BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80046_g1_i1 len=1027 path=[1:0-1026]

Length=1027
                                                                      Score     E

ref|XP_009627635.1|  PREDICTED: uncharacterized protein LOC104118150  98.2    4e-21   
ref|XP_009782717.1|  PREDICTED: uncharacterized protein LOC104231417  96.7    1e-20   
ref|XP_011079821.1|  PREDICTED: histidine-rich membrane protein K...  97.1    2e-20   
gb|AGJ98242.1|  PIG93                                                 89.7    7e-19   
emb|CBI32355.3|  unnamed protein product                              89.0    2e-18   
ref|XP_010652136.1|  PREDICTED: zinc transporter 7-B                  89.7    4e-18   
emb|CAN64249.1|  hypothetical protein VITISV_032977                   89.7    4e-18   Vitis vinifera
gb|EPS59564.1|  hypothetical protein M569_15243                       88.2    1e-17   
ref|XP_006355869.1|  PREDICTED: uncharacterized protein LOC102579338  88.6    1e-17   
ref|XP_004247316.1|  PREDICTED: uncharacterized protein LOC101258484  87.8    2e-17   
ref|XP_011082636.1|  PREDICTED: uncharacterized protein LOC105165355  85.9    7e-17   
ref|XP_009778780.1|  PREDICTED: uncharacterized protein LOC104228079  84.0    4e-16   
ref|XP_010545083.1|  PREDICTED: RNA-binding protein 33-like           83.6    1e-15   
ref|XP_011007542.1|  PREDICTED: uncharacterized protein LOC105113180  82.4    1e-15   
emb|CDP03605.1|  unnamed protein product                              83.6    1e-15   
ref|XP_006444119.1|  hypothetical protein CICLE_v10024447mg           82.4    2e-15   
gb|KDO68789.1|  hypothetical protein CISIN_1g044805mg                 81.6    2e-15   
gb|EYU46609.1|  hypothetical protein MIMGU_mgv1a014816mg              82.4    2e-15   
ref|XP_010039258.1|  PREDICTED: proline-rich protein 13-like          82.4    3e-15   
gb|KCW49923.1|  hypothetical protein EUGRSUZ_K03387                   82.4    3e-15   
ref|XP_007050664.1|  Tetratricopeptide repeat-like superfamily pr...  81.3    4e-15   
ref|XP_006352782.1|  PREDICTED: UBX domain-containing protein 11-...  81.3    5e-15   
emb|CDX93936.1|  BnaC04g20950D                                        82.8    5e-15   
ref|XP_010316744.1|  PREDICTED: uncharacterized protein LOC104645827  80.9    6e-15   
emb|CDX89172.1|  BnaA04g00140D                                        82.8    6e-15   
ref|XP_002533067.1|  conserved hypothetical protein                   80.5    7e-15   Ricinus communis
ref|NP_001078333.1|  protease inhibitor/seed storage/LTP family p...  82.4    8e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010090376.1|  hypothetical protein L484_025041                 79.7    1e-14   
ref|XP_009104413.1|  PREDICTED: histidine-rich glycoprotein-like      81.6    1e-14   
ref|XP_002302826.1|  hypothetical protein POPTR_0002s22550g           79.0    2e-14   Populus trichocarpa [western balsam poplar]
ref|XP_010468887.1|  PREDICTED: probable zinc transporter protein...  80.9    2e-14   
ref|XP_010413198.1|  PREDICTED: nonsense-mediated mRNA decay prot...  80.9    2e-14   
emb|CDX67917.1|  BnaA07g19570D                                        80.5    2e-14   
ref|XP_010512716.1|  PREDICTED: histidine-rich glycoprotein-like      80.9    3e-14   
emb|CDX79421.1|  BnaC06g18820D                                        80.1    3e-14   
emb|CDY63338.1|  BnaA09g55630D                                        80.1    3e-14   
ref|XP_007144613.1|  hypothetical protein PHAVU_007G170000g           78.6    3e-14   
ref|XP_009116975.1|  PREDICTED: LOW QUALITY PROTEIN: probable zin...  80.5    5e-14   
gb|KEH23735.1|  Lipid transfer protein-like protein                   78.6    5e-14   
ref|XP_006604424.1|  PREDICTED: uncharacterized protein LOC102669806  78.2    6e-14   
gb|KFK35474.1|  hypothetical protein AALP_AA5G288900                  79.7    7e-14   
gb|KDP21489.1|  hypothetical protein JCGZ_21960                       77.0    8e-14   
gb|EYU38143.1|  hypothetical protein MIMGU_mgv1a015131mg              77.8    8e-14   
ref|XP_007162405.1|  hypothetical protein PHAVU_001G149300g           77.4    1e-13   
ref|XP_010684244.1|  PREDICTED: uncharacterized protein LOC104898831  77.4    1e-13   
ref|XP_008235264.1|  PREDICTED: protein catecholamines up             77.0    1e-13   
emb|CDY64155.1|  BnaCnng43330D                                        80.1    3e-13   
ref|XP_008368867.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  76.3    3e-13   
ref|XP_007199171.1|  hypothetical protein PRUPE_ppa021373mg           75.9    4e-13   
ref|XP_006576887.1|  PREDICTED: uncharacterized protein LOC102666530  75.1    6e-13   
ref|XP_009356752.1|  PREDICTED: transcription cofactor vestigial-...  76.3    7e-13   
ref|XP_006658907.1|  PREDICTED: protein PFC0760c-like                 75.9    7e-13   
ref|XP_011033687.1|  PREDICTED: uncharacterized protein LOC105132093  74.7    1e-12   
ref|XP_002320394.1|  hypothetical protein POPTR_0014s13520g           74.3    1e-12   Populus trichocarpa [western balsam poplar]
ref|XP_006375480.1|  hypothetical protein POPTR_0014s13530g           72.8    2e-12   
gb|EAZ04978.1|  hypothetical protein OsI_27158                        73.2    2e-12   Oryza sativa Indica Group [Indian rice]
ref|NP_001149735.1|  AAA ATPase containing von Willebrand factor ...  75.1    3e-12   Zea mays [maize]
ref|NP_001158897.1|  AAA ATPase containing von Willebrand factor ...  75.1    3e-12   Zea mays [maize]
ref|XP_004495224.1|  PREDICTED: uncharacterized protein LOC101511533  73.6    3e-12   
ref|XP_008386520.1|  PREDICTED: uncharacterized protein LOC103449030  72.8    4e-12   
ref|XP_004493654.1|  PREDICTED: uncharacterized protein LOC101500505  72.8    5e-12   
ref|NP_001140718.1|  uncharacterized protein LOC100272793 precursor   74.3    7e-12   Zea mays [maize]
ref|XP_011033686.1|  PREDICTED: metal tolerance protein 1-like        72.0    9e-12   
ref|NP_001150311.1|  AAA ATPase containing von Willebrand factor ...  73.9    1e-11   Zea mays [maize]
gb|ACG37671.1|  aspartic acid-rich protein                            72.0    1e-11   Zea mays [maize]
ref|NP_001050142.1|  Os03g0357500                                     73.6    1e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003557893.1|  PREDICTED: sarcoplasmic reticulum histidine-...  73.9    1e-11   
ref|XP_004136185.1|  PREDICTED: uncharacterized protein LOC101206671  71.6    1e-11   
ref|XP_002465242.1|  hypothetical protein SORBIDRAFT_01g034880        73.6    1e-11   Sorghum bicolor [broomcorn]
gb|EEC75289.1|  hypothetical protein OsI_11632                        72.4    1e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_010256204.1|  PREDICTED: uncharacterized protein LOC104596643  71.6    1e-11   
ref|XP_004984320.1|  PREDICTED: protein PFC0760c-like                 73.2    2e-11   
ref|NP_001152240.1|  aspartic acid-rich protein precursor             72.8    2e-11   Zea mays [maize]
ref|NP_001140990.1|  aspartic acid-rich protein precursor             72.8    2e-11   Zea mays [maize]
gb|EMT17194.1|  Putative pectinesterase 66                            74.3    2e-11   
gb|EEE67730.1|  hypothetical protein OsJ_25410                        72.8    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001060499.1|  Os07g0655800                                     72.8    3e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002463297.1|  hypothetical protein SORBIDRAFT_02g041423        68.6    8e-11   Sorghum bicolor [broomcorn]
ref|XP_003637691.1|  AAA ATPase containing von Willebrand factor ...  69.3    1e-10   
ref|XP_008451383.1|  PREDICTED: protein FAM76B                        67.4    4e-10   
ref|XP_006651394.1|  PREDICTED: probable serine/threonine-protein...  67.0    4e-10   
dbj|BAK07112.1|  predicted protein                                    69.3    4e-10   
ref|XP_004958535.1|  PREDICTED: guanine nucleotide-binding protei...  68.9    5e-10   
ref|XP_002305616.2|  hypothetical protein POPTR_0004s02190g           65.5    6e-10   Populus trichocarpa [western balsam poplar]
ref|XP_002533068.1|  hypothetical protein RCOM_0176280                68.2    6e-10   Ricinus communis
ref|XP_010242431.1|  PREDICTED: protein catecholamines up-like        66.2    2e-09   
ref|XP_010524012.1|  PREDICTED: pleckstrin homology-like domain f...  64.3    9e-09   
ref|XP_008776443.1|  PREDICTED: protein catecholamines up-like        63.9    1e-08   
ref|XP_010942492.1|  PREDICTED: uncharacterized protein LOC105060474  59.3    3e-07   
gb|KHN03781.1|  hypothetical protein glysoja_011010                   58.9    3e-07   
gb|KHN18894.1|  hypothetical protein glysoja_028263                   58.5    4e-07   
ref|XP_006850779.1|  hypothetical protein AMTR_s00025p00092990        55.1    7e-06   



