTLT  181



>ref|XP_004292019.1| PREDICTED: purple acid phosphatase 2-like [Fragaria vesca subsp. 
vesca]
Length=621

 Score =   193 bits (490),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 115/156 (74%), Gaps = 8/156 (5%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TS++VR           +DMPLDSDVF+VP G NAPQQVHITQGD  GKGVI+SW T  +
Sbjct  186  TSTFVRQI------DRGLDMPLDSDVFKVPPGYNAPQQVHITQGDRHGKGVIVSWVTVDE  239

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW+ N +  + + G V TY +YNYTS YIHH TIK L+ +TKYYY +G GH +
Sbjct  240  PGSSTVLYWSANGKQMK-AEGKVKTYNFYNYTSGYIHHTTIKKLKFNTKYYYVVGIGHTE  298

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWFVTPPK GPDVPYTFGLIGDLGQT+DSN TLT
Sbjct  299  RQFWFVTPPKVGPDVPYTFGLIGDLGQTFDSNKTLT  334



>gb|KHG15250.1| Purple acid phosphatase 2 [Gossypium arboreum]
Length=467

 Score =   190 bits (483),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 118/156 (76%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHKH  287
            TS+YVR         + VDMPLDSDVFRVP G NAPQQVHITQGD+ GK VI+SW T   
Sbjct  30   TSTYVRKV------EKTVDMPLDSDVFRVPPGYNAPQQVHITQGDHVGKAVIVSWVTEDE  83

Query  286  -GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW+ENS+ K+ + G   TY+++NYTS +IHHCTI+++E++TKYYY +G  H  
Sbjct  84   PGSSTVVYWSENSKEKKKAKGKFNTYRFFNYTSGFIHHCTIRNMEYNTKYYYVVGVDHTM  143

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF TPP+ GP+VPYTFGLIGDLGQ++DSN TLT
Sbjct  144  RKFWFTTPPEVGPNVPYTFGLIGDLGQSFDSNRTLT  179



>gb|KEH44359.1| purple acid phosphatase superfamily protein [Medicago truncatula]
Length=467

 Score =   190 bits (482),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 120/157 (76%), Gaps = 8/157 (5%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHKH  287
            TS++VRN          V+M LDSDVF VP G NAPQQVHITQGD  GK VI+SW T   
Sbjct  27   TSAFVRNVQKG------VNMSLDSDVFAVPSGYNAPQQVHITQGDLVGKEVIVSWVTEDE  80

Query  286  -GSKAVHYWA-ENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
             GS AV YW+ +NS+ K+ + G +VTY+++NY+S +IHH TI++LE++TKYYY++G G+ 
Sbjct  81   PGSIAVRYWSTDNSKQKKLAKGKIVTYRFFNYSSGFIHHTTIRNLEYNTKYYYEVGLGNT  140

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF+TPP+ GPDVPYTFGLIGDLGQ++DSN TL+
Sbjct  141  TRQFWFITPPEIGPDVPYTFGLIGDLGQSFDSNRTLS  177



>dbj|BAA92365.1| purple acid phosphatase [Spirodela punctata]
Length=455

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 114/157 (73%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TS +VR   SA      VDMPL +DVFR+P G NAPQQVHITQGD+EG+ +I+SW T  
Sbjct  22   ITSEFVRLQESA------VDMPLHADVFRMPPGYNAPQQVHITQGDHEGRSIIVSWITPS  75

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GS  V Y    ++  + + G V  YK+Y YTS YIHHC + DL++D KY+YK+G G A
Sbjct  76   EKGSSTVFYGTSENKLDQHAEGTVTMYKFYTYTSGYIHHCVLTDLKYDRKYFYKVGEGSA  135

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R+FWF TPP+ GPDVPYTFGLIGDLGQT+DSN TLT
Sbjct  136  ARLFWFKTPPEVGPDVPYTFGLIGDLGQTFDSNVTLT  172



>ref|XP_007131378.1| hypothetical protein PHAVU_011G008700g [Phaseolus vulgaris]
 gb|ESW03372.1| hypothetical protein PHAVU_011G008700g [Phaseolus vulgaris]
Length=464

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 115/151 (76%), Gaps = 1/151 (1%)
 Frame = -2

Query  451  RNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHKH-GSKA  275
            ++SL      + VDMPL SDVF VP G NAPQQVHITQGD  G+G+I+SW T    GS A
Sbjct  24   KSSLFIRKTKKTVDMPLGSDVFSVPRGYNAPQQVHITQGDLVGRGMIVSWVTMDEPGSSA  83

Query  274  VHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWF  95
            V YW   +  K+ + G +VTY+++NY+S +IHH TI++LE++TKYYY++G G+  R FWF
Sbjct  84   VRYWRGKNGKKKTAEGKMVTYRFFNYSSGFIHHATIRNLEYNTKYYYEVGLGNTTRQFWF  143

Query  94   VTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            VTPP+ GPDVPYTFGLIGDLGQ++DSN TL+
Sbjct  144  VTPPEIGPDVPYTFGLIGDLGQSFDSNITLS  174



>ref|XP_008237016.1| PREDICTED: purple acid phosphatase 2-like [Prunus mume]
Length=401

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 110/137 (80%), Gaps = 2/137 (1%)
 Frame = -2

Query  409  MPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HKHGSKAVHYWAENSRAKRFS  233
            MP +SD F+VPHG NAPQQVHITQGD++GK +I+SW T  + GS  V +W+E  + KR +
Sbjct  1    MPYESDAFQVPHGYNAPQQVHITQGDHKGKAMIVSWVTVDEKGSSKVLFWSEGQK-KRMA  59

Query  232  VGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPYTF  53
             G   TY Y++YTS YIHHCTI++LE++TKYYY +G GH  R+FWFVTPP+ GPDVPYTF
Sbjct  60   EGKAKTYTYHDYTSGYIHHCTIRNLEYNTKYYYVVGIGHTVRLFWFVTPPEVGPDVPYTF  119

Query  52   GLIGDLGQTYDSNTTLT  2
            GL+GDLGQT+DSN TLT
Sbjct  120  GLMGDLGQTFDSNLTLT  136



>ref|XP_010933142.1| PREDICTED: purple acid phosphatase-like [Elaeis guineensis]
Length=470

 Score =   189 bits (479),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 114/157 (73%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            VTSS+VR +       + VDMPLDSDVFRVP G NAPQQVHITQGD +G  +I+SW T  
Sbjct  32   VTSSFVRKT------EKTVDMPLDSDVFRVPPGYNAPQQVHITQGDLDGAAIIVSWVTQD  85

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V Y  + ++ + ++ G    YK+YNYTS YIHHCT+  L++DTKYYY +G G  
Sbjct  86   EPGSSTVLYGTDKNKLEFYAEGKYTRYKFYNYTSGYIHHCTLGHLKYDTKYYYAVGIGQT  145

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF+TPPK GPDVPYTFGLIGDLGQ++DSN TL+
Sbjct  146  MRQFWFMTPPKVGPDVPYTFGLIGDLGQSFDSNITLS  182



>ref|XP_010910529.1| PREDICTED: purple acid phosphatase-like [Elaeis guineensis]
Length=470

 Score =   188 bits (478),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 114/157 (73%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            VTSS+VR +       + VDMPLDSDVFRVP G NAPQQVHITQGD +G  +I+SW T  
Sbjct  32   VTSSFVRKT------EKTVDMPLDSDVFRVPPGYNAPQQVHITQGDLDGAAIIVSWVTQD  85

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V Y  + ++ + ++ G    YK+YNYTS YIHHCT+  L++DTKYYY +G G  
Sbjct  86   EPGSSTVLYGTDKNKLEFYAEGKYTRYKFYNYTSGYIHHCTLGHLKYDTKYYYAVGIGQT  145

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF+TPPK GPDVPYTFGLIGDLGQ++DSN TL+
Sbjct  146  MRQFWFMTPPKVGPDVPYTFGLIGDLGQSFDSNITLS  182



>ref|XP_004290282.1| PREDICTED: purple acid phosphatase 2-like [Fragaria vesca subsp. 
vesca]
Length=470

 Score =   187 bits (476),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 116/156 (74%), Gaps = 8/156 (5%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TS++VR         + VDMP DSDVF+ PHG NAPQQVHITQGD  GK VI+SW T  +
Sbjct  33   TSTFVRKV------EKSVDMPFDSDVFKAPHGYNAPQQVHITQGDQLGKAVIVSWVTVDE  86

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW+  S+ K+ +VG   TYKY +Y+S YIHH TI++L+++TKYYY++G GH  
Sbjct  87   PGSSKVIYWSAKSK-KKIAVGKFNTYKYSDYSSPYIHHVTIRNLKYNTKYYYEVGIGHTT  145

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWFVTPP  GPDVPYTFGLIGDLGQT+DSN T+T
Sbjct  146  RKFWFVTPPPVGPDVPYTFGLIGDLGQTFDSNKTVT  181



>ref|XP_007017665.1| Purple acid phosphatase 10 isoform 2 [Theobroma cacao]
 gb|EOY14890.1| Purple acid phosphatase 10 isoform 2 [Theobroma cacao]
Length=342

 Score =   184 bits (466),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 107/143 (75%), Gaps = 7/143 (5%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TSS+VRN   +       DMPLDSDVFR+P G NAPQQVHITQGD+ GKGVI+SW T  +
Sbjct  31   TSSFVRNDQLSH------DMPLDSDVFRIPPGYNAPQQVHITQGDHLGKGVIVSWVTPDE  84

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YWAENS  K  + G V+TYKY+NYTS YIHHCTI +LE DTKYYY++G G+  
Sbjct  85   PGSNLVLYWAENSELKHQAEGIVLTYKYFNYTSGYIHHCTITNLESDTKYYYEVGIGNTS  144

Query  109  RVFWFVTPPKPGPDVPYTFGLIG  41
            R FWF TPP+ GPDVPYTFGLI 
Sbjct  145  REFWFRTPPEVGPDVPYTFGLIA  167



>ref|XP_007199264.1| hypothetical protein PRUPE_ppa022682mg [Prunus persica]
 gb|EMJ00463.1| hypothetical protein PRUPE_ppa022682mg [Prunus persica]
Length=475

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 118/156 (76%), Gaps = 8/156 (5%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISW-TTH  293
            +TS +VR +       + VDMP +SD F+VPHG NAPQQVHITQGD++GK +I+SW T  
Sbjct  36   ITSPFVRKA------EKTVDMPYESDAFQVPHGYNAPQQVHITQGDHKGKAMIVSWVTVD  89

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GS  V +W+E  + KR + G   TY Y++YTS YIHH TI++LE++TKYYY +G GH 
Sbjct  90   EKGSSKVLFWSEGQK-KRMAEGKAKTYTYHDYTSGYIHHSTIRNLEYNTKYYYMVGIGHT  148

