BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80021_g1_i1 len=1784 path=[1:0-1783]

Length=1784
                                                                      Score     E

ref|XP_011098591.1|  PREDICTED: uncharacterized protein LOC105177224    717   0.0      
ref|XP_009782555.1|  PREDICTED: uncharacterized protein LOC104231286    706   0.0      
ref|XP_009621314.1|  PREDICTED: uncharacterized protein LOC104112...    704   0.0      
ref|XP_010661033.1|  PREDICTED: uncharacterized protein LOC104881693    697   0.0      
ref|XP_009621315.1|  PREDICTED: uncharacterized protein LOC104112...    697   0.0      
ref|XP_010242400.1|  PREDICTED: uncharacterized protein LOC104586761    692   0.0      
emb|CBI22171.3|  unnamed protein product                                694   0.0      
ref|XP_006587758.1|  PREDICTED: uncharacterized protein LOC100791552    688   0.0      
emb|CDP02211.1|  unnamed protein product                                686   0.0      
ref|XP_007099708.1|  Quinohemoprotein ethanol dehydrogenase type-1      683   0.0      
ref|XP_010661142.1|  PREDICTED: uncharacterized protein LOC104877357    681   0.0      
ref|XP_008230740.1|  PREDICTED: uncharacterized protein LOC103329981    681   0.0      
gb|EYU34100.1|  hypothetical protein MIMGU_mgv1a026159mg                678   0.0      
ref|XP_007216818.1|  hypothetical protein PRUPE_ppa022972mg             680   0.0      
gb|ABN08942.1|  Quinonprotein alcohol dehydrogenase-like                673   0.0      Medicago truncatula
ref|XP_007139594.1|  hypothetical protein PHAVU_008G042900g             670   0.0      
ref|XP_004489158.1|  PREDICTED: polyvinylalcohol dehydrogenase-like     667   0.0      
ref|XP_007139592.1|  hypothetical protein PHAVU_008G042700g             667   0.0      
ref|XP_008230739.1|  PREDICTED: uncharacterized protein LOC103329980    663   0.0      
ref|XP_010661143.1|  PREDICTED: uncharacterized protein LOC104877332    660   0.0      
ref|XP_003621148.1|  Quinohaemoprotein ethanol dehydrogenase type-1     658   0.0      
ref|XP_003621152.1|  Quinohaemoprotein ethanol dehydrogenase type-1     659   0.0      
ref|XP_004147493.1|  PREDICTED: polyvinylalcohol dehydrogenase-like     656   0.0      
ref|XP_004304938.1|  PREDICTED: polyvinylalcohol dehydrogenase-like     655   0.0      
emb|CDP11594.1|  unnamed protein product                                655   0.0      
ref|XP_008443424.1|  PREDICTED: uncharacterized protein LOC103487015    653   0.0      
ref|XP_008341556.1|  PREDICTED: uncharacterized protein LOC103404426    653   0.0      
ref|XP_009347060.1|  PREDICTED: uncharacterized protein LOC103938746    652   0.0      
ref|XP_004302347.1|  PREDICTED: polyvinylalcohol dehydrogenase-like     651   0.0      
ref|XP_004304937.1|  PREDICTED: polyvinylalcohol dehydrogenase-like     647   0.0      
ref|XP_006345832.1|  PREDICTED: uncharacterized protein LOC102598039    639   0.0      
ref|XP_007217415.1|  hypothetical protein PRUPE_ppa025769mg             640   0.0      
gb|KDP45487.1|  hypothetical protein JCGZ_09736                         641   0.0      
emb|CBI22172.3|  unnamed protein product                                676   0.0      
ref|XP_007216718.1|  hypothetical protein PRUPE_ppa026320mg             635   0.0      
ref|XP_008379337.1|  PREDICTED: uncharacterized protein LOC103442334    633   0.0      
ref|XP_008230741.1|  PREDICTED: uncharacterized protein LOC103329982    633   0.0      
gb|KHN13642.1|  Quinohemoprotein ethanol dehydrogenase type-1           625   0.0      
ref|XP_006602902.1|  PREDICTED: uncharacterized protein LOC102669135    625   0.0      
gb|KHN13644.1|  Quinohemoprotein ethanol dehydrogenase type-1           624   0.0      
ref|XP_008348222.1|  PREDICTED: uncharacterized protein LOC103411362    622   0.0      
ref|XP_006602903.1|  PREDICTED: uncharacterized protein LOC102669266    619   0.0      
gb|KHN13641.1|  Quinohemoprotein ethanol dehydrogenase type-1           619   0.0      
emb|CBI22173.3|  unnamed protein product                                615   0.0      
ref|XP_006602900.1|  PREDICTED: uncharacterized protein LOC102668...    617   0.0      
ref|XP_010690063.1|  PREDICTED: uncharacterized protein LOC104903...    616   0.0      
ref|XP_007139593.1|  hypothetical protein PHAVU_008G042800g             615   0.0      
ref|XP_010690064.1|  PREDICTED: uncharacterized protein LOC104903...    614   0.0      
ref|XP_010693329.1|  PREDICTED: uncharacterized protein LOC104906291    610   0.0      
ref|XP_010661145.1|  PREDICTED: uncharacterized protein LOC100853307    607   0.0      
gb|KHN13638.1|  Quinohemoprotein ethanol dehydrogenase type-1           608   0.0      
ref|XP_006431100.1|  hypothetical protein CICLE_v10013418mg             605   0.0      
ref|XP_006374054.1|  hypothetical protein POPTR_0016s14620g             605   0.0      
ref|XP_004298441.1|  PREDICTED: polyvinylalcohol dehydrogenase-like     607   0.0      
ref|XP_010068793.1|  PREDICTED: uncharacterized protein LOC104455756    605   0.0      
ref|XP_010096357.1|  hypothetical protein L484_021105                   602   0.0      
ref|XP_004489157.1|  PREDICTED: polyvinylalcohol dehydrogenase-like     599   0.0      
ref|XP_006363936.1|  PREDICTED: uncharacterized protein LOC102580594    598   0.0      
gb|KHN11593.1|  Quinohemoprotein ethanol dehydrogenase type-1           598   0.0      
ref|XP_010066940.1|  PREDICTED: uncharacterized protein LOC104453970    593   0.0      
ref|XP_009765669.1|  PREDICTED: uncharacterized protein LOC104217192    592   0.0      
ref|XP_009627242.1|  PREDICTED: uncharacterized protein LOC104117826    590   0.0      
gb|EYU28721.1|  hypothetical protein MIMGU_mgv1a019021mg                587   0.0      
gb|KCW64987.1|  hypothetical protein EUGRSUZ_G02531                     584   0.0      
gb|EYU28720.1|  hypothetical protein MIMGU_mgv1a019168mg                584   0.0      
ref|XP_011087060.1|  PREDICTED: uncharacterized protein LOC105168623    582   0.0      
ref|XP_006438637.1|  hypothetical protein CICLE_v10033589mg             573   0.0      
ref|XP_010652339.1|  PREDICTED: uncharacterized protein LOC104879808    573   0.0      
emb|CBI31999.3|  unnamed protein product                                574   0.0      
ref|XP_010652333.1|  PREDICTED: uncharacterized protein LOC104879807    565   0.0      
gb|EYU28719.1|  hypothetical protein MIMGU_mgv1a017992mg                564   0.0      
emb|CDP21840.1|  unnamed protein product                                556   0.0      
ref|XP_008379826.1|  PREDICTED: uncharacterized protein LOC103442802    548   0.0      
ref|XP_010683398.1|  PREDICTED: uncharacterized protein LOC104898088    521   5e-176   
ref|XP_008390061.1|  PREDICTED: uncharacterized protein LOC103452339    514   7e-172   
gb|KDO72515.1|  hypothetical protein CISIN_1g040693mg                   505   8e-172   
emb|CAN66558.1|  hypothetical protein VITISV_001825                     496   4e-166   Vitis vinifera
ref|XP_006602901.1|  PREDICTED: uncharacterized protein LOC102668...    481   9e-161   
gb|KDP21213.1|  hypothetical protein JCGZ_21684                         469   3e-157   
ref|XP_007099711.1|  Quinohemoprotein ethanol dehydrogenase type-1      482   3e-157   
gb|EPS61948.1|  hypothetical protein M569_12846                         466   1e-154   
ref|XP_001757145.1|  predicted protein                                  467   2e-153   
gb|KDO82850.1|  hypothetical protein CISIN_1g039692mg                   450   1e-149   
ref|XP_004167481.1|  PREDICTED: polyvinylalcohol dehydrogenase-like     440   9e-147   
ref|XP_002960975.1|  hypothetical protein SELMODRAFT_437427             437   1e-143   
ref|XP_002967034.1|  hypothetical protein SELMODRAFT_408373             436   4e-143   
ref|XP_007046194.1|  Uncharacterized protein TCM_011786                 426   7e-140   
gb|KHN13633.1|  hypothetical protein glysoja_019320                     411   1e-135   
ref|XP_002974635.1|  hypothetical protein SELMODRAFT_442585             416   2e-134   
ref|XP_002963347.1|  hypothetical protein SELMODRAFT_438505             412   2e-131   
ref|XP_007224952.1|  hypothetical protein PRUPE_ppa021290mg             401   5e-131   
ref|XP_002972263.1|  hypothetical protein SELMODRAFT_441782             403   2e-130   
ref|XP_002984177.1|  hypothetical protein SELMODRAFT_445822             402   4e-130   
ref|XP_006602904.1|  PREDICTED: uncharacterized protein LOC102669536    390   9e-128   
gb|KHN13640.1|  hypothetical protein glysoja_019327                     381   3e-124   
ref|XP_011015276.1|  PREDICTED: uncharacterized protein LOC105118916    379   2e-118   
ref|WP_039748847.1|  hypothetical protein                               370   3e-117   
ref|XP_002963758.1|  hypothetical protein SELMODRAFT_405158             367   2e-116   
ref|XP_002974841.1|  hypothetical protein SELMODRAFT_442588             365   5e-114   
ref|WP_020741593.1|  hypothetical protein                               353   1e-110   
ref|XP_007216879.1|  hypothetical protein PRUPE_ppa020987mg             343   5e-109   
ref|WP_030200207.1|  polyvinylalcohol dehydrogenase                     346   7e-108   
ref|WP_020735240.1|  hypothetical protein                               345   1e-107   
gb|KCW64985.1|  hypothetical protein EUGRSUZ_G02529                     337   8e-106   
ref|WP_012238034.1|  polyvinylalcohol dehydrogenase                     340   8e-106   
ref|WP_013491202.1|  pyrrolo-quinoline quinone repeat-containing ...    339   2e-105   
ref|WP_028785649.1|  polyvinylalcohol dehydrogenase                     333   6e-103   
ref|WP_035356940.1|  hypothetical protein                               332   9e-103   
emb|CDI02935.1|  Pyrrolo-quinoline quinone repeat-containing protein    330   2e-101   
ref|WP_033412672.1|  polyvinylalcohol dehydrogenase                     327   1e-100   
ref|XP_002963759.1|  hypothetical protein SELMODRAFT_438508             323   5e-98    
ref|WP_026292022.1|  polyvinylalcohol dehydrogenase                     320   5e-98    
gb|EXX51333.1|  hypothetical protein RirG_262810                        320   9e-98    
ref|XP_002974840.1|  hypothetical protein SELMODRAFT_442586             316   4e-97    
gb|EXX76536.1|  hypothetical protein RirG_032350                        315   5e-96    
gb|ERZ95657.1|  hypothetical protein GLOINDRAFT_331141                  311   1e-94    
ref|WP_034801302.1|  hypothetical protein                               309   1e-93    
emb|CBI22177.3|  unnamed protein product                                297   1e-92    
emb|CBI22175.3|  unnamed protein product                                307   1e-92    
ref|WP_011687395.1|  pyrrolo-quinoline quinone                          305   2e-92    
ref|WP_014266931.1|  pyrrolo-quinoline quinone                          304   2e-91    
ref|WP_018521987.1|  MULTISPECIES: hypothetical protein                 302   7e-91    
ref|WP_035237051.1|  hypothetical protein                               295   3e-88    
ref|WP_036568982.1|  hypothetical protein                               281   7e-83    
gb|ELQ02887.1|  polyvinylalcohol dehydrogenase                          279   6e-82    
ref|XP_004338620.1|  PQQ enzyme repeat domain containing protein        279   7e-82    
ref|WP_026144241.1|  polyvinylalcohol dehydrogenase                     278   9e-82    
ref|WP_003479338.1|  polyvinyl-alcohol dehydrogenase (acceptor)         279   1e-81    
ref|WP_038239231.1|  polyvinylalcohol dehydrogenase                     279   1e-81    
ref|WP_026143236.1|  polyvinylalcohol dehydrogenase                     278   1e-81    
ref|WP_010342314.1|  polyvinylalcohol dehydrogenase                     278   2e-81    
ref|YP_008319572.1|  pqq-dependent dehydrogenase                        278   3e-81    
ref|WP_014786651.1|  PQQ enzyme repeat-containing protein               275   6e-81    
ref|WP_039007026.1|  polyvinylalcohol dehydrogenase                     276   1e-80    
ref|WP_009583585.1|  exported putative alcohol dehydrogenase (acc...    275   3e-80    
gb|KCW64982.1|  hypothetical protein EUGRSUZ_G02524                     267   4e-80    
ref|WP_035996091.1|  hypothetical protein                               269   1e-78    
gb|ETY80356.1|  hypothetical protein K788_004339                        270   1e-78    
ref|YP_008319373.1|  pyrroloquinoline quinone-dependent alcohol d...    266   4e-77    
ref|WP_039421632.1|  polyvinylalcohol dehydrogenase                     266   5e-77    
ref|WP_011270088.1|  polyvinylalcohol dehydrogenase                     265   6e-77    
ref|WP_037731359.1|  hypothetical protein                               263   2e-76    
ref|WP_029217738.1|  polyvinylalcohol dehydrogenase                     265   2e-76    
ref|WP_019238115.1|  polyvinylalcohol dehydrogenase                     265   2e-76    
ref|WP_011039149.1|  polyvinylalcohol dehydrogenase                     263   3e-76    
ref|WP_005996485.1|  polyvinylalcohol dehydrogenase                     265   3e-76    
ref|WP_014506080.1|  polyvinylalcohol dehydrogenase                     264   3e-76    
ref|WP_024743774.1|  polyvinylalcohol dehydrogenase                     264   5e-76    
ref|WP_029561587.1|  polyvinylalcohol dehydrogenase                     263   2e-75    
gb|EWT01720.1|  polyvinylalcohol dehydrogenase                          260   3e-75    
ref|WP_012439619.1|  polyvinylalcohol dehydrogenase                     261   3e-75    
gb|EWC48990.1|  polyvinylalcohol dehydrogenase                          261   4e-75    
ref|WP_016849815.1|  polyvinylalcohol dehydrogenase                     261   5e-75    
ref|WP_034805109.1|  hypothetical protein                               259   6e-75    
ref|WP_012446370.1|  polyvinylalcohol dehydrogenase                     260   8e-75    
ref|WP_027703799.1|  polyvinylalcohol dehydrogenase                     261   9e-75    
ref|WP_023905681.1|  polyvinylalcohol dehydrogenase                     260   9e-75    
ref|WP_011407346.1|  polyvinylalcohol dehydrogenase                     261   1e-74    
ref|WP_005914566.1|  MULTISPECIES: polyvinylalcohol dehydrogenase       260   2e-74    
ref|WP_008571737.1|  MULTISPECIES: polyvinylalcohol dehydrogenase       260   2e-74    
ref|WP_015471407.1|  polyvinylalcohol dehydrogenase                     260   2e-74    
gb|KGK55929.1|  polyvinylalcohol dehydrogenase                          260   2e-74    
ref|WP_005923088.1|  polyvinylalcohol dehydrogenase                     259   2e-74    
ref|WP_014091452.1|  polyvinylalcohol dehydrogenase                     259   2e-74    
ref|YP_008437577.1|  pyrroloquinoline quinone-dependent alcohol d...    259   2e-74    
ref|WP_015463756.1|  polyvinylalcohol dehydrogenase                     259   3e-74    
ref|WP_024711795.1|  polyvinylalcohol dehydrogenase                     259   3e-74    
ref|WP_029218055.1|  polyvinylalcohol dehydrogenase                     259   3e-74    
ref|WP_039563749.1|  polyvinylalcohol dehydrogenase                     259   3e-74    
ref|WP_039412258.1|  polyvinylalcohol dehydrogenase                     259   3e-74    
gb|KER73041.1|  hypothetical protein HR51_10690                         256   5e-74    
ref|WP_007973917.1|  polyvinylalcohol dehydrogenase                     258   6e-74    
ref|WP_039731966.1|  polyvinylalcohol dehydrogenase                     258   6e-74    
ref|WP_007966504.1|  polyvinylalcohol dehydrogenase                     258   7e-74    
ref|WP_022560360.1|  putative PQQ-dependent dehydrogenase               258   8e-74    
ref|WP_033483102.1|  MULTISPECIES: polyvinylalcohol dehydrogenase       257   1e-73    
ref|WP_014501555.1|  polyvinylalcohol dehydrogenase                     257   2e-73    
ref|WP_006449107.1|  polyvinylalcohol dehydrogenase                     256   4e-73    
ref|WP_010381318.1|  polyvinylalcohol dehydrogenase                     256   4e-73    
gb|KGE50571.1|  polyvinylalcohol dehydrogenase                          256   4e-73    
emb|CEL40299.1|  Polyvinylalcohol dehydrogenase                         256   5e-73    
ref|WP_024937591.1|  polyvinylalcohol dehydrogenase                     255   8e-73    
ref|WP_022971217.1|  polyvinylalcohol dehydrogenase                     255   1e-72    
ref|WP_039567299.1|  polyvinylalcohol dehydrogenase                     254   2e-72    
ref|WP_017159747.1|  polyvinylalcohol dehydrogenase                     254   3e-72    
ref|WP_017156056.1|  polyvinylalcohol dehydrogenase                     254   3e-72    
ref|WP_011257274.1|  polyvinylalcohol dehydrogenase                     251   4e-72    
ref|WP_039524525.1|  polyvinylalcohol dehydrogenase                     253   4e-72    
ref|WP_011052804.1|  polyvinylalcohol dehydrogenase                     251   5e-72    
gb|ADN64238.1|  putative polyvinylalcohol dehydrogenase                 252   5e-72    
ref|WP_039521238.1|  polyvinylalcohol dehydrogenase                     253   6e-72    
ref|WP_011113104.1|  probable polyvinylalcohol dehydrogenase            252   6e-72    
ref|WP_011349059.1|  polyvinylalcohol dehydrogenase                     251   9e-72    
ref|WP_037663542.1|  hypothetical protein                               250   9e-72    
ref|YP_009001198.1|  pyrroloquinoline quinone-dependent DHase           251   1e-71    
ref|WP_026064663.1|  polyvinylalcohol dehydrogenase                     252   1e-71    
dbj|GAE54390.1|  hypothetical protein XPR_1025                          252   1e-71    
emb|CCG39082.1|  PQQ enzyme repeat family protein                       249   2e-71    
ref|WP_039513544.1|  polyvinylalcohol dehydrogenase                     251   2e-71    
ref|WP_039814780.1|  polyvinylalcohol dehydrogenase                     251   3e-71    
ref|XP_007917887.1|  putative quinohemoprotein ethanol dehydrogen...    248   1e-69    
ref|WP_002809388.1|  polyvinylalcohol dehydrogenase                     244   7e-69    
ref|XP_001691739.1|  predicted protein                                  248   1e-67    Chlamydomonas reinhardtii
ref|WP_008922098.1|  Pyrrolo-quinoline quinone                          240   1e-67    
ref|WP_014898563.1|  polyvinylalcohol dehydrogenase                     239   2e-67    
gb|EQB44371.1|  hypothetical protein CGLO_16897                         238   1e-66    
ref|XP_009219017.1|  hypothetical protein GGTG_02975                    238   2e-66    
ref|WP_039323860.1|  hypothetical protein                               235   4e-66    
gb|ELQ35660.1|  hypothetical protein OOU_Y34scaffold00696g2             231   9e-64    
gb|AFK45688.1|  unknown                                                 216   1e-62    
ref|XP_007282941.1|  pyrrolo-quinoline quinone                          224   1e-61    
ref|XP_001696369.1|  predicted protein                                  220   6e-60    Chlamydomonas reinhardtii
ref|XP_003621146.1|  hypothetical protein MTR_7g009760                  209   3e-58    
ref|XP_003345090.1|  hypothetical protein SMAC_09311                    213   1e-57    
gb|AFK48302.1|  unknown                                                 200   5e-56    
emb|CAN79118.1|  hypothetical protein VITISV_005773                     215   1e-55    Vitis vinifera
ref|XP_010068791.1|  PREDICTED: uncharacterized protein LOC104455754    195   1e-54    
ref|XP_006603583.1|  PREDICTED: uncharacterized protein LOC102659955    194   3e-54    
ref|XP_002517484.1|  conserved hypothetical protein                     182   3e-50    Ricinus communis
ref|WP_030428312.1|  hypothetical protein                               189   6e-49    
ref|WP_035701718.1|  cytochrome Cbb3                                    189   2e-48    
ref|WP_018322182.1|  cytochrome CBB3                                    188   3e-48    
ref|WP_035726524.1|  cytochrome Cbb3                                    186   4e-48    
ref|WP_035113987.1|  hypothetical protein                               186   6e-48    
ref|WP_007611725.1|  cytochrome CBB3                                    187   1e-47    
ref|WP_027554611.1|  cytochrome Cbb3                                    186   2e-47    
dbj|BAE98075.1|  putative polyvinylalcohol dehydrogenase                185   2e-47    Streptoalloteichus hindustanus
ref|WP_038943595.1|  cytochrome Cbb3                                    185   4e-47    
ref|WP_027549085.1|  cytochrome Cbb3                                    185   4e-47    
ref|WP_026232942.1|  cytochrome Cbb3                                    184   5e-47    
ref|WP_026312652.1|  cytochrome Cbb3                                    184   6e-47    
ref|WP_028141086.1|  MULTISPECIES: cytochrome Cbb3                      184   1e-46    
ref|WP_038972366.1|  cytochrome Cbb3                                    183   1e-46    
ref|XP_010661140.1|  PREDICTED: uncharacterized protein LOC104881707    171   3e-46    
ref|WP_039147385.1|  cytochrome Cbb3                                    182   3e-46    
ref|WP_038950513.1|  cytochrome Cbb3                                    180   4e-46    
ref|WP_028154794.1|  cytochrome Cbb3                                    182   4e-46    
ref|WP_038935979.1|  cytochrome Cbb3                                    182   5e-46    
ref|WP_035517536.1|  dehydrogenase                                      180   9e-46    
ref|WP_014494373.1|  cytochrome CBB3                                    181   9e-46    
ref|WP_028175890.1|  MULTISPECIES: cytochrome Cbb3                      181   1e-45    
gb|KGJ71079.1|  putative polyvinyl-alcohol dehydrogenase                181   1e-45    
ref|WP_027525615.1|  cytochrome Cbb3                                    181   1e-45    
ref|WP_027582751.1|  cytochrome Cbb3                                    181   1e-45    
gb|KGE03706.1|  Polyvinyl-alcohol dehydrogenase, PQQ-dependent          181   2e-45    
ref|WP_038967515.1|  cytochrome Cbb3                                    180   2e-45    
ref|WP_011088252.1|  cytochrome CBB3                                    180   2e-45    
ref|WP_007992272.1|  hypothetical protein                               178   7e-45    
ref|WP_028164459.1|  cytochrome Cbb3                                    178   8e-45    
ref|XP_003657063.1|  hypothetical protein THITE_122540                  176   2e-44    
ref|WP_018270316.1|  hypothetical protein                               177   2e-44    
gb|AIA18976.1|  PQQ enzyme repeat                                       172   3e-44    
ref|XP_003347398.1|  hypothetical protein SMAC_08673                    175   4e-44    
ref|WP_024515185.1|  cytochrome Cbb3                                    176   4e-44    
gb|ESA13875.1|  hypothetical protein GLOINDRAFT_25571                   167   2e-43    
ref|WP_035731999.1|  MULTISPECIES: hypothetical protein                 173   4e-43    
ref|WP_028337049.1|  cytochrome Cbb3                                    173   5e-43    
ref|WP_016848236.1|  hypothetical protein                               171   7e-43    
ref|WP_009281750.1|  dehydrogenase                                      172   1e-42    
ref|WP_039285766.1|  pyrrolo-quinoline quinone                          172   1e-42    
ref|WP_028339632.1|  cytochrome Cbb3                                    171   1e-42    
ref|WP_007235177.1|  putative PQQ-dependent polyvinyl alcohol deh...    172   2e-42    
ref|WP_009021087.1|  dehydrogenase                                      171   2e-42    
ref|WP_038387433.1|  cytochrome Cbb3                                    171   2e-42    
ref|XP_004346017.1|  protein kinase domain containing protein           172   4e-42    
ref|WP_035982391.1|  hypothetical protein                               169   7e-42    
emb|CCE08617.1|  conserved exported hypothetical protein                169   7e-42    
emb|CAQ52613.1|  PQQ-dependent enzyme                                   168   9e-42    Streptomyces violaceoruber
gb|AFI57011.1|  PQQ-dependent dehydrogenase                             168   1e-41    
ref|WP_029548673.1|  dehydrogenase                                      169   1e-41    
ref|WP_030089896.1|  dehydrogenase                                      168   2e-41    
ref|WP_029994466.1|  dehydrogenase                                      168   3e-41    
ref|WP_036503024.1|  pyrrolo-quinoline quinone                          166   4e-41    
gb|EJL31118.1|  WD40-like repeat containing protein                     166   8e-41    
ref|WP_029079726.1|  cytochrome Cbb3                                    166   8e-41    
ref|WP_011952166.1|  dehydrogenase                                      166   8e-41    
ref|WP_009020020.1|  dehydrogenase                                      164   3e-40    
dbj|GAJ80538.1|  hypothetical protein NBRGN_027_01950                   164   3e-40    
sp|P77931.1|PVADH_PSESP  RecName: Full=Polyvinylalcohol dehydroge...    165   3e-40    Pseudomonas sp.
ref|WP_014981089.1|  polyvinylalcohol dehydrogenase                     162   7e-40    
gb|KIA60946.1|  hypothetical protein FG87_33900                         162   8e-40    
ref|WP_029894699.1|  hypothetical protein                               162   1e-39    
ref|WP_007235133.1|  dehydrogenase                                      163   1e-39    
ref|WP_036501630.1|  hypothetical protein                               161   1e-39    
ref|WP_016905319.1|  hypothetical protein                               160   6e-39    
ref|WP_013836830.1|  pyrrolo-quinoline quinone                          160   7e-39    
ref|WP_030477194.1|  hypothetical protein                               159   7e-39    
ref|WP_030470642.1|  hypothetical protein                               159   1e-38    
ref|WP_026361375.1|  hypothetical protein                               159   1e-38    
ref|WP_035514460.1|  dehydrogenase                                      160   1e-38    
ref|WP_038958951.1|  cytochrome Cbb3                                    155   1e-38    
gb|KGE05085.1|  putative cell surface protein/ lipoprotein              159   1e-38    
emb|CEL14776.1|  predicted cell surface protein/ lipoprotein            158   2e-38    
ref|WP_039827782.1|  hypothetical protein                               158   2e-38    
ref|WP_037503931.1|  dehydrogenase                                      158   4e-38    
ref|WP_030301351.1|  hypothetical protein                               157   5e-38    
ref|WP_020600576.1|  dehydrogenase                                      157   7e-38    
ref|WP_030396579.1|  hypothetical protein                               155   1e-37    
ref|WP_024584764.1|  cytochrome Cbb3                                    156   2e-37    
ref|WP_011254963.1|  dehydrogenase                                      156   2e-37    
emb|CEL21126.1|  Glucose dehydrogenase, PQQ-dependent                   155   2e-37    
ref|WP_027944967.1|  hypothetical protein                               155   3e-37    
ref|WP_026361514.1|  hypothetical protein                               154   3e-37    
ref|WP_026315882.1|  hypothetical protein                               154   3e-37    
ref|WP_012927525.1|  dehydrogenase                                      155   5e-37    
sp|Q588Z1.3|PVADH_SPHS1  RecName: Full=Polyvinylalcohol dehydroge...    155   6e-37    
ref|WP_029474710.1|  hypothetical protein                               152   8e-37    
emb|CEL23109.1|  Serine/threonine protein kinase related protein        153   1e-36    
ref|WP_015101656.1|  hypothetical protein                               152   2e-36    
ref|WP_026359989.1|  hypothetical protein                               152   2e-36    
ref|XP_007216226.1|  hypothetical protein PRUPE_ppa016767mg             142   2e-36    
ref|WP_020672242.1|  hypothetical protein                               152   2e-36    
ref|WP_033383659.1|  hypothetical protein                               151   3e-36    
ref|WP_009019850.1|  putative PQQ-dependent polyvinyl alcohol deh...    152   3e-36    
ref|WP_026423923.1|  hypothetical protein                               150   8e-36    
gb|EWM13062.1|  polyvinyl-alcohol dehydrogenase                         148   4e-35    
ref|WP_033400351.1|  hypothetical protein                               148   5e-35    
ref|WP_021076103.1|  polyvinyl alcohol dehydrogenase (cytochrome)       149   5e-35    
ref|WP_015100985.1|  hypothetical protein                               147   9e-35    
ref|WP_019544143.1|  hypothetical protein                               146   2e-34    
ref|WP_033338618.1|  hypothetical protein                               142   3e-33    
ref|WP_007224503.1|  putative PQQ-dependent polyvinyl alcohol deh...    140   2e-32    
ref|XP_001223203.1|  hypothetical protein CHGG_03989                    138   5e-32    
gb|KCW64984.1|  hypothetical protein EUGRSUZ_G02528                     132   8e-32    
ref|WP_007225420.1|  dehydrogenase                                      139   8e-32    
ref|WP_033431251.1|  hypothetical protein                               138   9e-32    
ref|WP_033431134.1|  hypothetical protein                               138   9e-32    
ref|WP_036928242.1|  hypothetical protein                               134   2e-30    
ref|WP_035514927.1|  hypothetical protein                               135   3e-30    
gb|KGE03928.1|  putative cell surface protein/ lipoprotein              135   4e-30    
ref|WP_027066280.1|  hypothetical protein                               132   7e-30    
ref|WP_037481328.1|  hypothetical protein                               131   2e-29    
ref|XP_002984699.1|  hypothetical protein SELMODRAFT_423793             123   3e-29    
ref|WP_031304276.1|  hypothetical protein                               130   4e-29    
gb|EZP73961.1|  Polyvinylalcohol dehydrogenase precursor                132   5e-29    
gb|AIC13805.1|  polyvinylalcohol dehydrogenase                          130   1e-28    
gb|EQB08082.1|  hypothetical protein L288_08645                         130   1e-28    
ref|WP_012382663.1|  polyvinylalcohol dehydrogenase                     130   1e-28    
gb|EWG15353.1|  Pyrrolo-quinoline quinone                               129   1e-28    
ref|WP_030539948.1|  hypothetical protein                               128   2e-28    
dbj|BAA12104.1|  dehydrogenase                                          127   2e-27    
ref|WP_027948868.1|  dehydrogenase                                      126   3e-27    
ref|WP_022696249.1|  hypothetical protein                               126   3e-27    
ref|XP_010108980.1|  hypothetical protein L484_027175                   118   3e-27    
gb|KHN11592.1|  Putative WRKY transcription factor 72                   124   1e-26    
gb|KHN13639.1|  hypothetical protein glysoja_019326                     116   3e-26    
ref|WP_028008910.1|  hypothetical protein                               120   2e-25    
ref|WP_022693594.1|  hypothetical protein                               121   2e-25    
ref|WP_017733305.1|  hypothetical protein                               119   3e-25    
ref|WP_009021441.1|  pyrrolo-quinoline quinone                          120   4e-25    
ref|WP_020650738.1|  hypothetical protein                               119   5e-25    
ref|WP_026905739.1|  quinonprotein alcohol dehydrogenase                118   2e-24    
ref|WP_007088201.1|  putative pyrrolo-quinoline quinone                 118   3e-24    
ref|WP_024030960.1|  putative pyrrolo-quinoline quinone                 117   3e-24    
ref|WP_010093600.1|  quinoprotein ethanol dehydrogenase                 117   3e-24    
ref|WP_011098041.1|  polyvinylalcohol dehydrogenase                     115   5e-24    
ref|WP_004088282.1|  polyvinylalcohol dehydrogenase                     115   5e-24    
ref|WP_038233191.1|  polyvinylalcohol dehydrogenase                     115   5e-24    
ref|WP_038228403.1|  polyvinylalcohol dehydrogenase                     115   6e-24    
emb|CBI22178.3|  unnamed protein product                                107   7e-24    
ref|WP_007229606.1|  dehydrogenase                                      115   2e-23    
ref|WP_020852025.1|  quinoprotein                                       113   2e-23    
gb|KIA57621.1|  polyvinylalcohol dehydrogenase                          113   4e-23    
ref|WP_026471494.1|  hypothetical protein                               113   5e-23    
ref|WP_022693599.1|  hypothetical protein                               112   9e-23    
ref|WP_008246156.1|  dehydrogenase                                      112   1e-22    
gb|KEQ80677.1|  hypothetical protein M438DRAFT_348612                   106   1e-22    
ref|WP_023907488.1|  polyvinylalcohol dehydrogenase                     110   2e-22    
ref|WP_023906302.1|  polyvinylalcohol dehydrogenase                     110   3e-22    
gb|KHN13643.1|  hypothetical protein glysoja_019330                     103   4e-22    
ref|WP_010894707.1|  polyvinylalcohol dehydrogenase                     110   4e-22    
ref|WP_010677583.1|  quinoprotein ethanol dehydrogenase                 111   4e-22    
ref|XP_007676095.1|  hypothetical protein BAUCODRAFT_33851              103   5e-21    
ref|WP_012520619.1|  glucose dehydrogenase                              107   7e-21    
ref|WP_036841499.1|  quinonprotein alcohol dehydrogenase                107   7e-21    
gb|KGX91704.1|  quinoprotein ethanol dehydrogenase                      107   8e-21    
ref|WP_036204196.1|  quinonprotein alcohol dehydrogenase                106   2e-20    
ref|XP_002324042.2|  hypothetical protein POPTR_0017s11610g           97.4    2e-20    
ref|WP_030179207.1|  hypothetical protein                               100   3e-20    
ref|WP_007083729.1|  quinoprotein ethanol dehydrogenase                 101   5e-19    
ref|WP_027322366.1|  quinonprotein alcohol dehydrogenase                100   1e-18    
ref|XP_006431102.1|  hypothetical protein CICLE_v10013770mg           92.8    3e-18    
gb|KGN59584.1|  hypothetical protein Csa_3G827265                     90.9    3e-18    
ref|WP_014587418.1|  Cytochrome c class I                             98.2    5e-18    
gb|EWS78182.1|  polyvinylalcohol dehydrogenase                        96.3    2e-17    
gb|KEQ80676.1|  hypothetical protein M438DRAFT_105417                 92.0    2e-17    
ref|WP_020718361.1|  hypothetical protein                             95.1    3e-17    
gb|KFA42156.1|  hypothetical protein DF22_001285                      91.7    2e-16    
ref|WP_011686716.1|  pyrrolo-quinoline quinone                        91.7    5e-16    
gb|EAO13916.1|  quinoprotein                                          90.1    6e-16    
ref|WP_008414422.1|  dehydrogenase                                    90.1    1e-15    
ref|WP_036320334.1|  hypothetical protein                             89.4    2e-15    
ref|WP_009664502.1|  quinoprotein ethanol dehydrogenase               89.0    4e-15    
ref|WP_013566984.1|  PQQ-dependent enzyme-like protein                88.2    5e-15    
ref|WP_020718217.1|  hypothetical protein                             88.2    5e-15    
ref|WP_020722810.1|  hypothetical protein                             88.6    6e-15    
ref|WP_014868153.1|  Quinoprotein ethanol dehydrogenase               87.8    1e-14    
ref|WP_008247242.1|  alcohol dehydrogenase                            85.9    4e-14    
ref|WP_035958364.1|  hypothetical protein                             85.1    5e-14    
gb|AAL76398.1|  PpQ dehydrogenase family protein                      85.5    5e-14    
ref|WP_029878953.1|  alcohol dehydrogenase                            85.1    6e-14    
ref|WP_039600296.1|  hypothetical protein                             85.1    6e-14    
ref|WP_009942739.1|  alcohol dehydrogenase                            84.7    7e-14    
ref|WP_022694979.1|  hypothetical protein                             85.1    7e-14    
emb|CDZ81643.1|  Polyvinylalcohol dehydrogenase precursor             84.7    7e-14    
ref|WP_037303249.1|  alcohol dehydrogenase                            84.7    8e-14    
ref|WP_035731504.1|  MULTISPECIES: alcohol dehydrogenase              84.7    8e-14    
gb|ERF86699.1|  quinohemoprotein ethanol dehydrogenase type-1         84.3    1e-13    
ref|WP_029311740.1|  pyrrolo-quinoline quinone                        83.6    2e-13    
ref|WP_035649499.1|  alcohol dehydrogenase                            83.6    2e-13    
ref|WP_029755368.1|  alcohol dehydrogenase                            83.6    2e-13    
ref|WP_027872847.1|  alcohol dehydrogenase                            83.2    3e-13    
ref|WP_020216706.1|  hypothetical protein                             82.4    3e-13    
ref|WP_035222903.1|  hypothetical protein                             82.0    4e-13    
gb|AAR38298.1|  alcohol dehydrogenase, PQQ family                     82.8    4e-13    
ref|WP_007234681.1|  Pyrrolo-quinoline quinone                        82.4    4e-13    
ref|WP_037526882.1|  pyrrolo-quinoline quinone                        82.0    5e-13    
gb|AHY49109.1|  hypothetical protein BJS_07182                        82.0    6e-13    
ref|WP_039156569.1|  alcohol dehydrogenase                            82.0    6e-13    
ref|WP_024875070.1|  hypothetical protein                             81.6    6e-13    
ref|WP_013878388.1|  dehydrogenase                                    81.6    7e-13    
ref|WP_036051003.1|  alcohol dehydrogenase                            81.6    8e-13    
ref|WP_008896054.1|  PQQ-dependent enzyme-like protein                81.3    1e-12    
ref|WP_012941891.1|  dehydrogenase                                    80.9    1e-12    
ref|WP_035691342.1|  alcohol dehydrogenase                            81.3    1e-12    
ref|WP_038956547.1|  alcohol dehydrogenase                            81.3    1e-12    
ref|WP_011441245.1|  alcohol dehydrogenase                            81.3    1e-12    
ref|WP_038935372.1|  alcohol dehydrogenase                            80.9    1e-12    
ref|WP_007176349.1|  quinoprotein ethanol dehydrogenase               80.5    1e-12    
ref|WP_035569726.1|  alcohol dehydrogenase                            80.9    1e-12    
ref|WP_006664318.1|  alcohol dehydrogenase                            80.5    2e-12    
ref|WP_035178183.1|  hypothetical protein                             80.1    2e-12    
ref|WP_034479008.1|  quinonprotein alcohol dehydrogenase              80.1    2e-12    
ref|WP_014497403.1|  hypothetical protein                             80.1    2e-12    
ref|WP_018424560.1|  quinoprotein ethanol dehydrogenase               80.1    2e-12    
gb|ETX08106.1|  hypothetical protein ETSY2_07300                      79.3    2e-12    
ref|WP_028137772.1|  alcohol dehydrogenase                            80.5    2e-12    
gb|ETW96069.1|  hypothetical protein ETSY1_28085                      79.7    2e-12    
ref|WP_034422921.1|  hypothetical protein                             79.7    2e-12    
ref|WP_035528692.1|  alcohol dehydrogenase                            80.1    2e-12    
ref|WP_008492596.1|  pyrrolo-quinoline quinone                        79.7    3e-12    
ref|WP_007422214.1|  MULTISPECIES: pyrrolo-quinoline quinone          79.7    3e-12    
ref|XP_003621153.1|  hypothetical protein MTR_7g009830                74.7    3e-12    
ref|WP_027945499.1|  alcohol dehydrogenase                            79.3    3e-12    
ref|WP_027583082.1|  alcohol dehydrogenase                            79.7    3e-12    
ref|WP_035505564.1|  pyrrolo-quinoline quinone                        79.3    3e-12    
ref|WP_035069481.1|  alcohol dehydrogenase                            79.3    4e-12    
ref|WP_011687101.1|  pyrrolo-quinoline quinone                        79.3    4e-12    
emb|CEL14190.1|  Quino(hemo)protein alcohol dehydrogenase, PQQ-de...  79.0    4e-12    
ref|WP_014076182.1|  pyrrolo-quinoline quinone                        79.0    5e-12    
gb|ERZ99443.1|  hypothetical protein GLOINDRAFT_87967                 75.1    5e-12    
ref|WP_011766747.1|  alcohol dehydrogenase                            79.0    5e-12    
ref|WP_006913759.1|  alcohol dehydrogenase                            79.0    5e-12    
ref|WP_006825593.1|  PQQ-dependent enzyme-like protein                78.6    6e-12    
ref|WP_013093270.1|  MULTISPECIES: quinoprotein ethanol dehydroge...  78.6    7e-12    
ref|WP_034418619.1|  alcohol dehydrogenase                            78.2    7e-12    
gb|ETW98770.1|  alcohol dehydrogenase                                 78.2    7e-12    
ref|WP_008253257.1|  alcohol dehydrogenase                            78.6    7e-12    
ref|WP_012948557.1|  alcohol dehydrogenase                            78.2    7e-12    
ref|WP_011503510.1|  alcohol dehydrogenase                            78.6    8e-12    
ref|WP_012045424.1|  alcohol dehydrogenase                            78.6    8e-12    
ref|WP_026595638.1|  alcohol dehydrogenase                            78.2    9e-12    
ref|WP_037485766.1|  alcohol dehydrogenase                            78.2    9e-12    
gb|EJK85079.1|  PQQ-dependent dehydrogenase, methanol/ethanol family  78.2    1e-11    
ref|WP_006109795.1|  alcohol dehydrogenase                            77.8    1e-11    
ref|WP_024512788.1|  alcohol dehydrogenase                            77.4    1e-11    
ref|WP_026091114.1|  alcohol dehydrogenase                            77.8    1e-11    
ref|WP_014252542.1|  pyrrolo-quinoline quinone                        77.4    1e-11    
ref|WP_035958792.1|  pyrrolo-quinoline quinone                        77.8    1e-11    
ref|WP_037042758.1|  alcohol dehydrogenase                            77.4    1e-11    
ref|WP_022959786.1|  alcohol dehydrogenase                            77.4    2e-11    
ref|WP_035670518.1|  alcohol dehydrogenase                            77.4    2e-11    
ref|WP_028936127.1|  alcohol dehydrogenase                            77.0    2e-11    
ref|WP_034766806.1|  alcohol dehydrogenase                            77.4    2e-11    
emb|CDO59735.1|  Quino(hemo)protein alcohol dehydrogenase,PQQ-dep...  77.4    2e-11    
ref|WP_028364239.1|  quinonprotein alcohol dehydrogenase              77.0    2e-11    
ref|WP_024342531.1|  alcohol dehydrogenase                            77.0    2e-11    
ref|WP_011767587.1|  quinoprotein ethanol dehydrogenase               77.0    2e-11    
ref|WP_038201908.1|  alcohol dehydrogenase                            77.0    2e-11    
ref|WP_011664928.1|  alcohol dehydrogenase                            77.0    2e-11    
ref|WP_014076413.1|  alcohol dehydrogenase                            77.0    2e-11    
ref|WP_026397313.1|  pyrrolo-quinoline quinone                        76.6    3e-11    
ref|WP_032891329.1|  alcohol dehydrogenase                            76.6    3e-11    
ref|WP_015437404.1|  putative quinoprotein ethanol dehydrogenase      76.6    3e-11    
ref|WP_027935204.1|  alcohol dehydrogenase                            76.6    3e-11    
ref|WP_014075054.1|  pyrrolo-quinoline quinone                        76.6    3e-11    
gb|EWS54175.1|  Alcohol dehydrogenase [cytochrome c] precursor        76.3    3e-11    
ref|WP_008006004.1|  PQQ-dependent enzyme-like protein                76.3    3e-11    
gb|AAF86335.1|  terahydrofurfuryl alcohol dehydrogenase               76.6    3e-11    
ref|WP_029641221.1|  alcohol dehydrogenase                            76.6    3e-11    
ref|WP_036197980.1|  alcohol dehydrogenase                            76.6    3e-11    
dbj|BAO92114.1|  PQQ-dependent dehydrogenase, methanol/ethanol fa...  76.3    3e-11    
ref|WP_035975508.1|  pyrrolo-quinoline quinone                        76.3    3e-11    
ref|WP_013501967.1|  alcohol dehydrogenase                            76.6    3e-11    
ref|WP_038441596.1|  alcohol dehydrogenase                            76.3    3e-11    
ref|WP_036234401.1|  alcohol dehydrogenase                            76.3    3e-11    
ref|WP_016348057.1|  putative alcohol dehydrogenase                   76.3    4e-11    
ref|WP_008347842.1|  MULTISPECIES: pyrrolo-quinoline quinone          76.3    4e-11    
ref|WP_006181095.1|  dehydrogenase                                    75.9    4e-11    
ref|WP_029291129.1|  alcohol dehydrogenase                            76.3    4e-11    



>ref|XP_011098591.1| PREDICTED: uncharacterized protein LOC105177224 [Sesamum indicum]
Length=512

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/505 (72%), Positives = 422/505 (84%), Gaps = 7/505 (1%)
 Frame = -1

Query  1643  SGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWN  1464
             +GNWLNHGGDIYNRRYA GE +ISPSTVS+L+LKW+FYAG DI+ATPAI  G+VYFPSWN
Sbjct  14    TGNWLNHGGDIYNRRYAEGETRISPSTVSQLRLKWKFYAGNDITATPAIFGGIVYFPSWN  73

Query  1463  GYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVV  1284
             GY+YAV A+DGSL+W++NLQ LTGLNAT+   N T +VSR+TP++  + LII IYGPA V
Sbjct  74    GYIYAVRAADGSLVWKQNLQVLTGLNATISFTNDTTLVSRATPTVADDKLIIAIYGPAYV  133

Query  1283  IGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAK  1104
             I VKRATG+LLW   LD+HPA +ITMSGTYY  AFYVG SSLEE  +   CCTFRG FAK
Sbjct  134   IAVKRATGELLWKRQLDKHPAAVITMSGTYYMKAFYVGVSSLEETYNIEDCCTFRGSFAK  193

Query  1103  LDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLK  924
             LDV TG +LWQT+M+PDN GK+G YAGAA+WGSSPSID  R HVYIATGNLYSAP+ V +
Sbjct  194   LDVQTGAILWQTYMIPDNNGKKGGYAGAALWGSSPSIDVGRNHVYIATGNLYSAPESVEE  253

Query  923   CQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSST  744
             CQE+QNN+ T PT  D C+EP+ H DS+LALDL +GKIKW+RQLGGYDV+F AC N  ST
Sbjct  254   CQERQNNQ-TVPTHPDDCIEPDIHFDSMLALDLKSGKIKWYRQLGGYDVWFFACRN-PST  311

Query  743   PNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpg  564
             PNCPPGPNPDADFGEAPM+LS+ +NG+  DIVVAVQKSGFAWALDR+NG +VW TEAGPG
Sbjct  312   PNCPPGPNPDADFGEAPMVLSININGTKLDIVVAVQKSGFAWALDRNNGNIVWSTEAGPG  371

Query  563   gfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVP  384
             G +GGGTWGAATDN RVYT+IANSN+ NFTL PSKNVT GGGWVAMD  TG+ILWSTAVP
Sbjct  372   GTLGGGTWGAATDNRRVYTNIANSNQQNFTLAPSKNVTTGGGWVAMDPGTGRILWSTAVP  431

Query  383   DTGLSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVG  204
                 +NPV++ANGVLFAGS +  GPV+AINA +GEILWSY TGA+VYGG+S S GC+YVG
Sbjct  432   YNATTNPVSIANGVLFAGSTYRTGPVYAINAASGEILWSYETGASVYGGLSASKGCIYVG  491

Query  203   NGYRVSIGAGIPIFTGGTSLFAFCL  129
             +GYRV     +P  T GTSLFAFC+
Sbjct  492   HGYRV-----MPALTAGTSLFAFCM  511



>ref|XP_009782555.1| PREDICTED: uncharacterized protein LOC104231286 [Nicotiana sylvestris]
Length=555

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/545 (66%), Positives = 435/545 (80%), Gaps = 9/545 (2%)
 Frame = -1

Query  1736  LYYCVCIIIFLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACGENKISPSTVS  1557
             L+  +  ++  I IS  + P+WH  R      GNW+NHGGD+YNRRYA GE KIS  T S
Sbjct  10    LFLLLASVLCTISISCNSNPDWHNYRTHYHKQGNWINHGGDLYNRRYAYGEKKISRWTAS  69

Query  1556  KLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATV  1377
             +LK KWEF AGKDI+ATPAI  GV+YFPSWNG +YAV A DG L+W+++L +LTG+N   
Sbjct  70    RLKQKWEFKAGKDITATPAIFAGVLYFPSWNGNIYAVRAKDGVLVWKKSLPELTGINGKF  129

Query  1376  RTG---NVTAIVSRSTPSIV--GETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLI  1212
                   NVT+IV+R+TP++V   + +I+G+YGP++V+ +KR++GDL+W T LD HPA ++
Sbjct  130   NASSLPNVTSIVARATPTVVINRDMVIVGVYGPSLVLALKRSSGDLIWSTQLDDHPASVV  189

Query  1211  TMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGE  1032
             TMSGTYY GA+Y+GTSSLEEG++   CCTFRG F KLDV TGK+LW+TF+LPDN GK GE
Sbjct  190   TMSGTYYKGAYYIGTSSLEEGATINECCTFRGSFLKLDVKTGKILWKTFLLPDNGGKLGE  249

Query  1031  YAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTT---PTTSDKCVEP  861
             YAGAA+WGSSPSID  R HVYIATGNLYS PKH+  CQ++QN +  T   PT  DKC+EP
Sbjct  250   YAGAAVWGSSPSIDIWRNHVYIATGNLYSVPKHIEDCQKEQNKQNQTNPDPTRPDKCIEP  309

Query  860   ENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLS  681
             ENHSDSILALDLD+GKIKW++QLGGYDV+F+AC  +S+ PNCP GP+PDADFGEAPMMLS
Sbjct  310   ENHSDSILALDLDSGKIKWYKQLGGYDVWFVACGFNSTNPNCPIGPSPDADFGEAPMMLS  369

Query  680   VVVNGS-TRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTS  504
             V+ NG+  RDIV AVQKSG AWALDRD G++ W TEAGPGG  GGGTWGAATD +RVYTS
Sbjct  370   VLANGTKKRDIVAAVQKSGIAWALDRDTGDIFWTTEAGPGGTAGGGTWGAATDTKRVYTS  429

Query  503   IANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSNPVTVANGVLFAGSV  324
             I NS+ LNFTL+PSKNVT GG WVAMDA+TGKILW+TAVP+ G SNPVTVANGV+ AGS 
Sbjct  430   IVNSDNLNFTLVPSKNVTTGGAWVAMDAKTGKILWTTAVPNNGKSNPVTVANGVMLAGSQ  489

Query  323   HPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSL  144
             +P GP++AI+ KTG+ILWS  TGATVYGGMSVSNGC YVGNGYR  IG      T GTSL
Sbjct  490   NPTGPIYAIDTKTGKILWSNETGATVYGGMSVSNGCFYVGNGYRSGIGVFNTNNTAGTSL  549

Query  143   FAFCL  129
             FA+C+
Sbjct  550   FAYCV  554



>ref|XP_009621314.1| PREDICTED: uncharacterized protein LOC104112969 isoform X1 [Nicotiana 
tomentosiformis]
Length=555

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/534 (67%), Positives = 430/534 (81%), Gaps = 9/534 (2%)
 Frame = -1

Query  1703  ICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAG  1524
             I I  T+ P+WH  R      GNW+NHGGD+YNRRYA GE KIS  T S+LK KWEF AG
Sbjct  21    ISICCTSNPDWHSYRTHYHKQGNWINHGGDLYNRRYAYGEKKISRWTASRLKQKWEFKAG  80

Query  1523  KDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTG---NVTAI  1353
             KDI+ATPAI  GV+YFPSWNG +YAV A DG L+W++ L +LTG+N         NVT I
Sbjct  81    KDITATPAIFDGVLYFPSWNGNIYAVRAKDGVLIWKKGLPELTGINGKFNASSLPNVTTI  140

Query  1352  VSRSTPSIVGET--LIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAF  1179
             V+R+TP++V +   +I+G+YGP++V+ +KR++GDL+W T LD HPA ++TMSGTY+ GAF
Sbjct  141   VARATPTVVSDKDMVIVGVYGPSLVLALKRSSGDLIWSTQLDDHPASVVTMSGTYFKGAF  200

Query  1178  YVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSP  999
             Y+GTSSLEEG++   CCTFRG F KLDV TGK+LW+TF+LPDN GK G+YAGAA+WGSSP
Sbjct  201   YIGTSSLEEGATINECCTFRGNFLKLDVKTGKILWKTFLLPDNGGKLGKYAGAAVWGSSP  260

Query  998   SIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTT---PTTSDKCVEPENHSDSILALD  828
             SID  R HVYIATGNLYS PKH+ +CQ++QN +  T   PT  DKC+EPENHSDS+LALD
Sbjct  261   SIDIRRNHVYIATGNLYSVPKHIEECQKEQNQQNQTNPDPTRPDKCIEPENHSDSMLALD  320

Query  827   LDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGS-TRDI  651
             LD+G+IKW++QLGGYDV+F+AC  +S+ PNCP GP+PDADFGEAPMMLSV+ NG+  RD+
Sbjct  321   LDSGEIKWYKQLGGYDVWFVACGFNSTNPNCPIGPSPDADFGEAPMMLSVLANGTKKRDV  380

Query  650   VVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTL  471
             V AVQKSG AWALDRD G++ W TEAGPGG  GGG WGAATD +RVYTSI NS+ LNFTL
Sbjct  381   VAAVQKSGIAWALDRDTGDIFWTTEAGPGGTAGGGIWGAATDTKRVYTSIVNSDNLNFTL  440

Query  470   LPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSNPVTVANGVLFAGSVHPRGPVFAINA  291
             +PSKNVT GG WVAMDA+TGKILW+TAVP+ G SNPVTVANGVL AGS +P GP++AI+ 
Sbjct  441   VPSKNVTTGGAWVAMDAKTGKILWTTAVPNKGKSNPVTVANGVLLAGSQNPTGPIYAIDT  500

Query  290   KTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             KTG+ILWS  TGATV+GGMSVSNGC YVGNGYR  IG   P  TGGTSLFA+C+
Sbjct  501   KTGKILWSNETGATVFGGMSVSNGCFYVGNGYRSGIGVFNPNNTGGTSLFAYCV  554



>ref|XP_010661033.1| PREDICTED: uncharacterized protein LOC104881693, partial [Vitis 
vinifera]
Length=528

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/512 (68%), Positives = 421/512 (82%), Gaps = 3/512 (1%)
 Frame = -1

Query  1661  RFSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVV  1482
              +S     +WLNHGGD+YNRRYA  E KISP TVSKL LKWEFYAG+DI+ATPAI  G +
Sbjct  19    EYSHQEPADWLNHGGDLYNRRYASSETKISPETVSKLSLKWEFYAGQDITATPAIFNGTL  78

Query  1481  YFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGI  1302
             YFPSWNGYLYAV A+DGSL+W++NLQ LTGLN T    NV   VSRSTP++  + LI+GI
Sbjct  79    YFPSWNGYLYAVKATDGSLVWKQNLQMLTGLNGTGLIVNVNWTVSRSTPTMADDMLIVGI  138

Query  1301  YGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTF  1122
             YGPAVVI V++ATG L+W T LD +P G++TMSGT++ GAFYVGTSS+EE  S   CC F
Sbjct  139   YGPAVVIAVEQATGRLVWSTRLDSNPTGIVTMSGTFHKGAFYVGTSSVEEELSIEQCCVF  198

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG  +KLD+ TG +LWQTF LPDN GKRGEYAGAAIWGSSPSID  R  VY+ATGNLYSA
Sbjct  199   RGSLSKLDIKTGVILWQTFTLPDNHGKRGEYAGAAIWGSSPSIDVRRNLVYVATGNLYSA  258

Query  941   PKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIAC  762
             P ++ +CQE+QNN+ T PT +D+C+EP+NHS+SILA +LD+GKIKW+RQLGGYD++F AC
Sbjct  259   PLNIRECQEQQNNQ-TAPTQTDQCIEPDNHSNSILAFELDSGKIKWYRQLGGYDLWFFAC  317

Query  761   INSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWY  582
              N+ STPNCPPGP+PDADFGEAP+MLS+ +NG+  D+V AVQKSGFAWALDR NG +VW 
Sbjct  318   -NNLSTPNCPPGPSPDADFGEAPIMLSINLNGTMWDVVSAVQKSGFAWALDRYNGSLVWS  376

Query  581   teagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKIL  402
             TEAGPGG  GGGTWGAATDN+RVYT+IANS+  NFTL PS+  T  GGWVAMDA TGKIL
Sbjct  377   TEAGPGGLTGGGTWGAATDNKRVYTNIANSDSKNFTLKPSEKNTTAGGWVAMDASTGKIL  436

Query  401   WSTAVPDTGLSN-PVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVS  225
             WSTA P    SN PVT+ANGVLF GS HP GP++A++A++G+ILWS+ TGATVYGG+SVS
Sbjct  437   WSTADPSNATSNGPVTIANGVLFGGSTHPTGPIYAMDARSGKILWSHNTGATVYGGISVS  496

Query  224   NGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             NGC+Y+GNGY+V++G+    FT GTSLFAFC+
Sbjct  497   NGCIYLGNGYKVNLGSFTASFTNGTSLFAFCV  528



>ref|XP_009621315.1| PREDICTED: uncharacterized protein LOC104112969 isoform X2 [Nicotiana 
tomentosiformis]
Length=541

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/524 (67%), Positives = 424/524 (81%), Gaps = 9/524 (2%)
 Frame = -1

Query  1673  WHITRFSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAIL  1494
             WH  R      GNW+NHGGD+YNRRYA GE KIS  T S+LK KWEF AGKDI+ATPAI 
Sbjct  17    WHSYRTHYHKQGNWINHGGDLYNRRYAYGEKKISRWTASRLKQKWEFKAGKDITATPAIF  76

Query  1493  KGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTG---NVTAIVSRSTPSIVG  1323
              GV+YFPSWNG +YAV A DG L+W++ L +LTG+N         NVT IV+R+TP++V 
Sbjct  77    DGVLYFPSWNGNIYAVRAKDGVLIWKKGLPELTGINGKFNASSLPNVTTIVARATPTVVS  136

Query  1322  ET--LIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEG  1149
             +   +I+G+YGP++V+ +KR++GDL+W T LD HPA ++TMSGTY+ GAFY+GTSSLEEG
Sbjct  137   DKDMVIVGVYGPSLVLALKRSSGDLIWSTQLDDHPASVVTMSGTYFKGAFYIGTSSLEEG  196

Query  1148  SSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVY  969
             ++   CCTFRG F KLDV TGK+LW+TF+LPDN GK G+YAGAA+WGSSPSID  R HVY
Sbjct  197   ATINECCTFRGNFLKLDVKTGKILWKTFLLPDNGGKLGKYAGAAVWGSSPSIDIRRNHVY  256

Query  968   IATGNLYSAPKHVLKCQEKQNNKTTT---PTTSDKCVEPENHSDSILALDLDTGKIKWFR  798
             IATGNLYS PKH+ +CQ++QN +  T   PT  DKC+EPENHSDS+LALDLD+G+IKW++
Sbjct  257   IATGNLYSVPKHIEECQKEQNQQNQTNPDPTRPDKCIEPENHSDSMLALDLDSGEIKWYK  316

Query  797   QLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGS-TRDIVVAVQKSGFA  621
             QLGGYDV+F+AC  +S+ PNCP GP+PDADFGEAPMMLSV+ NG+  RD+V AVQKSG A
Sbjct  317   QLGGYDVWFVACGFNSTNPNCPIGPSPDADFGEAPMMLSVLANGTKKRDVVAAVQKSGIA  376

Query  620   WALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGG  441
             WALDRD G++ W TEAGPGG  GGG WGAATD +RVYTSI NS+ LNFTL+PSKNVT GG
Sbjct  377   WALDRDTGDIFWTTEAGPGGTAGGGIWGAATDTKRVYTSIVNSDNLNFTLVPSKNVTTGG  436

Query  440   GWVAMDAQTGKILWSTAVPDTGLSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYY  261
              WVAMDA+TGKILW+TAVP+ G SNPVTVANGVL AGS +P GP++AI+ KTG+ILWS  
Sbjct  437   AWVAMDAKTGKILWTTAVPNKGKSNPVTVANGVLLAGSQNPTGPIYAIDTKTGKILWSNE  496

Query  260   TGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             TGATV+GGMSVSNGC YVGNGYR  IG   P  TGGTSLFA+C+
Sbjct  497   TGATVFGGMSVSNGCFYVGNGYRSGIGVFNPNNTGGTSLFAYCV  540



>ref|XP_010242400.1| PREDICTED: uncharacterized protein LOC104586761 [Nelumbo nucifera]
Length=534

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/510 (69%), Positives = 415/510 (81%), Gaps = 6/510 (1%)
 Frame = -1

Query  1646  ASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSW  1467
             AS NWLNHGGD+YNRRYA GENKIS  TVS+L+LKW+F+AGKDI+ATPAI  G+VYFPSW
Sbjct  28    ASSNWLNHGGDLYNRRYAKGENKISAKTVSRLRLKWKFFAGKDITATPAIFHGIVYFPSW  87

Query  1466  NGYLYAVNASDGSLLWERNLQKLTGLNATV--RTGNVTAIVSRSTPSIVGETLIIGIYGP  1293
             NG +YAV  +DGSL+W++NL +LTGLNAT    + ++   VSRSTP++ G+ LIIGIYGP
Sbjct  88    NGNVYAVKGADGSLVWKKNLGELTGLNATGIGLSQDINVTVSRSTPTVAGKLLIIGIYGP  147

Query  1292  AVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGR  1113
             AVVI VKRA+G+L+W T LD H A  ITMSGT YN AFYVGTSS EE S    CCTFRG 
Sbjct  148   AVVIAVKRASGELVWSTQLDSHNASQITMSGTVYNKAFYVGTSSAEEASGVEECCTFRGS  207

Query  1112  FAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKH  933
              AKLD+ TG +LWQTF+LPDN+GK G YAGAAIWGSSPSID  R  +Y+ TGNLYSAP H
Sbjct  208   MAKLDINTGTILWQTFVLPDNQGKLGGYAGAAIWGSSPSIDVSRNLIYVGTGNLYSAPAH  267

Query  932   VLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINS  753
             V +CQEKQNN+ T P   D+C+EP+NH +SILA D+DTG I+W+RQLGGYD++F+AC N+
Sbjct  268   VTECQEKQNNQ-TFPAHPDQCIEPDNHENSILAFDMDTGHIRWYRQLGGYDIWFLAC-NN  325

Query  752   SSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYtea  573
              STPNCPPGPNPDADFGEAPMML+V VNG+ RDIVVAVQKSG AWALDRDNG ++W T A
Sbjct  326   LSTPNCPPGPNPDADFGEAPMMLTVFVNGTKRDIVVAVQKSGSAWALDRDNGNIIWSTVA  385

Query  572   gpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWST  393
             GPGG  GGGTWGAATD  RVYT+IANS RLNFTL PSK  T  G WVAM+A +GK+ WST
Sbjct  386   GPGGISGGGTWGAATDGRRVYTNIANSGRLNFTLAPSKRTTTAGAWVAMNANSGKVQWST  445

Query  392   AVPDTGLSN-PVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGC  216
             A P    SN PVTVANGVLFAGS   RGP++AI+ KTG+ILWSY TGAT+YGG+SVSNGC
Sbjct  446   ANPSNATSNGPVTVANGVLFAGSTDTRGPLYAIDVKTGKILWSYDTGATIYGGVSVSNGC  505

Query  215   VYVGNGYRVSIGAGIPIFTGGTSLFAFCLE  126
             +Y+GNGY V++G  +  F  GTSLFAFC++
Sbjct  506   IYLGNGYGVNVGKFLG-FNSGTSLFAFCIK  534



>emb|CBI22171.3| unnamed protein product [Vitis vinifera]
Length=565

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/512 (68%), Positives = 421/512 (82%), Gaps = 3/512 (1%)
 Frame = -1

Query  1661  RFSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVV  1482
              +S     +WLNHGGD+YNRRYA  E KISP TVSKL LKWEFYAG+DI+ATPAI  G +
Sbjct  56    EYSHQEPADWLNHGGDLYNRRYASSETKISPETVSKLSLKWEFYAGQDITATPAIFNGTL  115

Query  1481  YFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGI  1302
             YFPSWNGYLYAV A+DGSL+W++NLQ LTGLN T    NV   VSRSTP++  + LI+GI
Sbjct  116   YFPSWNGYLYAVKATDGSLVWKQNLQMLTGLNGTGLIVNVNWTVSRSTPTMADDMLIVGI  175

Query  1301  YGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTF  1122
             YGPAVVI V++ATG L+W T LD +P G++TMSGT++ GAFYVGTSS+EE  S   CC F
Sbjct  176   YGPAVVIAVEQATGRLVWSTRLDSNPTGIVTMSGTFHKGAFYVGTSSVEEELSIEQCCVF  235

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG  +KLD+ TG +LWQTF LPDN GKRGEYAGAAIWGSSPSID  R  VY+ATGNLYSA
Sbjct  236   RGSLSKLDIKTGVILWQTFTLPDNHGKRGEYAGAAIWGSSPSIDVRRNLVYVATGNLYSA  295

Query  941   PKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIAC  762
             P ++ +CQE+QNN+ T PT +D+C+EP+NHS+SILA +LD+GKIKW+RQLGGYD++F AC
Sbjct  296   PLNIRECQEQQNNQ-TAPTQTDQCIEPDNHSNSILAFELDSGKIKWYRQLGGYDLWFFAC  354

Query  761   INSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWY  582
              N+ STPNCPPGP+PDADFGEAP+MLS+ +NG+  D+V AVQKSGFAWALDR NG +VW 
Sbjct  355   -NNLSTPNCPPGPSPDADFGEAPIMLSINLNGTMWDVVSAVQKSGFAWALDRYNGSLVWS  413

Query  581   teagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKIL  402
             TEAGPGG  GGGTWGAATDN+RVYT+IANS+  NFTL PS+  T  GGWVAMDA TGKIL
Sbjct  414   TEAGPGGLTGGGTWGAATDNKRVYTNIANSDSKNFTLKPSEKNTTAGGWVAMDASTGKIL  473

Query  401   WSTAVPDTGLSN-PVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVS  225
             WSTA P    SN PVT+ANGVLF GS HP GP++A++A++G+ILWS+ TGATVYGG+SVS
Sbjct  474   WSTADPSNATSNGPVTIANGVLFGGSTHPTGPIYAMDARSGKILWSHNTGATVYGGISVS  533

Query  224   NGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             NGC+Y+GNGY+V++G+    FT GTSLFAFC+
Sbjct  534   NGCIYLGNGYKVNLGSFTASFTNGTSLFAFCV  565



>ref|XP_006587758.1| PREDICTED: uncharacterized protein LOC100791552 [Glycine max]
Length=541

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/536 (66%), Positives = 427/536 (80%), Gaps = 6/536 (1%)
 Frame = -1

Query  1727  CVCIIIFLICISATAKPEWHITRF-SCPASGNWLNHGGDIYNRRYACGENKISPSTVSKL  1551
             C  I + LIC+ A++  E     F S   + NWLNHGG+IYNRRYA  E+KIS  TVS L
Sbjct  9     CFIISMILICLLASSVSEGSDDIFTSTEKTENWLNHGGNIYNRRYASMEHKISVETVSNL  68

Query  1550  KLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRT  1371
              LKW+FYAGKDI+ATPAI  G +YFP WNG ++AV A DGSL+W++NL  LTGL+AT   
Sbjct  69    SLKWKFYAGKDITATPAIFDGTLYFPCWNGDIFAVRAKDGSLVWKQNLGNLTGLSATGFV  128

Query  1370  GNVTAIVSRSTPSIVG-ETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTY  1194
               V   V+R+TP+I   + LI GIYGPAVVI VKR+TGDL+W T LD H + ++TMSGTY
Sbjct  129   AGVNWTVARATPTIAEVDLLIFGIYGPAVVIAVKRSTGDLVWQTPLDSHNSSVVTMSGTY  188

Query  1193  YNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAI  1014
             Y GA+YVG SSLEE +++  CCTFRG F+KLD+ +G +LWQTFMLPDN G+RGEYAGAA+
Sbjct  189   YKGAYYVGASSLEELTTE-ECCTFRGSFSKLDIQSGVILWQTFMLPDNHGQRGEYAGAAV  247

Query  1013  WGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILA  834
             WGSSPSIDA R H+YIATGNLYSAP  +L+CQE++NN  T PT  D+CVEP+NHSDSILA
Sbjct  248   WGSSPSIDASRNHIYIATGNLYSAPLDILECQERENN-VTQPTHPDECVEPDNHSDSILA  306

Query  833   LDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRD  654
             LDLD GKIKW+RQLGGYDV+F++C N+ STPNCPPGPNPDADFGEAPMML++ VNG+ +D
Sbjct  307   LDLDDGKIKWYRQLGGYDVWFLSC-NNLSTPNCPPGPNPDADFGEAPMMLTIDVNGTKQD  365

Query  653   IVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFT  474
              VVAVQKSGFAWAL RDNG ++W TEAGPGG  GGGTWGAATD ERVYT+IANS+  NFT
Sbjct  366   TVVAVQKSGFAWALHRDNGNLIWSTEAGPGGLAGGGTWGAATDKERVYTNIANSDGQNFT  425

Query  473   LLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSN-PVTVANGVLFAGSVHPRGPVFAI  297
             L PS   T  GGWVAM+A +GKILWS A P    +N PVTVANGV+FAGS + +GP++AI
Sbjct  426   LKPSNKTTTSGGWVAMEASSGKILWSIANPSNATANGPVTVANGVVFAGSTNQKGPIYAI  485

Query  296   NAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             N KTG+I WSY TG+TVYGGMSVS+GC+Y GNGY++ +G  +  FT GTSLFAFC+
Sbjct  486   NGKTGKIEWSYETGSTVYGGMSVSDGCIYFGNGYKIGVGLNLGNFTAGTSLFAFCV  541



>emb|CDP02211.1| unnamed protein product [Coffea canephora]
Length=545

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/540 (65%), Positives = 427/540 (79%), Gaps = 15/540 (3%)
 Frame = -1

Query  1739  LLYYCVCIIIFLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACGENKISPSTV  1560
             L ++ +CI+I +I  +A+A   +   RF  P  G+WLNHGGDIYNRRYA GE KISP+T 
Sbjct  18    LAFFLLCILIQIIGTAASAAGPY--VRFGSP-RGDWLNHGGDIYNRRYASGETKISPATA  74

Query  1559  SKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNAT  1380
             S+L LKW+F AG  ++ TPA+  GVVYF SWNGY+YAV A DGSL+W++NL++LTG++  
Sbjct  75    SRLGLKWKFNAGGLVTGTPAVYDGVVYFTSWNGYVYAVKACDGSLVWKQNLKRLTGISGG  134

Query  1379  VRTGNVTAIVSRSTPSIVG---ETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLIT  1209
                G   A ++RSTP++V    + LI+GI GPA VI +KR++G L+W T LD HP  +IT
Sbjct  135   QLLG-FNATIARSTPTVVAGDLDMLILGITGPAYVIAIKRSSGRLIWSTQLDTHPYAIIT  193

Query  1208  MSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEY  1029
             MSGTYY+G FYVG SSLEE ++   CCTFRG F KLD  TG++LW+TF LPDN G+RG+Y
Sbjct  194   MSGTYYHGGFYVGVSSLEENATIEECCTFRGSFVKLDARTGRILWKTFTLPDNHGQRGDY  253

Query  1028  AGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHS  849
             AG AIWGSS  IDA R HVYIATGNLYSAP+ +  CQE+ NN+ TTPT  ++C+EP+NHS
Sbjct  254   AGGAIWGSSAPIDASRNHVYIATGNLYSAPQRIQDCQERLNNQ-TTPTNPEECIEPDNHS  312

Query  848   DSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVN  669
             DS++ALD+D GKI+W+RQLGGYDV+F AC N+ STPNCP GPNPDADFGE PMMLS+ +N
Sbjct  313   DSMMALDMDNGKIRWYRQLGGYDVWFFAC-NNLSTPNCPSGPNPDADFGEEPMMLSIELN  371

Query  668   GSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSN  489
              + RDIVVAVQKSGFAWALDRD+G ++W+TEAGPGG  GGGTWGAATD +++YT+IANSN
Sbjct  372   ATKRDIVVAVQKSGFAWALDRDDGNIIWFTEAGPGGIAGGGTWGAATDTKKIYTNIANSN  431

Query  488   RLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSNPVTVANGVLFAGSVHPRGP  309
             R+NFTLLPSK VT GGGWVAMDA TGKILWSTA P     NPVT+ANGVLF GS H  GP
Sbjct  432   RMNFTLLPSKKVTNGGGWVAMDAPTGKILWSTADPKNATVNPVTIANGVLFGGSTHSTGP  491

Query  308   VFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             V+AINA TG+ILWSY TGA+VYGGMSVSNGC+YVG+GYR       P FT GT LFAFC+
Sbjct  492   VYAINAGTGKILWSYETGASVYGGMSVSNGCMYVGHGYRA------PAFTAGTHLFAFCI  545



>ref|XP_007099708.1| Quinohemoprotein ethanol dehydrogenase type-1 [Theobroma cacao]
 gb|EOY20323.1| Quinohemoprotein ethanol dehydrogenase type-1 [Theobroma cacao]
Length=528

 Score =   683 bits (1763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/505 (69%), Positives = 407/505 (81%), Gaps = 2/505 (0%)
 Frame = -1

Query  1637  NWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGY  1458
             +WLNHGG++ NRR+A  E KISP TVS+L+LKW F AG+DI+ATPAI  G +YFPSWNGY
Sbjct  25    DWLNHGGNLLNRRFADNETKISPGTVSRLRLKWTFNAGRDITATPAIFGGTLYFPSWNGY  84

Query  1457  LYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIG  1278
             LYAV ASDGSL+W++NLQ+LTGL +TV   NV   VSR+TP+I  + LI+G+ GPA V+ 
Sbjct  85    LYAVKASDGSLVWKQNLQQLTGLKSTVAISNVNVTVSRTTPAIADDLLILGLSGPAYVVA  144

Query  1277  VKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLD  1098
             VKR+ G L+W T LD++  G+ITMSGTYY G FYVGTSSLE   S   CC FRG F KL+
Sbjct  145   VKRSNGQLVWSTQLDKNSHGVITMSGTYYKGHFYVGTSSLESTVSIEECCIFRGSFVKLN  204

Query  1097  VWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQ  918
               TGK+LWQT+MLPDN GKRG YAGAAIWGSSPSID  R HVYI TGNLYSAPK+V  CQ
Sbjct  205   ARTGKILWQTYMLPDNFGKRGGYAGAAIWGSSPSIDVRRNHVYIGTGNLYSAPKNVTDCQ  264

Query  917   EKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPN  738
             E+QNN+T  PT  D+CVEPEN SDSILALDLDTGKIKWF QLGGYDV+  ACIN S+ P+
Sbjct  265   ERQNNQTDIPTHPDECVEPENLSDSILALDLDTGKIKWFHQLGGYDVWTFACINPSN-PS  323

Query  737   CPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggf  558
             CPPGPN DADFGEAPMMLS  VN + RD+VVA QKSGFAWAL+RDNG ++WYTEAGPGG 
Sbjct  324   CPPGPNRDADFGEAPMMLSTYVNRTKRDLVVAAQKSGFAWALERDNGNIIWYTEAGPGGL  383

Query  557   vgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDT  378
             VGGG WGAATD +RVYT+IANS+  NFTL PS  +T  GGWVAMDA+ G+ILWSTA P  
Sbjct  384   VGGGIWGAATDEKRVYTNIANSDGKNFTLKPSTKITTAGGWVAMDAKNGQILWSTADPSN  443

Query  377   GL-SNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGN  201
             G  S PVTVANGVLF  S +  GP++A+N+ TG+ILWSY TGAT+YGG+SVSNGC+Y+G+
Sbjct  444   GTASGPVTVANGVLFGCSTYRHGPIYAMNSYTGKILWSYNTGATIYGGLSVSNGCIYIGH  503

Query  200   GYRVSIGAGIPIFTGGTSLFAFCLE  126
             GY+VS+G   P FT GTSLFAFC+ 
Sbjct  504   GYKVSLGFSNPRFTAGTSLFAFCVS  528



>ref|XP_010661142.1| PREDICTED: uncharacterized protein LOC104877357 [Vitis vinifera]
Length=519

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/507 (70%), Positives = 414/507 (82%), Gaps = 4/507 (1%)
 Frame = -1

Query  1643  SGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWN  1464
             S +WLNHGGD+YNRRYA  E +ISP T SKL+LKWEFYAGKDI+ATPAI  G +YFPSWN
Sbjct  16    SADWLNHGGDLYNRRYASTETEISPETTSKLRLKWEFYAGKDITATPAIFNGTLYFPSWN  75

Query  1463  GYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVV  1284
             GYLYAV ASDGSL+W++NLQ LTGLNAT    NV   VSRSTP+I G+ LIIGIYGPAVV
Sbjct  76    GYLYAVKASDGSLVWKQNLQNLTGLNATGFVTNVNWTVSRSTPTIAGDMLIIGIYGPAVV  135

Query  1283  IGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAK  1104
             IGV +ATG L+W T L+ +PAG++TMSGT++ G+FYVGTSSLEE      CC FRG  +K
Sbjct  136   IGVDQATGRLVWSTWLESNPAGVVTMSGTFHKGSFYVGTSSLEELLGIEQCCIFRGSLSK  195

Query  1103  LDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLK  924
             LD+ TG +LWQTF LPDN G+RGEYAGAAIWGSSPSID  R  VY+ATGNLYSAP ++ +
Sbjct  196   LDIKTGAILWQTFTLPDNHGERGEYAGAAIWGSSPSIDVQRNLVYVATGNLYSAPLNIQE  255