>ref|XP_009627635.1| PREDICTED: uncharacterized protein LOC104118150 [Nicotiana tomentosiformis]
Length=159

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  530  VQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRIKI*T  700
            ++E+CCRW+K+VD EC+CDLLVHLPPFLSRP+H+YTV VD +C+VTF+CGSRIK  T
Sbjct  96   IEEECCRWMKQVDSECICDLLVHLPPFLSRPVHQYTVVVDASCNVTFECGSRIKFET  152


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 35/52 (67%), Gaps = 3/52 (6%)
 Frame = +2

Query  68   LKTGFLIVLLVVCH--VAESKWVPVPVPVISGPLCTSQFTLVNHACAFLPFA  217
            L    LIV+ +V H   + S+WVP P P+++ PLC SQF LVNHAC+ LP+ 
Sbjct  6    LTKIVLIVVFLVLHPSGSRSQWVPQP-PIVTRPLCASQFALVNHACSLLPYT  56



>ref|XP_009782717.1| PREDICTED: uncharacterized protein LOC104231417 [Nicotiana sylvestris]
Length=160

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +2

Query  524  SAVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRIKI*T  700
            + V+E+CCRW+K+VD ECVCDLLVHLPPFLSRP+H+Y V VD +C+VTF+CGSRIK  T
Sbjct  95   TPVEEECCRWMKQVDSECVCDLLVHLPPFLSRPVHQYNVVVDSSCNVTFECGSRIKFET  153



>ref|XP_011079821.1| PREDICTED: histidine-rich membrane protein KE4 homolog 1 [Sesamum 
indicum]
Length=176

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  524  SAVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            +A++EDCCRWLKEVDD CVC+LLVHLPPFL+RP+H YTV VD TC++TF CGSR+
Sbjct  119  TAIEEDCCRWLKEVDDVCVCELLVHLPPFLTRPVHNYTVGVDDTCNITFTCGSRL  173



>gb|AGJ98242.1| PIG93, partial [Petunia x hybrida]
Length=79

 Score = 89.7 bits (221),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  530  VQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRIKI  694
            V+E+CCRW+K VD ECVC LL  LPPFLSRPLH+YT  VD +CSVTF C SRI++
Sbjct  16   VEEECCRWMKTVDSECVCGLLAQLPPFLSRPLHQYTAVVDASCSVTFMCSSRIRV  70



>emb|CBI32355.3| unnamed protein product [Vitis vinifera]
Length=113

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +2

Query  524  SAVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRIK  691
            S+ +E CCRWLKE+DDECVCDLL HLP FL+RP H YTV VD +CSVTF CG R++
Sbjct  57   SSAEEACCRWLKEIDDECVCDLLAHLPLFLTRPSHYYTVSVDPSCSVTFSCGGRLR  112



>ref|XP_010652136.1| PREDICTED: zinc transporter 7-B [Vitis vinifera]
Length=160

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +2

Query  524  SAVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRIK  691
            S+ +E CCRWLKE+DDECVCDLL HLP FL+RP H YTV VD +CSVTF CG R++
Sbjct  104  SSAEEACCRWLKEIDDECVCDLLAHLPLFLTRPSHYYTVSVDPSCSVTFSCGGRLR  159