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTL  5
            +R+FWFVTPP+ GPDV YTFGL+GDLGQT+DSN TL
Sbjct  149  ERLFWFVTPPEVGPDVTYTFGLMGDLGQTFDSNLTL  184



>ref|XP_008377263.1| PREDICTED: purple acid phosphatase-like [Malus domestica]
Length=470

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 116/156 (74%), Gaps = 8/156 (5%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISW-TTHK  290
            TSS+VR         + +DMPLDSDVF+VP G NAPQQVHITQGD  GK VI+SW T  +
Sbjct  34   TSSFVRKV------EKTMDMPLDSDVFKVPPGYNAPQQVHITQGDQLGKAVIVSWVTVDE  87

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS +V YW+ NS+  + + G + TYK+YNYTS YIHH T+++L  +TKYYY +G GH +
Sbjct  88   PGSSSVLYWSANSKKNK-AEGKITTYKFYNYTSGYIHHTTVRNLMFNTKYYYVIGIGHTE  146

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF+TPP+ GPD  YTFGLIGDLGQ+YDSN TLT
Sbjct  147  RQFWFITPPEVGPDTSYTFGLIGDLGQSYDSNKTLT  182



>gb|AAK51700.1|AF317218_1 secreted acid phosphatase [Lupinus albus]
 gb|AAK58416.1|AF309552_1 orthophosphoric monoester phosphohydrolase precursor [Lupinus 
albus]
Length=460

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 114/156 (73%), Gaps = 6/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TS+YVRN +      + VDMPLDSD F +P G NAPQQVHITQGD  G+ +IISW T  +
Sbjct  24   TSTYVRNLIE-----KPVDMPLDSDAFAIPPGYNAPQQVHITQGDLVGQAMIISWVTVDE  78

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW+++S     + G V TY YYNYTS +IHH TI +LE DT YYY++G G+  
Sbjct  79   PGSNQVIYWSDSSLQNFTAEGEVFTYTYYNYTSGFIHHTTITNLEFDTTYYYEVGIGNTT  138

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF+TPP+ G DVPYTFG+IGDLGQT+DSNTTLT
Sbjct  139  RQFWFITPPEVGLDVPYTFGIIGDLGQTFDSNTTLT  174



>gb|EPS60513.1| hypothetical protein M569_14289, partial [Genlisea aurea]
Length=350

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 103/137 (75%), Gaps = 1/137 (1%)
 Frame = -2

Query  412  DMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HKHGSKAVHYWAENSRAKRF  236
            D+P +SD F+VP G NAPQQVHITQGD+EG+ VI+SW T  + GS +V YW E +  K+ 
Sbjct  31   DLPFESDAFKVPPGYNAPQQVHITQGDHEGRAVIVSWITPSEPGSNSVLYWEEKNLIKKT  90

Query  235  SVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPYT  56
            + G +  YK+Y YTS +IHHC I DL  DTKYYY+LG+G   R FWF TPPKPGPDVPY 
Sbjct  91   ASGIIRRYKFYTYTSGFIHHCNISDLNFDTKYYYELGTGKTTRQFWFRTPPKPGPDVPYA  150

Query  55   FGLIGDLGQTYDSNTTL  5
            FG+IGDLGQT DSN T+
Sbjct  151  FGIIGDLGQTQDSNGTV  167



>dbj|BAA97745.1| secretory acid phosphatase precursor [Lupinus albus]
Length=462

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 114/156 (73%), Gaps = 6/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TS+YVRN +      + VDMPLDSD F +P G NAPQQVHITQGD  G+ +IISW T  +
Sbjct  26   TSTYVRNLIE-----KPVDMPLDSDAFAIPPGYNAPQQVHITQGDLVGQAMIISWVTVDE  80

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW+++S     + G V TY YYNYTS +IHH TI +LE DT YYY++G G+  
Sbjct  81   PGSNQVIYWSDSSLQNFTAEGEVFTYTYYNYTSGFIHHTTITNLEFDTTYYYEVGIGNTT  140

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF+TPP+ G DVPYTFG+IGDLGQT+DSNTTLT
Sbjct  141  RQFWFITPPEVGLDVPYTFGIIGDLGQTFDSNTTLT  176



>ref|NP_001136973.1| uncharacterized protein LOC100217133 precursor [Zea mays]
 gb|ACF82993.1| unknown [Zea mays]
 gb|ACL53769.1| unknown [Zea mays]
 gb|AFW56580.1| purple acid phosphatase [Zea mays]
Length=466

 Score =   186 bits (472),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 113/156 (72%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHKH  287
            TSSY R  L A+     V+MPLD+DVFRVP G NAPQQVHIT GD EG  +I+SW T   
Sbjct  33   TSSY-RRKLEAT-----VEMPLDADVFRVPPGYNAPQQVHITLGDQEGTAMIVSWVTASE  86

Query  286  -GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             G+  V Y  + +R +R + GA   Y Y+NYTS +IHHCT+++L+H TKYYY +G GH  
Sbjct  87   PGNSTVAYGEDPARMERRADGAHTRYDYFNYTSGFIHHCTLRNLKHATKYYYAMGFGHTV  146

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF TPPKPGPDVP+ FGLIGDLGQT+DSN TL+
Sbjct  147  RTFWFTTPPKPGPDVPFKFGLIGDLGQTFDSNITLS  182



>ref|XP_008236959.1| PREDICTED: purple acid phosphatase-like [Prunus mume]
Length=471

 Score =   186 bits (472),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 116/156 (74%), Gaps = 8/156 (5%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TSS+VR    +        MPLDSDVF+VP G NAPQQVHITQGD  GK +I+SW T  +
Sbjct  33   TSSFVRKVEKSGV------MPLDSDVFKVPPGYNAPQQVHITQGDQLGKAMIVSWVTVEE  86

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW+  S+ ++ S G V TYK+YNYTS YIHH TI++L+ +TKYYY +G GH +
Sbjct  87   PGSNTVLYWSAYSKKQK-SEGKVTTYKFYNYTSGYIHHTTIRNLKFNTKYYYVVGIGHTE  145

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF+TPP+ GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  146  RQFWFITPPEVGPDVPYTFGLIGDLGQSFDSNKTLT  181



>gb|ACG26714.1| purple acid phosphatase precursor [Zea mays]
Length=508

 Score =   186 bits (472),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 114/155 (74%), Gaps = 7/155 (5%)
 Frame = -2

Query  463  SSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISW-TTHKH  287
            SSY R  L A+     V+MPLD+DVFRVP G NAPQQVHIT GD EG  +I+SW T ++ 
Sbjct  76   SSY-RRKLEAT-----VEMPLDADVFRVPPGYNAPQQVHITLGDQEGTAMIVSWVTANEP  129

Query  286  GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKR  107
            GS  V Y  + +R +R + GA   Y Y+NYTS +IHHCT+++L+H TKYYY +G GH  R
Sbjct  130  GSSTVAYGEDLARMERRADGAHTRYDYFNYTSGFIHHCTLRNLKHATKYYYAMGFGHTVR  189

Query  106  VFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             FWF TPPKPGPDVP+ FGLIGDLGQT+DSN TL+
Sbjct  190  TFWFTTPPKPGPDVPFKFGLIGDLGQTFDSNITLS  224



>ref|XP_006838700.1| hypothetical protein AMTR_s00002p00249280 [Amborella trichopoda]
 gb|ERN01269.1| hypothetical protein AMTR_s00002p00249280 [Amborella trichopoda]
Length=461

 Score =   185 bits (469),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 113/157 (72%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            VTS +VR            DMPLDSDVFRVP G NAPQQVHITQGD++GKGVI+SW T  
Sbjct  23   VTSLFVRKVEPTK------DMPLDSDVFRVPPGYNAPQQVHITQGDHDGKGVIVSWVTPS  76

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GS  V YW  N + K  + G V  YK+YNYTS +IHHCT+++L+ DT+YYY++G  H 
Sbjct  77   EPGSNTVLYWTANDKHKYHAEGHVRKYKFYNYTSGFIHHCTLRNLKIDTQYYYEVGIKHT  136

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R F F TPPK GPDVPYTFGLIGDLGQ++DSN TL 
Sbjct  137  MRQFSFRTPPKVGPDVPYTFGLIGDLGQSFDSNRTLA  173



>ref|XP_009408475.1| PREDICTED: purple acid phosphatase 2-like [Musa acuminata subsp. 
malaccensis]
Length=459

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 113/157 (72%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            VTSS+VR +       + VDMP+DSDVF VP G NAPQQVHITQG+++G  +I+SW T  
Sbjct  30   VTSSFVRKA------EKGVDMPIDSDVFSVPPGYNAPQQVHITQGNHDGSAMILSWVTED  83

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V Y  +  +   ++ G    YK+YNYTS YIHHCT++ L+HDTKYYY +G GH 
Sbjct  84   EPGSSKVLYGTDKDQLDFYAEGKYTRYKFYNYTSGYIHHCTLRHLKHDTKYYYAVGIGHT  143

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF TPP+ GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  144  IRKFWFTTPPEVGPDVPYTFGLIGDLGQSHDSNVTLT  180



>ref|XP_007131385.1| hypothetical protein PHAVU_011G009200g [Phaseolus vulgaris]
 gb|ESW03379.1| hypothetical protein PHAVU_011G009200g [Phaseolus vulgaris]
Length=429

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 116/151 (77%), Gaps = 1/151 (1%)
 Frame = -2

Query  451  RNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHKH-GSKA  275
            ++SL      ++ DMPLDSDVFRVP G NAPQQVHITQGD  G+ +IISW T    GS A
Sbjct  24   KSSLFVRKTNKNGDMPLDSDVFRVPPGYNAPQQVHITQGDLVGRAMIISWVTMDEPGSGA  83

Query  274  VHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWF  95
            V YW+E +  K+ + G +VTY+++NY+S +IHH TI+ L+++TKYYY++G  +  R F F
Sbjct  84   VRYWSEKNGTKKIAKGKMVTYRFFNYSSGFIHHTTIRKLKYNTKYYYEVGHRNTTRQFSF  143

Query  94   VTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +TPP+ GPDVPYTFGLIGD+GQ++DSNTTL+
Sbjct  144  ITPPQIGPDVPYTFGLIGDVGQSFDSNTTLS  174



>ref|XP_009397025.1| PREDICTED: purple acid phosphatase 2 [Musa acuminata subsp. malaccensis]
Length=467

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 110/157 (70%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            VTS +VR         + +DMPLDSD+FRVP G NAPQQVHITQG+ +G  +IISW T  
Sbjct  31   VTSGFVRKV------EKTIDMPLDSDIFRVPPGYNAPQQVHITQGNLDGTAMIISWVTED  84