Query  923   CQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSST  744
             CQE+Q N  T PT  D+C+EP+NHS+SILA DLD+GKIKW+RQLGGYDV+F+AC N+ ST
Sbjct  256   CQEQQ-NNQTVPTQPDQCIEPDNHSNSILAFDLDSGKIKWYRQLGGYDVWFLAC-NNLST  313

Query  743   PNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpg  564
             PNCPPGPNPDADFGEAPMMLS+ VNG+ RDIVVAVQKSGFAWALDR +G +VW TEAGPG
Sbjct  314   PNCPPGPNPDADFGEAPMMLSIYVNGTMRDIVVAVQKSGFAWALDRYDGSLVWSTEAGPG  373

Query  563   gfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVP  384
             G  GGGTWGA TD +RVYT+I NS   NFTL PS  +T  GGWVAMDA TG+ LWSTA P
Sbjct  374   GLAGGGTWGATTDGKRVYTNIVNSYGKNFTLKPSDTITTTGGWVAMDANTGETLWSTANP  433

Query  383   DTGLSN-PVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYV  207
                 SN PVT+ANGVLFAGS HP GP++A+ A +G ILWS+ TGA+VYGG SVS+GC+YV
Sbjct  434   SNATSNGPVTIANGVLFAGSTHPTGPMYAMEAASGRILWSHNTGASVYGGASVSSGCIYV  493

Query  206   GNGYRVSIGAGIPIFTGGTSLFAFCLE  126
             G+GY V+IG  +  FTGGTSLFAFCL 
Sbjct  494   GSGYSVNIGTSLS-FTGGTSLFAFCLS  519



>ref|XP_008230740.1| PREDICTED: uncharacterized protein LOC103329981 [Prunus mume]
Length=538

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/507 (68%), Positives = 409/507 (81%), Gaps = 4/507 (1%)
 Frame = -1

Query  1646  ASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSW  1467
             A+ NWLNHGGD+YNRRYA  E KISP TVSKL  KWEFY G+++SATPAI +  +YFPSW
Sbjct  34    ATQNWLNHGGDLYNRRYASKETKISPETVSKLSFKWEFYTGREVSATPAIYEDTLYFPSW  93

Query  1466  NGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAV  1287
             NGY+YA+ ASDGS++WE+NL+ LTG+NAT    NV   VSRSTP+I G+ L+IGI GPAV
Sbjct  94    NGYIYAIKASDGSVVWEKNLETLTGINATGYLLNVNTTVSRSTPTIAGDLLLIGICGPAV  153

Query  1286  VIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFA  1107
             V+ V+R+TG L+W TLLD H + +ITMSGTYY G  Y+GTSS+EE +  A CCTFRG FA
Sbjct  154   VLAVERSTGKLIWSTLLDSHASSVITMSGTYYKGGLYIGTSSVEESAPIATCCTFRGSFA  213

Query  1106  KLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVL  927
             KLDV +G +LWQTF+LPDN  KRG Y+GAAIWGSSPSID HR  VYIATGNLYS P++V+
Sbjct  214   KLDVKSGTILWQTFVLPDNHQKRGLYSGAAIWGSSPSIDVHRRQVYIATGNLYSVPENVI  273

Query  926   KCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSS  747
             +CQE Q N +T PT  D CVEPENH +SILALDLD G IKW+RQLGGYDV+F+AC  ++S
Sbjct  274   QCQENQTNNSTIPTHPDACVEPENHGNSILALDLDGGNIKWYRQLGGYDVWFVACYLNAS  333

Query  746   TPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagp  567
               NCP GPN DADFGEAPMML   VNG+ RDIVVAVQKSGFAWALDR+NG +VW TEAGP
Sbjct  334   --NCPIGPNVDADFGEAPMMLRTYVNGTRRDIVVAVQKSGFAWALDRNNGSLVWSTEAGP  391

Query  566   ggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAV  387
             GG  GGGTWGAATD +RVYT+IANS+R  FTL PS N+T  GGWVAMDA++GK+LWST  
Sbjct  392   GGIGGGGTWGAATDKKRVYTNIANSDRKKFTLKPSSNITTAGGWVAMDARSGKVLWSTVN  451

Query  386   PDTGLS-NPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVY  210
             P    S  PV+VANGVLFAGS  P G ++A+N +TG+ILWSY TGA+VYGGMS+SNGC+Y
Sbjct  452   PSNASSPGPVSVANGVLFAGSPDPEGSLYAMNTRTGKILWSYETGASVYGGMSISNGCIY  511

Query  209   VGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             VGNGY VS G  +  FT GTSL+AFC+
Sbjct  512   VGNGYNVSFGV-VLGFTPGTSLYAFCI  537



>gb|EYU34100.1| hypothetical protein MIMGU_mgv1a026159mg [Erythranthe guttata]
Length=501

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/507 (69%), Positives = 410/507 (81%), Gaps = 9/507 (2%)
 Frame = -1

Query  1643  SGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWN  1464
             +GNWLNHGGDIYNRRYA GE +ISPST  +L+LKW+F+AG DI+ATPAI  GVVYFPSWN
Sbjct  2     TGNWLNHGGDIYNRRYAAGETRISPSTAYQLRLKWKFHAGNDITATPAIFGGVVYFPSWN  61

Query  1463  GYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVV  1284
             GY+YAV A DG+L+W++NL+ LTGLNATV   N T +VSR+TP++ G+ LIIGIYGPA V
Sbjct  62    GYIYAVRAVDGTLVWKKNLKALTGLNATVFFTNGT-LVSRATPTVAGDKLIIGIYGPAYV  120

Query  1283  IGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAK  1104
             I V RATG L+W   LD HPA +ITMSGTYY    YVG SSLEE SS  +CCTFRG  AK
Sbjct  121   IAVARATGQLVWKRQLDNHPAAIITMSGTYYAKYLYVGVSSLEETSSIENCCTFRGSLAK  180

Query  1103  LDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLK  924
             LD+ TG V+WQT+MLPDN+   G YAGAA+WGSSPSIDA R HVYIATGNLYSAP  V +
Sbjct  181   LDIQTGSVIWQTYMLPDNQRTTGGYAGAALWGSSPSIDAVRNHVYIATGNLYSAPPSVEE  240

Query  923   CQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSST  744
             CQE+QNN+ T PT  ++CV PE H DS+LALDL++G+++W+RQLGGYDV+  AC    ST
Sbjct  241   CQERQNNQ-TVPTNPEECVGPEIHFDSVLALDLNSGRVEWYRQLGGYDVWLFAC-RDPST  298

Query  743   PNCPPGPNPDADFGEAPMMLSV-VVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagp  567
             PNCPPGPNPDADFGEAPMML+V   N +  DIV  VQKSGFAWAL+R+NG +VW TEAGP
Sbjct  299   PNCPPGPNPDADFGEAPMMLTVNFANATKVDIVAIVQKSGFAWALNRNNGNLVWSTEAGP  358

Query  566   ggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAV  387
             GG  GGGTWGAATDN +VYT+IAN+N+ NFTLLPS NVT GGGWV+MDA TG+ILWSTAV
Sbjct  359   GGTQGGGTWGAATDNRKVYTNIANTNKQNFTLLPSNNVTNGGGWVSMDAGTGRILWSTAV  418

Query  386   PDTGLSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYV  207
             P    +NPVT+ANGVLFAGS +  GPV+AINA +GEILWS+ TG +VYGG SVS GC YV
Sbjct  419   PHNATTNPVTIANGVLFAGSTYKTGPVYAINAASGEILWSFDTGGSVYGGFSVSKGCAYV  478

Query  206   GNGYRVSIGAGIPIFTGGTSLFAFCLE  126
             G+G+RV+     P FTGGTSLFAFC+ 
Sbjct  479   GSGFRVN-----PTFTGGTSLFAFCIR  500



>ref|XP_007216818.1| hypothetical protein PRUPE_ppa022972mg [Prunus persica]
 gb|EMJ18017.1| hypothetical protein PRUPE_ppa022972mg [Prunus persica]
Length=547

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/507 (68%), Positives = 408/507 (80%), Gaps = 4/507 (1%)
 Frame = -1

Query  1646  ASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSW  1467
             A+ NWLNHGGD+YNRRYA  E KISP TVSKL  KWEFY G+++SATPAI    +YFPSW
Sbjct  43    ATQNWLNHGGDLYNRRYASKETKISPETVSKLSFKWEFYTGREVSATPAIYDDTLYFPSW  102

Query  1466  NGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAV  1287
             NGY+YA+ ASDGS++WE+NL+ LTG+NAT    NV   VSRSTP+I G+ L+IGI GPAV
Sbjct  103   NGYIYAIKASDGSVVWEKNLETLTGINATGYLLNVNTTVSRSTPTIAGDLLLIGICGPAV  162

Query  1286  VIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFA  1107
             VI ++R+TG L+W TLLD H A ++TMSGTYY G FY+GTSS+EE +  A CCTFRG FA
Sbjct  163   VIALERSTGKLIWSTLLDGHAASVVTMSGTYYKGGFYIGTSSVEESAPIATCCTFRGSFA  222

Query  1106  KLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVL  927
             KLDV +G +LWQTF+LPDN  KRG Y+GAAIWGSSPSID HR HVYI TGNLYS P++V 
Sbjct  223   KLDVKSGTILWQTFVLPDNHQKRGLYSGAAIWGSSPSIDVHRRHVYIGTGNLYSVPENVT  282

Query  926   KCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSS  747
             +CQE Q N +T PT  D CVEPENH +SILALDLD G IKW+ QLGGYDV+F+AC  ++S
Sbjct  283   QCQENQTNNSTIPTHPDACVEPENHGNSILALDLDGGDIKWYHQLGGYDVWFVACYLNAS  342

Query  746   TPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagp  567
               NCP GPN DADFGEAPMML   VNG+ RDIVVAVQKSGFAWALDR+NG +VW TEAGP
Sbjct  343   --NCPIGPNVDADFGEAPMMLRTYVNGTRRDIVVAVQKSGFAWALDRNNGSLVWSTEAGP  400

Query  566   ggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAV  387
             GG  GGGTWGAATD +RVYT+IANS+R NFTL PS N+T  GGWVAMDA++GK+LWST  
Sbjct  401   GGIGGGGTWGAATDKKRVYTNIANSDRKNFTLKPSSNITTAGGWVAMDARSGKVLWSTVN  460

Query  386   PDTGLS-NPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVY  210
             P    S  PV+VANGVLFAGS  P+G ++A+N +TG+ILWSY TGA+VYGGMS+SNGC+Y
Sbjct  461   PSNASSPGPVSVANGVLFAGSPDPQGSLYAMNTRTGKILWSYETGASVYGGMSISNGCIY  520

Query  209   VGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             VGNGY VS G  +  FT GTS +AFC+
Sbjct  521   VGNGYNVSFGV-VLGFTPGTSFYAFCI  546



>gb|ABN08942.1| Quinonprotein alcohol dehydrogenase-like [Medicago truncatula]
Length=539

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/537 (65%), Positives = 421/537 (78%), Gaps = 10/537 (2%)
 Frame = -1

Query  1727  CVCIIIFLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLK  1548
             C  + +FL+C S T    +  T        NWLNHGGDIYNRRYA  E+KI+  T+S L 
Sbjct  9     CFLVSLFLLC-SLTCSKRYDYTE----KEQNWLNHGGDIYNRRYASKEHKINLKTISNLT  63

Query  1547  LKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTG  1368
             LKWEF AGKDI+ATPAI  G +YFPSWNG ++AV   DG+L+W++NL KLTGL++     
Sbjct  64    LKWEFNAGKDITATPAIFNGTIYFPSWNGLIFAVREIDGTLVWKKNLTKLTGLDSIGFIA  123

Query  1367  NVTAIVSRSTPSI-VGETLII-GIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTY  1194
             NV   V+R+TP+I V E L+I GIYGPAVVI V R+TGDL+W T LD + AG++TMSGTY
Sbjct  124   NVNWTVARATPTIAVDEDLVIVGIYGPAVVIAVNRSTGDLIWQTRLDSNDAGVVTMSGTY  183

Query  1193  YNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAI  1014
             Y GA+YVG+SSLEE  S   CCTFRG F+KLD+ +G +LW+T+MLPDN GKRGEY+G AI
Sbjct  184   YKGAYYVGSSSLEELKSAEECCTFRGSFSKLDIKSGAILWKTYMLPDNNGKRGEYSGGAI  243

Query  1013  WGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKT-TTPTTSDKCVEPENHSDSIL  837
             WGSSP IDA R H+YIATGNLYSAP H+ +CQ+++NNK  T PT  D+CVEPENHS+SIL
Sbjct  244   WGSSPPIDASRNHIYIATGNLYSAPLHIRQCQDEENNKNLTRPTQPDQCVEPENHSNSIL  303

Query  836   ALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTR  657
             ALDL  G+IKW+ QLGGYDV+F+AC N  STPNCPPGPNPDADFGEAPMML++ VNG+ +
Sbjct  304   ALDLYNGEIKWYHQLGGYDVWFLAC-NDLSTPNCPPGPNPDADFGEAPMMLTIDVNGTKQ  362

Query  656   DIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNF  477
             DIVVAVQKSGFAWAL R NG+++W TEAGPGG  GGGTWGAATD ERVYT+IANSN  NF
Sbjct  363   DIVVAVQKSGFAWALHRHNGDIIWSTEAGPGGVAGGGTWGAATDKERVYTNIANSNAKNF  422

Query  476   TLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSN-PVTVANGVLFAGSVHPRGPVFA  300
             TL PS      GGWVAM+A +GKILW+ A P    +N PV+VANG++FAGS + +GP++A
Sbjct  423   TLKPSNKTITSGGWVAMEASSGKILWAIANPSNATANGPVSVANGIVFAGSANRKGPIYA  482

Query  299   INAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             IN KTGEILWSY TGATVYGG+S++NGC+Y+GNGY V +   I   TGGTSL+AFC+
Sbjct  483   INGKTGEILWSYETGATVYGGISINNGCIYLGNGYTVGLATVIGGLTGGTSLYAFCV  539



>ref|XP_007139594.1| hypothetical protein PHAVU_008G042900g, partial [Phaseolus vulgaris]
 gb|ESW11588.1| hypothetical protein PHAVU_008G042900g, partial [Phaseolus vulgaris]
Length=547

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/543 (64%), Positives = 422/543 (78%), Gaps = 13/543 (2%)
 Frame = -1

Query  1733  YYCVCIIIFLICISATAKPEWHITRFSCPA------SGNWLNHGGDIYNRRYACGENKIS  1572
             Y+  C +  ++C+S      + +  F+  +      S  WLNHGGD++NRRYA  E KIS
Sbjct  10    YFANCSMHSVLCLSLVCA--YAVAVFAASSDWQGQESQEWLNHGGDLFNRRYAYKERKIS  67

Query  1571  PSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTG  1392
             P T   L+LKW+FYAGKDI+ATPAI  G +YFPSWNG +YAV  +DGSL+W++NLQ LTG
Sbjct  68    PETAPNLRLKWKFYAGKDITATPAIYDGTLYFPSWNGNIYAVKEADGSLVWKQNLQILTG  127

Query  1391  LNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLI  1212
             L AT    NV   VSRSTP++ G+ LI+GIYGPAVVIG+KR +G+L+W T LD HPA LI
Sbjct  128   LKATGFVQNVNWTVSRSTPTVAGDLLIVGIYGPAVVIGLKRTSGELVWKTTLDHHPAALI  187

Query  1211  TMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGE  1032
             TMSGT+YNG+FYVGTSSLEEG++   CC FRG F KLD  +G +LW+TF+LPDN   RG+
Sbjct  188   TMSGTFYNGSFYVGTSSLEEGATIEQCCIFRGSFTKLDAQSGAILWKTFVLPDNNNTRGK  247

Query  1031  YAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENH  852
             YAGAAIWGSSPSID HR HVYIATGNLYSAP  +L+CQEKQ+N+ T P   D+CVEPENH
Sbjct  248   YAGAAIWGSSPSIDVHRNHVYIATGNLYSAPLEILQCQEKQDNQ-TKPAQPDECVEPENH  306

Query  851   SDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPP-GPNPDADFGEAPMMLSVV  675
             S+SILALDL++G I W+RQLGGYDV+F AC N +ST NCPP GP PDADFGEAPMML+  
Sbjct  307   SNSILALDLNSGNITWYRQLGGYDVWFFACTN-ASTLNCPPSGPTPDADFGEAPMMLTTY  365

Query  674   VNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIAN  495
             VNG+ +D+VVAVQKSGFAWALDR+NG ++W+TEAGPGGF GGGTWGAATD  RVYT+IAN
Sbjct  366   VNGNKKDMVVAVQKSGFAWALDRNNGSLIWFTEAGPGGFAGGGTWGAATDERRVYTNIAN  425

Query  494   SNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSN-PVTVANGVLFAGSVHP  318
             S   NFTL P    T  GGWVAMD+  G ILWSTA P    +N PV+VAN V+FAGS   
Sbjct  426   SGAKNFTLAPLNISTTTGGWVAMDSNKGHILWSTANPSNSTANGPVSVANEVVFAGSTDR  485

Query  317   RGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFA  138
              G ++AINAK+G+ILWSY TG +VYGGMS+SNGC+YVG+GY V++G  + + TGGTSLFA
Sbjct  486   MGFIYAINAKSGKILWSYKTGGSVYGGMSISNGCIYVGHGYNVNLGFSVNL-TGGTSLFA  544

Query  137   FCL  129
             FC+
Sbjct  545   FCV  547



>ref|XP_004489158.1| PREDICTED: polyvinylalcohol dehydrogenase-like [Cicer arietinum]
Length=531

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/534 (63%), Positives = 416/534 (78%), Gaps = 11/534 (2%)
 Frame = -1

Query  1724  VCIIIFLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKL  1545
             + + +  +C+         I  F   +  +WLNHGGD++NRRYA  E KISP T   L+L
Sbjct  7     IVLRLLFLCVHV-------IVAFVASSESDWLNHGGDLFNRRYAKKEYKISPKTAPNLRL  59

Query  1544  KWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGN  1365
             KW+F AGKDI+ATPAI  G +YFPSWNG +YA+   DGSL+W++NL+KLTGLNAT    N
Sbjct  60    KWKFNAGKDITATPAIYNGTLYFPSWNGNIYAIKQIDGSLIWKQNLKKLTGLNATGYIIN  119

Query  1364  VTAIVSRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNG  1185
                 V+R+TP++ G+ LIIGIYGPAVVIG+KR TG+L+W+  LD HPA ++TMSGTYYNG
Sbjct  120   ANWTVARATPTVAGDLLIIGIYGPAVVIGLKRTTGELVWLAHLDNHPAAVVTMSGTYYNG  179

Query  1184  AFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGS  1005
              +YVGTSSLEEG++   CC FRG F KLD  +G +LW+T+MLP+N GK+GEYAGAAIWGS
Sbjct  180   GYYVGTSSLEEGATIEQCCIFRGSFIKLDAKSGVILWKTYMLPNNNGKKGEYAGAAIWGS  239

Query  1004  SPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDL  825
             SPSID +R H+YIATGNLYSAP ++L+CQE+QNN+ TTP   DKCVE ENHS+SILALDL
Sbjct  240   SPSIDVYRNHIYIATGNLYSAPLNILQCQERQNNE-TTPIKQDKCVEQENHSNSILALDL  298

Query  824   DTGKIKWFRQLGGYDVFFIACINSSSTPNCPP-GPNPDADFGEAPMMLSVVVNGSTRDIV  648
             D G IKW+RQLGGYDV+F+AC  ++S PNCPP GP PDADFGEAPMML+  VNG+ +D+V
Sbjct  299   DYGNIKWYRQLGGYDVWFVACSLNASNPNCPPQGPTPDADFGEAPMMLTTCVNGTKKDMV  358

Query  647   VAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLL  468
             VAVQKSG+AWAL+RD G ++W+ E GPGG VGGGTWGA+TD +++YT+IANS   NF L 
Sbjct  359   VAVQKSGYAWALNRDTGNLLWFMEVGPGGTVGGGTWGASTDEKKIYTNIANSEAKNFNLA  418

Query  467   PSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSN-PVTVANGVLFAGSVHPRGPVFAINA  291
             PS   T  GGWVAMDA+ GKI+WS A P    SN PV+VAN V+FAGS +  G V+AINA
Sbjct  419   PSNMSTTFGGWVAMDAKNGKIIWSIANPSNSSSNGPVSVANEVVFAGSTNKVGNVYAINA  478

Query  290   KTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             + G ILWSY TGA+VYGGMS+SNGC+YVG+GY VS+G     FT GTSLFAFC+
Sbjct  479   RNGGILWSYETGASVYGGMSISNGCMYVGHGYNVSLGF-YSNFTSGTSLFAFCV  531



>ref|XP_007139592.1| hypothetical protein PHAVU_008G042700g [Phaseolus vulgaris]
 gb|ESW11586.1| hypothetical protein PHAVU_008G042700g [Phaseolus vulgaris]
Length=542

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/536 (64%), Positives = 418/536 (78%), Gaps = 5/536 (1%)
 Frame = -1

Query  1727  CVCIIIFLICISATAKPEWHITRFSCPA-SGNWLNHGGDIYNRRYACGENKISPSTVSKL  1551
             C  I + LIC+   +  E     FS    + NWLNHGGDI+NRRYA  E+KIS  TVS L
Sbjct  9     CFIISMLLICLLTCSLSEGSDDIFSSTENTENWLNHGGDIFNRRYASMEHKISVETVSNL  68

Query  1550  KLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRT  1371
              LKW+F AGKDI+ATPAI  G++YFPSWNG ++AV   DGSL+W +NLQ LT L+AT   
Sbjct  69    SLKWKFNAGKDITATPAIFDGILYFPSWNGDIFAVRTQDGSLVWRQNLQNLTKLSATGFV  128

Query  1370  GNVTAIVSRSTPSIV-GETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTY  1194
               V   V+R+TP+I   + L++GIYGPAVVI VKR+TG+L+W T LD H + +ITMSGTY
Sbjct  129   AGVNWTVARATPTIAEDDLLVVGIYGPAVVIAVKRSTGELVWKTRLDSHNSSIITMSGTY  188

Query  1193  YNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAI  1014
             Y GA+YVGTSSLEE  +   CCTFRG F+KLD+ +G +LWQTFMLPDN GK+GEYAGAAI
Sbjct  189   YKGAYYVGTSSLEEIITSEECCTFRGSFSKLDIKSGVILWQTFMLPDNNGKKGEYAGAAI  248

Query  1013  WGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILA  834
             WGSSPSIDA R H+YIATGNLYSAP ++L+CQE++NN  T PT  D+CVEP+NHSDS LA
Sbjct  249   WGSSPSIDASRNHIYIATGNLYSAPLNILECQERENN-ATQPTHPDQCVEPDNHSDSFLA  307

Query  833   LDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRD  654
             LDLD GKIKW+ QLGGYDV+ ++C N  STPNCPPGPNPDADFGEAPMML++ VN + +D
Sbjct  308   LDLDDGKIKWYHQLGGYDVWLLSCRN-LSTPNCPPGPNPDADFGEAPMMLTIHVNKTKQD  366

Query  653   IVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFT  474
             +VVAVQKSGF WAL R +G+++W TEAGPGG  GGGTWGAATD ERVYT+I NS+  NFT
Sbjct  367   VVVAVQKSGFTWALHRHDGKLIWSTEAGPGGVAGGGTWGAATDEERVYTNIVNSDGKNFT  426

Query  473   LLPSKNVTIGGGWVAMDAQTGKILWSTAVP-DTGLSNPVTVANGVLFAGSVHPRGPVFAI  297
             L PS   T  GGWVAM+ ++GKILWST  P +     PVTVANG++FAGSV  +G ++A+
Sbjct  427   LRPSNKTTRTGGWVAMEGKSGKILWSTENPSNANAYGPVTVANGIVFAGSVDSKGAIYAM  486

Query  296   NAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             NA++G I+WSY TG+TVYGGMSVS+GC+YVGNGY+V IG  +  FT GTSL AFC+
Sbjct  487   NAESGNIVWSYETGSTVYGGMSVSDGCIYVGNGYKVGIGLNLGNFTAGTSLLAFCV  542



>ref|XP_008230739.1| PREDICTED: uncharacterized protein LOC103329980 [Prunus mume]
Length=544

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/538 (64%), Positives = 418/538 (78%), Gaps = 4/538 (1%)
 Frame = -1

Query  1739  LLYYCVCIIIFLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACGENKISPSTV  1560
             L    +C++  +I  SA     W   +    A+ +WLNHGGD+YNRRYA  E KISP+TV
Sbjct  10    LFLLSLCMVCLVITPSAGFNI-WRSAQKHKAAAQDWLNHGGDLYNRRYANREKKISPATV  68

Query  1559  SKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNAT  1380
             S L LKW+FYAG DI+ TPAI+ G +YFPSWNGYLYAV ASDGSL+W++N+Q+LTG N T
Sbjct  69    SNLSLKWKFYAGGDITVTPAIVDGTLYFPSWNGYLYAVKASDGSLVWKKNVQELTGFNNT  128

Query  1379  VRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSG  1200
                 NV + V+RSTP++ G+ LI+GIYGPA VI VKR+ G L+W T LD H    ITMSG
Sbjct  129   GFILNVNSTVTRSTPTVAGDLLIVGIYGPAFVIAVKRSNGKLVWSTRLDNHTRAFITMSG  188

Query  1199  TYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGA  1020
             TYY G +YVGTSSLEEG +   CCTFRG  +KL+V TG +LWQTFMLPDN GK GEYAGA
Sbjct  189   TYYKGGYYVGTSSLEEGLTIEQCCTFRGSISKLEVRTGAILWQTFMLPDNFGKFGEYAGA  248

Query  1019  AIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSI  840
             AIWGSSPSID  R  V+IAT NLYSAP  +++CQEK+NN+ T P+  + C+EP+NHS+SI
Sbjct  249   AIWGSSPSIDVPRNLVFIATSNLYSAPPRIIECQEKENNQ-TVPSHPEACIEPDNHSESI  307

Query  839   LALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGST  660
             +ALDLDTGKIKW++QLGGYD++F AC +    P CPPGP+PDADFGEAPMML+  VNG+ 
Sbjct  308   VALDLDTGKIKWYKQLGGYDIWFGAC-HRHLDPRCPPGPSPDADFGEAPMMLTTYVNGTK  366

Query  659   RDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLN  480
             +DIVVAVQKSGFAWALDRD+G +VW TEAGPGG  GG  WGAATD +RVYT+IANS   N
Sbjct  367   KDIVVAVQKSGFAWALDRDSGSLVWSTEAGPGGLGGGAMWGAATDEKRVYTNIANSQHKN  426

Query  479   FTLLPSKNVTIGGGWVAMDAQTGKILWSTA-VPDTGLSNPVTVANGVLFAGSVHPRGPVF  303
             FTL PS+N TI GGWVAM+A++G I+WSTA   D      VTVANGV+F GS H +GP++
Sbjct  427   FTLKPSQNSTIAGGWVAMEARSGNIIWSTANSNDATAPAAVTVANGVVFGGSTHRQGPIY  486

Query  302   AINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             A+NAKTG+ILWSY TGATVYGG+SVS+GC+Y+GNGY+V  G   P +T GTSLFAFC+
Sbjct  487   AMNAKTGKILWSYDTGATVYGGISVSDGCIYLGNGYKVFNGFVNPNYTAGTSLFAFCV  544



>ref|XP_010661143.1| PREDICTED: uncharacterized protein LOC104877332, partial [Vitis 
vinifera]
Length=500

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/503 (69%), Positives = 406/503 (81%), Gaps = 4/503 (1%)
 Frame = -1

Query  1631  LNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLY  1452
             LNHGGD+YNRRYA  E +ISP T SKL+LKWEFYAGKDI+ATPAI  G +YFPSWNGYLY
Sbjct  1     LNHGGDLYNRRYASTETEISPETTSKLRLKWEFYAGKDITATPAIFNGTLYFPSWNGYLY  60

Query  1451  AVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGVK  1272
             AV ASDGSL+W++NLQ LTGLNAT    NV   VSRSTP+I G+ LIIGIYGPAVVIGV 
Sbjct  61    AVKASDGSLVWKQNLQNLTGLNATGFVTNVNWTVSRSTPTIAGDMLIIGIYGPAVVIGVD  120

Query  1271  RATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVW  1092
             +ATG L+W T L+ +PAG++ MSGT++ G+FYVGTSSLEE      CC FRG  +KLD+ 
Sbjct  121   QATGRLMWSTRLESNPAGVVAMSGTFHKGSFYVGTSSLEELLGIEQCCIFRGSLSKLDIK  180

Query  1091  TGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEK  912
             TG +LWQTF LPDN G+RGEYAGAAIWGSSPSID  R  VY+ATGNLYSAP ++ +CQE+
Sbjct  181   TGAILWQTFTLPDNHGERGEYAGAAIWGSSPSIDVQRNLVYVATGNLYSAPLNIQECQEQ  240

Query  911   QNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCP  732
             Q N  T PT  D+C+EP+NHS+SILA DLD+GKIKW+RQLGGYDV+F+AC N  STPNCP
Sbjct  241   Q-NNQTVPTQPDQCIEPDNHSNSILAFDLDSGKIKWYRQLGGYDVWFLACSN-LSTPNCP  298

Query  731   PGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvg  552
              GPN DADFGEAPMML + +NG+  DIVVAVQKSGFAWALDR +G +VW TEAGPGG  G
Sbjct  299   SGPNQDADFGEAPMMLRIYLNGTMLDIVVAVQKSGFAWALDRYDGSLVWSTEAGPGGLTG  358

Query  551   ggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGL  372
             GGTWGAATD +RVYT+I NS+  NFTL PS  +T  GGWVAMDA TG+ LWSTA P    
Sbjct  359   GGTWGAATDGKRVYTNIVNSSGQNFTLKPSDAITTAGGWVAMDANTGETLWSTANPSNAT  418

Query  371   SN-PVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             SN PVT+ANGVLFAGS HP GP++A+ A +G ILWS+ TGA+VYGG SVS+GC+YVG+GY
Sbjct  419   SNGPVTIANGVLFAGSTHPTGPMYAMEATSGRILWSHNTGASVYGGASVSSGCIYVGSGY  478

Query  194   RVSIGAGIPIFTGGTSLFAFCLE  126
              V+ G  +  FTGGTSLFAFCL 
Sbjct  479   SVNFGTLLS-FTGGTSLFAFCLS  500



>ref|XP_003621148.1| Quinohaemoprotein ethanol dehydrogenase type-1 [Medicago truncatula]
 gb|AES77366.1| polyvinylalcohol dehydrogenase-like protein [Medicago truncatula]
Length=528

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/535 (63%), Positives = 418/535 (78%), Gaps = 15/535 (3%)
 Frame = -1

Query  1724  VCIIIFLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKL  1545
             +C+++F + +         I  F+  +  +W+NHGGD++NRRYA  E KI+  TV KL L
Sbjct  6     LCLLLFCVHV---------ILIFAASSESDWINHGGDLFNRRYAYKEQKINIETVPKLSL  56

Query  1544  KWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGN  1365
             KW+FYA KDI+ATP I  G +YFPSWNG +YA+   DGSL+W++NL+KLTGLN T    N
Sbjct  57    KWKFYANKDITATPTIYNGTIYFPSWNGNIYAIKQVDGSLVWKQNLEKLTGLNTTGFIIN  116

Query  1364  VTAIVSRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNG  1185
                 ++R+TP++  + LI+GIYGPAVVIG++R TG+L+W+T LD HPAG++TMSGTYYNG
Sbjct  117   ANWTLARATPTVAEDLLIVGIYGPAVVIGLERRTGELVWLTHLDNHPAGVVTMSGTYYNG  176

Query  1184  AFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGS  1005
             ++YVGTSSLEEG++   CC FRG   KLD  TG +LW+T+MLPDN GK G YAGAAIWGS
Sbjct  177   SYYVGTSSLEEGATIKDCCIFRGSLVKLDAQTGDILWKTYMLPDNNGKIGAYAGAAIWGS  236

Query  1004  SPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDL  825
             SPSID +R HVYIATGNLYSAPK+VL+CQE+QNN+ TTP   DKCVEPENHS+SILALDL
Sbjct  237   SPSIDVYRKHVYIATGNLYSAPKNVLECQERQNNQ-TTPIEQDKCVEPENHSNSILALDL  295

Query  824   DTGKIKWFRQLGGYDVFFIACINSSSTPNCPP-GPNPDADFGEAPMMLSVVVNGSTRDIV  648
             D+G IKW++QLGGYDV+F++C N++S  NCPP G  PDADFGEAPMML+  VNG+ +DIV
Sbjct  296   DSGNIKWYKQLGGYDVWFVSC-NNASISNCPPQGSIPDADFGEAPMMLTTHVNGTKKDIV  354

Query  647   VAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLL  468
             VAVQKSGFAWALDRDNG ++W+TEAGPGG  GGGT+GAATD +R+YT+IANS+   F LL
Sbjct  355   VAVQKSGFAWALDRDNGTLLWFTEAGPGGLAGGGTFGAATDEKRIYTNIANSDAKIFKLL  414

Query  467   PSKNVTIGGGWVAMDAQTGKILWSTAVP--DTGLSNPVTVANGVLFAGSVHPRGPVFAIN  294
             PS   T  GGWVAMDA  G ILWSTA P  ++  S PV+VAN V+F GS    G ++AIN
Sbjct  415   PSNMNTTSGGWVAMDASNGTILWSTANPSINSTASGPVSVANEVVFVGSTDRLGHIYAIN  474

Query  293   AKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
              + G ILW Y TGA+VYGGMS+SNGCVYVG+GY VS+G     +TGGTSLFAFC+
Sbjct  475   GRNGHILWFYETGASVYGGMSISNGCVYVGHGYNVSLGF-YSNYTGGTSLFAFCV  528



>ref|XP_003621152.1| Quinohaemoprotein ethanol dehydrogenase type-1 [Medicago truncatula]
 gb|AES77370.1| polyvinylalcohol dehydrogenase-like protein [Medicago truncatula]
Length=569

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/538 (63%), Positives = 415/538 (77%), Gaps = 10/538 (2%)
 Frame = -1

Query  1727  CVCIIIFLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLK  1548
             C  + +FL+C S T    +  T        NWLNHGGDIYNRRYA  E+KI+  T+S L 
Sbjct  9     CFLVSLFLLC-SLTCSKRYDYTE----KEQNWLNHGGDIYNRRYASKEHKINLKTISNLT  63

Query  1547  LKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTG  1368
             LKWEF AGKDI+ATPAI  G +YFPSWNG ++AV   DG+L+W++NL KLTGL++     
Sbjct  64    LKWEFNAGKDITATPAIFNGTIYFPSWNGLIFAVREIDGTLVWKKNLTKLTGLDSIGFIA  123

Query  1367  NVTAIVSRSTPSI-VGETLII-GIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTY  1194
             NV   V+R+TP+I V E L+I GIYGPAVVI V R+TGDL+W T LD + AG++TMSGTY
Sbjct  124   NVNWTVARATPTIAVDEDLVIVGIYGPAVVIAVNRSTGDLIWQTRLDSNDAGVVTMSGTY  183

Query  1193  YNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAI  1014
             Y GA+YVG+SSLEE  S   CCTFRG F+KLD+ +G +LW+T+MLPDN GKRGEY+G AI
Sbjct  184   YKGAYYVGSSSLEELKSAEECCTFRGSFSKLDIKSGAILWKTYMLPDNNGKRGEYSGGAI  243

Query  1013  WGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKT-TTPTTSDKCVEPENHSDSIL  837
             WGSSP IDA R H+YIATGNLYSAP H+ +CQ+++NNK  T PT  D+CVEPENHS+SIL
Sbjct  244   WGSSPPIDASRNHIYIATGNLYSAPLHIRQCQDEENNKNLTRPTQPDQCVEPENHSNSIL  303

Query  836   ALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTR  657
             ALDL  G+IKW+ QLGGYDV+F+AC N  STPNCPPGPNPDADFGEAPMML++ VNG+ +
Sbjct  304   ALDLYNGEIKWYHQLGGYDVWFLAC-NDLSTPNCPPGPNPDADFGEAPMMLTIDVNGTKQ  362

Query  656   DIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNF  477
             DIVVAVQKSGFAWAL R NG+++W TEAGPGG  GGGTWGAATD ERVYT+IANSN  NF
Sbjct  363   DIVVAVQKSGFAWALHRHNGDIIWSTEAGPGGVAGGGTWGAATDKERVYTNIANSNAKNF  422

Query  476   TLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSN-PVTVANGVLFAGSVHPRGPVFA  300
             TL PS      GGWVAM+A +GKILW+ A P    +N PV+VANG++FAGS + +GP++A
Sbjct  423   TLKPSNKTITSGGWVAMEASSGKILWAIANPSNATANGPVSVANGIVFAGSANRKGPIYA  482

Query  299   INAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCLE  126
             IN KTGEILWSY TGATVYGG+S++NGC+Y+GNGY V +   I   TG    + +  E
Sbjct  483   INGKTGEILWSYETGATVYGGISINNGCIYLGNGYTVGLATVIGGLTGAPMQYKWLTE  540



>ref|XP_004147493.1| PREDICTED: polyvinylalcohol dehydrogenase-like [Cucumis sativus]
 gb|KGN59583.1| hypothetical protein Csa_3G827260 [Cucumis sativus]
Length=538

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/512 (66%), Positives = 401/512 (78%), Gaps = 9/512 (2%)
 Frame = -1

Query  1643  SGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWN  1464
              GNWLNHGGD+ NRRYA  E KISPSTVS L+LKWEFYAG DIS TPAI  GV+YFPSWN
Sbjct  29    EGNWLNHGGDLKNRRYANRETKISPSTVSHLRLKWEFYAGGDISVTPAIYDGVIYFPSWN  88

Query  1463  GYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVV  1284
             G+LYAV AS+G+LLW++NLQKLTG N T    NV + VSRSTP++ GE +++GIYGPAVV
Sbjct  89    GFLYAVRASNGALLWKKNLQKLTGFNNTGFILNVNSTVSRSTPTVAGELVVVGIYGPAVV  148

Query  1283  IGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAK  1104
             IGVKR+TG L+W T LD      ITMSGTYY G+F++GTSSLEEG     CCTFRG F+K
Sbjct  149   IGVKRSTGKLVWCTRLDYKNRSFITMSGTYYKGSFFIGTSSLEEGLPVDQCCTFRGSFSK  208

Query  1103  LDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLK  924
             LD  TG +LWQTFMLPDN G   +Y+GAAIWGSSPSID  R  VYIATGNLYSAP  + +
Sbjct  209   LDAKTGAILWQTFMLPDNHGDTEQYSGAAIWGSSPSIDPLRNLVYIATGNLYSAPLRIRE  268

Query  923   CQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSST  744
             CQE+QNN+ T PT  DKC+EPENHS+SILALDLD+G IKW++QLGGYDV+F AC N    
Sbjct  269   CQERQNNQ-TEPTLPDKCIEPENHSNSILALDLDSGDIKWYKQLGGYDVWFGAC-NWHLD  326

Query  743   PNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYtea---  573
             P CPPGP+ D+DFGE+PMMLSV V    RDIVVAVQKSGFAWALDRDNG +VW  E+   
Sbjct  327   PRCPPGPSSDSDFGESPMMLSVFVRNMKRDIVVAVQKSGFAWALDRDNGNLVWSKESFIP  386

Query  572   ---gpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKIL  402
                GPGG  GGG WGAATD +RVYT+IANS   NFTL P+   TI GGWVAM+A+TG I+
Sbjct  387   LEAGPGGLGGGGMWGAATDEKRVYTNIANSQHKNFTLKPTNKTTIAGGWVAMEAKTGDII  446

Query  401   WSTA-VPDTGLSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVS  225
             WSTA + +     PVT+ANGV+FAGS + +GP++A++AKTG+I+WSY TG +VYGG+SVS
Sbjct  447   WSTANLKEATAPGPVTIANGVVFAGSTYRQGPIYAMDAKTGKIVWSYETGGSVYGGISVS  506

Query  224   NGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
              GC+YVGNGY+  IG     +T GTSL+AFC+
Sbjct  507   KGCIYVGNGYKEHIGFVNKNYTAGTSLYAFCV  538



>ref|XP_004304938.1| PREDICTED: polyvinylalcohol dehydrogenase-like [Fragaria vesca 
subsp. vesca]
Length=523

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/508 (65%), Positives = 402/508 (79%), Gaps = 3/508 (1%)
 Frame = -1

Query  1649  PASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPS  1470
             P++ +W NHGGD+YNRRYA  E KISP+TVS L +KW+F  G DI+ TPAI  G++YFPS
Sbjct  18    PSTLDWPNHGGDLYNRRYANTEKKISPATVSNLSVKWKFSVGGDITVTPAIADGILYFPS  77

Query  1469  WNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPA  1290
             WNGYLYAV  SDGSL+W++N+Q+LTG N T    NV + V+RSTP+I G+ LI GIYGPA
Sbjct  78    WNGYLYAVKQSDGSLVWKKNVQELTGFNNTGFILNVNSTVTRSTPTIAGDLLICGIYGPA  137

Query  1289  VVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRF  1110
              VI VKR+ G L+W T +D H    +TMSGTYY G +YVGTSSLEEG +   CCTFRG F
Sbjct  138   FVIAVKRSNGKLVWSTRVDNHTRAFVTMSGTYYKGGYYVGTSSLEEGLTIDLCCTFRGSF  197

Query  1109  AKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHV  930
              KLDV TG +LWQT+MLPDN GK GEYAGAAIWGSSPSID  R  VYIAT NLYSAP H+
Sbjct  198   LKLDVRTGAILWQTYMLPDNFGKFGEYAGAAIWGSSPSIDVKRNLVYIATSNLYSAPSHI  257

Query  929   LKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSS  750
             ++CQE++NN+ T P+  D C+EP+NHS+SI+ALDLDTGKIKW++QLGGYD++F AC +  
Sbjct  258   IECQERENNQ-TIPSQPDACIEPDNHSESIVALDLDTGKIKWYKQLGGYDLWFGAC-HRH  315

Query  749   STPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteag  570
               P CPPGP+PDADFGEAPMM++  +NG+ +DIVVAVQKSGFAWALDRD G +VW TEAG
Sbjct  316   LDPRCPPGPSPDADFGEAPMMITTKINGTKKDIVVAVQKSGFAWALDRDTGSIVWSTEAG  375

Query  569   pggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTA  390
             PGG  GG  WGAATD +RVYT+IANS   NFTL PS+N TI GGWVAM+A++G ILWSTA
Sbjct  376   PGGLGGGAMWGAATDEKRVYTNIANSQHKNFTLKPSQNTTIAGGWVAMEARSGNILWSTA  435

Query  389   VPDTGLS-NPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCV  213
               +   S   VTVANGV+F GS +  GP++A+NAKTG+ILWSY TGATVYGG+SVSNGC+
Sbjct  436   NANDATSPAAVTVANGVVFGGSTYKEGPIYAMNAKTGKILWSYDTGATVYGGISVSNGCI  495

Query  212   YVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             Y+GNGY+V  G   P +T GTS +AFC+
Sbjct  496   YLGNGYKVFNGFVNPNYTAGTSFYAFCV  523



>emb|CDP11594.1| unnamed protein product [Coffea canephora]
Length=541

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/546 (63%), Positives = 423/546 (77%), Gaps = 18/546 (3%)
 Frame = -1

Query  1751  HGQPLLYYCVCIIIFLICISATAKP--EWHITRFSCPASGNWLNHGGDIYNRRYACGENK  1578
             H Q +    V  I+    I   AK    +H  + S P  GNWLNHGGDIYNRRYA  E+K
Sbjct  8     HPQFIAILIVSSILCQTAIGTAAKNPYRYHTNKPSRP--GNWLNHGGDIYNRRYASSESK  65

Query  1577  ISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKL  1398
             ISPST SKL LKW+F A   ++ TPA+  G+VYF SWNGY++AV A DGSL+W++N+++L
Sbjct  66    ISPSTASKLGLKWKFNAAGFVTGTPAVYDGIVYFTSWNGYVHAVKACDGSLVWKQNVEQL  125

Query  1397  TGLNATVRTGNVTAIVSRSTPSIV--GETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHP  1224
             TGL   V    + + +SRSTP+I+   + +I+GI GPA  + VKR++G L+W T LD HP
Sbjct  126   TGLTVPV----LNSTISRSTPTIITDQDMIILGITGPAYAVAVKRSSGSLIWSTQLDGHP  181

Query  1223  AGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKG  1044
               +ITMSGTYY+G FYVG SS+EE ++   CCTFRG   KLD  +G++LW+TF LPDN G
Sbjct  182   FAIITMSGTYYDGGFYVGVSSVEETATIEECCTFRGSLIKLDARSGRILWKTFTLPDNHG  241

Query  1043  KRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVE  864
              RGEYAGAA+WGSSPSIDA R HVYIATGNLYSAP+ + KCQE+ NN+T     ++ C+E
Sbjct  242   NRGEYAGAAVWGSSPSIDAPRNHVYIATGNLYSAPRRIRKCQERLNNQTNPTNPNE-CIE  300

Query  863   PENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMML  684
             P+NHS+SI+ALD+DTGKI+W++QLGGYDV+F AC N  STPNCPPGPNPDADFGE PMML
Sbjct  301   PDNHSNSIMALDMDTGKIQWYKQLGGYDVWFAACSN-LSTPNCPPGPNPDADFGEEPMML  359

Query  683   SVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTS  504
             S+ VNG+ RDIVVAVQKSGFAWALDRDNG ++W+TEAGPGG +GGGTWGAATD +R+YT+
Sbjct  360   SIKVNGTKRDIVVAVQKSGFAWALDRDNGNIIWFTEAGPGGGLGGGTWGAATDTKRIYTN  419

Query  503   IANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSNPVTVANGVLFAGSV  324
             IANSN+LNFTLLPS+ VT GGGWVA+D  TGKILWSTA P   + NPVT+ANGVLF GS 
Sbjct  420   IANSNQLNFTLLPSQKVTNGGGWVALDPPTGKILWSTADPKDSMVNPVTIANGVLFGGST  479

Query  323   HPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSL  144
             +  GPV+AI+AK G ILWSY TGA+VYGGMSVS+GC+YVG+GY        P++T GT L
Sbjct  480   YSTGPVYAIDAKNGNILWSYETGASVYGGMSVSDGCMYVGHGYVA------PLYTAGTHL  533

Query  143   FAFCLE  126
             FAFC++
Sbjct  534   FAFCVQ  539



>ref|XP_008443424.1| PREDICTED: uncharacterized protein LOC103487015 [Cucumis melo]
Length=531

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/506 (66%), Positives = 398/506 (79%), Gaps = 3/506 (1%)
 Frame = -1

Query  1643  SGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWN  1464
              GNW NHGGD+ NRRYA  E KISPSTVS+L+LKWEF+AG DIS TPAI  GV+YFPSWN
Sbjct  28    EGNWPNHGGDLKNRRYANRETKISPSTVSRLRLKWEFFAGGDISVTPAIYDGVIYFPSWN  87

Query  1463  GYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVV  1284
             G+LYAV AS+G+LLW++NLQKLTG N T    NV + VSRSTP++ GE L++GIYGPAVV
Sbjct  88    GFLYAVRASNGALLWKKNLQKLTGFNNTGFILNVNSTVSRSTPTVAGELLVVGIYGPAVV  147

Query  1283  IGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAK  1104
             IGVKR+TG L+W   +D      ITMSGTYY G+F++GTSSLEEG     CCTFRG F+K
Sbjct  148   IGVKRSTGKLVWCRRMDYKKRSFITMSGTYYKGSFFIGTSSLEEGLPVDQCCTFRGSFSK  207

Query  1103  LDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLK  924
             LD  TG +LWQTFMLPDN G   +Y+GAAIWGSSPSID  R  VYIATGNLYSAP  + +
Sbjct  208   LDARTGAILWQTFMLPDNHGDTQQYSGAAIWGSSPSIDPVRNLVYIATGNLYSAPLRIRE  267

Query  923   CQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSST  744
             CQE+QNN+ T PT  DKC+EPENHS+SILALD+D+G IKW++QLGGYDV+F AC N    
Sbjct  268   CQERQNNQ-TDPTLPDKCIEPENHSNSILALDVDSGDIKWYKQLGGYDVWFGAC-NWHLD  325

Query  743   PNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpg  564
             P CPPGP+ D+DFGE+PMMLSV      RDIVV+VQKSGFAWALDRDNG +VW  EAGPG
Sbjct  326   PRCPPGPSSDSDFGESPMMLSVFERNMKRDIVVSVQKSGFAWALDRDNGNLVWSKEAGPG  385

Query  563   gfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTA-V  387
             G  GGG WGAATD + VYT+IANS   NFTL P+   TI GGWVAM+A+TG I+WSTA +
Sbjct  386   GLGGGGMWGAATDEKSVYTNIANSQHKNFTLKPTNKTTIAGGWVAMEAKTGDIIWSTANL  445

Query  386   PDTGLSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYV  207
              D     P+T+ANGV+FAGS + +GP++ ++AKTG+I+WSY TG TVYGG+SVSNGC+YV
Sbjct  446   NDATAPGPITIANGVVFAGSTYRQGPIYGMDAKTGKIIWSYETGGTVYGGISVSNGCIYV  505

Query  206   GNGYRVSIGAGIPIFTGGTSLFAFCL  129
             GNGY+  IG     +T GTSL+AFC+
Sbjct  506   GNGYKEHIGFVNKNYTAGTSLYAFCV  531



>ref|XP_008341556.1| PREDICTED: uncharacterized protein LOC103404426 [Malus domestica]
Length=543

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/549 (63%), Positives = 417/549 (76%), Gaps = 19/549 (3%)
 Frame = -1

Query  1754  THGQPLLYYCV-CIII-----FLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYA  1593
             ++G  LL  C+ C++I     F I  SA  K +          + +WLNHGGD+YNRRYA
Sbjct  7     SNGPFLLSLCMFCLVITPSAGFNIWGSAQKKKD----------AQDWLNHGGDLYNRRYA  56

Query  1592  CGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWER  1413
               E KISP TVS L LKW+FYAG DI+ TP I  G +YFPSWNGYLYAV ASDGSL+W++
Sbjct  57    NREKKISPVTVSNLSLKWKFYAGGDITVTPVIFDGTLYFPSWNGYLYAVKASDGSLVWKK  116

Query  1412  NLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTLLD  1233
             N+QKLTG N T    NV + V+RSTP++ G+ LI GIYGPA VI VKR+ G L+W T LD
Sbjct  117   NVQKLTGFNNTGFILNVNSTVTRSTPTVAGDLLICGIYGPAFVIAVKRSNGKLVWSTRLD  176

Query  1232  RHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPD  1053
              H    ITMSGTYY G +YVGTSSLEEG +   CCTFRG  +KLDV TGK+LWQTFMLPD
Sbjct  177   NHTRAFITMSGTYYKGGYYVGTSSLEEGLTIEQCCTFRGSVSKLDVRTGKILWQTFMLPD  236

Query  1052  NKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDK  873
             N GK  EYAGAAIWGSSPSID  R  V++AT NLYSAP  +++CQEK+NN+ T P+  + 
Sbjct  237   NFGKFNEYAGAAIWGSSPSIDVPRNLVFVATSNLYSAPPRIIECQEKENNQ-TLPSHPEA  295

Query  872   CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAP  693
             C+EPENHS+S++ALDLDTGKIKW++QLGGYD++F AC +    P CPPGP+PDADFGEAP
Sbjct  296   CIEPENHSESMVALDLDTGKIKWYKQLGGYDIWFGAC-HRHLDPRCPPGPSPDADFGEAP  354

Query  692   MMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERV  513
             MML+  +NG+ RD+VVAVQKSGFAWALDRD G +VW TEAGPGG  GG  WGAATD +RV
Sbjct  355   MMLTTYINGARRDLVVAVQKSGFAWALDRDTGSIVWSTEAGPGGLGGGAMWGAATDEKRV  414

Query  512   YTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTA-VPDTGLSNPVTVANGVLF  336
             YT+IANS   NFTL PS+N TI GGWVAM+A++G ILWSTA   D      VTVANGV+F
Sbjct  415   YTNIANSQHKNFTLKPSQNTTIAGGWVAMEARSGNILWSTANANDATAPAAVTVANGVVF  474

Query  335   AGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTG  156
              GS H  GP++A+NAKTG+ILW+Y TGATVYGG+SVS+GC+Y+GNGY+V  G   P +T 
Sbjct  475   GGSTHRLGPIYAMNAKTGKILWTYDTGATVYGGISVSDGCIYLGNGYKVFNGFVNPNYTA  534

Query  155   GTSLFAFCL  129
             GT+LFAFC+
Sbjct  535   GTTLFAFCV  543



>ref|XP_009347060.1| PREDICTED: uncharacterized protein LOC103938746 [Pyrus x bretschneideri]
Length=543

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/549 (63%), Positives = 417/549 (76%), Gaps = 19/549 (3%)
 Frame = -1

Query  1754  THGQPLLYYCV-CIII-----FLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYA  1593
             ++G  LL  C+ C++I     F I  SA  K +          + +WLNHGGD+YNRRYA
Sbjct  7     SNGPLLLSLCMFCLVITPSAGFNIWGSAEKKKD----------AQDWLNHGGDLYNRRYA  56

Query  1592  CGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWER  1413
               E KISP+TVS L LKW+FYAG DI+ TPAI  G +YF SWNGYLYAV ASDGSL+W++
Sbjct  57    NREKKISPATVSNLSLKWKFYAGGDITVTPAIFDGTLYFASWNGYLYAVKASDGSLVWKK  116

Query  1412  NLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTLLD  1233
             N+QKLTG N T    NV + V+RSTP++ G+ LI GIYGPA VI VKR+ G L+W T LD
Sbjct  117   NVQKLTGFNNTGFILNVNSTVTRSTPTVAGDLLICGIYGPAFVIAVKRSNGKLVWSTRLD  176

Query  1232  RHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPD  1053
              H    ITMSGTYY   +YVGTSSLEEG +   CCTFRG  +KLDV TGK+LWQTFMLPD
Sbjct  177   NHTRAFITMSGTYYKRGYYVGTSSLEEGLTIEQCCTFRGSVSKLDVRTGKILWQTFMLPD  236

Query  1052  NKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDK  873
             N GK  EYAGAAIWGSSPSID  R  V++AT NLYSAP  +++CQEK+NN+ T P+  + 
Sbjct  237   NFGKFNEYAGAAIWGSSPSIDVPRNLVFVATSNLYSAPPRIIECQEKENNQ-TVPSHPEA  295

Query  872   CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAP  693
             C+EPENHS+S++ALDLDTGKIKW++QLGGYD++F AC +    P CPPGP+PDADFGEAP
Sbjct  296   CIEPENHSESMVALDLDTGKIKWYKQLGGYDIWFGAC-HRHLDPRCPPGPSPDADFGEAP  354

Query  692   MMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERV  513
             MML+  +NG+ RD+VVAVQKSGFAWALDRD G +VW TEAGPGG  GG  WGAATD +RV
Sbjct  355   MMLTTYINGARRDLVVAVQKSGFAWALDRDTGSIVWSTEAGPGGLGGGAMWGAATDEKRV  414

Query  512   YTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTA-VPDTGLSNPVTVANGVLF  336
             YT+IANS   NFTL PS+N TI GGWVAM+A++G ILWSTA   D      VTVANGV+F
Sbjct  415   YTNIANSQHKNFTLKPSQNTTIAGGWVAMEARSGNILWSTANANDATAPAAVTVANGVVF  474

Query  335   AGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTG  156
              GS H  GP++A+NAKTG+ILW+Y TGATVYGG+SVS+GC+Y+GNGY+V  G   P +T 
Sbjct  475   GGSTHRLGPIYAMNAKTGKILWTYDTGATVYGGISVSDGCIYLGNGYKVFNGFVNPNYTA  534

Query  155   GTSLFAFCL  129
             GTSLFAFC+
Sbjct  535   GTSLFAFCV  543



>ref|XP_004302347.1| PREDICTED: polyvinylalcohol dehydrogenase-like [Fragaria vesca 
subsp. vesca]
Length=546

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/537 (63%), Positives = 414/537 (77%), Gaps = 14/537 (3%)
 Frame = -1

Query  1712  IFLICISATA-KPEWHITRFSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWE  1536
             +F +C+ A+A   ++     +   + NWLNHGGD+ NRRYA  E KISP TVSKL+ KWE
Sbjct  14    LFTVCLFASAANADYDQHGHNHKVTQNWLNHGGDLRNRRYAKYETKISPETVSKLRFKWE  73

Query  1535  FYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTA  1356
             F AG+DI+ TP+I  G +YFPSWNG+LYA+ ASDGS++WE+N+  LTGLN    TG +T 
Sbjct  74    FKAGQDITVTPSIYDGTLYFPSWNGHLYALKASDGSVVWEKNMGILTGLN---WTGFITP  130

Query  1355  --IVSRSTPSIVG---ETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYY  1191
               IVSRSTP+I G   E LI+GIYGPAV+I ++R+TG L+W   LD H AG ITMS TYY
Sbjct  131   NWIVSRSTPTIAGDNDELLIVGIYGPAVLIALERSTGKLVWSVRLDSHAAGAITMSPTYY  190

Query  1190  NGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIW  1011
              G+ Y+GT+S+EEG S   CCTFRG F+KLDV TG VLWQT+MLPDN GK G+Y+GAAIW
Sbjct  191   KGSIYIGTTSVEEGVSPDECCTFRGSFSKLDVKTGAVLWQTYMLPDNHGKLGQYSGAAIW  250

Query  1010  GSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKT--TTPTTSDKCVEPENHSDSIL  837
             GSSPSID HR HVYIATGN YS P+++ +CQE Q N T  + PT SD CVEP NH +SIL
Sbjct  251   GSSPSIDVHRRHVYIATGNTYSVPEYISQCQENQLNTTNSSVPTHSDACVEPVNHGNSIL  310

Query  836   ALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTR  657
             ALD+DTG+I+W+RQLGGYDV+F+ C  ++S   CP GPN DADFGEAPMML   +N + R
Sbjct  311   ALDMDTGEIQWYRQLGGYDVWFLECFLNTSV--CPIGPNVDADFGEAPMMLRPYINETKR  368

Query  656   DIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNF  477
             DIVVAVQKSGFAWALDR+NG +VW TE GPGG +GGG+WGAATD +RVYT+I N+   NF
Sbjct  369   DIVVAVQKSGFAWALDRNNGSLVWSTEVGPGGILGGGSWGAATDKKRVYTNIINNGGKNF  428

Query  476   TLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLS-NPVTVANGVLFAGSVHPRGPVFA  300
             TL PS NVT  GGW AMD ++G++LWSTA P    S  PV+VANGVLF GS    G V+A
Sbjct  429   TLKPSNNVTTSGGWAAMDPRSGEVLWSTANPSNAFSAGPVSVANGVLFGGSTDANGTVYA  488

Query  299   INAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             +N +TGEILWSY TGATVYGGMS+SNGC+YVG+GY+V  GA +P+FT GTSLFAFC+
Sbjct  489   MNTRTGEILWSYETGATVYGGMSISNGCIYVGSGYKVGFGATMPMFTAGTSLFAFCV  545



>ref|XP_004304937.1| PREDICTED: polyvinylalcohol dehydrogenase-like [Fragaria vesca 
subsp. vesca]
Length=536

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/508 (67%), Positives = 397/508 (78%), Gaps = 14/508 (3%)
 Frame = -1

Query  1637  NWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGY  1458
             NW NHGGD++NRRYA  E KISP TVSKL+LKW+FYAG  I+ATPAI    +YFPSWNGY
Sbjct  39    NWENHGGDMFNRRYAFKETKISPETVSKLRLKWKFYAGDHITATPAIYDNSLYFPSWNGY  98

Query  1457  LYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGET---LIIGIYGPAV  1287
             +YAV ASDGSL+W++NL  LTGLN T     V   +SRSTP+I G+    LI G+Y PAV
Sbjct  99    IYAVRASDGSLIWKKNLLALTGLNTTGFVQAVNTTISRSTPTIAGDRGDLLIFGLYAPAV  158

Query  1286  VIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFA  1107
             V+ V+R+TG L+W T LDRHPA LITMSGTYY G+ Y+GTSSLEE  S   CCTFRG  A
Sbjct  159   VVAVERSTGRLIWSTFLDRHPASLITMSGTYYKGSIYIGTSSLEETVSVEKCCTFRGSIA  218

Query  1106  KLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVL  927
             KLDV TG +LWQTFMLPDN G  G+Y+GAAIWGSSPSID  R HVYIATGN YS P++V 
Sbjct  219   KLDVKTGFILWQTFMLPDNHGNLGQYSGAAIWGSSPSIDVLRKHVYIATGNTYSVPENVS  278

Query  926   KCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSS  747
             +CQE QNN +T PT S  CVEP+NH +SILALDLD+G IKW+RQLGGYDV+F  C  ++S
Sbjct  279   QCQENQNN-STVPTRSYACVEPQNHGNSILALDLDSGNIKWYRQLGGYDVWFKQCQLNAS  337

Query  746   TPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagp  567
             T  CPPGPN DADFGEAPMMLS  VNGS  DIVVAVQKSGFAWAL+R+NG +VW TEAGP
Sbjct  338   T--CPPGPNVDADFGEAPMMLSAQVNGSWLDIVVAVQKSGFAWALNRNNGRLVWSTEAGP  395

Query  566   ggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAV  387
             GG  GGGTWGAATD  RVYT+IANS   NFTL PS  +T  GGWVAMD  +GKILWSTA 
Sbjct  396   GGTAGGGTWGAATDERRVYTNIANSGANNFTLKPSSKITTSGGWVAMDPCSGKILWSTAN  455

Query  386   P-DTGLSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVY  210
             P +   S PV+VANGVLF GS +P+G ++A++AKTG+ILWSY TGATV+GGMS+SNGCVY
Sbjct  456   PRNATASGPVSVANGVLFGGSTNPQGNIYAMDAKTGKILWSYVTGATVFGGMSISNGCVY  515

Query  209   VGNGYRVSIGAGIPIFTGGTSLFAFCLE  126
             +GNGY+         +T GTSLFAFC+ 
Sbjct  516   MGNGYKFP-------YTAGTSLFAFCVS  536



>ref|XP_006345832.1| PREDICTED: uncharacterized protein LOC102598039 [Solanum tuberosum]
Length=487

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/486 (67%), Positives = 399/486 (82%), Gaps = 8/486 (2%)
 Frame = -1

Query  1565  TVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLN  1386
             + SKL+LKWEF AGKDI+ATPAI  G++YFPSWNG +YAV   DG ++W+++L++LTG+N
Sbjct  2     SASKLRLKWEFKAGKDITATPAIFNGILYFPSWNGNIYAVRGEDGVVVWKKSLKELTGIN  61

Query  1385  ATVRTG---NVTAIVSRSTPSIV--GETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPA  1221
              +  +    NVT+IV+R+TPS+V   + LI+G+YGP++V+G+KR+ G+L+W T LD HPA
Sbjct  62    GSFNSSSLPNVTSIVARATPSVVFDKDLLIVGVYGPSLVLGLKRSNGNLVWSTKLDHHPA  121

Query  1220  GLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGK  1041
              ++TMSGTYY GAFYVGTSSLEEG+    CC FRG F KLDV TGK+LW+TFMLP+N GK
Sbjct  122   SVVTMSGTYYKGAFYVGTSSLEEGAEIDKCCYFRGSFLKLDVETGKILWKTFMLPENGGK  181

Query  1040  RGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKT-TTPTTSDKCVE  864
              G Y+GAA+WGSSPSID+ R HVYIATGNLYS PK +  CQ++QN +  T PT  DKC+E
Sbjct  182   IGGYSGAAVWGSSPSIDSRRNHVYIATGNLYSVPKRIEDCQKEQNQQNHTDPTQPDKCIE  241

Query  863   PENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMML  684
             PENHSDSI+ALDLD+G+I+W++QLGGYDV+F+AC NS++ PNCP GP+PD DFGEAPMML
Sbjct  242   PENHSDSIMALDLDSGEIEWYKQLGGYDVWFVACANSTN-PNCPIGPSPDYDFGEAPMML  300

Query  683   SVVVNGSTR-DIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYT  507
             SVVVNG  + DIV AVQKSG AWAL RDNG++ W TEAGPGG  GGG WGAATD + VYT
Sbjct  301   SVVVNGRKKEDIVAAVQKSGIAWALKRDNGKLFWTTEAGPGGVGGGGIWGAATDTKIVYT  360

Query  506   SIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSNPVTVANGVLFAGS  327
              IANS  LN+TL PS N+T GG WVAMDAQTG+ILW+TAVP+ G SNPVTVANGVL AGS
Sbjct  361   GIANSGNLNYTLYPSTNITTGGAWVAMDAQTGEILWTTAVPNNGRSNPVTVANGVLLAGS  420

Query  326   VHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTS  147
              +PRGP++AI+AKTG+ILWS  TGATV+GGMSVSNGC YVG+GYR  IG   P  TGGTS
Sbjct  421   QNPRGPIYAISAKTGKILWSNETGATVFGGMSVSNGCFYVGHGYRSGIGVFNPNNTGGTS  480

Query  146   LFAFCL  129
             LFA+C+
Sbjct  481   LFAYCV  486



>ref|XP_007217415.1| hypothetical protein PRUPE_ppa025769mg, partial [Prunus persica]
 gb|EMJ18614.1| hypothetical protein PRUPE_ppa025769mg, partial [Prunus persica]
Length=510

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/495 (66%), Positives = 393/495 (79%), Gaps = 3/495 (1%)
 Frame = -1

Query  1673  WHITRFSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAIL  1494
             W   +    A+ +WLNHGGD+YNRRYA  E KISP+TVS L LKW+FYAG DI+ TPAI+
Sbjct  18    WRSAQKHKAAAQDWLNHGGDLYNRRYANREKKISPATVSNLSLKWKFYAGGDITVTPAIV  77

Query  1493  KGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETL  1314
              G +YFPSWNGYLYAV ASDGSL+W++N+QKLTG   T    NV + V+RSTP++ G+ L
Sbjct  78    DGTLYFPSWNGYLYAVKASDGSLVWKKNVQKLTGFKNTGFILNVNSTVTRSTPTVAGDLL  137

Query  1313  IIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAH  1134
             I+GIYGPA VI VKR+ G L+W T LD H    ITMSGTYY G +YVGTSSLEEG +   
Sbjct  138   IVGIYGPAFVIAVKRSNGKLVWSTRLDNHTRAFITMSGTYYKGDYYVGTSSLEEGLTIEQ  197

Query  1133  CCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGN  954
             CCTFRG  +KLDV TG +LWQTFMLPDN GK GEYAGAAIWGSSPSID  R  V+IAT N
Sbjct  198   CCTFRGSVSKLDVRTGAILWQTFMLPDNFGKFGEYAGAAIWGSSPSIDVPRNLVFIATSN  257

Query  953   LYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVF  774
             LYSAP  +++CQEK+NN+ T P+  + C+EP+NHS+SI+ALDLDTGKIKW++QLGGYD++
Sbjct  258   LYSAPPRIIECQEKENNQ-TVPSHPEACIEPDNHSESIVALDLDTGKIKWYKQLGGYDIW  316

Query  773   FIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGE  594
             F AC +    P CPPGP+PDADFGEAPMML+  VNG+ +DIVVAVQKSGFAWALDRD G 
Sbjct  317   FGAC-HRHLDPRCPPGPSPDADFGEAPMMLTTYVNGTKKDIVVAVQKSGFAWALDRDTGS  375

Query  593   MVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQT  414
             +VW TEAGPGG  GG  WGAATD +RVYT+IANS   NFTL PS+N TI GGWVAM+A++
Sbjct  376   LVWSTEAGPGGLGGGAMWGAATDEKRVYTNIANSQHKNFTLKPSQNSTIAGGWVAMEARS  435

Query  413   GKILWSTA-VPDTGLSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGG  237
             G I+WSTA   D      VTVANGV+F GS H +GP++A+NAKTG+ILWSY TGATVYGG
Sbjct  436   GNIIWSTANSNDATAPAAVTVANGVVFGGSTHRQGPIYAMNAKTGKILWSYDTGATVYGG  495

Query  236   MSVSNGCVYVGNGYR  192
             +SVS+GC+Y+GNGY+
Sbjct  496   ISVSDGCIYLGNGYK  510



>gb|KDP45487.1| hypothetical protein JCGZ_09736 [Jatropha curcas]
Length=553

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/545 (61%), Positives = 413/545 (76%), Gaps = 9/545 (2%)
 Frame = -1

Query  1739  LLYYCVCIIIFLICISATAKPEWHITRFSC-PASGNWLNHGGDIYNRRYACGENKISPST  1563
             LL + +C +   I     A   W    +    A+ NWLNHGGD+ NRRYA  E KI+P T
Sbjct  9     LLVFFLCTLCAFITNGTRANSNWQPHYYKRDKATQNWLNHGGDLQNRRYANKETKINPKT  68

Query  1562  VSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNA  1383
              SKL LKW+F AG DISATPAI  G +YFPSWNGY+YAV A DGSL+W++NLQ L+G+ A
Sbjct  69    ASKLGLKWKFLAGGDISATPAIFNGTLYFPSWNGYIYAVKAFDGSLIWKKNLQNLSGVIA  128

Query  1382  T--VRTGNVTAIVSRSTPSIVGET--LIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGL  1215
                +   NV +  SRSTP++V +   LI G YGPAVV+ VKR+TGD +W T ++ H A +
Sbjct  129   PSFLSLLNVNSTASRSTPTVVADADLLIFGTYGPAVVVAVKRSTGDFVWATQVETHLASV  188

Query  1214  ITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRG  1035
             ITMSGTYY G++Y+G SS+EEG+S A CCTFRG F KLD  TGK+LW+T+MLPDN  K G
Sbjct  189   ITMSGTYYKGSYYIGASSIEEGASIAQCCTFRGSFIKLDPKTGKILWKTYMLPDNFNKTG  248

Query  1034  EYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPEN  855
              Y+GAA+WGSSPSID HR  V+IATGNLYS P+HV +CQEK+NN  T PT  D+C+ P+ 
Sbjct  249   NYSGAAVWGSSPSIDKHRNLVFIATGNLYSVPQHVRECQEKENN-ATKPTHLDQCLGPDI  307

Query  854   HSDSILALDLDTGKIKWFRQLGGYDVFFIAC-INSSSTPNCP-PGPNPDADFGEAPMMLS  681
             HS+SILALDLD+GKIKW  QLGGYDV+F+AC I + ++P+CP PGPNPDADFGEAPMML+
Sbjct  308   HSESILALDLDSGKIKWSHQLGGYDVWFVACSIINFTSPDCPIPGPNPDADFGEAPMMLN  367

Query  680   VVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSI  501
             + VNGS +D+VVAVQKSGFAWALDRD+G ++W TEAGPGG  GGGTWGAATD +R+YT+I
Sbjct  368   IKVNGSRKDVVVAVQKSGFAWALDRDDGNLIWSTEAGPGGIGGGGTWGAATDKKRIYTNI  427

Query  500   ANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLS-NPVTVANGVLFAGSV  324
              NS+  NFTL PS   T  GGWVAM+A  GK+LWS   P    +  PVT+ANGVLFAGS 
Sbjct  428   VNSDGKNFTLKPSNKTTNSGGWVAMNAHNGKVLWSVPDPSNAWAFGPVTIANGVLFAGST  487

Query  323   HPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSL  144
                GP++AI+AKTG+ILW  +TGAT++GG SVS+GC+Y G+GY+VS G   P+FT G SL
Sbjct  488   FREGPIYAIDAKTGKILWRNHTGATIFGGASVSDGCIYFGHGYKVSTGTANPLFTRGKSL  547

Query  143   FAFCL  129
             FAFC+
Sbjct  548   FAFCV  552



>emb|CBI22172.3| unnamed protein product [Vitis vinifera]
Length=1752

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/504 (69%), Positives = 406/504 (81%), Gaps = 5/504 (1%)
 Frame = -1

Query  1637  NWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGY  1458
             +WLNHGGD+YNRRYA  E +I P T SKL+LKWEFYAG DI+    I  G +YFPSWNGY
Sbjct  1252  DWLNHGGDLYNRRYASTETEIGPETTSKLRLKWEFYAGNDITVE-TIFNGTLYFPSWNGY  1310

Query  1457  LYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIG  1278
             LYAV ASDGSL+W++NLQ LTGLNAT    NV   VSRSTP+I G+ LIIGIYGPAVVIG
Sbjct  1311  LYAVKASDGSLVWKQNLQNLTGLNATGFVTNVNWTVSRSTPTIAGDMLIIGIYGPAVVIG  1370

Query  1277  VKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLD  1098
             V RATG L W T L+ +PAG +TMSGT++NG+FYVGTSS EE  S   CC FRG  +KLD
Sbjct  1371  VDRATGRLAWSTRLESNPAGAVTMSGTFHNGSFYVGTSSFEEKLSIKQCCIFRGSLSKLD  1430

Query  1097  VWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQ  918
             + TG +LWQT++LPDN G++GEYAG AIWGSSPSI   R  VYIATGNLYSAP ++ +CQ
Sbjct  1431  IKTGTILWQTYVLPDNHGEKGEYAGGAIWGSSPSIGVLRNFVYIATGNLYSAPLNIRECQ  1490

Query  917   EKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPN  738
             E+QNN+ T PT  D C+EP+NHS+SILA DLD+GKIKW+RQLGGYD++F AC N+ STPN
Sbjct  1491  EQQNNQ-TVPTQPDPCIEPDNHSNSILAFDLDSGKIKWYRQLGGYDLWFRAC-NNLSTPN  1548

Query  737   CPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggf  558
             CPPGPNPDADFGEAPMMLS+ +NG+  DIVVAVQKSGFAWALDRD+G +VWYTEAGPGG 
Sbjct  1549  CPPGPNPDADFGEAPMMLSIYLNGTMPDIVVAVQKSGFAWALDRDDGSLVWYTEAGPGGV  1608

Query  557   vgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDT  378
              GGGTWGAATD +RVYT+I NS+  NFTL PS  +T  GGWVAMDA TGK LWSTA P  
Sbjct  1609  TGGGTWGAATDGKRVYTNILNSDGKNFTLKPSNTITNAGGWVAMDANTGKTLWSTANPSN  1668

Query  377   GLSN-PVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGN  201
               +N PVT+ANGVLFAGS HP GP++A+ A +G ILWS+ TGA+V+GG SVSNGC+YVG+
Sbjct  1669  ASTNGPVTIANGVLFAGSTHPTGPMYAMEAASGRILWSHNTGASVFGGASVSNGCIYVGS  1728

Query  200   GYRVSIGAGIPIFTGGTSLFAFCL  129
             GY V+ G     FTGGTSLFAFCL
Sbjct  1729  GYNVNSGPHFS-FTGGTSLFAFCL  1751


 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/484 (70%), Positives = 397/484 (82%), Gaps = 3/484 (1%)
 Frame = -1

Query  1643  SGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWN  1464
             S +WLNHGGD+YNRRYA  E +ISP T SKL+LKWEFYAGKDI+ATPAI  G +YFPSWN
Sbjct  699   SADWLNHGGDLYNRRYASTETEISPETTSKLRLKWEFYAGKDITATPAIFNGTLYFPSWN  758

Query  1463  GYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVV  1284
             GYLYAV ASDGSL+W++NLQ LTGLNAT    NV   VSRSTP+I G+ LIIGIYGPAVV
Sbjct  759   GYLYAVKASDGSLVWKQNLQNLTGLNATGFVTNVNWTVSRSTPTIAGDMLIIGIYGPAVV  818

Query  1283  IGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAK  1104
             IGV +ATG L+W T L+ +PAG++TMSGT++ G+FYVGTSSLEE      CC FRG  +K
Sbjct  819   IGVDQATGRLVWSTWLESNPAGVVTMSGTFHKGSFYVGTSSLEELLGIEQCCIFRGSLSK  878

Query  1103  LDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLK  924
             LD+ TG +LWQTF LPDN G+RGEYAGAAIWGSSPSID  R  VY+ATGNLYSAP ++ +
Sbjct  879   LDIKTGAILWQTFTLPDNHGERGEYAGAAIWGSSPSIDVQRNLVYVATGNLYSAPLNIQE  938

Query  923   CQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSST  744
             CQE+Q N  T PT  D+C+EP+NHS+SILA DLD+GKIKW+RQLGGYDV+F+AC N+ ST
Sbjct  939   CQEQQ-NNQTVPTQPDQCIEPDNHSNSILAFDLDSGKIKWYRQLGGYDVWFLAC-NNLST  996

Query  743   PNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpg  564
             PNCPPGPNPDADFGEAPMMLS+ VNG+ RDIVVAVQKSGFAWALDR +G +VW TEAGPG
Sbjct  997   PNCPPGPNPDADFGEAPMMLSIYVNGTMRDIVVAVQKSGFAWALDRYDGSLVWSTEAGPG  1056

Query  563   gfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVP  384
             G  GGGTWGA TD +RVYT+I NS   NFTL PS  +T  GGWVAMDA TG+ LWSTA P
Sbjct  1057  GLAGGGTWGATTDGKRVYTNIVNSYGKNFTLKPSDTITTTGGWVAMDANTGETLWSTANP  1116

Query  383   DTGLSN-PVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYV  207
                 SN PVT+ANGVLFAGS HP GP++A+ A +G ILWS+ TGA+VYGG SVS+GC+YV
Sbjct  1117  SNATSNGPVTIANGVLFAGSTHPTGPMYAMEAASGRILWSHNTGASVYGGASVSSGCIYV  1176

Query  206   GNGY  195
             G+GY
Sbjct  1177  GSGY  1180


 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/475 (69%), Positives = 383/475 (81%), Gaps = 3/475 (1%)
 Frame = -1

Query  1601  RYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLL  1422
             RYA  E +ISP T SKL+LKWEFYAGKDI+ATPAI  G +YFPSWNGYLYAV ASDGSL+
Sbjct  183   RYASTETEISPETTSKLRLKWEFYAGKDITATPAIFNGTLYFPSWNGYLYAVKASDGSLV  242

Query  1421  WERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMT  1242
             W++NLQ LTGLNAT    NV   VSRSTP+I G+ LIIGIYGPAVVIGV +ATG L+W T
Sbjct  243   WKQNLQNLTGLNATGFVTNVNWTVSRSTPTIAGDMLIIGIYGPAVVIGVDQATGRLMWST  302