>emb|CAN64249.1| hypothetical protein VITISV_032977 [Vitis vinifera]
Length=160

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +2

Query  524  SAVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRIK  691
            S+ +E CCRWLKE+DDECVCDLL HLP FL+RP H YTV VD +CSVTF CG R++
Sbjct  104  SSAEEACCRWLKEIDDECVCDLLAHLPLFLTRPSHYYTVSVDPSCSVTFSCGGRLR  159



>gb|EPS59564.1| hypothetical protein M569_15243, partial [Genlisea aurea]
Length=150

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  524  SAVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            ++ +EDCCRW+KE+DD CVC+LLV LPPFL+RP+H YTV VD  CSVT+QC SR+
Sbjct  96   TSTEEDCCRWVKEIDDVCVCELLVRLPPFLTRPVHNYTVAVDDLCSVTYQCSSRL  150



>ref|XP_006355869.1| PREDICTED: uncharacterized protein LOC102579338 [Solanum tuberosum]
Length=158

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  524  SAVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSR  685
            S+ +E+CCRW+K+VD ECVCDLLV LP FLSRPLH+YT+ VD  C++TF+CGSR
Sbjct  94   SSAEENCCRWMKQVDSECVCDLLVRLPLFLSRPLHQYTIMVDPGCNITFECGSR  147



>ref|XP_004247316.1| PREDICTED: uncharacterized protein LOC101258484 [Solanum lycopersicum]
Length=155

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +2

Query  524  SAVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSR  685
            S+ +E+CCRW+K+VD+ECVCDLLV LP FLSRP+H+YT+ VD  C++TF+CGSR
Sbjct  91   SSAEENCCRWMKQVDNECVCDLLVRLPLFLSRPVHQYTILVDPGCNITFECGSR  144



>ref|XP_011082636.1| PREDICTED: uncharacterized protein LOC105165355 [Sesamum indicum]
Length=139

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +2

Query  524  SAVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            +A +E+CCRWLKEVD+ CVCD+L+HLP FL+RP+H Y V VD TC V F+CGSR+
Sbjct  82   AAREEECCRWLKEVDNACVCDVLLHLPSFLTRPVHNYVVIVDDTCDVKFECGSRL  136



>ref|XP_009778780.1| PREDICTED: uncharacterized protein LOC104228079 [Nicotiana sylvestris]
Length=150

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  542  CCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRIK  691
            CCRW+K +D ECVC LL HLPPFLS+P+H+YT  VD +CSVTF+C SRI+
Sbjct  91   CCRWMKSIDSECVCALLAHLPPFLSKPIHQYTAVVDASCSVTFKCSSRIR  140



>ref|XP_010545083.1| PREDICTED: RNA-binding protein 33-like [Tarenaya hassleriana]
Length=179

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  524  SAVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            S  + +CC+WLK++D+ECVCDLLVHLPP L+RP+H YTV VD +C VTF CG R 
Sbjct  123  SFAEAECCKWLKQMDNECVCDLLVHLPPLLARPVHNYTVFVDESCIVTFICGGRF  177



>ref|XP_011007542.1| PREDICTED: uncharacterized protein LOC105113180 [Populus euphratica]
Length=138

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 44/53 (83%), Gaps = 1/53 (2%)
 Frame = +2

Query  524  SAVQED-CCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCG  679
               QED CCRWL +VDDEC+C+LLV LPPFLSRP H+YT+++D +CSV++ CG
Sbjct  84   GGTQEDTCCRWLNDVDDECICELLVRLPPFLSRPRHEYTIKIDDSCSVSYTCG  136



>emb|CDP03605.1| unnamed protein product [Coffea canephora]
Length=185

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +2

Query  530  VQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            V+  CC WL  +D ECVCDLLV+LPPFLSRP+H+YTV V  +C+VTFQC SRI
Sbjct  131  VEASCCHWLGTIDSECVCDLLVYLPPFLSRPVHEYTVSVKDSCNVTFQCASRI  183



>ref|XP_006444119.1| hypothetical protein CICLE_v10024447mg [Citrus clementina]
 ref|XP_006479752.1| PREDICTED: uncharacterized protein LOC102623449 [Citrus sinensis]
 gb|ESR57359.1| hypothetical protein CICLE_v10024447mg [Citrus clementina]
Length=160

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  536  EDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRIK  691
            E CCRWLK+VDDECVCDLLV LP FL+RP+H YTV VD +C+VT+ C  R++
Sbjct  108  ESCCRWLKQVDDECVCDLLVRLPVFLARPVHTYTVIVDESCNVTYACSGRLR  159



>gb|KDO68789.1| hypothetical protein CISIN_1g044805mg [Citrus sinensis]
Length=139

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  536  EDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRIK  691
            E CCRWLK+VDDECVCDLLV LP FL+RP+H YTV VD +C+VT+ C  R++
Sbjct  87   ESCCRWLKQVDDECVCDLLVRLPVFLARPVHTYTVIVDESCNVTYACSGRLR  138



>gb|EYU46609.1| hypothetical protein MIMGU_mgv1a014816mg [Erythranthe guttata]
Length=177

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  524  SAVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            +  + DCCRWLKE+DD CVC LLV LP FL+RP+H YTV VD +C+++F CGSR+
Sbjct  121  TQAEGDCCRWLKEIDDVCVCGLLVRLPAFLTRPVHNYTVVVDESCTISFACGSRL  175



>ref|XP_010039258.1| PREDICTED: proline-rich protein 13-like [Eucalyptus grandis]
Length=191

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  524  SAVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            S  ++DCC+WLKEVD ECVCDLLV LP FL+RP+H YTV V   C+VTF CG R+
Sbjct  135  SPAEQDCCKWLKEVDSECVCDLLVRLPSFLTRPIHVYTVTVPDLCNVTFSCGGRL  189



>gb|KCW49923.1| hypothetical protein EUGRSUZ_K03387 [Eucalyptus grandis]
Length=182

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  524  SAVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            S  ++DCC+WLKEVD ECVCDLLV LP FL+RP+H YTV V   C+VTF CG R+
Sbjct  126  SPAEQDCCKWLKEVDSECVCDLLVRLPSFLTRPIHVYTVTVPDLCNVTFSCGGRL  180



>ref|XP_007050664.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma 
cacao]
 gb|EOX94821.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma 
cacao]
Length=150