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V Y  +  + +  + G    YK+YNYTS YIHHCTI+ L++DT+YYY +G GH 
Sbjct  85   EPGSSEVLYGTDEDKLELSAEGKYTRYKFYNYTSGYIHHCTIRHLKYDTEYYYAVGIGHT  144

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF TPP  GPDVPYTFGLIGDLGQ+YDSN TLT
Sbjct  145  VRKFWFTTPPAVGPDVPYTFGLIGDLGQSYDSNVTLT  181



>ref|NP_001242198.1| purple acid phosphatase 2-like [Glycine max]
 gb|ADM32501.1| purple acid phosphatases [Glycine max]
Length=424

 Score =   182 bits (463),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 105/137 (77%), Gaps = 1/137 (1%)
 Frame = -2

Query  409  MPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HKHGSKAVHYWAENSRAKRFS  233
            MPL SDVF  P G NAPQQVHITQGD  G+ +I+SW T  + G   VHYW++ S+ KR +
Sbjct  1    MPLHSDVFVAPSGYNAPQQVHITQGDQVGRAMIVSWVTVDEPGKSLVHYWSDASQHKRVA  60

Query  232  VGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPYTF  53
             G  VTY+Y+NY+S +IHHCT++DLE +TKYYY++G GH  R FWFVTPP+  PD PYTF
Sbjct  61   KGNHVTYRYFNYSSGFIHHCTLRDLEFNTKYYYEVGIGHTTRQFWFVTPPEVHPDAPYTF  120

Query  52   GLIGDLGQTYDSNTTLT  2
            GLIGDLGQT+DSN TL 
Sbjct  121  GLIGDLGQTFDSNKTLV  137



>ref|XP_007200121.1| hypothetical protein PRUPE_ppa018522mg [Prunus persica]
 gb|EMJ01320.1| hypothetical protein PRUPE_ppa018522mg [Prunus persica]
Length=479

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 110/156 (71%), Gaps = 8/156 (5%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TSS+VR    +        MPLDSDVF+VP G NAPQQVHITQGD  GK VI+SW T  +
Sbjct  41   TSSFVRKVEKSGV------MPLDSDVFKVPPGYNAPQQVHITQGDQLGKAVIVSWVTVDE  94

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW+     K  + G V TYK+YNYTS YIHH  I +L  DTKY+Y++G  H K
Sbjct  95   PGSNTVVYWSAKG-VKEMAEGEVTTYKFYNYTSGYIHHTIISNLNFDTKYHYEVGIDHTK  153

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF+TPP+ GPDVPYTFGLIGDLGQTYDSN TLT
Sbjct  154  RQFWFITPPEVGPDVPYTFGLIGDLGQTYDSNATLT  189



>ref|XP_009373026.1| PREDICTED: LOW QUALITY PROTEIN: purple acid phosphatase-like 
[Pyrus x bretschneideri]
Length=466

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 114/156 (73%), Gaps = 8/156 (5%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISW-TTHK  290
            TSS+VR         + VDMPLDSDVF+VP G NAPQQVHITQGD  G  VI+SW T  +
Sbjct  34   TSSFVRRV------EKTVDMPLDSDVFKVPPGFNAPQQVHITQGDQLGAAVIVSWVTVDE  87

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW+ NS+ K+ + G + TYK+YNYTS YIHH T+++L+ +TKYYY +G GH +
Sbjct  88   PGSSTVLYWSANSKKKK-ANGKITTYKFYNYTSGYIHHTTVRNLKFNTKYYYVVGIGHTE  146

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF+T P+ GPD  YTF LIGDLGQTYDSN TLT
Sbjct  147  RKFWFITSPEVGPDATYTFRLIGDLGQTYDSNKTLT  182



>ref|XP_008236962.1| PREDICTED: purple acid phosphatase-like [Prunus mume]
Length=479

 Score =   183 bits (464),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 109/156 (70%), Gaps = 8/156 (5%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TSS+VR    +        MPLDSDVF+VP G NAPQQVHI QGD  GK VI+SW T  +
Sbjct  41   TSSFVRKVEKSGV------MPLDSDVFKVPPGYNAPQQVHIIQGDQLGKAVIVSWVTVDE  94

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW+     K  +VG V TYK+YNYTS YIHH  I +L  DTKY+Y +G  H K
Sbjct  95   PGSNTVVYWSAKG-VKEMAVGEVTTYKFYNYTSGYIHHTIISNLNFDTKYHYVVGIDHTK  153

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF+TPP+ GPDVPYTFGLIGDLGQTYDSN TLT
Sbjct  154  RQFWFITPPEVGPDVPYTFGLIGDLGQTYDSNATLT  189



>ref|XP_008237014.1| PREDICTED: purple acid phosphatase 2-like [Prunus mume]
Length=477

 Score =   182 bits (463),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 114/157 (73%), Gaps = 8/157 (5%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            +TS++VR    ++      DMPLDSDVF+VP G NAPQQVHITQGD++G  VI+SW T  
Sbjct  39   ITSTFVRTIKYSA------DMPLDSDVFQVPPGHNAPQQVHITQGDHQGNAVIVSWITAD  92

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              G   V YW+ +S+  + + G V TY +YNYTS YIHHCTI +L  +T YYY +G G+ 
Sbjct  93   EPGYSGVIYWSADSK-NQMAEGVVTTYTFYNYTSGYIHHCTIGNLSFNTTYYYVVGIGNT  151

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R FWF TPP+ GPD+PYTFGLIGDLGQT+DSN TLT
Sbjct  152  ERQFWFTTPPEVGPDLPYTFGLIGDLGQTFDSNRTLT  188



>ref|XP_007131379.1| hypothetical protein PHAVU_011G008800g [Phaseolus vulgaris]
 gb|ESW03373.1| hypothetical protein PHAVU_011G008800g [Phaseolus vulgaris]
Length=395

 Score =   181 bits (458),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 110/141 (78%), Gaps = 1/141 (1%)
 Frame = -2

Query  421  EDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHKH-GSKAVHYWAENSRA  245
            ++ DMPLDSDVFRVP G NAPQQVHITQGD  G+ +IISW T    GS AV YW+E +  
Sbjct  34   KNRDMPLDSDVFRVPPGYNAPQQVHITQGDLVGRAMIISWVTMDEPGSSAVRYWSEKNGR  93

Query  244  KRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDV  65
            KR + G + TY+++NY+S +IHH TI+ L+++TKYYY++G  +  R F F+TPP+ G DV
Sbjct  94   KRIAKGKMSTYRFFNYSSGFIHHTTIRKLKYNTKYYYEVGLRNTTRRFSFITPPQIGLDV  153

Query  64   PYTFGLIGDLGQTYDSNTTLT  2
            PYTFGLIGDLGQ++DSNTTL+
Sbjct  154  PYTFGLIGDLGQSFDSNTTLS  174



>ref|XP_006362021.1| PREDICTED: purple acid phosphatase 2-like [Solanum tuberosum]
Length=470

 Score =   182 bits (462),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 114/157 (73%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            VTSS+VR         + +DMPLDSDVF VP G N PQQVHITQGD+ GK VI+SW T  
Sbjct  31   VTSSFVRKV------EKTIDMPLDSDVFSVPPGHNTPQQVHITQGDHVGKAVIVSWVTMD  84

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V YW+E S+ K  + G V TY YYNYTS YIHHC IK+L+ DTKYYYK+G G  
Sbjct  85   EPGSSTVVYWSEKSKQKYKASGKVTTYTYYNYTSGYIHHCNIKNLKFDTKYYYKIGIGRV  144

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF TPP+ GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  145  SRTFWFTTPPEVGPDVPYTFGLIGDLGQSFDSNKTLT  181



>ref|XP_007200250.1| hypothetical protein PRUPE_ppa015069mg [Prunus persica]
 gb|EMJ01449.1| hypothetical protein PRUPE_ppa015069mg [Prunus persica]
Length=477

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 114/157 (73%), Gaps = 8/157 (5%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            +TS++VR    ++      DMPLDSDVF+VP G NAPQQVHITQGD++G  VI+SW T  
Sbjct  39   ITSTFVRTIKYSA------DMPLDSDVFQVPPGHNAPQQVHITQGDHQGNAVIVSWITAD  92

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              G   V YW+ +S+ +  + G V TY +YNYTS YIHHCTI +L  +T YYY +G G+ 
Sbjct  93   EPGYSGVIYWSADSKNQT-AEGVVTTYTFYNYTSGYIHHCTIGNLSFNTTYYYVVGIGNT  151

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +R FWF TPP+ GPDVPYTFGLIGDLGQT+DSN TLT
Sbjct  152  ERQFWFTTPPEIGPDVPYTFGLIGDLGQTFDSNRTLT  188



>gb|ADM16565.2| purple acid phosphatase precursor [Euphorbia characias]
Length=463

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 112/156 (72%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TS YVR         + +DMPLDSDVF +P G NAPQQVHITQG  +G  VI+SW T  +
Sbjct  25   TSVYVRQV------DKTIDMPLDSDVFCLPPGYNAPQQVHITQGVIDGTAVIVSWVTPDE  78

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW EN+  K+ + G + TY ++ YTS +I++CTI+ LEH TKYYY++G G+  
Sbjct  79   PGSSLVVYWPENTTKKKVAEGKLRTYTFFKYTSGFIYYCTIRKLEHSTKYYYEVGIGNTT  138

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF+TPP  GPDVPYTFGLIGDLGQ+YDSN TLT
Sbjct  139  REFWFITPPPVGPDVPYTFGLIGDLGQSYDSNRTLT  174