Query  1241  LLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFM  1062
              L+ +PAG++ MSGT++ G+FYVGTSSLEE      CC FRG  +KLD+ TG +LWQTF 
Sbjct  303   RLESNPAGVVAMSGTFHKGSFYVGTSSLEELLGIEQCCIFRGSLSKLDIKTGAILWQTFT  362

Query  1061  LPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTT  882
             LPDN G+RGEYAGAAIWGSSPSID  R  VY+ATGNLYSAP ++ +CQE+Q N  T PT 
Sbjct  363   LPDNHGERGEYAGAAIWGSSPSIDVQRNLVYVATGNLYSAPLNIQECQEQQ-NNQTVPTQ  421

Query  881   SDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFG  702
              D+C+EP+NHS+SILA DLD+GKIKW+RQLGGYDV+F+AC N  STPNCP GPN DADFG
Sbjct  422   PDQCIEPDNHSNSILAFDLDSGKIKWYRQLGGYDVWFLACSN-LSTPNCPSGPNQDADFG  480

Query  701   EAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDN  522
             EAPMML + +NG+  DIVVAVQKSGFAWALDR +G +VW TEAGPGG  GGGTWGAATD 
Sbjct  481   EAPMMLRIYLNGTMLDIVVAVQKSGFAWALDRYDGSLVWSTEAGPGGLTGGGTWGAATDG  540

Query  521   ERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSN-PVTVANG  345
             +RVYT+I NS+  NFTL PS  +T  GGWVAMDA TG+ LWSTA P    SN PVT+ANG
Sbjct  541   KRVYTNIVNSSGQNFTLKPSDAITTAGGWVAMDANTGETLWSTANPSNATSNGPVTIANG  600

Query  344   VLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIG  180
             VLFAGS HP GP++A+ A +G ILWS+ TGA+VYGG SVS+GC+YVG+GY V+ G
Sbjct  601   VLFAGSTHPTGPMYAMEATSGRILWSHNTGASVYGGASVSSGCIYVGSGYSVNFG  655



>ref|XP_007216718.1| hypothetical protein PRUPE_ppa026320mg [Prunus persica]
 gb|EMJ17917.1| hypothetical protein PRUPE_ppa026320mg [Prunus persica]
Length=538

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/507 (67%), Positives = 395/507 (78%), Gaps = 14/507 (3%)
 Frame = -1

Query  1637  NWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGY  1458
             NWLNHGGD+ NRRYA  E KISP TVSKL LKWEFYAG DISATPAI    +YFPSWNG 
Sbjct  41    NWLNHGGDLSNRRYADRETKISPKTVSKLSLKWEFYAGDDISATPAIYDDTLYFPSWNGN  100

Query  1457  LYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVG--ETLIIGIYGPAVV  1284
             +YAV AS+GSL+W++NL  LTGLNA+   G +   VSRSTP+I+G  + LI+GIYGPA+V
Sbjct  101   IYAVKASNGSLVWKKNLHALTGLNASSFVG-LNWTVSRSTPTIIGGLDLLIVGIYGPAIV  159

Query  1283  IGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAK  1104
             I ++R+TG L+W T+LD H AGLITMSGTYY G+ Y+GTSSLEE  S   CCTFRG  AK
Sbjct  160   IALERSTGKLIWSTMLDTHEAGLITMSGTYYKGSLYIGTSSLEETVSAEKCCTFRGSLAK  219

Query  1103  LDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHV-L  927
             LD  +G +LWQTFMLPDN G  G Y+GAAIWGSSPSID HR HVYIATGN+YS P++V  
Sbjct  220   LDAKSGTILWQTFMLPDNHGNLGNYSGAAIWGSSPSIDVHRKHVYIATGNVYSVPENVSQ  279

Query  926   KCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSS  747
               + + NN +T P   D CVEPENH +SILALDLD G IKW+RQLGGYDV+F AC  ++S
Sbjct  280   CQENQNNNNSTLPIHPDACVEPENHGNSILALDLDGGDIKWYRQLGGYDVWFFACFLNAS  339

Query  746   TPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagp  567
             T  CPPGPN DADFGEAPMMLS  VNG+ RDIVVAVQKSGFAWALDR+NG +VW TEAGP
Sbjct  340   T--CPPGPNLDADFGEAPMMLSPYVNGTKRDIVVAVQKSGFAWALDRNNGSLVWSTEAGP  397

Query  566   ggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAV  387
             GG  GGG WGAATD + VYT+IANS+  NFTL PS N+T  GGWVAM    GKI+WSTA 
Sbjct  398   GGVAGGGMWGAATDKKMVYTNIANSDNKNFTLKPSTNITTWGGWVAMAPGNGKIIWSTAN  457

Query  386   PDTGLSN-PVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVY  210
             P    S+ PV+VANGVLFAGS +P G ++A+N KTG+ILWS  TGATVYGGMS+SNGC+Y
Sbjct  458   PSNATSSGPVSVANGVLFAGSTNPEGSIYAMNTKTGKILWSNETGATVYGGMSISNGCIY  517

Query  209   VGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             VGNGY+ +       +  GTSLFAFC+
Sbjct  518   VGNGYKRT-------YIAGTSLFAFCV  537



>ref|XP_008379337.1| PREDICTED: uncharacterized protein LOC103442334 [Malus domestica]
Length=538

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/547 (62%), Positives = 411/547 (75%), Gaps = 20/547 (4%)
 Frame = -1

Query  1760  CHTHGQPLLYYCVCIIIFLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACGEN  1581
             CH     +L + +     LI  + +A    H      PA  NWLNHGGD+ NRRYA  E 
Sbjct  8     CH---NLILVFSLYTCSLLITSTTSAGGHSHDEN---PAIQNWLNHGGDLSNRRYANREI  61

Query  1580  KISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQK  1401
             KI+  TVSKL L WEFYAG DISATP+I  G +YFPSWNG +YAV AS+GSL+W++NL +
Sbjct  62    KINRRTVSKLSLNWEFYAGDDISATPSIYDGTLYFPSWNGEIYAVQASNGSLVWKKNLHE  121

Query  1400  LTGLNATVRTGNVTAIVSRSTPSIVGET--LIIGIYGPAVVIGVKRATGDLLWMTLLDRH  1227
             LTGLNAT  +G     V+RSTP++V +   LI+GIYGPAVVI ++R+TG+L+W TLLD H
Sbjct  122   LTGLNATGFSG-FNWTVARSTPTVVDDQDLLIVGIYGPAVVIALERSTGNLIWSTLLDTH  180

Query  1226  PAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNK  1047
              AG+ITMSGTYYNG+ Y+GTSSLEE  S   CCTFRG  AKLD  +G VLW+TFMLPDN 
Sbjct  181   AAGVITMSGTYYNGSIYIGTSSLEETLSPEECCTFRGSLAKLDAKSGTVLWKTFMLPDNH  240

Query  1046  GKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCV  867
             G+ G Y+GAAIWGSSPSID HR HVYIATGN+YS P++V +CQE QNN +T PT  D CV
Sbjct  241   GQLGSYSGAAIWGSSPSIDVHRKHVYIATGNVYSVPENVSQCQENQNN-STLPTHPDACV  299

Query  866   EPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMM  687
             EP+N  +SILALDLD+G IKW   LGGYDV+F+ C  ++ST  CP GPN DADFGEAPMM
Sbjct  300   EPDNRGNSILALDLDSGDIKWNHHLGGYDVWFLECFLNTST--CPTGPNVDADFGEAPMM  357

Query  686   LSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYT  507
             L   VNG+ RD+VVAVQKSGFAWALDR+NG ++W TEAGPGG  GGGTWGAATD  +VYT
Sbjct  358   LKTCVNGTKRDLVVAVQKSGFAWALDRNNGTLIWSTEAGPGGVAGGGTWGAATDKXKVYT  417

Query  506   SIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSN-PVTVANGVLFAG  330
             +IANS   NFTL PS N+T  GGWVAM  + GKILWSTA P    S+ PV+VANG+LFAG
Sbjct  418   NIANSESRNFTLKPSSNITTWGGWVAMAPENGKILWSTANPSNSTSSGPVSVANGILFAG  477

Query  329   SVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGT  150
             S +PRG ++A+N + G+ LWSY TGA+V+GGMS+S+GC+YVG+GY+         +T GT
Sbjct  478   STNPRGSIYAMNTENGKXLWSYDTGASVFGGMSISDGCIYVGSGYKRQ-------YTAGT  530

Query  149   SLFAFCL  129
             SLFAFC+
Sbjct  531   SLFAFCV  537



>ref|XP_008230741.1| PREDICTED: uncharacterized protein LOC103329982 [Prunus mume]
Length=538

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/507 (67%), Positives = 397/507 (78%), Gaps = 14/507 (3%)
 Frame = -1

Query  1637  NWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGY  1458
             NWLNHGGD+ NRRYA  E KISP T SKL LKWEFYAG DISATPAI    +YFPSWNG 
Sbjct  41    NWLNHGGDLSNRRYANRETKISPKTASKLSLKWEFYAGDDISATPAIYDDTLYFPSWNGN  100

Query  1457  LYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIV--GETLIIGIYGPAVV  1284
             +Y+V AS+GSL+W++NL  LTGLNA+   G V   VSRSTP+I+   + LI+GIYGPAVV
Sbjct  101   IYSVKASNGSLIWKKNLHALTGLNASSFVG-VNWTVSRSTPTIIRGHDLLIVGIYGPAVV  159

Query  1283  IGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAK  1104
             I ++R+TG L+W T+LD H AGLITMSGTYY G+ Y+GTSSLEE  S   CCTFRG  AK
Sbjct  160   IALERSTGKLIWSTMLDTHEAGLITMSGTYYKGSLYIGTSSLEETVSAEKCCTFRGSLAK  219

Query  1103  LDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHV-L  927
             LD  +G +LWQTFMLPDN G  G Y+GAAIWGSSPSIDAHR HVYIATGN+YS P++V  
Sbjct  220   LDAKSGTILWQTFMLPDNHGNLGNYSGAAIWGSSPSIDAHRKHVYIATGNVYSVPENVSQ  279

Query  926   KCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSS  747
               + + NN +T PT  D CVEP+NH +SILALDLD G IKW+RQLGGYDV+F AC  ++S
Sbjct  280   CQENQNNNNSTIPTHPDACVEPQNHGNSILALDLDGGDIKWYRQLGGYDVWFFACFLNTS  339

Query  746   TPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagp  567
             T  CPPGPN DADFGEAPMMLS  VNG+ RDIVVAVQKSGFAWALDR+NG +VW TEAGP
Sbjct  340   T--CPPGPNVDADFGEAPMMLSPYVNGTKRDIVVAVQKSGFAWALDRNNGSLVWSTEAGP  397

Query  566   ggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAV  387
             GG  GGG WGAATD ++VYT+IANS+  NFTL PS N+T  GGWVAM    GKI+WSTA 
Sbjct  398   GGVAGGGMWGAATDIKKVYTNIANSDNKNFTLKPSTNITTWGGWVAMAPGNGKIIWSTAN  457

Query  386   PDTGLSN-PVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVY  210
             P    S+ PV+VANGVLFAGS +P+G ++A+N KTG+ILWS  TGATVYGGMS+SNGC+Y
Sbjct  458   PSNATSSGPVSVANGVLFAGSTNPQGSIYAMNTKTGKILWSNETGATVYGGMSISNGCIY  517

Query  209   VGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             VG+GY+ +       +  GTSLFAFC+
Sbjct  518   VGSGYKRT-------YIAGTSLFAFCV  537



>gb|KHN13642.1| Quinohemoprotein ethanol dehydrogenase type-1 [Glycine soja]
Length=533

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/540 (61%), Positives = 408/540 (76%), Gaps = 17/540 (3%)
 Frame = -1

Query  1739  LLYYCVCIIIFLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACGENKISPSTV  1560
              L +CV  I+ +   S+               S +WLNHGGD++NRRYA  E+KISP T 
Sbjct  7     FLLFCVHAIVLIFAASSDGHGH---------ESQDWLNHGGDLFNRRYAYKEHKISPKTA  57

Query  1559  SKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNAT  1380
               L+LKW+F+AG+DISATPAI  G +YFPSW+G +YAVN ++G L+W++NLQKLTG+NAT
Sbjct  58    PNLRLKWKFFAGRDISATPAIYDGTLYFPSWDGNIYAVNKANGLLVWKQNLQKLTGINAT  117

Query  1379  VRTGNVTAIVSRSTPSIVGETL-IIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMS  1203
                 ++   VSRSTP++ G+ L II +YGPAVVI VKR +G L+W T LD HP  L+TMS
Sbjct  118   GGVRSLNWTVSRSTPTVAGDDLMIINVYGPAVVICVKRTSGKLVWKTTLDYHPEALVTMS  177

Query  1202  GTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAG  1023
             GTYY G +YVG SS E    K  CC  RG F KL   +G+ LW+T+MLPDN  +RGEYAG
Sbjct  178   GTYYKGYYYVGISSQESLLPKEQCCISRGSFVKLSARSGETLWRTYMLPDNNNRRGEYAG  237

Query  1022  AAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDS  843
             AAIWGSSPSID  R HVYIATGNLYSAP H+L+C+E+QNN+ T PT  D+C+EPENHS+S
Sbjct  238   AAIWGSSPSIDVKRNHVYIATGNLYSAPLHILQCRERQNNR-TEPTQPDECIEPENHSNS  296

Query  842   ILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPP-GPNPDADFGEAPMMLSVVVNG  666
             ILALDLD+GKI W+ QLGGYDV+ + C N++STPNCPP G   DADFGEAPMML+  +N 
Sbjct  297   ILALDLDSGKIIWYCQLGGYDVWTLDC-NNASTPNCPPRGLRQDADFGEAPMMLTTYINQ  355

Query  665   STRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNR  486
             + +DIVVAVQKSG+AWALDR+NG ++W TEAGPGG  GGGTWGAATD + VYT+I NS+ 
Sbjct  356   TKKDIVVAVQKSGYAWALDRNNGNIIWSTEAGPGGLTGGGTWGAATDGKTVYTNIVNSDA  415

Query  485   LNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSN-PVTVANGVLFAGSVHPRGP  309
              NFTL PS  +T  GGWVAMDA+ G++LWSTA P    +N PV+VAN V+FAGS    G 
Sbjct  416   KNFTLAPSNVITTAGGWVAMDARNGRVLWSTANPSNSTANGPVSVANEVVFAGSADRLGY  475

Query  308   VFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             ++AI+AK+G+ILWSY TGA+VYGGMS+SNGC+YVG+GY V +   +  +TGGT LFAFC+
Sbjct  476   IYAIDAKSGKILWSYKTGASVYGGMSISNGCIYVGHGYSVGL---VFSYTGGTKLFAFCI  532



>ref|XP_006602902.1| PREDICTED: uncharacterized protein LOC102669135 [Glycine max]
Length=540

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/540 (61%), Positives = 407/540 (75%), Gaps = 17/540 (3%)
 Frame = -1

Query  1739  LLYYCVCIIIFLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACGENKISPSTV  1560
              L +CV  I+ +   S+               S +WLNHGGD++NRRYA  E+KISP T 
Sbjct  14    FLLFCVHAIVLIFAASSDGHGH---------ESQDWLNHGGDLFNRRYAYKEHKISPKTA  64

Query  1559  SKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNAT  1380
               L+LKW+F+AG+DISATPAI  G +YFPSW+G +YAVN ++G L+W++NLQKLTG+NAT
Sbjct  65    PNLRLKWKFFAGRDISATPAIYDGTLYFPSWDGNIYAVNKANGLLVWKQNLQKLTGINAT  124

Query  1379  VRTGNVTAIVSRSTPSIVGETL-IIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMS  1203
                 ++   VSRSTP++ G+ L II +YGPAVVI VKR  G L+W T LD HP  L+TMS
Sbjct  125   GGVRSLNWTVSRSTPTVAGDDLMIINVYGPAVVICVKRTNGKLVWKTTLDYHPEALVTMS  184

Query  1202  GTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAG  1023
             GTYY G +YVG SS E    K  CC  RG F KL   +G+ LW+T+MLPDN  +RGEYAG
Sbjct  185   GTYYKGYYYVGISSQESLLPKEQCCISRGSFVKLSARSGETLWRTYMLPDNNNRRGEYAG  244

Query  1022  AAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDS  843
             AAIWGSSPSID  R HVYIATGNLYSAP H+L+C+E+QNN+ T PT  D+C+EPENHS+S
Sbjct  245   AAIWGSSPSIDVKRNHVYIATGNLYSAPLHILQCRERQNNR-TEPTQPDECIEPENHSNS  303

Query  842   ILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPP-GPNPDADFGEAPMMLSVVVNG  666
             ILALDLD+GKI W+ QLGGYDV+ + C N++STPNCPP G   DADFGEAPMML+  +N 
Sbjct  304   ILALDLDSGKIIWYCQLGGYDVWTLDC-NNASTPNCPPRGLRQDADFGEAPMMLTTYINQ  362

Query  665   STRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNR  486
             + +DIVVAVQKSG+AWALDR+NG ++W TEAGPGG  GGGTWGAATD + VYT+I NS+ 
Sbjct  363   TKKDIVVAVQKSGYAWALDRNNGNIIWSTEAGPGGLTGGGTWGAATDGKTVYTNIVNSDA  422

Query  485   LNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSN-PVTVANGVLFAGSVHPRGP  309
              NFTL PS  +T  GGWVAMDA+ G++LWSTA P    +N PV+VAN V+FAGS    G 
Sbjct  423   KNFTLAPSNVITTAGGWVAMDARNGRVLWSTANPSNSTANGPVSVANEVVFAGSADRLGY  482

Query  308   VFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             ++AI+AK+G+ILWSY TGA+VYGGMS+SNGC+YVG+GY V +   +  +TGGT LFAFC+
Sbjct  483   IYAIDAKSGKILWSYKTGASVYGGMSISNGCIYVGHGYSVGL---VFSYTGGTKLFAFCI  539



>gb|KHN13644.1| Quinohemoprotein ethanol dehydrogenase type-1 [Glycine soja]
Length=544

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/547 (59%), Positives = 407/547 (74%), Gaps = 15/547 (3%)
 Frame = -1

Query  1757  HTHGQPLLYYCVCIIIFLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACGENK  1578
             H   + LL+Y V  ++ +   ++               S +WLNHGGD++NRRYA  E K
Sbjct  9     HLDLRLLLFYVVHAVVMVFAANSDGPRH---------QSQDWLNHGGDLFNRRYAYKERK  59

Query  1577  ISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKL  1398
             ISP T   L+LKW+FYAG+DI+ATPAI  G +YFPSWNG +YAV  +DGSL+W++NLQKL
Sbjct  60    ISPKTAPNLRLKWKFYAGRDITATPAIYDGTLYFPSWNGNIYAVKEADGSLVWKQNLQKL  119

Query  1397  TGLNATV-RTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPA  1221
             TGL A      NV + VSRSTP++ G+ LIIG+YGPA VI +KR TG+L+W T+LD HPA
Sbjct  120   TGLKAPDGLVENVNSTVSRSTPTVAGDLLIIGVYGPAAVIALKRKTGELVWKTILDYHPA  179

Query  1220  GLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGK  1041
              LITMSGTYYN  +YVGTSSLE       CCTFRG F KL+  +G + W+T+ LPDNK  
Sbjct  180   ALITMSGTYYNRGYYVGTSSLESLVPLEKCCTFRGSFVKLNPRSGAIYWRTYTLPDNKNT  239

Query  1040  RGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEP  861
             +GEYAGAAIWGSSPSID  R  VYI TGNLYSAP  + +C+E+Q N+ T PT  D+CVEP
Sbjct  240   KGEYAGAAIWGSSPSIDVERNLVYIGTGNLYSAPLRIQQCRERQLNQ-TQPTQQDECVEP  298

Query  860   ENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSS-TPNCPP-GPNPDADFGEAPMM  687
             +NHS+SILALDLD+GKI W+RQ GGYDV  +AC ++S+ +P+CPP G  PD DFGEAPMM
Sbjct  299   DNHSNSILALDLDSGKIIWYRQFGGYDVSILACSDTSTPSPDCPPLGDKPDIDFGEAPMM  358

Query  686   LSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYT  507
             L++ +N + +DIVVAVQKSGFAWALDR+NG ++WY +AGP G  GGG+WGAATD +R+YT
Sbjct  359   LTIYINRTKKDIVVAVQKSGFAWALDRNNGNLIWYKKAGPYGLAGGGSWGAATDEKRIYT  418

Query  506   SIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVP-DTGLSNPVTVANGVLFAG  330
             +I NS+  NFTL PS  +T  GGWVAMDA  G++LWSTA P ++    PV++AN V FAG
Sbjct  419   NIVNSDAKNFTLAPSNKITTAGGWVAMDANNGRVLWSTANPGNSTAYGPVSIANEVAFAG  478

Query  329   SVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGT  150
             S    G ++AI+AK+G+ILWSY TGA+VYGGMS+SNGC+YVG+GY V+ G  + + T G 
Sbjct  479   SADRMGYIYAIDAKSGKILWSYKTGASVYGGMSISNGCIYVGHGYNVAYGYSLNL-TSGK  537

Query  149   SLFAFCL  129
              LFAFC+
Sbjct  538   FLFAFCV  544



>ref|XP_008348222.1| PREDICTED: uncharacterized protein LOC103411362 [Malus domestica]
Length=538

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/548 (61%), Positives = 407/548 (74%), Gaps = 22/548 (4%)
 Frame = -1

Query  1760  CHTHGQPLLYYCVCIIIFLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACGEN  1581
             CH     +L + +     LI  + +A    H      PA  NWLNHGGD+ NRRYA  E 
Sbjct  8     CH---NLILVFSLYTCSLLITSTXSAGGHSHDEN---PAXQNWLNHGGDLSNRRYANREX  61

Query  1580  KISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQK  1401
             KI+  TVSKL L WEFYAG DISATP+I  G +YFPSWNG +YAV AS+GSL+W++NL +
Sbjct  62    KINRRTVSKLSLNWEFYAGDDISATPSIYDGTLYFPSWNGEIYAVQASNGSLVWKKNLHE  121

Query  1400  LTGLNAT-VRTGNVTAIVSRSTPSIVGET--LIIGIYGPAVVIGVKRATGDLLWMTLLDR  1230
             LTGLNAT     N T  V+RSTP++V +   LI+GIYGPAVVI ++R+TG+L+W TLLD 
Sbjct  122   LTGLNATGFSXXNWT--VARSTPTVVDDQDLLIVGIYGPAVVIALERSTGNLIWSTLLDT  179

Query  1229  HPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDN  1050
             H AG+ITMSGTYYNG+ Y+GTSSLEE  S   CCTFRG  AKLD  +G VLW+TFMLPDN
Sbjct  180   HAAGVITMSGTYYNGSIYIGTSSLEETLSPEECCTFRGSLAKLDAKSGTVLWKTFMLPDN  239

Query  1049  KGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKC  870
              G+ G Y+GAAIWGSSPSID HR HVYIATGN+YS P++V + QE QNN +T PT  D C
Sbjct  240   HGQLGSYSGAAIWGSSPSIDVHRKHVYIATGNVYSVPENVSQXQENQNN-STLPTHPDAC  298

Query  869   VEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPM  690
             VEP+N  +SILALDLD+G IKW   LGGYDV+F  C  ++ST  C  GPN DADFGEAPM
Sbjct  299   VEPDNRGNSILALDLDSGDIKWNHHLGGYDVWFXECFLNTST--CXTGPNVDADFGEAPM  356

Query  689   MLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVY  510
             ML   VNG+ RD+VVAVQKSGFAWALDR+NG ++W TEAGPGG  GGGTWGAATD  +VY
Sbjct  357   MLKTCVNGTKRDLVVAVQKSGFAWALDRNNGTLIWSTEAGPGGVAGGGTWGAATDKXKVY  416

Query  509   TSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSN-PVTVANGVLFA  333
             T+IANS   NFTL PS N+T  GGWVA   + GKILWSTA P    S+ PV+VANG+LFA
Sbjct  417   TNIANSESRNFTLKPSSNITTWGGWVAXAPENGKILWSTANPSNSTSSGPVSVANGILFA  476

Query  332   GSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGG  153
             GS +PRG ++A+N + G+ LWSY TGA+V+GGMS+S+GC+YVG+GY+         +T G
Sbjct  477   GSTNPRGSIYAMNTENGKXLWSYDTGASVFGGMSISDGCIYVGSGYKRQ-------YTAG  529

Query  152   TSLFAFCL  129
             TSLFAFC+
Sbjct  530   TSLFAFCV  537



>ref|XP_006602903.1| PREDICTED: uncharacterized protein LOC102669266 [Glycine max]
Length=532

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/508 (63%), Positives = 386/508 (76%), Gaps = 5/508 (1%)
 Frame = -1

Query  1643  SGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWN  1464
             S +WLNHGGD++NRRYA  E+KISP T   L+LKW+F AGKDISATPAI  G +YFPSWN
Sbjct  27    SQDWLNHGGDLFNRRYAYKEHKISPKTAPNLRLKWKFNAGKDISATPAIYDGTLYFPSWN  86

Query  1463  GYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVV  1284
             G +YAV  +DGSL+W++NLQ LTG+NAT     V   VSRSTP++ G+ LIIG+YGP ++
Sbjct  87    GNIYAVKEADGSLVWKQNLQNLTGINATGYVTTVNWTVSRSTPTVAGDRLIIGVYGPCIL  146

Query  1283  IGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAK  1104
             I VKR TG+L+W T LD HPA +ITMSGTYYN   Y+G SS+E  +    CCTFRG F K
Sbjct  147   IAVKRTTGELVWKTTLDNHPAAIITMSGTYYNRHLYIGISSVEYFAPFEQCCTFRGSFVK  206

Query  1103  LDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLK  924
             L+  +G +LW+TFMLPDN   RGEYAGA++WGSSPSID  R HVYIATGNLYSAP  + +
Sbjct  207   LNARSGAILWKTFMLPDNNNTRGEYAGASVWGSSPSIDVKRNHVYIATGNLYSAPLRIRQ  266

Query  923   CQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSST  744
             C+E+Q N  T PT  D CVEPENHSDS+LALDLD+GKIKW+RQLGG D++   C++  ST
Sbjct  267   CRERQING-TEPTQPDACVEPENHSDSMLALDLDSGKIKWYRQLGGVDIWLFDCVD-PST  324

Query  743   PNCPP-GPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagp  567
             PNCPP G NPDADF EAPMML+  VN + +DIVVA QKSG  WALDR+NG +VW  +AGP
Sbjct  325   PNCPPQGINPDADFAEAPMMLTTYVNRTKKDIVVAGQKSGIVWALDRNNGNLVWSKQAGP  384

Query  566   ggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAV  387
             GG  GG TWGA+TD  RVYT+IANS   NFTL PS   T  GGWVAM+A  G++LWS A 
Sbjct  385   GGVTGGATWGASTDERRVYTNIANSEARNFTLAPSNITTTAGGWVAMNASNGRVLWSIAN  444

Query  386   PDTGLSN-PVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVY  210
             P    ++ PV+VAN V+FAGS    G +FAI+AK+G+ILWSY TGA+VYGGMS+SNGC+Y
Sbjct  445   PSNSTAHGPVSVANDVVFAGSTDRNGSIFAIDAKSGKILWSYQTGASVYGGMSISNGCIY  504

Query  209   VGNGYRVSIGAGIPIFTGGTSLFAFCLE  126
             VG+GY V  G  +  F+GG  LF FC+E
Sbjct  505   VGHGYSV-WGPDLFNFSGGIWLFGFCVE  531



>gb|KHN13641.1| Quinohemoprotein ethanol dehydrogenase type-1 [Glycine soja]
Length=532

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/508 (62%), Positives = 386/508 (76%), Gaps = 5/508 (1%)
 Frame = -1

Query  1643  SGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWN  1464
             S +WLNHGGD++NRRYA  E+KISP T   L+LKW+F AGKDISATPAI  G +YFPSWN
Sbjct  27    SQDWLNHGGDLFNRRYAYKEHKISPKTAPNLRLKWKFNAGKDISATPAIYDGTLYFPSWN  86

Query  1463  GYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVV  1284
             G +YAV  +DGSL+W++NLQ LTG+NAT     V   VSRSTP++ G+ LIIG+YGP ++
Sbjct  87    GNIYAVKEADGSLVWKQNLQNLTGINATGYVTTVNWTVSRSTPTVAGDRLIIGVYGPCIL  146

Query  1283  IGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAK  1104
             I VKR TG+L+W T LD HPA +ITMSGTYYN   Y+G SS+E  +    CCTFRG F K
Sbjct  147   IAVKRTTGELVWKTTLDNHPAAIITMSGTYYNRHLYIGISSVEYFAPFEQCCTFRGSFVK  206

Query  1103  LDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLK  924
             L+  +G +LW+TFMLPDN   RGEYAGA++WGSSPSID  R HVY+ATGNLYSAP  + +
Sbjct  207   LNARSGAILWKTFMLPDNNNTRGEYAGASVWGSSPSIDVKRNHVYVATGNLYSAPLRIRQ  266

Query  923   CQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSST  744
             C+E+Q N  T PT  D CVEPENHSDS+LALDLD+GKIKW+RQLGG D++   C++  ST
Sbjct  267   CRERQING-TEPTQPDACVEPENHSDSMLALDLDSGKIKWYRQLGGVDIWLFECVD-PST  324

Query  743   PNCPP-GPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagp  567
             PNCPP G NPDADF EAPMML+  VN + +DIVVA QKSG  WALDR+NG +VW  +AGP
Sbjct  325   PNCPPQGINPDADFAEAPMMLTTYVNRTKKDIVVAGQKSGIVWALDRNNGNLVWSKQAGP  384

Query  566   ggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAV  387
             GG  GG TWGA+TD  RVYT+IANS   NFTL PS   T  GGWVAM+A  G++LWS A 
Sbjct  385   GGVTGGATWGASTDERRVYTNIANSEARNFTLAPSNITTTAGGWVAMNASNGRVLWSIAN  444

Query  386   PDTGLSN-PVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVY  210
             P    ++ PV+VAN V+FAGS    G +FAI+AK+G+ILWSY TGA+VYGGMS+SNGC+Y
Sbjct  445   PSNSTAHGPVSVANDVVFAGSTDRNGSIFAIDAKSGKILWSYQTGASVYGGMSISNGCIY  504

Query  209   VGNGYRVSIGAGIPIFTGGTSLFAFCLE  126
             VG+GY V  G  +  F+GG  LF FC+E
Sbjct  505   VGHGYSV-WGPDLFNFSGGIWLFGFCVE  531



>emb|CBI22173.3| unnamed protein product [Vitis vinifera]
Length=469

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/512 (64%), Positives = 383/512 (75%), Gaps = 48/512 (9%)
 Frame = -1

Query  1661  RFSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVV  1482
             +FS      WLNHGGD+YNRRYA  E KISP T SKL+LKWEFYAG+DI+ATPAI  G +
Sbjct  4     KFSQKEPAEWLNHGGDLYNRRYASTETKISPETASKLRLKWEFYAGQDITATPAIFNGTL  63

Query  1481  YFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGI  1302
             YFPSWNGYLYAV ASDGSL+W++NLQKLTGLNAT    NV   VSR+TP+I G+ LIIGI
Sbjct  64    YFPSWNGYLYAVKASDGSLVWKQNLQKLTGLNATGFVNNVNWTVSRATPTIAGDMLIIGI  123

Query  1301  YGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTF  1122
             YGPAVVI +K+ATG L+W T LD +PAG++TMSGT++ G+FYVGTSSLEEG S   CC F
Sbjct  124   YGPAVVIALKQATGRLVWSTQLDSNPAGVVTMSGTFHMGSFYVGTSSLEEGLSIEQCCIF  183

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG  +KLD+ TG +LWQTF LPDN G+RGEYAGAAIWGSSPSID  R  VY+AT      
Sbjct  184   RGSLSKLDIKTGALLWQTFTLPDNHGERGEYAGAAIWGSSPSIDVRRNLVYVAT------  237

Query  941   PKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIAC  762
                                                    D+ KIKW+RQLGGYDV+F+AC
Sbjct  238   ---------------------------------------DSDKIKWYRQLGGYDVWFLAC  258

Query  761   INSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWY  582
              N+ STPNCPPGPNPDADFGEAPMMLS+ VNG+ RDIV AVQKSGFAWALDR+NG +VW 
Sbjct  259   -NNLSTPNCPPGPNPDADFGEAPMMLSIYVNGTMRDIVTAVQKSGFAWALDRNNGSLVWA  317

Query  581   teagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKIL  402
             TEAGPGG  GGGTWGAATD  RVYT+I NS+  NFTL PS+  T  GGWVA++A TGKIL
Sbjct  318   TEAGPGGLSGGGTWGAATDGIRVYTNIVNSDSKNFTLKPSEKNTTAGGWVAIEAGTGKIL  377

Query  401   WSTAVPDTGLSN-PVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVS  225
             WSTA P    SN PVT+ANGVLFAGS H  G V+A++A +G+ILWS+ TGATV+GG SVS
Sbjct  378   WSTANPSNATSNGPVTIANGVLFAGSTHATGLVYAMDAASGKILWSHNTGATVFGGASVS  437

Query  224   NGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             +GC+YVG+GY V+IG+  P FT GTSLFAFC+
Sbjct  438   SGCIYVGSGYHVNIGSFFP-FTSGTSLFAFCV  468



>ref|XP_006602900.1| PREDICTED: uncharacterized protein LOC102668917 isoform X1 [Glycine 
max]
Length=544

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/547 (58%), Positives = 405/547 (74%), Gaps = 15/547 (3%)
 Frame = -1

Query  1757  HTHGQPLLYYCVCIIIFLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACGENK  1578
             H   + LL+Y V  ++ +   ++               S +WLNHGGD++NRRYA  E K
Sbjct  9     HLDLRLLLFYVVHAVVMVFAANSDGPRH---------QSQDWLNHGGDLFNRRYAYKERK  59

Query  1577  ISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKL  1398
             ISP T   L+LKW+FYAG+DI+ATPAI  G +YFPSWNG +YAV  +DGSL+W+++LQKL
Sbjct  60    ISPKTAPNLRLKWKFYAGRDITATPAIYDGTLYFPSWNGNIYAVKEADGSLVWKQSLQKL  119

Query  1397  TGLNATV-RTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPA  1221
             TGL A      NV + VSRSTP++ G+ LIIG+YGPA VI +KR TG+L+W T+LD HPA
Sbjct  120   TGLKAPDGLVENVNSTVSRSTPTVAGDLLIIGVYGPAAVIALKRKTGELVWKTILDYHPA  179

Query  1220  GLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGK  1041
              LITMSGTYYN  +YVGTSSLE       CCTFRG F KL+  +G + W+T+ LPDNK  
Sbjct  180   ALITMSGTYYNRGYYVGTSSLESLVPLEKCCTFRGSFVKLNPRSGAIYWRTYTLPDNKNT  239

Query  1040  RGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEP  861
             +GEYAGAAIWGSSPSID  R  VYI TGNLYSAP  + +C+E+Q N+ T PT  D+CVEP
Sbjct  240   KGEYAGAAIWGSSPSIDVERNLVYIGTGNLYSAPLRIQQCRERQLNQ-TQPTQQDECVEP  298

Query  860   ENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSS-TPNCPP-GPNPDADFGEAPMM  687
             +NHS+SILALDLD+GKI W+RQ GGYDV  + C ++S+ +P+CPP G  PD DFGEAPMM
Sbjct  299   DNHSNSILALDLDSGKIIWYRQFGGYDVSILPCSDTSTPSPDCPPLGDKPDIDFGEAPMM  358

Query  686   LSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYT  507
             L++ +N + +DIVVAVQKSGFAWALDR+NG ++WY +AGP G  GGG+WGAATD +R+YT
Sbjct  359   LTIYINRTKKDIVVAVQKSGFAWALDRNNGNLIWYKKAGPYGLAGGGSWGAATDEKRIYT  418

Query  506   SIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVP-DTGLSNPVTVANGVLFAG  330
             +I NS+  NFTL PS  +T  GGWVAMDA  G++LWSTA P ++    PV++AN V FAG
Sbjct  419   NIVNSDAKNFTLAPSNKITTAGGWVAMDANNGRVLWSTANPGNSTAYGPVSIANEVAFAG  478

Query  329   SVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGT  150
             S    G ++AI+A +G+ILWSY TGA+VYGGMS+SNGC+YVG+GY V+ G  + + T G 
Sbjct  479   SADRMGYIYAIDAMSGKILWSYKTGASVYGGMSISNGCIYVGHGYNVAYGYSLNL-TSGK  537

Query  149   SLFAFCL  129
              LFAFC+
Sbjct  538   FLFAFCV  544



>ref|XP_010690063.1| PREDICTED: uncharacterized protein LOC104903677 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=529

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/527 (60%), Positives = 397/527 (75%), Gaps = 17/527 (3%)
 Frame = -1

Query  1706  LICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYA  1527
             +  +SA AK      R+       W+NHGGD++NRRYA  E KISP T   L+L W+F A
Sbjct  19    IFIVSACAKSYDQKPRYE----SKWVNHGGDLHNRRYAEQETKISPKTAQNLELIWKFEA  74

Query  1526  GKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVS  1347
                 +ATP I +  +YF S++G +YA+   DG+L+W++NL +LTG N+T+     T ++S
Sbjct  75    ESYATATPTIFEETIYFSSFDGNIYAIKQLDGTLVWKQNLHQLTGFNSTIILFKGTLVLS  134

Query  1346  RSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGT  1167
             R+TP+I G+ LI+G+YGP+VV+G KR TG L+WMT LD HP  +ITMSGTYYNGAFYVGT
Sbjct  135   RATPTIAGDLLIVGMYGPSVVLGFKRDTGKLVWMTRLDNHPDSVITMSGTYYNGAFYVGT  194

Query  1166  SSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDA  987
             SSLEE +S   CCTFRG FAKL+  TGK+LWQT+MLPDNKGK+GEYAGAAIWGSSPSID 
Sbjct  195   SSLEELASIDKCCTFRGSFAKLNAKTGKILWQTYMLPDNKGKQGEYAGAAIWGSSPSIDV  254

Query  986   HRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIK  807
              R  VYIATGNLYSAP+ +  CQE++NN+ TTPT  ++C+E +NH +SILAL+L+TG I+
Sbjct  255   SRNLVYIATGNLYSAPERIETCQERENNQ-TTPTHPEECIEADNHENSILALELETGNIR  313

Query  806   WFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSG  627
             W++QLGGYDV+F  C+N  STP+CP GPNPDADFGEAPM+LSV V G  +D+ VAVQKSG
Sbjct  314   WYQQLGGYDVWFAKCMN-LSTPHCPLGPNPDADFGEAPMLLSVEVKGCRKDVAVAVQKSG  372

Query  626   FAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTI  447
              AWALDRD G+++W TEAGPGG  GGG WGAATD +RVYT+IANS+  NFTL PS   T 
Sbjct  373   IAWALDRDTGDVIWSTEAGPGGMKGGGIWGAATDEKRVYTNIANSDAKNFTLKPSNTTTK  432

Query  446   GGGWVAMDAQTGKILWSTAVPDTGLS-NPVTVANGVLFAGSVHPRGPVFAINAKTGEILW  270
              GGWVAMD Q G ILW+ A P +G+S  PVTVANGV+FAGS   +G ++AI+A TG ILW
Sbjct  433   AGGWVAMDPQDGTILWTAANPSSGVSFGPVTVANGVVFAGSYDKQGNIYAIDANTGVILW  492

Query  269   SYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             SY TG+ VYGG+SV +GC+YV NGY          +T G SLFAFC+
Sbjct  493   SYETGSEVYGGVSVGDGCIYVANGY----------WTAGKSLFAFCI  529



>ref|XP_007139593.1| hypothetical protein PHAVU_008G042800g [Phaseolus vulgaris]
 gb|ESW11587.1| hypothetical protein PHAVU_008G042800g [Phaseolus vulgaris]
Length=542

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/509 (62%), Positives = 388/509 (76%), Gaps = 6/509 (1%)
 Frame = -1

Query  1643  SGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWN  1464
             S +WLNHGGD++NRRYA  E KIS  T   L+LKW+FYAG+DI+ATPAI  G +YFPSWN
Sbjct  36    SQDWLNHGGDLFNRRYAYKERKISTKTAPDLRLKWKFYAGRDITATPAIYDGTLYFPSWN  95

Query  1463  GYLYAVNASDGSLLWERNLQKLTGLNATV-RTGNVTAIVSRSTPSIVGETLIIGIYGPAV  1287
             G +YAV  +DGSL+W++NL+K+TGL AT     NV   VSRSTP++ G+ L+IG+Y PA 
Sbjct  96    GNIYAVKEADGSLVWKQNLEKMTGLKATDGLVENVNWTVSRSTPTVAGDLLMIGVYSPAA  155

Query  1286  VIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFA  1107
             V+ VKR TG L+W T LD HP  LITMSGTYYN  +YVGTSSLE       CCTFRG F 
Sbjct  156   VVAVKRTTGKLVWKTTLDYHPEALITMSGTYYNRGYYVGTSSLESLVDLEKCCTFRGSFV  215

Query  1106  KLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVL  927
             KL+  +G +LW+T+M+PDN  K+GEYAGAAIWGSSPSID  R HVYI TGNLYSAP H+ 
Sbjct  216   KLNAQSGGILWRTYMIPDNNNKKGEYAGAAIWGSSPSIDEKRKHVYIGTGNLYSAPSHIS  275

Query  926   KCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINS-S  750
              C+E+Q N+T   T  D+CVEP+NHS+SILALDLD+GKI+W+RQ GGYDV  I C  S +
Sbjct  276   LCRERQINRTQH-TQPDECVEPDNHSNSILALDLDSGKIRWYRQFGGYDVSVIVCTGSPT  334

Query  749   STPNCPPGPN-PDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYtea  573
              +PNCPP  + PD DFGEAPMML+V +N   +DIVVAVQKSG AWALDR+NG +VWYTEA
Sbjct  335   PSPNCPPQADKPDVDFGEAPMMLTVYINRIKKDIVVAVQKSGIAWALDRNNGHLVWYTEA  394

Query  572   gpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWST  393
             GP G  GGG+WGAATD +RVYT+I NS+  NFTL PS  +T  GGWVAMDA  G++LWST
Sbjct  395   GPYGLAGGGSWGAATDEKRVYTNIVNSDANNFTLAPSNEITTAGGWVAMDAHNGRVLWST  454

Query  392   AVPDTGLS-NPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGC  216
             A P    +  PV+VAN V+FAGS    G ++AI+ K+G+ILWSY TGA+VYGGMS+S GC
Sbjct  455   ANPSNSTAYGPVSVANDVVFAGSADRMGYIYAIDGKSGKILWSYKTGASVYGGMSISRGC  514

Query  215   VYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             +YVG+GY V+ G  + + T GT LFAFC+
Sbjct  515   IYVGHGYNVAYGHTLNL-TDGTFLFAFCV  542



>ref|XP_010690064.1| PREDICTED: uncharacterized protein LOC104903677 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=528

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/531 (60%), Positives = 396/531 (75%), Gaps = 22/531 (4%)
 Frame = -1

Query  1718  IIIFLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKW  1539
             I I   C  +  +P +            W+NHGGD++NRRYA  E KISP T   L+L W
Sbjct  19    IFIVSACAKSYDQPRYE---------SKWVNHGGDLHNRRYAEQETKISPKTAQNLELIW  69

Query  1538  EFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVT  1359
             +F A    +ATP I +  +YF S++G +YA+   DG+L+W++NL +LTG N+T+     T
Sbjct  70    KFEAESYATATPTIFEETIYFSSFDGNIYAIKQLDGTLVWKQNLHQLTGFNSTIILFKGT  129

Query  1358  AIVSRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAF  1179
              ++SR+TP+I G+ LI+G+YGP+VV+G KR TG L+WMT LD HP  +ITMSGTYYNGAF
Sbjct  130   LVLSRATPTIAGDLLIVGMYGPSVVLGFKRDTGKLVWMTRLDNHPDSVITMSGTYYNGAF  189

Query  1178  YVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSP  999
             YVGTSSLEE +S   CCTFRG FAKL+  TGK+LWQT+MLPDNKGK+GEYAGAAIWGSSP
Sbjct  190   YVGTSSLEELASIDKCCTFRGSFAKLNAKTGKILWQTYMLPDNKGKQGEYAGAAIWGSSP  249

Query  998   SIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDT  819
             SID  R  VYIATGNLYSAP+ +  CQE++NN+ TTPT  ++C+E +NH +SILAL+L+T
Sbjct  250   SIDVSRNLVYIATGNLYSAPERIETCQERENNQ-TTPTHPEECIEADNHENSILALELET  308

Query  818   GKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAV  639
             G I+W++QLGGYDV+F  C+N  STP+CP GPNPDADFGEAPM+LSV V G  +D+ VAV
Sbjct  309   GNIRWYQQLGGYDVWFAKCMN-LSTPHCPLGPNPDADFGEAPMLLSVEVKGCRKDVAVAV  367

Query  638   QKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSK  459
             QKSG AWALDRD G+++W TEAGPGG  GGG WGAATD +RVYT+IANS+  NFTL PS 
Sbjct  368   QKSGIAWALDRDTGDVIWSTEAGPGGMKGGGIWGAATDEKRVYTNIANSDAKNFTLKPSN  427

Query  458   NVTIGGGWVAMDAQTGKILWSTAVPDTGLS-NPVTVANGVLFAGSVHPRGPVFAINAKTG  282
               T  GGWVAMD Q G ILW+ A P +G+S  PVTVANGV+FAGS   +G ++AI+A TG
Sbjct  428   TTTKAGGWVAMDPQDGTILWTAANPSSGVSFGPVTVANGVVFAGSYDKQGNIYAIDANTG  487

Query  281   EILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
              ILWSY TG+ VYGG+SV +GC+YV NGY          +T G SLFAFC+
Sbjct  488   VILWSYETGSEVYGGVSVGDGCIYVANGY----------WTAGKSLFAFCI  528



>ref|XP_010693329.1| PREDICTED: uncharacterized protein LOC104906291 [Beta vulgaris 
subsp. vulgaris]
Length=541

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/556 (57%), Positives = 406/556 (73%), Gaps = 23/556 (4%)
 Frame = -1

Query  1769  MAHCHTHGQPLLYYCVCIIIFLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYAC  1590
             MA   +H   LL   + I +  I ++A   P+            NWLNHGGD+ NRR+A 
Sbjct  1     MAKRLSHSFILL--VISITLPWILVTANYDPK------------NWLNHGGDLLNRRFAS  46

Query  1589  GENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERN  1410
              E KISP TV  L+LKW F A +DI+ATPAI  GVVYFPSW+GY+YAV ASDGSL+W++ 
Sbjct  47    KETKISPQTVHNLRLKWRFEAERDITATPAIYNGVVYFPSWDGYVYAVKASDGSLVWKKF  106

Query  1409  LQKLTGLNATVRTGNVTAIVSRSTPSIVGET--LIIGIYGPAVVIGVKRATGDLLWMTLL  1236
             +Q+LT + +     NV   V+R+TP++  +   L++G+YGP+ V+G++   G L+WMT L
Sbjct  107   IQELTRIPSPGIVANVNVTVARATPTVAPDLGLLLVGVYGPSYVLGLRIKDGSLVWMTRL  166

Query  1235  DRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLP  1056
             D H   +ITMSGTYYN  +YVG SSLEE +S   CC FRG F KLD  TG +LWQT+MLP
Sbjct  167   DPHNDSIITMSGTYYNRKYYVGVSSLEEETSIEECCNFRGSFVKLDARTGAILWQTYMLP  226

Query  1055  DNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSD  876
             DN  +RGEYAGAAIWGSSP ID  R  +YIATGNLYSAP+ +  C E++NN+ T PT + 
Sbjct  227   DNHQQRGEYAGAAIWGSSPPIDVSRNLIYIATGNLYSAPQRIRDCSERENNQ-TFPTNTS  285

Query  875   KCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEA  696
              CVEPENHS+S LAL+LDTG IKW+ Q+GGYDV+F  C + S +P+CPPGPNPDADFGEA
Sbjct  286   LCVEPENHSNSFLALELDTGDIKWYHQIGGYDVWFFECNDISVSPDCPPGPNPDADFGEA  345

Query  695   PMMLSVVVNGST----RDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaT  528
             PM+++++ N +      DIVVA QKSGF WALDRD+G +VW TEAGPGG  GGG WG+AT
Sbjct  346   PMLVTIMNNNNRTKRPHDIVVATQKSGFTWALDRDDGNLVWSTEAGPGGLGGGGIWGSAT  405

Query  527   DNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSN-PVTVA  351
             DN+R+YT+IAN+++  F L PS   T  GGWVAMDA TGK+LWST  P    SN P+TVA
Sbjct  406   DNKRIYTNIANTDQKTFILNPSNETTTAGGWVAMDASTGKVLWSTGNPSNASSNGPITVA  465

Query  350   NGVLFAGSVHP-RGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAG  174
             NGV+FAGS +   GP++A+ A+TG I+WS+ TGAT+YGG+SVS+GC+YVG+GY+V IG+ 
Sbjct  466   NGVVFAGSSNSTTGPIYAMVAETGNIIWSFDTGATIYGGVSVSDGCIYVGHGYKVGIGSF  525

Query  173   IPIFTGGTSLFAFCLE  126
              P F+ G +LFAFC++
Sbjct  526   NPAFSTGITLFAFCVD  541



>ref|XP_010661145.1| PREDICTED: uncharacterized protein LOC100853307 [Vitis vinifera]
Length=476

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/470 (67%), Positives = 370/470 (79%), Gaps = 8/470 (2%)
 Frame = -1

Query  1739  LLYYCVCIIIFLICISATAKPEWHITR--FSCPASGNWLNHGGDIYNRRYACGENKISPS  1566
             +L+ C   +  L+ I+A A   W   R  FS      WLNHGGD+YNRRYA  E KISP 
Sbjct  12    VLFLC---MFCLLTITACADSRWDSMRDKFSQKEPAEWLNHGGDLYNRRYASTETKISPE  68

Query  1565  TVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLN  1386
             T SKL+LKWEFYAGKDI+ATPAI  G +YFPSWNGYLYAV ASDGSL+W++NLQKLTGLN
Sbjct  69    TASKLRLKWEFYAGKDITATPAIFNGTLYFPSWNGYLYAVKASDGSLVWKQNLQKLTGLN  128

Query  1385  ATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITM  1206
             AT    NV   VSR+TP+I G+ LIIGIYGPAVVI VK+AT  L+W T LD +PAG++TM
Sbjct  129   ATGFVNNVNWTVSRATPTIAGDMLIIGIYGPAVVIAVKQATERLVWSTQLDSNPAGVVTM  188

Query  1205  SGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYA  1026
             S T++ G+FYVGTSSLEEG S   CC FRG  +KLD+ TG +LWQTF LPDN G+RGEYA
Sbjct  189   SETFHMGSFYVGTSSLEEGLSIEQCCIFRGSLSKLDIKTGALLWQTFTLPDNHGERGEYA  248

Query  1025  GAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSD  846
             G AIWGSSPSID  R  VY+ATGNLYSAP  + +CQE+QNN+ T PT  D+C+EP+NHS+
Sbjct  249   GGAIWGSSPSIDVRRNLVYVATGNLYSAPLSIRECQEQQNNQ-TVPTQPDQCIEPDNHSN  307

Query  845   SILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNG  666
             SILA+DLD+ KIKW+RQLGGYD +F+AC N+ STPNCPPGPNPDADFGEAPMMLS+ VNG
Sbjct  308   SILAIDLDSDKIKWYRQLGGYDAWFLAC-NNLSTPNCPPGPNPDADFGEAPMMLSIYVNG  366

Query  665   STRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNR  486
             + RDIV+AVQKSGF WALDR+NG ++W TEAGPGG  GGGTWGAATD  +VYT+I NS+ 
Sbjct  367   TMRDIVIAVQKSGFVWALDRNNGSLIWATEAGPGGLSGGGTWGAATDGIKVYTNIVNSDS  426

Query  485   LNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSN-PVTVANGVL  339
              NFTL PS+  T  GGWVAM+A TGKILWSTA P    SN PVT+ANG +
Sbjct  427   KNFTLKPSEKNTTAGGWVAMEAGTGKILWSTANPSNATSNGPVTIANGAI  476



>gb|KHN13638.1| Quinohemoprotein ethanol dehydrogenase type-1 [Glycine soja]
Length=552

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/550 (59%), Positives = 401/550 (73%), Gaps = 24/550 (4%)
 Frame = -1

Query  1739  LLYYCVCIIIFLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACGENKISPSTV  1560
              L++CV  ++        A  +  I +     S +WLNHGGD++NRRYA  E  ISP T 
Sbjct  14    FLFFCVHTVVIF-----AASSDDRIQK-----SQDWLNHGGDLFNRRYAYKERMISPKTA  63

Query  1559  SKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNAT  1380
               L+LKW+F AGKDISATPAI  G VYFPSWNGY+YAV  +DGSL+W++NL+ LTGL+AT
Sbjct  64    PNLRLKWKFNAGKDISATPAIYGGTVYFPSWNGYIYAVKEADGSLVWKQNLENLTGLSAT  123

Query  1379  VRTGNVTAIVSRSTPSIVGE-TLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMS  1203
                 NV   VSRSTP++ G+ +L+IGIYGPAVVI V R TG+L+W T LD HPA +ITMS
Sbjct  124   GFVRNVNWTVSRSTPTVAGDDSLLIGIYGPAVVICVNRTTGELVWKTTLDHHPAAVITMS  183

Query  1202  GTYYNG--------AFYVGTSSLEEG-SSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDN  1050
             GTYY G         FYVG SSLE    +   CCTFRG F KL+  TG++ W+T+MLPDN
Sbjct  184   GTYYKGYYTITVHRDFYVGISSLEIAVPTVEECCTFRGSFTKLNARTGRMRWKTYMLPDN  243

Query  1049  KGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKC  870
               + GEYAGA+IWGSSPSID  R HVY ATGNLYSAP  + +C+E+Q N+T      D+C
Sbjct  244   NNRTGEYAGASIWGSSPSIDVERNHVYTATGNLYSAPLRIRQCRERQINRTQPTQPGDEC  303

Query  869   VEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPP-GPNPDADFGEAP  693
             VEP+NHSDS+LALDLD+GK+KW+RQLGG D++ IACIN  STPNCPP    PD DFG++P
Sbjct  304   VEPDNHSDSMLALDLDSGKMKWYRQLGGLDIWTIACIN-PSTPNCPPQAERPDVDFGQSP  362

Query  692   MMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERV  513
             MML++ +N + +DIVVAVQKSG AWAL R+NG ++W T AGP G  GGG WGAATD +RV
Sbjct  363   MMLTIYINRTKQDIVVAVQKSGIAWALYRNNGNILWSTNAGPYGLSGGGIWGAATDVKRV  422

Query  512   YTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSN-PVTVANGVLF  336
             YT+IAN+   NFTL PS   T  GGWVAMDA  G+ILWSTA P    +N PV+VANGV+F
Sbjct  423   YTNIANTGARNFTLAPSNVTTTAGGWVAMDASNGRILWSTANPSNRTANGPVSVANGVVF  482

Query  335   AGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTG  156
             AGS    G V+AI+A  G+ILWSY TGA+VYGGMS+S GC++VG+GY V++G    +  G
Sbjct  483   AGSADRMGSVYAIDAMNGKILWSYQTGASVYGGMSISKGCIFVGHGYGVALGPAFGLI-G  541

Query  155   GTSLFAFCLE  126
             GTSLFAFC+ 
Sbjct  542   GTSLFAFCVR  551



>ref|XP_006431100.1| hypothetical protein CICLE_v10013418mg, partial [Citrus clementina]
 gb|ESR44340.1| hypothetical protein CICLE_v10013418mg, partial [Citrus clementina]
Length=502

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/485 (65%), Positives = 367/485 (76%), Gaps = 27/485 (6%)
 Frame = -1

Query  1637  NWLNHGGDIYNRRYACGENK-ISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNG  1461
             NW+NHGGD+YNRRYA  E K ISP+TVSKL LKW+FYAG DIS TPAI    +YFPSWNG
Sbjct  9     NWVNHGGDLYNRRYANKEEKKISPATVSKLNLKWKFYAGSDISVTPAIFNNTLYFPSWNG  68

Query  1460  YLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVI  1281
             YLYAV A+DGSL+W++NLQ LTG++    T NV + VSRSTP++ G  LI G++GPAVV+
Sbjct  69    YLYAVKAADGSLIWKQNLQNLTGISNPGFTLNVNSTVSRSTPTVAGNLLIFGLWGPAVVV  128

Query  1280  GVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKL  1101
              VKR+ G L+W T LD H    ITMSGTYY GA+YVGTSS+EEG +   CCTF+G  AKL
Sbjct  129   AVKRSNGKLVWKTKLDDHARSFITMSGTYYKGAYYVGTSSIEEGLTFELCCTFQGSLAKL  188

Query  1100  DVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKC  921
             D  TG++LWQTFMLPDN GK  EYAGAAIWGSSPSID  R HVYIATGNLYS        
Sbjct  189   DAKTGRILWQTFMLPDNFGKLNEYAGAAIWGSSPSIDPIRNHVYIATGNLYS--------  240

Query  920   QEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTP  741
                             C+EPENHS+S+LALDLDTGK  W++QLGGYDV+F AC N    P
Sbjct  241   ----------------CIEPENHSNSLLALDLDTGKFVWYKQLGGYDVWFGAC-NWHLNP  283

Query  740   NCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpgg  561
             NCPPGP+PDADFGEAPMMLS+  N    DIVVAVQKSGFAWALDRD+G ++W  EAGPGG
Sbjct  284   NCPPGPSPDADFGEAPMMLSMYRNKVKHDIVVAVQKSGFAWALDRDSGSLIWSMEAGPGG  343

Query  560   fvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPD  381
               GG  WGAATD  R+YT+IANS   NF L PSKN TI GGWVAMDA  G +LWSTA P 
Sbjct  344   LGGGAMWGAATDERRIYTNIANSQHKNFNLKPSKNSTIAGGWVAMDASNGNVLWSTADPS  403

Query  380   TGLS-NPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVG  204
              G +  PVTVANGVLF GS + +GP++A++ KTG+ILWSY TGAT+YGG SVSNGC+Y+G
Sbjct  404   NGTAPGPVTVANGVLFGGSTYRQGPIYAMDVKTGKILWSYDTGATIYGGASVSNGCIYMG  463

Query  203   NGYRV  189
             NGY++
Sbjct  464   NGYKM  468



>ref|XP_006374054.1| hypothetical protein POPTR_0016s14620g, partial [Populus trichocarpa]
 gb|ERP51851.1| hypothetical protein POPTR_0016s14620g, partial [Populus trichocarpa]
Length=501

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/503 (62%), Positives = 377/503 (75%), Gaps = 4/503 (1%)
 Frame = -1

Query  1634  WLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYL  1455
             WLNHG DI N R A GE  I+  TV  L+LKW F+AGKDISATPAI  GVVYFPSWNG+L
Sbjct  1     WLNHGADISNTRSAKGEVLINRLTVKNLRLKWTFFAGKDISATPAIANGVVYFPSWNGFL  60

Query  1454  YAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGV  1275
             YAVNA +G+L+W++NL +LTGLN T    NVT  VSRSTP+I  + L++GIYGPAVVI V
Sbjct  61    YAVNAFNGALIWKQNLSQLTGLNGTGIVVNVT--VSRSTPTIADDLLLVGIYGPAVVIAV  118

Query  1274  KRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDV  1095
              RA+G L+W T LD  P   IT SGT+YNGAFYVG SSLE G     CCTFRG  AKL+V
Sbjct  119   ARASGRLVWSTQLDPRPRAQITQSGTFYNGAFYVGVSSLEVGLPANQCCTFRGSMAKLNV  178

Query  1094  WTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQE  915
              TG  +W+T+ LPDN+G+ G Y+GAAIWGSSP+ID  R  V++ TGNLY+AP  V +CQE
Sbjct  179   RTGTTIWRTYTLPDNEGQLGGYSGAAIWGSSPAIDVTRRLVFVGTGNLYTAPPEVTQCQE  238

Query  914   KQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNC  735
              QNN+TT P   D+C+ P+ H DSILA+D+DTG+IKW R+L GYDVF+ AC+   + P+C
Sbjct  239   AQNNQTTKPAQPDQCIGPDIHFDSILAIDIDTGRIKWSRKLSGYDVFYFACL-VPNNPDC  297

Query  734   PPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfv  555
             PPGPN DADFGEAPM+L++  N + RD+ VAVQKSGFA ALDRD G +VW   AGPGG  
Sbjct  298   PPGPNLDADFGEAPMLLTITANRTRRDVAVAVQKSGFAVALDRDTGSIVWSKLAGPGGLE  357

Query  554   gggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVP-DT  378
             GGG WGAATD   VYT+IANSNR  FTL PS   T  G WVA+DA +G+ILWSTA P + 
Sbjct  358   GGGIWGAATDERTVYTNIANSNRERFTLAPSNQTTTVGAWVALDANSGQILWSTANPSNE  417

Query  377   GLSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNG  198
                 PVT+ N VLFAGSV P GP++A++AKTG ILWSY  GATVYGG+S S GC+Y+GNG
Sbjct  418   AAQGPVTIVNDVLFAGSVAPNGPIYAMDAKTGNILWSYNIGATVYGGVSASYGCIYLGNG  477

Query  197   YRVSIGAGIPIFTGGTSLFAFCL  129
             Y + +    P +TGGTSL+AFC+
Sbjct  478   YSIGLARFHPSWTGGTSLYAFCV  500



>ref|XP_004298441.1| PREDICTED: polyvinylalcohol dehydrogenase-like [Fragaria vesca 
subsp. vesca]
Length=543

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/545 (58%), Positives = 394/545 (72%), Gaps = 22/545 (4%)
 Frame = -1

Query  1760  CHTHGQPLLYYCVCIIIFLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACGEN  1581
             CH+    +L  C+C+   L             T F+      WLNHGGD  NRRYA GE 
Sbjct  19    CHSTVH-MLVLCLCLFTLLD------------TTFAF-----WLNHGGDNSNRRYANGEV  60

Query  1580  KISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQK  1401
              I+P TV  ++ KW F+AGKDI+ATPA+  G +YFPSWNG+LYAVNA  G+L+W++NL +
Sbjct  61    LINPRTVLNMRQKWSFFAGKDITATPAVADGRIYFPSWNGFLYAVNAFTGALIWKQNLSQ  120

Query  1400  LTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPA  1221
             LTGLN T    NVT  VSR+TP+I G  LI+GIYGPAVVI V R+ G L+W T LD  P 
Sbjct  121   LTGLNGTGIVVNVT--VSRATPTIAGNLLIVGIYGPAVVIAVDRSNGRLVWSTQLDSRPR  178

Query  1220  GLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGK  1041
              +ITMSGT   G+FYVG SSLEEG   + CC+FRG  AKLD+ TG V+W+T+MLPDN G+
Sbjct  179   TMITMSGTVLLGSFYVGVSSLEEGLPASQCCSFRGSVAKLDLRTGAVIWRTYMLPDNSGR  238

Query  1040  RGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEP  861
                Y+GAA+WGSSPSID  R HVY+ATGNLY+AP  V++CQE+QNN+T  PT  D+C  P
Sbjct  239   LNGYSGAAVWGSSPSIDVLRRHVYVATGNLYTAPPEVIQCQEEQNNQTGKPTQPDQCTGP  298

Query  860   ENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLS  681
             + H +SILALDL TG+I W RQLGGYD+F+ AC+   + P+CPPGPN DADFGEAPM+L+
Sbjct  299   DIHFNSILALDLVTGRIVWSRQLGGYDIFYFACL-IPNNPDCPPGPNDDADFGEAPMLLT  357

Query  680   VVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSI  501
             +  NG++RD+VVAVQKSGFAWALDRDNG + W+  AGPG   GGG WGAATD  RVYT+I
Sbjct  358   IHPNGTSRDVVVAVQKSGFAWALDRDNGNITWFKLAGPGSNEGGGIWGAATDGRRVYTNI  417

Query  500   ANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSN-PVTVANGVLFAGSV  324
             AN  R  FTL PS   T  G WVA+D  TGKILW+TA P    +  PV+VANGV+FAGS+
Sbjct  418   ANGQRQRFTLAPSNLTTTAGVWVALDVDTGKILWTTANPSNDTTQGPVSVANGVVFAGSM  477

Query  323   HPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSL  144
                GP++A++A TG+ILWS  TG++VYGG+S S GC+Y+G GY V +    P +TGGTSL
Sbjct  478   ASNGPIYAMDATTGKILWSTNTGSSVYGGVSASYGCIYLGTGYTVGLAKFHPTWTGGTSL  537

Query  143   FAFCL  129
             FAFC+
Sbjct  538   FAFCV  542



>ref|XP_010068793.1| PREDICTED: uncharacterized protein LOC104455756 [Eucalyptus grandis]
Length=531

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/503 (62%), Positives = 377/503 (75%), Gaps = 4/503 (1%)
 Frame = -1

Query  1634  WLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYL  1455
             WLNHGGD+ N R A  E  ISPSTVS L+L+W+F+ GKDISATPAI  GVVYFPSWNGYL
Sbjct  31    WLNHGGDLRNTRNAREEMLISPSTVSGLQLRWKFFTGKDISATPAIANGVVYFPSWNGYL  90

Query  1454  YAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGV  1275
             YAVNA  G L+W++NL +LTGL  T    NVT  VSRSTP+I G  LI+ IYGPAVVI V
Sbjct  91    YAVNAFTGGLIWQQNLSELTGLRGTGIIVNVT--VSRSTPTIAGRLLIVSIYGPAVVIAV  148

Query  1274  KRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDV  1095
              R+ G L+W+T LD  P  +IT SGT Y  AFY G SSLE       CCTFRG  AKL +
Sbjct  149   NRSNGRLIWLTQLDLRPLAVITTSGTAYMRAFYAGVSSLEVTLLGEQCCTFRGSLAKLSI  208

Query  1094  WTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQE  915
              +G ++WQT+ +PDN GKRG Y+GA+IWGSSP+ID  R  VY+ TG LY+ P+ V +CQE
Sbjct  209   RSGAIIWQTYTIPDNGGKRGGYSGASIWGSSPAIDPRRRLVYVGTGQLYTVPREVAQCQE  268

Query  914   KQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNC  735
             KQNN+TT P+  D+C+  + + DSI+A D+++G+I+W RQLGGYDVF+ AC+   + P+C
Sbjct  269   KQNNQTTKPSQPDQCIGRDVNFDSIIAFDIESGRIRWARQLGGYDVFYFACL-VPNNPDC  327

Query  734   PPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfv  555
             PPGPN DADFGEAPM+LS+  NG+ RDIV AVQKSGFAWALDRD G +VW+  AGPGG  
Sbjct  328   PPGPNLDADFGEAPMLLSISANGTRRDIVAAVQKSGFAWALDRDTGAIVWFKLAGPGGLE  387

Query  554   gggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTG  375
             GGGTWGAATD +R+YT+IANS R+ FTL PS   T  G WVA+DA TGKILWSTA P   
Sbjct  388   GGGTWGAATDGQRIYTNIANSYRVRFTLAPSTQTTTAGAWVALDANTGKILWSTANPSNE  447

Query  374   L-SNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNG  198
             + S PV+V NGV+FAGS  P GP++A+ A TG ILWS+ TGAT+YGG+S S GC+Y+GNG
Sbjct  448   MASGPVSVVNGVVFAGSPAPNGPLYAMEATTGNILWSFNTGATIYGGVSASYGCIYLGNG  507

Query  197   YRVSIGAGIPIFTGGTSLFAFCL  129
             Y VS     P +T GTSLFAFCL
Sbjct  508   YTVSTAKFHPTWTPGTSLFAFCL  530



>ref|XP_010096357.1| hypothetical protein L484_021105 [Morus notabilis]
 gb|EXB63832.1| hypothetical protein L484_021105 [Morus notabilis]
Length=554

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/550 (58%), Positives = 392/550 (71%), Gaps = 5/550 (1%)
 Frame = -1

Query  1772  SMAHCHTHGQPLLYYCVCIIIFLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYA  1593
             +++     G+ L+ Y V I   ++  +   +    ++  +      WLNHG DI N R A
Sbjct  7     TLSKVTEAGEALVLYGVWIPKVVVLRNGVGEDVRRVSSLTQQLM--WLNHGSDITNDRKA  64

Query  1592  CGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWER  1413
              GE  ISP T S+L+L+W+F AG+DI+ATPAI  GV YFPSW+G LYAVNA +G L+W+R
Sbjct  65    DGEALISPRTASRLRLRWKFLAGRDITATPAIANGVAYFPSWDGNLYAVNAFNGRLIWKR  124

Query  1412  NLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTLLD  1233
             NL +LTGLN T    NV   VSR+TP+I G+ LI+GIYGPA+VI V R  G LLW TLLD
Sbjct  125   NLNELTGLNGTGIIVNVNVTVSRTTPAIAGDRLIVGIYGPALVIAVSRLDGRLLWSTLLD  184

Query  1232  RHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPD  1053
               P  LIT SGT Y G FYVG SSLE       CCTFRG   KLDV TG+VLWQT+ LPD
Sbjct  185   PRPRALITASGTAYLGDFYVGVSSLEVVLPADQCCTFRGSLVKLDVRTGRVLWQTYTLPD  244

Query  1052  NKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDK  873
             N GKRG YAGAAIWGSSP+ID  R HVY+ TG LY+AP  VL+CQE+QNN+   PT  D+
Sbjct  245   NGGKRGGYAGAAIWGSSPAIDVRRQHVYVGTGQLYTAPAEVLRCQEEQNNQPGKPTHPDQ  304

Query  872   CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAP  693
             C+ P  H +SILA D+DTG I W RQLGGYDVF+  C+   + P+CPPGPN DADFGEAP
Sbjct  305   CIGPNIHYNSILAFDIDTGGIVWSRQLGGYDVFYFVCL-VPNNPDCPPGPNLDADFGEAP  363

Query  692   MMLSVVVNGSTR-DIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNER  516
             M+L++  NG+ R D+ VAVQKSGFAWALDRDNG++VW+  AGPG   GGG WGAATD  R
Sbjct  364   MLLTINPNGTRRVDVAVAVQKSGFAWALDRDNGDIVWFKLAGPGSLEGGGIWGAATDGRR  423

Query  515   VYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSN-PVTVANGVL  339
             VYT+I N+++  F L PS      GGWVA+DA TG+ILW+TA P    ++ PVTVANGV+
Sbjct  424   VYTNIVNADKKPFVLAPSNRTATSGGWVALDANTGRILWTTADPANDTAHGPVTVANGVV  483

Query  338   FAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFT  159
             FAGSV P GPV+A++ +TG+ILWS  TGATVYGG SV  GC+++G+GY VS+    P +T
Sbjct  484   FAGSVAPSGPVYAMDGETGKILWSANTGATVYGGASVGYGCMFIGSGYSVSLARFHPTWT  543

Query  158   GGTSLFAFCL  129
              GTSLFA+C+
Sbjct  544   PGTSLFAYCV  553



>ref|XP_004489157.1| PREDICTED: polyvinylalcohol dehydrogenase-like [Cicer arietinum]
Length=536

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/539 (59%), Positives = 395/539 (73%), Gaps = 13/539 (2%)
 Frame = -1

Query  1736  LYYCVCIIIFLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACGENKISPSTVS  1557
             L+  VC +IF + I      E          S +W+NHGGD+ NRRYA  E+KIS  T+S
Sbjct  8     LFTIVCWLIFCLHIITALWFE--------EDSQDWINHGGDLLNRRYANKEHKISTKTIS  59

Query  1556  KLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATV  1377
              L LKW+F  GK+I++TP I  G +YFPSWNGY+YAV A DGSL+W++N++ +T + +  
Sbjct  60    HLSLKWKFNVGKEITSTPTIFNGTIYFPSWNGYIYAVKACDGSLVWKQNIENITRIKSPG  119

Query  1376  RTGNVTAIVSRSTPSIVG-ETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSG  1200
                NV +  SR+TPSIVG + L++G+ GPAVVI + R  G+LLW+T LD HP+G ITMSG
Sbjct  120   SVRNVNSTFSRATPSIVGHDLLVVGLCGPAVVIALNRTNGNLLWITQLDSHPSGAITMSG  179

Query  1199  TYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGA  1020
             TYY G FYVGTSS EE SS   CCTFRG F+KL++ +G ++WQT+MLP+N G + EY+GA
Sbjct  180   TYYKGGFYVGTSSQEESSSVEKCCTFRGSFSKLNIKSGAIIWQTYMLPNNNGNKSEYSGA  239

Query  1019  AIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSI  840
             AIWGSSPSID  R  VYIATGNLYS P  + +CQEK+NN+ T P+  D+C++P+NHSDSI
Sbjct  240   AIWGSSPSIDPLRNLVYIATGNLYSVPLRISQCQEKENNQ-TIPSHLDECIDPDNHSDSI  298

Query  839   LALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGST  660
             LALDLD+GKIKW+RQLGGYDV+F AC N+ STPNCPPGPNPDADFGEAPMML++ VNGS 
Sbjct  299   LALDLDSGKIKWYRQLGGYDVWFAAC-NNLSTPNCPPGPNPDADFGEAPMMLTIYVNGSK  357

Query  659   RDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLN  480
             RDIVVAVQKSGF WALDRDNG +VW  EAGP G  GGGTWGAATD + +YT+I N+   N
Sbjct  358   RDIVVAVQKSGFVWALDRDNGSLVWSVEAGPSGLGGGGTWGAATDEQNIYTNIVNTFAKN  417

Query  479   FTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPD--TGLSNPVTVANGVLFAGSVHPRGPV  306
             FTL+PS  +   GGWVA++A+ GKILWS + P   T +S PV+VANGVLF  S    G  
Sbjct  418   FTLIPSNKIANNGGWVALEARNGKILWSISNPSNTTLISGPVSVANGVLFVASPTSDGTT  477

Query  305   FAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             +AIN K G+ILWSY TG  VYGG+S+S+GC+Y G G  +             SLFAFC+
Sbjct  478   YAINTKNGQILWSYETGIGVYGGISISDGCIYFGQGLSLITAPANYNPKANISLFAFCV  536



>ref|XP_006363936.1| PREDICTED: uncharacterized protein LOC102580594 [Solanum tuberosum]
Length=530

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/509 (62%), Positives = 381/509 (75%), Gaps = 7/509 (1%)
 Frame = -1

Query  1643  SGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWN  1464
             S  WLNHGGDI NRR A GE  ISP T++KLKL+W+F AG DI+ATPA+  GVVYFPSWN
Sbjct  24    SAEWLNHGGDITNRRSAPGEILISPRTINKLKLRWKFLAGFDITATPAVANGVVYFPSWN  83

Query  1463  GYLYAVNASDGSLLWERNLQKLTGLNATV-RTGNVTAIVSRSTPSIVGETLIIGIYGPAV  1287
             G LYAVNA  G L+W++NL +LTGL     RT N+  IVSR+TP +  + L++GIYGPAV
Sbjct  84    GNLYAVNALTGGLIWQQNLTRLTGLPIPPGRTVNL--IVSRATPVVADDLLLVGIYGPAV  141

Query  1286  VIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEG-SSKAHCCTFRGRF  1110
             VI V+R TG+L+W T LD  P  LIT SGT + G +YVG SS+E    S A CC FRG  
Sbjct  142   VIAVRRLTGELVWSTQLDSRPLALITQSGTVHLGGYYVGVSSVENTVPSAAQCCIFRGSL  201

Query  1109  AKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHV  930
              KL+V TG ++WQT+ LPDN G+ G Y+GAAIWGSSP+ID  RGHVY+ TGNLYSAP  V
Sbjct  202   VKLNVRTGAIIWQTYTLPDNGGRLGGYSGAAIWGSSPAIDIARGHVYVGTGNLYSAPPEV  261

Query  929   LKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSS  750
             LKCQ  QNN+TT PT  D+C   + H DSILALDL +G+I W  QLGGYDVF  AC+   
Sbjct  262   LKCQAAQNNRTTPPTVPDQCFGKDIHFDSILALDLYSGQIVWATQLGGYDVFTFACL-VP  320

Query  749   STPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteag  570
             + P+CPPGPN DADFGEAPMML++  NG  RD+VVAVQKSGFAWALDR+NG +VW+ +AG
Sbjct  321   NNPDCPPGPNVDADFGEAPMMLTIFSNGRFRDVVVAVQKSGFAWALDRNNGNIVWFKKAG  380

Query  569   pggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTA  390
             PGG  GGG WGAATD  RVYT+IAN NRL FTL PS   T  GGWVAM+A TG+ILW+TA
Sbjct  381   PGGAEGGGIWGAATDGRRVYTNIANGNRLPFTLAPSTQTTTAGGWVAMNANTGQILWTTA  440

Query  389   VPDTGLS-NPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCV  213
              P    S  PVT+ NGVLFAGSV P GP++A++A  G+ILW++ TGAT+YGG S+S GCV
Sbjct  441   NPSNETSPGPVTIVNGVLFAGSVAPNGPLYAMDASDGKILWTFNTGATIYGGASISYGCV  500

Query  212   YVGNGYRVSIGAGI-PIFTGGTSLFAFCL  129
             ++G+GY V +     P +T GTSLFAFC+
Sbjct  501   FIGHGYSVGLAKLFHPTWTTGTSLFAFCI  529



>gb|KHN11593.1| Quinohemoprotein ethanol dehydrogenase type-1 [Glycine soja]
Length=629

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/472 (67%), Positives = 377/472 (80%), Gaps = 6/472 (1%)
 Frame = -1

Query  1586  ENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNL  1407
             E+KIS  TVS L LKW+FYAGKDI+ATPAI  G +YFP WNG ++AV A DGSL+W++NL
Sbjct  2     EHKISVETVSNLSLKWKFYAGKDITATPAIFDGTLYFPCWNGDIFAVRAKDGSLVWKQNL  61

Query  1406  QKLTGLNATVRTGNVTAIVSRSTPSIVG-ETLIIGIYGPAVVIGVKRATGDLLWMTLLDR  1230
               LTGL+AT     V   V+R+TP+I   + LI GIYGPAVVI VKR+TGDL+W T LD 
Sbjct  62    GNLTGLSATGFVAGVNWTVARATPTIAEVDLLIFGIYGPAVVIAVKRSTGDLVWQTPLDS  121