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  539  DCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            +CCRWLKEVD ECVC++LVHLP FLSRP H YTV VD TCS TF CG RI
Sbjct  98   NCCRWLKEVDHECVCEVLVHLPVFLSRPNHDYTVIVDETCSHTFTCGGRI  147



>ref|XP_006352782.1| PREDICTED: UBX domain-containing protein 11-like [Solanum tuberosum]
Length=174

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  530  VQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRIK  691
             +E+CCRW+K VD ECVC LL HLP FL+RP+H+YT     TCSVTF CGS  +
Sbjct  108  AEEECCRWMKAVDSECVCSLLAHLPTFLARPIHQYTTLAHATCSVTFTCGSSAR  161



>emb|CDX93936.1| BnaC04g20950D [Brassica napus]
Length=260

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  524  SAVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            +  Q+DCC+WL+++D+ECVCDLLV LPP LS+P H YTV VD +C VTF CG R+
Sbjct  204  TYAQQDCCKWLRQIDNECVCDLLVTLPPLLSKPAHNYTVFVDDSCIVTFTCGGRL  258



>ref|XP_010316744.1| PREDICTED: uncharacterized protein LOC104645827 [Solanum lycopersicum]
Length=158

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +2

Query  530  VQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRIKI  694
            V+E+CCRW+K VD ECVC LL HLP FLSRP+H+YT     TCSVTF C S  + 
Sbjct  92   VEEECCRWMKAVDSECVCSLLAHLPIFLSRPIHQYTTLAHATCSVTFTCASSARF  146



>emb|CDX89172.1| BnaA04g00140D [Brassica napus]
Length=268

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  524  SAVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            +  Q+DCC+WL+++D+ECVCDLLV LPP LS+P H YTV VD +C VTF CG R+
Sbjct  212  TYAQQDCCKWLRQIDNECVCDLLVTLPPLLSKPAHNYTVFVDDSCIVTFTCGGRL  266



>ref|XP_002533067.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29306.1| conserved hypothetical protein [Ricinus communis]
Length=143

 Score = 80.5 bits (197),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  536  EDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRIK  691
            +DCCRWL ++DDEC+C+LLV LPPFL+RPLH+YTV +   C+VT+ C  R++
Sbjct  91   DDCCRWLNDLDDECICELLVRLPPFLARPLHQYTVVIADACNVTYTCSGRVR  142



>ref|NP_001078333.1| protease inhibitor/seed storage/LTP family protein [Arabidopsis 
thaliana]
 gb|AEE80435.1| protease inhibitor/seed storage/LTP family protein [Arabidopsis 
thaliana]
Length=250

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  533  QEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            Q++CC+WLK++D+ECVCDLLV LPP L++P+H YTV VD +C VTF CG R+
Sbjct  197  QQECCKWLKQMDNECVCDLLVRLPPLLAKPIHNYTVFVDESCIVTFVCGGRL  248



>ref|XP_010090376.1| hypothetical protein L484_025041 [Morus notabilis]
 gb|EXB39346.1| hypothetical protein L484_025041 [Morus notabilis]
Length=156

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  533  QEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            ++DCCRWL E+D +CVC++LVHLP FLSRP+H+Y++ V  TC+VT+ CG R+
Sbjct  102  EDDCCRWLYEIDTDCVCEMLVHLPDFLSRPVHEYSLIVGDTCNVTYSCGGRV  153



>ref|XP_009104413.1| PREDICTED: histidine-rich glycoprotein-like [Brassica rapa]
Length=250

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  533  QEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            Q++CC+WLK++D+ECVCDLLV LPP L++P H YTV VD +C VT+ CG R+
Sbjct  197  QQECCKWLKQMDNECVCDLLVRLPPLLAKPAHNYTVFVDESCIVTYTCGGRL  248



>ref|XP_002302826.1| hypothetical protein POPTR_0002s22550g [Populus trichocarpa]
 gb|EEE82099.1| hypothetical protein POPTR_0002s22550g [Populus trichocarpa]
Length=139

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = +2

Query  524  SAVQED-CCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCG  679
               QED CCRWL +VDDECVC LLV LPPFLSR  H+YT+++D +CSV++ CG
Sbjct  85   GGTQEDTCCRWLNDVDDECVCQLLVRLPPFLSRTRHEYTIKIDDSCSVSYTCG  137



>ref|XP_010468887.1| PREDICTED: probable zinc transporter protein DDB_G0283629 [Camelina 
sativa]
Length=241

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  533  QEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            Q++CC+WLK++D+ECVCDLLV LPP L++P+H YTV VD +C VTF CG R 
Sbjct  188  QQECCKWLKQMDNECVCDLLVRLPPLLAKPIHNYTVFVDESCIVTFVCGGRF  239



>ref|XP_010413198.1| PREDICTED: nonsense-mediated mRNA decay protein 2-like [Camelina 
sativa]
Length=248

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  533  QEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            Q++CC+WLK++D+ECVCDLLV LPP L++P+H YTV VD +C VTF CG R 
Sbjct  195  QQECCKWLKQMDNECVCDLLVRLPPLLAKPIHNYTVFVDESCIVTFVCGGRF  246



>emb|CDX67917.1| BnaA07g19570D [Brassica napus]
Length=239

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  524  SAVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            +  Q++CC+WLK++D+ECVCDLLV LPP L++P H YTV VD +C VT+ CG R+
Sbjct  183  TYAQQECCKWLKQMDNECVCDLLVRLPPLLAKPAHNYTVFVDESCIVTYTCGGRL  237



>ref|XP_010512716.1| PREDICTED: histidine-rich glycoprotein-like [Camelina sativa]
Length=259

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  533  QEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            Q++CC+WLK++D+ECVCDLLV LPP L++P+H YTV VD +C VTF CG R 
Sbjct  206  QQECCKWLKQMDNECVCDLLVRLPPLLAKPIHNYTVFVDESCIVTFVCGGRF  257



>emb|CDX79421.1| BnaC06g18820D [Brassica napus]
Length=217

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  533  QEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            Q++CC+WLK++D+ECVCDLLV LPP L++P H YTV VD +C VT+ CG R+
Sbjct  164  QQECCKWLKQMDNECVCDLLVRLPPLLAKPAHNYTVFVDESCIVTYTCGGRL  215



>emb|CDY63338.1| BnaA09g55630D [Brassica napus]
Length=227

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  533  QEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            Q++CC+W+K++D+ECVCDLLV LPP L++P H YTV VD +C VTF CG R+
Sbjct  174  QQECCKWVKQMDNECVCDLLVRLPPLLAKPAHDYTVFVDESCIVTFTCGGRL  225