>pdb|4DSY|A Chain A, Crystal Structure Of Red Kidney Bean Purple Acid Phosphatase 
In Complex With Maybridge Fragment Cc24201
 pdb|4DSY|B Chain B, Crystal Structure Of Red Kidney Bean Purple Acid Phosphatase 
In Complex With Maybridge Fragment Cc24201
 pdb|4DSY|C Chain C, Crystal Structure Of Red Kidney Bean Purple Acid Phosphatase 
In Complex With Maybridge Fragment Cc24201
 pdb|4DSY|D Chain D, Crystal Structure Of Red Kidney Bean Purple Acid Phosphatase 
In Complex With Maybridge Fragment Cc24201
 pdb|4DT2|A Chain A, Crystal Structure Of Red Kidney Bean Purple Acid Phosphatase 
In Complex With Maybridge Fragment Cc27209
 pdb|4DT2|B Chain B, Crystal Structure Of Red Kidney Bean Purple Acid Phosphatase 
In Complex With Maybridge Fragment Cc27209
 pdb|4DT2|C Chain C, Crystal Structure Of Red Kidney Bean Purple Acid Phosphatase 
In Complex With Maybridge Fragment Cc27209
 pdb|4DT2|D Chain D, Crystal Structure Of Red Kidney Bean Purple Acid Phosphatase 
In Complex With Maybridge Fragment Cc27209
 pdb|4DHL|A Chain A, Crystal Structure Of Red Kidney Bean Purple Acid Phosphatase 
In Complex With Maybridge Fragment Mo07123
 pdb|4DHL|B Chain B, Crystal Structure Of Red Kidney Bean Purple Acid Phosphatase 
In Complex With Maybridge Fragment Mo07123
 pdb|4DHL|D Chain D, Crystal Structure Of Red Kidney Bean Purple Acid Phosphatase 
In Complex With Maybridge Fragment Mo07123
 pdb|4DHL|C Chain C, Crystal Structure Of Red Kidney Bean Purple Acid Phosphatase 
In Complex With Maybridge Fragment Mo07123
 pdb|4KKZ|A Chain A, The Crystal Structure Of Red Kidney Bean Purple Acid 
Phosphatase In Complex With Diethylene Glycol Monovanadate
 pdb|4KKZ|B Chain B, The Crystal Structure Of Red Kidney Bean Purple Acid 
Phosphatase In Complex With Diethylene Glycol Monovanadate
 pdb|4KKZ|C Chain C, The Crystal Structure Of Red Kidney Bean Purple Acid 
Phosphatase In Complex With Diethylene Glycol Monovanadate
 pdb|4KKZ|D Chain D, The Crystal Structure Of Red Kidney Bean Purple Acid 
Phosphatase In Complex With Diethylene Glycol Monovanadate
Length=426

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 110/141 (78%), Gaps = 1/141 (1%)
 Frame = -2

Query  421  EDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHKH-GSKAVHYWAENSRA  245
            ++ DMPLDSDVFRVP G NAPQQVHITQGD  G+ +IISW T    GS AV YW+E +  
Sbjct  1    KNRDMPLDSDVFRVPPGYNAPQQVHITQGDLVGRAMIISWVTMDEPGSSAVRYWSEKNGR  60

Query  244  KRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDV  65
            KR + G + TY+++NY+S +IHH TI+ L+++TKYYY++G  +  R F F+TPP+ G DV
Sbjct  61   KRIAKGKMSTYRFFNYSSGFIHHTTIRKLKYNTKYYYEVGLRNTTRRFSFITPPQTGLDV  120

Query  64   PYTFGLIGDLGQTYDSNTTLT  2
            PYTFGLIGDLGQ++DSNTTL+
Sbjct  121  PYTFGLIGDLGQSFDSNTTLS  141



>pdb|1KBP|A Chain A, Kidney Bean Purple Acid Phosphatase
 pdb|1KBP|B Chain B, Kidney Bean Purple Acid Phosphatase
 pdb|1KBP|C Chain C, Kidney Bean Purple Acid Phosphatase
 pdb|1KBP|D Chain D, Kidney Bean Purple Acid Phosphatase
 pdb|3KBP|A Chain A, Kidney Bean Purple Acid Phosphatase
 pdb|3KBP|B Chain B, Kidney Bean Purple Acid Phosphatase
 pdb|3KBP|C Chain C, Kidney Bean Purple Acid Phosphatase
 pdb|3KBP|D Chain D, Kidney Bean Purple Acid Phosphatase
 pdb|4KBP|A Chain A, Kidney Bean Purple Acid Phosphatase
 pdb|4KBP|B Chain B, Kidney Bean Purple Acid Phosphatase
 pdb|4KBP|C Chain C, Kidney Bean Purple Acid Phosphatase
 pdb|4KBP|D Chain D, Kidney Bean Purple Acid Phosphatase
Length=432

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 110/141 (78%), Gaps = 1/141 (1%)
 Frame = -2

Query  421  EDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHKH-GSKAVHYWAENSRA  245
            ++ DMPLDSDVFRVP G NAPQQVHITQGD  G+ +IISW T    GS AV YW+E +  
Sbjct  7    KNRDMPLDSDVFRVPPGYNAPQQVHITQGDLVGRAMIISWVTMDEPGSSAVRYWSEKNGR  66

Query  244  KRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDV  65
            KR + G + TY+++NY+S +IHH TI+ L+++TKYYY++G  +  R F F+TPP+ G DV
Sbjct  67   KRIAKGKMSTYRFFNYSSGFIHHTTIRKLKYNTKYYYEVGLRNTTRRFSFITPPQTGLDV  126

Query  64   PYTFGLIGDLGQTYDSNTTLT  2
            PYTFGLIGDLGQ++DSNTTL+
Sbjct  127  PYTFGLIGDLGQSFDSNTTLS  147



>pdb|2QFP|A Chain A, Crystal Structure Of Red Kidney Bean Purple Acid Phosphatase 
In Complex With Fluoride
 pdb|2QFP|B Chain B, Crystal Structure Of Red Kidney Bean Purple Acid Phosphatase 
In Complex With Fluoride
 pdb|2QFP|C Chain C, Crystal Structure Of Red Kidney Bean Purple Acid Phosphatase 
In Complex With Fluoride
 pdb|2QFP|D Chain D, Crystal Structure Of Red Kidney Bean Purple Acid Phosphatase 
In Complex With Fluoride
 pdb|2QFR|A Chain A, Crystal Structure Of Red Kidney Bean Purple Acid Phosphatase 
With Bound Sulfate
 pdb|2QFR|B Chain B, Crystal Structure Of Red Kidney Bean Purple Acid Phosphatase 
With Bound Sulfate
Length=424

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 108/138 (78%), Gaps = 1/138 (1%)
 Frame = -2

Query  412  DMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHKH-GSKAVHYWAENSRAKRF  236
            DMPLDSDVFRVP G NAPQQVHITQGD  G+ +IISW T    GS AV YW+E +  KR 
Sbjct  2    DMPLDSDVFRVPPGYNAPQQVHITQGDLVGRAMIISWVTMDEPGSSAVRYWSEKNGRKRI  61

Query  235  SVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPYT  56
            + G + TY+++NY+S +IHH TI+ L+++TKYYY++G  +  R F F+TPP+ G DVPYT
Sbjct  62   AKGKMSTYRFFNYSSGFIHHTTIRKLKYNTKYYYEVGLRNTTRRFSFITPPQTGLDVPYT  121

Query  55   FGLIGDLGQTYDSNTTLT  2
            FGLIGDLGQ++DSNTTL+
Sbjct  122  FGLIGDLGQSFDSNTTLS  139



>sp|P80366.3|PPAF_PHAVU RecName: Full=Fe(3+)-Zn(2+) purple acid phosphatase; Short=PAP; 
AltName: Full=Iron(III)-zinc(II) purple acid phosphatase; 
Flags: Precursor [Phaseolus vulgaris]
 emb|CAA04644.1| purple acid phosphatase precursor [Phaseolus vulgaris]
Length=459

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 110/141 (78%), Gaps = 1/141 (1%)
 Frame = -2

Query  421  EDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHKH-GSKAVHYWAENSRA  245
            ++ DMPLDSDVFRVP G NAPQQVHITQGD  G+ +IISW T    GS AV YW+E +  
Sbjct  34   KNRDMPLDSDVFRVPPGYNAPQQVHITQGDLVGRAMIISWVTMDEPGSSAVRYWSEKNGR  93

Query  244  KRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDV  65
            KR + G + TY+++NY+S +IHH TI+ L+++TKYYY++G  +  R F F+TPP+ G DV
Sbjct  94   KRIAKGKMSTYRFFNYSSGFIHHTTIRKLKYNTKYYYEVGLRNTTRRFSFITPPQTGLDV  153

Query  64   PYTFGLIGDLGQTYDSNTTLT  2
            PYTFGLIGDLGQ++DSNTTL+
Sbjct  154  PYTFGLIGDLGQSFDSNTTLS  174



>tpg|DAA57388.1| TPA: hypothetical protein ZEAMMB73_877733, partial [Zea mays]
Length=268

 Score =   175 bits (444),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 106/156 (68%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISW-TTHK  290
            TS Y R   SA      +DMPLD+DVFR P G NAP+QVHITQG+++G  +IISW TT +
Sbjct  38   TSEYRRQLGSA------IDMPLDADVFRPPPGYNAPEQVHITQGNHDGTAMIISWVTTSE  91

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V Y          + G    Y +YNYTS YIHHCTIK LE DTKYYY +G G   
Sbjct  92   PGSSTVIYGTSEDNLNYTANGKHTQYTFYNYTSGYIHHCTIKKLEFDTKYYYAVGIGQTV  151

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF+TPPK GPDVPYT GLIGDLGQ++DSN TLT
Sbjct  152  RKFWFLTPPKSGPDVPYTLGLIGDLGQSFDSNVTLT  187



>ref|NP_001044416.1| Os01g0776600 [Oryza sativa Japonica Group]
 dbj|BAC07354.1| putative purple acid phosphatase [Oryza sativa Japonica Group]
 dbj|BAF06330.1| Os01g0776600 [Oryza sativa Japonica Group]
 gb|EAY76021.1| hypothetical protein OsI_03945 [Oryza sativa Indica Group]
 gb|EAZ13731.1| hypothetical protein OsJ_03653 [Oryza sativa Japonica Group]
 dbj|BAG92599.1| unnamed protein product [Oryza sativa Japonica Group]
Length=465

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 105/156 (67%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISW-TTHK  290
            TS Y R   SA      VDMPLD+DVFR P G NAPQQVHITQG+++G  +IISW TT +
Sbjct  28   TSEYRRQLGSA------VDMPLDADVFRAPPGRNAPQQVHITQGNHDGTAMIISWVTTIE  81

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V Y          + G    Y +YNYTS YIHHCTIK LE DTKYYY +G G   
Sbjct  82   PGSSTVLYGTSEDNLNFSADGKHTQYTFYNYTSGYIHHCTIKKLEFDTKYYYAVGIGQTV  141

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF TPPK GPDVPYTFGLIGDLGQ+YDSN TL 
Sbjct  142  RKFWFRTPPKSGPDVPYTFGLIGDLGQSYDSNITLA  177



>emb|CAD44185.1| putative acid phosphatase [Lupinus luteus]
Length=463

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 112/156 (72%), Gaps = 6/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HK  290
            TSSYVR  +    NP  VDMPLDSD F +P G NAPQQVHITQGD+ G+ +IISW T  +
Sbjct  26   TSSYVRKLIQ---NP--VDMPLDSDAFAIPPGYNAPQQVHITQGDHVGQAMIISWVTVDE  80

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V YW+ +S     + G V TY YYNYTS +IHH  I +LE +T Y+Y +G G+  
Sbjct  81   PGSNEVIYWSNSSLQNFTAEGEVFTYTYYNYTSGFIHHTNITNLEFNTTYFYVVGIGNTT  140

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF+TPP+ G +VPYTFG+IGDLGQT+DSNTTLT
Sbjct  141  RQFWFITPPEVGINVPYTFGIIGDLGQTFDSNTTLT  176