Query  1229  HPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDN  1050
             H + ++TMSGTYY GA+YVG SSLEE +++  CCTFRG F+KLD+ +G +LWQTFMLPDN
Sbjct  122   HNSSVVTMSGTYYKGAYYVGASSLEELTTE-ECCTFRGSFSKLDIQSGVILWQTFMLPDN  180

Query  1049  KGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKC  870
              G+RGEYAGAA+WGSSPSIDA R H+YIATGNLYSAP  +L+CQE++NN  T PT  D+C
Sbjct  181   HGQRGEYAGAAVWGSSPSIDASRNHIYIATGNLYSAPLDILECQERENN-VTQPTHPDEC  239

Query  869   VEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPM  690
             VEP+NHSDSILALDLD GKIKW+RQLGGYDV+F++C N+ STPNCPPGPNPDADFGEAPM
Sbjct  240   VEPDNHSDSILALDLDDGKIKWYRQLGGYDVWFLSC-NNLSTPNCPPGPNPDADFGEAPM  298

Query  689   MLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVY  510
             ML++ VNG+ +D VVAVQKSGFAWAL RDNG ++W TEAGPGG  GGGTWGAATD ERVY
Sbjct  299   MLTIDVNGTKQDTVVAVQKSGFAWALHRDNGNLIWSTEAGPGGLAGGGTWGAATDKERVY  358

Query  509   TSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSN-PVTVANGVLFA  333
             T+IANS+  NFTL PS   T  GGWVAM+A +GKILWS A P    +N PVTVANGV+FA
Sbjct  359   TNIANSDGQNFTLKPSNKTTTSGGWVAMEASSGKILWSIANPSNATANGPVTVANGVVFA  418

Query  332   GSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGA  177
             GS + +GP++AIN KTG+I WSY TG+TVYGGM+ +  C         SIGA
Sbjct  419   GSTNQKGPIYAINGKTGKIEWSYETGSTVYGGMNFAF-CFLCLRKVLCSIGA  469


 Score =   180 bits (457),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 114/177 (64%), Gaps = 33/177 (19%)
 Frame = -1

Query  1187  GAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWG  1008
             GA+YVGTSS EEG      CTF G F+KL++  G +LWQT+M+PDN G++GEY+GAA+W 
Sbjct  468   GAYYVGTSSQEEGLPPEERCTFGGSFSKLNIQAGGILWQTYMIPDNHGQKGEYSGAAVW-  526

Query  1007  SSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALD  828
                                            K+ N  T PT  D+CVE +NHSDSI+ALD
Sbjct  527   ------------------------------RKRENNVTQPTHPDECVESDNHSDSIVALD  556

Query  827   LDTGKIKWFRQLGGYDVFFIACINSSSTP--NCPPGPNPDADFGEAPMMLSVVVNGS  663
             LD G IKW+  LGG+ V+F++C+N S+ P  NCPP P+PDADFGEAPMML++ VNG+
Sbjct  557   LDDGSIKWYHPLGGFGVWFVSCLNLSTIPSINCPPCPSPDADFGEAPMMLTIHVNGT  613



>ref|XP_010066940.1| PREDICTED: uncharacterized protein LOC104453970 [Eucalyptus grandis]
 gb|KCW64986.1| hypothetical protein EUGRSUZ_G02530 [Eucalyptus grandis]
Length=534

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/551 (57%), Positives = 404/551 (73%), Gaps = 20/551 (4%)
 Frame = -1

Query  1769  MAHCHTHGQPLLYYCVCI-IIFLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYA  1593
             M H H H Q + +  + I ++  +C+   A  EW             LNHGGD+ N R A
Sbjct  1     MTH-HLHIQRISHGILGIFVVIAVCLLNIAVAEW-------------LNHGGDLSNTRSA  46

Query  1592  CGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWER  1413
               E  I PSTV  L+L+W+F+AGKDISATPA+   VVYFPSWNG LYAVNA +GSL+W++
Sbjct  47    REEKLIGPSTVGNLRLRWKFFAGKDISATPAVADAVVYFPSWNGNLYAVNAFNGSLVWKQ  106

Query  1412  NLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTLLD  1233
             NL +LTGL       NVT  +SRSTP+I  + LI+ IYGP VVI V R+ G L+W T LD
Sbjct  107   NLSELTGLKGVGTVANVT--LSRSTPTIARKLLIVPIYGPGVVIAVNRSNGRLVWSTQLD  164

Query  1232  RHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPD  1053
              HP  +IT SGT Y GAFYVG SS EEG   A CCTFRG   KL++ +G++LWQT+ LPD
Sbjct  165   PHPLAVITTSGTAYMGAFYVGVSSTEEGLPAAKCCTFRGSLVKLNILSGEILWQTYTLPD  224

Query  1052  NKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDK  873
             N G+ G YAGA+IWGSSP+ID  R   Y ATGNLY+AP  V +CQ +QNN+TT PT  D+
Sbjct  225   NGGELGGYAGASIWGSSPAIDPKRRLAYAATGNLYTAPAKVQECQARQNNQTTPPTAPDQ  284

Query  872   CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAP  693
             C+ P+ + +SI+A + +TG+I+W RQLGGYDV+++AC+  +ST +CP GPN DADFGEAP
Sbjct  285   CIGPDVNFNSIIAFETETGRIRWARQLGGYDVWYVACLVPNST-DCPTGPNVDADFGEAP  343

Query  692   MMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERV  513
             M++++  NG+ RD+ VAVQKSGFAWA+DRD+G++VW+T AGPG   GGGTWGAATD +RV
Sbjct  344   MLITISTNGTERDVAVAVQKSGFAWAVDRDSGDIVWFTLAGPGSIEGGGTWGAATDGKRV  403

Query  512   YTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLS-NPVTVANGVLF  336
             YT+IAN NR NFTL PS   T  G WVA+DA +G+ILWSTA P   ++  PV+VANG++F
Sbjct  404   YTNIANGNRNNFTLAPSTQTTTAGAWVALDACSGEILWSTANPSNEIAPAPVSVANGIIF  463

Query  335   AGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGI-PIFT  159
             AGSV P GPV+A++A+TG+ILWSY +GATVYGG+S+S GC+Y GNGY++ + A + P +T
Sbjct  464   AGSVAPEGPVYAMDAETGKILWSYNSGATVYGGISISYGCIYHGNGYKLGLVAPLHPTWT  523

Query  158   GGTSLFAFCLE  126
             GGT L+A C++
Sbjct  524   GGTDLYALCVK  534



>ref|XP_009765669.1| PREDICTED: uncharacterized protein LOC104217192 [Nicotiana sylvestris]
Length=532

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/507 (61%), Positives = 377/507 (74%), Gaps = 4/507 (1%)
 Frame = -1

Query  1643  SGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWN  1464
             S  WLNHGGD  NRR A GE  ISP T+++LKL+W+F AG DI+ATPA+  GVVYFPSWN
Sbjct  28    SAEWLNHGGDRTNRRSAVGEVLISPRTINRLKLRWKFLAGFDITATPAVANGVVYFPSWN  87

Query  1463  GYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVV  1284
             G LYAVNA  G L+W++NL +LTGL  T  T  V   VSRSTP +  + L++GIYGPAVV
Sbjct  88    GNLYAVNALTGQLIWQQNLTRLTGLPVTRTT--VNVTVSRSTPVVADDLLLVGIYGPAVV  145

Query  1283  IGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAK  1104
             I V+R TG L+W TLLD  P  LIT SGT + G +YVG SSLEE      CCTFRG   K
Sbjct  146   IAVRRLTGTLVWSTLLDPRPLALITQSGTVFFGGYYVGVSSLEELLPATQCCTFRGSLVK  205

Query  1103  LDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLK  924
             L+V TG + WQT+ LPDN G+ G Y+GAAIWGSSP+ID  RG VY+ TGNLY AP  VL+
Sbjct  206   LNVRTGAIQWQTYTLPDNGGRLGGYSGAAIWGSSPAIDIARGFVYVGTGNLYLAPPEVLR  265

Query  923   CQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSST  744
             CQ  QNN+TT PT  D+C   + H +SILA D+D+G+I W  QLGGYDVF+  C+   + 
Sbjct  266   CQAAQNNRTTPPTNPDQCFGEDVHFNSILAFDVDSGEIAWATQLGGYDVFYFTCL-VPNN  324

Query  743   PNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpg  564
             P+CPPGPN DADFGEAPM+L++  NG  RDIVVAVQKSGFAWALDR+ G +VW  +AGPG
Sbjct  325   PDCPPGPNLDADFGEAPMLLTIFSNGRLRDIVVAVQKSGFAWALDRNTGHIVWVKKAGPG  384

Query  563   gfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVP  384
                GGG WGAATD +RVYT+I N NR+ FTL PS   T  GGWVA+DA TG+ILW+TA P
Sbjct  385   SLEGGGVWGAATDGKRVYTNIVNGNRVPFTLAPSNQTTTAGGWVALDANTGQILWTTADP  444

Query  383   DTGLSN-PVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYV  207
                 ++ PVT+ NG+LFAGSV P GP++A++A TG+ILW++ TGAT+YGG+SVS GCVYV
Sbjct  445   SNDTAHGPVTIVNGLLFAGSVAPNGPLYAMDASTGKILWTFNTGATIYGGVSVSYGCVYV  504

Query  206   GNGYRVSIGAGIPIFTGGTSLFAFCLE  126
             G+GY +S+    P +T GTSLFAFC++
Sbjct  505   GHGYSISLAKFHPTWTSGTSLFAFCID  531



>ref|XP_009627242.1| PREDICTED: uncharacterized protein LOC104117826 [Nicotiana tomentosiformis]
Length=532

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/534 (59%), Positives = 382/534 (72%), Gaps = 18/534 (3%)
 Frame = -1

Query  1724  VCIIIFLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKL  1545
             + II F   I +TA                WLNHGGD  NRR A GE  ISP T+++LKL
Sbjct  15    ILIITFCFIIDSTAA--------------EWLNHGGDRRNRRSAVGEVLISPRTINRLKL  60

Query  1544  KWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGN  1365
             +W+F AG DI+ATPA+  GVVYFPSWNG LYAVNA  G L+W++NL +LTGL  T  T  
Sbjct  61    RWKFLAGFDITATPAVANGVVYFPSWNGNLYAVNALAGQLIWQQNLTRLTGLPVTRTT--  118

Query  1364  VTAIVSRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNG  1185
             V   VSRSTP +  + L++GIYGPAVVI V+R TG L+W TLLD  P  LIT SGT   G
Sbjct  119   VNVTVSRSTPVVADDLLLVGIYGPAVVIAVRRLTGTLVWSTLLDPRPLALITQSGTVSLG  178

Query  1184  AFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGS  1005
              +YVG SSLEE      CCTFRG   KL+V TG +LWQT+ LPDN G+ G Y+GAAIWGS
Sbjct  179   GYYVGVSSLEELLPATQCCTFRGSLVKLNVRTGAILWQTYTLPDNGGRLGGYSGAAIWGS  238

Query  1004  SPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDL  825
             SP+ID  RG VY+ TGNLY AP  VL+CQ  QNN+TT PT  D+C   + H +SILA D+
Sbjct  239   SPAIDIARGFVYVGTGNLYLAPPEVLRCQAAQNNRTTPPTNPDQCFGEDVHFNSILAFDV  298

Query  824   DTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVV  645
             D+G+I W  QLGGYDVF+  C+   + P+CPPGPN DADFGEAPM+L++  NG  RDIVV
Sbjct  299   DSGEIAWATQLGGYDVFYFTCL-VPNNPDCPPGPNLDADFGEAPMLLTIFSNGRLRDIVV  357

Query  644   AVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLP  465
             AVQKSGFAWALDR+ G +VW  +AGPG   GGG WGAATD  RVYT+I N NR+ FTL P
Sbjct  358   AVQKSGFAWALDRNTGHIVWVKKAGPGSLEGGGVWGAATDGRRVYTNIVNGNRVPFTLAP  417

Query  464   SKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSN-PVTVANGVLFAGSVHPRGPVFAINAK  288
             S   T  GGWVA+DA TG+ILW+TA P    ++ PVT+ NG+LFAGSV P GP++A++A 
Sbjct  418   SNQTTTAGGWVALDANTGQILWTTADPSNDTAHGPVTIVNGLLFAGSVAPNGPLYAMDAS  477

Query  287   TGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCLE  126
              G+ILW++ TGAT+YGG+SVS GCVYVG+GY +S+    P +T GTSLFAFC++
Sbjct  478   NGKILWTFNTGATIYGGVSVSYGCVYVGHGYSISLAKFHPTWTSGTSLFAFCID  531



>gb|EYU28721.1| hypothetical protein MIMGU_mgv1a019021mg [Erythranthe guttata]
Length=504

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/505 (61%), Positives = 373/505 (74%), Gaps = 7/505 (1%)
 Frame = -1

Query  1634  WLNHGGDIYNRRYACGENKISPSTVSK--LKLKWEFYAGKDISATPAILKGVVYFPSWNG  1461
             WL HGGDI NRR A G   I+P TV    L+ KW+F AG DI+ATP++  G VYFPSWNG
Sbjct  3     WLTHGGDITNRRNAVG-GAINPITVKLGLLRQKWKFLAGFDITATPSVADGAVYFPSWNG  61

Query  1460  YLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVI  1281
              LYAV+AS+G+L+W+++L +LTGL  T R GN T  VSR+TP + G+ LI+GIYGPA V+
Sbjct  62    NLYAVDASNGALIWQQSLVQLTGLTPTGRYGNAT--VSRATPVVAGDLLIVGIYGPAYVV  119

Query  1280  GVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKL  1101
              V RATG L+W T LD  P GL+T SGT Y G FYVG SSLEE      CCTFRG   KL
Sbjct  120   AVTRATGRLVWSTQLDPRPLGLVTASGTVYRGGFYVGVSSLEELLPAGQCCTFRGSLVKL  179

Query  1100  DVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKC  921
             DV TG +LWQT+ LPDN G+ G Y+GAAIWGSSPSID  RG VY+ TGNLY  P  VL+C
Sbjct  180   DVRTGTILWQTYTLPDNGGQIGGYSGAAIWGSSPSIDTVRGRVYVGTGNLYLVPAEVLQC  239

Query  920   QEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTP  741
             Q +QNN+TT P+T D+C   + H DS ++ D++TG I W RQLGGYDVF+ AC+   + P
Sbjct  240   QARQNNRTTPPSTDDQCFGADIHFDSFMSFDINTGNIVWARQLGGYDVFYFACL-VPNNP  298

Query  740   NCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpgg  561
             +CPPGPN DADFGEAPM+L+++ N   RD+ VAVQKSGFAWALDRDNG++VW+T+AGPG 
Sbjct  299   DCPPGPNLDADFGEAPMLLTIISNRRLRDVAVAVQKSGFAWALDRDNGDIVWFTKAGPGS  358

Query  560   fvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVP-  384
               GGG WGAATD  RVYT+I N++ L FTL PS      GGWVAMDA TG+ILW+TA P 
Sbjct  359   LEGGGVWGAATDGARVYTNIVNNDNLPFTLKPSTQTATSGGWVAMDANTGRILWTTANPS  418

Query  383   DTGLSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVG  204
             +     PVTV NGVLFAGSV P GPV+A++A+TG I+WS+ TGAT+YGG SVS GCVY+G
Sbjct  419   NESAHGPVTVVNGVLFAGSVAPSGPVYAMDARTGAIIWSFETGATIYGGASVSYGCVYIG  478

Query  203   NGYRVSIGAGIPIFTGGTSLFAFCL  129
             +GY VS+    P +  G  LFAFC+
Sbjct  479   HGYSVSLAKFHPTWNSGKYLFAFCI  503



>gb|KCW64987.1| hypothetical protein EUGRSUZ_G02531 [Eucalyptus grandis]
Length=484

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/484 (62%), Positives = 365/484 (75%), Gaps = 4/484 (1%)
 Frame = -1

Query  1577  ISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKL  1398
             ISPSTVS L+L+W+F+ GKDISATPAI  GVVYFPSWNGYLYAVNA  G L+W++NL +L
Sbjct  3     ISPSTVSGLQLRWKFFTGKDISATPAIANGVVYFPSWNGYLYAVNAFTGGLIWQQNLSEL  62

Query  1397  TGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAG  1218
             TGL  T    NVT  VSRSTP+I G  LI+ IYGPAVVI V R+ G L+W+T LD  P  
Sbjct  63    TGLRGTGIIVNVT--VSRSTPTIAGRLLIVSIYGPAVVIAVNRSNGRLIWLTQLDLRPLA  120

Query  1217  LITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKR  1038
             +IT SGT Y  AFY G SSLE       CCTFRG  AKL + +G ++WQT+ +PDN GKR
Sbjct  121   VITTSGTAYMRAFYAGVSSLEVTLLGEQCCTFRGSLAKLSIRSGAIIWQTYTIPDNGGKR  180

Query  1037  GEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPE  858
             G Y+GA+IWGSSP+ID  R  VY+ TG LY+ P+ V +CQEKQNN+TT P+  D+C+  +
Sbjct  181   GGYSGASIWGSSPAIDPRRRLVYVGTGQLYTVPREVAQCQEKQNNQTTKPSQPDQCIGRD  240

Query  857   NHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSV  678
              + DSI+A D+++G+I+W RQLGGYDVF+ AC+   + P+CPPGPN DADFGEAPM+LS+
Sbjct  241   VNFDSIIAFDIESGRIRWARQLGGYDVFYFACL-VPNNPDCPPGPNLDADFGEAPMLLSI  299

Query  677   VVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIA  498
               NG+ RDIV AVQKSGFAWALDRD G +VW+  AGPGG  GGGTWGAATD +R+YT+IA
Sbjct  300   SANGTRRDIVAAVQKSGFAWALDRDTGAIVWFKLAGPGGLEGGGTWGAATDGQRIYTNIA  359

Query  497   NSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGL-SNPVTVANGVLFAGSVH  321
             NS R+ FTL PS   T  G WVA+DA TGKILWSTA P   + S PV+V NGV+FAGS  
Sbjct  360   NSYRVRFTLAPSTQTTTAGAWVALDANTGKILWSTANPSNEMASGPVSVVNGVVFAGSPA  419

Query  320   PRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLF  141
             P GP++A+ A TG ILWS+ TGAT+YGG+S S GC+Y+GNGY VS     P +T GTSLF
Sbjct  420   PNGPLYAMEATTGNILWSFNTGATIYGGVSASYGCIYLGNGYTVSTAKFHPTWTPGTSLF  479

Query  140   AFCL  129
             AFCL
Sbjct  480   AFCL  483



>gb|EYU28720.1| hypothetical protein MIMGU_mgv1a019168mg, partial [Erythranthe 
guttata]
Length=503

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/505 (60%), Positives = 372/505 (74%), Gaps = 6/505 (1%)
 Frame = -1

Query  1634  WLNHGGDIYNRRYACGENKISPSTVSK--LKLKWEFYAGKDISATPAILKGVVYFPSWNG  1461
             WL HGGD  NRR A G   I+P TV    L+ KW+F AG DI+ATP++  G VYFPSWNG
Sbjct  1     WLTHGGDSTNRRNAVGGGAINPITVKLGLLRQKWKFLAGFDITATPSVADGAVYFPSWNG  60

Query  1460  YLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVI  1281
              LYAV+AS+G+L+W+++L +LTGL  T R GN T  VSR+TP + G+ LI+GIYGPA V+
Sbjct  61    NLYAVDASNGALIWQQSLVQLTGLTPTGRYGNAT--VSRATPVVAGDLLIVGIYGPAYVV  118

Query  1280  GVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKL  1101
              V RATG L+W T LD  P  L+T SGT Y G +YVG SSLE       CCTFRG   KL
Sbjct  119   AVTRATGRLVWSTQLDPRPLALVTASGTVYKGGYYVGVSSLEVLLPAGQCCTFRGSLVKL  178

Query  1100  DVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKC  921
             DV TG ++WQT+ LPDN G+ G Y+GAAIWGSSPSID  RG VY+ TGNLY AP  VL+C
Sbjct  179   DVRTGAIIWQTYTLPDNGGQIGGYSGAAIWGSSPSIDTVRGRVYVGTGNLYLAPAEVLQC  238

Query  920   QEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTP  741
             Q +QNN+TT P+T D+C  P+ H DS+++ D++TG I W RQLGGYDVF+  C+   + P
Sbjct  239   QARQNNRTTPPSTGDQCFGPDVHFDSLMSFDINTGNIVWARQLGGYDVFYFVCL-VPNNP  297

Query  740   NCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpgg  561
             +CP GPN DADFGEAPM+L+++ N   RD+ VAVQKSGFAWALDRDNG++VW+T+AGPG 
Sbjct  298   DCPTGPNLDADFGEAPMLLTIISNRRLRDVAVAVQKSGFAWALDRDNGDIVWFTKAGPGS  357

Query  560   fvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPD  381
               GGG WGAATD  RVYT+I N + + FTL PS   TI GGWVAMDA TG+ILW+TA P 
Sbjct  358   LEGGGIWGAATDGARVYTNIVNGDNVPFTLKPSTQTTISGGWVAMDANTGRILWTTANPS  417

Query  380   TGLSN-PVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVG  204
                +N PVT+ NGVLFAGSV P GPV+A++A+TG I+WS+ TGATVYGG SVS GCVY+G
Sbjct  418   NDTANGPVTIVNGVLFAGSVAPSGPVYAMDARTGAIIWSFETGATVYGGASVSYGCVYIG  477

Query  203   NGYRVSIGAGIPIFTGGTSLFAFCL  129
             +GY V +    P +  G  LFAFC+
Sbjct  478   HGYSVGLARFNPTWNSGKYLFAFCI  502



>ref|XP_011087060.1| PREDICTED: uncharacterized protein LOC105168623 [Sesamum indicum]
Length=534

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/516 (59%), Positives = 380/516 (74%), Gaps = 7/516 (1%)
 Frame = -1

Query  1667  ITRFSCPASGNWLNHGGDIYNRRYACGENKISPSTV--SKLKLKWEFYAGKDISATPAIL  1494
             I  F   ++  W  HGGDI NRR A G   I+P +V    L+ +W+F AG DI+ATPA+ 
Sbjct  22    ILSFPDDSTAEWFTHGGDISNRRNAIG-GTINPISVRLGLLRQRWKFLAGFDITATPAVA  80

Query  1493  KGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETL  1314
              GVVYFPSWNG LYAV+A  G+L+W+++L  LTG+  T R   V A VSR+TP +VG+ L
Sbjct  81    DGVVYFPSWNGNLYAVSALSGALIWKQSLGSLTGIPPTGRY--VNATVSRATPVVVGDLL  138

Query  1313  IIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAH  1134
             I+GIYGPA V+ V+RATG L+W TL+D     ++T SGT Y G FY G SSLEE      
Sbjct  139   IVGIYGPAYVVAVRRATGQLVWSTLVDPGRLSIVTASGTVYMGGFYAGVSSLEELLPAGQ  198

Query  1133  CCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGN  954
             CCTFRG   KLDV TGK+LWQT+ LPDN GK G Y+GAAIWGSSPSID  RG VY+ TGN
Sbjct  199   CCTFRGSLVKLDVRTGKILWQTYTLPDNGGKLGGYSGAAIWGSSPSIDPIRGRVYVGTGN  258

Query  953   LYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVF  774
             LY AP  VL+CQ +QNN+TT P+  D+C  P+ H DS+L+ D+++GKI W +QLGGYDVF
Sbjct  259   LYLAPADVLQCQARQNNQTTPPSGPDQCFGPDVHFDSLLSFDVNSGKIVWAKQLGGYDVF  318

Query  773   FIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGE  594
             + AC+  +S P+CPPGPN DADFGEAPM+LS+V NG  RD+VVAVQKSGFAWALDR NG+
Sbjct  319   YFACLVPNS-PDCPPGPNLDADFGEAPMLLSIVSNGRLRDVVVAVQKSGFAWALDRGNGD  377

Query  593   MVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQT  414
             +VW+TEAGPG   GGG WGAATD  RVYT+I N +RL FTL PS   T+ GGWVAMDA T
Sbjct  378   IVWFTEAGPGALEGGGVWGAATDGIRVYTNIVNGDRLPFTLKPSNQTTVAGGWVAMDANT  437

Query  413   GKILWSTAVPDTGLSN-PVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGG  237
             G+ILW+TA P    ++ PVTV NGVLFAGSV P GPV+A++A+TG I+WS+ TGAT+YGG
Sbjct  438   GRILWTTANPSNETAHGPVTVVNGVLFAGSVAPSGPVYAMDAQTGAIIWSFNTGATIYGG  497

Query  236   MSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
              S S GC+Y+G+GY + +    P +  G  L+AFC+
Sbjct  498   ASASYGCIYIGHGYSIGLAKFHPTWNSGKYLYAFCM  533



>ref|XP_006438637.1| hypothetical protein CICLE_v10033589mg, partial [Citrus clementina]
 gb|ESR51877.1| hypothetical protein CICLE_v10033589mg, partial [Citrus clementina]
Length=482

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/502 (59%), Positives = 371/502 (74%), Gaps = 23/502 (5%)
 Frame = -1

Query  1634  WLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYL  1455
             WLNHGGD+ NRRYA GE  I+P TV  L+L+W FYAGKDISATPA+  GVVYFPSWNGYL
Sbjct  1     WLNHGGDLNNRRYAYGEVLINPVTVRNLRLRWSFYAGKDISATPAVANGVVYFPSWNGYL  60

Query  1454  YAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGV  1275
             YAVNA +G+L+WE+NL KLTGL+ T                      I+     AVV+ V
Sbjct  61    YAVNAFNGALIWEQNLSKLTGLSGTG---------------------IVVNVTVAVVVAV  99

Query  1274  KRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDV  1095
              R+ G+L+W T +D  P   ITMSG+ Y GAFYVG SSLEE      CCTFRG  AKLDV
Sbjct  100   SRSNGELVWSTQIDPRPRSQITMSGSVYMGAFYVGLSSLEEALPADQCCTFRGSLAKLDV  159

Query  1094  WTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQE  915
               G+++WQT+MLPDN GKRG Y+GAA+WGSSP+ID  R  VYI TGNLY+AP  VL+CQE
Sbjct  160   RNGRIIWQTYMLPDNGGKRGGYSGAAVWGSSPAIDVIRRRVYIGTGNLYTAPAEVLQCQE  219

Query  914   KQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNC  735
             KQNN+TT PT  D+C+  + +++SI+ALD+D+G+I W + LGGYD+F+  C+   + P+C
Sbjct  220   KQNNQTTKPTHPDQCISSDIYANSIVALDIDSGRIAWAKPLGGYDIFYFTCL-VPNNPDC  278

Query  734   PPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfv  555
             PPGPN DADFGEAPM+L++  NG  RD+VVAVQKSGFAWA DRD+G+++W+  AGPGG  
Sbjct  279   PPGPNLDADFGEAPMLLTISTNGRFRDVVVAVQKSGFAWAFDRDSGDIIWFKLAGPGGRE  338

Query  554   gggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTG  375
             GGG WGAATD  RVYT+I N++R+NFTL PS   T  G WVA+DA +G+I+WSTA P   
Sbjct  339   GGGVWGAATDGRRVYTNIVNNDRVNFTLAPSHQTTTAGAWVALDANSGEIMWSTADPSNE  398

Query  374   LSN-PVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNG  198
              ++ PVTV NGVLFAGSV   GP++A++  TG+ILWSY T +TVYGG+S S GC+Y+GNG
Sbjct  399   TAHGPVTVVNGVLFAGSVSANGPIYAMDTNTGKILWSYNTSSTVYGGVSASYGCIYLGNG  458

Query  197   YRVSIGAGIPIFTGGTSLFAFC  132
             Y VS+G   P +T GTSL+A+C
Sbjct  459   YTVSLGKFHPTWTPGTSLYAYC  480



>ref|XP_010652339.1| PREDICTED: uncharacterized protein LOC104879808 [Vitis vinifera]
Length=510

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/509 (59%), Positives = 379/509 (74%), Gaps = 8/509 (2%)
 Frame = -1

Query  1646  ASGNWLNHGGDIYNRRYAC--GENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFP  1473
             A   W++HGGD+ N R      E  I+P  +SKL+LKW+F+ G D +ATPA+  GVVYFP
Sbjct  4     ADAVWVSHGGDLGNTRSRSIHDEPFINPVLISKLQLKWKFFTGDDTTATPAVADGVVYFP  63

Query  1472  SWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGP  1293
             SWNGYLYAVNA +G+L+W R+L +LTGL+ T    NVT  VSR+TP++  + ++IGIYGP
Sbjct  64    SWNGYLYAVNAFNGALVWRRHLGELTGLSPTGIVVNVT--VSRTTPAVADDLIVIGIYGP  121

Query  1292  AVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGR  1113
             AVV+ V R  G L+W T+LD HP   ITMSGT Y+G FYVG SSLEE      CCTFRG 
Sbjct  122   AVVVAVNRLKGTLVWSTVLDPHPRSQITMSGTPYSGDFYVGVSSLEEALPPEQCCTFRGS  181

Query  1112  FAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKH  933
              AKLD+ TG+VLW+T+M+PDN G+ G Y+GAA+WGSSP+ID  RG VYI TGNLYSAP  
Sbjct  182   MAKLDIGTGEVLWRTYMIPDNGGQIGGYSGAALWGSSPAIDIKRGLVYIGTGNLYSAPAE  241

Query  932   VLKCQEKQNNKTTTPTTSDKCV-EPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACIN  756
             VL+CQ ++NN+ TTP+  D+CV +P  H DSILAL+L +GKI+WFR+   YDVF+ AC+ 
Sbjct  242   VLECQARRNNQ-TTPSQPDQCVDDPNVHFDSILALELHSGKIRWFRRFESYDVFYFACL-  299

Query  755   SSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYte  576
               + P CPPGPN DADFGEAPM+L++  NG+ RD+VVAVQKSG+ WALDRD+G++VW+  
Sbjct  300   VPNNPTCPPGPNLDADFGEAPMLLTIFSNGTKRDVVVAVQKSGYTWALDRDSGDIVWFNV  359

Query  575   agpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWS  396
             AGPGG  GGG WGAATD +RVYT+I NS   +F L PS   T  G WVA+DA TG+I+WS
Sbjct  360   AGPGGLEGGGVWGAATDGKRVYTNIVNSYLASFRLAPSNQTTTSGAWVALDANTGEIVWS  419

Query  395   TAVPDTGLSN-PVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNG  219
             T  P    ++ PVTVANGV+FAGSV P GP + ++A+TG I+W+Y T ATVYGG SVS G
Sbjct  420   TTNPSNETAHGPVTVANGVVFAGSVAPSGPFYGMDAETGTIIWTYNTNATVYGGASVSYG  479

Query  218   CVYVGNGYRVSIGAGIPIFTGGTSLFAFC  132
             CVY+G+GY V++    P +  GTSLFAFC
Sbjct  480   CVYLGHGYTVALAKFHPSWNRGTSLFAFC  508



>emb|CBI31999.3| unnamed protein product [Vitis vinifera]
Length=536

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/509 (59%), Positives = 379/509 (74%), Gaps = 8/509 (2%)
 Frame = -1

Query  1646  ASGNWLNHGGDIYNRRYAC--GENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFP  1473
             A   W++HGGD+ N R      E  I+P  +SKL+LKW+F+ G D +ATPA+  GVVYFP
Sbjct  30    ADAVWVSHGGDLGNTRSRSIHDEPFINPVLISKLQLKWKFFTGDDTTATPAVADGVVYFP  89

Query  1472  SWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGP  1293
             SWNGYLYAVNA +G+L+W R+L +LTGL+ T    NVT  VSR+TP++  + ++IGIYGP
Sbjct  90    SWNGYLYAVNAFNGALVWRRHLGELTGLSPTGIVVNVT--VSRTTPAVADDLIVIGIYGP  147

Query  1292  AVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGR  1113
             AVV+ V R  G L+W T+LD HP   ITMSGT Y+G FYVG SSLEE      CCTFRG 
Sbjct  148   AVVVAVNRLKGTLVWSTVLDPHPRSQITMSGTPYSGDFYVGVSSLEEALPPEQCCTFRGS  207

Query  1112  FAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKH  933
              AKLD+ TG+VLW+T+M+PDN G+ G Y+GAA+WGSSP+ID  RG VYI TGNLYSAP  
Sbjct  208   MAKLDIGTGEVLWRTYMIPDNGGQIGGYSGAALWGSSPAIDIKRGLVYIGTGNLYSAPAE  267

Query  932   VLKCQEKQNNKTTTPTTSDKCV-EPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACIN  756
             VL+CQ ++NN+ TTP+  D+CV +P  H DSILAL+L +GKI+WFR+   YDVF+ AC+ 
Sbjct  268   VLECQARRNNQ-TTPSQPDQCVDDPNVHFDSILALELHSGKIRWFRRFESYDVFYFACL-  325

Query  755   SSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYte  576
               + P CPPGPN DADFGEAPM+L++  NG+ RD+VVAVQKSG+ WALDRD+G++VW+  
Sbjct  326   VPNNPTCPPGPNLDADFGEAPMLLTIFSNGTKRDVVVAVQKSGYTWALDRDSGDIVWFNV  385

Query  575   agpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWS  396
             AGPGG  GGG WGAATD +RVYT+I NS   +F L PS   T  G WVA+DA TG+I+WS
Sbjct  386   AGPGGLEGGGVWGAATDGKRVYTNIVNSYLASFRLAPSNQTTTSGAWVALDANTGEIVWS  445

Query  395   TAVPDTGLSN-PVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNG  219
             T  P    ++ PVTVANGV+FAGSV P GP + ++A+TG I+W+Y T ATVYGG SVS G
Sbjct  446   TTNPSNETAHGPVTVANGVVFAGSVAPSGPFYGMDAETGTIIWTYNTNATVYGGASVSYG  505

Query  218   CVYVGNGYRVSIGAGIPIFTGGTSLFAFC  132
             CVY+G+GY V++    P +  GTSLFAFC
Sbjct  506   CVYLGHGYTVALAKFHPSWNRGTSLFAFC  534



>ref|XP_010652333.1| PREDICTED: uncharacterized protein LOC104879807 [Vitis vinifera]
 emb|CBI31998.3| unnamed protein product [Vitis vinifera]
Length=534

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/503 (59%), Positives = 367/503 (73%), Gaps = 6/503 (1%)
 Frame = -1

Query  1634  WLNHGGDIYNRR-YACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGY  1458
             W NHGGD+ N R  +  E  I+P  +SKL+LKW+F+ G D +ATPA+  GVVYFPSWNGY
Sbjct  34    WFNHGGDLSNSRSRSIEEPLINPLLISKLRLKWKFFTGDDTTATPAVAHGVVYFPSWNGY  93

Query  1457  LYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIG  1278
             LYAVNA  G+L+W ++L +LTGL+      NVT  VSR+TP I G  LIIGIYGPAVV+ 
Sbjct  94    LYAVNAFSGALVWRQHLGELTGLSPAGVVVNVT--VSRTTPVIAGHLLIIGIYGPAVVVA  151

Query  1277  VKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLD  1098
             + R +G L+W T+LD  P   IT SGT Y   FYVG SSLE       CCTFRG  AKLD
Sbjct  152   INRFSGALVWSTVLDTRPRSQITTSGTPYLEGFYVGVSSLEVTLPAEQCCTFRGSMAKLD  211

Query  1097  VWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQ  918
             + TG VLW+T+ +PDN GK G Y+GAAIWGSSP+ID  R  VYI TGNLY+AP  V +CQ
Sbjct  212   IQTGAVLWRTYTIPDNAGKLGGYSGAAIWGSSPAIDTKRNLVYIGTGNLYNAPTEVQQCQ  271

Query  917   EKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPN  738
               +NN+ T P+  D+C+ P+ H DSILAL+LD+GKI+WFRQ GGYDVF+  C+   + P 
Sbjct  272   ANRNNQ-TIPSQPDQCIAPDVHFDSILALELDSGKIRWFRQFGGYDVFYFVCL-VPNNPA  329

Query  737   CPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggf  558
             CP GPN DADFGEAPM+L++  NG+ RD+VVAVQKSGFAWALDRD G++VW+  AGPGG 
Sbjct  330   CPTGPNLDADFGEAPMLLTIFPNGTRRDVVVAVQKSGFAWALDRDTGDIVWFNLAGPGGL  389

Query  557   vgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDT  378
              GGG WGAATD +RVYT+I N+  + F L PS   T  G WVA+DA TG+I+WSTA P  
Sbjct  390   EGGGVWGAATDGKRVYTNIVNNAGVRFRLAPSNQTTTFGAWVALDANTGEIVWSTANPSN  449

Query  377   GLSN-PVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGN  201
               ++ PVTV NGV+FAGSV P GP +A++A+TG I+W+Y T ATVYGG SVS GCV++G+
Sbjct  450   ETAHGPVTVTNGVVFAGSVAPSGPFYAMDAETGTIIWTYNTNATVYGGASVSYGCVFLGH  509

Query  200   GYRVSIGAGIPIFTGGTSLFAFC  132
             GY VS+    P +T G S+FAFC
Sbjct  510   GYSVSLARFHPTWTRGNSVFAFC  532



>gb|EYU28719.1| hypothetical protein MIMGU_mgv1a017992mg, partial [Erythranthe 
guttata]
Length=507

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/506 (58%), Positives = 367/506 (73%), Gaps = 6/506 (1%)
 Frame = -1

Query  1634  WLNHGGDIYNRRYACGENKISPSTVSK--LKLKWEFYAGKDISATPAILKGVVYFPSWNG  1461
             W  HGGDI NRR A G   I+  +V    LK KW+F AG DI+ATP+I  GVVYFPSWNG
Sbjct  1     WFTHGGDITNRRSAVGGTTINAVSVKLGLLKQKWKFSAGFDITATPSIADGVVYFPSWNG  60

Query  1460  YLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVI  1281
              LYAV+AS+G+L+W+R+L +LTG+  T    NVT  VSR+TP + G+ LI+ IYGPA V+
Sbjct  61    NLYAVDASNGTLIWQRSLGELTGITPTRLYVNVT--VSRATPVVAGDLLIVAIYGPAYVV  118

Query  1280  GVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKL  1101
              V+RATG L+W T +D  P  ++T SGT Y   FYVG SSLE       CCTFRG   KL
Sbjct  119   AVERATGRLVWSTRVDPGPLSVVTASGTVYRRGFYVGVSSLEVSLPAGQCCTFRGSLVKL  178

Query  1100  DVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKC  921
             DV TG ++WQT+ LPDN GK G Y+GAAIWGSSPSID  RG VY+ TGNLY AP  VL+C
Sbjct  179   DVRTGAIIWQTYTLPDNGGKIGGYSGAAIWGSSPSIDTVRGRVYVGTGNLYLAPAEVLRC  238

Query  920   QEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTP  741
             Q +QNN+TT PT+ D+C   + H DS+++ D+ TGKI W RQLGGYDVF+ AC+   + P
Sbjct  239   QARQNNRTTPPTSGDQCFGLDVHFDSLMSFDIKTGKIVWARQLGGYDVFYFACL-VPNNP  297

Query  740   NCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpgg  561
             +CPPGPN DADFGEAPM+L++      RD+VVAVQKSGFAWALDRD+G++VW+T+AGPG 
Sbjct  298   DCPPGPNLDADFGEAPMLLTITSKRRLRDVVVAVQKSGFAWALDRDSGDIVWFTKAGPGS  357

Query  560   fvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPD  381
               GGG WGAATD   VYT+I N + L FTL PSK +T GGGWVAMDA TG+I W+TA P 
Sbjct  358   LEGGGVWGAATDGVHVYTNIVNGDNLPFTLKPSKRITTGGGWVAMDANTGRIRWTTANPS  417

Query  380   TGLSN-PVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVG  204
                ++ PVT+ NGVLFAGS  P GPV+A++ KTG I+WS+ +GATV+GG S S GC+Y+G
Sbjct  418   NDTAHGPVTIVNGVLFAGSTAPNGPVYAMDGKTGSIIWSFESGATVHGGASSSYGCIYIG  477

Query  203   NGYRVSIGAGIPIFTGGTSLFAFCLE  126
             +GY +      P +T G  LFAFC+ 
Sbjct  478   HGYSIGQARFHPTWTSGKYLFAFCIS  503



>emb|CDP21840.1| unnamed protein product [Coffea canephora]
Length=536

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/507 (60%), Positives = 370/507 (73%), Gaps = 5/507 (1%)
 Frame = -1

Query  1646  ASGNWLNHGGDIYNRRYAC-GENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPS  1470
             A+  WLNHGG + N R A   E  I+P +V KL+LKW F AG DISATPA+  GVVYFPS
Sbjct  30    AAAEWLNHGGALTNTRNAVVQEVLINPISVRKLRLKWRFIAGFDISATPAVASGVVYFPS  89

Query  1469  WNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPA  1290
             WNG+LYAV A +G+L+W++NL  LTGL       NVT  VSRSTP++ G+ LI G+YGPA
Sbjct  90    WNGFLYAVRADNGALIWKQNLGTLTGLPPVGAIVNVT--VSRSTPTVAGDLLICGVYGPA  147

Query  1289  VVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRF  1110
             VV+ V+R TG+L+W+T LD  P   IT SGT+Y+GA+YVG SSLEE      CCTFRG  
Sbjct  148   VVVAVRRLTGELVWLTRLDPRPLAQITASGTFYSGAYYVGVSSLEELLPAQQCCTFRGSM  207

Query  1109  AKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHV  930
              KLD  TG +LWQT+ +PDN GK G Y+GAAIWGSSP+ID  RG VY+ TGNLY AP  V
Sbjct  208   VKLDARTGTILWQTYTIPDNCGKLGGYSGAAIWGSSPAIDILRGLVYVGTGNLYIAPAEV  267

Query  929   LKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSS  750
             L CQ   NN+TT P    +C+ P+ H DSI+A D+++G+IKW R+L GYDVF   C+   
Sbjct  268   LACQRALNNQTTPPINVSQCIGPDVHFDSIVAFDINSGQIKWSRRLSGYDVFNFECL-VP  326

Query  749   STPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteag  570
             + PNCPPGPN DADFGEAPM+L++  NG  RDI VAVQKSGFAWALDR+NG++VW   AG
Sbjct  327   NNPNCPPGPNLDADFGEAPMLLTINNNGRKRDIAVAVQKSGFAWALDRNNGDIVWSIRAG  386

Query  569   pggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTA  390
             PG   GGG WGAATD +RVYT+IAN +RL FTL PS   T  GGWVA+DA TG+ILWSTA
Sbjct  387   PGSNQGGGIWGAATDGKRVYTNIANGDRLPFTLAPSTRTTTAGGWVALDANTGQILWSTA  446

Query  389   VPDTGLS-NPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCV  213
              P   +S  PVT+ NGVLFAGS  P GP +A++A TG+I+W+Y TGAT+YGG S S GCV
Sbjct  447   NPSNEISPGPVTIVNGVLFAGSTAPNGPFYAMDANTGDIVWTYNTGATIYGGASASYGCV  506

Query  212   YVGNGYRVSIGAGIPIFTGGTSLFAFC  132
             ++GNGY V +    P +T G S+FAFC
Sbjct  507   FIGNGYSVGLAKFHPTWTSGNSVFAFC  533



>ref|XP_008379826.1| PREDICTED: uncharacterized protein LOC103442802 [Malus domestica]
Length=501

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/547 (57%), Positives = 377/547 (69%), Gaps = 57/547 (10%)
 Frame = -1

Query  1760  CHTHGQPLLYYCVCIIIFLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACGEN  1581
             CH     +L + +     LI  + +A    H      PA  NWLNHGGD+ NRRYA  E 
Sbjct  8     CH---NLILVFSLYTCSLLITSTTSAGGHSHDEN---PAIQNWLNHGGDLSNRRYANREI  61

Query  1580  KISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQK  1401
             KI+  TVSKL L WEFYAG DISATP+I  G +YFPSWNG +YAV AS+GSL+W++NL +
Sbjct  62    KINRRTVSKLSLNWEFYAGDDISATPSIYDGTLYFPSWNGEIYAVQASNGSLVWKKNLHE  121

Query  1400  LTGLNATVRTGNVTAIVSRSTPSIVGET--LIIGIYGPAVVIGVKRATGDLLWMTLLDRH  1227
             LTGLNAT  +G     V+RSTP++V +   LI+GIYGPAVVI ++R+TG+L+W TLLD H
Sbjct  122   LTGLNATGFSG-FNWTVARSTPTVVDDQDLLIVGIYGPAVVIALERSTGNLIWSTLLDTH  180

Query  1226  PAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNK  1047
              AG+ITMSGTYYNG+ Y+GTSSLEE  S   CCTFRG  AKLD  +G VLW+TFMLPDN 
Sbjct  181   AAGVITMSGTYYNGSIYIGTSSLEETLSPEECCTFRGSLAKLDAKSGTVLWKTFMLPDNH  240

Query  1046  GKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCV  867
             G                                       +CQE QNN +T PT  D CV
Sbjct  241   GH--------------------------------------QCQENQNN-STLPTHPDACV  261

Query  866   EPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMM  687
             EP+N  +SILALDLD+G IKW   LGGYDV+F  C  ++ST  C  GPN DADFGEAPMM
Sbjct  262   EPDNRGNSILALDLDSGDIKWNHHLGGYDVWFXECFLNTST--CXTGPNVDADFGEAPMM  319

Query  686   LSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYT  507
             L   VNG+ RD+VVAVQKSGFAWALDR+NG ++W TEAGPGGF GGGTWGAATD ++VYT
Sbjct  320   LKTCVNGTKRDLVVAVQKSGFAWALDRNNGTLIWSTEAGPGGFAGGGTWGAATDKKKVYT  379

Query  506   SIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSN-PVTVANGVLFAG  330
             +IANS   NFTL PS N+T  GGWVA+  + GKILWSTA P    S+ PV+VANG+LFAG
Sbjct  380   NIANSESRNFTLKPSSNITTWGGWVAVAPENGKILWSTANPSNSTSSGPVSVANGILFAG  439

Query  329   SVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGT  150
             S +PRG ++A+N + G+ LWSY TGA+V+GGMS+S+GC+YVG+GY          +T GT
Sbjct  440   STNPRGSIYAMNTENGKFLWSYDTGASVFGGMSISDGCIYVGSGYNKH------QYTAGT  493

Query  149   SLFAFCL  129
             SLFAFC+
Sbjct  494   SLFAFCV  500



>ref|XP_010683398.1| PREDICTED: uncharacterized protein LOC104898088 [Beta vulgaris 
subsp. vulgaris]
Length=503

 Score =   521 bits (1341),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 286/504 (57%), Positives = 356/504 (71%), Gaps = 6/504 (1%)
 Frame = -1

Query  1634  WLNHGGDIYNRR-YACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGY  1458
             W NHGG++ N R    GE  I+ + + +L L+W+++ G DI+ATPAI  GVVYFP+W+G 
Sbjct  3     WFNHGGNLANTRARPFGEPFINRNYIQRLHLRWKYFVGNDITATPAISNGVVYFPAWDGN  62

Query  1457  LYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIG  1278
             LYAVNA  G L+W+ NL +LTGL       NVT  V+R+TP++  + LIIGIYGPAVV+ 
Sbjct  63    LYAVNAFTGDLIWKVNLGQLTGLAPVGTYVNVT--VARATPTVTHDMLIIGIYGPAVVVA  120

Query  1277  VKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLD  1098
             + R +  L+WMT LD +P  LITMSGT Y   FYVG SSLEE      CC FRG  AKLD
Sbjct  121   INRFSPRLVWMTRLDPNPLALITMSGTAYLDGFYVGVSSLEELLPPTECCIFRGSMAKLD  180

Query  1097  VWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQ  918
             + TG ++WQT+ LPDN GK G Y+GAAIWGSSP+ID  R  VY+ +GN+Y AP  VL+CQ
Sbjct  181   IQTGAIIWQTYTLPDNGGKLGGYSGAAIWGSSPAIDIIRNRVYVGSGNIYIAPPDVLECQ  240

Query  917   EKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPN  738
              KQNN++   T  D+C  P+ H DSILA+D+++G I W  QLGGYDVF+ AC+  ++  N
Sbjct  241   AKQNNQSRA-TQPDQCTSPDAHFDSILAIDMNSGSIIWALQLGGYDVFYFACLEPNNP-N  298

Query  737   CPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggf  558
             CPPGPN DADFGEAPM+L++   G  RDIV AVQKSG+ WALDRD G++VW+  AGPGG 
Sbjct  299   CPPGPNLDADFGEAPMLLTIFAGGIRRDIVAAVQKSGYVWALDRDTGDIVWFNVAGPGGL  358

Query  557   vgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVP-D  381
              GGG WGAATD  R+YT+I NS R  F L PS   T GGGWVA+DA TG ILW+T  P +
Sbjct  359   EGGGVWGAATDGRRIYTNIVNSGRTKFRLAPSNETTTGGGWVALDANTGNILWTTDNPSN  418

Query  380   TGLSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGN  201
              G   PVT+ N VLFAGSV P GP +A++A+ G ILWS  T AT+YGG SVS GCVYVG+
Sbjct  419   EGAHGPVTLVNDVLFAGSVDPSGPFYAMDAENGRILWSLNTAATIYGGASVSYGCVYVGH  478

Query  200   GYRVSIGAGIPIFTGGTSLFAFCL  129
             GY V +    P +  G SLFAFC+
Sbjct  479   GYSVGLAEFHPTWNRGNSLFAFCI  502



>ref|XP_008390061.1| PREDICTED: uncharacterized protein LOC103452339 [Malus domestica]
Length=612

 Score =   514 bits (1324),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 270/460 (59%), Positives = 331/460 (72%), Gaps = 17/460 (4%)
 Frame = -1

Query  1733  YYCVCIIIFLICISATAKPEWHITRFSCPASGN--WLNHGGDIYNRRYACGENKISPSTV  1560
             +Y + ++I L+C+            F+   + N  WLNHGGDI NRR + GE  I+P TV
Sbjct  7     HYTMKMLIMLLCL------------FTVLDTTNAIWLNHGGDIGNRRNSVGEVLINPRTV  54

Query  1559  SKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNAT  1380
               + L+W F+AG+DISATPA+  G VYFPSWNG ++AV+A  G L+W+RNL +LTGLN T
Sbjct  55    QNMSLRWSFFAGRDISATPALADGRVYFPSWNGNVHAVDAFTGRLIWQRNLGELTGLNGT  114

Query  1379  VRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSG  1200
                 NV A VSR+TPSI G  LI+GIYGPAVVI + R+ G L+W T LD  P  LITMSG
Sbjct  115   GIVSNVNATVSRATPSIAGNLLIVGIYGPAVVIALDRSNGRLVWSTELDPRPRVLITMSG  174

Query  1199  TYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGA  1020
             T + GAFYVG SSL+E    A CC FRG  AKL + TG VLW+T+MLPDN G  G Y+GA
Sbjct  175   TVHLGAFYVGVSSLQEALPAAQCCNFRGSLAKLSLRTGSVLWRTYMLPDNGGSLGGYSGA  234

Query  1019  AIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSI  840
             AIWGSSP+ID  R HVY+ATGNLY+AP  V +CQE+QNN+T  PT  D+C  P+ + +SI
Sbjct  235   AIWGSSPAIDISRRHVYVATGNLYTAPPEVTECQERQNNQTGRPTQPDQCFGPDINFNSI  294

Query  839   LALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGST  660
             LALDLD+G+I W RQLGGYD+F+ AC+   + P+CPPGPN DADFGEAPM+L++  NG+ 
Sbjct  295   LALDLDSGRIVWSRQLGGYDIFYFACL-VPNNPDCPPGPNVDADFGEAPMLLTIRPNGTR  353

Query  659   R--DIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNR  486
             R  D+VVAVQKSGFAWAL+RDNG +VW+  AGPGG  GGG WGAATD  RVYT+IAN +R
Sbjct  354   RALDVVVAVQKSGFAWALNRDNGSIVWFKLAGPGGNEGGGIWGAATDGRRVYTNIANGDR  413

Query  485   LNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSN  366
              NFTL PS   T  G WVA+DA TG ILW+TA P    S 
Sbjct  414   QNFTLAPSTQTTTAGVWVALDADTGNILWTTANPSNDTSQ  453


 Score =   104 bits (259),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = -1

Query  365  PVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVS  186
            PVTVANGV+FAGSV   GPV+ ++A TG+ILW+Y TGAT+YGG+S S GC+YVG+GY V 
Sbjct  533  PVTVANGVVFAGSVASNGPVYGMDASTGKILWTYNTGATIYGGISASYGCIYVGSGYSVG  592

Query  185  IGAGIPIFTGGTSLFAFCL  129
            + +  P +T GT LFAFC+
Sbjct  593  LASFHPSWTAGTKLFAFCV  611



>gb|KDO72515.1| hypothetical protein CISIN_1g040693mg, partial [Citrus sinensis]
Length=382

 Score =   505 bits (1301),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 261/384 (68%), Positives = 303/384 (79%), Gaps = 4/384 (1%)
 Frame = -1

Query  1277  VKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLD  1098
             VKR+ G L+W T LD H    ITMSGTYY GA+YVGTSS+EEG +   CCTF+G  AKLD
Sbjct  2     VKRSNGKLVWKTKLDDHARSFITMSGTYYKGAYYVGTSSIEEGLTFELCCTFQGSLAKLD  61

Query  1097  VWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQ  918
               TG++LWQTFMLPDN GK  EYAGAAIWGSSPSID  R HVYIATGNLYS P H+ +CQ
Sbjct  62    AKTGRILWQTFMLPDNFGKLNEYAGAAIWGSSPSIDPIRNHVYIATGNLYSVPLHIRQCQ  121

Query  917   EKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPN  738
             E+ N   TTPT+ DKC+EPENHS+S+LALDLDTGKI W++QLGGYDV+F AC N    PN
Sbjct  122   EENNQ--TTPTSPDKCIEPENHSNSLLALDLDTGKIVWYKQLGGYDVWFGAC-NWYLNPN  178

Query  737   CPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggf  558
             CPPGP+PDADFGEAPMMLS+  N    DIVVAVQKSGFAWALDRD+G ++W  EAGPGG 
Sbjct  179   CPPGPSPDADFGEAPMMLSMYRNKVKHDIVVAVQKSGFAWALDRDSGSLIWSMEAGPGGL  238

Query  557   vgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDT  378
              GG  WGAATD  R+YT+IANS   NF L PSKN TI GGWVAMDA  G +LWSTA P  
Sbjct  239   GGGAMWGAATDERRIYTNIANSQHKNFNLKPSKNSTIAGGWVAMDASNGNVLWSTADPSN  298

Query  377   GLS-NPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGN  201
             G +  PVTVANGVLF GS + +GP++A++ KTG+ILWSY TGAT+YGG SVSNGC+Y+GN
Sbjct  299   GTAPGPVTVANGVLFGGSTYRQGPIYAMDVKTGKILWSYDTGATIYGGASVSNGCIYMGN  358

Query  200   GYRVSIGAGIPIFTGGTSLFAFCL  129
             GY+V++G G   FT GTSL+AFC+
Sbjct  359   GYKVTVGFGNKNFTSGTSLYAFCV  382



>emb|CAN66558.1| hypothetical protein VITISV_001825 [Vitis vinifera]
Length=510

 Score =   496 bits (1276),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 269/511 (53%), Positives = 337/511 (66%), Gaps = 46/511 (9%)
 Frame = -1

Query  1634  WLNHGGDIYNRR-YACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGY  1458
             W NHGGD+ N R  +  E  I+P  +SKL+LKW+F+ G D +ATPA+  GVVYFPSWNGY
Sbjct  34    WFNHGGDLSNSRSRSIEEPLINPLLISKLRLKWKFFTGDDTTATPAVAHGVVYFPSWNGY  93

Query  1457  LYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIG  1278
             LYAVNA  G+L+W ++L +LTGL+      NVT  VSR+TP I G  LIIGIYGPAVV+ 
Sbjct  94    LYAVNAFSGALVWRQHLGELTGLSPAGVVVNVT--VSRTTPVIAGHLLIIGIYGPAVVVA  151

Query  1277  VKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLD  1098
             + R +G L+W T+LD  P   IT SGT Y   FYVG SSLE       CCTFRG  AKLD
Sbjct  152   INRFSGALVWSTVLDTRPRSQITTSGTPYLXGFYVGVSSLEVTLPAEQCCTFRGSMAKLD  211

Query  1097  VWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQ  918
             + TG VLW+T+ +PDN GK G                                  V +CQ
Sbjct  212   IQTGAVLWRTYTIPDNAGKLG--------------------------------AEVQQCQ  239

Query  917   EKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPN  738
               +NN+T  P+  D+C+ P+ H DSILAL+LD+GKI+WFRQ GGYDVF+  C+   + P 
Sbjct  240   ANRNNQTI-PSQPDQCIAPDVHFDSILALELDSGKIRWFRQFGGYDVFYFVCL-VPNNPA  297

Query  737   CPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpg--  564
             CP GPN DADFGEAPM+L++  NG+ RD+VVAVQKSGFAWALDRD G++VW+  +     
Sbjct  298   CPTGPNLDADFGEAPMLLTIFPNGTRRDVVVAVQKSGFAWALDRDTGDIVWFNVSISENI  357

Query  563   ------gfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKIL  402
                   G  GGG WGAATD +RVYT+I N+  + F L PS   T  G WVA+DA TG+I+
Sbjct  358   LLAGLGGLEGGGVWGAATDGKRVYTNIVNNAGVRFRLAPSNQTTAFGAWVALDANTGEIV  417

Query  401   WSTAVPDTGLSN-PVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVS  225
             WSTA P    ++ PVTV NGV+FAGSV P GP +A++A+TG I+W+Y T ATVYGG SVS
Sbjct  418   WSTANPSNETAHGPVTVTNGVVFAGSVAPSGPFYAMDAETGTIIWTYNTNATVYGGASVS  477

Query  224   NGCVYVGNGYRVSIGAGIPIFTGGTSLFAFC  132
              GCV +G+GY VS+    P +T G S+FAFC
Sbjct  478   YGCVXLGHGYSVSLARFHPTWTRGNSVFAFC  508



>ref|XP_006602901.1| PREDICTED: uncharacterized protein LOC102668917 isoform X2 [Glycine 
max]
Length=483

 Score =   481 bits (1237),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 231/395 (58%), Positives = 292/395 (74%), Gaps = 13/395 (3%)
 Frame = -1

Query  1757  HTHGQPLLYYCVCIIIFLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACGENK  1578
             H   + LL+Y V  ++ +   ++               S +WLNHGGD++NRRYA  E K
Sbjct  9     HLDLRLLLFYVVHAVVMVFAANSDGPRH---------QSQDWLNHGGDLFNRRYAYKERK  59

Query  1577  ISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKL  1398
             ISP T   L+LKW+FYAG+DI+ATPAI  G +YFPSWNG +YAV  +DGSL+W+++LQKL
Sbjct  60    ISPKTAPNLRLKWKFYAGRDITATPAIYDGTLYFPSWNGNIYAVKEADGSLVWKQSLQKL  119

Query  1397  TGLNATV-RTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPA  1221
             TGL A      NV + VSRSTP++ G+ LIIG+YGPA VI +KR TG+L+W T+LD HPA
Sbjct  120   TGLKAPDGLVENVNSTVSRSTPTVAGDLLIIGVYGPAAVIALKRKTGELVWKTILDYHPA  179

Query  1220  GLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGK  1041
              LITMSGTYYN  +YVGTSSLE       CCTFRG F KL+  +G + W+T+ LPDNK  
Sbjct  180   ALITMSGTYYNRGYYVGTSSLESLVPLEKCCTFRGSFVKLNPRSGAIYWRTYTLPDNKNT  239

Query  1040  RGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEP  861
             +GEYAGAAIWGSSPSID  R  VYI TGNLYSAP  + +C+E+Q N+ T PT  D+CVEP
Sbjct  240   KGEYAGAAIWGSSPSIDVERNLVYIGTGNLYSAPLRIQQCRERQLNQ-TQPTQQDECVEP  298

Query  860   ENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSS-TPNCPP-GPNPDADFGEAPMM  687
             +NHS+SILALDLD+GKI W+RQ GGYDV  + C ++S+ +P+CPP G  PD DFGEAPMM
Sbjct  299   DNHSNSILALDLDSGKIIWYRQFGGYDVSILPCSDTSTPSPDCPPLGDKPDIDFGEAPMM  358

Query  686   LSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWY  582
             L++ +N + +DIVVAVQKSGFAWALDR+NG ++WY
Sbjct  359   LTIYINRTKKDIVVAVQKSGFAWALDRNNGNLIWY  393



>gb|KDP21213.1| hypothetical protein JCGZ_21684 [Jatropha curcas]
Length=396

 Score =   469 bits (1206),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 230/354 (65%), Positives = 267/354 (75%), Gaps = 3/354 (1%)
 Frame = -1

Query  1646  ASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSW  1467
             A  +WLNHG  I N R A GE KI  STV  L+LKWEF AGKDISATPAI  GVVYFPSW
Sbjct  32    ALASWLNHGAGIKNTRNAIGEEKIKSSTVKNLRLKWEFIAGKDISATPAIADGVVYFPSW  91

Query  1466  NGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAV  1287
             NGYLYAV+A +G L+W++NL +LT LN T  T NVT  VSR+TP+I    LI+GIYGPAV
Sbjct  92    NGYLYAVDAFNGGLIWKQNLSQLTRLNGTGITVNVT--VSRATPTIANNQLIVGIYGPAV  149

Query  1286  VIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFA  1107
             VI V R  G L+W T LD  P  +IT SGT+Y GAFYVG SSL+EG     CCTFRG  A
Sbjct  150   VIAVDRLNGRLVWFTELDSRPRAIITQSGTFYRGAFYVGVSSLKEGLPANQCCTFRGSLA  209

Query  1106  KLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVL  927
             +LDV TGK+ W+T+M+PDN  K G Y+GAAIWGSSPSID  R  VY+ATGNLY  P  V 
Sbjct  210   ELDVLTGKIKWRTYMVPDNGSKLGGYSGAAIWGSSPSIDTDRRLVYVATGNLYRVPSAVT  269

Query  926   KCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSS  747
             KCQE QNN+TT PT  DKCV  + H DSILAL +DTG+I W RQLGGYDVF+ AC+   +
Sbjct  270   KCQEAQNNQTTKPTQPDKCVGSDVHFDSILALKIDTGEIAWARQLGGYDVFYFACL-LPN  328

Query  746   TPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVW  585
              P+CPPGPN DADFGEAP++LS+V N + RDIVVAVQKSGFAW+LDRD G++VW
Sbjct  329   NPDCPPGPNLDADFGEAPIILSIVANSTKRDIVVAVQKSGFAWSLDRDTGDVVW  382



>ref|XP_007099711.1| Quinohemoprotein ethanol dehydrogenase type-1 [Theobroma cacao]
 gb|EOY20326.1| Quinohemoprotein ethanol dehydrogenase type-1 [Theobroma cacao]
Length=770

 Score =   482 bits (1240),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 249/352 (71%), Positives = 289/352 (82%), Gaps = 3/352 (1%)
 Frame = -1

Query  1181  FYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSS  1002
             FYVGTSS EE  S   CCTFRG FAKLD  +G+VLWQTF LP+N G++GEYAG AIWGSS
Sbjct  420   FYVGTSSQEESLSIEQCCTFRGSFAKLDALSGRVLWQTFTLPENFGQKGEYAGGAIWGSS  479

Query  1001  PSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLD  822
             PSID  R  VYI TGNLYSAP  + +CQE +NN+ T PT+ DKC+EPENHS+SILALDLD
Sbjct  480   PSIDITRNLVYIGTGNLYSAPLRIRQCQEAENNQ-TVPTSPDKCIEPENHSNSILALDLD  538

Query  821   TGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVA  642
             TG IKW+RQLGGYDV+F AC N+ STPNCPPGPNPDADF EAPMMLS+ VNG+ +DI+VA
Sbjct  539   TGTIKWYRQLGGYDVWFFAC-NNLSTPNCPPGPNPDADFAEAPMMLSINVNGTKQDIIVA  597

Query  641   VQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPS  462
             VQKSGFAWAL+RDNG  +W TEAGPGG  GGGTWGAATD +++YT+IANS   NFTL PS
Sbjct  598   VQKSGFAWALNRDNGSPIWSTEAGPGGSAGGGTWGAATDKKKIYTNIANSQFKNFTLRPS  657

Query  461   KNVTIGGGWVAMDAQTGKILWSTAVPDTGL-SNPVTVANGVLFAGSVHPRGPVFAINAKT  285
                T  GGWVAMDA  G+ILWSTA P     S PVT+ANGVLF+GS + +GP++AI+A+ 
Sbjct  658   TTNTTAGGWVAMDADNGEILWSTADPSNATASGPVTIANGVLFSGSTYKQGPIYAIDAEN  717

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             G+ILWSY TGATVYGGMSVSNGC+YVG+GY+VS GA IP F+ GTSLFAFC+
Sbjct  718   GKILWSYDTGATVYGGMSVSNGCIYVGSGYKVSFGAVIPSFSAGTSLFAFCM  769


 Score =   219 bits (558),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 136/194 (70%), Gaps = 4/194 (2%)
 Frame = -1

Query  1766  AHCHTHGQPLLYYCVCIIIFLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACG  1587
             AH + H   L++    +  F       A+  W+       +S NWLNHGGD+YNRRYA  
Sbjct  15    AHVYHHNVLLMF----LFSFPFLNRTFAQFGWNSVIKEQKSSQNWLNHGGDLYNRRYAEK  70

Query  1586  ENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNL  1407
             E +ISP TVS+L+LKWEFYAGKDI+ATPAI  G++YFPSWNG +YAV A+DGSL+WE+NL
Sbjct  71    ETRISPETVSRLRLKWEFYAGKDITATPAIFNGILYFPSWNGNIYAVEAADGSLVWEKNL  130

Query  1406  QKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTLLDRH  1227
              +LTGL  T    NV   V+R+TP+I  + LIIGI GPA+VI V+R TG+L+W T LD H
Sbjct  131   HELTGLTGTGFLINVNWTVARATPTIADDLLIIGISGPAIVIAVERLTGELVWSTQLDNH  190

Query  1226  PAGLITMSGTYYNG  1185
               G+ITMSGTYY G
Sbjct  191   ATGVITMSGTYYKG  204



>gb|EPS61948.1| hypothetical protein M569_12846, partial [Genlisea aurea]
Length=491

 Score =   466 bits (1198),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 262/508 (52%), Positives = 340/508 (67%), Gaps = 23/508 (5%)
 Frame = -1

Query  1634  WLNHGGDIYNRRYACGENKISPST-VSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGY  1458
             W NHG D+ N R A G    S S     LKLKW+F AG D+SATPAI  GV+YFP WNG 
Sbjct  1     WYNHGADLNNSRSATGGTINSTSVGFGSLKLKWKFQAGLDVSATPAIYNGVIYFPCWNGN  60

Query  1457  LYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGE---TLIIGIYGPAV  1287
             +YAVNA  G+L+W +++  LTG+ +     +VT  V+R+TP++V +    L+ GIYGPAV
Sbjct  61    IYAVNAITGTLVWMKSVGALTGVPSPNILTSVT--VARATPTVVTDGYNLLVWGIYGPAV  118

Query  1286  VIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFA  1107
                V   TG L WMT LD     ++T SGTYY+GA+YVG SSL+E   ++ CCTFRG   
Sbjct  119   AFAVSITTGKLAWMTALDPSNYSVVTASGTYYSGAYYVGLSSLDEMLPESMCCTFRGSMV  178

Query  1106  KLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVL  927
             K++V TGK+ WQT+ LPDN G  G YAGAAIWGSSP ID +RG +Y ATGNLYSAP  V+
Sbjct  179   KMNVRTGKIQWQTYTLPDNGGNMGGYAGAAIWGSSPPIDINRGVIYAATGNLYSAPASVV  238

Query  926   KCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSS  747
              C E Q ++    T  D CV    + +S +A D+ +G + W  ++GGYD           
Sbjct  239   NC-EVQTSQAQNATNPDSCVPSNIYFNSFIAFDMTSGGVIWGTRMGGYD-----------  286

Query  746   TPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagp  567
                 P  P+PDADFGEAPM+++  VNGS  D+VVAVQKSG+A+AL+R+NG +VW T AGP
Sbjct  287   ---GPGLPSPDADFGEAPMLITAAVNGSQVDMVVAVQKSGYAYALNRNNGAIVWSTLAGP  343

Query  566   ggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAV  387
             G   GGG WGAATD +RVYT+I+N+ +  F L PS   T  GGWVA+D  TG ILW+TA 
Sbjct  344   GSAQGGGIWGAATDGKRVYTNISNAWKKTFVLAPSNQTTTAGGWVALDPPTGNILWTTAN  403

Query  386   PDTGLSN-PVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVY  210
             P + L++ PVTV N V+ AGSV P GPV+ +NA TG+++WS +T ATVYGG S S GC+Y
Sbjct  404   PSSNLADGPVTVVNDVVIAGSVDPTGPVYGMNAATGKVIWSSFTNATVYGGASSSYGCIY  463

Query  209   VGNGYRVSIGAGI-PIFTGGTSLFAFCL  129
             +GNGYRV   +   P +TGG  ++ +C+
Sbjct  464   IGNGYRVGPTSQFHPAWTGGKYVYCYCI  491



>ref|XP_001757145.1| predicted protein [Physcomitrella patens]
 gb|EDQ78004.1| predicted protein [Physcomitrella patens]
Length=616

 Score =   467 bits (1201),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 270/555 (49%), Positives = 349/555 (63%), Gaps = 31/555 (6%)
 Frame = -1

Query  1736  LYYCVCIIIFLICISATAKPEWHITRFSCPASGNWLNHGGD-IYNRRYACGENKISPSTV  1560
             L+    ++  +  ++AT  P             +W +HGG  I N R A  E KI P +V
Sbjct  71    LWRTFLLVCLVAAVTATKGPSQQ--------DRDWPSHGGPGIINWRNAFRERKIDPDSV  122

Query  1559  SKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNAT  1380
                 LKWEF  G D++ATP++ +G+VYFPSWNG L+AV A  G L+WE+NL +LT     
Sbjct  123   QSYDLKWEFITGGDVTATPSVSRGLVYFPSWNGKLFAVRARTGKLVWEQNLTQLTAGIPD  182

Query  1379  VRTGNVTA------IVSRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAG  1218
             +   N         I+SRSTP IVG  LI+G+  P  VI VKR+TG  +W T+LD HP  
Sbjct  183   IEGKNFVTKLFGYPILSRSTPVIVGNLLIVGLSSPGAVIAVKRSTGHHVWSTVLDSHPYA  242

Query  1217  LITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKR  1038
             LITMSGT + GA+Y+GTSSLEE   +  CCTF+GRF KLD+ TGK+LW   M PDN GK 
Sbjct  243   LITMSGTVFEGAYYIGTSSLEEVRQEG-CCTFQGRFFKLDLATGKILWSVRMQPDNGGKP  301

Query  1037  GEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPE  858
             G Y+G AIW S P ID  R  VYIATGN YSAP  V +C+ +     T PT  D CV   
Sbjct  302   GLYSGNAIWASGPPIDTTRRLVYIATGNSYSAPPDVEECRTQNPANVTNPTLEDPCVAEG  361

Query  857   NHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSV  678
             ++  SI+A+++DTGK+ W R LGG DVF +AC+ + +  NCP  P PD DFGE+PM+L++
Sbjct  362   DYVTSIVAINIDTGKVSWARNLGGSDVFVLACLANPTGGNCPESPGPDYDFGESPMLLTI  421

Query  677   VVN-GSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSI  501
                 G +RD+ +  QKSGF WALDR  G++VW T AGPGG +GG +WG ATD +RV+T I
Sbjct  422   KPKGGESRDVAIVGQKSGFVWALDRSTGDLVWVTAAGPGGVLGGSSWGMATDGKRVFTHI  481

Query  500   ANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSN-PVTVANGVLFAGS-  327
              N+ R  F LLPS  V   GGWVAMDA TG+ILWSTA PD   +N P++ ANGVLF GS 
Sbjct  482   INNERAEFKLLPSTEVVRRGGWVAMDAATGQILWSTANPDNFTTNPPMSHANGVLFGGSN  541

Query  326   -----VHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSI----GAG  174
                  ++P G V A++AKTG++LW++ T   + GG+SV  G  +VG G  V      GAG
Sbjct  542   GNIETLNP-GKVVALDAKTGKVLWTHPTPGPLAGGVSVVKGMAFVGVGTNVVFPRLTGAG  600

Query  173   IPIFTGGTSLFAFCL  129
                +  G S+ AF L
Sbjct  601   TSYY--GKSVLAFSL  613



>gb|KDO82850.1| hypothetical protein CISIN_1g039692mg, partial [Citrus sinensis]
Length=417

 Score =   450 bits (1157),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 257/502 (51%), Positives = 322/502 (64%), Gaps = 88/502 (18%)
 Frame = -1

Query  1634  WLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYL  1455
             WLNHGGD+ NRRYA GE  I+P TV  L+L+W FYAGKDISATPA+  GVVYFPSWNGYL
Sbjct  1     WLNHGGDLNNRRYAYGEVLINPVTVRNLRLRWSFYAGKDISATPAVANGVVYFPSWNGYL  60

Query  1454  YAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGV  1275
             YAVNA +G+L+WE+NL KLTGL+ T                      I+     AVV+ V
Sbjct  61    YAVNAFNGALIWEQNLSKLTGLSGTG---------------------IVVNVTVAVVVAV  99

Query  1274  KRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDV  1095
              R+ G+L+W T +D  P   ITMSG+ Y GAFYVG SSLEE      CCTFRG  AKLDV
Sbjct  100   SRSNGELVWSTQIDPRPRSQITMSGSVYMGAFYVGLSSLEEALPADQCCTFRGSLAKLDV  159

Query  1094  WTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQE  915
               G+++WQT+MLPDN GKRG Y+GAA+WGSSP+ID  R                    ++
Sbjct  160   RNGRIIWQTYMLPDNGGKRGGYSGAAVWGSSPAIDVIR--------------------RQ  199

Query  914   KQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNC  735
             KQNN+TT PT  D+C+  + +++SI+ALD+D+G+I W + LGGYD+F+  C+   + P+C
Sbjct  200   KQNNQTTKPTHPDQCISSDIYANSIVALDIDSGRIAWAKPLGGYDIFYFTCL-VPNNPDC  258

Query  734   PPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfv  555
             PPGPN DADFGEAPM+L++  NG  RD+VVAVQKSGFAWA DRD+G+++W+  AGPGG  
Sbjct  259   PPGPNLDADFGEAPMLLTISTNGRFRDVVVAVQKSGFAWAFDRDSGDIIWFKLAGPGGRE  318

Query  554   gggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTG  375
             GGG WGAATD  RVYT+I N++R                          I+WSTA P   
Sbjct  319   GGGVWGAATDGRRVYTNIVNNDR--------------------------IIWSTADPSNE  352

Query  374   LSN-PVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNG  198
              ++ PVTV NGVLFAGSV                      G+TVYGG+  S GC+Y+GNG
Sbjct  353   TAHGPVTVVNGVLFAGSVSA-------------------NGSTVYGGVPASYGCIYLGNG  393

Query  197   YRVSIGAGIPIFTGGTSLFAFC  132
             Y VS+G   P +T GTSL+AFC
Sbjct  394   YTVSLGKFHPTWTPGTSLYAFC  415



>ref|XP_004167481.1| PREDICTED: polyvinylalcohol dehydrogenase-like [Cucumis sativus]
Length=362

 Score =   440 bits (1132),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 232/359 (65%), Positives = 279/359 (78%), Gaps = 9/359 (3%)
 Frame = -1

Query  1184  AFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGS  1005
             +F++GTSSLEEG     CCTFRG F+KLD  TG +LWQTFMLPDN G   +Y+GAAIWGS
Sbjct  6     SFFIGTSSLEEGLPVDQCCTFRGSFSKLDAKTGAILWQTFMLPDNHGDTEQYSGAAIWGS  65

Query  1004  SPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDL  825
             SPSID  R  VYIATGNLYSAP  + +CQE+QNN+ T PT  DKC+EPENHS+SILALDL
Sbjct  66    SPSIDPLRNLVYIATGNLYSAPLRIRECQERQNNQ-TEPTLPDKCIEPENHSNSILALDL  124

Query  824   DTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVV  645
             D+G IKW++QLGGYDV+F AC N    P CPPGP+ D+DFGE+PMMLSV V    RDIVV
Sbjct  125   DSGDIKWYKQLGGYDVWFGAC-NWHLDPRCPPGPSSDSDFGESPMMLSVFVRNMKRDIVV  183

Query  644   AVQKSGFAWALDRDNGEMVWYtea------gpggfvgggtwgaaTDNERVYTSIANSNRL  483
             AVQKSGFAWALDRDNG +VW  E+      GPGG  GGG WGAATD +RVYT+IANS   
Sbjct  184   AVQKSGFAWALDRDNGNLVWSKESFIPLEAGPGGLGGGGMWGAATDEKRVYTNIANSQHK  243

Query  482   NFTLLPSKNVTIGGGWVAMDAQTGKILWSTA-VPDTGLSNPVTVANGVLFAGSVHPRGPV  306
             NFTL P+   TI GGWVAM+A+TG I+WSTA + +     PVT+ANGV+FAGS + +GP+
Sbjct  244   NFTLKPTNKTTIAGGWVAMEAKTGDIIWSTANLKEATAPGPVTIANGVVFAGSTYRQGPI  303

Query  305   FAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             +A++AKTG+I+WSY TG +VYGG+SVS GC+YVGNGY+  IG     +T GTSL+AFC+
Sbjct  304   YAMDAKTGKIVWSYETGGSVYGGISVSKGCIYVGNGYKEHIGFVNKNYTAGTSLYAFCV  362



>ref|XP_002960975.1| hypothetical protein SELMODRAFT_437427 [Selaginella moellendorffii]
 gb|EFJ38514.1| hypothetical protein SELMODRAFT_437427 [Selaginella moellendorffii]
Length=504

 Score =   437 bits (1125),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 248/508 (49%), Positives = 326/508 (64%), Gaps = 29/508 (6%)
 Frame = -1