>ref|XP_007144613.1| hypothetical protein PHAVU_007G170000g [Phaseolus vulgaris]
 gb|ESW16607.1| hypothetical protein PHAVU_007G170000g [Phaseolus vulgaris]
Length=136

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  527  AVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
             +QE+CCRW KE+D +CVC++LV LPPFL++PLH+Y++ +  +C+VT+ CG  I
Sbjct  83   TLQENCCRWAKEIDTQCVCEVLVRLPPFLTKPLHQYSIMIGESCNVTYSCGGPI  136



>ref|XP_009116975.1| PREDICTED: LOW QUALITY PROTEIN: probable zinc transporter cis4 
[Brassica rapa]
Length=270

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  533  QEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            Q++CC+W+K++D+ECVCDLLV LPP L++P H YTV VD +C VTF CG R+
Sbjct  217  QQECCKWVKQMDNECVCDLLVRLPPLLAKPAHDYTVFVDESCIVTFTCGGRL  268



>gb|KEH23735.1| Lipid transfer protein-like protein [Medicago truncatula]
Length=171

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  524  SAVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            +A QE+CCRW +EVD++CVC+LLV LPPFL RPLH YT+ +   C +T+ CG  I
Sbjct  117  TAEQENCCRWAREVDNQCVCELLVRLPPFLVRPLHLYTLNIGEDCEITYSCGGPI  171



>ref|XP_006604424.1| PREDICTED: uncharacterized protein LOC102669806 [Glycine max]
 gb|KHN45369.1| hypothetical protein glysoja_028376 [Glycine soja]
Length=155

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  524  SAVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            +A +++CCRW KEVD++CVC+LL+ LPPFL RPLH+YT+ V  +C +T+ CG+ I
Sbjct  101  TADEDNCCRWAKEVDNQCVCELLLRLPPFLIRPLHQYTLNVGESCDITYSCGAPI  155



>gb|KFK35474.1| hypothetical protein AALP_AA5G288900 [Arabis alpina]
Length=249

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  524  SAVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            +  Q++CC+WLK++D+ECVCDLLV LPP L++P H YTV VD +C VT+ CG R 
Sbjct  193  TYAQQECCKWLKQMDNECVCDLLVRLPPLLAKPAHNYTVFVDESCIVTYTCGGRF  247



>gb|KDP21489.1| hypothetical protein JCGZ_21960 [Jatropha curcas]
Length=121

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  536  EDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRIK  691
            E+CCRWL +VD+ECVCDLL+ LP FL+RP H++T+ +  TC++TF C  R++
Sbjct  69   ENCCRWLSDVDNECVCDLLIRLPIFLARPAHQFTIVIGDTCTITFSCSGRVR  120



>gb|EYU38143.1| hypothetical protein MIMGU_mgv1a015131mg [Erythranthe guttata]
Length=167

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  533  QEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            +E+CCRWLK +D  CVC LL++LPPFL+RP H Y V V G C ++F CGSR+
Sbjct  113  EEECCRWLKNIDSVCVCKLLLYLPPFLTRPHHNYGVDVGGLCDISFNCGSRL  164



>ref|XP_007162405.1| hypothetical protein PHAVU_001G149300g [Phaseolus vulgaris]
 gb|ESW34399.1| hypothetical protein PHAVU_001G149300g [Phaseolus vulgaris]
Length=151

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +2

Query  533  QEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            + +CCRW KEVD +CVC++LVHLPPFL RP+H+YT+ +   C VT+ CG+ I
Sbjct  100  ENNCCRWAKEVDSQCVCEILVHLPPFLIRPVHQYTLNIGDACDVTYSCGAPI  151



>ref|XP_010684244.1| PREDICTED: uncharacterized protein LOC104898831 [Beta vulgaris 
subsp. vulgaris]
Length=165

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  524  SAVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            +A  E+CCRWLKEVD +CVCDLLV LP FL++P H +TV V   CSVT+QC  R+
Sbjct  109  NAAVEECCRWLKEVDTQCVCDLLVRLPIFLAKPAHDFTVAVSDDCSVTYQCPGRV  163



>ref|XP_008235264.1| PREDICTED: protein catecholamines up [Prunus mume]
Length=149

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +2

Query  524  SAVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRIKI  694
            S  +++CCRWL ++D+ECVC+LLVHLP FL +P H YTV V  +C VT+ CG+ I+I
Sbjct  91   SPAEDNCCRWLTQLDNECVCELLVHLPTFLLKPTHAYTVTVGESCRVTYTCGTPIRI  147



>emb|CDY64155.1| BnaCnng43330D [Brassica napus]
Length=612

 Score = 80.1 bits (196),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  524  SAVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            +  Q++CC+W+K++D+ECVCDLLV LPP L++P H YTV VD +C VTF CG R+
Sbjct  556  TYAQQECCKWVKQMDNECVCDLLVRLPPLLAKPAHNYTVFVDESCIVTFTCGGRL  610



>ref|XP_008368867.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103432449 
[Malus domestica]
Length=168

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  533  QEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRIKI  694
            +++CC+WL ++D+ECVC+LLVHLP FL RP H Y+V V  TC+V++ CG+ I+I
Sbjct  113  EDNCCKWLNQLDNECVCELLVHLPNFLIRPAHAYSVAVGETCTVSYTCGTPIRI  166



>ref|XP_007199171.1| hypothetical protein PRUPE_ppa021373mg, partial [Prunus persica]
 gb|EMJ00370.1| hypothetical protein PRUPE_ppa021373mg, partial [Prunus persica]
Length=156

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  524  SAVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRIKI  694
            S  +++CCRWL ++D+ECVC+LLVHLP FL +P H YTV V   C VT+ CG+ I+I
Sbjct  98   SPAEDNCCRWLTQLDNECVCELLVHLPTFLLKPTHAYTVAVGEFCRVTYTCGTPIRI  154



>ref|XP_006576887.1| PREDICTED: uncharacterized protein LOC102666530 [Glycine max]
 gb|KHN19876.1| hypothetical protein glysoja_033508 [Glycine soja]
Length=144

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  533  QEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            +++CCRW KEVD +CVC+LL+ LPPFL RP H+YT++V  +C +T+ CG+ I
Sbjct  93   EDNCCRWAKEVDHQCVCELLLRLPPFLIRPSHQYTLKVGASCDITYSCGAPI  144



>ref|XP_009356752.1| PREDICTED: transcription cofactor vestigial-like protein 3 [Pyrus 
x bretschneideri]
Length=205