>ref|XP_006594791.1| PREDICTED: purple acid phosphatase 2-like [Glycine max]
Length=471

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 103/138 (75%), Gaps = 1/138 (1%)
 Frame = -2

Query  412  DMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HKHGSKAVHYWAENSRAKRF  236
            DMPL SDVF  P G NAPQQVHIT GD  G+ +I+SW T  + G   VHYW+++   KR 
Sbjct  46   DMPLHSDVFVSPSGYNAPQQVHITLGDQVGRAMIVSWVTLDEPGKSLVHYWSDDCPHKRV  105

Query  235  SVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPYT  56
            + G   TY+Y+NY+S +IHHCT++DLE +TKYYY++G GH  R FWFVTPP+  PD PYT
Sbjct  106  AKGNHFTYRYFNYSSGFIHHCTLRDLEFNTKYYYEVGIGHTTRQFWFVTPPEVHPDTPYT  165

Query  55   FGLIGDLGQTYDSNTTLT  2
            FGLIGDLGQT+DSN TL 
Sbjct  166  FGLIGDLGQTFDSNKTLA  183



>ref|XP_004963326.1| PREDICTED: purple acid phosphatase 2-like [Setaria italica]
Length=459

 Score =   177 bits (450),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 109/157 (69%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            VTS Y R  L A+     V+MPLD+DVFRVP G NAPQQVHIT G+ EG  +I+SW T  
Sbjct  26   VTSEY-RRKLEAT-----VEMPLDADVFRVPPGYNAPQQVHITLGNQEGTAMIVSWVTPS  79

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GS  V Y     + +  + G    Y Y+NYTS +IHHCT+K+L+H +KYYY +G GH 
Sbjct  80   ELGSSTVMYGGAPHKLELRAEGTHTRYDYFNYTSGFIHHCTLKNLKHSSKYYYAMGFGHT  139

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF TPPKPGPD PY FGLIGDLGQT+DSN TL+
Sbjct  140  VRTFWFTTPPKPGPDAPYKFGLIGDLGQTFDSNRTLS  176



>ref|XP_008382344.1| PREDICTED: purple acid phosphatase 2-like [Malus domestica]
Length=528

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 109/157 (69%), Gaps = 10/157 (6%)
 Frame = -2

Query  466  TSSYVRN-SLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            TS++VR    SA       DMPLDSDVFRVP G NAPQQVHITQGD+ G  VI+SW T  
Sbjct  91   TSAFVRKIDFSA-------DMPLDSDVFRVPLGYNAPQQVHITQGDHTGSAVIVSWITAD  143

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              G   V YW+ NS  +  + G + TY +YNYTS YIHHC I +L  +T+YYY +G G  
Sbjct  144  EPGYSKVVYWSANSENQT-AEGIITTYTFYNYTSGYIHHCIIGNLTFNTRYYYVVGIGET  202

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            +  FWF TPP+ GPDVPYTFGLIGDLGQT+DSN TLT
Sbjct  203  ETQFWFTTPPEVGPDVPYTFGLIGDLGQTFDSNKTLT  239



>ref|XP_004970155.1| PREDICTED: purple acid phosphatase 2-like [Setaria italica]
Length=475

 Score =   177 bits (450),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 107/156 (69%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISW-TTHK  290
            TS Y R+  SA      +DMPLD+DVFR P G NAP+QVHITQG+++G  +IISW TT +
Sbjct  38   TSEYRRHLGSA------IDMPLDADVFRPPPGQNAPEQVHITQGNHDGTAMIISWVTTSE  91

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V Y          + G    Y +YNYTS YIHHCTIK LE DTKYYY +G G   
Sbjct  92   PGSSTVVYGTSEDNLNYTANGKNTQYTFYNYTSGYIHHCTIKKLEFDTKYYYAVGIGQTV  151

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF+TPPK GPDVPYTFGL+GDLGQ++DSN TL 
Sbjct  152  RKFWFITPPKSGPDVPYTFGLVGDLGQSFDSNVTLA  187



>ref|XP_007149618.1| hypothetical protein PHAVU_005G084900g [Phaseolus vulgaris]
 gb|ESW21612.1| hypothetical protein PHAVU_005G084900g [Phaseolus vulgaris]
Length=461

 Score =   177 bits (448),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 106/139 (76%), Gaps = 2/139 (1%)
 Frame = -2

Query  412  DMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HKHGSKAVHYWAENSRAKR-  239
            DMPL SDVF  P G NAPQQVHIT GD+ G+ +I+SW T  + G+  V YW+E+S  KR 
Sbjct  36   DMPLHSDVFAAPSGYNAPQQVHITIGDHVGRAMIVSWVTVDEPGNSLVQYWSEDSSQKRE  95

Query  238  FSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPY  59
             + G  VTY+++NY+S +IHHCT++DLE + KYYY++G GH  R FWF+TPP+  PD PY
Sbjct  96   VAKGNHVTYRFFNYSSGFIHHCTLRDLEFNKKYYYEIGIGHTIRQFWFMTPPEVHPDAPY  155

Query  58   TFGLIGDLGQTYDSNTTLT  2
            TFGLIGDLGQT+DSNTTL 
Sbjct  156  TFGLIGDLGQTFDSNTTLA  174



>ref|XP_010250242.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Nelumbo 
nucifera]
Length=531

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 108/156 (69%), Gaps = 7/156 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISW-TTH  293
            VTSS+VR+   +      +D+PLD+ VF VP G NAPQQVHITQGDY+GK VIISW TT 
Sbjct  80   VTSSFVRSEWPS------IDIPLDNKVFAVPKGYNAPQQVHITQGDYDGKAVIISWVTTD  133

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + G   V Y     +    + G +  Y +Y Y S YIHHC + DLE+DTKYYYK+G G +
Sbjct  134  EPGPNKVQYGKSKKKYSFSAEGTITNYTFYKYKSGYIHHCLVDDLEYDTKYYYKIGKGDS  193

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTL  5
             R FWF TPPK GPD PYTFG+IGDLGQTY+S +TL
Sbjct  194  AREFWFQTPPKLGPDAPYTFGIIGDLGQTYNSLSTL  229



>ref|XP_002458586.1| hypothetical protein SORBIDRAFT_03g036210 [Sorghum bicolor]
 gb|EES03706.1| hypothetical protein SORBIDRAFT_03g036210 [Sorghum bicolor]
Length=476

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 107/156 (69%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISW-TTHK  290
            TS Y R   SA      +DMPLD+DVFR P G NAP+QVHITQG+++G  +IISW TT +
Sbjct  39   TSEYRRQLGSA------IDMPLDADVFRPPPGHNAPEQVHITQGNHDGTAMIISWVTTSE  92

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V Y          + G    Y +YNYTS YIHHCTIK LE DTKYYY +G G   
Sbjct  93   PGSSTVIYGTSEDNLNYTANGKHTQYTFYNYTSGYIHHCTIKKLEFDTKYYYAVGIGQTV  152

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF+TPP+ GPDVPYTFGLIGDLGQ++DSN TLT
Sbjct  153  RKFWFMTPPESGPDVPYTFGLIGDLGQSFDSNVTLT  188



>ref|NP_001141970.1| hypothetical protein precursor [Zea mays]
 gb|ACF78809.1| unknown [Zea mays]
 gb|ACF87398.1| unknown [Zea mays]
 tpg|DAA57387.1| TPA: hypothetical protein ZEAMMB73_877733 [Zea mays]
Length=475

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 106/156 (68%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISW-TTHK  290
            TS Y R   SA      +DMPLD+DVFR P G NAP+QVHITQG+++G  +IISW TT +
Sbjct  38   TSEYRRQLGSA------IDMPLDADVFRPPPGYNAPEQVHITQGNHDGTAMIISWVTTSE  91

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V Y          + G    Y +YNYTS YIHHCTIK LE DTKYYY +G G   
Sbjct  92   PGSSTVIYGTSEDNLNYTANGKHTQYTFYNYTSGYIHHCTIKKLEFDTKYYYAVGIGQTV  151

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF+TPPK GPDVPYT GLIGDLGQ++DSN TLT
Sbjct  152  RKFWFLTPPKSGPDVPYTLGLIGDLGQSFDSNVTLT  187



>ref|XP_006646385.1| PREDICTED: purple acid phosphatase 2-like [Oryza brachyantha]
Length=659

 Score =   177 bits (449),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 105/156 (67%), Gaps = 7/156 (4%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISW-TTHK  290
            TS Y R   SA      VDMPLD+DVFR P G NAPQQVHITQG+++G  +IISW TT +
Sbjct  30   TSEYRRRLGSA------VDMPLDADVFRAPPGHNAPQQVHITQGNHDGTAMIISWVTTSE  83

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             GS  V Y          + G    Y +YNYTS YIHHCT+K+LE D KYYY +G G   
Sbjct  84   PGSSTVLYGTAKDNLNFSANGKHTQYTFYNYTSGYIHHCTVKNLEFDRKYYYAVGIGQTV  143

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            R FWF TPPK GPDVPYTFGLIGDLGQ++DSN TL 
Sbjct  144  RKFWFRTPPKSGPDVPYTFGLIGDLGQSFDSNITLA  179



>ref|NP_001239650.1| uncharacterized protein LOC100818438 precursor [Glycine max]
 gb|ADM32498.1| phytase [Glycine max]
Length=457

 Score =   174 bits (442),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 109/156 (70%), Gaps = 7/156 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TSS+VR      P    VD+P+D +VF VP G NAPQQVHITQGDY+GK VI+SW T  
Sbjct  30   ITSSFVR------PQWPGVDIPVDHEVFAVPKGYNAPQQVHITQGDYDGKAVIVSWVTPD  83

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + G++ V Y     + K  + G V  Y +YNY S YIHHC I+ LE+ TKYYY++GSG +
Sbjct  84   EPGTRHVQYGTSKDKFKTSAEGTVANYTFYNYKSGYIHHCLIEGLEYKTKYYYRIGSGDS  143

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTL  5
             R FWF TPPK GPD PY FG+IGDLGQT++S +TL
Sbjct  144  ARDFWFETPPKVGPDTPYKFGIIGDLGQTFNSLSTL  179



>ref|XP_006593472.1| PREDICTED: uncharacterized protein LOC100818438 isoform X1 [Glycine 
max]
Length=475

 Score =   174 bits (442),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 109/156 (70%), Gaps = 7/156 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TSS+VR      P    VD+P+D +VF VP G NAPQQVHITQGDY+GK VI+SW T  
Sbjct  30   ITSSFVR------PQWPGVDIPVDHEVFAVPKGYNAPQQVHITQGDYDGKAVIVSWVTPD  83