Query  1643  SGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWN  1464
              G+W NHGGDI NRR+   E+KISP     L  KW F  G  +SATPAI KGV+Y P+W+
Sbjct  22    QGDWTNHGGDITNRRFQEKEHKISPQNAHTLAQKWRFVTGPFVSATPAIYKGVIYVPTWS  81

Query  1463  GYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVV  1284
             G ++AV+   GSL+W  NL ++TGL         + ++SR++P++  E +I+G+ GPA V
Sbjct  82    GLVFAVSMQ-GSLVWRVNLTQITGL---------SGVISRTSPAVTKELVILGLLGPAKV  131

Query  1283  IGVKRATGDLLWMTL-LDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFA  1107
             + ++R TG L+W++  L+  P   ITMSGT    AFYVG SS +E  +   CCTF+G F 
Sbjct  132   VALERETGKLVWISQELEETPLAKITMSGTANKDAFYVGISSDQE-VNDTICCTFQGSFQ  190

Query  1106  KLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVL  927
             KL + TG  +W+T MLPDN G+ G Y+GAAIWGSSPSID  RG VYIATGNLY+ P  V 
Sbjct  191   KLSLKTGARIWKTGMLPDNHGQNGLYSGAAIWGSSPSIDEERGLVYIATGNLYTVPASVQ  250

Query  926   KCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSS  747
              C +  N     P+ +  C       D+++ALD +TG I+W  +LGG DVF   C + ++
Sbjct  251   ACLDA-NRTGCFPSNATLC------DDAVVALDTETGAIRWCNRLGGDDVFSFICRDRAN  303

Query  746   -TPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteag  570
               PNCP  P PD DFGE+PM++++      RD+VV  QKSG  WA DR  GE+VW T AG
Sbjct  304   PLPNCPSQPGPDYDFGESPMLVTIRHRNRWRDVVVTGQKSGIVWAHDRSTGELVWETLAG  363

Query  569   pggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTA  390
             PG   GG  WGAA DN R+YT+I N + LNFTL+PS NVT GGGWVAMDA TG I WSTA
Sbjct  364   PGSKSGGAIWGAAADNTRIYTNIVNRDGLNFTLIPSSNVTRGGGWVAMDANTGVIRWSTA  423

Query  389   VPDTGLS-NPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCV  213
              P   L+   V +AN VLF GS    G ++A++A+ G I+W   T A   GG SV++GC 
Sbjct  424   NPTGALAYGAVAIANDVLFVGSFEDAGYIYALDARNGSIVWRGMTNAKQGGGFSVADGCA  483

Query  212   YVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             +VG+GY       +P  T G S++AFC+
Sbjct  484   FVGSGY-------MPPTT-GDSIYAFCV  503



>ref|XP_002967034.1| hypothetical protein SELMODRAFT_408373 [Selaginella moellendorffii]
 gb|EFJ31633.1| hypothetical protein SELMODRAFT_408373 [Selaginella moellendorffii]
Length=503

 Score =   436 bits (1122),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 247/508 (49%), Positives = 325/508 (64%), Gaps = 29/508 (6%)
 Frame = -1

Query  1643  SGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWN  1464
              G+W NHGGDI NRR+   E+KISP     L  KW F  G  +SATPAI KGVVY P+W+
Sbjct  21    QGDWTNHGGDITNRRFQEKEHKISPQNAHTLAQKWRFVTGPFVSATPAIYKGVVYVPTWS  80

Query  1463  GYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVV  1284
             G ++AV+   GSL+W  NL ++TGL         + ++SR++P++  E +IIG+ GPA V
Sbjct  81    GLVFAVSMQ-GSLVWRVNLTQITGL---------SGVISRTSPALTKELVIIGLLGPAKV  130

Query  1283  IGVKRATGDLLWMTL-LDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFA  1107
             + +KR TG L+W++  L+  P   ITMSGT +  AFYVG SS +E  +   CCTF+G F 
Sbjct  131   VALKRETGKLVWISQELEETPLAKITMSGTAHKDAFYVGISSDQE-VNDTICCTFQGSFQ  189

Query  1106  KLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVL  927
             KL + TG  +W+T MLPDN G+   Y+GAAIWGSSPSID  RG VYIATGNLY+ P  + 
Sbjct  190   KLSLTTGSRIWKTGMLPDNHGQNELYSGAAIWGSSPSIDEKRGLVYIATGNLYTVPASIQ  249

Query  926   KCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSS  747
              C +  N     P+ +  C       D+++ALD +TG I+W  +LGG DVF   C +  +
Sbjct  250   ACLDA-NRTGCFPSNATLC------DDAVVALDTETGAIRWCNRLGGGDVFSFICRDREN  302

Query  746   -TPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteag  570
               P CP  P PD DFGE+PM++++      RD+VV  QKSG  WA DR  GE+VW T AG
Sbjct  303   PLPKCPSQPGPDYDFGESPMLVTIRHRNRWRDVVVTGQKSGIVWAHDRSTGELVWETLAG  362

Query  569   pggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTA  390
             PG   GG  WGAA DN R+YT+I N + LNFTL+PS NVT GGGWVAMDA TG ILWSTA
Sbjct  363   PGSKSGGAIWGAAADNTRIYTNIVNRDGLNFTLIPSSNVTRGGGWVAMDANTGAILWSTA  422

Query  389   VPDTGLS-NPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCV  213
              P   L+   V ++N VLF GS    G ++A++A+ G I+W   T +   GG SV++GC 
Sbjct  423   NPTGALAYGAVAISNDVLFVGSFEDAGYIYALDARNGRIVWRGMTNSKQGGGFSVADGCA  482

Query  212   YVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             +VG+GY       +P  T G S++AFC+
Sbjct  483   FVGSGY-------MPPTT-GDSIYAFCV  502



>ref|XP_007046194.1| Uncharacterized protein TCM_011786 [Theobroma cacao]
 gb|EOY02026.1| Uncharacterized protein TCM_011786 [Theobroma cacao]
Length=437

 Score =   426 bits (1094),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 240/446 (54%), Positives = 302/446 (68%), Gaps = 46/446 (10%)
 Frame = -1

Query  1523  KDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSR  1344
             KDISATPA+  GVVYFPSWNGYLYAVNA +G+L+W++NL +LTGL  T    NVT  VSR
Sbjct  14    KDISATPAVAYGVVYFPSWNGYLYAVNAFNGALIWKQNLGQLTGLTGTGVLANVT--VSR  71

Query  1343  STPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTS  1164
             ST +I G+ L+IG+    ++                   P G IT     +        S
Sbjct  72    STSTIDGD-LLIGVLCRNII-------------------PGGGITTRAMLHFQRQCRKAS  111

Query  1163  SLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAH  984
             S  +G+                        +  +LPDN G+ G YAGAA+WGSSP+ID +
Sbjct  112   SPNQGNPM----------------------EDLLLPDNGGRPGGYAGAAVWGSSPAIDVN  149

Query  983   RGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKW  804
             R  VY+ATGNLY+AP  VLKCQE+QNN+T  P+  D+C+ P+ + +SILA+D+D+G+I W
Sbjct  150   RRLVYVATGNLYTAPAEVLKCQEQQNNQTAKPSHPDQCIGPDINYNSILAIDIDSGRISW  209

Query  803   FRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGF  624
              RQLGGYD+F+ AC+   + P+CPPGPN DADFGEAPM+L++  NG+ RD+ VAVQKSGF
Sbjct  210   SRQLGGYDIFYFACL-VPNNPDCPPGPNLDADFGEAPMLLTINSNGTIRDVAVAVQKSGF  268

Query  623   AWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIG  444
             AWALDRDNG++VW+  AGPGG  GGG WGAATD   VYT+IANS+R +F L PS   T  
Sbjct  269   AWALDRDNGDIVWFNLAGPGGKEGGGQWGAATDGRGVYTNIANSDRQSFMLTPSNQTTTA  328

Query  443   GGWVAMDAQTGKILWSTAVPDTGLSN-PVTVANGVLFAGSVHPRGPVFAINAKTGEILWS  267
             G WVA+DA TG+I+WSTA P    +  PVTVANGVLFAGSV   GP++AI+  TG ILW+
Sbjct  329   GAWVALDANTGEIVWSTANPSNDTAQGPVTVANGVLFAGSVASNGPIYAIDTGTGNILWT  388

Query  266   YYTGATVYGGMSVSNGCVYVGNGYRV  189
             Y TGA VYGG+S S GC+YVGNGY V
Sbjct  389   YNTGAMVYGGISASYGCIYVGNGYTV  414



>gb|KHN13633.1| hypothetical protein glysoja_019320 [Glycine soja]
Length=354

 Score =   411 bits (1057),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 219/442 (50%), Positives = 280/442 (63%), Gaps = 92/442 (21%)
 Frame = -1

Query  1586  ENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNL  1407
             E+KIS  T S L LKWEFYAGKDI+ATPAI  G +YFP WNG ++AV A  GSL+W++NL
Sbjct  2     EHKISVETFSNLSLKWEFYAGKDITATPAIFDGTLYFPCWNGNIFAVRAKYGSLVWKQNL  61

Query  1406  QKLTGLNATVRTGNVTAIVSRSTPSIV-GETLIIGIYGPAVVIGVKRATGDLLWMTLLDR  1230
               LTGL+AT     V   V+R+TP+I   + LI+GIYGPAVVI VKR+TGDL+W T LD 
Sbjct  62    GNLTGLSATGFVAGVNWTVARATPTIAEDDLLIVGIYGPAVVIAVKRSTGDLVWETRLDS  121

Query  1229  HPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDN  1050
             H + ++TMS TY  G                        F+KLD+ +G +LWQT+ +PDN
Sbjct  122   HNSSVVTMSRTYLRG------------------------FSKLDIESGAILWQTYTIPDN  157

Query  1049  KGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKC  870
              G++GEY+GAA+WGSSP IDA R H+YIATGNLY+AP  +L+                  
Sbjct  158   HGEKGEYSGAAVWGSSPPIDASRNHIYIATGNLYTAPLDILEYD----------------  201

Query  869   VEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACIN-SSSTPNCPPGPNPDADFGEAP  693
                              G IKW+  LGG+DV+F++C+N S  + NCPPGP+PDADFGEAP
Sbjct  202   -----------------GSIKWYHPLGGFDVWFVSCLNLSIPSINCPPGPSPDADFGEAP  244

Query  692   MMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERV  513
             MML++ VNG+ +D+VVAVQKSGFAWAL RD+G+++W                        
Sbjct  245   MMLTIDVNGTKQDVVVAVQKSGFAWALHRDDGKLIW------------------------  280

Query  512   YTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSN-PVTVANGVLF  336
                       NFTL PSKN T  GGWVAM+A +GKILWSTA P    +N PVTVANG++F
Sbjct  281   --------STNFTLRPSKNTTTSGGWVAMEACSGKILWSTANPSNAKANGPVTVANGIVF  332

Query  335   AGSVHPRGPVFAINAKTGEILW  270
             AGS H +GP++AIN +TG+I+W
Sbjct  333   AGSTHQKGPIYAINGETGKIVW  354



>ref|XP_002974635.1| hypothetical protein SELMODRAFT_442585, partial [Selaginella 
moellendorffii]
 gb|EFJ24155.1| hypothetical protein SELMODRAFT_442585, partial [Selaginella 
moellendorffii]
Length=552

 Score =   416 bits (1068),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 256/533 (48%), Positives = 336/533 (63%), Gaps = 32/533 (6%)
 Frame = -1

Query  1715  IIFLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWE  1536
             ++FL+ + A +  +      +C  +G W++HGGD+ NRR+A  E+ IS  +   L  KW 
Sbjct  5     LVFLLIVMAQSLLQ---VESNC-QTGEWISHGGDLKNRRFAEDEHLISVWSAPHLSEKWS  60

Query  1535  FYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTA  1356
             F AG DISATPAI   VVYFPSWNG ++AV    G LLW  NL K+TG+          A
Sbjct  61    FDAGADISATPAIYDCVVYFPSWNGLVFAVTIH-GELLWRVNLTKITGV----------A  109

Query  1355  IVSRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTL-LDRHPAGLITMSGTYYNGAF  1179
              +SR+TP++  E L+ G+ GPA V+ + R +G ++WM+  LD  P   ITMSGT Y+GAF
Sbjct  110   TLSRTTPAVTEEFLLYGLLGPARVVALHRKSGRMVWMSEDLDETPLARITMSGTAYDGAF  169

Query  1178  YVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSP  999
             YVG SSL+E   +A CCTF+G F KLD+ TGK +W+T M+P+N      + G  +WGSSP
Sbjct  170   YVGISSLQE-LVEAACCTFQGSFQKLDLKTGKRIWRTSMVPENS----SFYGVTVWGSSP  224

Query  998   SIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDT  819
             SID  RG  +I TGNLY  P  V  C  +  N       S  C       D+++A+++  
Sbjct  225   SIDPKRGLAFIGTGNLYQIPSDVQDCLNRNAN-------SSDCYPRGVCDDAVVAVNMAD  277

Query  818   GKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGST---RDIV  648
             G+I+W  +LGG DV+ +AC  +    NCPP P PD DFGE+PM+L++    S    +DI+
Sbjct  278   GEIRWCNRLGGNDVWRLACDTNPPPANCPPEPGPDYDFGESPMLLTIPSRFSKNKFQDIL  337

Query  647   VAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLL  468
             V  QKSG  WA DRD+G +VW T AGPGG VGG  WGAATDN RVYT+IANS+R  F L+
Sbjct  338   VTGQKSGIVWAHDRDDGSLVWETTAGPGGSVGGAIWGAATDNHRVYTNIANSDRATFHLV  397

Query  467   PSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLS-NPVTVANGVLFAGSVHPRGPVFAINA  291
             PS   T  GGWVAMDA TG+I WSTA P    +  PVTVANGV+F GS    G V A++A
Sbjct  398   PSGESTTAGGWVAMDAATGRIEWSTANPHGARAYGPVTVANGVVFCGSFDKDGHVLALDA  457

Query  290   KTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFC  132
             ++G ILW   TG+TVYGG SV +GC ++G GY  +  A     T G+ L+AFC
Sbjct  458   ESGRILWERTTGSTVYGGPSVGHGCWFIGTGYSRAPLAPALGGTPGSELYAFC  510



>ref|XP_002963347.1| hypothetical protein SELMODRAFT_438505, partial [Selaginella 
moellendorffii]
 gb|EFJ35218.1| hypothetical protein SELMODRAFT_438505, partial [Selaginella 
moellendorffii]
Length=679

 Score =   412 bits (1059),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 259/533 (49%), Positives = 337/533 (63%), Gaps = 40/533 (8%)
 Frame = -1

Query  1709  FLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFY  1530
             +L+C +A  +        S   +G W++HGGD+ NRR+A  E+ IS  +   L  KW F 
Sbjct  165   YLLCNTAQVE--------SNCQTGEWISHGGDLKNRRFAEDEHLISVWSAPHLSEKWSFD  216

Query  1529  AGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIV  1350
             AG DISATPAI   VVYFPSWNG ++AV    G LLW  NL ++TG+          A +
Sbjct  217   AGADISATPAIYDCVVYFPSWNGLVFAVTIH-GELLWRFNLTEITGV----------ATL  265

Query  1349  SRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTL-LDRHPAGLITMSGTYYNGAFYV  1173
             SR+TP++  E L+ G+ GPA V+ + R +G ++WM+  LD  P   ITMSGT Y+GAFYV
Sbjct  266   SRTTPAVTEELLLYGLLGPARVVALHRKSGRMVWMSEDLDETPLARITMSGTAYDGAFYV  325

Query  1172  GTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSI  993
             G SSL+E   +A CCTF+G F KLD+ TGK +W+T+M+P+N      + G  +WGSSPSI
Sbjct  326   GMSSLQE-LVEAACCTFQGSFQKLDLKTGKRIWRTYMVPENS----SFYGVTVWGSSPSI  380

Query  992   DAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGK  813
             D  RG  +I TGNLY  P  V  C  +  N       S  C  P    D+++A+++  G+
Sbjct  381   DPKRGLAFIGTGNLYQIPSDVQDCLNRNAN-------SSDCYPPGVCDDAVVAVNMADGE  433

Query  812   IKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGST---RDIVVA  642
             I+W  +LGG DV+ +AC  +    NCPP P PD DFGE+PM+L++    S    +DIVV 
Sbjct  434   IRWCNRLGGNDVWRLACDTNPPPANCPPEPGPDYDFGESPMLLTIPSRYSKNKFQDIVVT  493

Query  641   VQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPS  462
              QKSG  WA DRD+G +VW T AGPGG VGG  WGAATDN RVYT+IANS+R  F L+PS
Sbjct  494   GQKSGIVWAHDRDDGSLVWETTAGPGGSVGGAIWGAATDNHRVYTNIANSDRATFQLVPS  553

Query  461   KNVTIGGGWVAMDAQTGKILWSTAVPDTGLS-NPVTVANGVLFAGSVHPRGPVFAINAKT  285
                T  GGWVAMDA TG+I WSTA P    +  PVTVANGV+F GS    G V A++A++
Sbjct  554   GQSTTAGGWVAMDAATGRIEWSTANPHGARAYGPVTVANGVVFCGSFDKDGHVLALDAES  613

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTG--GTSLFAFC  132
             G ILW   TG+TVYGG SV +GC ++G GY  +  A  P F G  G+ L+AFC
Sbjct  614   GRILWERTTGSTVYGGPSVGHGCCFIGTGYSRAPLA--PAFGGTPGSELYAFC  664



>ref|XP_007224952.1| hypothetical protein PRUPE_ppa021290mg, partial [Prunus persica]
 gb|EMJ26151.1| hypothetical protein PRUPE_ppa021290mg, partial [Prunus persica]
Length=396

 Score =   401 bits (1031),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 238/503 (47%), Positives = 295/503 (59%), Gaps = 109/503 (22%)
 Frame = -1

Query  1634  WLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYL  1455
             W NHGGDI NRR A GE  I+P TV  ++L+W                  VYFPSWNGYL
Sbjct  1     WTNHGGDITNRRNAVGEVLINPRTVLNMRLRW------------------VYFPSWNGYL  42

Query  1454  YAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGV  1275
             YAV+A  G L+W++NL  LTGLN T     V   VSRSTP+I G  LI+GIYGPAV    
Sbjct  43    YAVDAFTGRLIWQQNLGALTGLNGTGVV--VNVTVSRSTPTIAGNLLIVGIYGPAVAC--  98

Query  1274  KRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDV  1095
                   ++W T LD  P  LITMSGT + GAFYVG             C    + A    
Sbjct  99    ------VVWSTQLDPRPRVLITMSGTVHLGAFYVG-------------CRLCKKVAD---  136

Query  1094  WTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQE  915
                       ML D + + G Y+GAA+WGSSP+ID  R HVY+ATG LY+AP  V KCQE
Sbjct  137   ----------MLQDIRRRLGGYSGAAVWGSSPAIDISRRHVYVATGILYTAPPEVTKCQE  186

Query  914   KQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNC  735
             +QN +   PT  D+C+ P+ + +SILALDLD+G+I W RQLGGYDVF+ AC+        
Sbjct  187   RQNKQRGKPTHPDQCIGPDINFNSILALDLDSGRIVWSRQLGGYDVFYFACL--------  238

Query  734   PPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfv  555
                         APM+L++  N + RD+VVAVQKSGFAWA+DRDNG +VW          
Sbjct  239   ------------APMLLTIHPNRTRRDVVVAVQKSGFAWAIDRDNGTIVW----------  276

Query  554   gggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTG  375
                        + VYT+IAN +R NFTL               DA +G+ILW+TA P   
Sbjct  277   ---------SKKSVYTNIANGDRENFTL---------------DADSGEILWTTANPSND  312

Query  374   LSN-PVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNG  198
              +  PVTVANGV+FAGSV   GP++A+ A TG ILWSY TGATVYGG+S S G +YVG+G
Sbjct  313   TAQAPVTVANGVVFAGSVASNGPIYAMKANTGRILWSYNTGATVYGGISASYGYIYVGSG  372

Query  197   YRVSIGAGIPIFTGGTSLFAFCL  129
             Y V +    P +T GTSL+AFC+
Sbjct  373   YSVDLAKFHPTWTAGTSLYAFCV  395



>ref|XP_002972263.1| hypothetical protein SELMODRAFT_441782 [Selaginella moellendorffii]
 gb|EFJ26349.1| hypothetical protein SELMODRAFT_441782 [Selaginella moellendorffii]
Length=494

 Score =   403 bits (1036),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 241/508 (47%), Positives = 331/508 (65%), Gaps = 30/508 (6%)
 Frame = -1

Query  1637  NWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGY  1458
             NW++HGGD+ NRRYA  E+KI+  T   L L+W +    D+SATPAI    VY PSWNG 
Sbjct  9     NWISHGGDLGNRRYAASEHKINLETAPSLALRWRYVTQGDVSATPAIHDCAVYVPSWNGI  68

Query  1457  LYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIG  1278
             + AV A DG+ LW+ NL ++T L+  V         SR+TP +    +++G+ GPA V+ 
Sbjct  69    VAAV-AMDGATLWQTNLSQVTSLHPAV---------SRATPVVTKRCVLVGLRGPARVLC  118

Query  1277  VKRATGDLLWMTL-LDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKL  1101
             + R TGDLLWM+  L+  P  +ITMSGT Y+GA+YVG SS+++ +    CCTF+G F KL
Sbjct  119   LDRMTGDLLWMSPDLELAPHSMITMSGTAYDGAYYVGVSSMQQHAKS--CCTFQGSFHKL  176

Query  1100  DVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKC  921
             D+ TG+ +W T+M+P    +  +Y G  +WGSSP++D  RG VYIATG+++S P  V +C
Sbjct  177   DLQTGQTVWSTYMVP----RDSQYTGVPVWGSSPALDERRGLVYIATGSVFSVPSEVRQC  232

Query  920   QEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTP  741
             Q+   N       S  C+ P    +S++A+D   G I+W  ++   +++  AC +    P
Sbjct  233   QQATGN-------SSSCIVPSVCYNSVVAVDTRDGTIRWCSRMTMSEIWENACRSIRPPP  285

Query  740   NCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpgg  561
             NCPP P+PDADFGE+PM++++   G+ RD+VV  QK+GF WA DR+ GE+VW+  AGPGG
Sbjct  286   NCPPRPDPDADFGESPMLVTIQQQGALRDVVVTGQKTGFVWAHDRETGELVWHAVAGPGG  345

Query  560   fvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPD  381
               GG  WG+ATDN RV+T+IANS+R +F   PS+ VT GGGWVAM A TG++LWST  P 
Sbjct  346   SGGGANWGSATDNSRVFTNIANSDRQSFLHEPSQLVTTGGGWVAMAATTGRLLWSTPNP-  404

Query  380   TGLS--NPVTVAN-GVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVY  210
             TG     PVT  + GVL   S    G V+AIN+ +GEI+W+  TG+TVYGG SV  GC +
Sbjct  405   TGQPAYGPVTYTHGGVLLCTSFDSNGHVYAINSYSGEIIWNATTGSTVYGGFSVGCGCAF  464

Query  209   VGNGYRVSIGAGIPI-FTGGTSLFAFCL  129
             VG GY  S   G+ +  T G SLFAFC+
Sbjct  465   VGAGY-ASTPTGLALGGTPGDSLFAFCI  491



>ref|XP_002984177.1| hypothetical protein SELMODRAFT_445822 [Selaginella moellendorffii]
 gb|EFJ14687.1| hypothetical protein SELMODRAFT_445822 [Selaginella moellendorffii]
Length=494

 Score =   402 bits (1034),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 240/508 (47%), Positives = 331/508 (65%), Gaps = 30/508 (6%)
 Frame = -1

Query  1637  NWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGY  1458
             NW++HGGD+ NRRYA  E+KI+  T   L L+W +    D+SATPAI    VY PSWNG 
Sbjct  9     NWISHGGDLGNRRYAASEHKINLETAPSLALRWRYVTQGDVSATPAIHDCAVYVPSWNGI  68

Query  1457  LYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIG  1278
             + AV A DG+ LW+ NL ++T L+  V         SR+TP +    +++G+ GPA V+ 
Sbjct  69    VAAV-AMDGATLWQTNLSQVTSLHPAV---------SRATPVVTKRCVLVGLRGPARVLC  118

Query  1277  VKRATGDLLWMTL-LDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKL  1101
             + R TGDLLWM+  L+  P  +ITMSGT Y+GA+YVG SS+++ +    CCTF+G F KL
Sbjct  119   LDRMTGDLLWMSQDLELAPHSMITMSGTAYDGAYYVGVSSMQQHAKS--CCTFQGSFHKL  176

Query  1100  DVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKC  921
             D+ TG+ +W T+M+P    +  +Y G  +WGSSP++D  RG VYI+TG+++S P  V +C
Sbjct  177   DLQTGQTVWSTYMVP----RDSQYTGVPVWGSSPALDERRGLVYISTGSVFSVPSEVRQC  232

Query  920   QEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTP  741
             Q+   N       S  C+ P    +S++A+D   G I+W  ++   +++  AC +    P
Sbjct  233   QQATGN-------SSSCIVPSVCYNSVVAVDTRDGTIRWCSRMTMSEIWENACRSIRPPP  285

Query  740   NCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpgg  561
             NCPP P+PDADFGE+PM++++   G+ RD+VV  QK+GF WA DR+ GE+VW+  AGPGG
Sbjct  286   NCPPRPDPDADFGESPMLVTIQQQGALRDVVVTGQKTGFVWAHDRETGELVWHAVAGPGG  345

Query  560   fvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPD  381
               GG  WG+ATDN RV+T+IANS+R +F   PS+ VT GGGWVAM A TG++LWST  P 
Sbjct  346   SGGGANWGSATDNSRVFTNIANSDRQSFLHEPSQLVTTGGGWVAMAATTGRLLWSTPNP-  404

Query  380   TGLS--NPVTVAN-GVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVY  210
             TG     PVT  + GVL   S    G V+AIN+ +GEI+W+  TG+TVYGG SV  GC +
Sbjct  405   TGQPAYGPVTYTHGGVLLCTSFDSNGHVYAINSYSGEIIWNATTGSTVYGGFSVGCGCAF  464

Query  209   VGNGYRVSIGAGIPI-FTGGTSLFAFCL  129
             VG GY  S   G+ +  T G SLFAFC+
Sbjct  465   VGAGY-ASTPTGLALGGTPGDSLFAFCV  491



>ref|XP_006602904.1| PREDICTED: uncharacterized protein LOC102669536 [Glycine max]
Length=314

 Score =   390 bits (1001),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 203/311 (65%), Positives = 249/311 (80%), Gaps = 6/311 (2%)
 Frame = -1

Query  1064  MLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPT  885
             MLPDN  +RGEYAGAAIWGSSPSID  R HVYI TGNLYSAP H+ +C+E+QNN+T  PT
Sbjct  1     MLPDNNNRRGEYAGAAIWGSSPSIDVKRNHVYIGTGNLYSAPLHIRQCRERQNNRTE-PT  59

Query  884   TSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPP-GPNPDAD  708
               D+C+EP+NHS+SILALDLD+GKI+W+RQ GG+D+FF+ACIN+S+ PNCPP G   DAD
Sbjct  60    QPDECIEPDNHSNSILALDLDSGKIRWYRQCGGFDIFFLACINASA-PNCPPRGLWQDAD  118

Query  707   FGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaT  528
             FGEAPMML++ +N + +D+VVAVQKSG+AWALDR+NG ++W+T AGPGG  GGGTWGAAT
Sbjct  119   FGEAPMMLTIYINRTKKDVVVAVQKSGYAWALDRNNGNLMWFTPAGPGGITGGGTWGAAT  178

Query  527   DNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSNPVTVAN  348
             D  RVYT+IANS   NFTL PS   T  GGWVAM+A  G++LWSTA P  G   PV+VAN
Sbjct  179   DERRVYTNIANSEAKNFTLAPSNMTTTAGGWVAMNASNGRVLWSTANPTNG---PVSVAN  235

Query  347   GVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIP  168
              V+ AGS    G ++A +A  G+ILW+Y TGATVYGGMS++NGC+YVG+GY V + + I 
Sbjct  236   EVVIAGSTDRMGSIYAFDANNGKILWTYKTGATVYGGMSINNGCIYVGHGYNVFVSSLIN  295

Query  167   IFTGGTSLFAF  135
              FTGG SLFAF
Sbjct  296   NFTGGASLFAF  306



>gb|KHN13640.1| hypothetical protein glysoja_019327 [Glycine soja]
Length=310

 Score =   381 bits (978),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 202/312 (65%), Positives = 247/312 (79%), Gaps = 10/312 (3%)
 Frame = -1

Query  1064  MLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPT  885
             MLPDN  +RGEYAGAAIWGSSPSID  R HVYI TGNLYSAP H+ +C+E+QNN+T  PT
Sbjct  1     MLPDNNNRRGEYAGAAIWGSSPSIDVKRNHVYIGTGNLYSAPLHIRQCRERQNNRTE-PT  59

Query  884   TSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPP-GPNPDAD  708
               D+C+EP+NHS+SILALDLD+GKI+W    GG+D+FF+ACIN+S+ PNCPP G   DAD
Sbjct  60    QPDECIEPDNHSNSILALDLDSGKIRW----GGFDIFFLACINASA-PNCPPRGLWQDAD  114

Query  707   FGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaT  528
             FGEAPMML++ +N + +D+VVAVQKSG+AWALDR+NG ++W+T AGPGG  GGGTWGAAT
Sbjct  115   FGEAPMMLTIYINRTKKDVVVAVQKSGYAWALDRNNGNLMWFTPAGPGGITGGGTWGAAT  174

Query  527   DNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSNPVTVAN  348
             D  RVYT+IANS   NFTL PS   T  GGWVAM+A  G++LWSTA P  G   PV+VAN
Sbjct  175   DERRVYTNIANSEAKNFTLAPSNMTTTAGGWVAMNATNGRVLWSTANPTNG---PVSVAN  231

Query  347   GVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIP  168
              V+ AGS    G ++A +A  G+ILW+Y TGATVYGGMS++NGC+YVG+GY V + + I 
Sbjct  232   EVVIAGSTDRMGSIYAFDANNGKILWTYKTGATVYGGMSINNGCMYVGHGYNVFVSSLIN  291

Query  167   IFTGGTSLFAFC  132
              FTGG SLFAFC
Sbjct  292   NFTGGASLFAFC  303



>ref|XP_011015276.1| PREDICTED: uncharacterized protein LOC105118916 [Populus euphratica]
Length=677

 Score =   379 bits (972),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 194/317 (61%), Positives = 239/317 (75%), Gaps = 2/317 (1%)
 Frame = -1

Query  1076  WQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKT  897
             W+T+ LPDN+GK G Y+GAAIWGSSP+ID  R  VY+ TGNLY+AP+ V +CQE QNN+T
Sbjct  361   WRTYTLPDNQGKLGGYSGAAIWGSSPAIDVTRRLVYVGTGNLYTAPREVTQCQEAQNNQT  420

Query  896   TTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNP  717
             T P   D+C+ P+ H DSILA+++DTG+IKW R+L GYDVF+ AC+   + P+CPPGPN 
Sbjct  421   TKPAQPDQCIGPDIHFDSILAINIDTGRIKWSRKLSGYDVFYFACL-VPNNPDCPPGPNL  479

Query  716   DADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwg  537
             DADFGEAPM+L++  N + RD+ VAVQKSGFA ALDRD G +VW   AGPGG  GGG WG
Sbjct  480   DADFGEAPMLLTITANRTRRDVAVAVQKSGFAVALDRDTGSIVWSKLAGPGGLEGGGIWG  539

Query  536   aaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVP-DTGLSNPV  360
             AATD   VYT+IANSNR  FTL PS   T  G WVA+DA +G+ILWSTA P +     PV
Sbjct  540   AATDERTVYTNIANSNRERFTLAPSNQTTTVGAWVALDANSGQILWSTANPSNEAAQGPV  599

Query  359   TVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIG  180
             T+ N VLFAGSV P GP+ A++AKTG ILWSY T ATVYGG+  S GC+Y+GNGY + + 
Sbjct  600   TIVNDVLFAGSVAPNGPIDAMDAKTGNILWSYNTCATVYGGVLASYGCIYLGNGYSIGLA  659

Query  179   AGIPIFTGGTSLFAFCL  129
                P +TGGTSL+AFC+
Sbjct  660   RFHPSWTGGTSLYAFCV  676



>ref|WP_039748847.1| hypothetical protein, partial [Hassallia byssoidea]
Length=511

 Score =   370 bits (949),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 209/497 (42%), Positives = 292/497 (59%), Gaps = 23/497 (5%)
 Frame = -1

Query  1634  WLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYL  1455
             W   G ++ N R    E  + P  V+ L  KW F  G +ISATPA++ G VY P W G L
Sbjct  2     WKLGGQNLNNTRNQATERYLKPENVASLSPKWVFTTGGEISATPAVVDGAVYLPDWAGNL  61

Query  1454  YAVNASDGSLLWER------NLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGP  1293
             + ++A  G+ +W        N   +   ++      +   +SR++P++ G  +IIG  G 
Sbjct  62    FKIDAQTGAQIWSNTIANYINDPSIPPASSGTPYSTIPIAMSRTSPAVKGNKVIIGSQGG  121

Query  1292  AVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSS----KAHCCT  1125
             A ++ + + TG L+W T LD HP  +IT S   Y    YVG +SLEEG +       CCT
Sbjct  122   AYLMAINKDTGKLIWKTKLDSHPTAIITQSPAIYGNRVYVGVASLEEGEAFVNPNYECCT  181

Query  1124  FRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYS  945
             FRG  A +D+ TGK+LW+T+ +PDN G  G Y+GA++WGS+P+ID  R  VYIATGN   
Sbjct  182   FRGSMASVDLTTGKILWKTYTVPDNGGLPGGYSGASVWGSTPAIDPKRNSVYIATGNNND  241

Query  944   APKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIA  765
              P+    C    N  + TP+   +C++P NH D+I+ALDLDTG IKW  +L GYD + ++
Sbjct  242   VPQTAKDC--IANLSSPTPSDESQCLDPNNHVDAIMALDLDTGAIKWSNKLEGYDTWTVS  299

Query  764   CINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVW  585
             C       NCP     D DF +APM+ +V   G  RD++ A QKSG  WALD D+G++VW
Sbjct  300   C-QFGIARNCPDPQGEDYDFAQAPMLFTVKNAGQRRDLIGAGQKSGVFWALDPDSGQIVW  358

Query  584   YteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKI  405
                 GPGG  GG  WG+ATD +++Y +I N+    + L PS   T  G W A+DA TGKI
Sbjct  359   SQIVGPGGTSGGIQWGSATDGQQIYVAIVNTQSQEYKLQPSGETTTAGSWSALDAATGKI  418

Query  404   LWSTAVP----DTGLSNPVTVANGVLFAGSV---HPRGPVFAINAKTGEILWSYYTGATV  246
             +W TA P    D G   P+TVANGV++AGS+        ++A+ AKTG+ILW + +G +V
Sbjct  419   IWQTADPAGAKDEG---PMTVANGVVYAGSMASGQGANNMYALEAKTGKILWGFNSGGSV  475

Query  245   YGGMSVSNGCVYVGNGY  195
               G +V NG VY G+GY
Sbjct  476   VAGAAVVNGTVYWGSGY  492



>ref|XP_002963758.1| hypothetical protein SELMODRAFT_405158 [Selaginella moellendorffii]
 gb|EFJ35629.1| hypothetical protein SELMODRAFT_405158 [Selaginella moellendorffii]
Length=493

 Score =   367 bits (942),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 239/510 (47%), Positives = 308/510 (60%), Gaps = 46/510 (9%)
 Frame = -1

Query  1643  SGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWN  1464
             +G W++HGGD+ NRR+A  E+ IS  +   L  KW F AG DISATPAI   VVYFPSWN
Sbjct  25    TGEWISHGGDLKNRRFAEDEHLISVWSAPHLSEKWSFDAGADISATPAIYDCVVYFPSWN  84

Query  1463  GYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVV  1284
             G ++AV    G LLW  NL ++TG+          A +SR+ P++  E L+ G+ GPA  
Sbjct  85    GLVFAVTIH-GELLWSTNLTEITGV----------ATLSRTIPAVTEELLLYGLLGPARG  133

Query  1283  IGVKRATGDLLWMTL-LDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFA  1107
             + + R  G ++WM+  LD  P   ITMSGT Y+GAFYVG SSL+E   KA CCTF+G F 
Sbjct  134   VALHRKNGRMVWMSEDLDETPLARITMSGTAYDGAFYVGMSSLQE-LVKAACCTFQGSFQ  192

Query  1106  KLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVL  927
             KLD+ TGK +W+T+M P+N G                        +I TGNLY  P  V 
Sbjct  193   KLDLKTGKRIWRTYMAPENSGL----------------------AFIGTGNLYQIPSDVQ  230

Query  926   KCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSS  747
              C  +  N       S  C       D+++A+++  G+I+W  +LGG DV+ +AC  +  
Sbjct  231   DCLNRNAN-------SSDCYPRGVCDDAVVAVNMPDGEIRWCNRLGGNDVWRLACDTNPP  283

Query  746   TPNCPPGPNPDADFGEAPMMLSVVVNGST---RDIVVAVQKSGFAWALDRDNGEMVWYte  576
               NCPP P PD D GE+PM+L++    S    +DIVV  QKSG  WA DRD+G + W T 
Sbjct  284   PANCPPEPGPDYDLGESPMLLTIPSRFSKNKFQDIVVTGQKSGIVWAHDRDDGSLAWETT  343

Query  575   agpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWS  396
             AGPGGFVGG  WGAATDN RVYT+IANS    F L+PS   T  GGWVAMDA TG+I WS
Sbjct  344   AGPGGFVGGAIWGAATDNHRVYTNIANSGSATFQLVPSGGSTTAGGWVAMDAATGRIEWS  403

Query  395   TAVPDTGLS-NPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNG  219
             TA P +  +  PVTVANGV+F GS    G V A++A++G ILW   TG+TVYGG+SV +G
Sbjct  404   TANPHSARAYGPVTVANGVVFCGSFDKDGHVLALDAESGPILWERTTGSTVYGGLSVGHG  463

Query  218   CVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             C +VG GY           T G+ L+AFC+
Sbjct  464   CCFVGTGYSWDPLGDALGGTPGSELYAFCV  493



>ref|XP_002974841.1| hypothetical protein SELMODRAFT_442588 [Selaginella moellendorffii]
 gb|EFJ24361.1| hypothetical protein SELMODRAFT_442588 [Selaginella moellendorffii]
Length=606

 Score =   365 bits (936),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 226/497 (45%), Positives = 296/497 (60%), Gaps = 57/497 (11%)
 Frame = -1

Query  1670  HITRFSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILK  1491
             H    +C  +G  ++HGGD+ NRR+A  E+ IS      L  +W F AG DISATPAI  
Sbjct  135   HEVESNC-QTGECISHGGDLKNRRFAEDEHFISVWRAPHLSERWSFDAGADISATPAIYD  193

Query  1490  GVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLI  1311
              VVYFPSWNG+++AV+   G LLW  NL ++T +          A +SR+TP++  + L+
Sbjct  194   CVVYFPSWNGFVFAVSIQ-GQLLWRVNLPEITRV----------ATLSRTTPAVTEDLLL  242

Query  1310  IGIYGPAVVIGVKRATGDLLWMTL-LDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAH  1134
              G+ GPA V+ + R +G L+WM+  LD      ITMSGT Y+GAFYVG SS +E   +A 
Sbjct  243   YGLLGPARVVALDRKSGRLVWMSEDLDETARARITMSGTAYDGAFYVGISSRQE-LVEAT  301

Query  1133  CCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGN  954
             CCTF+G F KLD+  GK  W+T M+P+N G    + G ++WGSSPS+D  RG V+I TGN
Sbjct  302   CCTFQGSFQKLDLKNGKRRWRTDMVPENSG----FYGVSVWGSSPSVDPKRGLVFIGTGN  357

Query  953   LYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVF  774
             LY  P  V  C  +  N       S  C       D+++A+++                 
Sbjct  358   LYQIPSDVQDCLNRNAN-------SSDCYPRGVCDDTVVAVNMADA--------------  396

Query  773   FIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGST---RDIVVAVQKSGFAWALDRD  603
                           P P PD DFGE+PM+L++    S    +DIVV  QKSG  WA DRD
Sbjct  397   --------------PEPGPDYDFGESPMLLTIPSRYSKNKFQDIVVTGQKSGIVWAHDRD  442

Query  602   NGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMD  423
             +G +VW T AGPGG VGG  WGAATDN RVYT+IANS+R  F L+PS   T  GGWVAM+
Sbjct  443   DGSLVWETTAGPGGSVGGAIWGAATDNHRVYTNIANSDRATFQLVPSGESTTAGGWVAME  502

Query  422   AQTGKILWSTA-VPDTGLSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATV  246
             A TG+I WSTA    +    PVTVANGV+F GS    G V  ++A++G ILW   TG+TV
Sbjct  503   AATGRIEWSTANAHGSRAYGPVTVANGVVFCGSFDNDGHVLELDAESGRILWERTTGSTV  562

Query  245   YGGMSVSNGCVYVGNGY  195
             YGG+SV +GC ++G GY
Sbjct  563   YGGLSVGHGCCFIGTGY  579



>ref|WP_020741593.1| hypothetical protein [Sorangium cellulosum]
 ref|YP_008156103.1| hypothetical protein SCE1572_48810 [Sorangium cellulosum So0157-2]
 gb|AGP41707.1| hypothetical protein SCE1572_48810 [Sorangium cellulosum So0157-2]
Length=514

 Score =   353 bits (906),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 214/511 (42%), Positives = 285/511 (56%), Gaps = 32/511 (6%)
 Frame = -1

Query  1646  ASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSW  1467
             ++G W   G D+ N   A  E  I  + V+ L ++W F     +SATPA+    VYFP W
Sbjct  30    SAGRWTVFGRDLANTHNADDERDIGAANVASLSVRWSFTTSGSVSATPAVDHEAVYFPDW  89

Query  1466  NGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAV  1287
              G LY ++A  G  LW R +  LTG             +SR++P++ G  L +G    A 
Sbjct  90    GGSLYKLDAETGLPLWTRTIPGLTG---------TADAISRTSPALHGHMLFVGTQAGAY  140

Query  1286  VIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEE---GSSKAHCCTFRG  1116
             ++ V R TGDLLW T +D HPA ++T S   + G  YVG SS EE         CCTFRG
Sbjct  141   LLAVDRRTGDLLWKTQVDPHPAAIVTQSPVVHGGRVYVGVSSREELFAADEGYPCCTFRG  200

Query  1115  RFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPK  936
                 LD  TG+VLWQT+++P        Y+G A+W  +P+ID  R  +Y+ TGN Y+ P 
Sbjct  201   SVVALDAVTGEVLWQTYVVPAG------YSGGAVWAGAPAIDVGRRALYVTTGNNYTVPP  254

Query  935   HVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACIN  756
              V  C E   +    P  ++ C+  ++H D+I+ALDLDTG  KW R+L G+D +  AC  
Sbjct  255   SVASCAEAAGDD---PLAAEACLAADDHIDAIVALDLDTGATKWARRLQGFDAWTGACFY  311

Query  755   SSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYte  576
                   CP    PD DFG    + +       R +V A QKSG  WALDRD+G +VW T 
Sbjct  312   GHDW--CPSPTGPDYDFGTGAALFTAGAGEHRRALVGAGQKSGIFWALDRDDGSLVWSTL  369

Query  575   agpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWS  396
              GPGG +GG  WG A D  R+Y  I NS+++  TL PS  +   G W A+DA TG+ILW 
Sbjct  370   VGPGGILGGIMWGVALDESRIYVPIGNSDQVAHTLHPSGEIITWGSWSALDAATGEILWQ  429

Query  395   TAVPDTGLSN--PVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSN  222
             TA P  G  +  P+TVANGVL+AGS+   G V A++A TG ILWS+    +V  G +VS 
Sbjct  430   TADPAAGAQDRGPLTVANGVLYAGSM--SGDVHALSAATGAILWSHPADGSVNAGPAVSR  487

Query  221   GCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             G VY G+GY+ S G G P    G +LFAF L
Sbjct  488   GTVYWGSGYQ-SFGVGTP----GHTLFAFGL  513



>ref|XP_007216879.1| hypothetical protein PRUPE_ppa020987mg [Prunus persica]
 gb|EMJ18078.1| hypothetical protein PRUPE_ppa020987mg [Prunus persica]
Length=345

 Score =   343 bits (879),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 201/351 (57%), Positives = 235/351 (67%), Gaps = 56/351 (16%)
 Frame = -1

Query  1181  FYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSS  1002
              Y+GT+SLEE  S   CCTF G FAKLDV +G +LWQTF+L DN GK G+Y+G AIWGSS
Sbjct  46    IYIGTASLEETLSAEECCTFHGSFAKLDVKSGTILWQTFVLLDNHGKLGQYSGPAIWGSS  105

Query  1001  PSIDAHRGHVYIATGNLYSAPKHV-LKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDL  825
             PSID HR HVYIATGN+YS P++V    + + NN +T PT  D CVEP+NH +SILALDL
Sbjct  106   PSIDVHRKHVYIATGNIYSVPENVSQCQENQNNNNSTLPTHPDACVEPQNHGNSILALDL  165

Query  824   DTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVV  645
             D G IKW                                           VNGS  D VV
Sbjct  166   DGGDIKW-----------------------------------------TYVNGSKLDTVV  184

Query  644   AVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLP  465
             AVQKSGFAWALDR+NG +VW TE GPGG  GGGTWGAATD +RVYT+IANS   NFTL P
Sbjct  185   AVQKSGFAWALDRNNGSLVWSTEVGPGGITGGGTWGAATDKKRVYTNIANSEGKNFTLNP  244

Query  464   SKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSNPVTVANGVLFAGSVHPRGPVFAINAKT  285
             S N+T  GGWVAMDA++ K+L               VANGVLFAGS +P+G ++A+N +T
Sbjct  245   SNNITTAGGWVAMDARSDKVL--------------CVANGVLFAGSTNPKGSIYAMNTRT  290

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFC  132
             G+ILWS  TGATVYGGMS+SNGC+YVGNGY V IG+   +FTGGTSLFAFC
Sbjct  291   GKILWSNETGATVYGGMSISNGCIYVGNGYNVGIGSLTSMFTGGTSLFAFC  341



>ref|WP_030200207.1| polyvinylalcohol dehydrogenase [Corynebacterium variabile]
Length=519

 Score =   346 bits (887),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 213/521 (41%), Positives = 296/521 (57%), Gaps = 40/521 (8%)
 Frame = -1

Query  1655  SCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYF  1476
             + P+S  W + GGD  N RYA  E +ISP+TV +L  KW      D+SATP++    VY 
Sbjct  28    AAPSSTGWSSAGGDRQNTRYAADETRISPTTVGRLGAKWAVATEGDVSATPSVDDKQVYA  87

Query  1475  PSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYG  1296
             P W G LYAVN + G + W+  +   +G+             +R+TP++  + +++G  G
Sbjct  88    PDWAGNLYAVNRASGKVAWKTRISDYSGIPGD---------KARATPAVGDKAIVVGNQG  138

Query  1295  P----AVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA---  1137
             P      V+ + +ATG LLW T ++ HPA +IT S T + G  YVG +S EE  +     
Sbjct  139   PLGHGGEVMAIDKATGALLWKTQVEDHPAAIITQSATIWRGVVYVGVASQEELLASGIAG  198

Query  1136  --HCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIA  963
                CC+FRG  A LD+ TG +LW+T+M P       +Y G A+WGSSP++DA RG +YIA
Sbjct  199   PYTCCSFRGSIAALDLATGDILWKTYMTPGP-----DYPGTAVWGSSPAVDAKRGSLYIA  253

Query  962   TGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGY  783
             TGN Y  P  VL C       T        C+ P++H DSI+ALDL TG +KW  +   +
Sbjct  254   TGNNYDVPDTVLACITAAGTDTAAQAA---CLPPDDHFDSIVALDLATGAVKWATRALPF  310

Query  782   DVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVN-GSTRDIVVAVQKSGFAWALDR  606
             D + ++CI    + NCP    PD DFG+AP +  V       R+++   QKSG  WALD 
Sbjct  311   DAWTVSCIFGDPS-NCPQPSGPDYDFGQAPALYKVAAGPAKGRELLGTGQKSGDYWALDP  369

Query  605   DNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAM  426
             D G +VW T AGPGG  GG  WG+A D +RVYT+ ANSN      +P +  T  G W A+
Sbjct  370   DTGAVVWKTSAGPGGTAGGLQWGSAVDGKRVYTANANSN-----FVPYQGST-DGVWSAL  423

Query  425   DAQTGKILWSTAVPDTG-LSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGAT  249
             DA TG++LW T  P  G  S P T ANGV+F  S+   G ++A+NA TG++LWS+ +G +
Sbjct  424   DAATGQVLWQTRPPHGGSTSGPATTANGVVFGCSLDAAGWMYALNAATGQVLWSFASGGS  483

Query  248   VYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCLE  126
                G ++S+G VY G+GY  + G G P       L+AF L 
Sbjct  484   CLSGAAISDGTVYWGSGYS-NFGFGTP----NNKLYAFALR  519



>ref|WP_020735240.1| hypothetical protein [Sorangium cellulosum]
 ref|YP_008149714.1| hypothetical protein SCE1572_16470 [Sorangium cellulosum So0157-2]
 gb|AGP35952.1| hypothetical protein SCE1572_16470 [Sorangium cellulosum So0157-2]
Length=516

 Score =   345 bits (886),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 215/510 (42%), Positives = 281/510 (55%), Gaps = 32/510 (6%)
 Frame = -1

Query  1643  SGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWN  1464
             +G W  +G D+ N  +A GEN+I  S V  L +KW F     + ATPA+  G VYFP   
Sbjct  33    AGRWTMYGRDLANTHHATGENEIGTSNVGSLSVKWAFTTTGIVPATPAVDHGAVYFPDGG  92

Query  1463  GYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVV  1284
             G LY ++A  G  +W R +  LTG             VSR++P++ G  L +G    A +
Sbjct  93    GNLYKLDAETGVPIWTRTIPSLTG---------TADAVSRTSPALHGHMLFVGTQAGAHM  143

Query  1283  IGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEE---GSSKAHCCTFRGR  1113
             + V   TGDLLW T LD HPA +IT S   + G  YVG SS EE     +   CC+FRG 
Sbjct  144   LAVDSRTGDLLWKTQLDPHPAAIITQSPVVHGGRVYVGVSSREELFAADNAYPCCSFRGS  203

Query  1112  FAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKH  933
                LD  TG+VLWQ +++P        + G A+WG +P+ID  R  +Y+ATGN Y+ P  
Sbjct  204   VVALDAVTGEVLWQRYLVPAG------FTGGAVWGGAPAIDLGRRTLYVATGNNYTVPPA  257

Query  932   VLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINS  753
             V  C E   +        + C+  +N+ D++LALDLDTG +KW R+L G+D +  AC   
Sbjct  258   VSACVEAAGDDA---LAVEACLPADNYIDAVLALDLDTGALKWARRLQGFDAWTGACYFG  314

Query  752   SSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYtea  573
                  CP    PD DFG    + S       RD+V A QKSG  WALDRD+G +VW T  
Sbjct  315   GDW--CPDPAGPDYDFGTGATLFSAGAGAERRDLVGAGQKSGIFWALDRDDGSVVWSTLV  372

Query  572   gpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWST  393
             GPGG +GG  WG A D  R+Y  I N+  + +TL PS  V   G W A+D  TG ILW T
Sbjct  373   GPGGELGGIMWGVAVDESRIYVPIGNNGGVEYTLEPSGQVVSWGSWSALDTATGDILWQT  432

Query  392   AVPDTGLSN--PVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNG  219
               P  G  +  P+TVANGVL+AGS+   G V A++A TG ILWS+    +V  G +V NG
Sbjct  433   PDPTPGAQDRGPLTVANGVLYAGSM--SGNVHALSAATGAILWSHPADGSVSAGPAVVNG  490

Query  218   CVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
               Y G+GY  S G G P    G +LFAF L
Sbjct  491   TAYWGSGYE-SFGIGTP----GNTLFAFGL  515



>gb|KCW64985.1| hypothetical protein EUGRSUZ_G02529 [Eucalyptus grandis]
Length=401

 Score =   337 bits (863),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 203/525 (39%), Positives = 273/525 (52%), Gaps = 135/525 (26%)
 Frame = -1

Query  1754  THGQPLLYYCVCIIIFLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACGENKI  1575
             +HG P ++  + +     C  AT + ++ I          WLN GGD+ N R A  E  I
Sbjct  11    SHGIPGIFIVIAVCSEHCCCIATTR-DFFI----------WLNRGGDLRNTRSAWEEKLI  59

Query  1574  SPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLT  1395
              PSTV  L+L+W+F+AGKDISATPA+   VVY                            
Sbjct  60    GPSTVGNLRLRWKFFAGKDISATPAVANVVVYC---------------------------  92

Query  1394  GLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGL  1215
                              S P       I+ I GP VVI V R+ G L+W T LD HP  +
Sbjct  93    -----------------SAP-------IVSICGPVVVIAVNRSNGRLVWSTQLDPHPRAV  128

Query  1214  ITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRG  1035
             IT S T Y G                      G   KL++  G +LWQT+ LPDN G+  
Sbjct  129   ITTSRTAYLG----------------------GSLVKLNILPGAILWQTYTLPDNGGELR  166

Query  1034  EYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPEN  855
              Y GA IWGSSP+ID  R   Y+ATGN Y+AP  V +CQ +QNN+T  PT  D+C+ P+ 
Sbjct  167   GYDGACIWGSSPAIDPKRRLAYVATGNHYTAPAKVQECQARQNNQTIPPTAPDQCIGPDV  226

Query  854   HSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVV  675
             + +SI+A ++++G+I+W  QLGG D                     D D           
Sbjct  227   NFNSIIAFEMESGRIRWAPQLGGSDA--------------------DHD-----------  255

Query  674   VNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIAN  495
                   DI V VQ SGFAWA+D D+ ++VW+  +               + +RVY + AN
Sbjct  256   ----PHDIAVVVQMSGFAWAVDHDSRDIVWFRVS---------------NGKRVYINTAN  296

Query  494   SNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLS-NPVTVANGVLFAGSVHP  318
              NR NFTL PS   T  G WVA+D ++G++LWSTA P   ++  PV+VANGV+FA SV P
Sbjct  297   GNRKNFTLAPSTQTTTAGAWVALDGRSGEVLWSTANPSNEMAPTPVSVANGVMFACSVAP  356

Query  317   RGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSI  183
              GPVFA++A+TG+IL SY +GATVYGG+S+S GC+Y GNGY++ +
Sbjct  357   EGPVFAMDAETGKILRSYNSGATVYGGISISYGCIYHGNGYKLGL  401



>ref|WP_012238034.1| polyvinylalcohol dehydrogenase [Sorangium cellulosum]
 ref|YP_001616046.1| polyvinylalcohol dehydrogenase [Sorangium cellulosum So ce56]
 emb|CAN95566.1| putative polyvinylalcohol dehydrogenase [Sorangium cellulosum 
So ce56]
Length=516

 Score =   340 bits (873),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 210/510 (41%), Positives = 280/510 (55%), Gaps = 32/510 (6%)
 Frame = -1

Query  1643  SGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWN  1464
             +G W  +G D+ N  YA  E+ + PS V+ L +KW F     + ATPA+  G VYFP   
Sbjct  33    AGRWTVYGYDLANTHYARDEHHLGPSNVASLAVKWAFTTTGIVPATPAVDHGAVYFPDGG  92

Query  1463  GYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVV  1284
             G LY ++A  G  +W R +  LTG             VSR+TP++ G TL +G    A +
Sbjct  93    GKLYKLDARTGHPIWTRTIAALTG---------TAGAVSRTTPALHGHTLFLGTLAGAHM  143

Query  1283  IGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEE---GSSKAHCCTFRGR  1113
             I V   TG LLW   LD HPA +IT S   + G  YVG SS EE     +   CC+FRG 
Sbjct  144   IAVDTRTGALLWKRQLDTHPAAIITQSPVVHGGRVYVGVSSREELFAADNAYPCCSFRGS  203

Query  1112  FAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKH  933
                LD  TG VLW+ + +P        Y G A+WG +PS+D  R  +Y+ TGN Y+ P  
Sbjct  204   VVALDAGTGAVLWKRYTVPAG------YTGGAVWGGAPSLDLKRRTLYVTTGNNYTVPPS  257

Query  932   VLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINS  753
             V  C E   +    P  ++ C+ P+++ D++LALDL TG +KW R+L G+D +  AC   
Sbjct  258   VSACVEAAGDD---PVAAEACLAPDDYIDAVLALDLRTGALKWARRLQGFDAWTGACYFG  314

Query  752   SSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYtea  573
                  CP    PD DFG    + +       RD+V A QKSG  WALDRD+G +VW T  
Sbjct  315   GDW--CPDPAGPDYDFGTGATLFTAGQGAERRDLVGAGQKSGIFWALDRDDGSVVWSTLV  372

Query  572   gpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWST  393
             GPGG +GG  WG A D  R+Y  I N+ ++ +TL PS  V   G W A+D  TG ILW T
Sbjct  373   GPGGELGGIMWGVAVDESRIYVPIGNNGQVEYTLQPSGEVIDWGSWSALDTATGDILWQT  432

Query  392   AVPDTGLSN--PVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNG  219
               P  G     P+TVANGVL+ GS+   G V A++A+TG++LWS+    +V  G +V  G
Sbjct  433   PDPTPGAQTRGPLTVANGVLYGGSM--SGDVHALDAETGDVLWSHPADGSVNAGPAVVRG  490

Query  218   CVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
              V+ G+GY  S G G P    G +LFAF L
Sbjct  491   TVFWGSGYE-SFGIGTP----GNTLFAFDL  515



>ref|WP_013491202.1| pyrrolo-quinoline quinone repeat-containing protein [Intrasporangium 
calvum]
 ref|YP_004097607.1| pyrrolo-quinoline quinone repeat-containing protein [Intrasporangium 
calvum DSM 43043]
 gb|ADU46880.1| Pyrrolo-quinoline quinone repeat-containing protein [Intrasporangium 
calvum DSM 43043]
Length=520

 Score =   339 bits (870),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 219/519 (42%), Positives = 294/519 (57%), Gaps = 37/519 (7%)
 Frame = -1

Query  1655  SCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYF  1476
             + P    W + GGD  N R A  E KISPSTV  L  KW   AG D+SATPA+    VY 
Sbjct  28    AAPGGNGWNSAGGDRSNTRNAASETKISPSTVGDLTPKWVLTAGGDVSATPAVDGTRVYV  87

Query  1475  PSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYG  1296
             P W G LYAV+   G + W+ ++  +TG+      GN     +R+TP+    TL++G  G
Sbjct  88    PDWAGNLYAVDRMTGEVAWQASIPDITGV-----PGN----KARATPAFTDTTLVVGDQG  138

Query  1295  PAV----VIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA---  1137
             P      VI + +ATG   W+T +D +P  +IT S T ++G  YVG +S EE  S     
Sbjct  139   PFGGGGRVIALDKATGAARWVTQVDSNPGAIITQSATIFDGVVYVGVASQEEAYSALVPG  198

Query  1136  -HCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIAT  960
               CCTFRG    LD+ TG +LW+T+M P+      ++ G A+WGSSP++D  RG VYIAT
Sbjct  199   YDCCTFRGSLVALDLATGSILWKTYMTPE------DFPGVAVWGSSPAVDPKRGTVYIAT  252

Query  959   GNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYD  780
             GN Y  P+ VL C        T P     C+ PE+  DSI+ALD+ TG +KW      YD
Sbjct  253   GNNYDVPQDVLDCVAAAG---TDPVAQRACLPPEDLFDSIVALDMRTGAVKWATHAISYD  309

Query  779   VFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGST-RDIVVAVQKSGFAWALDRD  603
              + ++CI  + + NCP    PD DFG+AP +  V    +  R+++ A QKSG  WALD D
Sbjct  310   AWTVSCIFGNPS-NCPSPAGPDYDFGQAPALFKVASGPAKGRELLGAGQKSGQYWALDPD  368

Query  602   NGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMD  423
              G +VW T+AGPGG  GG  WG+A D  R+YT+ ANSN + F   P  +    G W A+D
Sbjct  369   TGAVVWETQAGPGGTAGGLQWGSAVDGRRIYTANANSNLVEF---PDGSGDTSGVWSALD  425

Query  422   AQTGKILWSTAVPDTG-LSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATV  246
               TG ILW T     G  S P T ANGV+F  ++   G ++A++A TGEILWS+ +G + 
Sbjct  426   PSTGAILWQTRPTHGGSTSGPATTANGVVFGCALDADGYMYALDAATGEILWSFESGGSC  485

Query  245   YGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
               G ++SNG VY G+GY  + G G    T    L+AF L
Sbjct  486   LSGAAISNGMVYWGSGYS-NFGFG----TANNKLYAFGL  519



>ref|WP_028785649.1| polyvinylalcohol dehydrogenase [Terracoccus sp. 273MFTsu3.1]
Length=518

 Score =   333 bits (854),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 216/512 (42%), Positives = 292/512 (57%), Gaps = 38/512 (7%)
 Frame = -1

Query  1634  WLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYL  1455
             W + GGD  N RYA  E KIS +TV  L  KWE   G D+SATPA+    VY P W G L
Sbjct  35    WNSAGGDRQNTRYAASETKISAATVGGLTKKWELTTGGDVSATPAVDGSRVYVPDWAGNL  94

Query  1454  YAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLII----GIYGPAV  1287
             YAVN S G+++W+R +   TG+             +R+TP++    ++I       G   
Sbjct  95    YAVNRSTGAIVWQRTITSYTGIPGD---------KARATPAVTDSAIVIGNQGPFGGGGA  145

Query  1286  VIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAH---CCTFRG  1116
             V+ + + TG LLW T ++ HPA +IT S T ++G  YVG +S EE  S +    CC+FRG
Sbjct  146   VMAIDKNTGALLWKTQVESHPAAIITQSATVFDGVVYVGVASQEEAFSASGGYPCCSFRG  205

Query  1115  RFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPK  936
               A LD+ TG +LW+T++ P        Y G A+WGSSPSID  RG VYIATGN Y  P 
Sbjct  206   SMAALDLRTGVILWKTYLTPVG------YPGNAVWGSSPSIDTKRGSVYIATGNNYDVPD  259

Query  935   HVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACIN  756
               L C     +          C+  +++ DSIL+LDL TG IKW  Q   +D + + CI 
Sbjct  260   ATLDCVAAAASD----AAKRACLPADDYFDSILSLDLRTGAIKWATQALPFDAWTVGCIP  315

Query  755   -SSSTPNCPPGPNPDADFGEAPMMLSVV-VNGSTRDIVVAVQKSGFAWALDRDNGEMVWY  582
                   NCP    PD DFG+AP + +V    G + D+V A QKSG  WAL  D+G ++W 
Sbjct  316   FFGDGVNCPEPAGPDYDFGQAPNLYTVKDATGRSVDVVGAGQKSGQYWALRADSGALIWR  375

Query  581   teagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKIL  402
             T+AGPGG  GG  WG+A D +RVYT+ ANSN + +   PS   T  G W  +DA TG ++
Sbjct  376   TQAGPGGTAGGLQWGSAVDGKRVYTANANSNAVPWG--PSGLTT--GVWSGLDAVTGALV  431

Query  401   WSTAVPDTG-LSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVS  225
             W T  P+ G  S PVT ANGV+F  S+  +G ++A+NA TG +LW++ +G +   G ++S
Sbjct  432   WETRPPNGGSTSGPVTTANGVVFGCSLDAQGHMYALNAVTGAVLWTFASGGSCLSGAAIS  491

Query  224   NGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             NG VY G+GY  + G G P       L+AF L
Sbjct  492   NGTVYWGSGYS-NFGFGTP----NNKLYAFGL  518



>ref|WP_035356940.1| hypothetical protein, partial [Edaphobacter aggregans]
Length=517

 Score =   332 bits (852),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 211/530 (40%), Positives = 295/530 (56%), Gaps = 50/530 (9%)
 Frame = -1

Query  1724  VCIIIFLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKL  1545
             +C+++ +  +SA ++ +  +       SG W   G D+ N R    E  I P+ V  LK 
Sbjct  16    ICVLLLVSALSAQSQSDVSL-------SGQWQEAGQDLNNTRSQPAEYSIGPANVKGLKP  68

Query  1544  KWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGN  1365
             KW F A  D+SATP +    VYFP W G+L+AVN   G ++W   +             +
Sbjct  69    KWVFKASGDVSATPTVADDAVYFPDWGGHLFAVNKDSGQVIWNHKISAYD---------S  119

Query  1364  VTAIVSRSTPSIVGETLIIG------IYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMS  1203
             V   VSR +P +  + LIIG      ++  A VI V R TG+L W+T +D HPA +IT S
Sbjct  120   VAGSVSRVSPVVDHDQLIIGDILSSQVHDGANVISVDRETGELRWITHVDSHPAAIITGS  179

Query  1202  GTYYNGAFYVGTSSLEEGSS---KAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGE  1032
                ++G  YVG SSLEEG +      CC+FRG    L+  TG++LW+T+ +P+N G+ G 
Sbjct  180   PVVFDGVVYVGVSSLEEGLATNLDYPCCSFRGSVVALNAKTGQMLWKTYDMPENGGQPGG  239

Query  1031  YAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENH  852
             Y+G A+W   P+ID  RG +++ TGN Y+ P  V  CQ         PT +  C   ++ 
Sbjct  240   YSGGAVW-QPPAIDPKRGLLFVGTGNNYTVPAAVEACQNAD------PTAN--CAAADDF  290

Query  851   SDSILALDLDTGKIKWFRQLGGYDVFFIACINSSST-PNCPPGPNPDADFGEA-PMMLSV  678
              D+ LALDL TG+IKW ++L G+D + +AC+    T PNCP   +PD DFG A P  L  
Sbjct  291   FDTALALDLKTGQIKWAKRLQGFDTWTVACLRPPGTNPNCPVPTSPDFDFGGAGPNFLG-  349

Query  677   VVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIA  498
                    +I+   QKSG  WALD D G +VW      G    G  WG ATD +R+Y  IA
Sbjct  350   -------NIIGFGQKSGIYWALDPDTGNIVW--STPVGPGGTGIGWGTATDGKRIYVEIA  400

Query  497   NSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSN--PVTVANGVLFAGSV  324
             N+  L +TL+PS      G W A+D  TGKILW TA P  G  +   V+VANGV++AGS 
Sbjct  401   NNGHLPYTLVPSGQQIAWGSWSALDVATGKILWQTADPTVGTIDIGSVSVANGVMYAGSY  460

Query  323   HPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAG  174
                G ++A++ KTG ILW++ +G +V  G S+ +G VY G+GYR   G G
Sbjct  461   --SGQMYALDTKTGTILWNFASGGSVIDGPSIVDGVVYWGSGYRRMAGIG  508



>emb|CDI02935.1| Pyrrolo-quinoline quinone repeat-containing protein [Candidatus 
Competibacter denitrificans Run_A_D11]
Length=548

 Score =   330 bits (846),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 205/530 (39%), Positives = 286/530 (54%), Gaps = 50/530 (9%)
 Frame = -1

Query  1646  ASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSW  1467
             A   WL  G D++N R+   E  I P+    L ++W+F  G D+SATPA+ +   YFP W
Sbjct  38    ADSRWLTAGHDLHNTRFQNEERTIGPNNAPALTVRWQFATGGDVSATPAVDEQATYFPDW  97

Query  1466  NGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGP--  1293
              G L+AV+   G  LW R +   TG         +   ++R+TP++ G+ LI G      
Sbjct  98    AGNLFAVDRHTGKQLWSRRVADYTG---------IAGDLARATPAVGGDKLIFGNQSARR  148

Query  1292  ----AVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSS----KA  1137
                 A V+ V + TGDLLW T +D HPA +IT +    NG  YVG SS EE  +      
Sbjct  149   QPSTAWVMAVDKRTGDLLWKTQVDAHPAAIITQAAIVANGVVYVGVSSWEEAYAVLVPNY  208

Query  1136  HCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATG  957
              CCTFRG    LD  TG++LW+   +P+       Y+G AIWGS+  +DA R  +Y+ TG
Sbjct  209   QCCTFRGSMVALDEHTGQILWKWHTVPEG------YSGGAIWGSTAVLDAARRSLYVTTG  262

Query  956   NLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDV  777
             N Y+ P+ V +C         +P     C+ P+NH DS++ALD  TG +KW   +  +D 
Sbjct  263   NNYTVPEAVRQCVAGAQG---SPQAQRACIAPDNHFDSVVALDPSTGAVKWANTVLPFDA  319

Query  776   FFIACINS-SSTPNCPPGPNPDADFGEAPMMLSVVV--NGSTRDIVVAVQKSGFAWALDR  606
             +   CI    +  NCP    PD DFG+ P + +V +   G  R ++ A QKSG  WA D 
Sbjct  320   WNAGCIPELGNDSNCPQPAGPDYDFGQGPALFTVRIPETGRLRQLLGAGQKSGQYWAFDP  379

Query  605   DNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLP---SKNVTIGGG-  438
             D G +VW T+ GPGG  GG  WG+A D +R+YT++AN+   ++TL+    S   TI  G 
Sbjct  380   DTGAVVWMTQVGPGGQGGGLQWGSAVDGQRIYTAVANTENKSWTLIQNGKSTTTTINSGL  439

Query  437   WVAMDAQTGKILWSTAVPDTGLSN---------PVTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TG ILW  A  D+G+           PVTVAN V++A S+   G ++A +A T
Sbjct  440   WSALDAATGIILWQVA--DSGIGRDGQPAPTMAPVTVANNVVYACSLDQAGSMYAFHATT  497

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAF  135
             G +LW Y +G    GG +VS+G +Y G+GY    G   P    G   FAF
Sbjct  498   GAVLWKYASGNVCLGGAAVSDGTIYWGSGYGNFTGQATP----GNKFFAF  543



>ref|WP_033412672.1| polyvinylalcohol dehydrogenase, partial [Segetibacter koreensis]
Length=528

 Score =   327 bits (839),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 204/527 (39%), Positives = 299/527 (57%), Gaps = 50/527 (9%)
 Frame = -1

Query  1634  WLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYL  1455
             WL  G ++ N R A  EN +S   VS L +KW F    D+SATPA+ +  VYFP W G L
Sbjct  22    WLMGGQNLNNTRNAVEENTLSAKNVSDLTVKWTFTTSGDVSATPAVDEDGVYFPDWGGNL  81

Query  1454  YAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGI-----YGPA  1290
             Y VN++ G+ +W + ++  TG    V+       ++R+TP++ G TL+IG      +  A
Sbjct  82    YKVNSATGAQVWSKMIKDYTG---QVKG------LARATPALSGNTLVIGTQLGFPFEGA  132

Query  1289  VVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAH---CCTFR  1119
              V+G+ + TG LLW T ++ HP  ++T S T  +G  YVG +S EEG +  +   CC+FR
Sbjct  133   YVLGINKMTGALLWKTKVEDHPLSIVTQSATINDGKVYVGVASQEEGFAADNSYPCCSFR  192

Query  1118  GRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAP  939
             G    LD+ +G ++W+T+MLP+ KG    +AG A+WGS+P +D  R  ++I TGN Y  P
Sbjct  193   GSMLCLDLSSGHIIWKTYMLPEGKG----FAGNAVWGSTPVVDMKRNSLFITTGNNYKVP  248

Query  938   KHVLKCQEKQNNKTTTPTTSDKCVE-----PENHSDSILALDLDTGKIKWFRQLGGYDVF  774
             + +L C+          T    C+E      EN+ D+I+A+DL TG IKW +    +D +
Sbjct  249   QAILDCRAVGGGAAAVKT----CIEAVPGSAENYIDAIVAIDLKTGAIKWTKSALPFDAW  304

Query  773   FIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGE  594
              +AC    S  NCP    PD DFG+ P + S     + R+++ A QKSG  WA+D DNG 
Sbjct  305   TVACFIPGSA-NCPENAGPDYDFGQGPALFSAGTGANKRELLGAGQKSGTYWAVDPDNGA  363

Query  593   MVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLP---SKNVTIGGGWVAMD  423
              VW TE GPG  +GG  WG+A D++++YT++AN   +   +     + N   GG W A+D
Sbjct  364   EVWRTEVGPGSSLGGLEWGSAVDDKQIYTAVANYYYIPHLMTKGPGAGNTVKGGFWAALD  423

Query  422   AQTGKILWSTA-------VPDTGLSNP----VTVANGVLFAGSVHPRGPVFAINAKTGEI  276
             A TG + W  A        P  G + P    VT+ANGV+F G++  +G ++A+NA TGE 
Sbjct  424   ATTGVLNWEYAADKLPAIAPPPGTTAPNLGMVTIANGVMFGGALDEKGTMYALNAATGEK  483

Query  275   LWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAF  135
             LWS+ +G +V  G +V  G VY G+GY  + G G P       L+AF
Sbjct  484   LWSFESGGSVNSGAAVVKGNVYWGSGYS-NFGLGTP----NNKLYAF  525



>ref|XP_002963759.1| hypothetical protein SELMODRAFT_438508 [Selaginella moellendorffii]
 gb|EFJ35630.1| hypothetical protein SELMODRAFT_438508 [Selaginella moellendorffii]
Length=604

 Score =   323 bits (827),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 219/501 (44%), Positives = 289/501 (58%), Gaps = 63/501 (13%)
 Frame = -1

Query  1676  EWHITRFSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAI  1497
             + H    +C  +G W++HGGD+ NRR+A  E+ IS     +L  +W F AG DISATPAI
Sbjct  133   QHHEVESNC-QTGEWISHGGDLKNRRFAEDEHLISVGHAPQLSERWNFDAGADISATPAI  191

Query  1496  LKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGET  1317
                VVYF SWNG ++AV+   G LLW  NL ++T +          A +SR+TP++  + 
Sbjct  192   CDCVVYFHSWNGLVFAVSIQ-GQLLWRVNLTEITRV----------ATLSRTTPAVTEDL  240

Query  1316  LIIGIYGPAVVIGVKRATGDLLWMTL-LDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSK  1140
             L+ G+ G A V+ ++R +G L+WM+  LD      ITMSGT Y+GAFYVG SS +E   +
Sbjct  241   LLYGLLGSARVVALERKSGRLVWMSEDLDETARARITMSGTAYDGAFYVGISSRQE-LVE  299

Query  1139  AHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIAT  960
             A CCTF+G F KLD+  GK +W+T+M P+N G      G A+  S PS D+      +A 
Sbjct  300   ATCCTFQGSFQKLDLKNGKRIWRTYMAPENSGSTALQFGEAVLPSIPSEDSSS----LAL  355

Query  959   GNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYD  780
             G                    T+ T+     E    + +IL     T  + + R+L    
Sbjct  356   G--------------------TSATSRTASTETPTRATAILPASATT--LLYGRRL----  389

Query  779   VFFIACINSSSTPNCPPGPNP--DADFGEAPMMLSVVVNGST---RDIVVAVQKSGFAWA  615
                 AC       N PP P P  D DFGE+PM+L++    S    +DIVV  QKSG  WA
Sbjct  390   ----ACDT-----NPPPAPEPGLDYDFGESPMLLTIPSRYSKNKFQDIVVTGQKSGIVWA  440

Query  614   LDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGW  435
              DRD+G +VW T AGPGG VGG  WGAATDN RVYT+IANS+R  F  +PS   T  GGW
Sbjct  441   HDRDDGSLVWETTAGPGGSVGGAIWGAATDNHRVYTNIANSDRATFQHVPSGESTTAGGW  500

Query  434   VAMDAQTGKILWSTAVPDTGLS-NPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYT  258
             VAM+A TG+I WSTA P +  +  PVTVANGV+F GS    G V A++A++G ILW   T
Sbjct  501   VAMEAATGRIEWSTANPHSARAYGPVTVANGVVFCGSFDKDGHVLALDAESGRILWERTT  560

Query  257   GATVYGGMSVSNGCVYVGNGY  195
             G+TVYGG SV     ++G GY
Sbjct  561   GSTVYGGPSVG----HIGTGY  577



>ref|WP_026292022.1| polyvinylalcohol dehydrogenase [Marinobacterium rhizophilum]
Length=517

 Score =   320 bits (820),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 203/514 (39%), Positives = 284/514 (55%), Gaps = 36/514 (7%)
 Frame = -1

Query  1637  NWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGY  1458
             +W++ GG+  N R+   E+ +S   V+ L  KW    G D+SATPA+    VY P W G 
Sbjct  27    DWISAGGNRQNTRHQQAEHTLSVENVNGLIQKWVLQTGGDVSATPAVDADTVYVPDWAGN  86

Query  1457  LYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGP----A  1290
             LYAV+   G++ W+ ++ ++TGL             +R+TP++  + +IIG  GP     
Sbjct  87    LYAVDKLTGAVRWQVSIAEVTGLPGD---------KARATPAVTEDKVIIGTQGPFGNGG  137

Query  1289  VVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSK---AHCCTFR  1119
              ++   + TG  LW T  D HPA +IT S T ++G  YVG SS EE  +     +  +FR
Sbjct  138   KILAFDKFTGQTLWSTQADSHPAAIITQSATVFDGRVYVGVSSQEEALAAFIPGYVLSFR  197

Query  1118  GRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAP  939
             G    LD+ TG +LW+T+M P        Y G A+WGSSP+ID  RG VYIATGN YS P
Sbjct  198   GSMLALDLETGAILWKTYMAPQG------YTGNAVWGSSPAIDTRRGQVYIATGNNYSVP  251

Query  938   KHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACI  759
               VL C          P     C+  +NH DSILALD+ TG I+W  +   YD + + C+
Sbjct  252   DDVLDCVAAAGGD---PVAKSACLPADNHFDSILALDMKTGAIRWATRATPYDAWTLDCV  308

Query  758   NSSSTPN-CPPGPNPDADFGEAPMMLSVV-VNGSTRDIVVAVQKSGFAWALDRDNGEMVW  585
                   + CP    P  DF +AP +  +    G   D+V A QKSG  W LD D G + W
Sbjct  309   PFLGDGSLCPDPAGPGYDFAQAPALFRIKGTMGKPLDVVGAGQKSGQYWTLDADTGAVRW  368

Query  584   YteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKI  405
              T+AGPGG  GG  WG+A D +R+YT+ ANS+  ++T LP  + T  G W AMD  +G++
Sbjct  369   VTQAGPGGSKGGLQWGSAVDGQRIYTANANSDLEDWT-LPDGSTTTNGVWSAMDTSSGEL  427