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  533  QEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRIKI  694
            +++CCRWL ++D++CVC+LLVHLP FL RP H Y+V +  TC+VT+ CG+ I+I
Sbjct  150  EDNCCRWLTQLDNQCVCELLVHLPNFLVRPAHVYSVVIGETCTVTYTCGTPIRI  203



>ref|XP_006658907.1| PREDICTED: protein PFC0760c-like [Oryza brachyantha]
Length=188

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  536  EDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGS  682
             DCCRWLKEVD  CVC+ L+ LPPFL++P HKYTVRV   C +T++CG 
Sbjct  139  SDCCRWLKEVDPACVCEALLRLPPFLTKPQHKYTVRVAKNCKLTYRCGG  187



>ref|XP_011033687.1| PREDICTED: uncharacterized protein LOC105132093 [Populus euphratica]
Length=156

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +2

Query  530  VQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQC  676
            ++E+CCRWL +VD ECVC LLV LPPFLS+P H+YTV+++ +CSV++ C
Sbjct  108  LEENCCRWLSDVDPECVCQLLVRLPPFLSKPHHEYTVKINDSCSVSYSC  156



>ref|XP_002320394.1| hypothetical protein POPTR_0014s13520g [Populus trichocarpa]
 gb|EEE98709.1| hypothetical protein POPTR_0014s13520g [Populus trichocarpa]
Length=152

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  524  SAVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            S+ +++CC+WLKE+D+ECVCD+L  LPPFLS+P H YTV V   C+VT+ C   +
Sbjct  98   SSSEDNCCKWLKELDEECVCDVLYRLPPFLSKPTHTYTVYVAEACNVTYSCDMHL  152



>ref|XP_006375480.1| hypothetical protein POPTR_0014s13530g [Populus trichocarpa]
 gb|ERP53277.1| hypothetical protein POPTR_0014s13530g [Populus trichocarpa]
Length=89

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  530  VQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQC  676
            ++++CCRWL +VD ECVC+LLV LPPFLS+P H+YTV+++ +CSV++ C
Sbjct  41   LEQNCCRWLSDVDPECVCELLVRLPPFLSKPHHEYTVKINDSCSVSYSC  89



>gb|EAZ04978.1| hypothetical protein OsI_27158 [Oryza sativa Indica Group]
Length=141

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  533  QEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGS  682
              DCCRWLKEV+  CVCD L+ LPPFL +P HKYTV+V  +C  T+ CG 
Sbjct  91   NRDCCRWLKEVEPACVCDALLRLPPFLVKPQHKYTVKVGDSCKYTYHCGG  140



>ref|NP_001149735.1| AAA ATPase containing von Willebrand factor type A precursor 
[Zea mays]
 gb|ACG36602.1| AAA ATPase containing von Willebrand factor type A [Zea mays]
Length=255

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  536  EDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGS  682
             DCCRWLKEV  ECVC+ L+ LPPFL +P H Y VRV  TC++T++CG 
Sbjct  206  RDCCRWLKEVQKECVCEALLRLPPFLVKPQHTYVVRVGRTCNITYRCGG  254



>ref|NP_001158897.1| AAA ATPase containing von Willebrand factor type A precursor 
[Zea mays]
 gb|ACF84246.1| unknown [Zea mays]
 gb|ACF85356.1| unknown [Zea mays]
 tpg|DAA45451.1| TPA: AAA ATPase containing von Willebrand factor type A [Zea 
mays]
Length=254

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  536  EDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGS  682
             DCCRWLKEV  ECVC+ L+ LPPFL +P H Y VRV  TC++T++CG 
Sbjct  205  RDCCRWLKEVQKECVCEALLRLPPFLVKPQHTYVVRVGRTCNITYRCGG  253



>ref|XP_004495224.1| PREDICTED: uncharacterized protein LOC101511533 [Cicer arietinum]
Length=173

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  524  SAVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            S  +++CCRW KE+D  CVC++LV LPPFL+RPLH+Y+V +  +C +T+ CG  I
Sbjct  119  STEEDNCCRWAKEMDSRCVCEILVRLPPFLTRPLHQYSVVIGESCVITYSCGGPI  173



>ref|XP_008386520.1| PREDICTED: uncharacterized protein LOC103449030 [Malus domestica]
Length=139

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = +2

Query  533  QEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGS--RIKI  694
            +++CCRWL ++D++CVC+LL HLP FL RP H Y+V +  TC+VT+ CG+  RIKI
Sbjct  84   EDNCCRWLTQLDNQCVCELLAHLPNFLVRPAHVYSVVIGETCTVTYTCGTPVRIKI  139



>ref|XP_004493654.1| PREDICTED: uncharacterized protein LOC101500505 [Cicer arietinum]
Length=161

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +2

Query  533  QEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            +++CCRW +EVD +CVC+LLV LPPFL RPLH YT+ +   C +T+ CG  I
Sbjct  110  EDNCCRWAREVDSQCVCELLVRLPPFLVRPLHVYTLAIGDDCEITYSCGGPI  161



>ref|NP_001140718.1| uncharacterized protein LOC100272793 precursor [Zea mays]
 gb|ACF84453.1| unknown [Zea mays]
 tpg|DAA63938.1| TPA: AAA ATPase containing von Willebrand factor type A [Zea 
mays]
Length=282

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  536  EDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGS  682
             DCCRWLKEV+ +CVC+ L+ LPPFL +P HKYTV+V  +C  T++CG 
Sbjct  233  RDCCRWLKEVEPDCVCEALLRLPPFLVKPQHKYTVKVGNSCKFTYRCGG  281



>ref|XP_011033686.1| PREDICTED: metal tolerance protein 1-like [Populus euphratica]
Length=146

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +2

Query  524  SAVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            S+ +++CC+WLKE+D+ECVCD+L  LP FLS+P H YTV V   C+VT+ C   +
Sbjct  92   SSSEDNCCKWLKELDEECVCDVLYRLPSFLSKPAHTYTVNVAEACNVTYSCDMHL  146



>ref|NP_001150311.1| AAA ATPase containing von Willebrand factor type A precursor 
[Zea mays]
 gb|ACG38612.1| AAA ATPase containing von Willebrand factor type A [Zea mays]
Length=278

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  536  EDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCG  679
             DCCRWLKEV+ +CVC+ L+ LPPFL +P HKYTV+V  +C  T++CG
Sbjct  229  RDCCRWLKEVEPDCVCEALLRLPPFLVKPQHKYTVKVGNSCKFTYRCG  276