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + G++ V Y     + K  + G V  Y +YNY S YIHHC I+ LE+ TKYYY++GSG +
Sbjct  84   EPGTRHVQYGTSKDKFKTSAEGTVANYTFYNYKSGYIHHCLIEGLEYKTKYYYRIGSGDS  143

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTL  5
             R FWF TPPK GPD PY FG+IGDLGQT++S +TL
Sbjct  144  ARDFWFETPPKVGPDTPYKFGIIGDLGQTFNSLSTL  179



>gb|KHN47108.1| Bifunctional purple acid phosphatase 26 [Glycine soja]
Length=472

 Score =   174 bits (441),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 109/156 (70%), Gaps = 7/156 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TSS+VR      P    VD+P+D +VF VP G NAPQQVHITQGDY+GK VI+SW T  
Sbjct  27   ITSSFVR------PQWPGVDIPVDHEVFAVPKGYNAPQQVHITQGDYDGKAVIVSWVTPD  80

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + G++ V Y     + K  + G V  Y +YNY S YIHHC I+ LE+ TKYYY++GSG +
Sbjct  81   EPGTRHVQYGTSKDKFKTSAEGTVANYTFYNYKSGYIHHCLIEGLEYKTKYYYRIGSGDS  140

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTL  5
             R FWF TPPK GPD PY FG+IGDLGQT++S +TL
Sbjct  141  ARDFWFETPPKVGPDTPYKFGIIGDLGQTFNSLSTL  176



>dbj|BAJ85173.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91499.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89313.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=466

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 99/141 (70%), Gaps = 1/141 (1%)
 Frame = -2

Query  421  EDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISW-TTHKHGSKAVHYWAENSRA  245
            + +DMPLD+DVFR P G NAPQQVHITQG+ EG  +IISW TT + GS  V Y       
Sbjct  39   QAIDMPLDADVFRAPPGHNAPQQVHITQGNQEGTAMIISWVTTVEPGSSTVLYGTSEDNL  98

Query  244  KRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDV  65
               + G  + Y +Y YTS YIHHCTIK LE DTKYYY +G+    R FWF TPPK GPDV
Sbjct  99   NCSAQGKHLQYTFYKYTSGYIHHCTIKKLEFDTKYYYAVGTEETLRKFWFRTPPKSGPDV  158

Query  64   PYTFGLIGDLGQTYDSNTTLT  2
            PYTFGLIGDLGQ++DSN TL 
Sbjct  159  PYTFGLIGDLGQSFDSNVTLA  179



>ref|NP_001149655.1| purple acid phosphatase [Zea mays]
 gb|ACG36252.1| purple acid phosphatase precursor [Zea mays]
Length=460

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 111/160 (69%), Gaps = 10/160 (6%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            VTS Y R  L A+     V+MPLD+DVFRVP G NAPQQVHIT GD EG  +I+SW T +
Sbjct  32   VTSQY-RRKLEAT-----VEMPLDADVFRVPPGYNAPQQVHITLGDQEGTAMIVSWVTAN  85

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVT---YKYYNYTSDYIHHCTIKDLEHDTKYYYKLGS  122
            + GS  V Y   +   ++  + A  T   Y Y+NYTS +IHHCT+ +L+H TKYYY +G 
Sbjct  86   ELGSSTVMYSEASPDPEKMELRAEGTHTRYDYFNYTSGFIHHCTLTNLKHSTKYYYAMGF  145

Query  121  GHAKRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            GH  R F F TPP PGPDVP+ FGLIGDLGQT+DSNTTL+
Sbjct  146  GHTVRSFCFTTPPMPGPDVPFKFGLIGDLGQTFDSNTTLS  185



>ref|XP_009373020.1| PREDICTED: purple acid phosphatase 2-like [Pyrus x bretschneideri]
Length=540

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 108/158 (68%), Gaps = 11/158 (7%)
 Frame = -2

Query  466  TSSYVRN-SLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            TS++VR    SA       DMPLDSDVFRVP G NAPQQVHITQGD+ G  VI+SW T  
Sbjct  102  TSAFVRKIDFSA-------DMPLDSDVFRVPPGYNAPQQVHITQGDHTGSAVIVSWITAD  154

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              G   V YW+ NS  +  + G + TY +YNYTS YIHHC I +L  +T+YYY +G G  
Sbjct  155  EPGYSKVVYWSANSENQT-AEGIITTYTFYNYTSGYIHHCVIGNLTFNTRYYYVVGIGEE  213

Query  112  KRV-FWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
                FWF TPP+ GPDVPYTFGLIGDLGQT+DSN TLT
Sbjct  214  TETQFWFTTPPEVGPDVPYTFGLIGDLGQTFDSNKTLT  251



>gb|ACN28207.1| unknown [Zea mays]
 gb|AFW79411.1| purple acid phosphatase [Zea mays]
Length=461

 Score =   172 bits (436),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 111/160 (69%), Gaps = 10/160 (6%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISW-TTH  293
            VTS Y R  L A+     V+MPLD+DVFRVP G NAPQQVHIT GD EG  +I+SW T +
Sbjct  33   VTSQY-RRKLEAT-----VEMPLDADVFRVPPGYNAPQQVHITLGDQEGTAMIVSWVTAN  86

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVT---YKYYNYTSDYIHHCTIKDLEHDTKYYYKLGS  122
            + GS  V Y   +   ++  + A  T   Y Y+NYTS +IHHCT+ +L+H TKYYY +G 
Sbjct  87   ELGSSTVMYSEASPDPEKMELRAEGTHTRYDYFNYTSGFIHHCTLTNLKHSTKYYYAMGF  146

Query  121  GHAKRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            GH  R F F TPP PGPDVP+ FGLIGDLGQT+DSNTTL+
Sbjct  147  GHTVRSFCFTTPPMPGPDVPFKFGLIGDLGQTFDSNTTLS  186



>gb|EMT02488.1| Purple acid phosphatase 2 [Aegilops tauschii]
Length=463

 Score =   172 bits (436),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 103/157 (66%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            VTS+Y R   +A       DMPLD+DVF VP G NAPQQVH+T GD  G  + +SW T  
Sbjct  29   VTSAYRRRLEAAE------DMPLDADVFAVPPGHNAPQQVHVTLGDQAGTAMTVSWVTVD  82

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + G+  V Y     R    + G    YKY+NYTS +IHHCT+  LEH TKYYY +G GH 
Sbjct  83   EVGNSTVMYGRAMGRLDMAAEGTHTRYKYHNYTSGFIHHCTLTSLEHGTKYYYAMGFGHT  142

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF TPPKPGPDVP+  GLIGDLGQT DSN+TLT
Sbjct  143  VRTFWFTTPPKPGPDVPFRLGLIGDLGQTSDSNSTLT  179



>gb|KHN28032.1| Purple acid phosphatase 2 [Glycine soja]
Length=466

 Score =   172 bits (436),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 102/137 (74%), Gaps = 4/137 (3%)
 Frame = -2

Query  412  DMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-HKHGSKAVHYWAENSRAKRF  236
            DMPL SDVF  P G NAPQQVHITQGD  G+ +I+SW T  + G   VHYW++ S+ KR 
Sbjct  45   DMPLHSDVFVAPSGYNAPQQVHITQGDQVGRAMIVSWVTVDEPGKSLVHYWSDASQHKRV  104

Query  235  SVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPYT  56
            + G  VTY+Y+NY+S +IHHCT+ DLE +TKYYY++G GH  R FWFVTPP+  PD PYT
Sbjct  105  AKGNHVTYRYFNYSSGFIHHCTLTDLEFNTKYYYEVGIGHTTRQFWFVTPPEVHPDAPYT  164

Query  55   FGLIGDLGQTYDSNTTL  5
            F   GDLGQT+DSN TL
Sbjct  165  F---GDLGQTFDSNKTL  178



>gb|ABK24726.1| unknown [Picea sitchensis]
Length=517

 Score =   172 bits (437),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 109/156 (70%), Gaps = 7/156 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            VTSS++R SL AS     VDMPLD++ F +P G NAP+QVHITQGDYEGK VI+SW T  
Sbjct  62   VTSSFMR-SLMAS-----VDMPLDNEAFSIPKGYNAPEQVHITQGDYEGKAVIVSWVTSA  115

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V Y       K  + G + TY ++NYTS +IHHC I DLE+DTKYYYK+G+  +
Sbjct  116  EPGSSEVFYDTVEHNYKYRAKGNITTYTFFNYTSGFIHHCLIIDLEYDTKYYYKIGNESS  175

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTL  5
             R FWF TPPK  PD  YTFG+IGD+GQT++S +T 
Sbjct  176  AREFWFSTPPKIAPDAAYTFGIIGDMGQTFNSLSTF  211



>ref|XP_004287267.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Fragaria 
vesca subsp. vesca]
Length=482

 Score =   172 bits (435),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 105/156 (67%), Gaps = 7/156 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            +TS++VR+   +      VD+PLD  VF VP G NAPQQVHITQGDY+GK VIISW T  
Sbjct  32   ITSNFVRSEYPS------VDIPLDHRVFAVPKGHNAPQQVHITQGDYDGKAVIISWVTAD  85

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              G+  V Y       +  + G +  Y +Y Y S YIHHC +  LEHDTKYYYK+GSG +
Sbjct  86   EPGTSKVQYGTSEKNYEFSAEGTITNYTFYEYKSGYIHHCHVDGLEHDTKYYYKIGSGDS  145

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTL  5
             R FWF+TPP  GPD PY FG+IGDLGQT++S +TL
Sbjct  146  SREFWFITPPMVGPDAPYKFGIIGDLGQTFNSLSTL  181



>ref|XP_004508441.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X3 [Cicer arietinum]
Length=466

 Score =   171 bits (434),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 109/156 (70%), Gaps = 7/156 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            +TSS+VR+   +      VD+PL+ + F VP G NAPQQVHITQGDY+GK VIISW T +
Sbjct  26   ITSSFVRSDWPS------VDIPLNHEAFAVPKGYNAPQQVHITQGDYDGKAVIISWVTPE  79

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V +    ++ K  + G V  Y +Y Y S YIHHC ++ LE++TKYYY++GSG +
Sbjct  80   EPGSNHVQFGTSENKFKATAEGTVSNYTFYKYKSGYIHHCLVEGLEYNTKYYYRIGSGES  139

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTL  5
             R FWF TPPK GPD PY FG+IGDLGQT++S +TL
Sbjct  140  SREFWFETPPKVGPDAPYKFGIIGDLGQTFNSLSTL  175



>emb|CDM84477.1| unnamed protein product [Triticum aestivum]
Length=466

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 98/141 (70%), Gaps = 1/141 (1%)
 Frame = -2