Query  404   LWSTAVPDTG--LSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMS  231
             LW    P  G   S PVT ANGV+F  S+ P G ++A+N  TGE LWS+ +G +   G +
Sbjct  428   LWQV-TPSWGGSTSGPVTTANGVVFGCSLDPEGHMYALNGATGEELWSFASGGSCLSGAA  486

Query  230   VSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             +S+G ++ G+GY  + G G    T    L+AF L
Sbjct  487   ISDGMLFWGSGYS-NFGLG----TSNNKLYAFGL  515



>gb|EXX51333.1| hypothetical protein RirG_262810 [Rhizophagus irregularis DAOM 
197198w]
Length=529

 Score =   320 bits (819),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 207/499 (41%), Positives = 286/499 (57%), Gaps = 27/499 (5%)
 Frame = -1

Query  1637  NWLNHGGD-IYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNG  1461
             +WL+ GG  I N R    E  ISP  V  LK+K+    G  +SATP   +  +YFP W+G
Sbjct  26    DWLSFGGTGINNNRNGDEEEIISPINVGSLKVKFIVETGSSVSATPVTFQNNIYFPDWSG  85

Query  1460  YLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSI--VGETLIIGIY----  1299
              LY+VNA  G + W  N+       + +   +   ++SR+T +I  V + L+ G      
Sbjct  86    NLYSVNAQTGQINWAYNISL-----SYIPQPSDPRVLSRTTIAIDPVEKLLVFGTQVSDN  140

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA----HC  1131
             G    I      G L+W TLLD HP  +IT S T Y+G  YVG SS EE +S +     C
Sbjct  141   GSNPYIVAVDLDGRLVWSTLLDNHPHAIITQSATIYDGGVYVGVSSKEEAASSSIPNYQC  200

Query  1130  CTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNL  951
             CTFRG F KLD+ TG ++W+TFMLPDN G+   Y+G A+WGS+P+ID     VYIATGN 
Sbjct  201   CTFRGSFVKLDLKTGNIIWKTFMLPDNNGRSDLYSGNAVWGSAPAIDPVNKLVYIATGNN  260

Query  950   YSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             Y  P +V  C     N         KC +P NH D+ILAL++DTG+I W R+  G D + 
Sbjct  261   YETPSYVADCVANATNSVDMM----KCHDPNNHFDAILALNIDTGEIVWSRKTAGLDNWT  316

Query  770   IACINSSSTP-NCPPGPNPDADFGEAPMMLSVVV-NGSTRDIVVAVQKSGFAWALDRDNG  597
             +AC+ + + P NCP    PD DFG+AP++++    +G    +V+A  KSG  WAL+   G
Sbjct  317   VACVFNQTNPQNCPTPAGPDYDFGQAPLLVNTCYSSGECIQLVIATAKSGITWALNAATG  376

Query  596   EMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTL---LPSKNVTI-GGGWVA  429
             E++W T +GPG   GG  +G ATD +R + S AN+N L + L    P    TI  G  VA
Sbjct  377   EIIWSTNSGPGAVGGGSLFGCATDGKRYFVSQANANNLQYVLDKPAPGSPSTIYSGAIVA  436

Query  428   MDAQTGKILWSTAVP-DTGLSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGA  252
             +D  TG ILW TA    +G + P++ +NGV++  S    G +FA+NA+TGE L+ + T  
Sbjct  437   LDITTGGILWQTANKLQSGGTAPISYSNGVVYYPSYDTNGTLFALNAETGETLFEFQTIG  496

Query  251   TVYGGMSVSNGCVYVGNGY  195
              +  G S+ NG VYVG+GY
Sbjct  497   ALNCGPSIVNGVVYVGSGY  515



>ref|XP_002974840.1| hypothetical protein SELMODRAFT_442586 [Selaginella moellendorffii]
 gb|EFJ24360.1| hypothetical protein SELMODRAFT_442586 [Selaginella moellendorffii]
Length=457

 Score =   316 bits (809),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 221/511 (43%), Positives = 288/511 (56%), Gaps = 77/511 (15%)
 Frame = -1

Query  1643  SGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWN  1464
             +G W++HGGD+ NRR+A  E+ IS      L+ KW F AG DISATPAI   VVYFPSWN
Sbjct  18    TGEWISHGGDLKNRRFAEDEHLISVWRAPHLREKWSFDAGADISATPAIYDCVVYFPSWN  77

Query  1463  GYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVV  1284
             G ++AV    G LLW  NL ++TG+          A +SR+ P++  E L+ G+ GPA  
Sbjct  78    GLVFAVTIH-GELLWSTNLTEITGV----------ATLSRTIPAVTEELLLYGLLGPARG  126

Query  1283  IGVKRATGDLLWMTL-LDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFA  1107
             + + R  G ++WM+  LD  P   ITMSGT                       T+ G F 
Sbjct  127   VALHRKNGRMVWMSEDLDETPLARITMSGT-----------------------TYDGAFY  163

Query  1106  KLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVL  927
                                           +WGSSPSID  RG  +I TGNLY  P  V 
Sbjct  164   -----------------------------VVWGSSPSIDPKRGLAFIGTGNLYQIPSDVQ  194

Query  926   KCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSS  747
              C  +  N       S  C       D+++A+++  G+I+W  +LGG DV+ +AC  +  
Sbjct  195   DCLNRNAN-------SSDCYPRGVCDDAVVAVNMPDGEIRWCNRLGGNDVWRLACDTNPP  247

Query  746   TPNCPPGPNPDADFGEAPMMLSVVVNGST---RDIVVAVQKSGFAWALDRDNGEMVWYte  576
               NCPP P PD D GE+PM+L++    S    +DI+V  QKSG  WA DRD+G + W   
Sbjct  248   PANCPPEPGPDYDLGESPMLLTIPSRFSKNKFQDILVTGQKSGIVWAHDRDDGSLAWEKT  307

Query  575   agpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWS  396
             AGPGGFVGG  WGAATDN RVYT+IANS+R  F L+PS   T  GGWVAMDA TG+I WS
Sbjct  308   AGPGGFVGGAIWGAATDNHRVYTNIANSDRATFQLVPSGGSTTAGGWVAMDAATGRIEWS  367

Query  395   TAVPDTGLS-NPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNG  219
             TA P +  +  PVTVANGV+F GS    G V A++A++G ILW   TG+TVYG +SV + 
Sbjct  368   TANPHSARAYEPVTVANGVVFCGSFDKDGHVLALDAESGRILWERTTGSTVYGRLSVGHE  427

Query  218   CVYVGNGY-RVSIGAGIPIFTGGTSLFAFCL  129
             C +VG GY R  +GA +   T G+ L+AFC+
Sbjct  428   CWFVGTGYSRDPLGAALG-GTPGSELYAFCV  457



>gb|EXX76536.1| hypothetical protein RirG_032350 [Rhizophagus irregularis DAOM 
197198w]
Length=532

 Score =   315 bits (808),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 204/513 (40%), Positives = 292/513 (57%), Gaps = 39/513 (8%)
 Frame = -1

Query  1637  NWLNHGGD----IYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPS  1470
             +WL+ GG     I N R +  E  ISP  V  LK+K+       +SATP   +  VYFP 
Sbjct  25    DWLSFGGTGENNINNNRNSDAEKIISPKNVGSLKVKFIIPVESSVSATPVTFQNNVYFPD  84

Query  1469  WNGYLYAVNASDGSLLWERNLQKL-----TGLNATVRTGNVTAIVSRSTPSIVGETLIIG  1305
             W G+LY+ NA  G + W+ N+ K      +   A  RT    AI  +    + G   I G
Sbjct  85    WAGFLYSANARTGEINWKINITKTYLPQPSDPRAISRT--TLAIDPKEKLIVFGTQNISG  142

Query  1304  IYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAH---  1134
               G  + I +    G L+W TL+D HP  +IT S T ++ A Y+G SS EEG++      
Sbjct  143   GSGFVIAIDLY---GKLVWRTLIDEHPYAVITQSPTIFDNAVYIGVSSAEEGAASTVPGY  199

Query  1133  -CCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATG  957
              CC+FRG FAKLD+ TGKV+W+TFM+PDN G+   Y+G A+WGS+P+ID  +  VYIATG
Sbjct  200   VCCSFRGSFAKLDLKTGKVIWRTFMVPDNYGRPDLYSGNAVWGSAPAIDPIKKLVYIATG  259

Query  956   NLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDV  777
             N Y  P++V  C        TTP     C +P N  D+ILALD++ G +KW  +L  +D 
Sbjct  260   NNYEIPENVTNCI----TNATTPEQKSACHDPNNFLDAILALDIEKGDVKWVTRLSSFDS  315

Query  776   FFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRD-----IVVAVQKSGFAWAL  612
             + +AC++ ++  NCP    PD DF +AP++    VN  ++      + +A  KSG  WAL
Sbjct  316   WTVACLSGTNPQNCPDPAGPDYDFAQAPLL----VNACSKSNDCILLAIATAKSGITWAL  371

Query  611   DRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLL----PSKNVTIG  444
             +   G+++W+ E+GPGG  GG  +G+ATD +  + S +NS    +        S+  T G
Sbjct  372   NAATGKIIWFVESGPGGVGGGSMFGSATDGKHYFVSQSNSRGKAYVFTKPSPKSQPATFG  431

Query  443   GGWVAMDAQTGKILWSTAVP--DTGLSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILW  270
             G  V++D  TG+ILW TA P  D G++ PV+ +NGV++ GS    G +FA++A+ G IL 
Sbjct  432   GAIVSIDILTGEILWQTANPTQDKGVA-PVSYSNGVVWYGSNDDNGHLFALDAENGNILL  490

Query  269   SYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGI  171
              + TG TV  G S+ NG VY G+GY V  G G+
Sbjct  491   DFVTGGTVACGPSIVNGIVYAGSGY-VRFGGGV  522



>gb|ERZ95657.1| hypothetical protein GLOINDRAFT_331141 [Rhizophagus irregularis 
DAOM 181602]
Length=537

 Score =   311 bits (798),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 200/504 (40%), Positives = 287/504 (57%), Gaps = 38/504 (8%)
 Frame = -1

Query  1637  NWLNHGGD----IYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPS  1470
             +WL+ GG     I N R +  E  ISP  V  LK+K+       +SATP   +  VYFP 
Sbjct  25    DWLSFGGTGENNINNNRNSDAEKIISPKNVGSLKVKFIIPVESSVSATPVTFQNNVYFPD  84

Query  1469  WNGYLYAVNASDGSLLWERNLQKL-----TGLNATVRTGNVTAIVSRSTPSIVGETLIIG  1305
             W G+LY+ NA  G + W+ N+ K      +   A  RT    AI  +    + G   I G
Sbjct  85    WAGFLYSANARTGEINWKINITKTYLPQPSDPRAISRT--TLAIDPKEKLIVFGTQNISG  142

Query  1304  IYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAH---  1134
               G  + I +    G L+W TL+D HP  +IT S T ++ A Y+G SS EEG++      
Sbjct  143   GSGFVIAIDLY---GKLVWRTLIDEHPYAVITQSPTIFDNAVYIGVSSAEEGAASTVPGY  199

Query  1133  -CCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATG  957
              CC+FRG FAKLD+ TGKV+W+TFM+PDN G+   Y+G A+WGS+P+ID  +  VYIATG
Sbjct  200   VCCSFRGSFAKLDLKTGKVIWRTFMVPDNYGRPDLYSGNAVWGSAPAIDPIKKLVYIATG  259

Query  956   NLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDV  777
             N Y  P++V  C        TTP     C +P N  D+ILALD++ G +KW  +L  +D 
Sbjct  260   NNYEIPENVTNCI----TNATTPEQKSACHDPNNFLDAILALDIEKGDVKWVTRLSSFDS  315

Query  776   FFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRD-----IVVAVQKSGFAWAL  612
             + +AC++ ++  NCP    PD DF +AP++    VN  ++      + +A  KSG  WAL
Sbjct  316   WTVACLSGTNPQNCPDPAGPDYDFAQAPLL----VNACSKSNDCILLAIATAKSGITWAL  371

Query  611   DRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLL----PSKNVTIG  444
             +   G+++W+ E+GPGG  GG  +G+ATD +  + S +NS    +        S+  T G
Sbjct  372   NAATGKIIWFVESGPGGVGGGSMFGSATDGKHYFVSQSNSRGKAYVFTKPSPKSQPATFG  431

Query  443   GGWVAMDAQTGKILWSTAVP--DTGLSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILW  270
             G  V++D  TG+ILW TA P  D G++ PV+ +NGV++ GS    G +FA++A+ G IL 
Sbjct  432   GAIVSIDILTGEILWQTANPTQDKGVA-PVSYSNGVVWYGSNDDNGHLFALDAENGNILL  490

Query  269   SYYTGATVYGGMSVSNGCVYVGNG  198
              + TG TV  G S+ NG VY G+G
Sbjct  491   DFVTGGTVACGPSIVNGIVYAGSG  514



>ref|WP_034801302.1| hypothetical protein [Intrasporangium oryzae]
 gb|EWT03181.1| polyvinylalcohol dehydrogenase [Intrasporangium oryzae NRRL B-24470]
Length=522

 Score =   309 bits (791),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 202/523 (39%), Positives = 289/523 (55%), Gaps = 55/523 (11%)
 Frame = -1

Query  1637  NWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGY  1458
             +W   G D  N R    +  ISP     L  KW F    D+SATPA++   VYFP W GY
Sbjct  34    SWTMGGHDYANSRSNPAQTAISPGNARLLATKWTFTTHGDVSATPAVVGKAVYFPDWGGY  93

Query  1457  LYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYG------  1296
             L  V+A+ G+L+W++ L    G N      +   +VSR++P++VG+ + IG  G      
Sbjct  94    LNKVDATTGTLVWQKKLSDY-GYN------DDPTLVSRTSPAVVGDVVYIGDQGGGSFLT  146

Query  1295  --PAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSK----AH  1134
               PA ++ +   TG+LLW ++++     +IT S    NG  YVG +S EE  +       
Sbjct  147   PRPARLLAINANTGELLWSSVINPSIYSIITQSPIVRNGVIYVGAASAEENVAAFIPGYE  206

Query  1133  CCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGN  954
             CCTFRG F+ +D  +G+V+W T+ +P+       Y+G A+WGS+P+IDA  G VYI TGN
Sbjct  207   CCTFRGSFSAVDAASGQVIWTTYTVPEG------YSGGAVWGSTPAIDAKTGAVYITTGN  260

Query  953   LYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVF  774
              YS P  V +CQ    +         +C++P +H D+++ALD  TG +KW   + G+D +
Sbjct  261   NYSVPPAVKQCQLDGGSPA-------QCLDPSDHVDAVMALDPATGLVKWSTGVQGFDDW  313

Query  773   FIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGE  594
              ++CI     PNCP    PD DFG  P + S   NG  RD+V A  KSG  WALD   GE
Sbjct  314   IVSCI--VGVPNCPVAAGPDFDFGSGPNLFSATTNGKKRDLVGAGAKSGIYWALDATTGE  371

Query  593   MVWYteagpggfvgggtwgaaTDNERVYTSIANSNRL---NFTLLPSKNVTIGGGWVAMD  423
             +VW T+AGPG  +GG  WG ATD +R+Y + AN NR    N + LP+      G + A+D
Sbjct  372   IVWSTQAGPGSTLGGIEWGTATDGKRIYVAEANWNRQPYPNGSTLPAY-----GSFAALD  426

Query  422   AQTGKILWSTAVPDTGLSNP---VTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGA  252
               +G++LW   VPD    +P   V+V+NGVL+ GS+   G ++A +A TG IL       
Sbjct  427   PASGQVLWQ--VPDPSADSPLGAVSVSNGVLYGGSMS--GHMYAFDAATGAILKDLVGEG  482

Query  251   TVYGGMSVSN-GCVYVGNGYRVSIGAGIPIFTGGTSLFAFCLE  126
             +   G ++SN G VY GNGY    G G P     T+ +AF ++
Sbjct  483   SSNAGPAISNQGVVYWGNGYG-RFGLGTP----STTFYAFSIK  520



>emb|CBI22177.3| unnamed protein product [Vitis vinifera]
Length=251

 Score =   297 bits (761),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 166/210 (79%), Gaps = 1/210 (0%)
 Frame = -1

Query  1661  RFSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVV  1482
             +FS      WLNHGGD+YNRRYA  E KISP T SKL+LKWEFYAGKDI+ATPAI  G +
Sbjct  4     KFSQKEPAEWLNHGGDLYNRRYASTETKISPETASKLRLKWEFYAGKDITATPAIFNGTL  63

Query  1481  YFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGI  1302
             YFPSWNGYLYAV ASDGSL+W++NLQKLTGLNAT    NV   VSR+TP+I G+ LIIGI
Sbjct  64    YFPSWNGYLYAVKASDGSLVWKQNLQKLTGLNATGFVNNVNWTVSRATPTIAGDMLIIGI  123

Query  1301  YGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTF  1122
             YGPAVVI VK+AT  L+W T LD +PAG++TMS T++ G FYVGTSSLEEG S   CC F
Sbjct  124   YGPAVVIAVKQATERLVWSTQLDSNPAGVVTMSETFHMG-FYVGTSSLEEGLSIEQCCIF  182

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGE  1032
             RG  +KLD+ TG +LWQTF LPDN G+RGE
Sbjct  183   RGSLSKLDIKTGALLWQTFTLPDNHGERGE  212



>emb|CBI22175.3| unnamed protein product [Vitis vinifera]
Length=535

 Score =   307 bits (786),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 168/251 (67%), Positives = 201/251 (80%), Gaps = 6/251 (2%)
 Frame = -1

Query  1088  GKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQ  909
             GK++W+ F + +   K    AGAAIWGSSPSID  R  VY+ATGNLYSAP  + +CQE+Q
Sbjct  290   GKLVWEDFNIME---KANGIAGAAIWGSSPSIDVRRNLVYVATGNLYSAPLSIRECQEQQ  346

Query  908   NNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPP  729
             NN+T  PT  D+C+EP+NHS+SILA+DLD+ KIKW+RQLGGYD +F+AC N+ STPNCPP
Sbjct  347   NNQTV-PTQPDQCIEPDNHSNSILAIDLDSDKIKWYRQLGGYDAWFLAC-NNLSTPNCPP  404

Query  728   GPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgg  549
             GPNPDADFGEAPMMLS+ VNG+ RDIV+AVQKSGF WALDR+NG ++W TEAGPGG  GG
Sbjct  405   GPNPDADFGEAPMMLSIYVNGTMRDIVIAVQKSGFVWALDRNNGSLIWATEAGPGGLSGG  464

Query  548   gtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLS  369
             GTWGAATD  +VYT+I NS+  NFTL PS+  T  GGWVAM+A TGKILWSTA P    S
Sbjct  465   GTWGAATDGIKVYTNIVNSDSKNFTLKPSEKNTTAGGWVAMEAGTGKILWSTANPSNATS  524

Query  368   N-PVTVANGVL  339
             N PVT+ANG +
Sbjct  525   NGPVTIANGAI  535



>ref|WP_011687395.1| pyrrolo-quinoline quinone [Candidatus Solibacter usitatus]
 ref|YP_826945.1| pyrrolo-quinoline quinone [Candidatus Solibacter usitatus Ellin6076]
 gb|ABJ86660.1| Pyrrolo-quinoline quinone [Candidatus Solibacter usitatus Ellin6076]
Length=513

 Score =   305 bits (782),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 204/548 (37%), Positives = 293/548 (53%), Gaps = 51/548 (9%)
 Frame = -1

Query  1736  LYYCVCIIIFLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACGENKISPSTVS  1557
             +   + +++F + ++ +  P+        PA   W   G D+ + R    E KI  S V 
Sbjct  1     MKLSIILVLFALALTISLYPQ-------GPAD-QWTIAGQDLADSRSQPSETKIGVSNVG  52

Query  1556  KLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATV  1377
              L +KW+F    D+SATP I    VYFP W G L+A+  +DGS+LW   +    G     
Sbjct  53    NLAVKWKFTTESDVSATPTIDGDAVYFPDWAGNLFALKKTDGSILWSHKVADYDGF----  108

Query  1376  RTGNVTAIVSRSTPSIVGETLIIG-------IYGPAVVIGVKRATGDLLWMTLLDRHPAG  1218
                  T  +SR +P+I G  +IIG        +  A +I V R TG L W T +D H A 
Sbjct  109   -----TGAISRVSPAIHGNDIIIGDLQSSTQPHNGAWIIAVDRQTGLLHWKTQVDSHLAA  163

Query  1217  LITMSGTYYNGAFYVGTSSLEEG---SSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNK  1047
             +IT        A Y G SS EE    ++   CC+FRG    L+   G++LWQTF +PDN 
Sbjct  164   IITGPPVIAGNAVYAGVSSSEESLATNAAYPCCSFRGSMVALNANNGEILWQTFTVPDNH  223

Query  1046  GKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCV  867
             G+   Y+G AIW   P+ID  RG +Y  TGN Y  P  V  C       T T      C 
Sbjct  224   GRTDGYSGNAIW-QPPAIDLARGLLYTGTGNNYEVPDEVKACL-----ATATMAEQPSCF  277

Query  866   EPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADF-GEAPM  690
               +++ DS +ALDL TG+++W R+L G DV+ +AC+ + +  +CP   +PD D  G  P 
Sbjct  278   SSQDYFDSAMALDLRTGQVRWSRRLQGIDVWTVACVRNPTPVSCPIPASPDFDLSGSGPN  337

Query  689   MLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVY  510
             +L         +IV   QKSG  WAL+ D G MVW T  GPG  +GG  WG ATD +R+Y
Sbjct  338   LLP--------NIVGFGQKSGIYWALNPDTGAMVWSTVVGPGATLGGIEWGTATDGKRIY  389

Query  509   TSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLS-NPVTVANGVLFA  333
              +I NS  L + LL  +++T  G W A+D  TGKILW TA P   +    V+VANGV++A
Sbjct  390   VAITNSAHLPYPLLDGRSITW-GAWSALDVATGKILWQTADPFEAIDMGAVSVANGVVYA  448

Query  332   GSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGG  153
              S+   G + A++A TG++L+++ +G +V  G ++++G VY G+GY+ + G      T  
Sbjct  449   PSM--SGNMHALDAATGKVLFTFASGGSVLDGPAIADGVVYWGSGYKKTGGG-----TTN  501

Query  152   TSLFAFCL  129
               +FAF L
Sbjct  502   NKIFAFGL  509



>ref|WP_014266931.1| pyrrolo-quinoline quinone [Granulicella mallensis]
 ref|YP_005059089.1| pyrrolo-quinoline quinone repeat-containing protein [Granulicella 
mallensis MP5ACTX8]
 gb|AEU38059.1| Pyrrolo-quinoline quinone repeat-containing protein [Granulicella 
mallensis MP5ACTX8]
Length=538

 Score =   304 bits (778),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 202/550 (37%), Positives = 292/550 (53%), Gaps = 50/550 (9%)
 Frame = -1

Query  1715  IIFLICISATAKPEWHI--TRFSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLK  1542
             ++ + CI+        +  T  S   S +W + G  + + R    E  I+ + V  LK+K
Sbjct  16    VVAMFCIAGDFGRAQSVSPTPPSGSTSASWQSAGQSLGDNRQQPAETVINATNVQGLKVK  75

Query  1541  WEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNV  1362
             W F  G D+SATP +  GVVY P W G L+A++A+ G  +W   + +  G          
Sbjct  76    WTFTTGGDVSATPTVANGVVYAPDWKGNLFAIDANTGRQVWSHQVSEYDGQ---------  126

Query  1361  TAIVSRSTPSIVGETLIIG--------IYGPAVVIGVKRATGDLLWMTLLDRHPAGLITM  1206
             T  +SR +P ++ + +I+G        ++  A VI V  ++G   W+T +D HP  +IT 
Sbjct  127   TGSMSRVSPLVLADEVIVGDNVINRTALHNGANVIAVDPSSGIRKWITQVDPHPGSVITG  186

Query  1205  SGTYYNGAFYVGTSSLEEGSSKA---HCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRG  1035
             S T YNG  YV  +S EE  +      CCTFRG    LD  TG +LW+T+ +PDN G   
Sbjct  187   SPTAYNGIVYVPVASNEEALAAVPGYPCCTFRGSLVALDARTGSILWKTYTVPDNGGTTD  246

Query  1034  EYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPEN  855
              Y+G AIW   P+ID  RG +Y+ TG+ Y+ P  + +C+ +  +   T      C  P +
Sbjct  247   GYSGGAIW-QQPAIDVARGSIYVGTGDNYTVPDAIEQCETEHLSDGDT----SSCTPPND  301

Query  854   HSDSILALDLDTGKIKWFRQLGGYDVFFIAC---INSSSTPNCPPGPNPDADF-GEAPMM  687
             H DS++A DL TGKIKW  ++  YD     C   +   +TP CP  P  D DF G  P +
Sbjct  302   HLDSVMAFDLTTGKIKWANKITNYDTANADCELALAPGATP-CPTPPGRDFDFPGAGPNL  360

Query  686   LSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYT  507
             L         +IV   QKSG  WA+D D G + W T  GPG F+GG  WG A+D   +Y 
Sbjct  361   LG--------NIVGFGQKSGVYWAVDPDTGAVRWSTLVGPGSFLGGIMWGTASDGNNIYV  412

Query  506   SIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSN--PVTVANGVLFA  333
              IAN  + +++L PS      G W A++AQTG+I+W TA P  G  +    +VANGV++A
Sbjct  413   PIANFTQASYSLSPSGQAITWGSWAALNAQTGQIVWQTADPTKGGIDMGAASVANGVVYA  472

Query  332   GSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRV--SIGAGIPIFT  159
             GS    G ++A+NA +G+ILWS+ +G +V G  S+ NG VY G+GY        GI    
Sbjct  473   GSF--SGAMYALNAASGKILWSFASGGSVVGSPSIVNGVVYWGSGYTALNPTANGI----  526

Query  158   GGTSLFAFCL  129
             G   ++AF L
Sbjct  527   GNNKIYAFSL  536



>ref|WP_018521987.1| MULTISPECIES: hypothetical protein [Streptomyces]
Length=531

 Score =   302 bits (773),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 196/516 (38%), Positives = 286/516 (55%), Gaps = 26/516 (5%)
 Frame = -1

Query  1655  SCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYF  1476
             +C A  +W   G D+ N R A  E+KI+ +  S+LK KW +    D+SATPA++ G VYF
Sbjct  34    ACAAQVDWSTGGHDLANSRSASAEHKITKNNASRLKAKWTYATHGDVSATPAVVGGAVYF  93

Query  1475  PSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYG  1296
             P W GYL+ +NA  G  +W   + + TG  A+         VSRS+P+++   + I  + 
Sbjct  94    PDWGGYLHKINAKTGKEIWSHKVSEYTGDAAS---------VSRSSPTVMDGRVYIADWT  144

Query  1295  PAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLE-EGSSKAH--CCT  1125
              AV++ V   TG+ +W   +D+    ++T S   ++G  Y G SS E EG+      CCT
Sbjct  145   KAVLMAVDAKTGNKIWTREIDQQYKAVLTQSPVVHDGVIYQGVSSRESEGAYDPTYPCCT  204

Query  1124  FRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYS  945
             FRG    +   TG+VLW+ F  PDN GK G Y+G A+WG +P++D     VY  TGN Y+
Sbjct  205   FRGSVNAISAKTGQVLWRQFTTPDNGGKTGGYSGVAVWG-TPALDPSTNTVYFTTGNNYT  263

Query  944   APKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIA  765
              PK V  CQ       T   T  +C + +N+ D++LALD+ TG+IKW      +D +   
Sbjct  264   VPKEVSDCQ-------TAGGTPAQCYQEDNYVDTVLALDMTTGRIKWHTGAKRFDAWNTG  316

Query  764   CINSSSTPNCPPGPNPDADFGEAPMMLSVV-VNGSTRDIVVAVQKSGFAWALDRDNGEMV  588
             C+      NCPP P  D DFG+   + ++   NG +R ++ A +KSG  W +D  NGE+V
Sbjct  317   CLPGLPPNNCPPNPGYDYDFGDGAHLFTIKGANGRSRKVIGAGEKSGEYWLMDATNGEVV  376

Query  587   WYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGK  408
             W   AGPGG VGG  WG A D++R+Y + AN N+L++ L      T    + A+D QTGK
Sbjct  377   WSAAAGPGGHVGGIEWGTANDDKRIYIAEANFNKLDYQLADG-TTTNRSSFAALDPQTGK  435

Query  407   ILWSTAVPDTGLS-NPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMS  231
             +LW  A    G +   +T ANGV+F GS    G ++A +A TG  LW +    +   G +
Sbjct  436   VLWQVADRTDGFAWGALTAANGVVFGGST--SGHMYAFDAATGTYLWEFTAPYSSNAGPA  493

Query  230   VSNGCVYVGNGY-RVSIGAGIPIFTGGTSLFAFCLE  126
             V +G VY GNGY R + GAG    +   + +AF ++
Sbjct  494   VVDGTVYWGNGYARFADGAGTTGSSTEGTFYAFTVD  529



>ref|WP_035237051.1| hypothetical protein [Acidobacteriaceae bacterium URHE0068]
Length=538

 Score =   295 bits (755),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 194/517 (38%), Positives = 282/517 (55%), Gaps = 45/517 (9%)
 Frame = -1

Query  1637  NWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGY  1458
              W + GGD++N   +  E  ISP+ V+ L  KW F A  ++SATP +    +Y   W G 
Sbjct  54    QWSSWGGDLFNSHNSPTETTISPANVATLHTKWVFTALGNVSATPTVKNNALYITDWGGG  113

Query  1457  LYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIG  1278
             +Y + A  G  +W R +   TG + +         VSRS+P+I  + +IIG      ++ 
Sbjct  114   VYRLRADTGKPVWSRTMASYTGKSQS---------VSRSSPAIGSDRIIIGDQHSGTLLA  164

Query  1277  VKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEE---GSSKAHCCTFRGRFA  1107
             +    GDLLW  ++D  PA  +T S    NG  YVG SS EE    +  ++  +FRG   
Sbjct  165   INETNGDLLWKVVIDPLPAAHMTNSPVIANGVAYVGVSSGEESIAANKPSYVLSFRGSIQ  224

Query  1106  KLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVL  927
              ++V TG+VLW+T+ +P+       Y G A+WGS+  +DA RG +Y++TGN YS P  V 
Sbjct  225   AINVSTGQVLWKTYTVPEG------YTGGAVWGSNFVVDAARGSLYVSTGNNYSVPSDVS  278

Query  926   KCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSS  747
              C    N KT +   +  C++P ++ DS+LALDL TGK+KW  +L G D +   C +S  
Sbjct  279   SCL--INAKTRSEQIA--CIDPTDYVDSVLALDLKTGKVKWANRLEGADTWTGGCESSGG  334

Query  746   TPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagp  567
             +P CP     D DFG +P ++ +    S++D++   QKSG  W L+   G +++  + GP
Sbjct  335   SP-CPNPAGRDFDFGSSPNLIKL----SSKDVLGIGQKSGIFWGLNPATGAVLYKRQVGP  389

Query  566   ggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAV  387
             GG  GG  WG ATDN+RVY  I N+N   + L PS     GG W A++  TG ILW T V
Sbjct  390   GGGDGGIEWGTATDNQRVYVPIMNTNHNTYNLQPSGVAWNGGSWAALNPATGTILWQTKV  449

Query  386   PDT---------GLSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGM  234
             P +         G   P +VANGV++ GS    G + A+NA TG+ILW + +G TV    
Sbjct  450   PGSDPALPSHPAGSFAPASVANGVVYGGST--AGYMVAMNAATGKILWQFQSGGTVASAP  507

Query  233   SVSNGCVYVGNGY-RVSIGAGIPIFTGGTSLFAFCLE  126
             S+ NG VY G+GY R+S G           L+AF ++
Sbjct  508   SIVNGVVYWGSGYNRISGG------KANNKLYAFTVK  538



>ref|WP_036568982.1| hypothetical protein [Nocardioides sp. URHA0032]
Length=538

 Score =   281 bits (719),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 191/518 (37%), Positives = 272/518 (53%), Gaps = 41/518 (8%)
 Frame = -1

Query  1637  NWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGY  1458
              W   G ++ N   A    KI    V  LK KW F  G DISA  A++ GV YFP W+G+
Sbjct  44    QWPMFGQNLNNTANAP-ATKIGTGNVGALKPKWAFTTGGDISARAAVVDGVAYFPDWSGH  102

Query  1457  LYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSI--VGETLIIGIYGPAVV  1284
             LYA+ +S G L+W + +  L    +   +     +VSR++P++     TL +G    A +
Sbjct  103   LYAIKSSSGKLVWSKTI--LADYLSDAFSPAPAKVVSRTSPALDTATNTLYVGTQKGAYL  160

Query  1283  IGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGS---SKAHCCTFRGR  1113
             + +   TG L W T LD HP  + T S   +NG  YVG +SLEEG+   S   CC+FRG 
Sbjct  161   LAINATTGALKWRTQLDSHPLAIDTASPAVFNGVVYVGVASLEEGAAVDSTYPCCSFRGS  220

Query  1112  FAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPK-  936
                ++  TG VLW+T+ +P        Y G A+WGS+   D  RG VY  TGN Y  P  
Sbjct  221   VMAVNATTGAVLWKTYTVPTG------YNGGAVWGSTIVPDPARGFVYATTGNNYFTPTD  274

Query  935   -HVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACI  759
                  C +          T ++C  P++H DS++AL +  G I W  +    D + +AC 
Sbjct  275   PDYTSCIDAGR-------TQEQCNSPDDHVDSVMALRIADGTIAWSDRFATSDDWTVACF  327

Query  758   NSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYt  579
              S +  NCP    PD DFG    + +       + ++ A QKSG   A+D   G +VW T
Sbjct  328   FSGT--NCPVNSGPDFDFGSGVQLFTAQTATGPKTLIGAGQKSGVYTAIDPSTGTVVWAT  385

Query  578   eagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSK----NVTIGGGWVAMDAQTG  411
             + GPG  +GG  WG+ATD +R+Y  IA     NF  +P +      T GG W A+DA TG
Sbjct  386   QVGPGSSLGGMEWGSATDGKRIYVQIA-----NFYGIPDQVGNGTTTQGGEWAALDAATG  440

Query  410   KILWSTAVPDTGLS-NPVTVANGVLFAGSV---HPRGPVFAINAKTGEILWSYYTGATVY  243
             +I+W  A P+  +   P+TVANGV++A S+        +F ++A TG+ LWSY  G++V 
Sbjct  441   RIIWKVADPNGAVDLGPMTVANGVVYAASMAGGATNKTMFGLDAATGKTLWSYAAGSSVN  500

Query  242   GGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
              G S++N  V+ G+GY      GIP FTG   L+AF +
Sbjct  501   AGASIANDTVFWGSGYS---NLGIPGFTGNNKLYAFSI  535



>gb|ELQ02887.1| polyvinylalcohol dehydrogenase [Xanthomonas translucens DAR61454]
Length=556

 Score =   279 bits (713),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 185/504 (37%), Positives = 271/504 (54%), Gaps = 36/504 (7%)
 Frame = -1

Query  1637  NWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGY  1458
             +W N GG   N R+A  E +I+P   ++LK  W F    D+SATP +    +Y P W G 
Sbjct  60    SWENAGGGYRNTRFAPAEWQINPFNAARLKPAWTFTTAGDVSATPTVQGSALYVPDWGGQ  119

Query  1457  LYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIG  1278
             LY ++ + G  +W+  L   TG NA        A +SR++P+I  +++++G      V+ 
Sbjct  120   LYRIDTTLGKAVWQVKLSDYTG-NA--------ASLSRNSPAIARDSVLVGDQASGTVVA  170

Query  1277  VKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGS-SKAHCCTFRGRFAKL  1101
             + + TG LLW TL++ +    IT S   Y    YVG SS + G  S  +  +FRG  A L
Sbjct  171   IDKNTGKLLWKTLVEANAQARITASPVVYGDRVYVGVSSGDWGGLSPGYTFSFRGSVAAL  230

Query  1100  DVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKC  921
             D+ TGK+LW     P+       Y GAA+WG+  ++D  R  VY  TGN YS P  V +C
Sbjct  231   DLKTGKLLWSFRTAPEG------YTGAAVWGTL-ALDPQRQRVYATTGNNYSVPLDVARC  283

Query  920   QEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTP  741
              +  N   T       C+ P+N+ DS+LALD+ +GK  W R+L G D + ++C+ + +T 
Sbjct  284   VKNANGDKTAQLA---CLAPDNYVDSVLALDMRSGKPVWTRRLQGADAWSLSCLVAPTTG  340

Query  740   NCPPGPNPDADF-GEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpg  564
              C     PD DF G    + + + NG  + +V A QKSG  WA D D+G  VW T+ GPG
Sbjct  341   VCQQPQGPDYDFSGGGANLFTAIRNGKPQALVGAGQKSGVYWAFDADSGRTVWSTQVGPG  400

Query  563   gfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGGWVAMDAQTGKILWST  393
             G  GG  WG++ D    RVY +I N+N  ++TL P    T   G W A+DA +GKILW  
Sbjct  401   GTAGGIEWGSSVDPLKSRVYVAINNNNHTSYTLAPGNTETWNAGSWAALDAASGKILWQV  460

Query  392   AVP---------DTGLSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYG  240
              VP           G   P+  + G+++AGS+   G +  ++A+TG+ LWS+  G +V  
Sbjct  461   KVPGVDPVQTAFGAGGRGPLASSPGLVYAGSMS--GAMTVLDAETGKTLWSFDAGGSVSS  518

Query  239   GMSVSNGCVYVGNGY-RVSIGAGI  171
               +V +G +Y G GY R + G GI
Sbjct  519   APAVVDGALYWGAGYSRFNFGTGI  542



>ref|XP_004338620.1| PQQ enzyme repeat domain containing protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR16607.1| PQQ enzyme repeat domain containing protein [Acanthamoeba castellanii 
str. Neff]
Length=555

 Score =   279 bits (713),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 200/526 (38%), Positives = 266/526 (51%), Gaps = 56/526 (11%)
 Frame = -1

Query  1613  IYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGV--VYFPSWNGYLYAVNA  1440
             I N   A  E  I  S V +L  KW+     D++A P +      VYFP WNG ++ V+A
Sbjct  36    ISNNHRAVDETCIRQSNVHQLTPKWKLDVPSDVTAVPTVSADGRWVYFPDWNGNVWCVSA  95

Query  1439  SDGSLLWERNLQKLTGLNATVR--TGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGVKRA  1266
             + G++ W   L  +T +  T+   TG  +  +SR++P++  + +++G        G+   
Sbjct  96    ATGAVRWSVRLDAITDIVGTIDNATGISSGSLSRNSPALWEDLVLLGDMASGWFFGLNAT  155

Query  1265  TGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEE---GSSKAHCCTFRGRFAKLDV  1095
              G L+W TLLD HP  +ITMS T +     VG SS E       +  CCTFRG FA LD 
Sbjct  156   DGQLVWRTLLDPHPNAVITMSATVHRDRVLVGVSSTENQFGAVPEFPCCTFRGSFAALDA  215

Query  1094  WTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQE  915
              +G+V WQT+M P N      Y+GA +WGSSPS+D   G VY+ TGN Y     +  C+E
Sbjct  216   RSGRVEWQTYMTPAN------YSGAPVWGSSPSVDDQLGLVYVGTGNNYRETADIRACRE  269

Query  914   KQNNKTTTPTTSDKC-VEPENHSDSILALDLDTGKIKWFRQL--GGY--DVFFIAC----  762
             +        T   +C V P NH DSI+A+ L  G + W R    G Y  D + + C    
Sbjct  270   QG-------TPPGQCLVNPHNHVDSIVAMRLTDGAVAWARSFAPGDYLDDAYNLGCNPNY  322

Query  761   --INSSSTP--NCPPGPNPDADFGEAPMMLSVVVNG-----STRDIVVAVQKSGFAWALD  609
                N S+TP  NCP  P  DADFG+APM+++  V        TR +V A QK+G   AL+
Sbjct  323   FPANYSATPNSNCPAVPGADADFGQAPMLIAYEVTNDRGRRETRRLVTAGQKNGMMVALN  382

Query  608   RDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFT-LLPSKNVTIGGGWV  432
                G + W  +AGP G  GG  WGAA D +R+  +I NSN      L+PS   T GG W 
Sbjct  383   PATGALAWARKAGPAGLNGGAQWGAAFDGQRIVVAITNSNFAEVQGLVPSGGSTYGGLWT  442

Query  431   AMDAQTGKILWSTAVPDTGLSN-------------PVTVANGVLFAGSVHPR---GPVFA  300
             A+D   G I+W TAVP+   +N              VT ANGV   GS          FA
Sbjct  443   ALDPADGSIVWQTAVPEGQAANSSVAAARGATAYSAVTAANGVFLVGSSTKSLGASNYFA  502

Query  299   INAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIF  162
             + A TG ILW Y  G +   G SV +G VY G GY   IG G   F
Sbjct  503   LQADTGRILWDYAPGGSAVSGPSVVSGSVYWGCGY-ARIGRGCKTF  547



>ref|WP_026144241.1| polyvinylalcohol dehydrogenase [Xanthomonas sp. SHU199]
 gb|AJC45440.1| polyvinylalcohol dehydrogenase [Xanthomonas sacchari]
Length=558

 Score =   278 bits (712),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 183/503 (36%), Positives = 268/503 (53%), Gaps = 36/503 (7%)
 Frame = -1

Query  1634  WLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYL  1455
             W + GG   N R+A GE +I+P   ++LK  W F    D+SATP +    +Y P W G L
Sbjct  64    WDSAGGGFLNTRFAPGEWQITPFNAARLKTAWTFTTQGDVSATPTVQGTALYVPDWGGQL  123

Query  1454  YAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGV  1275
             Y ++   G  +W+  L   TG+  +         +SR++P+I  +++++G      V+ +
Sbjct  124   YRIDTDLGKAVWQVKLADYTGIAGS---------LSRNSPAIARDSVLVGDQASGTVLAI  174

Query  1274  KRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGS-SKAHCCTFRGRFAKLD  1098
              +ATG LLW TL++ +P   IT S   Y    YVG SS + G  S  +  +FRG  A LD
Sbjct  175   DKATGKLLWKTLVESNPQARITASPVIYGDRVYVGVSSGDWGGLSAGYKYSFRGSVAALD  234

Query  1097  VWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQ  918
             + TGK+LW     P+       Y GA++WG+  +ID  R  VY  TGN YS P  V  C 
Sbjct  235   LKTGKLLWSFRTTPEG------YTGASVWGTL-AIDPLRQRVYATTGNNYSVPTEVASCV  287

Query  917   EKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPN  738
             +  N   T       C+ P+N+ DS+LALD+ +GK  W R+L G D + ++C+ + +   
Sbjct  288   KNANGDKTAQLA---CMAPDNYVDSVLALDMRSGKPVWTRRLQGADAWSLSCLVAPTNGL  344

Query  737   CPPGPNPDADF-GEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpgg  561
             C     PD DF G    + + + NG  + +V A QKSG  WA D D G+ VW T+ GPGG
Sbjct  345   CQDPQGPDYDFSGGGANLFTAIRNGKPQALVGAGQKSGVYWAFDADTGQTVWSTQVGPGG  404

Query  560   fvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGGWVAMDAQTGKILWSTA  390
               GG  WG++ D  + RVY +I N+    +TL P    T   G W A+DA +GKILW   
Sbjct  405   TAGGIEWGSSVDPFSGRVYVAINNNEHTAYTLAPGNTETWNAGSWAALDAASGKILWQVK  464

Query  389   VPDT---------GLSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGG  237
             VP T         G   P+  + G+++AGS+   G +  ++AKTG  LWS+  G +V   
Sbjct  465   VPGTDPVQTAFGAGGRGPLASSPGLVYAGSMS--GAMTVLDAKTGATLWSFDAGGSVSSA  522

Query  236   MSVSNGCVYVGNGY-RVSIGAGI  171
              ++ +G VY G GY R + G G+
Sbjct  523   PAIVDGAVYWGAGYSRFNFGTGV  545



>ref|WP_003479338.1| polyvinyl-alcohol dehydrogenase (acceptor) [Xanthomonas translucens]
 emb|CCP41255.1| polyvinyl-alcohol dehydrogenase (acceptor) [Xanthomonas translucens 
pv. translucens DSM 18974]
Length=577

 Score =   279 bits (713),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 185/504 (37%), Positives = 271/504 (54%), Gaps = 36/504 (7%)
 Frame = -1

Query  1637  NWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGY  1458
             +W N GG   N R+A  E +I+P   ++LK  W F    D+SATP +    +Y P W G 
Sbjct  81    SWENAGGGYRNTRFAPAEWQINPFNAARLKPAWTFTTAGDVSATPTVQGSALYVPDWGGQ  140

Query  1457  LYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIG  1278
             LY ++ + G  +W+  L   TG NA        A +SR++P+I  +++++G      V+ 
Sbjct  141   LYRIDTTLGKAVWQVKLSDYTG-NA--------ASLSRNSPAIARDSVLVGDQASGTVVA  191

Query  1277  VKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGS-SKAHCCTFRGRFAKL  1101
             + + TG LLW TL++ +    IT S   Y    YVG SS + G  S  +  +FRG  A L
Sbjct  192   IDKNTGKLLWKTLVEANAQARITASPVVYGDRVYVGVSSGDWGGLSPGYTFSFRGSVAAL  251

Query  1100  DVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKC  921
             D+ TGK+LW     P+       Y GAA+WG+  ++D  R  VY  TGN YS P  V +C
Sbjct  252   DLKTGKLLWSFRTAPEG------YTGAAVWGTL-ALDPQRQRVYATTGNNYSVPLDVARC  304

Query  920   QEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTP  741
              +  N   T       C+ P+N+ DS+LALD+ +GK  W R+L G D + ++C+ + +T 
Sbjct  305   VKNANGDKTAQLA---CLAPDNYVDSVLALDMRSGKPVWTRRLQGADAWSLSCLVAPTTG  361

Query  740   NCPPGPNPDADF-GEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpg  564
              C     PD DF G    + + + NG  + +V A QKSG  WA D D+G  VW T+ GPG
Sbjct  362   VCQQPQGPDYDFSGGGANLFTAIRNGKPQALVGAGQKSGVYWAFDADSGRTVWSTQVGPG  421

Query  563   gfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGGWVAMDAQTGKILWST  393
             G  GG  WG++ D    RVY +I N+N  ++TL P    T   G W A+DA +GKILW  
Sbjct  422   GTAGGIEWGSSVDPLKSRVYVAINNNNHTSYTLAPGNTETWNAGSWAALDAASGKILWQV  481

Query  392   AVP---------DTGLSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYG  240
              VP           G   P+  + G+++AGS+   G +  ++A+TG+ LWS+  G +V  
Sbjct  482   KVPGVDPVQTAFGAGGRGPLASSPGLVYAGSMS--GAMTVLDAETGKTLWSFDAGGSVSS  539

Query  239   GMSVSNGCVYVGNGY-RVSIGAGI  171
               +V +G +Y G GY R + G GI
Sbjct  540   APAVVDGALYWGAGYSRFNFGTGI  563



>ref|WP_038239231.1| polyvinylalcohol dehydrogenase [Xanthomonas translucens]
Length=577

 Score =   279 bits (713),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 185/504 (37%), Positives = 271/504 (54%), Gaps = 36/504 (7%)
 Frame = -1

Query  1637  NWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGY  1458
             +W N GG   N R+A  E +I+P   ++LK  W F    D+SATP +    +Y P W G 
Sbjct  81    SWENAGGGYRNTRFAPAEWQINPFNAARLKPAWTFTTAGDVSATPTVQGSALYVPDWGGQ  140

Query  1457  LYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIG  1278
             LY ++ + G  +W+  L   TG NA        A +SR++P+I  +++++G      V+ 
Sbjct  141   LYRIDTTLGKAVWQVKLSDYTG-NA--------ASLSRNSPAIARDSVLVGDQASGTVVA  191

Query  1277  VKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGS-SKAHCCTFRGRFAKL  1101
             + + TG LLW TL++ +    IT S   Y    YVG SS + G  S  +  +FRG  A L
Sbjct  192   IDKNTGKLLWKTLVEANAQARITASPVVYGDRVYVGVSSGDWGGLSPGYTFSFRGSVAAL  251

Query  1100  DVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKC  921
             D+ TGK+LW     P+       Y GAA+WG+  ++D  R  VY  TGN YS P  V +C
Sbjct  252   DLKTGKLLWSFRTAPEG------YTGAAVWGTL-ALDPQRQRVYATTGNNYSVPLDVARC  304

Query  920   QEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTP  741
              +  N   T       C+ P+N+ DS+LALD+ +GK  W R+L G D + ++C+ + +T 
Sbjct  305   VKNANGDKTAQLA---CLAPDNYVDSVLALDMRSGKPVWTRRLQGADAWSLSCLVAPTTG  361

Query  740   NCPPGPNPDADF-GEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpg  564
              C     PD DF G    + + + NG  + +V A QKSG  WA D D+G  VW T+ GPG
Sbjct  362   VCQQPQGPDYDFSGGGANLFTAIRNGKPQALVGAGQKSGVYWAFDADSGRTVWSTQVGPG  421

Query  563   gfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGGWVAMDAQTGKILWST  393
             G  GG  WG++ D    RVY +I N+N  ++TL P    T   G W A+DA +GKILW  
Sbjct  422   GTAGGIEWGSSVDPLKSRVYVAINNNNHTSYTLAPGNTETWNAGSWAALDAASGKILWQV  481

Query  392   AVP---------DTGLSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYG  240
              VP           G   P+  + G+++AGS+   G +  ++A+TG+ LWS+  G +V  
Sbjct  482   KVPGVDPVQTAFGAGGRGPLASSPGLVYAGSMS--GAMTVLDAETGKTLWSFDAGGSVSS  539

Query  239   GMSVSNGCVYVGNGY-RVSIGAGI  171
               +V +G +Y G GY R + G GI
Sbjct  540   APAVVDGALYWGAGYSRFNFGTGI  563



>ref|WP_026143236.1| polyvinylalcohol dehydrogenase [Xanthomonas sp. SHU308]
Length=558

 Score =   278 bits (712),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 183/503 (36%), Positives = 268/503 (53%), Gaps = 36/503 (7%)
 Frame = -1

Query  1634  WLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYL  1455
             W + GG   N R+A GE +I+P   ++LK  W F    D+SATP +    +Y P W G L
Sbjct  64    WDSAGGGFLNTRFAPGEWQITPFNAARLKTAWTFTTQGDVSATPTVQGTALYVPDWGGQL  123

Query  1454  YAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGV  1275
             Y ++   G  +W+  L   TG+  +         +SR++P+I  +++++G      V+ +
Sbjct  124   YRIDTDLGKAVWQVKLADYTGIAGS---------LSRNSPAIARDSVLVGDQASGTVLAI  174

Query  1274  KRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGS-SKAHCCTFRGRFAKLD  1098
              +ATG LLW TL++ +P   IT S   Y    YVG SS + G  S  +  +FRG  A LD
Sbjct  175   DKATGKLLWKTLVESNPQARITASPVIYGDRVYVGVSSGDWGGLSAGYKYSFRGSVAALD  234

Query  1097  VWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQ  918
             + TGK+LW     P+       Y GA++WG+  +ID  R  VY  TGN YS P  V  C 
Sbjct  235   LKTGKLLWSFRTTPEG------YTGASVWGTL-AIDPLRQRVYATTGNNYSVPTEVASCV  287

Query  917   EKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPN  738
             +  N   T       C+ P+N+ DS+LALD+ +GK  W R+L G D + ++C+ + +   
Sbjct  288   KNANGDKTAQLA---CMAPDNYVDSVLALDMRSGKPVWTRRLQGADAWSLSCLVAPTNGL  344

Query  737   CPPGPNPDADF-GEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpgg  561
             C     PD DF G    + + + NG  + +V A QKSG  WA D D G+ VW T+ GPGG
Sbjct  345   CQDPQGPDYDFSGGGANLFTAIRNGKPQALVGAGQKSGVYWAFDADTGQTVWSTQVGPGG  404

Query  560   fvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGGWVAMDAQTGKILWSTA  390
               GG  WG++ D  + RVY +I N+    +TL P    T   G W A+DA +GKILW   
Sbjct  405   TAGGIEWGSSVDPFSGRVYVAINNNEHTPYTLAPGNTETWNAGSWAALDAASGKILWQVK  464

Query  389   VPDT---------GLSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGG  237
             VP T         G   P+  + G+++AGS+   G +  ++AKTG  LWS+  G +V   
Sbjct  465   VPGTDPVQTAFGAGGRGPLASSPGLVYAGSMS--GAMTVLDAKTGATLWSFDAGGSVSSA  522

Query  236   MSVSNGCVYVGNGY-RVSIGAGI  171
              ++ +G VY G GY R + G G+
Sbjct  523   PAIVDGAVYWGAGYSRFNFGTGV  545



>ref|WP_010342314.1| polyvinylalcohol dehydrogenase [Xanthomonas sacchari]
Length=557

 Score =   278 bits (710),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 183/503 (36%), Positives = 267/503 (53%), Gaps = 36/503 (7%)
 Frame = -1

Query  1634  WLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYL  1455
             W + GG   N R+A GE +I+P   ++LK  W F    D+SATP +    +Y P W G L
Sbjct  64    WDSAGGGFLNTRFAPGEWQITPFNAARLKTAWTFTTQGDVSATPTVQGTALYVPDWGGQL  123

Query  1454  YAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGV  1275
             Y ++   G  +W+  L   TG+  +         +SR++P+I  +++++G      V+ +
Sbjct  124   YRIDTDLGKAVWQVKLADYTGIAGS---------LSRNSPAIARDSVLVGDQASGTVLAI  174

Query  1274  KRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGS-SKAHCCTFRGRFAKLD  1098
              + TG LLW TL++ +P   IT S   Y    YVG SS + G  S  +  TFRG  A LD
Sbjct  175   DKTTGKLLWKTLVESNPQARITASPVIYGDRVYVGVSSGDWGGLSAGYKYTFRGSVAALD  234

Query  1097  VWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQ  918
             + TGK+LW     P+       Y GA++WG+  +ID  R  VY  TGN YS P  V  C 
Sbjct  235   LKTGKLLWSFRTAPEG------YTGASVWGTL-AIDPLRQRVYATTGNNYSVPTEVASCV  287

Query  917   EKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPN  738
             +  N   T       C+ P+N+ DS+LALD+ +GK  W R+L G D + ++C+ + +   
Sbjct  288   KNANGDKTAQLA---CMAPDNYVDSVLALDMRSGKPVWTRRLQGADAWSLSCLVAPTNGL  344

Query  737   CPPGPNPDADF-GEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpgg  561
             C     PD DF G    + + + NG  + +V A QKSG  WA D D G+ VW T+ GPGG
Sbjct  345   CQDPQGPDYDFSGGGANLFTAIRNGKPQALVGAGQKSGVYWAFDADTGQTVWSTQVGPGG  404

Query  560   fvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGGWVAMDAQTGKILWSTA  390
               GG  WG++ D  + RVY +I N+    +TL P    T   G W A+DA +GKILW   
Sbjct  405   TAGGIEWGSSVDPFSGRVYVAINNNEHTPYTLAPGNTETWNAGSWAALDAASGKILWQVK  464

Query  389   VPDT---------GLSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGG  237
             VP T         G   P+  + G+++AGS+   G +  ++AKTG  LWS+  G +V   
Sbjct  465   VPGTDPVQTAFGAGGRGPLASSPGLVYAGSMS--GAMTVLDAKTGATLWSFDAGGSVSSA  522

Query  236   MSVSNGCVYVGNGY-RVSIGAGI  171
              ++ +G VY G GY R + G G+
Sbjct  523   PAIVDGAVYWGAGYSRFNFGTGV  545



>ref|YP_008319572.1| pqq-dependent dehydrogenase [Pandoravirus dulcis]
 gb|AGO82903.1| pqq-dependent dehydrogenase [Pandoravirus dulcis]
Length=573

 Score =   278 bits (710),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 197/521 (38%), Positives = 275/521 (53%), Gaps = 50/521 (10%)
 Frame = -1

Query  1652  CPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILK-GVVYF  1476
              P    W N GG + N  +A  E +I+      L   W      D+++ PA+ K GVVY 
Sbjct  46    APKKAWWPNWGGGLDNNHHAAQEREIAACNAGSLMPAWVKVMRGDVASPPAVDKRGVVYI  105

Query  1475  PSWNGYLYAVNASDGSLLWERNLQKLTGLNATVR--TGNVTAIVSRSTPSIVGETLIIGI  1302
             P   G L+AV+   G+ +WE ++   TG+       TG       R TP++ G+ L +G 
Sbjct  106   PDLGGSLWAVDGDTGATIWEVDVGNFTGITGVYNPATGRSNGTTVRGTPALYGDALFVGD  165

Query  1301  YGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEE---GSSKAHC  1131
                A V GV   TG LLW TL++ HPA +ITMS T  +G   VG SS+EE   G     C
Sbjct  166   AASAHVFGVSTRTGRLLWKTLIEAHPAAVITMSPTVVDGLVLVGVSSIEESFAGFPDYPC  225

Query  1130  CTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNL  951
             C FRG    L+  TG ++W+T+  P        YAGAAIWGSSPS+D     VY+ATGN 
Sbjct  226   CDFRGSLVALNARTGAIVWKTYTTPVG------YAGAAIWGSSPSVDLDARAVYVATGNN  279

Query  950   YSAPKHVLKCQEKQNNKTTTPTTSDKCV-EPENHSDSILALDLDTGKIKW---FRQLGGY  783
             Y  P  V  C +      +      +C  +P+N +++++ALDLDTG ++W   F    G 
Sbjct  280   YKVPADVQACVDAHEGDAS------QCASDPDNLAEAVIALDLDTGVVRWNLSFTAQNGV  333

Query  782   DVFFIAC------INSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAV-QKSGF  624
             DV+ + C      +      NCP  P  DADFG+AP+      +G+T+  +V V QK+G 
Sbjct  334   DVWTVGCKPERVGLPGPPNVNCPAFPGEDADFGQAPLRF-YYESGATKVPLVGVGQKNGL  392

Query  623   AWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIG  444
              +AL   +G + W T  G GG +GG  WG+A D  R+Y + +NS+  N TL   +  T G
Sbjct  393   FFALHPADGSLAWVTVVGHGGDIGGLQWGSAFDGARIYVAASNSHFANETLHDGR-TTRG  451

Query  443   GGWVAMDAQTGKILWSTAVPDTGLS---------------NPVTVANGVLFAGSVHPRGP  309
             G WVA+D  TG +LW T VP+ GL+               + +TVANGV++AG+      
Sbjct  452   GSWVALDPATGSVLWQTPVPE-GLTVVDEADGVAKWPLAWSSLTVANGVVYAGTGSRSSA  510

Query  308   V---FAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             V   FA++A TG+ILW + TGA    G +V +G VY G GY
Sbjct  511   VPTMFALDAATGDILWEHVTGAATLNGPAVVDGTVYWGTGY  551



>ref|WP_014786651.1| PQQ enzyme repeat-containing protein [Terriglobus roseus]
 ref|YP_006422724.1| PQQ enzyme repeat-containing protein [Terriglobus roseus DSM 
18391]
 gb|AFL89389.1| PQQ enzyme repeat-containing protein [Terriglobus roseus DSM 
18391]
Length=514

 Score =   275 bits (703),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 189/516 (37%), Positives = 279/516 (54%), Gaps = 43/516 (8%)
 Frame = -1

Query  1634  WLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYL  1455
             W + G  + N R    E  IS   V +L +KW F    D++ATP +  GVVYFP   G L
Sbjct  27    WTSVGQGLTNLRSQPAEKSISALNVGRLAVKWAFTTVGDVTATPTVSGGVVYFPDSAGNL  86

Query  1454  YAVNASDGSLLWERNLQKLTGL-NATVRTGNVTAIVSRSTPSIVGETLIIG-------IY  1299
             YAVNA+ G  +W++ +    G+ NA          ++R +P++    +I+G        +
Sbjct  87    YAVNATTGIKIWQQTITSYVGMPNA----------IARVSPAVYMNEIILGDNLSVTEKH  136

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAH---CC  1128
               A V  V +A G LLW+T +D + A +IT S   YN   YVG SS EEG ++     CC
Sbjct  137   AGAHVFAVNQADGKLLWITQVDANKAAIITGSPVVYNNVAYVGISSEEEGLTQQKGYACC  196

Query  1127  TFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLY  948
             TFRG    L+  TG  LWQT+M PDN G+  +Y+GAAIW S P+ID  R  ++  TGN Y
Sbjct  197   TFRGSIVALNATTGAKLWQTYMTPDNNGQPNQYSGAAIW-SPPAIDVGRNLLFTTTGNNY  255

Query  947   SAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFI  768
             S P  V  CQ           T+ +C    +  D+I+AL+L TG+  W+++   YD + +
Sbjct  256   SVPSSVQACQAA---ANAAHNTTKRCALASDMFDAIVALNLTTGEPVWWQRPSVYDTYNL  312

Query  767   ACINSSSTPNCPPGPNPDADF-GEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEM  591
             AC  +   PNCP     D DF G  P +          ++V A QKSG     D   G+ 
Sbjct  313   ACHLTPPGPNCPTIQGLDYDFGGGGPNLF--------NNVVGAGQKSGVFNMFDAAKGKY  364

Query  590   VWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTG  411
             +W    GPGG +GG  WG A+D  R++ + ANS    +TL   +++   G W A+D +TG
Sbjct  365   IWSVPVGPGGQLGGILWGTASDGSRIFVASANSAAATWTLASGQSINW-GFWSALDMKTG  423

Query  410   KILWSTAVPDTGLS--NPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGG  237
             KILW T  P  G S  + ++ ANGV++ GS+   G ++A+++ TG++LWS+ +G +V+G 
Sbjct  424   KILWQTPEPTHGASAISSMSTANGVVYVGSLDAAGYMYALSSATGQVLWSFPSGGSVFGA  483

Query  236   MSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
              ++ +G +Y G+GY+   G      TG   L+AF +
Sbjct  484   PAIVDGTLYWGSGYKRFGG------TGNNKLYAFYI  513



>ref|WP_039007026.1| polyvinylalcohol dehydrogenase [Xanthomonas translucens]
Length=577

 Score =   276 bits (706),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 184/503 (37%), Positives = 270/503 (54%), Gaps = 36/503 (7%)
 Frame = -1

Query  1634  WLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYL  1455
             W N GG   N R+A  E +I+P   ++LK  W F    D+SATP +    +Y P W G L
Sbjct  82    WENAGGGYLNTRFAPAEWQITPFNAARLKTAWTFTTQGDVSATPTVQGSALYVPDWGGQL  141

Query  1454  YAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGV  1275
             Y ++ + G  +W+  L   TG NA        A +SR++P+I  +++++G      V+ +
Sbjct  142   YRIDTALGKAVWKVKLSDYTG-NA--------ASLSRNSPAIARDSILVGDQASGTVVAI  192

Query  1274  KRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGS-SKAHCCTFRGRFAKLD  1098
              + TG LLW TL++ +    IT S   Y    YVG SS + G  + A+  +FRG    LD
Sbjct  193   DKNTGKLLWKTLVEANAQARITASPVVYGDRVYVGVSSGDWGGLTPAYKFSFRGSVVALD  252

Query  1097  VWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQ  918
             + TGK+LW+    P+       Y GA++WG+  +ID  R  VY  TGN YS P +V  C 
Sbjct  253   LKTGKLLWRFQTAPEG------YTGASVWGTL-AIDPQRQRVYATTGNNYSVPLNVASCV  305

Query  917   EKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPN  738
             +  N  TT       C+ P+++ DS+LALD+ +GK  W R+L G D + ++C+ + +   
Sbjct  306   KNANGDTTAQLA---CLAPDDYVDSVLALDMRSGKPVWTRRLQGADAWSLSCLVAPTNGV  362

Query  737   CPPGPNPDADF-GEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpgg  561
             C     PD DF G    + + + NG  + +V A QKSG  WA D D+G  VW T+ GPGG
Sbjct  363   CQEPQGPDYDFSGGGANLFTAIRNGKPQALVGAGQKSGVYWAFDADSGRTVWSTQVGPGG  422

Query  560   fvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGGWVAMDAQTGKILWSTA  390
               GG  WG++ D    RVY +I NSN  ++TL P    T   G W A+DA +GKILW   
Sbjct  423   TAGGIEWGSSVDPLKSRVYVAINNSNHTSYTLAPGNTETWNAGSWAALDAASGKILWQVK  482

Query  389   VP---------DTGLSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGG  237
             VP           G   P+  + G+++AGS+   G +  ++A TG+ LWS+  G ++   
Sbjct  483   VPGVDPVQTAFGAGGRGPLASSPGLVYAGSMS--GAMTVLDAATGKTLWSFDAGGSISSA  540

Query  236   MSVSNGCVYVGNGY-RVSIGAGI  171
              +V +G VY G GY R + G GI
Sbjct  541   PAVVDGAVYWGAGYSRFNFGTGI  563



>ref|WP_009583585.1| exported putative alcohol dehydrogenase (acceptor) [Xanthomonas 
translucens]
 gb|EKU25904.1| exported putative alcohol dehydrogenase (acceptor) [Xanthomonas 
translucens pv. graminis ART-Xtg29]
Length=577

 Score =   275 bits (703),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 183/504 (36%), Positives = 269/504 (53%), Gaps = 36/504 (7%)
 Frame = -1

Query  1637  NWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGY  1458
             +W N GG   N R+A  E +I+P   ++LK  W F    D+SATP +    +Y P W G 
Sbjct  81    SWENAGGGYRNTRFAPAEWQINPFNAARLKTAWTFTTAGDVSATPTVQGSALYVPDWGGQ  140

Query  1457  LYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIG  1278
             LY ++ + G  +W+  L   TG NA        A +SR++P+I  +++++G      V+ 
Sbjct  141   LYRIDTTLGKAVWQVKLSDYTG-NA--------ASLSRNSPAIARDSVLVGDQASGTVVA  191

Query  1277  VKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGS-SKAHCCTFRGRFAKL  1101
             + + TG LLW TL++ +    IT S   Y    YVG SS + G  +  +  +FRG  A L
Sbjct  192   IDKNTGKLLWKTLVEANAQARITASPVVYGDRVYVGVSSGDWGGLTPGYTFSFRGSVAAL  251

Query  1100  DVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKC  921
             D+ TGK+LW+    P+       Y GAA+WG+  ++D  R  VY  TGN YS P  V  C
Sbjct  252   DLKTGKLLWRFQTAPEG------YTGAAVWGTL-ALDPQRQRVYATTGNNYSVPLDVASC  304

Query  920   QEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTP  741
              +  N   T       C+ P+N+ DS+LALD+ +GK  W R+L G D + ++C+ + +  
Sbjct  305   VKNANGDKTAQLA---CLAPDNYVDSVLALDMRSGKPVWTRRLQGADAWSLSCLVAPTVG  361

Query  740   NCPPGPNPDADF-GEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpg  564
              C     PD DF G    + + + NG  + +V A QKSG  WA D D+G  VW T+ GPG
Sbjct  362   VCQQPQGPDYDFSGGGANLFTAIRNGKPQALVGAGQKSGVYWAFDADSGRTVWSTQVGPG  421

Query  563   gfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGGWVAMDAQTGKILWST  393
             G  GG  WG++ D    RVY +I N+N  ++TL P    T   G W A+DA +GKILW  
Sbjct  422   GTAGGIEWGSSVDPLKSRVYVAINNNNHTSYTLAPGNTETWNAGSWAALDAASGKILWQV  481

Query  392   AVP---------DTGLSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYG  240
              VP           G   P+  + G+++AGS+   G +  ++A TG+ LWS+  G +V  
Sbjct  482   KVPGVDPVQTAFGAGGRGPLASSPGLVYAGSMS--GAMTVLDAATGKTLWSFDAGGSVSS  539

Query  239   GMSVSNGCVYVGNGY-RVSIGAGI  171
               ++ +G VY G GY R + G GI
Sbjct  540   APALVDGAVYWGAGYSRFNFGTGI  563



>gb|KCW64982.1| hypothetical protein EUGRSUZ_G02524 [Eucalyptus grandis]
Length=341

 Score =   267 bits (683),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 163/416 (39%), Positives = 225/416 (54%), Gaps = 82/416 (20%)
 Frame = -1

Query  1352  VSRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNG--AF  1179
             +SR   +I G+ LI+ IYGPA VI V R+ G L+W+T LD +P  +IT SGT Y+G  AF
Sbjct  1     MSRLVLTIAGKLLIVQIYGPAAVIAVNRSNGGLVWLTRLDSNPLAVITASGTSYSGLMAF  60

Query  1178  YVGTSSLEEGSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSP  999
             YVG SSLEE      CCTFRG   KL++  G                             
Sbjct  61    YVGVSSLEETLPAEQCCTFRGSLVKLNILYG-----------------------------  91

Query  998   SIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDT  819
                            LY+A     +CQE+QNN+TT PT  D+C+ P  + +SI+A ++++
Sbjct  92    ---------------LYTALPEAEECQERQNNQTTPPTEPDQCIGPNVNFNSIIAFEMES  136

Query  818   GKIKWFRQLGGYDVFFIACINSSSTPN---CPPGPNPDADFGEAPMMLSVVVNGSTRDIV  648
             G+I                   S  PN   C  GPN DADF EAPM++++  NG+ RDI 
Sbjct  137   GRI-------------------SLVPNSLGCLTGPNLDADFREAPMLITISTNGTERDIA  177

Query  647   VAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLL  468
             VAVQKSGFAW +DRD+G+++           G G+               ++ + NFTL 
Sbjct  178   VAVQKSGFAWVVDRDSGDIL----------AGPGSIEGGGTWGTTTDGKRSTLKENFTLA  227

Query  467   PSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLS-NPVTVANGVLFAGSVHPRGPVFAINA  291
             PS  +T  G WVA+D ++ +ILWSTA P    +   V+VA+GV+FAGSV   GP      
Sbjct  228   PSTRMTTAGAWVALDVRSREILWSTANPSNETAPTLVSVASGVVFAGSVALEGPCMQWTP  287

Query  290   KTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGI-PIFTGGTSLFAFCLE  126
             +    +WSY +GATVYGG+S+S GC+Y GNGY++   A + P + GGT L+A C++
Sbjct  288   RRA--MWSYNSGATVYGGISISYGCIYHGNGYKLGAVAQLHPTWIGGTDLYALCVK  341



>ref|WP_035996091.1| hypothetical protein [Burkholderia caribensis]
Length=510

 Score =   269 bits (688),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 183/516 (35%), Positives = 276/516 (53%), Gaps = 48/516 (9%)
 Frame = -1

Query  1643  SGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWN  1464
             +G+W   G +++N R A GE+ I+ + V+KL  +W      ++SATP ++ GVVY P + 
Sbjct  29    AGDWPMGGQNLHNTRSAQGEHAIALNNVAKLAPRWSVETDGNVSATPTVVDGVVYVPDFG  88

Query  1463  GYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIG-----IY  1299
             G L+AV+A+ G + W + +   +          +    SR++P+    TL+IG       
Sbjct  89    GSLWAVDAASGQVKWHKKITDYS---------QIPNDASRTSPAYWKGTLVIGQGTQVAN  139

Query  1298  GP--AVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCT  1125
              P  A V+G+K   G  LW T ++  P+ +IT S    +G  YVG SS  E  +     T
Sbjct  140   NPTGAYVLGIKAEDGSPLWRTQVETDPSAIITASPVIDDGVIYVGVSSRAE--ALKDKTT  197

Query  1124  FRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYS  945
             +RG    LD  TGK+LW+T+M+P        Y G ++WG++P +D   G +Y+ TGN +S
Sbjct  198   YRGSVVSLDASTGKLLWKTYMVPVG------YTGGSVWGNTPVVDHQTGLLYVTTGNNFS  251

Query  944   APKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIA  765
              P+ V +   + N K    T         NH DS +AL+L TGKI W  +          
Sbjct  252   VPEGVCRYPGQSNCKRDVAT---------NHIDSFVALNLKTGKIAWATR----------  292

Query  764   CINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVW  585
              + +  + N      PD DFG  P + +  V G  R ++ A  KSG  WALD   G++VW
Sbjct  293   TLAADMSTNYDHDDGPDYDFGSGPNLYTATVAGHKRTLLGAGAKSGVYWALDPKTGKVVW  352

Query  584   YteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTL--LPSKNVTIGGGWVAMDAQTG  411
             +T+ GPG  +GG  WG A D +R+Y SI N N  + ++   P K  T GG W A+DA TG
Sbjct  353   HTQVGPGSLLGGMLWGTAADGKRIYVSIGNLNHESISVNSPPGKTTTRGGVWAAVDAATG  412

Query  410   KILWSTAVP-DTGLSNPVTVANGVLFAGSVHPRGP-VFAINAKTGEILWSYYTGATVYGG  237
             K+LW TA P D   +  ++ ANG+++AGS+   G  ++A++A TGEI WS+ +G  V  G
Sbjct  413   KVLWRTADPQDMMDTMAMSEANGIVYAGSLAGSGANMYALDAATGEIKWSFESGGAVASG  472

Query  236   MSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
              ++ +G VY G+GY   +  G+P       L+AF L
Sbjct  473   AAIVDGTVYWGSGYHTKV-LGLPYAGDNHKLYAFAL  507



>gb|ETY80356.1| hypothetical protein K788_004339 [Burkholderia caribensis MBA4]
Length=525

 Score =   270 bits (689),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 183/516 (35%), Positives = 276/516 (53%), Gaps = 48/516 (9%)
 Frame = -1

Query  1643  SGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWN  1464
             +G+W   G +++N R A GE+ I+ + V+KL  +W      ++SATP ++ GVVY P + 
Sbjct  44    AGDWPMGGQNLHNTRSAQGEHAIALNNVAKLAPRWSVETDGNVSATPTVVDGVVYVPDFG  103

Query  1463  GYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIG-----IY  1299
             G L+AV+A+ G + W + +   +          +    SR++P+    TL+IG       
Sbjct  104   GSLWAVDAASGQVKWHKKITDYS---------QIPNDASRTSPAYWKGTLVIGQGTQVAN  154

Query  1298  GP--AVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCT  1125
              P  A V+G+K   G  LW T ++  P+ +IT S    +G  YVG SS  E  +     T
Sbjct  155   NPTGAYVLGIKAEDGSPLWRTQVETDPSAIITASPVIDDGVIYVGVSSRAE--ALKDKTT  212

Query  1124  FRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYS  945
             +RG    LD  TGK+LW+T+M+P        Y G ++WG++P +D   G +Y+ TGN +S
Sbjct  213   YRGSVVSLDASTGKLLWKTYMVPVG------YTGGSVWGNTPVVDHQTGLLYVTTGNNFS  266

Query  944   APKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIA  765
              P+ V +   + N K    T         NH DS +AL+L TGKI W  +          
Sbjct  267   VPEGVCRYPGQSNCKRDVAT---------NHIDSFVALNLKTGKIAWATR----------  307

Query  764   CINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVW  585
              + +  + N      PD DFG  P + +  V G  R ++ A  KSG  WALD   G++VW
Sbjct  308   TLAADMSTNYDHDDGPDYDFGSGPNLYTATVAGHKRTLLGAGAKSGVYWALDPKTGKVVW  367

Query  584   YteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTL--LPSKNVTIGGGWVAMDAQTG  411
             +T+ GPG  +GG  WG A D +R+Y SI N N  + ++   P K  T GG W A+DA TG
Sbjct  368   HTQVGPGSLLGGMLWGTAADGKRIYVSIGNLNHESISVNSPPGKTTTRGGVWAAVDAATG  427

Query  410   KILWSTAVP-DTGLSNPVTVANGVLFAGSVHPRGP-VFAINAKTGEILWSYYTGATVYGG  237
             K+LW TA P D   +  ++ ANG+++AGS+   G  ++A++A TGEI WS+ +G  V  G
Sbjct  428   KVLWRTADPQDMMDTMAMSEANGIVYAGSLAGSGANMYALDAATGEIKWSFESGGAVASG  487

Query  236   MSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
              ++ +G VY G+GY   +  G+P       L+AF L
Sbjct  488   AAIVDGTVYWGSGYHTKV-LGLPYAGDNHKLYAFAL  522



>ref|YP_008319373.1| pyrroloquinoline quinone-dependent alcohol dehydrogenase [Pandoravirus 
dulcis]
 gb|AGO82704.1| pyrroloquinoline quinone-dependent alcohol dehydrogenase [Pandoravirus 
dulcis]
Length=573

 Score =   266 bits (681),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 195/522 (37%), Positives = 273/522 (52%), Gaps = 48/522 (9%)
 Frame = -1

Query  1634  WLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILK-GVVYFPSWNGY  1458
             W N G  + N  +A  E +IS ++V +L + W+     D++  PA+ + G +Y     G 
Sbjct  51    WPNWGAGLDNVHHAVNETQISAASVGRLTVAWKATLVGDVTGPPAVDRDGTLYVNDLAGN  110

Query  1457  LYAVNASDGSLLWERNLQKLTGLNATVR--TGNVTAIVSRSTPSIVGETLIIGIYGPAVV  1284
             ++A+    G++LW   L   TG   T    TG  T   +R TP+I G  + +   G A V
Sbjct  111   VWALRGCTGTVLWRTALGNFTGNPGTFNPTTGRTTGTTARGTPAIHGAYIYVNDIGSARV  170

Query  1283  IGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEE---GSSKAHCCTFRGR  1113
               + + TG L W T+LD HPA + TMS T  +G  ++G SS E    G     CCTFRG 
Sbjct  171   FCLHKRTGALRWQTVLDTHPAAITTMSPTVVDGLVFIGVSSTESVLAGFPDYPCCTFRGS  230

Query  1112  FAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKH  933
              A LD  TG ++WQ +          +Y GA +WGSSPS+D     VY+ TGN Y  P  
Sbjct  231   MAALDARTGAIVWQKYT------TTSDYPGAPVWGSSPSVDLAERVVYVGTGNNYRVPAD  284

Query  932   VLKCQE-KQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKW---FRQLGGYDVFFIA  765
             V  C +  + +  T P       +P N +++I+A D+DTG I+W   F  L G DV+ +A
Sbjct  285   VQACIDANEGDARTCP------FDPANMAETIIAFDMDTGDIRWNTSFSLLHGLDVWNLA  338