>gb|ACG37671.1| aspartic acid-rich protein [Zea mays]
Length=160

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  536  EDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGS  682
             DCCRWLKEV+ +CVC+ L+ LPPFL +P HKYTV+V  +C  T++CG 
Sbjct  111  RDCCRWLKEVEPDCVCEALLRLPPFLVKPQHKYTVKVGNSCKFTYRCGG  159



>ref|NP_001050142.1| Os03g0357500 [Oryza sativa Japonica Group]
 gb|ABF96048.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF12056.1| Os03g0357500 [Oryza sativa Japonica Group]
Length=264

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  536  EDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGS  682
             DCCRWL+EV  +CVCD L+ LPPFL +P H Y VRV  TC +T++CG 
Sbjct  215  RDCCRWLQEVSKDCVCDALMRLPPFLVKPQHTYVVRVGRTCKITYRCGG  263



>ref|XP_003557893.1| PREDICTED: sarcoplasmic reticulum histidine-rich calcium-binding 
protein-like [Brachypodium distachyon]
Length=280

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  536  EDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGS  682
             DCCRWL+EV  +CVCD L+ LPPFL +P HKY VRV  TC + ++CG 
Sbjct  231  RDCCRWLQEVQKDCVCDALLRLPPFLVKPQHKYVVRVGRTCRIVYRCGG  279



>ref|XP_004136185.1| PREDICTED: uncharacterized protein LOC101206671 [Cucumis sativus]
 gb|KGN44871.1| hypothetical protein Csa_7G392440 [Cucumis sativus]
Length=149

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  530  VQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGS  682
            ++E+CC+W+++VD ECVC+LL  LP FL RP+H ++V + G+C+ T+ CG 
Sbjct  96   IEENCCKWVQQVDSECVCELLSRLPAFLKRPIHNFSVTIGGSCNATYWCGG  146



>ref|XP_002465242.1| hypothetical protein SORBIDRAFT_01g034880 [Sorghum bicolor]
 gb|EER92240.1| hypothetical protein SORBIDRAFT_01g034880 [Sorghum bicolor]
Length=268

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  536  EDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGS  682
             DCCRWLKEV  +CVC+ L+ LPPFL +P H Y VRV  TC +T++CG 
Sbjct  219  RDCCRWLKEVQKDCVCEALLRLPPFLVKPQHTYVVRVGRTCKITYRCGG  267



>gb|EEC75289.1| hypothetical protein OsI_11632 [Oryza sativa Indica Group]
Length=210

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  536  EDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGS  682
             DCCRWL+EV  +CVCD L+ LPPFL +P H Y VRV  TC +T++CG 
Sbjct  161  RDCCRWLQEVSKDCVCDALMRLPPFLVKPQHTYVVRVGRTCKITYRCGG  209



>ref|XP_010256204.1| PREDICTED: uncharacterized protein LOC104596643 [Nelumbo nucifera]
Length=149

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +2

Query  536  EDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            E+CCRWL+EVD  CVC L V +P FL RPLH YT+ VD TC V F+C  ++
Sbjct  98   EECCRWLREVDSMCVCQLFVPMPTFLRRPLHSYTIMVDHTCKVVFKCPQQL  148



>ref|XP_004984320.1| PREDICTED: protein PFC0760c-like [Setaria italica]
Length=273

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  536  EDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGS  682
             DCCRWLKEV  +CVC+ L+ LPPFL +P H Y VRV  TC +T++CG 
Sbjct  224  RDCCRWLKEVQKDCVCEALLRLPPFLVKPQHTYVVRVGRTCQITYRCGG  272



>ref|NP_001152240.1| aspartic acid-rich protein precursor [Zea mays]
 gb|ACG46563.1| aspartic acid-rich protein [Zea mays]
Length=252

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  536  EDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGS  682
             DCCRWLKEV  +CVC+ L+ LPPFL +P H Y VRV  TC +T++CG 
Sbjct  203  RDCCRWLKEVQKDCVCEALLRLPPFLVKPQHTYVVRVGRTCKITYRCGG  251



>ref|NP_001140990.1| aspartic acid-rich protein precursor [Zea mays]
 gb|ACF85117.1| unknown [Zea mays]
 gb|AFW88333.1| aspartic acid-rich protein [Zea mays]
Length=258

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +2

Query  536  EDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGS  682
             DCCRWLKEV  +CVC+ L+ LPPFL +P H Y VRV  TC +T++CG 
Sbjct  209  RDCCRWLKEVQKDCVCEALLRLPPFLVKPQHTYVVRVGRTCKITYRCGG  257



>gb|EMT17194.1| Putative pectinesterase 66 [Aegilops tauschii]
Length=411

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  536  EDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGS  682
             DCCRWLKEV+  CVC+ L+HLP FL +P HKYT+RV  TC VT++CG 
Sbjct  359  RDCCRWLKEVEPGCVCESLLHLPMFLVKPQHKYTLRVGKTCEVTYRCGG  407



>gb|EEE67730.1| hypothetical protein OsJ_25410 [Oryza sativa Japonica Group]
Length=272

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  533  QEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGS  682
              DCCRWLKEV+  CVCD L+ LPPFL +P HKYTV+V  +C  T+ CG 
Sbjct  222  NRDCCRWLKEVEPACVCDALLRLPPFLVKPQHKYTVKVGDSCKYTYHCGG  271



>ref|NP_001060499.1| Os07g0655800 [Oryza sativa Japonica Group]
 dbj|BAC20796.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAU01905.1| hypothetical protein [Oryza sativa Indica Group]
 dbj|BAF22413.1| Os07g0655800 [Oryza sativa Japonica Group]
Length=299

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  533  QEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGS  682
              DCCRWLKEV+  CVCD L+ LPPFL +P HKYTV+V  +C  T+ CG 
Sbjct  249  NRDCCRWLKEVEPACVCDALLRLPPFLVKPQHKYTVKVGDSCKYTYHCGG  298



>ref|XP_002463297.1| hypothetical protein SORBIDRAFT_02g041423 [Sorghum bicolor]
 gb|EER99818.1| hypothetical protein SORBIDRAFT_02g041423 [Sorghum bicolor]
Length=121

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +2

Query  536  EDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQC  676
             DCCRWLKEV+ +CVC+ L+ LPPFL RP HKYTV+V  +C  +++C
Sbjct  75   RDCCRWLKEVEPDCVCEALLRLPPFLVRPQHKYTVKVGNSCKFSYRC  121