Query  421  EDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISW-TTHKHGSKAVHYWAENSRA  245
            + +DMPLD+DVFR P G NAPQQVHITQGD+EG  +II W TT + GS  V Y       
Sbjct  39   QAIDMPLDADVFRAPPGHNAPQQVHITQGDHEGTAMIIPWVTTVEPGSSTVLYGTSEDNL  98

Query  244  KRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDV  65
               + G    Y +Y YTS YIHHCTIK L+ DTKYYY +G+    R FWF TPPK GPDV
Sbjct  99   NYSAKGKHSQYTFYKYTSGYIHHCTIKKLKFDTKYYYAVGTEETLRKFWFRTPPKSGPDV  158

Query  64   PYTFGLIGDLGQTYDSNTTLT  2
            PYTFGLIGDLGQ++DSN TL 
Sbjct  159  PYTFGLIGDLGQSFDSNVTLA  179



>ref|XP_004508439.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X1 [Cicer arietinum]
 ref|XP_004508440.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X2 [Cicer arietinum]
Length=476

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 109/156 (70%), Gaps = 7/156 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            +TSS+VR+   +      VD+PL+ + F VP G NAPQQVHITQGDY+GK VIISW T +
Sbjct  26   ITSSFVRSDWPS------VDIPLNHEAFAVPKGYNAPQQVHITQGDYDGKAVIISWVTPE  79

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V +    ++ K  + G V  Y +Y Y S YIHHC ++ LE++TKYYY++GSG +
Sbjct  80   EPGSNHVQFGTSENKFKATAEGTVSNYTFYKYKSGYIHHCLVEGLEYNTKYYYRIGSGES  139

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTL  5
             R FWF TPPK GPD PY FG+IGDLGQT++S +TL
Sbjct  140  SREFWFETPPKVGPDAPYKFGIIGDLGQTFNSLSTL  175



>gb|ABQ50886.1| purple acid phosphatase [Lolium multiflorum]
Length=396

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 100/141 (71%), Gaps = 1/141 (1%)
 Frame = -2

Query  421  EDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISW-TTHKHGSKAVHYWAENSRA  245
            + +DMP+D+DVFR P G NAPQQVHITQGD++G  +IISW TT + GS  V Y A     
Sbjct  37   QAMDMPIDADVFRPPPGRNAPQQVHITQGDHDGTAMIISWVTTIEPGSSTVLYGASEDSL  96

Query  244  KRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDV  65
               + G    Y +YNYTS YIHH TIK LE DTKYYY +G+G  +R FWF TPPK GPDV
Sbjct  97   NCSAKGKHTQYTFYNYTSGYIHHSTIKKLEFDTKYYYAVGTGETRRKFWFRTPPKSGPDV  156

Query  64   PYTFGLIGDLGQTYDSNTTLT  2
            PYTFG +GDLGQ++DSN  L 
Sbjct  157  PYTFGPLGDLGQSFDSNVALA  177



>ref|XP_002515485.1| Iron(III)-zinc(II) purple acid phosphatase precursor, putative 
[Ricinus communis]
 gb|EEF46934.1| Iron(III)-zinc(II) purple acid phosphatase precursor, putative 
[Ricinus communis]
Length=469

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 107/156 (69%), Gaps = 7/156 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            +TSS+ R+   ++      D+PLD+ VF +P G NAPQQVHITQGDY+GK VIISW T  
Sbjct  24   ITSSFTRSQWPST------DIPLDNQVFAIPKGHNAPQQVHITQGDYDGKAVIISWITAD  77

Query  289  H-GSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
              GS  V Y     + +  + G V  Y +YNYTS YIHHC +  LE+DTKY+YK+G G +
Sbjct  78   EPGSINVEYGKLEKKYEFSAQGTVTNYTFYNYTSGYIHHCLVDGLEYDTKYFYKIGEGDS  137

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTL  5
             R FWF TPPK  PD PYTFG+IGDLGQTY+S +TL
Sbjct  138  SREFWFRTPPKIDPDAPYTFGIIGDLGQTYNSFSTL  173



>ref|NP_198334.1| purple acid phosphatase 26 [Arabidopsis thaliana]
 sp|Q949Y3.1|PPA26_ARATH RecName: Full=Bifunctional purple acid phosphatase 26; Includes: 
RecName: Full=Acid phosphatase; Includes: RecName: Full=Peroxidase; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK92747.1| putative acid phosphatase [Arabidopsis thaliana]
 gb|AAM14354.1| putative acid phosphatase [Arabidopsis thaliana]
 gb|AED93912.1| purple acid phosphatase 26 [Arabidopsis thaliana]
Length=475

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 107/156 (69%), Gaps = 7/156 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TSS++R+   A      VD+PLD  VF+VP G NAPQQVHITQGDY+GK VIISW T  
Sbjct  24   ITSSFIRSEWPA------VDIPLDHHVFKVPKGYNAPQQVHITQGDYDGKAVIISWVTPD  77

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GS  VHY A   + +  + G    Y +Y Y S +IHHC + DLEHDTKYYYK+ SG +
Sbjct  78   EPGSSQVHYGAVQGKYEFVAQGTYHNYTFYKYKSGFIHHCLVSDLEHDTKYYYKIESGES  137

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTL  5
             R FWFVTPP   PD  Y FG+IGD+GQT++S +TL
Sbjct  138  SREFWFVTPPHVHPDASYKFGIIGDMGQTFNSLSTL  173



>gb|AAW29950.1| putative purple acid phosphatase [Arabidopsis thaliana]
Length=475

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 107/156 (69%), Gaps = 7/156 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TSS++R+   A      VD+PLD  VF+VP G NAPQQVHITQGDY+GK VIISW T  
Sbjct  24   ITSSFIRSEWPA------VDIPLDHHVFKVPKGYNAPQQVHITQGDYDGKAVIISWVTPD  77

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GS  VHY A   + +  + G    Y +Y Y S +IHHC + DLEHDTKYYYK+ SG +
Sbjct  78   EPGSSQVHYGAVQGKYEFVAQGTYHNYTFYKYKSGFIHHCLVSDLEHDTKYYYKIESGES  137

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTL  5
             R FWFVTPP   PD  Y FG+IGD+GQT++S +TL
Sbjct  138  SREFWFVTPPHVHPDASYKFGIIGDMGQTFNSLSTL  173



>gb|EMS53150.1| Purple acid phosphatase 2 [Triticum urartu]
Length=642

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 103/157 (66%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            VTS+Y R   +A       DMPLD+DVF VP G NAPQQVH+T GD  G  + +SW T  
Sbjct  208  VTSAYRRRLEAAE------DMPLDADVFAVPPGHNAPQQVHVTLGDQAGTAMTVSWVTVD  261

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + G+  V Y     R    + G    YKY+NYTS +IHHCT+  LEH TKYYY +G GH 
Sbjct  262  EVGNSTVMYGRAMGRLDMAAEGTHTRYKYHNYTSGFIHHCTLTSLEHGTKYYYAMGFGHT  321

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R FWF TPPKPGPDVP+  GLIGDLGQT DSN+TLT
Sbjct  322  VRTFWFTTPPKPGPDVPFRMGLIGDLGQTSDSNSTLT  358



>emb|CAD30328.1| acid phosphatase [Lupinus luteus]
Length=477

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 109/156 (70%), Gaps = 7/156 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISW-TTH  293
            +TSS++R+   ++      D+PLD +VF VP G NAPQQVHITQGDY+GK VI+SW TT 
Sbjct  26   ITSSFIRSEFPST------DIPLDHEVFAVPKGYNAPQQVHITQGDYDGKAVIVSWVTTD  79

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + G   V +    ++ +  + G V  Y +Y Y S Y+HHC I+ LE+ TKYYY++GSG A
Sbjct  80   EPGPSKVQFGTSENKFQTSAEGTVSNYTFYKYKSGYVHHCLIEGLEYKTKYYYRIGSGDA  139

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTL  5
             R FWF TPPK  PDVPY FG+IGDLGQT++S +TL
Sbjct  140  SREFWFETPPKVEPDVPYKFGIIGDLGQTFNSLSTL  175



>ref|XP_006371756.1| hypothetical protein POPTR_0018s01990g [Populus trichocarpa]
 gb|ERP49553.1| hypothetical protein POPTR_0018s01990g [Populus trichocarpa]
Length=354

 Score =   168 bits (425),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 107/156 (69%), Gaps = 7/156 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TS++VR    A+      D+PLD++VF +P G NAPQQVHITQGDY+GK VIISW T  
Sbjct  33   LTSTFVRTQWPAA------DIPLDNEVFAIPKGYNAPQQVHITQGDYDGKAVIISWVTPD  86

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GS +V Y    +     + G V  Y +Y Y S YIHHC +  LE+D+KYYYK+G G +
Sbjct  87   EPGSISVKYGTSENSYDFSAEGTVTNYTFYKYKSGYIHHCLVDGLEYDSKYYYKIGEGDS  146

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTL  5
             RVFWF TPP+  PD  YTFG+IGDLGQTY+S +TL
Sbjct  147  SRVFWFQTPPEIDPDASYTFGIIGDLGQTYNSLSTL  182



>ref|XP_010687873.1| PREDICTED: bifunctional purple acid phosphatase 26-like [Beta 
vulgaris subsp. vulgaris]
Length=462

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 103/156 (66%), Gaps = 7/156 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            VTS YVR       NP   D+PLDSD+   P   NAPQQVHITQGDY+GK VIISW T  
Sbjct  30   VTSKYVRK------NPASFDIPLDSDIIAAPKAHNAPQQVHITQGDYDGKAVIISWVTPQ  83

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
             HGS  V+Y     R    +     +Y + NY S  I+HC +  LE++TKYYY++GSG +
Sbjct  84   LHGSDTVYYGTTKGRYTSKAKATKTSYSFNNYKSGQIYHCLVDGLEYNTKYYYRIGSGSS  143

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTL  5
             R FWF TPP+ GPD PYTFGLIGDLGQT+DS +TL
Sbjct  144  SREFWFQTPPEVGPDAPYTFGLIGDLGQTFDSVSTL  179



>ref|XP_003564342.1| PREDICTED: purple acid phosphatase 2 [Brachypodium distachyon]
 ref|XP_010232421.1| PREDICTED: purple acid phosphatase 2 [Brachypodium distachyon]
Length=468

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 99/139 (71%), Gaps = 1/139 (1%)
 Frame = -2

Query  415  VDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISW-TTHKHGSKAVHYWAENSRAKR  239
            +DMPLD+DVFR P G NAPQQVHITQG+++G  +IISW TT + GS  V Y         
Sbjct  42   IDMPLDADVFRPPAGHNAPQQVHITQGNHDGTAMIISWVTTIEPGSSTVLYGTSQDNLNC  101

Query  238  FSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPY  59
             + G    Y +YNYTS YIHH T+K+LE DTKYYY +G+    R FWF TPPK GPDVPY
Sbjct  102  SAKGKHTQYTFYNYTSGYIHHSTVKNLEFDTKYYYAVGTEQTLRKFWFRTPPKSGPDVPY  161