Query  764   C------INSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRD  603
             C      +     PNCP  P PD+DFG+APM +     G    ++   QKSGF +AL   
Sbjct  339   CKPWLLGLPGGPGPNCPAFPGPDSDFGQAPMRIHYRSGGVQVPLLAVGQKSGFFYALHPA  398

Query  602   NGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMD  423
             +G + W     PGG +GG  WG+A D +R+Y + +NS+  N TL   + VT GG W A+D
Sbjct  399   DGRVAWLKSVAPGGDMGGFQWGSAFDGDRIYVAGSNSDYANQTLKDGR-VTRGGTWAALD  457

Query  422   AQTGKILWSTAVPD-TGLSNP---------------VTVANGVLF--AGSVHPRGP-VFA  300
               TG +LW T VP   GL N                +TVANGV+F  AGS  P  P +FA
Sbjct  458   PATGTVLWETPVPQGLGLVNATRDEAVAAWPLAWSSLTVANGVVFAGAGSRDPAVPTMFA  517

Query  299   INAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAG  174
             ++A TGEILW +  GA++    +V +G VY G GY  +  AG
Sbjct  518   LDAATGEILWQFAPGASIISSPAVVDGWVYWGIGYGQNSRAG  559



>ref|WP_039421632.1| polyvinylalcohol dehydrogenase [Xanthomonas vesicatoria]
 gb|KHM95545.1| polyvinylalcohol dehydrogenase [Xanthomonas vesicatoria]
 gb|KHM95909.1| polyvinylalcohol dehydrogenase [Xanthomonas vesicatoria]
Length=576

 Score =   266 bits (681),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 190/510 (37%), Positives = 271/510 (53%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P +  W   GG  +N R+A GE KI+ +TV  LK  W      DISATP++  G +Y
Sbjct  62    FASPTT--WPTAGGGYFNSRFAPGEWKINRTTVKGLKPAWTLTTNGDISATPSVEGGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA        A V+R+TP+I  +++I+G  
Sbjct  120   VPDWGGTLYSVDTQSGKPNWQAKLSDYTG-NA--------ASVTRNTPAISAKSIIVGDQ  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGS-SKAHCCTF  1122
                 V+ + + TG LLW T  + +P   IT S   Y    YVG SS + G+ +  H  +F
Sbjct  171   AAGTVLAIDKKTGKLLWKTTAEANPQARITSSPVIYGNRIYVGISSGDWGNLAPNHTFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    LD+ TGK LWQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  231   RGSVVALDLNTGKKLWQFYNVPEG------YTGASVWGQV-AIDPISRRLYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P+ V  C    ++ + +  T  D+  C+ P+N+ DS+++L++DTGK+ W  +  GYD + 
Sbjct  284   PQSVGNCVSNARSYRGSELTVQDELNCMAPDNYVDSVVSLNMDTGKLVWADRAQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++CI + +   CP         PD DFG A + L +V  NG  + +V A QKSG  WA D
Sbjct  344   LSCIVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFTVWRNGKPQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    +VY +I NS+   +TL P   V+  GG 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQVYVAINNSSNATYTLGPDNTVSHNGGS  463

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKI W   VP     NP         +TV+  +L+AGS+   G + A++  T
Sbjct  464   WAALDAATGKIKWQVKVPGINRVNPTVPAGGQGSLTVSPNLLYAGSMA--GNMVALDTDT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  LW+Y    +V    +V NG +Y G GY
Sbjct  522   GATLWNYDATGSVISSPAVVNGALYWGAGY  551



>ref|WP_011270088.1| polyvinylalcohol dehydrogenase [Xanthomonas campestris]
 ref|YP_245229.1| polyvinylalcohol dehydrogenase [Xanthomonas campestris pv. campestris 
str. 8004]
 gb|AAY51209.1| polyvinylalcohol dehydrogenase [Xanthomonas campestris pv. campestris 
str. 8004]
Length=539

 Score =   265 bits (678),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 190/510 (37%), Positives = 270/510 (53%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P   NW   GG  +N R+A GE KI+ +T   LK  W      DISATP++  G +Y
Sbjct  25    FASP--NNWPTAGGGYFNSRFAPGEWKINRTTAPTLKPAWTLTTTGDISATPSVEGGTLY  82

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA          V+R+TP+I G+++I+G  
Sbjct  83    VPDWGGTLYSVDTQSGKPNWQAKLSDYTG-NANS--------VTRNTPAISGKSIIVGDQ  133

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA-HCCTF  1122
                 V+ + + TG LLW ++ + +P   IT S   Y    YVG SS + G+  A H  TF
Sbjct  134   ASGTVMAIDKKTGKLLWSSVAESNPQARITSSPVIYGNRIYVGISSGDWGNLDATHTFTF  193

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    LD+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  194   RGSVVALDLNTGKKVWQFYNVPEG------YTGASVWGQV-AIDPISRRLYFGTGNNYNI  246

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P  V  C    ++ + +  T  D+  C+ P+N+ DS++AL+LDTGK+ W  +  GYD + 
Sbjct  247   PAGVGNCVSNARSYRGSELTVQDELNCMAPDNYVDSVVALNLDTGKLAWADRAQGYDAWN  306

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++CI + +   CP         PD DFG A + L +V  +G  + +V A QKSG  WA D
Sbjct  307   LSCIVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFTVWRDGKPQQLVGAGQKSGIYWAFD  366

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    +VY +I NS+   +TL P   V+  GG 
Sbjct  367   ARTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQVYVAINNSSNATYTLGPDNTVSHNGGS  426

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKI W   VP     NP         +TV+  +L+AGS+   G + A++  T
Sbjct  427   WAALDAATGKIKWQVKVPGVNSVNPNVPAGGQGSLTVSPNLLYAGSMA--GNMVALDTDT  484

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  LW+Y    +V    +V +G +Y G GY
Sbjct  485   GATLWNYNATGSVISSPAVVDGALYWGAGY  514



>ref|WP_037731359.1| hypothetical protein, partial [Streptomyces sp. BoleA5]
Length=493

 Score =   263 bits (671),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 180/498 (36%), Positives = 259/498 (52%), Gaps = 53/498 (11%)
 Frame = -1

Query  1646  ASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSW  1467
             A+ +W   GGD+ +   A  E  I    V+ LK KW F  G  +SATP ++ G VY P W
Sbjct  35    AAADWPYAGGDLGDTHNAAAERTIGTGNVADLKTKWTFTTGDSVSATPTVVGGYVYAPDW  94

Query  1466  NGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIG------  1305
              G LY V A+ G  +W   +   TG         +   +SR +P+    T++ G      
Sbjct  95    AGNLYKVQATTGQKIWSHQISDYTG---------IAGDISRLSPAYWNGTIVTGSGEQRS  145

Query  1304  -IYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCC  1128
                  A + G+   +G  LW T +D  PA ++T S    +G  YVG SS  E    A   
Sbjct  146   NSTDGAYLFGIDALSGSRLWKTQIDADPAAVVTSSPVIADGVVYVGVSSKAE--KYAPPY  203

Query  1127  TFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLY  948
             TFRG    LD  TG+ LW+T+++P+       Y G A+WGS+P +DA  G VY+ TGN Y
Sbjct  204   TFRGSVVALDAVTGRKLWKTYVVPEG------YTGGAVWGSNPVVDAKTGLVYVGTGNNY  257

Query  947   SAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFI  768
             + P  V    ++        T  D   + +N+ DSI+A DL TG+I W  +    D + +
Sbjct  258   TVPPGVCTSPDE--------TGCDPGAD-DNYQDSIVAFDLHTGEIAWATKTLTADTWTV  308

Query  767   ACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMV  588
                              D DFG AP + +  VNG + D++   QKSG  W LD   G++V
Sbjct  309   GQRFGD-----------DFDFGSAPNLFTTTVNGKSTDLLGIGQKSGVYWTLDPLTGKIV  357

Query  587   WYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPS---KNVTIGGGWVAMDAQ  417
             W T  GPGG +GG  WG+A D +R+Y +  N+N L  TL  +   K+ T GG W A+D  
Sbjct  358   WATAVGPGGNLGGLQWGSAVDGKRIYVANTNTNHLPITLTSATGQKSTTTGGFWAALDPA  417

Query  416   TGKILWSTAVPDTGLSNP---VTVANGVLFAGSVHPRG-PVFAINAKTGEILWSYYTGAT  249
             TG ILW TA PD+  ++P   V+ ANGV++ G+ +P G  ++A++A TG + W + +G  
Sbjct  418   TGNILWETATPDS--ASPMSFVSSANGVVYGGATNPTGNNMYALDAATGAVKWGFPSGGA  475

Query  248   VYGGMSVSNGCVYVGNGY  195
             V GG S+ +G VY G+GY
Sbjct  476   VLGGASIVDGSVYWGSGY  493



>ref|WP_029217738.1| polyvinylalcohol dehydrogenase [Xanthomonas oryzae]
Length=576

 Score =   265 bits (677),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 186/510 (36%), Positives = 276/510 (54%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P+  NW   GG   N R+A GE KI+ +T   LK  W      DISATP++  G +Y
Sbjct  62    FASPS--NWTTAGGGYLNSRFAPGEWKINRTTAKTLKPAWTLTTTGDISATPSVEGGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA          V+R+TP+I  +++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYTG-NANS--------VTRNTPAISAKSIIVGDQ  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA-HCCTF  1122
                 ++ + + TG LLW T ++ +P   IT S   Y    YVG SS + G+ +A H  +F
Sbjct  171   VAGTLLALDKKTGKLLWKTTVEANPQARITSSPVIYGNRIYVGVSSGDWGNLEANHTFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    +D+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  231   RGSVVAVDLNTGKRVWQFYNVPEG------YTGASVWGQV-AIDPINRRLYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P+ V  C   +++ + +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PQSVGNCISNERSYRGSELTVQDELNCMAPDNYVDSVISLNLDTGKLVWANRAQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++C+ + +   CP         PD DFG A + L +V  NGS + +V A QKSG  WA D
Sbjct  344   LSCLVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFAVPSNGSLQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    +VY +I N+    +TL P+   T  GG 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQVYVAINNNANTTYTLGPANVQTHNGGS  463

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKI W   VP     NP         +TV+  +L+AGS+   G + A++A T
Sbjct  464   WAALDAATGKIKWQVKVPGINPVNPTVPAGGQGSLTVSPNLLYAGSMA--GNMVALDADT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G+ +W+Y    +V    +++NG +Y G+GY
Sbjct  522   GDTVWNYNASGSVVSSPAIANGALYWGDGY  551



>ref|WP_019238115.1| polyvinylalcohol dehydrogenase [Xanthomonas campestris]
Length=575

 Score =   265 bits (677),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 190/510 (37%), Positives = 270/510 (53%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P   NW   GG  +N R+A GE KI+ +T   LK  W      DISATP++  G +Y
Sbjct  61    FASP--NNWPTAGGGYFNSRFAPGEWKINRTTAPTLKPAWTLTTTGDISATPSVEGGTLY  118

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA          V+R+TP+I G+++I+G  
Sbjct  119   VPDWGGTLYSVDTQSGKPNWQAKLSDYTG-NANS--------VTRNTPAISGKSIIVGDQ  169

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA-HCCTF  1122
                 V+ + + TG LLW ++ + +P   IT S   Y    YVG SS + G+  A H  TF
Sbjct  170   ASGTVMAIDKKTGKLLWSSVAESNPQARITSSPVIYGNRIYVGISSGDWGNLDATHTFTF  229

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    LD+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  230   RGSVVALDLNTGKKVWQFYNVPEG------YTGASVWGQV-AIDPISRRLYFGTGNNYNI  282

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P  V  C    ++ + +  T  D+  C+ P+N+ DS++AL+LDTGK+ W  +  GYD + 
Sbjct  283   PAGVGNCVSNARSYRGSELTVQDELNCMAPDNYVDSVVALNLDTGKLAWADRAQGYDAWN  342

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++CI + +   CP         PD DFG A + L +V  +G  + +V A QKSG  WA D
Sbjct  343   LSCIVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFTVWRDGKPQQLVGAGQKSGIYWAFD  402

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    +VY +I NS+   +TL P   V+  GG 
Sbjct  403   ARTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQVYVAINNSSNATYTLGPDNTVSHNGGS  462

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKI W   VP     NP         +TV+  +L+AGS+   G + A++  T
Sbjct  463   WAALDAATGKIKWQVKVPGVNSVNPNVPAGGQGSLTVSPNLLYAGSMA--GNMVALDTDT  520

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  LW+Y    +V    +V +G +Y G GY
Sbjct  521   GATLWNYNATGSVISSPAVVDGALYWGAGY  550



>ref|WP_011039149.1| polyvinylalcohol dehydrogenase [Xanthomonas campestris]
 ref|NP_639419.1| polyvinylalcohol dehydrogenase [Xanthomonas campestris pv. campestris 
str. ATCC 33913]
 gb|AAM43301.1| polyvinylalcohol dehydrogenase [Xanthomonas campestris pv. campestris 
str. ATCC 33913]
Length=539

 Score =   263 bits (673),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 189/510 (37%), Positives = 270/510 (53%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P   NW   GG  +N R+A GE KI+ +T   LK  W      DISATP++  G +Y
Sbjct  25    FASP--NNWPTAGGGYFNSRFAPGEWKINRTTAPTLKPAWTLTTTGDISATPSVEGGTLY  82

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA          V+R+TP+I G+++I+G  
Sbjct  83    VPDWGGTLYSVDTQSGKPNWQAKLSDYTG-NANS--------VTRNTPAISGKSIIVGDQ  133

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA-HCCTF  1122
                 V+ + + TG LLW ++ + +P   IT S   Y    YVG SS + G+  A H  +F
Sbjct  134   ASGTVMAIDKKTGKLLWSSVAESNPQARITSSPVIYGNRIYVGISSGDWGNLAANHTFSF  193

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    LD+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  194   RGSVVALDLNTGKKVWQFYNVPEG------YTGASVWGQV-AIDPISRRLYFGTGNNYNI  246

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P  V  C    ++ + +  T  D+  C+ P+N+ DS++AL+LDTGK+ W  +  GYD + 
Sbjct  247   PAGVGNCVSNARSYRGSELTVQDELNCMAPDNYVDSVVALNLDTGKLAWADRAQGYDAWN  306

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++CI + +   CP         PD DFG A + L +V  +G  + +V A QKSG  WA D
Sbjct  307   LSCIVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFTVWRDGKPQQLVGAGQKSGIYWAFD  366

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    +VY +I NS+   +TL P   V+  GG 
Sbjct  367   ARTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQVYVAINNSSNATYTLGPDNTVSHNGGS  426

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKI W   VP     NP         +TV+  +L+AGS+   G + A++  T
Sbjct  427   WAALDAATGKIKWQVKVPGVNSVNPNVPAGGQGSLTVSPNLLYAGSMA--GNMVALDTDT  484

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  LW+Y    +V    +V +G +Y G GY
Sbjct  485   GATLWNYNATGSVISSPAVVDGALYWGAGY  514



>ref|WP_005996485.1| polyvinylalcohol dehydrogenase [Xanthomonas vesicatoria]
 gb|EGD07630.1| glucose dehydrogenase [Xanthomonas vesicatoria ATCC 35937]
Length=576

 Score =   265 bits (676),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 189/510 (37%), Positives = 271/510 (53%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P +  W   GG  +N R+A GE KI+ +TV  LK  W      DISATP++  G +Y
Sbjct  62    FASPTT--WPTAGGGYFNSRFAPGEWKINRTTVKGLKPAWTLTTTGDISATPSVEGGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA        A V+R+TP+I  +++I+G  
Sbjct  120   VPDWGGTLYSVDTQSGKPNWQAKLSDYTG-NA--------ASVTRNTPAISAKSIIVGDQ  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGS-SKAHCCTF  1122
                 V+ + + TG LLW T  + +P   IT S   Y    YVG SS + G+ +  H  +F
Sbjct  171   AAGTVLAIDKKTGKLLWKTTAEANPQARITSSPVIYGNRIYVGISSGDWGNLAPNHTFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    LD+ TGK LWQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  231   RGSVVALDLNTGKKLWQFYNVPEG------YTGASVWGQV-AIDPISRRLYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P+ V  C    ++ + +  T  D+  C+ P+N+ DS+++L++DTGK+ W  +  GYD + 
Sbjct  284   PQSVGNCVSNARSYRGSELTVQDELNCMAPDNYVDSVVSLNMDTGKLVWADRAQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++CI + +   CP         PD DFG A + L +V  NG  + +V A QKSG  WA D
Sbjct  344   LSCIVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFTVWRNGKPQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    +VY +I NS+   +TL P   V+  GG 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQVYVAINNSSNATYTLGPDNTVSHNGGS  463

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKI W   VP     NP         +TV+  +L+AGS+   G + A++  T
Sbjct  464   WAALDAATGKIKWQVKVPGINRVNPTVPAGGQGSLTVSPNLLYAGSMA--GNMVALDTDT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  LW+Y    +V    +V +G +Y G GY
Sbjct  522   GATLWNYDATGSVISSPAVVDGALYWGAGY  551



>ref|WP_014506080.1| polyvinylalcohol dehydrogenase [Xanthomonas campestris]
 ref|YP_005635215.1| polyvinylalcohol dehydrogenase [Xanthomonas campestris pv. raphani 
756C]
 gb|AEL05097.1| polyvinylalcohol dehydrogenase [Xanthomonas campestris pv. raphani 
756C]
Length=575

 Score =   264 bits (675),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 189/510 (37%), Positives = 270/510 (53%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P   NW   GG  +N R+A GE KI+ +T   LK  W      DISATP++  G +Y
Sbjct  61    FASP--NNWPTAGGGYFNSRFAPGEWKINRTTAPTLKPAWTLTTTGDISATPSVEGGTLY  118

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA          V+R+TP+I G+++I+G  
Sbjct  119   VPDWGGTLYSVDTQSGKPNWQAKLSDYTG-NANS--------VTRNTPAISGKSIIVGDQ  169

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA-HCCTF  1122
                 V+ + + TG LLW ++ + +P   IT S   Y    YVG SS + G+  A H  +F
Sbjct  170   ASGTVMAIDKKTGKLLWSSVAESNPQARITSSPVIYGNRIYVGISSGDWGNLAANHTFSF  229

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    LD+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  230   RGSVVALDLNTGKKVWQFYNVPEG------YTGASVWGQV-AIDPISRRLYFGTGNNYNI  282

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P  V  C    ++ + +  T  D+  C+ P+N+ DS++AL+LDTGK+ W  +  GYD + 
Sbjct  283   PAGVGNCVSNARSYRGSELTVQDELNCMAPDNYVDSVVALNLDTGKLAWADRAQGYDAWN  342

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++CI + +   CP         PD DFG A + L +V  +G  + +V A QKSG  WA D
Sbjct  343   LSCIVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFTVWRDGKPQQLVGAGQKSGIYWAFD  402

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    +VY +I NS+   +TL P   V+  GG 
Sbjct  403   ARTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQVYVAINNSSNTTYTLGPDNTVSHNGGS  462

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKI W   VP     NP         +TV+  +L+AGS+   G + A++  T
Sbjct  463   WAALDAATGKIKWQVKVPGVNSVNPNVPAGGQGSLTVSPNLLYAGSMA--GNMVALDTDT  520

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  LW+Y    +V    +V +G +Y G GY
Sbjct  521   GATLWNYNAAGSVISSPAVVDGALYWGAGY  550



>ref|WP_024743774.1| polyvinylalcohol dehydrogenase [Xanthomonas oryzae]
Length=576

 Score =   264 bits (674),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 185/510 (36%), Positives = 273/510 (54%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P+  NW   GG   N R+A GE KI+P+T   LK  W      DISATP++  G +Y
Sbjct  62    FASPS--NWTTAGGGYLNSRFAPGEWKINPTTAKTLKPAWTLTTTGDISATPSVEDGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA          V+R+TP+I  +++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYTG-NANS--------VTRNTPAISAKSIIVGDQ  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA-HCCTF  1122
                 ++ + + TG LLW T ++ +P   IT S   Y    YVG SS + G+  A H  +F
Sbjct  171   VAGTLLALDKKTGKLLWKTTVEANPQARITSSPVIYGNRIYVGVSSGDWGNLAANHTFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    +D+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  231   RGSVVAVDLNTGKKVWQFYNVPEG------YTGASVWGQV-AIDPINRRLYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P+ V  C   +++ + +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PQDVGNCISNERSYRGSELTVQDELNCMAPDNYVDSVISLNLDTGKLVWANRAQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++C+ + +   CP         PD DFG A + L +V  NG  + +V A QKSG  WA D
Sbjct  344   LSCLVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFAVPRNGRLQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    ++Y +I N+    +TL P+   T  GG 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQIYVAINNNANTTYTLGPANVQTHNGGS  463

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKI W   VP     NP         +TV+  +L+AGS+   G + A++A T
Sbjct  464   WAALDAATGKIKWQVKVPGINPVNPTVPAGGQGSLTVSPNLLYAGSMA--GNMVALDADT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  +W+Y    +V    ++ NG +Y G+GY
Sbjct  522   GATVWNYNASGSVVSSPAIVNGALYWGDGY  551



>ref|WP_029561587.1| polyvinylalcohol dehydrogenase [Xanthomonas oryzae]
Length=576

 Score =   263 bits (671),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 185/510 (36%), Positives = 275/510 (54%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P+  NW   GG   N R+A GE KI+ +T   LK  W      DISATP++  G +Y
Sbjct  62    FASPS--NWTTAGGGYLNWRFAPGEWKINRTTAQTLKPAWTLTTTGDISATPSVEGGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA          V+R+TP+I  +++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYTG-NANS--------VTRNTPAISAKSIIVGDQ  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA-HCCTF  1122
                 ++ + + TG LLW T ++ +P   IT S   Y    YVG SS + G+ +A H  +F
Sbjct  171   VAGTLLALDKKTGKLLWKTTVEANPQARITSSPVIYGNRIYVGVSSGDWGNLEANHTFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    +D+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  231   RGSVVAVDLNTGKRVWQFYNVPEG------YTGASVWGQV-AIDPINRRLYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P+ V  C   +++ + +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PQSVGNCISNERSYRGSELTVQDELNCMAPDNYVDSVISLNLDTGKLVWANRAQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++C+ + +   CP         PD DFG A + L +V  NG  + +V A QKSG  WA D
Sbjct  344   LSCLVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFAVPSNGRLQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    +VY +I N+    +TL P+   T  GG 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQVYVAINNNANTTYTLGPANVQTHNGGS  463

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKI W   VP     NP         +TV+  +L+AGS+   G + A++A T
Sbjct  464   WAALDAATGKIKWQVKVPGINPVNPTVPAGGQGSLTVSPNLLYAGSMA--GNMVALDADT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G+ +W+Y    +V    +++NG +Y G+GY
Sbjct  522   GDTVWNYNASGSVVSSPAIANGALYWGDGY  551



>gb|EWT01720.1| polyvinylalcohol dehydrogenase [Intrasporangium oryzae NRRL B-24470]
Length=521

 Score =   260 bits (665),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 188/519 (36%), Positives = 271/519 (52%), Gaps = 46/519 (9%)
 Frame = -1

Query  1637  NWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGY  1458
             +W + G D  N RY  G   +    V  L +KW      ++SATPA+  GVVY P   G+
Sbjct  32    SWSSWGYDTSNSRYNPGPG-LGVGNVGSLSVKWRTPTAGNVSATPAVENGVVYVPDDAGF  90

Query  1457  LYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIG------IYG  1296
             LYA++AS G++ W+ ++  LTG         V    +R+TP+I G+ L++G      +  
Sbjct  91    LYAIDASTGAVRWQTSIATLTG---------VPRDYARATPAIAGDLLVLGDQAGKALSP  141

Query  1295  PAVVIGVKRATGDLLW-MTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSK-AHCCTF  1122
                ++G+ +ATG L+W  T+   +P  ++T S T   G  Y+G +S EE   +     TF
Sbjct  142   DGYLLGINKATGALVWKTTVAGGYP--ILTQSATVVGGTAYIGVASYEEALVRFGFPLTF  199

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RGR   +D  TG + W T  +PD       Y G ++WGS+P++D  RG +YI+TGN YS 
Sbjct  200   RGRMLAVDAATGTIKWSTDTVPDG------YTGGSVWGSAPAVDFKRGSLYISTGNNYSI  253

Query  941   PKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIAC  762
             P     C     +          C+   +  D+I++LDL TG +KW  +    D + +AC
Sbjct  254   PASATACLSSAPDDVARA----ACIPASDMFDAIVSLDLATGAVKWVMRALPSDAWNLAC  309

Query  761   ------INSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDN  600
                     +  TP CP  P PD DFG+AP +  V       + V A QKSG  WA++ D 
Sbjct  310   GIPFLPGFTDPTPACPSDPGPDFDFGQAPTLYKV----KGTEYVGAGQKSGRYWAVNPDT  365

Query  599   GEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDA  420
             G ++W T+AG GG  GG  WG+A D  RVYT+ ANS    +T L    VT  GGW A+DA
Sbjct  366   GAVLWSTQAGTGGVSGGLQWGSAVDGIRVYTANANSESKPWT-LKDGTVTNAGGWSALDA  424

Query  419   QTGKILW-STAVPDTGLSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVY  243
              TG++LW + A    G    VT  +GV+F  S    G ++A+ A +G +LW Y +G + Y
Sbjct  425   ATGRVLWTTAAPTGAGAPAAVTAVDGVVFGCSADADGHMYALKASSGGVLWDYASGDSCY  484

Query  242   GGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCLE  126
              G SV +G VY G GY V      P    G +L+AF + 
Sbjct  485   SGPSVVDGAVYWGTGYTVL----PPDPRPGGALYAFSVN  519



>ref|WP_012439619.1| polyvinylalcohol dehydrogenase [Xanthomonas campestris]
 ref|YP_001905687.1| alcohol dehydrogenase (acceptor) [Xanthomonas campestris pv. 
campestris str. B100]
 emb|CAP53652.1| exported putative alcohol dehydrogenase (acceptor) [Xanthomonas 
campestris pv. campestris]
Length=575

 Score =   261 bits (668),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 188/510 (37%), Positives = 266/510 (52%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P   NW   GG  +N R+A GE KI+ +T   LK  W      DISATP++  G +Y
Sbjct  61    FASP--NNWPTAGGGYFNSRFAPGEWKINRTTAPTLKPAWTLTTTGDISATPSVEGGTLY  118

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA          V+R+TP+I G+++I+G  
Sbjct  119   VPDWGGTLYSVDTQSGKPNWQAKLSDYTG-NANS--------VTRNTPAISGKSIIVGDQ  169

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA-HCCTF  1122
                 V+ + + TG LLW ++ + +P   IT S   Y    YVG SS + G+  A H  +F
Sbjct  170   ASGTVMAIDKKTGKLLWSSVAESNPQARITSSPVIYGNRIYVGISSGDWGNLAANHTFSF  229

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    LD+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  230   RGSVVALDLNTGKKVWQFYNVPEG------YTGASVWGQV-AIDPISRRLYFGTGNNYNI  282

Query  941   PKHVLKCQEKQNNKTTTPTTSD---KCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P  V  C     +   +  T      C+ P+N+ DS++AL+LDTGK+ W  +  GYD + 
Sbjct  283   PAGVGNCVSNARSYLGSELTVQDELNCMAPDNYVDSVVALNLDTGKLAWADRAQGYDAWN  342

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++CI + +   CP         PD DFG A + L +V  +G  + +V A QKSG  WA D
Sbjct  343   LSCIVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFTVWRDGKPQQLVGAGQKSGIYWAFD  402

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    +VY +I NS+   +TL P   V+  GG 
Sbjct  403   ARTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQVYVAINNSSNATYTLGPDNTVSHNGGS  462

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKI W   VP     NP         +TV+  +L+AGS+   G + A++  T
Sbjct  463   WAALDAATGKIKWQVKVPGVNSVNPNVPAGGQGSLTVSPNLLYAGSMA--GNMVALDTDT  520

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  LW+Y    +V    +V +G +Y G GY
Sbjct  521   GATLWNYNATGSVISSPAVVDGALYWGAGY  550



>gb|EWC48990.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. glycines 
str. 8ra]
Length=553

 Score =   261 bits (667),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 185/510 (36%), Positives = 272/510 (53%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P   NW   GG   N R+A GE KI+ +T   LK  W      DISATP++  G +Y
Sbjct  39    FASPT--NWTTAGGGYLNSRFAPGEWKINRTTAKTLKPAWTLTTTGDISATPSVEGGTLY  96

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA          V+R+TP+I  +++I+G  
Sbjct  97    VPDWGGTLYSVDTQTGKPNWQAKLSDYTG-NANS--------VTRNTPAISAKSIIVGDQ  147

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA-HCCTF  1122
                 ++ + + TG LLW T ++ +P   IT S   Y    YVG SS + G+  A H  +F
Sbjct  148   VAGTLLALDKKTGKLLWKTTVEANPQARITSSPVIYGNRIYVGVSSGDWGNLAANHTFSF  207

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    +D+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  208   RGSVVAVDLNTGKKVWQFYNVPEG------YTGASVWGQV-AIDPINRRLYFGTGNNYNI  260

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P+ V  C    ++ + +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  261   PQGVGNCISNARSYRGSELTVQDELDCMAPDNYVDSVISLNLDTGKLVWANRAQGYDAWN  320

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++CI + +   CP         PD DFG A + L +V  NG  + +V A QKSG  WA D
Sbjct  321   LSCIVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFAVPRNGRLQQLVGAGQKSGIYWAFD  380

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    ++Y +I N++   +TL P+   T  GG 
Sbjct  381   AKTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQIYVAINNNSNATYTLGPANVQTHNGGS  440

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W+A+DA TGKI W   VP     NP         +TV+  +L+AGS+   G + A++A T
Sbjct  441   WIALDAATGKIKWQVKVPGINPVNPTVPAGGQGSLTVSPNLLYAGSMA--GNMVALDADT  498

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  +W+Y    +V    +++NG +Y G GY
Sbjct  499   GATVWNYNASGSVISSPAIANGALYWGAGY  528



>ref|WP_016849815.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis]
 gb|KGU56780.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. phaseoli]
 gb|KHF49736.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. phaseoli]
 gb|KHS06703.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. phaseoli]
 gb|KHS31729.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. phaseoli]
Length=576

 Score =   261 bits (667),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 185/510 (36%), Positives = 272/510 (53%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P   NW   GG   N R+A GE KI+ +T   LK  W      DISATP++  G +Y
Sbjct  62    FASPT--NWTTAGGGYLNSRFAPGEWKINRTTAKTLKPAWTLTTTGDISATPSVEGGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA          V+R+TP+I  +++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYTG-NANS--------VTRNTPAISAKSIIVGDQ  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA-HCCTF  1122
                 ++ + + TG LLW T ++ +P   IT S   Y    YVG SS + G+  A H  +F
Sbjct  171   VAGTLLALDKKTGKLLWKTTVEANPQARITSSPVIYGNRIYVGVSSGDWGNLAANHTFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    +D+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  231   RGSVVAVDLNTGKKVWQFYNVPEG------YTGASVWGQV-AIDPINRRLYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P+ V  C    ++ + +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PQGVGNCISNARSYRGSELTVQDELDCMAPDNYVDSVISLNLDTGKLVWANRAQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++CI + +   CP         PD DFG A + L +V  NG  + +V A QKSG  WA D
Sbjct  344   LSCIVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFAVPRNGRLQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    ++Y +I N++   +TL P+   T  GG 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQIYVAINNNSNATYTLGPANVQTHNGGS  463

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W+A+DA TGKI W   VP     NP         +TV+  +L+AGS+   G + A++A T
Sbjct  464   WIALDAATGKIKWQVKVPGINPVNPTVPAGGQGSLTVSPNLLYAGSMA--GNMVALDADT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  +W+Y    +V    +++NG +Y G GY
Sbjct  522   GATVWNYNASGSVISSPAIANGALYWGAGY  551



>ref|WP_034805109.1| hypothetical protein, partial [Intrasporangium oryzae]
Length=495

 Score =   259 bits (661),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 182/496 (37%), Positives = 262/496 (53%), Gaps = 42/496 (8%)
 Frame = -1

Query  1637  NWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGY  1458
             +W + G D  N RY  G   +    V  L +KW      ++SATPA+  GVVY P   G+
Sbjct  26    SWSSWGYDTSNSRYNPGPG-LGVGNVGSLSVKWRTPTAGNVSATPAVENGVVYVPDDAGF  84

Query  1457  LYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIG------IYG  1296
             LYA++AS G++ W+ ++  LTG         V    +R+TP+I G+ L++G      +  
Sbjct  85    LYAIDASTGAVRWQTSIATLTG---------VPRDYARATPAIAGDLLVLGDQAGKALSP  135

Query  1295  PAVVIGVKRATGDLLW-MTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSK-AHCCTF  1122
                ++G+ +ATG L+W  T+   +P  ++T S T   G  Y+G +S EE   +     TF
Sbjct  136   DGYLLGINKATGALVWKTTVAGGYP--ILTQSATVVGGTAYIGVASYEEALVRFGFPLTF  193

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RGR   +D  TG + W T  +PD       Y G ++WGS+P++D  RG +YI+TGN YS 
Sbjct  194   RGRMLAVDAATGTIKWSTDTVPDG------YTGGSVWGSAPAVDFKRGSLYISTGNNYSI  247

Query  941   PKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIAC  762
             P     C     +          C+   +  D+I++LDL TG +KW  +    D + +AC
Sbjct  248   PASATACLSSAPDDVARA----ACIPASDMFDAIVSLDLATGAVKWVMRALPSDAWNLAC  303

Query  761   ------INSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDN  600
                     +  TP CP  P PD DFG+AP +  V       + V A QKSG  WA++ D 
Sbjct  304   GIPFLPGFTDPTPACPSDPGPDFDFGQAPTLYKV----KGTEYVGAGQKSGRYWAVNPDT  359

Query  599   GEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDA  420
             G ++W T+AG GG  GG  WG+A D  RVYT+ ANS    +T L    VT  GGW A+DA
Sbjct  360   GAVLWSTQAGTGGVSGGLQWGSAVDGIRVYTANANSESKPWT-LKDGTVTNAGGWSALDA  418

Query  419   QTGKILW-STAVPDTGLSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVY  243
              TG++LW + A    G    VT  +GV+F  S    G ++A+ A +G +LW Y +G + Y
Sbjct  419   ATGRVLWTTAAPTGAGAPAAVTAVDGVVFGCSADADGHMYALKASSGGVLWDYASGDSCY  478

Query  242   GGMSVSNGCVYVGNGY  195
              G SV +G VY G GY
Sbjct  479   SGPSVVDGAVYWGTGY  494



>ref|WP_012446370.1| polyvinylalcohol dehydrogenase [Xanthomonas oryzae]
 ref|YP_001916000.1| polyvinylalcohol dehydrogenase [Xanthomonas oryzae pv. oryzae 
PXO99A]
 gb|ACD61468.1| polyvinylalcohol dehydrogenase [Xanthomonas oryzae pv. oryzae 
PXO99A]
Length=561

 Score =   260 bits (665),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 185/510 (36%), Positives = 271/510 (53%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P+  NW   GG   N R+A GE KI+ +T   LK  W      DISATP++  G +Y
Sbjct  39    FASPS--NWTTAGGGYLNSRFAPGEWKINRTTAKTLKPAWTLTTTGDISATPSVEGGTLY  96

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA          V+R+TP+I  +++I+G  
Sbjct  97    VPDWGGTLYSVDTQTGKPNWQAKLSDYTG-NANS--------VTRNTPAISAKSIIVGDQ  147

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA-HCCTF  1122
                 ++ + + TG LLW T ++ +P   IT S   Y    YVG SS + G+  A H  +F
Sbjct  148   VAGTLLALDKKTGKLLWKTTVEANPQARITSSPVIYGNRIYVGVSSGDWGNLAANHTFSF  207

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    +D+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  208   RGSVVAVDLNTGKKVWQFYNVPEG------YTGASVWGQV-AIDPINRRLYFGTGNNYNI  260

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P+ V  C   +++ + +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  261   PQDVGNCISNERSYRGSEITVQDELNCMAPDNYVDSVISLNLDTGKLVWANRAQGYDAWN  320

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++C+ + +   CP         PD DFG A + L +V  NG  + +V A QKSG  WA D
Sbjct  321   LSCLVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFAVPGNGRLQQLVGAGQKSGIYWAFD  380

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    +VY +I N+    +TL P+   T  GG 
Sbjct  381   AKTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQVYVAINNNANTTYTLGPANVQTHNGGS  440

Query  437   WVAMDAQTGKILWSTAVPDTGLSNPVTVANG---------VLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKI W   VP     NP   A G         +L+AGS+   G + A++A T
Sbjct  441   WAALDAATGKIKWQVKVPGINPVNPTVPAGGQGSLTASPNLLYAGSMA--GNMVALDADT  498

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  +W+Y    +V    +++NG +Y G+GY
Sbjct  499   GATVWNYDASGSVVSSPAIANGALYWGDGY  528



>ref|WP_027703799.1| polyvinylalcohol dehydrogenase [Xanthomonas oryzae]
Length=584

 Score =   261 bits (666),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 185/510 (36%), Positives = 271/510 (53%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P+  NW   GG   N R+A GE KI+ +T   LK  W      DISATP++  G +Y
Sbjct  62    FASPS--NWTTAGGGYLNSRFAPGEWKINRTTAKTLKPAWTLTTTGDISATPSVEGGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA          V+R+TP+I  +++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYTG-NANS--------VTRNTPAISAKSIIVGDQ  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA-HCCTF  1122
                 ++ + + TG LLW T ++ +P   IT S   Y    YVG SS + G+  A H  +F
Sbjct  171   VAGTLLALDKKTGKLLWKTTVEANPQARITSSPVIYGNRIYVGVSSGDWGNLAANHTFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    +D+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  231   RGSVVAVDLNTGKKVWQFYNVPEG------YTGASVWGQV-AIDPINRRLYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P+ V  C   +++ + +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PQDVGNCISNERSYRGSEITVQDELNCMAPDNYVDSVISLNLDTGKLVWANRAQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++C+ + +   CP         PD DFG A + L +V  NG  + +V A QKSG  WA D
Sbjct  344   LSCLVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFAVPGNGRLQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    +VY +I N+    +TL P+   T  GG 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQVYVAINNNANTTYTLGPANVQTHNGGS  463

Query  437   WVAMDAQTGKILWSTAVPDTGLSNPVTVANG---------VLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKI W   VP     NP   A G         +L+AGS+   G + A++A T
Sbjct  464   WAALDAATGKIKWQVKVPGINPVNPTVPAGGQGSLTASPNLLYAGSMA--GNMVALDADT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  +W+Y    +V    +++NG +Y G+GY
Sbjct  522   GATVWNYDASGSVVSSPAIANGALYWGDGY  551



>ref|WP_023905681.1| polyvinylalcohol dehydrogenase [Xanthomonas hortorum]
 gb|ETC84044.1| polyvinylalcohol dehydrogenase [Xanthomonas hortorum pv. carotae 
str. M081]
Length=576

 Score =   260 bits (665),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 185/510 (36%), Positives = 271/510 (53%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P+S  W + GG  +N R+A GE KI+ +T   LK  W      DISATP++  G +Y
Sbjct  62    FASPSS--WHSAGGGYFNSRFAPGEWKINRTTAKTLKPAWTLTTTGDISATPSVEGGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA          V+R+TP+I  +++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYTG-NANS--------VTRNTPAISAKSIIVGDQ  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA-HCCTF  1122
                 V+ + + TG LLW + ++ +P   IT S   Y    YV  SS + G+  A H  +F
Sbjct  171   AAGTVLAIDKKTGKLLWSSTVEANPQARITSSPVIYGNRIYVPVSSGDWGNLDATHTFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    LD+ TGK LWQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  231   RGSVVALDLNTGKKLWQFYNVPEG------YTGASVWGQV-AIDPISRRLYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P  V  C    ++ + +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PASVGNCVSNARSYRGSELTVQDELDCMAPDNYVDSVISLNLDTGKLVWANRAQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++CI + +   CP         PD DFG A + L +V  +G  + ++ A QKSG  WA D
Sbjct  344   LSCIVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFTVWRDGKPQQLIGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    +VY +I NS+  ++TL P+      GG 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQVYVAINNSSNASYTLGPANTERHNGGS  463

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKI W   VP     NP         +TV+  +L+AGS+   G + A++  T
Sbjct  464   WAALDAATGKIKWQVKVPGINRVNPTVPAGGQGSLTVSPNLLYAGSMA--GNMVALDTDT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  LW+Y    +V    +++NG +Y G GY
Sbjct  522   GATLWNYDAAGSVISSPAIANGALYWGAGY  551



>ref|WP_011407346.1| polyvinylalcohol dehydrogenase [Xanthomonas oryzae]
 ref|YP_449330.1| polyvinylalcohol dehydrogenase [Xanthomonas oryzae pv. oryzae 
MAFF 311018]
 dbj|BAE67056.1| polyvinylalcohol dehydrogenase [Xanthomonas oryzae pv. oryzae 
MAFF 311018]
Length=584

 Score =   261 bits (666),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 185/510 (36%), Positives = 271/510 (53%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P+  NW   GG   N R+A GE KI+ +T   LK  W      DISATP++  G +Y
Sbjct  62    FASPS--NWTTAGGGYLNSRFAPGEWKINRTTAKTLKPAWTLTTTGDISATPSVEGGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA          V+R+TP+I  +++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYTG-NANS--------VTRNTPAISAKSIIVGDQ  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA-HCCTF  1122
                 ++ + + TG LLW T ++ +P   IT S   Y    YVG SS + G+  A H  +F
Sbjct  171   VAGTLLALDKKTGKLLWKTTVEANPQARITSSPVIYGNRIYVGVSSGDWGNLAANHTFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    +D+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  231   RGSVVAVDLNTGKKVWQFYNVPEG------YTGASVWGQV-AIDPINRRLYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P+ V  C   +++ + +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PQDVGNCISNERSYRGSELTVQDELNCMAPDNYVDSVISLNLDTGKLVWANRAQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++C+ + +   CP         PD DFG A + L +V  NG  + +V A QKSG  WA D
Sbjct  344   LSCLVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFAVPGNGRLQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    +VY +I N+    +TL P+   T  GG 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQVYVAINNNANTTYTLGPANVQTHNGGS  463

Query  437   WVAMDAQTGKILWSTAVPDTGLSNPVTVANG---------VLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKI W   VP     NP   A G         +L+AGS+   G + A++A T
Sbjct  464   WAALDAATGKIKWQVKVPGINPVNPTVPAGGQGSLTASPNLLYAGSMA--GNMVALDADT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  +W+Y    +V    +++NG +Y G+GY
Sbjct  522   GATVWNYDASGSVVSSPAIANGALYWGDGY  551



>ref|WP_005914566.1| MULTISPECIES: polyvinylalcohol dehydrogenase [Xanthomonas]
 emb|CCF69143.1| pyrrolo-quinoline quinone coenzyme N-terminus family protein 
[Xanthomonas axonopodis pv. punicae str. LMG 859]
 gb|EKQ64147.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. malvacearum 
str. GSPB1386]
Length=576

 Score =   260 bits (664),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 185/510 (36%), Positives = 271/510 (53%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P   NW   GG   N R+A GE KI+ +T   LK  W      DISATP++  G +Y
Sbjct  62    FASPT--NWTTAGGGYLNSRFAPGEWKINRTTAKTLKPAWTLTTTGDISATPSVEGGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA          V+R+TP+I  +++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYTG-NANS--------VTRNTPAISAKSIIVGDQ  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA-HCCTF  1122
                 ++ + + TG LLW T ++ +P   IT S   Y    YVG SS + G+  A H  +F
Sbjct  171   VAGTLLALDKKTGKLLWKTTVEANPQARITSSPVIYGNRIYVGVSSGDWGNLAANHTFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    +D+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  231   RGSVVAVDLNTGKKVWQFYNVPEG------YTGASVWGQV-AIDPINRRLYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P+ V  C    ++ + +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PQGVGNCISNARSYRGSELTVQDELDCMAPDNYVDSVISLNLDTGKLVWANRAQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++CI + +   CP         PD DFG A + L +V  NG  + +V A QKSG  WA D
Sbjct  344   LSCIVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFAVPRNGRLQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    ++Y +I N++   +TL P+   T  GG 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQIYVAINNNSNATYTLGPANVQTHNGGS  463

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKI W   VP     NP         +TV+  +L+AGS+   G + A++A T
Sbjct  464   WAALDAATGKIKWQVKVPGINPVNPTVPAGGQGSLTVSPNLLYAGSMA--GNMVALDADT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  +W+Y    +V    +++NG +Y G GY
Sbjct  522   GATVWNYNASGSVISSPAIANGALYWGAGY  551



>ref|WP_008571737.1| MULTISPECIES: polyvinylalcohol dehydrogenase [Xanthomonas]
 gb|EGD15517.1| glucose dehydrogenase [Xanthomonas perforans 91-118]
Length=576

 Score =   260 bits (664),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 185/510 (36%), Positives = 271/510 (53%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P   NW   GG   N R+A GE KI+ +T   LK  W      DISATP++  G +Y
Sbjct  62    FASPT--NWTTAGGGYLNSRFAPGEWKINRTTAKTLKPAWTLTTTGDISATPSVEGGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA          V+R+TP+I  +++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYTG-NANS--------VTRNTPAISAKSIIVGDQ  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA-HCCTF  1122
                 ++ + + TG LLW T ++ +P   IT S   Y    YVG SS + G+  A H  +F
Sbjct  171   VAGTLLALDKKTGKLLWKTTVEANPQARITSSPVIYGNRIYVGVSSGDWGNLAANHTFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    +D+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  231   RGSVVAVDLNTGKKVWQFYNVPEG------YTGASVWGQV-AIDPINRRLYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P+ V  C    ++ + +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PQGVGNCISNARSYRGSELTVQDELNCMAPDNYVDSVISLNLDTGKLIWANRAQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++CI + +   CP         PD DFG A + L +V  NG  + +V A QKSG  WA D
Sbjct  344   LSCIVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFAVPRNGRLQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    ++Y +I N++   +TL P+   T  GG 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQIYVAINNNSNATYTLGPANVQTHNGGS  463

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKI W   VP     NP         +TV+  +L+AGS+   G + A++A T
Sbjct  464   WAALDAATGKIKWQVKVPGVNPVNPTVPAGGQGSLTVSPNLLYAGSMA--GNMVALDADT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  +W+Y    +V    +++NG +Y G GY
Sbjct  522   GATVWNYNASGSVISSPAIANGALYWGAGY  551



>ref|WP_015471407.1| polyvinylalcohol dehydrogenase [Xanthomonas citri]
 ref|YP_007648120.1| polyvinylalcohol dehydrogenase [Xanthomonas citri subsp. citri 
Aw12879]
 gb|AGI05922.1| polyvinylalcohol dehydrogenase [Xanthomonas citri subsp. citri 
Aw12879]
 emb|CEI17233.1| Polyvinylalcohol dehydrogenase [Xanthomonas citri pv. citri]
 emb|CEI09665.1| Polyvinylalcohol dehydrogenase [Xanthomonas citri pv. citri]
Length=576

 Score =   260 bits (664),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 184/510 (36%), Positives = 271/510 (53%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P   NW   GG   N R+A GE KI+ +T   LK  W      DISATP++  G +Y
Sbjct  62    FASPT--NWTTAGGGYLNSRFAPGEWKINRTTAKTLKPAWTLTTTGDISATPSVEGGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA          V+R+TP+I  +++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYTG-NANS--------VTRNTPAISAKSIIVGDQ  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA-HCCTF  1122
                 ++ + + TG LLW T ++ +P   IT S   Y    YVG SS + G+  A H  +F
Sbjct  171   VAGTLLALDKKTGKLLWKTTVEANPQARITSSPVIYGNRIYVGVSSGDWGNLAANHTFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    +D+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  231   RGSVVAVDLNTGKKVWQFYNVPEG------YTGASVWGQV-AIDPINRRLYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P+ V  C    ++ + +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PQGVGNCISNARSYRGSELTVQDELDCMAPDNYVDSVISLNLDTGKLVWANRAQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++C+ + +   CP         PD DFG A + L +V  NG  + +V A QKSG  WA D
Sbjct  344   LSCVVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFAVPRNGRLQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    ++Y +I N++   +TL P+   T  GG 
Sbjct  404   AKTGAKVWSTKVGPGGTTGGVEWGTAFDPYKSQIYVAINNNSNATYTLGPANVQTHNGGS  463

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKI W   VP     NP         +TV+  +L+AGS+   G + A++A T
Sbjct  464   WAALDAATGKIKWQVKVPGINPVNPTVPAGGQGSLTVSPNLLYAGSMA--GNMVALDADT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  +W+Y    +V    +++NG +Y G GY
Sbjct  522   GATMWNYNASGSVISSPAIANGALYWGAGY  551



>gb|KGK55929.1| polyvinylalcohol dehydrogenase [Xanthomonas sp. Nyagatare]
Length=576

 Score =   260 bits (664),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 185/510 (36%), Positives = 268/510 (53%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P S  W   GG   N+R+A GE KI+ STVS LK  W      DISATP+I  G +Y
Sbjct  62    FASPTS--WPIAGGGYLNQRFAPGEWKINRSTVSSLKPAWTLTTTGDISATPSIEGGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG + +         +SR+TP+I  +++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYTGKSTS---------LSRTTPAITPKSIILGDM  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLE-EGSSKAHCCTF  1122
                 V+ + + TG LLW + ++ +P   IT S   Y    Y+G SS + E     H  +F
Sbjct  171   AGGTVLALDKKTGKLLWKSEVETNPQAQITSSPVVYGNRVYLGVSSRDYESLDPTHRFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    LD+ TGK +WQ +  P+       Y GA+ WG   ++D     +Y  TGN Y+ 
Sbjct  231   RGSVVALDLATGKKVWQFYNAPEG------YTGASTWGQV-AVDPIARRIYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P  V  C    ++ + +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PASVGNCVSNARSYRGSELTVQDELNCMAPDNYVDSVVSLNLDTGKLVWANRNQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPM-MLSVVVNGSTRDIVVAVQKSGFAWALD  609
             ++CI + +   CP         PD DFG A + + SV  +G  + +V A QKSG  WA D
Sbjct  344   LSCILAPTNGLCPNTQATNLTGPDYDFGGAGINLFSVQRDGKLQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WGAA D    RVY  I N+    +TL P   V+  GG 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGIEWGAAFDPYKSRVYVGINNNLNTPYTLAPGNTVSHNGGS  463

Query  437   WVAMDAQTGKILWSTAVP---------DTGLSNPVTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TG+ILW    P           G   P++V+  ++FAGS+   G + A+++ T
Sbjct  464   WAALDAATGRILWQVKAPGINPVNPAVPAGAQGPMSVSPNLVFAGSMA--GNMVALDSDT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  LW+Y    +V    S+ +G +Y G+GY
Sbjct  522   GATLWNYKATGSVMSAPSIVDGALYWGSGY  551



>ref|WP_005923088.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis]
 gb|EKQ58958.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. malvacearum 
str. GSPB2388]
Length=576

 Score =   259 bits (663),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 184/510 (36%), Positives = 271/510 (53%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P   NW   GG   N R+A GE KI+ +T   LK  W      DISATP++  G +Y
Sbjct  62    FASPT--NWTTAGGGYLNSRFAPGEWKINRTTAKTLKPAWTLTTTGDISATPSVEGGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA          V+R+TP+I  +++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYTG-NANS--------VTRNTPAISAKSIIVGDQ  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA-HCCTF  1122
                 ++ + + TG LLW T ++ +P   IT S   Y    YVG SS + G+  A H  +F
Sbjct  171   VAGALLALDKKTGKLLWKTTVEANPQARITSSPVIYGNRIYVGVSSGDWGNLAANHTFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    +D+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  231   RGSVVAVDLNTGKKVWQFYNVPEG------YTGASVWGQV-AIDPINRRLYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P+ V  C    ++ + +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PQGVGNCISNARSYRGSELTVQDELDCMAPDNYVDSVISLNLDTGKLVWANRAQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++C+ + +   CP         PD DFG A + L +V  NG  + +V A QKSG  WA D
Sbjct  344   LSCVVAPTNGLCPNTQATNLTGPDDDFGGAGVQLFAVPRNGRLQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    ++Y +I N++   +TL P+   T  GG 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQIYVAINNNSNATYTLGPANVQTHNGGS  463

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKI W   VP     NP         +TV+  +L+AGS+   G + A++A T
Sbjct  464   WAALDAATGKIKWQVKVPGINPVNPTVPAGGQGSLTVSPNLLYAGSMA--GNMVALDADT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  +W+Y    +V    +++NG +Y G GY
Sbjct  522   GATVWNYNASGSVISSPAIANGALYWGAGY  551



>ref|WP_014091452.1| polyvinylalcohol dehydrogenase [Xanthomonas alfalfae]
 ref|YP_004853605.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. citrumelo 
F1]
 gb|AEO44307.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. citrumelo 
F1]
Length=576

 Score =   259 bits (663),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 185/510 (36%), Positives = 271/510 (53%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P   NW   GG   N R+A GE KI+ +T   LK  W      DISATP++  G +Y
Sbjct  62    FASPT--NWTTAGGGYLNSRFAPGEWKINRTTAKTLKPAWTLTTTGDISATPSVEGGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA          V+R+TP+I  +++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYTG-NANS--------VTRNTPAISAKSIIVGDQ  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA-HCCTF  1122
                 ++ + + TG LLW T ++ +P   IT S   Y    YVG SS + G+  A H  +F
Sbjct  171   VAGTLLALDKKTGKLLWKTTVEANPQARITSSPVIYGNRIYVGVSSGDWGNLAANHTFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    +D+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  231   RGSVVAVDLNTGKKVWQFYNVPEG------YTGASVWGQV-AIDPINRRLYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P+ V  C    ++ + +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PQGVGNCISNARSYRGSELTVQDELNCMAPDNYVDSVISLNLDTGKLIWANRAQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++CI + +   CP         PD DFG A + L +V  NG  + +V A QKSG  WA D
Sbjct  344   LSCIVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFAVPRNGRLQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    ++Y +I N++   +TL P+   T  GG 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQIYVAINNNSNATYTLGPANVQTHNGGS  463

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKI W   VP     NP         +TV+  +L+AGS+   G + A++A T
Sbjct  464   WAALDAATGKIKWQVKVPGVNPVNPTVPAGGQGSLTVSPNLLYAGSMA--GNMVALDADT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  +W+Y    +V    +++NG +Y G GY
Sbjct  522   GATVWNYNASGSVISSPAIANGALYWGAGY  551



>ref|YP_008437577.1| pyrroloquinoline quinone-dependent alcohol dehydrogenase [Pandoravirus 
salinus]
 gb|AGO84506.1| pyrroloquinoline quinone-dependent alcohol dehydrogenase [Pandoravirus 
salinus]
Length=555

 Score =   259 bits (662),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 189/516 (37%), Positives = 267/516 (52%), Gaps = 50/516 (10%)
 Frame = -1

Query  1634  WLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILK-GVVYFPSWNGY  1458
             W N G  + N  +A  E +IS + V +L + W      D++  PA+ + G +Y     G 
Sbjct  33    WPNWGAGLDNTHHAINETQISAANVDRLSVAWTTTLVGDVTGPPAVDRDGTLYVNDLAGN  92

Query  1457  LYAVNASDGSLLWERNLQKLTGLNATVR--TGNVTAIVSRSTPSIVGETLIIGIYGPAVV  1284
             ++A+    G++LW   L   TG        TG  T   +R TP+I G  + +   G A V
Sbjct  93    VWALRGCTGTVLWRTALGNFTGNPGVFSPTTGRTTGTTARGTPAIHGAYIYVNDIGSARV  152

Query  1283  IGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEE---GSSKAHCCTFRGR  1113
               + + TG L W T+LD HPA + TMS T  +G  ++G SS E    G     CCTFRG 
Sbjct  153   FCLHKRTGALRWQTVLDSHPAAITTMSPTVVDGLVFIGVSSTESVMAGFPDYPCCTFRGS  212

Query  1112  FAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKH  933
              A L+  TG ++WQ +          +Y GA  WGSSPS+D  +  VY+ TGN Y  P  
Sbjct  213   MAALNARTGAIVWQKYT------TTADYPGAPAWGSSPSVDLAKRVVYVGTGNNYKVPAD  266

Query  932   VLKCQE-KQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKW---FRQLGGYDVFFIA  765
             V  C +  + +  T P       +P N +++I+A D+DTG I+W   F  L G DV+ +A
Sbjct  267   VQACIDANEGDARTCP------FDPANMAETIIAFDMDTGAIRWNTSFSLLHGLDVWNLA  320

Query  764   C------INSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRD  603
             C      +     PNCP  P PD+DFG+APM +     G    ++   QKSG  +AL   
Sbjct  321   CKPWLLGLPGGPGPNCPAFPGPDSDFGQAPMRIHYRSGGVRVPLLAVGQKSGLFYALHPA  380

Query  602   NGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMD  423
             +G + W     PGG +GG  WG+A D +R+Y + +NS+ +N TL   + VT GG W A+D
Sbjct  381   DGSVAWIKSVAPGGDMGGFQWGSAFDGDRIYVAGSNSDYVNQTLKDGR-VTRGGTWAALD  439

Query  422   AQTGKILWSTAVPDTGLS-----------------NPVTVANGVLF--AGSVHPRGP-VF  303
               TG +LW T VP  GL                  + +TVANGV+F  AGS  P  P +F
Sbjct  440   PATGTVLWETPVPQ-GLDLVNATRDEAVAAWPLAWSSLTVANGVVFAGAGSRDPTVPTMF  498

Query  302   AINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             A++A TGEILW +  GA++    +V +G VY G GY
Sbjct  499   ALDAATGEILWQFAPGASIISSPAVVDGWVYWGIGY  534



>ref|WP_015463756.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis]
 ref|YP_007638576.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis Xac29-1]
 gb|AGH79617.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis Xac29-1]
 emb|CEH55980.1| Polyvinylalcohol dehydrogenase [Xanthomonas citri pv. citri]
 emb|CEH65400.1| Polyvinylalcohol dehydrogenase [Xanthomonas citri pv. citri]
 emb|CEI36217.1| Polyvinylalcohol dehydrogenase [Xanthomonas citri pv. citri]
 emb|CEH57120.1| Polyvinylalcohol dehydrogenase [Xanthomonas citri pv. citri]
 emb|CEH68060.1| Polyvinylalcohol dehydrogenase [Xanthomonas citri pv. citri]
 emb|CEH57170.1| Polyvinylalcohol dehydrogenase [Xanthomonas citri pv. citri]
 emb|CEH79703.1| Polyvinylalcohol dehydrogenase [Xanthomonas citri pv. citri]
 emb|CEI17429.1| Polyvinylalcohol dehydrogenase [Xanthomonas citri pv. citri]
 emb|CEH97209.1| Polyvinylalcohol dehydrogenase [Xanthomonas citri pv. citri]
 emb|CEH98286.1| Polyvinylalcohol dehydrogenase [Xanthomonas citri pv. citri]
 emb|CEH95654.1| Polyvinylalcohol dehydrogenase [Xanthomonas citri pv. citri]
 emb|CEH80117.1| Polyvinylalcohol dehydrogenase [Xanthomonas citri pv. citri]
 emb|CEH88659.1| Polyvinylalcohol dehydrogenase [Xanthomonas citri pv. citri]
 emb|CEJ25864.1| Polyvinylalcohol dehydrogenase [Xanthomonas citri pv. citri]
 emb|CEJ21274.1| Polyvinylalcohol dehydrogenase [Xanthomonas citri pv. citri]
 gb|AJD70777.1| hypothetical protein J151_04381 [Xanthomonas citri subsp. citri 
A306]
 emb|CEL42478.1| Polyvinylalcohol dehydrogenase [Xanthomonas citri pv. citri]
 emb|CEL49072.1| Polyvinylalcohol dehydrogenase [Xanthomonas citri pv. citri]
 emb|CEL35384.1| Polyvinylalcohol dehydrogenase [Xanthomonas citri pv. citri]
Length=576

 Score =   259 bits (662),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 184/510 (36%), Positives = 271/510 (53%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P   NW   GG   N R+A GE KI+ +T   LK  W      DISATP++  G +Y
Sbjct  62    FASPT--NWTTAGGGYLNSRFAPGEWKINRTTAKTLKPAWTLTTTGDISATPSVEGGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA          V+R+TP+I  +++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYTG-NANS--------VTRNTPAISAKSIIVGDQ  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA-HCCTF  1122
                 ++ + + TG LLW T ++ +P   IT S   Y    YVG SS + G+  A H  +F
Sbjct  171   VAGTLLALDKKTGKLLWKTTVEANPQARITSSPVIYGNRIYVGVSSGDWGNLAANHTFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    +D+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  231   RGSVVAVDLNTGKKVWQFYNVPEG------YTGASVWGQV-AIDPINRRLYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P+ V  C    ++ + +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PQGVGNCISNARSYRGSELTVQDELDCMAPDNYVDSVISLNLDTGKLVWANRAQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++C+ + +   CP         PD DFG A + L +V  NG  + +V A QKSG  WA D
Sbjct  344   LSCVVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFAVPRNGRLQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    ++Y +I N++   +TL P+   T  GG 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQIYVAINNNSNATYTLGPANVQTHNGGS  463

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKI W   VP     NP         +TV+  +L+AGS+   G + A++A T
Sbjct  464   WAALDAATGKIKWQVKVPGINPVNPTVPAGGQGSLTVSPNLLYAGSMA--GNMVALDADT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  +W+Y    +V    +++NG +Y G GY
Sbjct  522   GATVWNYNASGSVISSPAIANGALYWGAGY  551



>ref|WP_024711795.1| polyvinylalcohol dehydrogenase [Xanthomonas oryzae]
Length=576

 Score =   259 bits (662),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 186/510 (36%), Positives = 271/510 (53%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P+  NW   GG   N R+A GE KI+ +T   LK  W      DISATP++  G VY
Sbjct  62    FASPS--NWTIAGGGYLNSRFAPGEWKINRTTAKTLKPAWTLTTTGDISATPSVEGGTVY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA          V+R+TP+I  +++I+G  
Sbjct  120   VPDWGGMLYSVDTQTGKPNWQAKLSDYTG-NANS--------VTRNTPAIRAKSIIVGDQ  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA-HCCTF  1122
                 ++ + + TG LLW T ++ +P   IT S   Y    YVG SS + G+  A H  +F
Sbjct  171   VAGTLLALDKKTGKLLWKTTVEANPQARITSSPLIYGNRIYVGVSSGDWGNLAANHTFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    +D+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  231   RGSVVAVDLNTGKKVWQFYNVPEG------YTGASVWGQV-AIDPINRRLYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P+ V  C   +++ + +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PQGVGNCISNERSYRGSELTVQDELNCMAPDNYVDSVISLNLDTGKLVWANRAQGYDAWS  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++C+ + +   CP         PD DFG A + L +V  NG  + +V A QKSG  WA D
Sbjct  344   LSCLVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFTVPRNGRLQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    +VY +I N+    +TL P+   T  GG 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQVYVAINNNANTTYTLGPANVQTHNGGS  463

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKI W   VP     NP         +TV+  +L+AGS+   G + A++A T
Sbjct  464   WAALDAATGKIKWQVKVPGVNPVNPTVPAGGQGSLTVSPNLLYAGSMA--GNMVALDADT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  +W Y    +V    +++NG +Y G GY
Sbjct  522   GATVWHYNASGSVISSPAIANGALYWGAGY  551



>ref|WP_029218055.1| polyvinylalcohol dehydrogenase [Xanthomonas cassavae]
Length=579

 Score =   259 bits (662),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 187/510 (37%), Positives = 266/510 (52%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P   NW   GG   N R+A GE KI+ +TV  LK  W      DISATP++  G +Y
Sbjct  65    FASPT--NWPTAGGGYLNSRFAPGEWKINRTTVKGLKPAWTLTTTGDISATPSVEGGTLY  122

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA        A V+R+TP+I  +++I+G  
Sbjct  123   VPDWGGTLYSVDTQTGKPNWQAKLSDYTG-NA--------ASVTRNTPAISAKSIIVGDR  173

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGS-SKAHCCTF  1122
                 V+ + + TG LLW T  + +P   IT S   Y    YV  SS + G+    H  +F
Sbjct  174   AAGTVLAIDKKTGKLLWKTTAEANPQARITSSPVIYGNRIYVPVSSGDWGNLDPTHTFSF  233

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    LD+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  234   RGSVVALDLDTGKKVWQFYNVPEG------YTGASVWGQV-AIDPINRRLYFGTGNNYNI  286

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P  V  C    +++  +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  287   PASVGNCVSNARSHGGSELTVQDELNCMAPDNYVDSVISLNLDTGKLVWANRAQGYDAWN  346

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++C+ + +   CP         PD DFG A + L +V  +G  + +V A QKSG  WA D
Sbjct  347   LSCVVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFAVPRDGKLQQLVGAGQKSGIYWAFD  406

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    +VY +I NS+   +TL P+   +  GG 
Sbjct  407   AKTGAKVWSTQVGPGGTAGGVEWGTAFDPYKSQVYVAINNSSNATYTLGPANTQSHNGGS  466

Query  437   WVAMDAQTGKILWSTAVPDTGLSNPVTVANG---------VLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKI W   VP     +P   A G         +LFAGS+   G + A++  T
Sbjct  467   WAALDAATGKIKWQVKVPGINRVSPTVPAGGQGSLTSSPNLLFAGSMA--GNMVALDTDT  524

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  LW+Y    +V    ++SNG +Y G GY
Sbjct  525   GATLWNYDASGSVISSPAISNGALYWGAGY  554



>ref|WP_039563749.1| polyvinylalcohol dehydrogenase [Xanthomonas campestris]
 gb|KHL59612.1| polyvinylalcohol dehydrogenase [Xanthomonas campestris pv. cannabis]
Length=576

 Score =   259 bits (662),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 185/510 (36%), Positives = 266/510 (52%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P S  W   GG   N+R+A GE KI+ STV  LK  W      DISATP+I  G +Y
Sbjct  62    FASPTS--WPIAGGGYLNQRFAPGEWKINRSTVPSLKPAWTLTTTGDISATPSIEGGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG + +         +SR+TP+I  +++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYTGKSTS---------LSRTTPAITPKSIILGDM  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLE-EGSSKAHCCTF  1122
                 V+ + + TG LLW + ++ +P   IT S   Y    Y+G SS + E     H  +F
Sbjct  171   AGGTVLALDKKTGKLLWKSEVETNPQAQITSSPVVYGNRVYLGVSSRDYESLDPTHRFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    LD+ TGK +WQ +  P+       Y GA+ WG   ++D     +Y  TGN Y+ 
Sbjct  231   RGSVVALDLATGKKVWQFYNAPEG------YTGASTWGQV-AVDPIARRIYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P  V  C    ++ + +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PASVGNCVSNARSYRGSELTVQDELDCMAPDNYVDSVVSLNLDTGKLVWANRNQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPM-MLSVVVNGSTRDIVVAVQKSGFAWALD  609
             ++CI + +   CP         PD DFG A + + SV   G  + +V A QKSG  WA D
Sbjct  344   LSCILAPTNGLCPNTQATNLTGPDYDFGGAGINLFSVQREGKLQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WGAA D    RVY  I N+    +TL P   V+  GG 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGIEWGAAFDPHKSRVYVGINNNLNTPYTLAPGNTVSHNGGS  463

Query  437   WVAMDAQTGKILWSTAVP---------DTGLSNPVTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TG+ILW    P           G   P++V+  +LFAGS+   G + A+++ T
Sbjct  464   WAALDAATGRILWQVKTPGINPVNPAVPAGAQGPISVSPNLLFAGSMA--GNMVALDSDT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  LW+Y    +V    S+ +G +Y G+GY
Sbjct  522   GATLWNYKATGSVMSAPSIVDGALYWGSGY  551



>ref|WP_039412258.1| polyvinylalcohol dehydrogenase [Xanthomonas campestris]
 gb|KHL53679.1| polyvinylalcohol dehydrogenase [Xanthomonas campestris pv. cannabis]
Length=576

 Score =   259 bits (662),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 185/510 (36%), Positives = 266/510 (52%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P S  W   GG   N+R+A GE KI+ STV  LK  W      DISATP+I  G +Y
Sbjct  62    FASPTS--WPIAGGGYLNQRFAPGEWKINRSTVPSLKPAWTLTTTGDISATPSIEGGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG + +         +SR+TP+I  +++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYTGKSTS---------LSRTTPAITPKSIILGDM  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLE-EGSSKAHCCTF  1122
                 V+ + + TG LLW + ++ +P   IT S   Y    Y+G SS + E     H  +F
Sbjct  171   AGGTVLALDKKTGKLLWKSEVETNPQAQITSSPVVYGNRVYLGVSSRDYESLDPTHRFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    LD+ TGK +WQ +  P+       Y GA+ WG   ++D     +Y  TGN Y+ 
Sbjct  231   RGSVVALDLATGKKVWQFYNAPEG------YTGASTWGQV-AVDPIARRIYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P  V  C    ++ + +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PASVGNCVSNARSYRGSELTVQDELDCMAPDNYVDSVVSLNLDTGKLVWANRNQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPM-MLSVVVNGSTRDIVVAVQKSGFAWALD  609
             ++CI + +   CP         PD DFG A + + SV   G  + +V A QKSG  WA D
Sbjct  344   LSCILAPTNGLCPNTQATNLTGPDYDFGGAGINLFSVQREGKLQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WGAA D    RVY  I N+    +TL P   V+  GG 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGIEWGAAFDPYKSRVYVGINNNLNTPYTLAPGNTVSHNGGS  463

Query  437   WVAMDAQTGKILWSTAVP---------DTGLSNPVTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TG+ILW    P           G   P++V+  +LFAGS+   G + A+++ T
Sbjct  464   WAALDAATGRILWQVKTPGINPVNPAVPAGAQGPISVSPNLLFAGSMA--GNMVALDSDT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  LW+Y    +V    S+ +G +Y G+GY
Sbjct  522   GATLWNYKATGSVMSAPSIVDGALYWGSGY  551



>gb|KER73041.1| hypothetical protein HR51_10690 [Burkholderia cepacia]
Length=503

 Score =   256 bits (655),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 179/515 (35%), Positives = 267/515 (52%), Gaps = 48/515 (9%)
 Frame = -1

Query  1640  GNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNG  1461
             G+W   G ++ N R A GE  I  S V+KL  +W      ++SATP +  GVVY P + G
Sbjct  23    GDWPMAGQNLRNTRSAAGERAIGLSNVAKLAPRWSVETDGNVSATPTVAGGVVYVPDFGG  82

Query  1460  YLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIG-----IYG  1296
              L+AV+A+ G + W + +   +          +    SR++P+    TL+IG        
Sbjct  83    SLWAVDAASGQVKWHKKVSDYS---------QIPNDASRTSPAYWKGTLVIGQGTQIANN  133

Query  1295  P--AVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTF  1122
             P  A ++G+K   G  LW T +D   + +IT S    NG  YVG SS  E  +      +
Sbjct  134   PTGAYMLGIKAEDGAPLWRTQVDTDKSAIITSSPVIDNGIVYVGVSSRAE--ALKETPQY  191

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    LD  +GK+LW+T+M+P+       Y G ++WG++  +D   G +Y+ TGN ++ 
Sbjct  192   RGSVVALDATSGKLLWKTYMVPEG------YTGGSVWGNTAVVDHETGLLYVTTGNNFTV  245

Query  941   PKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIAC  762
             P+ V  C+     K        K   P NH DS +AL+L TGKI W  +           
Sbjct  246   PEGV--CRYPGQEKC-------KAAVPGNHIDSFVALNLKTGKIAWATR----------T  286

Query  761   INSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWY  582
             +++  + N      PD DFG  P + +  V G  R ++ A QKSG  WAL+   G++VW+
Sbjct  287   LSADMSTNYDHDDGPDYDFGSGPNLYTTTVGGHKRTLLGAGQKSGVYWALEPKTGKVVWH  346

Query  581   teagpggfvgggtwgaaTDNERVYTSIANSNR--LNFTLLPSKNVTIGGGWVAMDAQTGK  408
             T+ GPG  +GG  WG A D +R+Y SI N N   ++         T GG W A+DA TGK
Sbjct  347   TQVGPGSLLGGMLWGTAADGKRIYVSIGNLNHESIDVNSPAGMKTTKGGIWAAVDAATGK  406

Query  407   ILWSTAVPDTGLSN-PVTVANGVLFAGSVHPRGP-VFAINAKTGEILWSYYTGATVYGGM  234
             +LW TA P   +    ++ ANGV++AGS+   G  ++A++A TGEI WS+ +G  V  G 
Sbjct  407   LLWRTADPQQMMDTVAMSEANGVVYAGSLAGSGANMYALDASTGEIKWSFESGGAVVSGA  466

Query  233   SVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             ++ +G VY G+GY   I  G+P       L+AF +
Sbjct  467   AIVDGTVYWGSGYHTKI-LGLPYAGDNHKLYAFSV  500



>ref|WP_007973917.1| polyvinylalcohol dehydrogenase [Xanthomonas fuscans]
 gb|EFF46635.1| polyvinylalcohol dehydrogenase [Xanthomonas fuscans subsp. aurantifolii 
str. ICPB 10535]
Length=576

 Score =   258 bits (660),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 185/510 (36%), Positives = 263/510 (52%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P+  NW   GG   N R+A GE KI+ +TV  LK  W      DISATP+I  G +Y
Sbjct  62    FASPS--NWTVAGGGYLNSRFAPGEWKINRTTVKTLKPAWTLTTTGDISATPSIEGGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   T         N +  +SR+TP+I  +++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYT---------NKSNSLSRTTPAITPKSIILGDM  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLE-EGSSKAHCCTF  1122
                 V+ + + TG LLW + ++ +P   IT S   Y    Y+G SS + E     H  +F
Sbjct  171   AGGTVLALDKKTGKLLWKSEVETNPQAQITSSPVVYGNRVYLGVSSRDYESLDPTHRFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    LDV TGK +WQ +  P+       Y GA+ WG   ++D     +Y  TGN Y+ 
Sbjct  231   RGSVVALDVNTGKKVWQFYNAPEG------YTGASTWGQV-AVDPIARRIYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P  V  C    ++ +    T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PASVGNCVSNARSYRGGDLTVQDELNCMAPDNYVDSVISLNLDTGKLVWANRNQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++CI + +   CP         PD DFG A + L +V  NG  + +V A QKSG  WA D
Sbjct  344   LSCILAPTNGLCPNTQATNLTGPDYDFGGAGVQLFAVPRNGKLQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  W AA D    R+Y  I N+    +TL P   V+   G 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGIEWSAAFDPYKSRIYVGINNNLNTPYTLGPDNTVSHNAGS  463

Query  437   WVAMDAQTGKILWSTAVP---------DTGLSNPVTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKILW    P           G   P+TV+  +LFAGS+   G + A+++ T
Sbjct  464   WAALDAGTGKILWQVKAPGINPVNPTVPAGAQGPITVSPNLLFAGSMA--GNMVALDSDT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  LW+Y    +V    ++ NG +Y G+GY
Sbjct  522   GATLWNYKASGSVMSAPAIVNGALYWGSGY  551



>ref|WP_039731966.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis]
 gb|KGK65745.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. phaseoli]
 gb|KGT55690.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. phaseoli]
 gb|KGU42333.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. phaseoli]
 gb|KGU44346.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. phaseoli]
 gb|KGU47735.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. phaseoli]
 gb|KGU53039.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. phaseoli]
 gb|KHF71896.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. phaseoli]
 gb|KIF08687.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. phaseoli]
Length=576

 Score =   258 bits (660),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 186/510 (36%), Positives = 264/510 (52%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P+  NW   GG   N R+A GE KI+ +TV  LK  W      DISATP+I  G +Y
Sbjct  62    FASPS--NWTVAGGGYLNSRFAPGEWKINRTTVKTLKPAWTLTTTGDISATPSIEGGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   T         N +  +SR+TP+I  +++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYT---------NKSNSLSRTTPAITPKSIILGDM  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLE-EGSSKAHCCTF  1122
                 V+ + + TG LLW + ++ +P   IT S   Y    Y+G SS + E     H  +F
Sbjct  171   AGGTVLALDKKTGKLLWKSEVETNPQAQITSSPVVYGNRVYLGVSSRDYESLDPTHRFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    LDV TGK +WQ +  P+       Y GA+ WG   ++D     +Y  TGN Y+ 
Sbjct  231   RGSVVALDVNTGKKVWQFYNAPEG------YTGASTWGQV-AVDPIARRIYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P  V  C    ++ +    T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PASVGNCVSNARSYRGGDLTVQDELNCMAPDNYVDSVISLNLDTGKLVWANRNQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++CI + +   CP         PD DFG A + L +V  NG  + +V A QKSG  WA D
Sbjct  344   LSCILAPTNGLCPNTQATNLTGPDYDFGGAGVQLFAVPRNGKLQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WGAA D    R+Y  I N+    +TL P   V+   G 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGIEWGAAFDPYKSRIYVGINNNLNTPYTLGPDNTVSHNAGS  463

Query  437   WVAMDAQTGKILWSTAVP---------DTGLSNPVTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKILW    P           G   P+TV+  +LFAGS+   G + A+++ T
Sbjct  464   WAALDAGTGKILWQVKAPGINPVNPTVPAGAQGPITVSPNLLFAGSMA--GNMVALDSDT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  LW+Y    +V    ++ NG +Y G+GY
Sbjct  522   GATLWNYKASGSVMSAPAIVNGALYWGSGY  551



>ref|WP_007966504.1| polyvinylalcohol dehydrogenase [Xanthomonas fuscans]
 gb|EFF43403.1| polyvinylalcohol dehydrogenase [Xanthomonas fuscans subsp. aurantifolii 
str. ICPB 11122]
Length=576