>ref|XP_003637691.1| AAA ATPase containing von Willebrand factor type A [Medicago 
truncatula]
 gb|KEH40590.1| hypothetical protein MTR_1g032050 [Medicago truncatula]
 gb|KEH40619.1| hypothetical protein MTR_1g032400 [Medicago truncatula]
Length=156

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +2

Query  533  QEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            +++CCRW + +D  CVC++LV LPPFL RPLH Y+V    +C+VT+ CG  I
Sbjct  105  EDNCCRWARALDSRCVCEILVRLPPFLIRPLHTYSVVFGESCTVTYSCGGPI  156



>ref|XP_008451383.1| PREDICTED: protein FAM76B [Cucumis melo]
Length=151

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 41/55 (75%), Gaps = 2/55 (4%)
 Frame = +2

Query  524  SAVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDG--TCSVTFQCGS  682
            S ++E+CC+W+++VD ECVC+LL  LP FL RP+H ++V + G  +C+ T+ CG 
Sbjct  94   SPIEENCCKWVQQVDSECVCELLSRLPAFLKRPIHNFSVIIGGSLSCNATYSCGG  148



>ref|XP_006651394.1| PREDICTED: probable serine/threonine-protein kinase fhkB-like 
[Oryza brachyantha]
Length=127

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  536  EDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGS  682
             DCCRWL+EV  +CVCD L+ L P L +P H Y VRV  TC +T++CG 
Sbjct  78   RDCCRWLQEVSKDCVCDALLRLAPVLVKPQHTYVVRVGRTCRITYRCGG  126



>dbj|BAK07112.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=280

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +2

Query  536  EDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGS  682
             DCCRWL+EV  +CVC+ L+ LPPFL +P HKY VRV  TC + ++ G 
Sbjct  231  RDCCRWLQEVQKDCVCEALLRLPPFLVKPQHKYVVRVGRTCRIVYRRGG  279



>ref|XP_004958535.1| PREDICTED: guanine nucleotide-binding protein-like 3 homolog 
[Setaria italica]
Length=276

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  536  EDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCG  679
             DCCRWLKEV+ +CVC  L+ LP FL +P HKYTVRV  +C   ++CG
Sbjct  227  RDCCRWLKEVEPDCVCQALLRLPSFLVKPQHKYTVRVGHSCKFIYRCG  274



>ref|XP_002305616.2| hypothetical protein POPTR_0004s02190g, partial [Populus trichocarpa]
 gb|EEE86127.2| hypothetical protein POPTR_0004s02190g, partial [Populus trichocarpa]
Length=84

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  527  AVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQC  676
            +++E+CC+WL  +D ECVC LL  LP FLS+P H+YT+ V  +C++T+ C
Sbjct  33   SIEENCCKWLGALDKECVCGLLHRLPVFLSKPAHQYTLYVSNSCNITYAC  82



>ref|XP_002533068.1| hypothetical protein RCOM_0176280 [Ricinus communis]
 gb|EEF29307.1| hypothetical protein RCOM_0176280 [Ricinus communis]
Length=243

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +2

Query  524  SAVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            S +Q++CC  L ++DDEC C LLVHLPP  SR  H Y + VD +CSV+F+C  R 
Sbjct  188  SYLQKECCDLLNDIDDECACLLLVHLPPAFSRLAHTYNIYVDESCSVSFKCEGRF  242



>ref|XP_010242431.1| PREDICTED: protein catecholamines up-like [Nelumbo nucifera]
Length=189

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +2

Query  539  DCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSR  685
            +CCRW++E+D  CVC L+V LP FL R  H YTVRV+ +C V F+C  R
Sbjct  140  ECCRWVRELDSTCVCQLMVQLPLFLRRSPHTYTVRVEDSCQVKFECPGR  188



>ref|XP_010524012.1| PREDICTED: pleckstrin homology-like domain family A member 1 
[Tarenaya hassleriana]
 ref|XP_010524013.1| PREDICTED: pleckstrin homology-like domain family A member 1 
[Tarenaya hassleriana]
Length=193

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  524  SAVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            S  + +CC+WLK++D+ECVCDLL+HLPP L+RP+H YTV VD +C VTF CG R 
Sbjct  137  SFAEAECCKWLKQMDNECVCDLLLHLPPLLARPVHDYTVFVDESCIVTFSCGGRF  191



>ref|XP_008776443.1| PREDICTED: protein catecholamines up-like [Phoenix dactylifera]
Length=180

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +2

Query  530  VQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGS  682
            V ++CCRWL EVD+ CVC+ L+ +PPFL +  H Y ++V  TC   + CG 
Sbjct  129  VNKNCCRWLAEVDEACVCEALLRMPPFLVKAKHTYIIKVGKTCKHEYNCGG  179



>ref|XP_010942492.1| PREDICTED: uncharacterized protein LOC105060474 [Elaeis guineensis]
Length=148

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  530  VQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQC  676
            V  DCCRWL EVD+ CVC+ L+ +PPF  +  H Y ++V  TC   + C
Sbjct  97   VNTDCCRWLAEVDEACVCEALLRMPPFFIKAKHTYIIKVGKTCKHEYNC  145



>gb|KHN03781.1| hypothetical protein glysoja_011010 [Glycine soja]
Length=148

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  524  SAVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            ++ +E+CCRW +E+D++CVC+ L+ LPPFL+RPLH+Y++ +  +C+VT+ CG  I
Sbjct  94   TSQEENCCRWAREMDNQCVCEFLLLLPPFLTRPLHQYSISIGESCNVTYSCGGPI  148



>gb|KHN18894.1| hypothetical protein glysoja_028263 [Glycine soja]
Length=148

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  524  SAVQEDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQCGSRI  688
            ++ +E+CCRW KE+D++CVC+ L+ LPPFL+RPLH+Y++ +  +C+ T+ CG  I
Sbjct  94   TSQEENCCRWAKEMDNQCVCEFLLLLPPFLTRPLHQYSISIGESCNATYSCGGPI  148



>ref|XP_006850779.1| hypothetical protein AMTR_s00025p00092990 [Amborella trichopoda]
 gb|ERN12360.1| hypothetical protein AMTR_s00025p00092990 [Amborella trichopoda]
Length=142

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  536  EDCCRWLKEVDDECVCDLLVHLPPFLSRPLHKYTVRVDGTCSVTFQC  676
              CCRWL+++D+ CVC +L  LP FLS+P    T+  D  CSVT++C
Sbjct  93   SSCCRWLRQIDNACVCHVLNRLPVFLSKPSSSITLTPDEYCSVTYRC  139



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2339198799562