Query  58   TFGLIGDLGQTYDSNTTLT  2
            TFGLIGDLGQ++DSN TL 
Sbjct  162  TFGLIGDLGQSFDSNVTLA  180



>ref|XP_007155070.1| hypothetical protein PHAVU_003G170600g [Phaseolus vulgaris]
 gb|ESW27064.1| hypothetical protein PHAVU_003G170600g [Phaseolus vulgaris]
Length=441

 Score =   169 bits (428),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 104/156 (67%), Gaps = 7/156 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TSS+VR    +       DMP+D +VF +P G NAPQQVHITQGDY+GK VIISW T  
Sbjct  23   MTSSFVRTKWPSE------DMPVDHEVFAIPKGYNAPQQVHITQGDYDGKAVIISWVTPD  76

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + G   V Y    S  +    G V  Y +YNY S YIHHC I+ L H+TKYYY++GSG +
Sbjct  77   EAGPSHVQYGTSKSNLQTSKEGTVANYTFYNYKSGYIHHCLIEGLTHNTKYYYRIGSGDS  136

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTL  5
             R FWF TPP  GPD PY FG+IGDLGQT++S +TL
Sbjct  137  ARDFWFQTPPTIGPDTPYKFGIIGDLGQTFNSLSTL  172



>gb|AFY06665.1| purple acid phosphatase [Citrus trifoliata]
Length=476

 Score =   169 bits (429),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 104/156 (67%), Gaps = 7/156 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TSS++R    +      VD+PLD+ VF +P G NAPQQV ITQGDY+GK VIISW    
Sbjct  31   ITSSFIRTEWPS------VDIPLDNKVFDIPKGHNAPQQVRITQGDYDGKAVIISWVAPD  84

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GS  V Y     +    + G V  Y +Y Y S YIHHC + DLE+DTKYYYK+G G +
Sbjct  85   EMGSSRVQYGKLEKKYDSSAEGTVTNYTFYKYKSGYIHHCLVDDLEYDTKYYYKIGDGDS  144

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTL  5
             R FWF TPPK  PD PYTFG+IGDLGQTY+S +TL
Sbjct  145  SREFWFQTPPKIHPDAPYTFGIIGDLGQTYNSLSTL  180



>gb|KDO49481.1| hypothetical protein CISIN_1g044242mg, partial [Citrus sinensis]
Length=247

 Score =   164 bits (414),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 93/118 (79%), Gaps = 1/118 (1%)
 Frame = -2

Query  352  VHITQGDYEGKGVIISWTT-HKHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHH  176
            VHITQGD  GK VI+SW T  + G+  V YW+ENS+ K  + G + TYKYYNYTS YIHH
Sbjct  1    VHITQGDLVGKAVIVSWVTVDEPGTNTVVYWSENSKQKEQAEGKIYTYKYYNYTSGYIHH  60

Query  175  CTIKDLEHDTKYYYKLGSGHAKRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
            CTI+ LE +TKYYY +G GH +R FWFVTPP+ GPDVPY+FGLIGDLGQ+YDSN TLT
Sbjct  61   CTIRHLEFNTKYYYVVGIGHTERQFWFVTPPEVGPDVPYSFGLIGDLGQSYDSNVTLT  118



>ref|XP_008443931.1| PREDICTED: bifunctional purple acid phosphatase 26 [Cucumis melo]
Length=481

 Score =   169 bits (428),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 106/156 (68%), Gaps = 7/156 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTTHK  290
            +TS+++R+   +      +D+PLD +VF VP G NAPQQVHITQGDYEGK VIISW TH 
Sbjct  32   ITSTFIRSEWPS------IDIPLDHEVFAVPQGYNAPQQVHITQGDYEGKAVIISWVTHD  85

Query  289  HGS-KAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
                 +V Y   +   +  + G V  Y +Y Y S YIHHC I DL++DTKYYYK+GSG +
Sbjct  86   EPEPNSVQYGTSDGSYEFTAEGVVTNYTFYKYKSGYIHHCLIADLKYDTKYYYKIGSGDS  145

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTL  5
             R FWF +PPK  PD  Y FG+IGDLGQT++S +TL
Sbjct  146  AREFWFRSPPKVDPDASYKFGIIGDLGQTFNSLSTL  181



>ref|XP_006371757.1| hypothetical protein POPTR_0018s01990g [Populus trichocarpa]
 gb|ERP49554.1| hypothetical protein POPTR_0018s01990g [Populus trichocarpa]
Length=406

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 107/156 (69%), Gaps = 7/156 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TS++VR    A+      D+PLD++VF +P G NAPQQVHITQGDY+GK VIISW T  
Sbjct  33   LTSTFVRTQWPAA------DIPLDNEVFAIPKGYNAPQQVHITQGDYDGKAVIISWVTPD  86

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GS +V Y    +     + G V  Y +Y Y S YIHHC +  LE+D+KYYYK+G G +
Sbjct  87   EPGSISVKYGTSENSYDFSAEGTVTNYTFYKYKSGYIHHCLVDGLEYDSKYYYKIGEGDS  146

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTL  5
             RVFWF TPP+  PD  YTFG+IGDLGQTY+S +TL
Sbjct  147  SRVFWFQTPPEIDPDASYTFGIIGDLGQTYNSLSTL  182



>ref|XP_006371758.1| hypothetical protein POPTR_0018s01990g [Populus trichocarpa]
 gb|ERP49555.1| hypothetical protein POPTR_0018s01990g [Populus trichocarpa]
Length=408

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 107/156 (69%), Gaps = 7/156 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TS++VR    A+      D+PLD++VF +P G NAPQQVHITQGDY+GK VIISW T  
Sbjct  33   LTSTFVRTQWPAA------DIPLDNEVFAIPKGYNAPQQVHITQGDYDGKAVIISWVTPD  86

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GS +V Y    +     + G V  Y +Y Y S YIHHC +  LE+D+KYYYK+G G +
Sbjct  87   EPGSISVKYGTSENSYDFSAEGTVTNYTFYKYKSGYIHHCLVDGLEYDSKYYYKIGEGDS  146

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTL  5
             RVFWF TPP+  PD  YTFG+IGDLGQTY+S +TL
Sbjct  147  SRVFWFQTPPEIDPDASYTFGIIGDLGQTYNSLSTL  182



>gb|AFY06664.1| purple acid phosphatase [Citrus trifoliata]
Length=458

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 112/156 (72%), Gaps = 9/156 (6%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            VTS YVR    A P+   VDMPLD+  F  P G NAP+QVHITQGD++G+ VI+SW T  
Sbjct  26   VTSRYVRK---AEPS---VDMPLDA--FPPPPGFNAPEQVHITQGDHDGRSVIVSWVTPD  77

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            +     V +W  NS+ K  +   + TY+Y+NY+S YIHH TIK L++DTKY+Y+LGSG+A
Sbjct  78   EKYPNVVTHWEANSKRKHKTHSIIKTYRYFNYSSGYIHHATIKRLKYDTKYFYQLGSGNA  137

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTL  5
             R F F TPPK GPDVPYTFG+IGDLGQTYDSN T 
Sbjct  138  TRRFHFTTPPKVGPDVPYTFGIIGDLGQTYDSNQTF  173



>ref|XP_008795838.1| PREDICTED: phosphoenolpyruvate phosphatase [Phoenix dactylifera]
Length=475

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 108/155 (70%), Gaps = 7/155 (5%)
 Frame = -2

Query  466  TSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISW-TTHK  290
            TS+++R+   ++      D+PLD++VF +P G NAPQQVH+TQGDY+GK VIISW TT +
Sbjct  27   TSTFIRSEWPST------DIPLDNEVFAIPKGYNAPQQVHVTQGDYDGKAVIISWVTTSE  80

Query  289  HGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHAK  110
             G+  V Y  E  + +  + G    Y +YNY S YIHHC +  LE+ TKYYY +G G A 
Sbjct  81   PGTSEVLYGKEEHKYEHSAQGKTTNYTFYNYKSGYIHHCLVDGLEYGTKYYYTIGKGDAA  140

Query  109  RVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTL  5
            RVFWF TPPK  PD PYTFG+IGDLGQT++S +TL
Sbjct  141  RVFWFETPPKIDPDAPYTFGIIGDLGQTFNSLSTL  175



>ref|XP_006664780.1| PREDICTED: purple acid phosphatase 2-like [Oryza brachyantha]
Length=458

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 103/157 (66%), Gaps = 7/157 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISW-TTH  293
            VTS Y R  L A+     VDMPLD+DVFRVP G NAPQQVHIT GD  G  + +SW T +
Sbjct  23   VTSEY-RRKLEAT-----VDMPLDADVFRVPSGYNAPQQVHITLGDQTGTAMTVSWVTAN  76

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            + GS  V Y     + ++ + G    Y Y+NYTS +IHHCT+  L H TKYYY +G GH 
Sbjct  77   EEGSSTVRYGRSAEKLEQAAEGRHARYDYFNYTSGFIHHCTLTGLSHATKYYYAMGFGHT  136

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTLT  2
             R F F TPP P PD P+ FGLIGDLGQT+DSN+TL 
Sbjct  137  VRTFSFTTPPLPAPDAPFKFGLIGDLGQTFDSNSTLA  173



>ref|XP_009790276.1| PREDICTED: bifunctional purple acid phosphatase 26-like isoform 
X2 [Nicotiana sylvestris]
Length=476

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 107/156 (69%), Gaps = 7/156 (4%)
 Frame = -2

Query  469  VTSSYVRNSLSASPNPEDVDMPLDSDVFRVPHGSNAPQQVHITQGDYEGKGVIISWTT-H  293
            +TSS++RN   +      VD+PLD++VF VP G NAPQQVHITQGDYEGK V++SW T  
Sbjct  22   ITSSFIRNEWPS------VDIPLDNEVFAVPKGYNAPQQVHITQGDYEGKAVLVSWITPD  75

Query  292  KHGSKAVHYWAENSRAKRFSVGAVVTYKYYNYTSDYIHHCTIKDLEHDTKYYYKLGSGHA  113
            K G   V Y     + +  + G+V  Y +YNYTS YIH C +  L++DTKYYY++G G +
Sbjct  76   KPGPSQVRYGLSEGKYEFTAEGSVTNYTFYNYTSGYIHQCFLDGLQYDTKYYYEIGDGDS  135

Query  112  KRVFWFVTPPKPGPDVPYTFGLIGDLGQTYDSNTTL  5
             R FWF TPPK  PD  Y FG+IGDLGQTY+S +TL
Sbjct  136  ARKFWFETPPKVDPDASYKFGIIGDLGQTYNSLSTL  171



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 512662103758