 Score =   258 bits (659),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 186/510 (36%), Positives = 264/510 (52%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P+  NW   GG   N R+A GE KI+ +TV  LK  W      DISATP+I  G +Y
Sbjct  62    FASPS--NWTVAGGGYLNSRFAPGEWKINRTTVKTLKPAWTLTTTGDISATPSIEGGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   T         N +  +SR+TP+I  +++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQVKLSDYT---------NKSNSLSRTTPAITPKSIILGDM  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLE-EGSSKAHCCTF  1122
                 V+ + + TG LLW + ++ +P   IT S   Y    Y+G SS + E     H  +F
Sbjct  171   AGGTVLALDKKTGKLLWKSEVETNPQAQITSSPVVYGNRVYLGVSSRDYESLDPTHRFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    LDV TGK +WQ +  P+       Y GA+ WG   ++D     +Y  TGN Y+ 
Sbjct  231   RGSVVALDVNTGKKVWQFYNAPEG------YTGASTWGQV-AVDPIARRIYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P  V  C    ++ +    T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PASVGNCVSNARSYRGGELTVQDELNCMAPDNYVDSVISLNLDTGKLVWANRNQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++CI + +   CP         PD DFG A + L +V  NG  + +V A QKSG  WA D
Sbjct  344   LSCILAPTNGLCPNTQATNLTGPDYDFGGAGVQLFAVPRNGKLQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WGAA D    R+Y  I N+    +TL P   V+   G 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGIEWGAAFDPYKSRIYVGINNNLNTPYTLGPDNTVSHNAGS  463

Query  437   WVAMDAQTGKILWSTAVP---------DTGLSNPVTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKILW    P           G   P+TV+  +LFAGS+   G + A+++ T
Sbjct  464   WAALDAGTGKILWQVKAPGINPVNPTVPAGAQGPITVSPNLLFAGSMA--GNMVALDSDT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  LW+Y    +V    ++ NG +Y G+GY
Sbjct  522   GATLWNYKASGSVMSAPAIVNGALYWGSGY  551



>ref|WP_022560360.1| putative PQQ-dependent dehydrogenase [Xanthomonas fuscans]
 ref|YP_008640673.1| putative PQQ-dependent dehydrogenase [Xanthomonas fuscans subsp. 
fuscans]
 emb|CDF63468.1| putative PQQ-dependent dehydrogenase [Xanthomonas fuscans subsp. 
fuscans]
 gb|KGP23730.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. phaseoli]
 gb|KGP28269.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. phaseoli]
 gb|KGP29950.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. phaseoli]
 gb|KGP34808.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. phaseoli]
Length=576

 Score =   258 bits (659),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 186/510 (36%), Positives = 264/510 (52%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P+  NW   GG   N R+A GE KI+ +TV  LK  W      DISATP+I  G +Y
Sbjct  62    FASPS--NWTVAGGGYLNSRFAPGEWKINRTTVKTLKPAWTLTTTGDISATPSIEGGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   T         N +  +SR+TP+I  +++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYT---------NKSNSLSRTTPAITPKSIILGDM  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLE-EGSSKAHCCTF  1122
                 V+ + + TG LLW + ++ +P   IT S   Y    Y+G SS + E     H  +F
Sbjct  171   AGGTVLALDKKTGKLLWKSEVETNPQAQITSSPVVYGNRVYLGVSSRDYESLDPTHRFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    LDV TGK +WQ +  P+       Y GA+ WG   ++D     +Y  TGN Y+ 
Sbjct  231   RGSVVALDVNTGKKVWQFYNAPEG------YTGASTWGQV-AVDPIAHRIYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P  V  C    ++ +    T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PASVGNCVSNARSYRGGDLTVQDELNCMAPDNYVDSVISLNLDTGKLVWANRNQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++CI + +   CP         PD DFG A + L +V  NG  + +V A QKSG  WA D
Sbjct  344   LSCILAPTNGLCPNTQATNLTGPDYDFGGAGVQLFAVPRNGKLQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WGAA D    R+Y  I N+    +TL P   V+   G 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGIEWGAAFDPYKSRIYVGINNNLNTPYTLGPDNTVSHNAGS  463

Query  437   WVAMDAQTGKILWSTAVP---------DTGLSNPVTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKILW    P           G   P+TV+  +LFAGS+   G + A+++ T
Sbjct  464   WAALDAGTGKILWQVKAPGINPVNPTVPAGAQGPITVSPNLLFAGSMA--GNMVALDSDT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  LW+Y    +V    ++ NG +Y G+GY
Sbjct  522   GATLWNYKASGSVMSAPAIVNGALYWGSGY  551



>ref|WP_033483102.1| MULTISPECIES: polyvinylalcohol dehydrogenase [Xanthomonas]
 emb|CDN21715.1| pyrrolo-quinoline quinone coenzyme N-terminus family protein 
[Xanthomonas campestris pv. viticola]
Length=576

 Score =   257 bits (657),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 183/510 (36%), Positives = 271/510 (53%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P   NW   GG   N R+A GE KI+ +T   LK  W      DISATP++  G +Y
Sbjct  62    FASPT--NWTTAGGGYLNSRFAPGEWKINRTTAKTLKPAWTLTTTGDISATPSVEGGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA          V+R+TP+I  +++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYTG-NANS--------VTRNTPAISAKSIIVGDQ  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA-HCCTF  1122
                 ++ + + TG LLW T ++ +P   IT S   +    YVG SS + G+  A H  +F
Sbjct  171   VAGTLLALDKKTGKLLWKTTVEANPQARITSSPVIHGNRIYVGVSSGDWGNLAANHTFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    +D+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  231   RGSVVAVDLNTGKKVWQFYNVPEG------YTGASVWGQV-AIDPINRRLYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P+ V  C    ++ + +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PQGVGNCISNARSYRGSELTVQDELDCMAPDNYVDSVISLNLDTGKLVWANRAQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++C+ + +   CP         PD DFG A + L +V  NG  + +V A QKSG  WA D
Sbjct  344   LSCVVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFAVPRNGRLQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    ++Y +I N++   +TL P+   T  GG 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQIYVAINNNSNATYTLGPANVQTHNGGS  463

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKI W   VP     NP         +TV+  +L+AGS+   G + A++A T
Sbjct  464   WAALDAATGKIKWQVKVPGINPVNPTVPAGGQGSLTVSPNLLYAGSMA--GNMVALDADT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  +W+Y    +V    +++NG +Y G GY
Sbjct  522   GATVWNYNASGSVISSPAIANGALYWGAGY  551



>ref|WP_014501555.1| polyvinylalcohol dehydrogenase [Xanthomonas oryzae]
 ref|YP_005626757.1| polyvinylalcohol dehydrogenase [Xanthomonas oryzae pv. oryzicola 
BLS256]
 gb|AEQ94590.1| polyvinylalcohol dehydrogenase [Xanthomonas oryzae pv. oryzicola 
BLS256]
Length=577

 Score =   257 bits (657),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 184/510 (36%), Positives = 271/510 (53%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P+  NW   GG   N R+A GE KI+ ++   LK  W      DISATP++  G +Y
Sbjct  63    FASPS--NWTIAGGGYLNSRFAPGEWKINRTSAKTLKPAWTLTTTGDISATPSVEGGTLY  120

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA          V+R+TP+I  +++I+G  
Sbjct  121   VPDWGGMLYSVDTQTGKPNWQAKLSDYTG-NANS--------VTRNTPAIRAKSIIVGDQ  171

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA-HCCTF  1122
                 ++ + + TG LLW T ++ +P   IT S   Y    YVG SS + G+  A H  +F
Sbjct  172   VAGTLLALDKKTGKLLWKTTVEANPQARITSSPLIYGNRIYVGVSSGDWGNLAANHTFSF  231

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    +D+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  232   RGSVVAVDLNTGKKVWQFYNVPEG------YTGASVWGQV-AIDPINRRLYFGTGNNYNI  284

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P+ V  C   +++ + +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  285   PQGVGNCISNERSYRGSELTVQDELNCMAPDNYVDSVISLNLDTGKLVWANRAQGYDAWS  344

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++C+ + +   CP         PD DFG A + L +V  NG  + +V A QKSG  WA D
Sbjct  345   LSCLVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFTVPRNGRLQQLVGAGQKSGIYWAFD  404

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    +VY +I N+    +TL P+   T  GG 
Sbjct  405   AKTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQVYVAINNNANTTYTLGPANVQTHNGGS  464

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKI W   VP     NP         +TV+  +L+AGS+   G + A++A T
Sbjct  465   WAALDAATGKIKWQVKVPGVNPVNPTVPAGGQGSLTVSPNLLYAGSMA--GNMVALDADT  522

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  +W Y    +V    +++NG +Y G GY
Sbjct  523   GATVWHYNASGSVISSPAIANGALYWGAGY  552



>ref|WP_006449107.1| polyvinylalcohol dehydrogenase [Xanthomonas gardneri]
 gb|EGD20566.1| glucose dehydrogenase [Xanthomonas gardneri ATCC 19865]
Length=576

 Score =   256 bits (654),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 181/510 (35%), Positives = 268/510 (53%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P+S  W   GG  +N R+A GE KI+ +T   LK  W      DISATP++  G +Y
Sbjct  62    FASPSS--WPIAGGGYFNSRFAPGEWKINRTTAKTLKPAWTLTTTGDISATPSVEGGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG + +         +SR+TP+I  +++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYTGKSTS---------LSRTTPAITPKSIILGDM  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLE-EGSSKAHCCTF  1122
                 V+ + + TG LLW + ++ +P   IT S   Y    Y+G SS + E     H  +F
Sbjct  171   SGGTVLALDKKTGKLLWKSEVETNPQAQITSSPVVYGNRIYLGVSSRDYESLDPTHRFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    LD+ TGK +WQ +  P+       Y GA+ WG   +ID     +Y  TGN Y+ 
Sbjct  231   RGSVVALDLNTGKKVWQFYNAPEG------YTGASTWGQV-AIDPIARRLYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P+ V  C    ++ + +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PQSVGNCVSNARSYRGSALTVQDELDCMAPDNYVDSVISLNLDTGKLVWANRAQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++CI + +   CP         PD DFG A + L +V  +G  + ++ A QKSG  WA D
Sbjct  344   LSCIVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFTVWRDGKPQQLIGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    +VY +I NS+  ++TL P+      GG 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQVYVAINNSSNASYTLGPANTERHNGGS  463

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKI W   VP     NP         +TV+  +L+AGS+   G + A++  T
Sbjct  464   WAALDAATGKIKWQVKVPGINRVNPTVPAGGQGSLTVSPNLLYAGSMA--GNMVALDTDT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  LW+Y    +V    +++NG +Y G GY
Sbjct  522   GATLWNYDAAGSVISSPAIANGALYWGAGY  551



>ref|WP_010381318.1| polyvinylalcohol dehydrogenase [Xanthomonas campestris]
Length=559

 Score =   256 bits (653),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 182/510 (36%), Positives = 271/510 (53%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P+  NW   GG   N R+A G+ KI+ +T   LK  W      DISATP++  G +Y
Sbjct  50    FASPS--NWTTAGGGYLNSRFAPGDWKINRTTAKTLKPAWTLTTTGDISATPSVEGGTLY  107

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA          V+R+TP+I  +++I+G  
Sbjct  108   VPDWGGTLYSVDTQTGKPNWQAKLSDYTG-NANS--------VTRNTPAISAKSIIVGDQ  158

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGS-SKAHCCTF  1122
                 ++ + + TG LLW T ++ +P   IT S   Y    YVG SS + G+ +  H  +F
Sbjct  159   VAGTLLALDKKTGKLLWKTKVEANPQARITSSPVIYGNRIYVGVSSGDWGNLAVNHSFSF  218

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    +D+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  219   RGSVVAVDLNTGKKVWQFYNVPEG------YTGASVWGQV-AIDPISRRLYFGTGNNYNI  271

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P+ V  C    ++ + +  T  D+  C+ P+N+ DS+++L+LDTG + W  +  GYD + 
Sbjct  272   PQGVGNCISNARSYRGSELTVQDELNCMAPDNYVDSVISLNLDTGTLVWANRAQGYDAWN  331

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++C+ + +   CP         PD DFG A + L +V  NG  + +V A QKSG  WA D
Sbjct  332   LSCVMAPTNSLCPNTQATNLTGPDYDFGGAGVQLFAVPRNGKLQQLVRAGQKSGIYWAFD  391

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    +VY +I N++   +TL P+   T  GG 
Sbjct  392   AKTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQVYVAINNNSNATYTLGPANVQTHNGGS  451

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKI W   VP     NP         +TV+  +L+AGS+   G + A++A T
Sbjct  452   WAALDAATGKIKWQVKVPGINPVNPTVPAGGQGSLTVSPNLLYAGSMA--GNMVALDADT  509

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  +W+Y    +V    +++NG +Y G GY
Sbjct  510   GATVWNYNASGSVISSPAIANGALYWGAGY  539



>gb|KGE50571.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. vasculorum]
Length=576

 Score =   256 bits (654),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 185/511 (36%), Positives = 271/511 (53%), Gaps = 44/511 (9%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P+  NW   GG   N R+A GE KI+ +T   LK  W      DISATP++  G +Y
Sbjct  62    FASPS--NWTTAGGGYLNARFAPGEWKINRTTAKTLKPAWTLTTTGDISATPSVEGGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   T  NA          V+R+TP+I  +++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYTD-NANS--------VTRNTPAISAKSIIVGDQ  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA-HCCTF  1122
                 ++ + + TG LLW T ++ +P   IT S   Y    YVG SS + G+  A H  +F
Sbjct  171   VAGTLLALDKKTGKLLWKTTVEANPQARITSSPVIYGNRIYVGVSSGDWGNLAANHTFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    +D+ TGK +WQ +  P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  231   RGSVVAVDLNTGKKVWQFYTAPEG------YTGASVWGQV-AIDPINRRLYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P+ V  C    ++ + +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PQDVGNCISNARSYRGSELTVQDELNCMAPDNYVDSVVSLNLDTGKLIWANRAQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++C+ + +   CP         PD DFG A + L +V  NG  + +V A QKSG  WA D
Sbjct  344   LSCVVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFAVPRNGKLQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI--GG  441
                G  VW T+ GPGG  GG  WG A D    +VY +I N++   +TL P+ NV    GG
Sbjct  404   AKTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQVYVAINNNSNATYTLGPA-NVQSHNGG  462

Query  440   GWVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAK  288
              W A+DA TGKI W   VP     NP         +TV+  +L+AGS+   G + A++A 
Sbjct  463   SWAALDAATGKIKWQVKVPGINPVNPTVPAGGQGSLTVSPNLLYAGSMA--GNMVALDAD  520

Query  287   TGEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             TG  +W+Y    +V    +++NG +Y G GY
Sbjct  521   TGATVWNYNASGSVISSPAIANGALYWGAGY  551



>emb|CEL40299.1| Polyvinylalcohol dehydrogenase [Xanthomonas citri pv. citri]
Length=576

 Score =   256 bits (654),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 183/510 (36%), Positives = 270/510 (53%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P   NW   GG   N R+A GE KI+ +T   LK  W      DISATP++  G +Y
Sbjct  62    FASPT--NWTTAGGGYLNSRFAPGEWKINRTTAKTLKPAWTLTTTGDISATPSVEGGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA          V+R+TP+I  +++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYTG-NANS--------VTRNTPAISAKSIIVGDQ  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA-HCCTF  1122
                 ++ + + TG LLW T ++ +P   IT S   Y    YVG SS + G+  A H  +F
Sbjct  171   VAGTLLALDKKTGKLLWKTTVEANPQARITSSPVIYGNRIYVGVSSGDWGNLAANHTFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    +D+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  231   RGSVVAVDLNTGKKVWQFYNVPEG------YTGASVWGQV-AIDPINRRLYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P+ V  C    ++ + +  T  D+  C+ P+N+  S+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PQGVGNCISNARSYRGSELTVQDELDCMAPDNYVGSVISLNLDTGKLVWANRAQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++C+ + +   CP         PD DFG A + L +V  NG  + +V A QKSG  WA D
Sbjct  344   LSCVVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFAVPRNGRLQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    ++Y +I N++   +TL P+   T  GG 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQIYVAINNNSNATYTLGPANVQTHNGGS  463

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKI W   VP     NP         +TV+  +L+AGS+   G + A++A T
Sbjct  464   WAALDAATGKIKWQVKVPGINPVNPTVPAGGQGSLTVSPNLLYAGSMA--GNMVALDADT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  +W+Y    +V    +++NG +Y G GY
Sbjct  522   GATVWNYNASGSVISSPAIANGALYWGAGY  551



>ref|WP_024937591.1| polyvinylalcohol dehydrogenase [Xanthomonas arboricola]
Length=576

 Score =   255 bits (652),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 184/510 (36%), Positives = 267/510 (52%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P S  W   GG   N+R+A GE KI+ +TV  LK  W      DISATP++  G +Y
Sbjct  62    FASPTS--WTTAGGGYLNQRFAPGEWKINRTTVKGLKPAWTLTTTGDISATPSVEGGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA          V+R+TP+I   ++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYTG-NANS--------VTRNTPAISANSIIVGDQ  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGS-SKAHCCTF  1122
                 V+ + + TG LLW T  + +P   IT S   Y    YV  SS + G+    H  +F
Sbjct  171   AAGTVLAIDKKTGKLLWKTTAEANPQARITSSPVIYGNRVYVPVSSGDWGNLDPTHTFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    LD+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  231   RGSVVALDLNTGKKVWQFYNVPEG------YTGASVWGQV-AIDPINRRLYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P  V  C    ++ + +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PASVGNCVSNARSYRGSELTVQDELACMAPDNYVDSVISLNLDTGKLVWADRAQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++CI + +   CP         PD DFG A + L +V  +G  + +V A QKSG  WA D
Sbjct  344   LSCIVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFTVWRDGKAQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    +VY +I NS+   +TL P+   +  GG 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQVYVAINNSSNATYTLGPANTQSHNGGS  463

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TG+I W   VP     NP         +TV+  +L+AGS+   G + A++A T
Sbjct  464   WAALDAATGRIKWQVKVPGINRVNPNVPAGGQGSLTVSPNLLYAGSMA--GNMVALDADT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  LW++    +V    ++ +G +Y G GY
Sbjct  522   GATLWNHDATGSVISSPAIVDGALYWGAGY  551



>ref|WP_022971217.1| polyvinylalcohol dehydrogenase [Xanthomonas sp. M97]
Length=577

 Score =   255 bits (651),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 178/502 (35%), Positives = 265/502 (53%), Gaps = 40/502 (8%)
 Frame = -1

Query  1634  WLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYL  1455
             W   GG  +N R+A GE KI+P TV  LK  W      DISATP++    +Y P W G L
Sbjct  68    WPTAGGGYFNTRFAPGEWKINPVTVKTLKPAWTLTTSGDISATPSVEGTTLYVPDWGGSL  127

Query  1454  YAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGV  1275
             Y+V+   G   W+  L   TG          T+ V+R+TP+I  +++++G      V+ +
Sbjct  128   YSVDTQTGKPNWQAKLSDYTG---------NTSSVTRNTPAISSKSIVVGDQAAGTVLAI  178

Query  1274  KRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA-HCCTFRGRFAKLD  1098
              + TG LLW + ++ +    IT S        YVG SS + G+  A H  +FRG    LD
Sbjct  179   DKKTGKLLWKSTVEANAQARITSSPVIVGNRVYVGVSSGDWGNLDATHTFSFRGSVVALD  238

Query  1097  VWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQ  918
             + TG  +WQ + +P+       Y GA++WG   +ID  +  +Y  TGN Y+ P  V  C 
Sbjct  239   LATGNKIWQFYTVPEG------YTGASVWGQV-AIDPAKRRLYFGTGNNYNIPFSVGNCV  291

Query  917   EK-QNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSS  747
                ++   +  T  D+  C+ P+N+ DS++AL+LDTGK+ W  +  GYD + ++C+ + +
Sbjct  292   SNVRSYLGSKATVQDELNCMAPDNYVDSVVALNLDTGKLVWANRAQGYDSWNLSCLVAPT  351

Query  746   TPNCPPG-----PNPDADFGEAPM-MLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVW  585
                CP         PD DFG A + + +V  +G  + ++ A QKSG  WA D   G+ VW
Sbjct  352   NGLCPNTQATNLAGPDYDFGGAGVNLFTVWKDGKPQQLIGAGQKSGIYWAFDAKTGDKVW  411

Query  584   YteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGGWVAMDAQT  414
              T+ GPGG  GG  WG A D    RVY +I N++  ++TL P    T  GG W A+DA T
Sbjct  412   STQVGPGGATGGIEWGTAFDPYKSRVYVAINNNDHTSYTLGPDNTQTHNGGSWAALDAAT  471

Query  413   GKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKTGEILWSYY  261
             GKILW   VP      P         +TV+  +++AGS+   G + A++A TG  LW+Y 
Sbjct  472   GKILWQVKVPGVNPVTPTFPAGGQGSLTVSPNLVYAGSMA--GIMVALDADTGATLWNYT  529

Query  260   TGATVYGGMSVSNGCVYVGNGY  195
                +V    ++S+G +Y G GY
Sbjct  530   APGSVLSSPAISDGALYWGAGY  551



>ref|WP_039567299.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis]
 gb|KGT52604.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. phaseoli]
 gb|KHD62168.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. phaseoli]
 gb|KHD67207.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. phaseoli]
 gb|KHD71211.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. phaseoli]
 gb|KHS23117.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. phaseoli]
 gb|KHS32045.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. phaseoli]
 gb|KHS35632.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. phaseoli]
 gb|KHS35946.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. phaseoli]
Length=576

 Score =   254 bits (649),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 183/510 (36%), Positives = 262/510 (51%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P+  NW   GG   N R+A GE KI+ +T   LK  W      DISATP+I    +Y
Sbjct  62    FASPS--NWTVAGGGYLNSRFAPGEWKINRTTAKTLKPAWTLTTTGDISATPSIEGATLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   T         N +  +SR+TP+I  +++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYT---------NKSNSLSRTTPAITPKSIILGDM  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLE-EGSSKAHCCTF  1122
                 V+ + + TG LLW + ++ +P   IT S   Y    Y+G SS + E     H  +F
Sbjct  171   AGGTVLALDKKTGKLLWKSEVETNPQAQITSSPVVYGNRVYLGVSSRDYESLDPTHRFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    LDV TGK +WQ +  P+       Y GA+ WG   ++D     +Y  TGN Y+ 
Sbjct  231   RGSVVALDVNTGKKVWQFYNAPEG------YTGASTWGQV-AVDPIARRIYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P  V  C    ++ +    T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PASVGNCVSNARSYRGGDLTVEDELNCMAPDNYVDSVISLNLDTGKLVWANRNQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++CI + +   CP         PD DFG A + L +V  NG  + +V A QKSG  WA D
Sbjct  344   LSCILAPTNGLCPNTQATNLTGPDYDFGGAGVQLFAVPRNGKLQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WGAA D    R+Y  I N+    +TL P   V+   G 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGIEWGAAFDPYKSRIYVGINNNLNTTYTLGPDNTVSHNAGS  463

Query  437   WVAMDAQTGKILWSTAVP---------DTGLSNPVTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKILW    P           G   P++V+  +LFAGS+   G + A+++ T
Sbjct  464   WAALDAGTGKILWQVKAPGINPVNPTVPAGAQGPISVSPNLLFAGSMA--GNMVALDSDT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  LW+Y    +V    ++ NG +Y G+GY
Sbjct  522   GATLWNYKASGSVMSAPAIVNGALYWGSGY  551



>ref|WP_017159747.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis]
Length=576

 Score =   254 bits (648),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 183/510 (36%), Positives = 262/510 (51%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P+  NW   GG   N R+A GE KI+ +T   LK  W      DISATP+I    +Y
Sbjct  62    FASPS--NWTVAGGGYLNSRFAPGEWKINRTTAKTLKPAWTLTTTGDISATPSIEGATLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   T         N +  +SR+TP+I  +++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYT---------NKSNSLSRTTPAITPKSIILGDM  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLE-EGSSKAHCCTF  1122
                 V+ + + TG LLW + ++ +P   IT S   Y    Y+G SS + E     H  +F
Sbjct  171   AGGTVLALDKKTGKLLWKSEVETNPQAQITSSPVVYGNRVYLGVSSRDYESLDPTHRFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    LDV TGK +WQ +  P+       Y GA+ WG   ++D     +Y  TGN Y+ 
Sbjct  231   RGSVVALDVNTGKKVWQFYNAPEG------YTGASTWGQV-AVDPIARRIYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P  V  C    ++ +    T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PASVGNCVSNARSYRGGDLTVEDELNCMAPDNYVDSVISLNLDTGKLVWANRNQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++CI + +   CP         PD DFG A + L +V  NG  + +V A QKSG  WA D
Sbjct  344   LSCILAPTNGLCPNTQATNLTGPDYDFGGAGVQLFAVPRNGKLQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WGAA D    R+Y  I N+    +TL P   V+   G 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGIEWGAAFDPYKSRIYVGINNNLNTTYTLGPDNTVSHNAGS  463

Query  437   WVAMDAQTGKILWSTAVP---------DTGLSNPVTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKILW    P           G   P++V+  +LFAGS+   G + A+++ T
Sbjct  464   WAALDAGTGKILWQVMAPGINPVNPTVPAGAQGPISVSPNLLFAGSMA--GNMVALDSDT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  LW+Y    +V    ++ NG +Y G+GY
Sbjct  522   GATLWNYKASGSVMSAPAIVNGALYWGSGY  551



>ref|WP_017156056.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis]
Length=576

 Score =   254 bits (648),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 183/510 (36%), Positives = 262/510 (51%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P+  NW   GG   N R+A GE KI+ +T   LK  W      DISATP+I    +Y
Sbjct  62    FASPS--NWTVAGGGYLNSRFAPGEWKINRTTAKTLKPAWTLTTTGDISATPSIEGATLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   T         N +  +SR+TP+I  +++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYT---------NKSNSLSRTTPAITPKSIILGDM  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLE-EGSSKAHCCTF  1122
                 V+ + + TG LLW + ++ +P   IT S   Y    Y+G SS + E     H  +F
Sbjct  171   AGGTVLALDKKTGKLLWKSEVETNPQAQITSSPVVYGNRVYLGVSSRDYESLDPTHRFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    LDV TGK +WQ +  P+       Y GA+ WG   ++D     +Y  TGN Y+ 
Sbjct  231   RGSVVALDVNTGKKVWQFYNAPEG------YTGASTWGQV-AVDPIARRIYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P  V  C    ++ +    T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PASVGNCVSNARSYRGGDLTVEDELNCMAPDNYVDSVISLNLDTGKLVWANRNQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++CI + +   CP         PD DFG A + L +V  NG  + +V A QKSG  WA D
Sbjct  344   LSCILAPTNGLCPNTQATNLTGPDYDFGGAGVQLFAVPRNGKLQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WGAA D    R+Y  I N+    +TL P   V+   G 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGIEWGAAFDPYKSRIYVGINNNLNTTYTLGPDNTVSHNAGS  463

Query  437   WVAMDAQTGKILWSTAVP---------DTGLSNPVTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKILW    P           G   P++V+  +LFAGS+   G + A+++ T
Sbjct  464   WAALDAGTGKILWQVKAPGINPVNPTVPAGAQGPISVSPNLLFAGSMA--GNMVALDSDT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  LW+Y    +V    ++ NG +Y G+GY
Sbjct  522   GATLWNYKASGSVMSAPAIVNGALYWGSGY  551



>ref|WP_011257274.1| polyvinylalcohol dehydrogenase [Xanthomonas oryzae]
 ref|YP_198968.1| polyvinylalcohol dehydrogenase [Xanthomonas oryzae pv. oryzae 
KACC 10331]
 gb|AAW73583.1| polyvinylalcohol dehydrogenase [Xanthomonas oryzae pv. oryzae 
KACC 10331]
Length=509

 Score =   251 bits (642),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 179/493 (36%), Positives = 263/493 (53%), Gaps = 40/493 (8%)
 Frame = -1

Query  1607  NRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGS  1428
             N R+A GE KI+ +T   LK  W      DISATP++  G +Y P W G LY+V+   G 
Sbjct  2     NSRFAPGEWKINRTTAKTLKPAWTLTTTGDISATPSVEGGTLYVPDWGGTLYSVDTQTGK  61

Query  1427  LLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLW  1248
               W+  L   TG NA          V+R+TP+I  +++I+G      ++ + + TG LLW
Sbjct  62    PNWQAKLSDYTG-NANS--------VTRNTPAISAKSIIVGDQVAGTLLALDKKTGKLLW  112

Query  1247  MTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA-HCCTFRGRFAKLDVWTGKVLWQ  1071
              T ++ +P   IT S   Y    YVG SS + G+  A H  +FRG    +D+ TGK +WQ
Sbjct  113   KTTVEANPQARITSSPVIYGNRIYVGVSSGDWGNLAANHTFSFRGSVVAVDLNTGKKVWQ  172

Query  1070  TFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKC-QEKQNNKTT  894
              + +P+       Y GA++WG   +ID     +Y  TGN Y+ P+ V  C   +++ + +
Sbjct  173   FYNVPEG------YTGASVWGQV-AIDPINRRLYFGTGNNYNIPQDVGNCISNERSYRGS  225

Query  893   TPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGP-  723
               T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + ++C+ + +   CP    
Sbjct  226   ELTVQDELNCMAPDNYVDSVISLNLDTGKLVWANRAQGYDAWNLSCLVAPTNGLCPNTQA  285

Query  722   ----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggf  558
                  PD DFG A + L +V  NG  + +V A QKSG  WA D   G  VW T+ GPGG 
Sbjct  286   TNLTGPDYDFGGAGVQLFAVPGNGRLQQLVGAGQKSGIYWAFDAKTGAKVWSTQVGPGGT  345

Query  557   vgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGGWVAMDAQTGKILWSTAV  387
              GG  WG A D    +VY +I N+    +TL P+   T  GG W A+DA TGKI W   V
Sbjct  346   TGGVEWGTAFDPYKSQVYVAINNNANTTYTLGPANVQTHNGGSWAALDAATGKIKWQVKV  405

Query  386   PDTGLSNPVTVANG---------VLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGM  234
             P     NP   A G         +L+AGS+   G + A++A TG  +W+Y    +V    
Sbjct  406   PGINPVNPTVPAGGQGSLTASPNLLYAGSMA--GNMVALDADTGATVWNYDASGSVVSSP  463

Query  233   SVSNGCVYVGNGY  195
             +++NG +Y G+GY
Sbjct  464   AIANGALYWGDGY  476



>ref|WP_039524525.1| polyvinylalcohol dehydrogenase [Xanthomonas arboricola]
 gb|KER86342.1| polyvinylalcohol dehydrogenase [Xanthomonas arboricola pv. celebensis]
Length=576

 Score =   253 bits (647),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 183/510 (36%), Positives = 266/510 (52%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P S  W   GG   N+R+A GE KI+ +TV  LK  W      DISATP++  G +Y
Sbjct  62    FASPTS--WTTAGGGYLNQRFAPGEWKINRTTVKGLKPAWTLTTTGDISATPSVEGGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA          V+R+TP+I   ++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYTG-NANS--------VTRNTPAISANSIIVGDQ  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGS-SKAHCCTF  1122
                 V+ + + TG LLW T  + +P   IT S   Y    YV  SS + G+    H  +F
Sbjct  171   AAGTVLAIDKKTGKLLWKTTAEANPQARITSSPVIYGNRVYVPVSSGDWGNLDPTHTFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    LD+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  231   RGSVVALDLNTGKKVWQFYNVPEG------YTGASVWGQV-AIDPINRRLYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P  V  C    ++ + +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PASVGNCVSNARSYRGSELTVQDELACMAPDNYVDSVISLNLDTGKLVWADRAQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++CI + +   CP         PD DFG A + L +V  +G  + +V A QKSG  WA D
Sbjct  344   LSCIVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFTVWRDGKAQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    +VY +I NS+   +TL P+   +  GG 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQVYVAINNSSNATYTLGPANTQSHNGGS  463

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TG+I W   VP     NP         +TV+  +L+AGS+   G + A++  T
Sbjct  464   WAALDAATGRIKWQVKVPGINRVNPNVPAGGQGSLTVSPNLLYAGSMA--GNMVALDTDT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  LW++    +V    ++ +G +Y G GY
Sbjct  522   GATLWNHDATGSVISSPAIVDGALYWGAGY  551



>ref|WP_011052804.1| polyvinylalcohol dehydrogenase [Xanthomonas citri]
 ref|NP_644498.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. citri 
str. 306]
 gb|AAM39034.1| polyvinylalcohol dehydrogenase [Xanthomonas axonopodis pv. citri 
str. 306]
Length=501

 Score =   251 bits (641),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 178/493 (36%), Positives = 264/493 (54%), Gaps = 40/493 (8%)
 Frame = -1

Query  1607  NRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGS  1428
             N R+A GE KI+ +T   LK  W      DISATP++  G +Y P W G LY+V+   G 
Sbjct  2     NSRFAPGEWKINRTTAKTLKPAWTLTTTGDISATPSVEGGTLYVPDWGGTLYSVDTQTGK  61

Query  1427  LLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLW  1248
               W+  L   TG NA          V+R+TP+I  +++I+G      ++ + + TG LLW
Sbjct  62    PNWQAKLSDYTG-NANS--------VTRNTPAISAKSIIVGDQVAGTLLALDKKTGKLLW  112

Query  1247  MTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA-HCCTFRGRFAKLDVWTGKVLWQ  1071
              T ++ +P   IT S   Y    YVG SS + G+  A H  +FRG    +D+ TGK +WQ
Sbjct  113   KTTVEANPQARITSSPVIYGNRIYVGVSSGDWGNLAANHTFSFRGSVVAVDLNTGKKVWQ  172

Query  1070  TFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKC-QEKQNNKTT  894
              + +P+       Y GA++WG   +ID     +Y  TGN Y+ P+ V  C    ++ + +
Sbjct  173   FYNVPEG------YTGASVWGQV-AIDPINRRLYFGTGNNYNIPQGVGNCISNARSYRGS  225

Query  893   TPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGP-  723
               T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + ++C+ + +   CP    
Sbjct  226   ELTVQDELDCMAPDNYVDSVISLNLDTGKLVWANRAQGYDAWNLSCVVAPTNGLCPNTQA  285

Query  722   ----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggf  558
                  PD DFG A + L +V  NG  + +V A QKSG  WA D   G  VW T+ GPGG 
Sbjct  286   TNLTGPDYDFGGAGVQLFAVPRNGRLQQLVGAGQKSGIYWAFDAKTGAKVWSTQVGPGGT  345

Query  557   vgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTIGGG-WVAMDAQTGKILWSTAV  387
              GG  WG A D    ++Y +I N++   +TL P+   T  GG W A+DA TGKI W   V
Sbjct  346   TGGVEWGTAFDPYKSQIYVAINNNSNATYTLGPANVQTHNGGSWAALDAATGKIKWQVKV  405

Query  386   PDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGM  234
             P     NP         +TV+  +L+AGS+   G + A++A TG  +W+Y    +V    
Sbjct  406   PGINPVNPTVPAGGQGSLTVSPNLLYAGSMA--GNMVALDADTGATVWNYNASGSVISSP  463

Query  233   SVSNGCVYVGNGY  195
             +++NG +Y G GY
Sbjct  464   AIANGALYWGAGY  476



>gb|ADN64238.1| putative polyvinylalcohol dehydrogenase [Streptomyces rochei 
subsp. volubilis]
Length=543

 Score =   252 bits (644),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 185/511 (36%), Positives = 270/511 (53%), Gaps = 53/511 (10%)
 Frame = -1

Query  1652  CPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFP  1473
              P    W + G + +N R A  E+ I P  V  L  KW F A  DISATP ++ G VY P
Sbjct  54    VPVQPEWASAGQNNHNTRNAATEHTIGPRNVGTLAPKWVFTADGDISATPTVVHGTVYVP  113

Query  1472  SWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYG-  1296
              W G L+AV+A  G  +W  ++    G         V   +SR++P+    +L +G    
Sbjct  114   DWGGKLWAVDADSGKAVWSHSIADYDG---------VEGHMSRTSPAYWQGSLYLGTGTL  164

Query  1295  ------PAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAH  1134
                    A +I V   TG   WMT +D  P  ++T S T  +G  YVG SS  + S+   
Sbjct  165   TTTALKSAYIISVDARTGAKQWMTKVDDDPTAVVTSSPTVDDGVVYVGVSS--KASTLHD  222

Query  1133  CCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGN  954
                FRG    LD  TGK+LW+T+ +P+       Y GA++WGS P +D   G V++ TGN
Sbjct  223   APGFRGSVMALDAHTGKILWKTYTIPEG------YTGASVWGSQPVVDHKTGLVFVGTGN  276

Query  953   LYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVF  774
              Y++P  V  C   +    T P   D       H DS+LALDL TG+I+W       D +
Sbjct  277   NYTSPPGV--CLNPKQTDCTPPAEDD-------HFDSVLALDLKTGRIRWSHHTLTADTW  327

Query  773   FIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGE  594
              +   N +          PD DFG AP + +  ++G  ++++   QKSG  + L+   G+
Sbjct  328   MMYQQNQA----------PDFDFGSAPNLYTTEIDGKPKELLGIGQKSGVYYTLEPATGK  377

Query  593   MVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLP---SKNVTIGGGWVAMD  423
             +VW T+ GPGG +GG  WG+ATD +R+Y  I N + L +T+     +K+    G + A+D
Sbjct  378   VVWQTQVGPGGALGGIQWGSATDGKRIYVGIGNGDHLPWTITAADGTKSTVDSGFFAAVD  437

Query  422   AQTGKILWSTAVPDTGL-----SNPVTVANGVLFAGSVHPRGP-VFAINAKTGEILWSYY  261
             A TGKI W TA P          + +T ANGV++AGS  P G  ++A++A TG+ILW Y 
Sbjct  438   AATGKIEWQTADPQGKAGKWLDDSFITHANGVMYAGSSAPSGTNMYALDADTGKILWDYA  497

Query  260   TGATVYGGMSVSNGCVYVGNGYRVS-IGAGI  171
             +G +V+GG +V +G VY G+GY +S +G G+
Sbjct  498   SGGSVWGGAAVVDGSVYWGSGYYISNVGEGL  528



>ref|WP_039521238.1| polyvinylalcohol dehydrogenase [Xanthomonas arboricola]
 gb|KER84708.1| polyvinylalcohol dehydrogenase [Xanthomonas arboricola pv. celebensis]
Length=576

 Score =   253 bits (646),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 183/510 (36%), Positives = 265/510 (52%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P S  W   GG   N+R+A GE KI+ +TV  LK  W      DISATP++  G +Y
Sbjct  62    FASPTS--WTTAGGGYLNQRFAPGEWKINRTTVKGLKPAWTLTTTGDISATPSVEGGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA          V+R+TP+I   ++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYTG-NANS--------VTRNTPAISANSIIVGDQ  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGS-SKAHCCTF  1122
                 V+ + + TG LLW T  + +P   IT S   Y    YV  SS + G+    H  +F
Sbjct  171   AAGTVLAIDKKTGKLLWKTTAEANPQARITSSPVIYGNRVYVPVSSGDWGNLDPTHTFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    LD+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  231   RGSVVALDLNTGKKVWQFYNVPEG------YTGASVWGQV-AIDPISRRLYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P  V  C    ++ + +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PASVGNCVSNARSYRGSELTVQDELACMAPDNYVDSVISLNLDTGKLVWADRAQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++CI + +   CP         PD DFG A + L +V  +G  + +V A QKSG  WA D
Sbjct  344   LSCIVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFTVWRDGKAQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    +VY +I NS    +TL P+   +  GG 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGVEWGTAFDPYKSQVYVAINNSTNATYTLGPANTQSHNGGS  463

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TG+I W   VP     NP         +TV+  +L+AGS+   G + A++  T
Sbjct  464   WAALDAATGRIKWQVKVPGINRVNPNVPAGGQGSLTVSPNLLYAGSMA--GNMVALDTDT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  LW++    +V    ++ +G +Y G GY
Sbjct  522   GATLWNHDATGSVISSPAIVDGALYWGAGY  551



>ref|WP_011113104.1| probable polyvinylalcohol dehydrogenase [Streptomyces rochei]
 ref|NP_851445.1| probable polyvinylalcohol dehydrogenase [Streptomyces rochei]
 dbj|BAC76481.1| probable polyvinylalcohol dehydrogenase [Streptomyces rochei]
Length=543

 Score =   252 bits (644),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 185/511 (36%), Positives = 270/511 (53%), Gaps = 53/511 (10%)
 Frame = -1

Query  1652  CPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFP  1473
              P    W + G + +N R A  E+ I P  V  L  KW F A  DISATP ++ G VY P
Sbjct  54    VPVQPEWASAGQNNHNTRNAATEHTIGPRNVGTLAPKWVFTADGDISATPTVVHGTVYVP  113

Query  1472  SWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYG-  1296
              W G L+AV+A  G  +W  ++    G         V   +SR++P+    +L +G    
Sbjct  114   DWGGKLWAVDADSGKAVWSHSIADYDG---------VEGHMSRTSPAYWQGSLYLGTGTL  164

Query  1295  ------PAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAH  1134
                    A +I V   TG   WMT +D  P  ++T S T  +G  YVG SS  + S+   
Sbjct  165   TTTALKSAYIISVDARTGAKQWMTKVDDDPTAVVTSSPTVDDGVVYVGVSS--KASTLHD  222

Query  1133  CCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGN  954
                FRG    LD  TGK+LW+T+ +P+       Y GA++WGS P +D   G V++ TGN
Sbjct  223   APGFRGSVMALDAHTGKILWKTYTIPEG------YTGASVWGSQPVVDHKTGLVFVGTGN  276

Query  953   LYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVF  774
              Y++P  V  C   +    T P   D       H DS+LALDL TG+I+W       D +
Sbjct  277   NYTSPPGV--CLNPKQTDCTPPAEDD-------HFDSVLALDLKTGRIRWSHHTLTADTW  327

Query  773   FIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGE  594
              +   N +          PD DFG AP + +  ++G  ++++   QKSG  + L+   G+
Sbjct  328   MMYQQNQA----------PDFDFGSAPNLYTTEIDGKPKELLGIGQKSGVYYTLEPATGK  377

Query  593   MVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLP---SKNVTIGGGWVAMD  423
             +VW T+ GPGG +GG  WG+ATD +R+Y  I N + L +T+     +K+    G + A+D
Sbjct  378   VVWQTQVGPGGALGGIQWGSATDGKRIYVGIGNGDHLPWTITAADGTKSTVDSGFFAAVD  437

Query  422   AQTGKILWSTAVPDTGL-----SNPVTVANGVLFAGSVHPRGP-VFAINAKTGEILWSYY  261
             A TGKI W TA P          + +T ANGV++AGS  P G  ++A++A TG+ILW Y 
Sbjct  438   AATGKIEWQTADPQGKAGKWLDDSFITHANGVMYAGSSAPSGTNMYALDADTGKILWDYA  497

Query  260   TGATVYGGMSVSNGCVYVGNGYRVS-IGAGI  171
             +G +V+GG +V +G VY G+GY +S +G G+
Sbjct  498   SGGSVWGGAAVVDGSVYWGSGYYISNVGEGL  528



>ref|WP_011349059.1| polyvinylalcohol dehydrogenase [Xanthomonas euvesicatoria]
 ref|YP_366031.1| polyvinylalcohol dehydrogenase [Xanthomonas campestris pv. vesicatoria 
str. 85-10]
 emb|CAJ26031.1| putative polyvinylalcohol dehydrogenase [Xanthomonas campestris 
pv. vesicatoria str. 85-10]
 gb|KHL63127.1| polyvinylalcohol dehydrogenase [Xanthomonas euvesicatoria]
 gb|KHL66973.1| polyvinylalcohol dehydrogenase [Xanthomonas euvesicatoria]
Length=501

 Score =   251 bits (640),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 178/493 (36%), Positives = 264/493 (54%), Gaps = 40/493 (8%)
 Frame = -1

Query  1607  NRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGS  1428
             N R+A GE KI+ +T   LK  W      DISATP++  G +Y P W G LY+V+   G 
Sbjct  2     NSRFAPGEWKINRTTAKTLKPAWTLTTTGDISATPSVEGGTLYVPDWGGTLYSVDTQTGK  61

Query  1427  LLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLW  1248
               W+  L   TG NA          V+R+TP+I  +++I+G      ++ + + TG LLW
Sbjct  62    PNWQAKLSDYTG-NANS--------VTRNTPAISAKSIIVGDQVAGTLLALDKKTGKLLW  112

Query  1247  MTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA-HCCTFRGRFAKLDVWTGKVLWQ  1071
              T ++ +P   +T S   Y    YVG SS + G+  A H  +FRG    +D+ TGK +WQ
Sbjct  113   KTTVEANPQARVTSSPVIYGNRIYVGVSSGDWGNLAANHTFSFRGSVVAVDLNTGKKVWQ  172

Query  1070  TFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKC-QEKQNNKTT  894
              + +P+       Y GA++WG   +ID     +Y  TGN Y+ P+ V  C    ++ + +
Sbjct  173   FYNVPEG------YTGASVWGQV-AIDPINRRLYFGTGNNYNIPQGVGNCISNARSYRGS  225

Query  893   TPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGP-  723
               T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + ++CI + +   CP    
Sbjct  226   ELTVQDELNCMAPDNYVDSVISLNLDTGKLIWANRAQGYDAWNLSCIVAPTNGLCPNTQA  285

Query  722   ----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggf  558
                  PD DFG A + L +V  NG  + +V A QKSG  WA D   G  VW T+ GPGG 
Sbjct  286   TNLTGPDYDFGGAGVQLFAVPRNGRLQQLVGAGQKSGIYWAFDAKTGAKVWSTQVGPGGT  345

Query  557   vgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGGWVAMDAQTGKILWSTAV  387
              GG  WG A D    ++Y +I N++   +TL P+   T  GG W A+DA TGKI W   V
Sbjct  346   TGGVEWGTAFDPYKSQIYVAINNNSNATYTLGPANVQTHNGGSWAALDAATGKIKWQVKV  405

Query  386   PDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGM  234
             P     NP         +TV+  +L+AGS+   G + A++A TG  +W+Y    +V    
Sbjct  406   PGINPVNPTVPAGGQGSLTVSPNLLYAGSMA--GNMVALDADTGAAVWNYNASGSVISSP  463

Query  233   SVSNGCVYVGNGY  195
             +++NG +Y G GY
Sbjct  464   AIANGALYWGAGY  476



>ref|WP_037663542.1| hypothetical protein, partial [Streptomyces griseofuscus]
Length=484

 Score =   250 bits (638),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 184/505 (36%), Positives = 269/505 (53%), Gaps = 53/505 (10%)
 Frame = -1

Query  1634  WLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYL  1455
             W + G + +N R A  E+ I P  V  L  KW F A  DISATP ++ G VY P W G L
Sbjct  1     WASAGQNNHNTRNAATEHTIGPRNVGTLAPKWVFTADGDISATPTVVHGTVYVPDWGGKL  60

Query  1454  YAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYG-------  1296
             +AV+A  G  +W  ++    G         V   +SR++P+    +L +G          
Sbjct  61    WAVDADSGKAVWSHSIADYDG---------VEGHMSRTSPAYWQGSLYLGTGTLTTTALK  111

Query  1295  PAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRG  1116
              A +I V   TG   WMT +D  P  ++T S T  +G  YVG SS  + S+      FRG
Sbjct  112   SAYIISVDARTGAKQWMTKVDDDPTAVVTSSPTVDDGVVYVGVSS--KASTLHDAPGFRG  169

Query  1115  RFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPK  936
                 LD  TGK+LW+T+ +P+       Y GA++WGS P +D   G V++ TGN Y++P 
Sbjct  170   SVMALDAHTGKILWKTYTIPEG------YTGASVWGSQPVVDHKTGLVFVGTGNNYTSPP  223

Query  935   HVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACIN  756
              V  C   +    T P   D       H DS+LALDL TG+I+W       D + +   N
Sbjct  224   GV--CLNPKQTDCTPPAEDD-------HFDSVLALDLKTGRIRWSHHTLTADTWMMYQQN  274

Query  755   SSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYte  576
              +          PD DFG AP + +  ++G  ++++   QKSG  + L+   G++VW T+
Sbjct  275   QA----------PDFDFGSAPNLYTTEIDGKPKELLGIGQKSGVYYTLEPATGKVVWQTQ  324

Query  575   agpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLP---SKNVTIGGGWVAMDAQTGKI  405
              GPGG +GG  WG+ATD +R+Y  I N + L +T+     +K+    G + A+DA TGKI
Sbjct  325   VGPGGALGGIQWGSATDGKRIYVGIGNGDHLPWTITAADGTKSTVDSGFFAAVDAATGKI  384

Query  404   LWSTAVPDTGL-----SNPVTVANGVLFAGSVHPRGP-VFAINAKTGEILWSYYTGATVY  243
              W TA P          + +T ANGV++AGS  P G  ++A++A TG+ILW Y +G +V+
Sbjct  385   EWQTADPQGKAGKWLDDSFITHANGVMYAGSSAPSGTNMYALDADTGKILWDYASGGSVW  444

Query  242   GGMSVSNGCVYVGNGYRVS-IGAGI  171
             GG +V +G VY G+GY +S +G G+
Sbjct  445   GGAAVVDGSVYWGSGYYISNVGEGL  469



>ref|YP_009001198.1| pyrroloquinoline quinone-dependent DHase [Pithovirus sibericum]
 gb|AHH01863.1| pyrroloquinoline quinone-dependent DHase [Pithovirus sibericum]
Length=515

 Score =   251 bits (640),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 173/501 (35%), Positives = 268/501 (53%), Gaps = 40/501 (8%)
 Frame = -1

Query  1637  NWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGY  1458
             N   +G D  N R    ++ I+   V+ L ++W      DISATP I K  ++  +++G 
Sbjct  27    NLPTNGVDSSNSRSM--KSNINACNVANLTVEWSRNFHADISATPIIWKNALFITTFSGE  84

Query  1457  LYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIV-GETLIIGIYGPAVVI  1281
             +  +NA  G +LW RN+   T         N+    +R++P I   + L++G      ++
Sbjct  85    IAKLNALTGEVLWSRNMSIFT---------NIPGSFARASPVISKNDELVVGDQVSGTLV  135

Query  1280  GVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSS----KAHCCTFRGR  1113
              ++   G L+W +LLD HPA ++T+S        Y+G SS E   +       CC+F G 
Sbjct  136   CLRSTDGGLIWTSLLDPHPAAILTISPVIDEDRIYIGVSSQESTIAAFIPNYPCCSFSGS  195

Query  1112  FAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKH  933
                +++  G++LWQT  +P      G+Y+GAA+WGSS S D  R  V   TGN Y+ P +
Sbjct  196   AVAVNLTNGQILWQTRTIPVELTGPGKYSGAAVWGSSSSFDDKR--VCFGTGNPYTVPDN  253

Query  932   VLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIAC---  762
             V  C+  + N ++ P     C++     DS++ L+  TG I W+++   YD + + C   
Sbjct  254   VTACEYVRAN-SSRPDLMPSCLDERVIFDSMMCLNKVTGDILWYKRTEKYDAWTVGCMLP  312

Query  761   -INSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVW  585
              +      NCP    PDADF EAP+M        T   V+A QKSG  W+ +++ G + W
Sbjct  313   ELGIPDIVNCPTIVGPDADFPEAPIM--------TASSVIAGQKSGALWSRNKNTGRLNW  364

Query  584   YteagpggfvgggtwgaaTD-----NERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDA  420
                 GPGG +GG  WG+A +     N  +Y++I+NS + N TLL     T G  + A+D 
Sbjct  365   GKVIGPGGTLGGFMWGSAYEARNPVNGILYSTISNSQKKNITLLDGTQ-TDGAFFFALDT  423

Query  419   QTGKILWSTAVPDTG-LSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVY  243
               GK+LW TA PD   L  PV+V NGV+F GS+   G V+A++ +TG+ILWS+ +GATV 
Sbjct  424   SNGKVLWQTAEPDRQRLPAPVSVTNGVVFGGSM--TGKVYALDGETGKILWSFQSGATVN  481

Query  242   GGMSVSNGCVYVGNGYRVSIG  180
              G+++S+  ++ GNGY    G
Sbjct  482   AGIAISDDWIFFGNGYTKQFG  502



>ref|WP_026064663.1| polyvinylalcohol dehydrogenase [Xanthomonas arboricola]
Length=576

 Score =   252 bits (643),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 181/512 (35%), Positives = 265/512 (52%), Gaps = 42/512 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P S  W   GG   N+R+A GE KI+ +TV  LK  W      DISATP++  G +Y
Sbjct  62    FASPTS--WTTAGGGYLNQRFAPGEWKINRTTVKGLKPAWTLTTTGDISATPSVEGGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG          T  V+R+TP+I   ++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYTG---------NTNSVTRNTPAISANSIIVGDQ  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGS-SKAHCCTF  1122
                 V+ + + TG LLW T  + +P   IT S   Y    YV  SS + G+    H  +F
Sbjct  171   AAGTVLAIDKKTGKLLWKTTAEANPQARITSSPVIYGNRVYVPVSSGDWGNLDPTHTFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    LD+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  231   RGSVVALDLNTGKKVWQFYNVPEG------YTGASVWGQV-AIDPINRRLYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P  V  C    ++ + +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PASVGNCVSNARSYRGSELTVQDELACMAPDNYVDSVISLNLDTGKLVWADRAQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++C+ + +   CP         PD DFG A + L +V  +G  + +V A QKSG  WA D
Sbjct  344   LSCLVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFTVWRDGKAQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    +VY +I NS    +TL P+   +  GG 
Sbjct  404   AKTGAKVWSTQVGPGGATGGVEWGTAFDPYKSQVYVAINNSTNATYTLGPANTQSHNGGS  463

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TG+I W   VP     NP         +TV+  +L+AGS+   G + A++  T
Sbjct  464   WAALDAATGRIKWQVKVPGINRVNPNVPAGGQGSLTVSPNLLYAGSMA--GNMVALDTDT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGYRV  189
             G  LW++    +V    ++ +G +Y G GY +
Sbjct  522   GATLWNHDATGSVISSPAIVDGALYWGAGYDL  553



>dbj|GAE54390.1| hypothetical protein XPR_1025 [Xanthomonas arboricola pv. pruni 
MAFF 301420]
 dbj|GAE51356.1| polyvinylalcohol dehydrogenase [Xanthomonas arboricola pv. pruni 
str. MAFF 311562]
 dbj|GAE61153.1| hypothetical protein XPN_3059 [Xanthomonas arboricola pv. pruni 
MAFF 301427]
Length=564

 Score =   252 bits (643),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 182/512 (36%), Positives = 265/512 (52%), Gaps = 42/512 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P S  W   GG   N+R+A GE KI+ +TV  LK  W      DISATP++  G +Y
Sbjct  50    FASPTS--WTTAGGGYLNQRFAPGEWKINRTTVKGLKPAWTLTTTGDISATPSVEGGTLY  107

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA          V+R+TP+I   ++I+G  
Sbjct  108   VPDWGGTLYSVDTQTGKPNWQAKLSDYTG-NANS--------VTRNTPAISANSIIVGDQ  158

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGS-SKAHCCTF  1122
                 V+ + + TG LLW T  + +P   IT S   Y    YV  SS + G+    H  +F
Sbjct  159   AAGTVLAIDKKTGKLLWKTTAEANPQARITSSPVIYGNRVYVPVSSRDWGNLDPTHTFSF  218

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    LD+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  219   RGSVVALDLNTGKKVWQFYNVPEG------YTGASVWGQV-AIDPISRRLYFGTGNNYNI  271

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P  V  C    +  + +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  272   PASVGNCVSNARAYRGSELTVQDELACMAPDNYVDSVISLNLDTGKLVWADRAQGYDAWN  331

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++C+ + +   CP         PD DFG A + L +V  +G  + +V A QKSG  WA D
Sbjct  332   LSCLVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFTVWRDGKAQQLVGAGQKSGIYWAFD  391

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    +VY +I NS    +TL P+   +  GG 
Sbjct  392   AKTGAKVWSTQVGPGGATGGVEWGTAFDPYKSQVYVAINNSTNATYTLGPANTQSHNGGS  451

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TG+I W   VP     NP         +TV+  +L+AGS+   G + A++  T
Sbjct  452   WAALDAATGRIKWQVKVPGINRVNPNVPAGGQGSLTVSPNLLYAGSMA--GNMVALDTDT  509

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGYRV  189
             G  LW++    +V    ++ +G +Y G GY +
Sbjct  510   GATLWNHDATGSVISSPAIVDGALYWGAGYDL  541



>emb|CCG39082.1| PQQ enzyme repeat family protein [Xanthomonas citri pv. mangiferaeindicae 
LMG 941]
Length=501

 Score =   249 bits (637),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 177/493 (36%), Positives = 264/493 (54%), Gaps = 40/493 (8%)
 Frame = -1

Query  1607  NRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGS  1428
             N R+A GE KI+ +T   LK  W      DISATP++  G +Y P W G LY+V+   G 
Sbjct  2     NSRFAPGEWKINRTTAKTLKPAWTLTTTGDISATPSVEGGTLYVPDWGGTLYSVDTQTGK  61

Query  1427  LLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLW  1248
               W+  L   TG NA          V+R+TP+I  +++I+G      ++ + + TG LLW
Sbjct  62    PNWQAKLSDYTG-NANS--------VTRNTPAISAKSIIVGDQVAGTLLALDKKTGKLLW  112

Query  1247  MTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA-HCCTFRGRFAKLDVWTGKVLWQ  1071
              T ++ +P   IT S   +    YVG SS + G+  A H  +FRG    +D+ TGK +WQ
Sbjct  113   KTTVEANPQARITSSPVIHGNRIYVGVSSGDWGNLAANHTFSFRGSVVAVDLNTGKKVWQ  172

Query  1070  TFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKC-QEKQNNKTT  894
              + +P+       Y GA++WG   +ID     +Y  TGN Y+ P+ V  C    ++ + +
Sbjct  173   FYNVPEG------YTGASVWGQV-AIDPINRRLYFGTGNNYNIPQGVGNCISNARSYRGS  225

Query  893   TPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGP-  723
               T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + ++C+ + +   CP    
Sbjct  226   ELTVQDELDCMAPDNYVDSVISLNLDTGKLVWANRAQGYDAWNLSCVVAPTNGLCPNTQA  285

Query  722   ----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggf  558
                  PD DFG A + L +V  NG  + +V A QKSG  WA D   G  VW T+ GPGG 
Sbjct  286   TNLTGPDYDFGGAGVQLFAVPRNGRLQQLVGAGQKSGIYWAFDAKTGAKVWSTQVGPGGT  345

Query  557   vgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTIGGG-WVAMDAQTGKILWSTAV  387
              GG  WG A D    ++Y +I N++   +TL P+   T  GG W A+DA TGKI W   V
Sbjct  346   TGGVEWGTAFDPYKSQIYVAINNNSNATYTLGPANVQTHNGGSWAALDAATGKIKWQVKV  405

Query  386   PDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGM  234
             P     NP         +TV+  +L+AGS+   G + A++A TG  +W+Y    +V    
Sbjct  406   PGINPVNPTVPAGGQGSLTVSPNLLYAGSMA--GNMVALDADTGATVWNYNASGSVISSP  463

Query  233   SVSNGCVYVGNGY  195
             +++NG +Y G GY
Sbjct  464   AIANGALYWGAGY  476



>ref|WP_039513544.1| polyvinylalcohol dehydrogenase [Xanthomonas arboricola]
 gb|KCX01716.1| polyvinylalcohol dehydrogenase [Xanthomonas arboricola pv. pruni]
Length=576

 Score =   251 bits (642),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 182/512 (36%), Positives = 265/512 (52%), Gaps = 42/512 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P S  W   GG   N+R+A GE KI+ +TV  LK  W      DISATP++  G +Y
Sbjct  62    FASPTS--WTTAGGGYLNQRFAPGEWKINRTTVKGLKPAWTLTTTGDISATPSVEGGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA          V+R+TP+I   ++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYTG-NANS--------VTRNTPAISANSIIVGDQ  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGS-SKAHCCTF  1122
                 V+ + + TG LLW T  + +P   IT S   Y    YV  SS + G+    H  +F
Sbjct  171   AAGTVLAIDKKTGKLLWKTTAEANPQARITSSPVIYGNRVYVPVSSRDWGNLDPTHTFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    LD+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  231   RGSVVALDLNTGKKVWQFYNVPEG------YTGASVWGQV-AIDPISRRLYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P  V  C    +  + +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PASVGNCVSNARAYRGSELTVQDELACMAPDNYVDSVISLNLDTGKLVWADRAQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++C+ + +   CP         PD DFG A + L +V  +G  + +V A QKSG  WA D
Sbjct  344   LSCLVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFTVWRDGKAQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    +VY +I NS    +TL P+   +  GG 
Sbjct  404   AKTGAKVWSTQVGPGGATGGVEWGTAFDPYKSQVYVAINNSTNATYTLGPANTQSHNGGS  463

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TG+I W   VP     NP         +TV+  +L+AGS+   G + A++  T
Sbjct  464   WAALDAATGRIKWQVKVPGINRVNPNVPAGGQGSLTVSPNLLYAGSMA--GNMVALDTDT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGYRV  189
             G  LW++    +V    ++ +G +Y G GY +
Sbjct  522   GATLWNHDATGSVISSPAIVDGALYWGAGYDL  553



>ref|WP_039814780.1| polyvinylalcohol dehydrogenase [Xanthomonas arboricola]
Length=576

 Score =   251 bits (641),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 182/512 (36%), Positives = 265/512 (52%), Gaps = 42/512 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P S  W   GG   N+R+A GE KI+ +TV  LK  W      DISATP++  G +Y
Sbjct  62    FASPTS--WTTAGGGYLNQRFAPGEWKINRTTVKGLKPAWTLTTTGDISATPSVEGGTLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA          V+R+TP+I   ++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYTG-NANS--------VTRNTPAISANSIIVGDQ  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGS-SKAHCCTF  1122
                 V+ + + TG LLW T  + +P   IT S   Y    YV  SS + G+    H  +F
Sbjct  171   AAGTVLAIDKKTGKLLWKTTAEANPQARITSSPVIYGNRVYVPVSSRDWGNLDPTHTFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    LD+ TGK +WQ + +P+       Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  231   RGSVVALDLNTGKKVWQFYNVPEG------YTGASVWGQV-AIDPISRRLYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P  V  C    +  + +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PASVGNCVSNARAYRGSELTVQDELACMAPDNYVDSVISLNLDTGKLVWADRAQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPMML-SVVVNGSTRDIVVAVQKSGFAWALD  609
             ++C+ + +   CP         PD DFG A + L +V  +G  + +V A QKSG  WA D
Sbjct  344   LSCLVAPTNGLCPNTQATNLTGPDYDFGGAGVQLFTVWRDGKAQQLVGAGQKSGIYWAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    +VY +I NS    +TL P+   +  GG 
Sbjct  404   AKTGAKVWSTQVGPGGATGGVEWGTAFDPYKSQVYVAINNSTNATYTLGPANTQSHNGGS  463

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TG+I W   VP     NP         +TV+  +L+AGS+   G + A++  T
Sbjct  464   WAALDAATGRIKWQVKVPGINRVNPNVPAGGQGSLTVSPNLLYAGSMA--GNMVALDTDT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGYRV  189
             G  LW++    +V    ++ +G +Y G GY +
Sbjct  522   GATLWNHDATGSVISSPAIVDGALYWGAGYDL  553



>ref|XP_007917887.1| putative quinohemoprotein ethanol dehydrogenase type-1 protein 
[Togninia minima UCRPA7]
 gb|EON97355.1| putative quinohemoprotein ethanol dehydrogenase type-1 protein 
[Togninia minima UCRPA7]
Length=609

 Score =   248 bits (632),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 183/531 (34%), Positives = 265/531 (50%), Gaps = 40/531 (8%)
 Frame = -1

Query  1685  AKPEWHITRFSCPAS--GNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDIS  1512
             A P + +     P S  G WL  G D+YN R+A  +  +S + V  L+L  E      +S
Sbjct  49    AFPSFQVPDSQPPPSRTGGWLGWGADLYNNRWAAPDAIVSSTNVESLELVCEQQYNPGVS  108

Query  1511  ATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKL----TGLNATVRTGNVTAIVSR  1344
             A P I  GV Y+P+W+G L A++     +LWE N+ K+      L+  ++ G V  I SR
Sbjct  109   AAPLIQDGVAYYPTWSGLLVALDYQRCKVLWETNITKIILKYKPLDP-IQLGIVVPI-SR  166

Query  1343  STPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTS  1164
             STP+  G  L IG    A+V+ + ++ G L+    L  HP   +T S T Y G  Y G S
Sbjct  167   STPAADGNVLYIGTLAHALVLTLDKSNGKLIDSLQLSDHPFASLTQSPTVYKGKIYYGVS  226

Query  1163  SLEEGSSKA----HCCTFRGRFAKLDVWTG--KVLWQTFMLPDNKGKRGEYAGAAIWGSS  1002
             SLEEG++       CC+F G      +  G  +++W   M+P        ++G+AIWGS 
Sbjct  227   SLEEGAADLIEDYPCCSFIGTMNAATLRHGRLRLVWTQAMIPSGV----NFSGSAIWGSQ  282

Query  1001  PSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPT--TSDKCVEPENHSDSILALD  828
             P+ID  R  V+IATGN Y  P    +CQ    N T      T+D C+      +++LA D
Sbjct  283   PAIDPIRNQVFIATGNTYQLPDAFEQCQNATANITVIQQGLTTDPCLPRNVFQEAVLAHD  342

Query  827   LDTGKIKWFRQLGGYDVFFIACIN------SSSTPNCPPGPNPDADFGEAP-MMLSVVVN  669
             LDTG+I W RQL   D + +AC++      + +T  CP  P PDADFG AP  +L     
Sbjct  343   LDTGRINWVRQLSPLDAWNVACLDGVLFPPTGNTEQCPDTPGPDADFGMAPTFVLGSEYT  402

Query  668   GSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSN  489
                 DIVV  QK+G  + +   +G ++W T   P GF GG  WG A D++ +Y +  NS 
Sbjct  403   PDGLDIVVVGQKNGNLYGMSATSGTLLWATVTSPDGFEGGLIWGMAVDDQAIYYTAVNSE  462

Query  488   RLNFTLL--PSKNVTIGGGWVAMDAQTGKILWSTAVP-DTGLSNPVTVANGVLFAGSV--  324
             R N+TL     K       + A   + G+I+W TA P DT      +VAN ++  GS   
Sbjct  463   RKNYTLPGGDGKTTISNSAFGAARLKDGQIIWQTASPRDTMSLVTPSVANDIVLTGSTGA  522

Query  323   ------HPRGP--VFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
                    P GP  + A+N  TG+++      +   GG++  +  V  G GY
Sbjct  523   INGTSPFPVGPGSLVALNKHTGQVVAEVILDSYFQGGIAPVHDYVMYGTGY  573



>ref|WP_002809388.1| polyvinylalcohol dehydrogenase [Xanthomonas fragariae]
 gb|ENZ95000.1| polyvinylalcohol dehydrogenase [Xanthomonas fragariae LMG 25863]
Length=575

 Score =   244 bits (624),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 181/510 (35%), Positives = 267/510 (52%), Gaps = 42/510 (8%)
 Frame = -1

Query  1658  FSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVY  1479
             F+ P S  W   GG   N+R+A GE KI+ +T   LK  W      DISATP++    +Y
Sbjct  62    FASPTS--WTTAGGGYLNQRFAPGEWKINRTTAKTLKPAWTLTTTGDISATPSVEGETLY  119

Query  1478  FPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIY  1299
              P W G LY+V+   G   W+  L   TG NA+         V+R+TP+I  +++I+G  
Sbjct  120   VPDWGGTLYSVDTQTGKPNWQAKLSDYTG-NASS--------VTRNTPAISAKSIIVGDQ  170

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA-HCCTF  1122
                 ++ + + TG LLW T ++ +P   IT S   Y    YVG SS + G+  A H  +F
Sbjct  171   AAGTLLALDKKTGKLLWKTSVEANPQARITSSPVIYGDRIYVGISSGDWGNLAANHTFSF  230

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSA  942
             RG    +D+ TG+ +WQ + +P  KG    Y GA++WG   +ID     +Y  TGN Y+ 
Sbjct  231   RGSVVAVDLNTGQKVWQFYNVP--KG----YTGASVWGQV-AIDPISRRLYFGTGNNYNI  283

Query  941   PKHVLKC-QEKQNNKTTTPTTSDK--CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFF  771
             P  V  C    +  + +  T  D+  C+ P+N+ DS+++L+LDTGK+ W  +  GYD + 
Sbjct  284   PAGVGNCVSNARAYRGSELTVQDELNCMAPDNYVDSVVSLNLDTGKLVWADRAQGYDAWN  343

Query  770   IACINSSSTPNCPPGP-----NPDADFGEAPM-MLSVVVNGSTRDIVVAVQKSGFAWALD  609
             ++CI + +   CP         PD DFG A + + +V  +G  + +V A QK G  +A D
Sbjct  344   LSCIVAPTNGLCPNTQATNLTGPDYDFGGAGVNLFTVWRDGKPQQLVGAGQKRGIYYAFD  403

Query  608   RDNGEMVWYteagpggfvgggtwgaaTD--NERVYTSIANSNRLNFTLLPSKNVTI-GGG  438
                G  VW T+ GPGG  GG  WG A D    RVY +I NS    +TL P  + +  GG 
Sbjct  404   AKTGAKVWSTQVGPGGTTGGIEWGTAFDPYKSRVYVAINNSGNATYTLGPDNSRSHNGGS  463

Query  437   WVAMDAQTGKILWSTAVPDTGLSNP---------VTVANGVLFAGSVHPRGPVFAINAKT  285
             W A+DA TGKI+W   VP      P         +TV+  +L+AGS+   G +  ++  T
Sbjct  464   WAALDAATGKIVWQVKVPGINRVKPTVPAGGQGSLTVSPNLLYAGSMA--GNMVVLDTDT  521

Query  284   GEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             G  LW+Y    +V    +++NG +Y G GY
Sbjct  522   GATLWNYNATGSVISSPAIANGALYWGAGY  551



>ref|XP_001691739.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP04847.1| predicted protein [Chlamydomonas reinhardtii]
Length=1141

 Score =   248 bits (633),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 203/560 (36%), Positives = 288/560 (51%), Gaps = 52/560 (9%)
 Frame = -1

Query  1739  LLYYCVCIIIFLICIS--ATAKPEWHITRFSCPASGNWLNHGGDIYNRRYAC--GENKIS  1572
             +L  C   ++ ++ +S    A     + +     +  W + GG+  N R A   G+ + +
Sbjct  4     MLQSCAMALMLVLAVSHAVDAHAPRRMAQSQAAITSTWGSFGGNNRNWRTATIPGKFRTT  63

Query  1571  PSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLT-  1395
             P    ++  +     G D+SATP ++   VYF  W+G+LY V+A  G++ W++N+ +L  
Sbjct  64    PQIAFQVDTQ-----GSDVSATPTVINNFVYFGDWSGFLYKVDAQTGAVSWKKNVTELVW  118

Query  1394  --GLNATVRTGNVTAIVSRSTPSIV--GETLII-----GIYGPAVVIGVKRATGDLLWMT  1242
               G+ AT      TA       +I+   +TLI+     G  G  V I  K A+ +  W +
Sbjct  119   PGGVGATNLLVTRTAATDAGNGNIIIGTQTLILPGNFAGTQGYVVSIRAKDASTN--WKS  176

Query  1241  LLDRHPAGLITMSGTYYNGAFYVGTSSLEE--GSSKAHCCTFRGRFAKLDVWTGKVLWQT  1068
             L D HP  ++T S T Y GA YVG SSLEE   +  A CCTFRG   +LD+ TG   WQ 
Sbjct  177   LPDPHPFAIVTASPTVYKGAIYVGISSLEELVDAFGAPCCTFRGSVVRLDLLTGATQWQF  236

Query  1067  FMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTP  888
             F  P+N G  G ++G A+WGS+P+ID  RG VY+ATGN Y AP+ VL+C E   N   TP
Sbjct  237   FTAPENGGVPG-WSGNAVWGSAPAIDEARGRVYVATGNQYVAPEEVLECLEDPAND--TP  293

Query  887   TTSDKCVE-PENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSST-PNCPPGPNPD  714
                  CV+ P N  +S+L+LD++TG++ W  ++  +DV+  AC+    T  +CP   +PD
Sbjct  294   AKKGACVDVPGNWFNSVLSLDIETGELVWGNRVSFFDVWTAACLPLLPTVTDCPFAESPD  353

Query  713   ADFGEAPMMLSVVVNGSTR-DIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwg  537
              DFG+AP+    V  GS R DI+V  QKSG+ +  D   G  +W T +G G   GG  WG
Sbjct  354   YDFGQAPLYFPSVQCGSQRKDILVVGQKSGWGYGFDAATGATLWQTNSGVGSASGGMQWG  413

Query  536   aaTDNER-VYTSIANSNRLNFTLLP----SKNVTIGGGWVAMDAQTGKILWSTAVPDT--  378
              ATD  R VY   +N    + TL      S  V  GG   A+D  TG+I W  A+P T  
Sbjct  414   TATDGVRTVYFQNSNFGFEDVTLTNPAPGSPAVAPGGFATAVDVCTGEIKWQAAIPITPA  473

Query  377   ----GLSNPVTV----ANGVLFAGSVHP----RGPVFAINAKTGEILWSYYTG-ATVYGG  237
                  L  PV V    ANG  +   V+P     G + A +A+TGE   +   G      G
Sbjct  474   RQSAALGPPVYVREQGANGNAYV--VYPTLSNDGELAAFDAQTGEHYTTLIAGPGGSVSG  531

Query  236   MSVSNGCVYV-GNGYRVSIG  180
              SV NG +Y  G G R   G
Sbjct  532   PSVVNGILYADGWGLRAVAG  551


 Score =   223 bits (569),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 182/492 (37%), Positives = 254/492 (52%), Gaps = 57/492 (12%)
 Frame = -1

Query  1526  GKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLT---GLNATVRTGNVTA  1356
             G D+SATP ++   VYF  W G+LY V+A  G++ W++N+ +L    G+ AT +    TA
Sbjct  653   GSDVSATPTVINHFVYFGDWTGFLYKVDAVTGAVSWKKNVTELVWPGGVGATNKLVTRTA  712

Query  1355  IVSRSTPSIVGETLII--GIYG-----PAVVIGVKRATGDLLWMTLLDRHPAGLITMSGT  1197
                    +I+  T +   G+ G        V+ VK + G   W TL+D  P  ++T S T
Sbjct  713   ATDAGNGNIIIGTQVQSQGLPGNPNGNQGYVLAVKASDGTAAWKTLVDESPYAVVTASPT  772

Query  1196  YYNGAFYVGTSSLEE--GSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAG  1023
              Y GA YVG SS+EE        CC FRG   +L + TG +LW+ +  PD KG    ++G
Sbjct  773   VYKGAVYVGVSSMEELVDGFGIECCKFRGSVVRLALDTGALLWKFYTAPDVKG----WSG  828

Query  1022  AAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDS  843
              A+WGS+P+ID  RG VY+ATGN Y+AP+ VL C E   +         K  E  N  +S
Sbjct  829   NAVWGSAPAIDEARGWVYVATGNQYTAPQDVLDCLESSASNEAKLACVSK--EEGNWFNS  886

Query  842   ILALDLDTGKIKWFRQLGGYDVFFIACIN-SSSTPNCPPGPNPDADFGEAPMMLSVVVNG  666
             ILA+D++TG + W R++  +DV+  ACI       +CP   +PD DFG+AP+        
Sbjct  887   ILAIDMNTGALAWGRRVSFFDVWTTACIPFVPGVTDCPFVESPDYDFGQAPLYFPGTKCA  946

Query  665   S-TRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSN  489
             S T DI+VA QKSG+ + +D   G ++W T  G G   GG  WG+A+D  R  T    + 
Sbjct  947   SQTMDILVAGQKSGWGYGIDAATGTILWKTYTGVGSSSGGMQWGSASDGVR--TVFYQNA  1004

Query  488   RLNFTLLPSKN-------VTIGGGWVAMDAQTGKILWSTAVPDTGLSN------PVTV--  354
                F  +P  N       V  GG   A+D  TG+I W  A+P T          PV V  
Sbjct  1005  NFAFQSVPLTNPAPGSPAVASGGFATAVDICTGQIKWQAAIPITPARQSAAAGPPVYVRE  1064

Query  353   --ANGVLFAGSVHP----RGPVFAINAKTGEILWSYYT------GATVYGGMSVSNGCVY  210
               ANG  +   V+P     G +   +A+TG+    YYT      G++V  G SV NG +Y
Sbjct  1065  LAANGNAYV--VYPTLSDDGKLVVFDAQTGK----YYTTLVAGPGSSV-SGPSVVNGYLY  1117

Query  209   VGNGY-RVSIGA  177
             VG GY R   GA
Sbjct  1118  VGVGYSRFGFGA  1129



>ref|WP_008922098.1| Pyrrolo-quinoline quinone [Burkholderia sp. H160]
 gb|EDZ99568.1| Pyrrolo-quinoline quinone [Burkholderia sp. H160]
Length=524

 Score =   240 bits (612),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 178/531 (34%), Positives = 262/531 (49%), Gaps = 60/531 (11%)
 Frame = -1

Query  1637  NWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGY  1458
             +W   G    N R    E+ I P TV  L   W      +++ATPA+ +   YFP   GY
Sbjct  26    DWPTSGNGWMNSRNQENESAIGPKTVGSLHELWAVSTAGNVTATPALDENYAYFPDSAGY  85

Query  1457  LYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYG------  1296
             LY V    G+++W++ +   TG         +    +R+TP+I G  LI+G         
Sbjct  86    LYKVERKTGNVVWQKLVSSYTG---------IPNDYARATPAISGNALILGDQSGKLSTP  136

Query  1295  -PAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSK-----AH  1134
              PA V  V + TG LLW T +D     ++T S     G  +VG +S EE  +      A 
Sbjct  137   QPAHVFAVDKNTGTLLWSTQVDSTTYSMVTQSAVIAKGMAFVGVTSNEEYVAAFIPPPAW  196

Query  1133  CCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGN  954
               TFRG    LDV TG + WQT+ +P  KG    Y G ++WGS+ ++D  R  V++A+GN
Sbjct  197   QWTFRGSVVALDVGTGAIKWQTYTMP--KG----YYGGSVWGSTGAVDVQRNTVFMASGN  250

Query  953   LYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVF  774
              ++ P+ VL C     N    PT    C++P +H DS+LALD+ TG +KW  +   YD +
Sbjct  251   NWAVPQAVLDCL----NSGGAPT---ACIDPNDHFDSVLALDMTTGALKWSARGLPYDTW  303

Query  773   FIAC-------INSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWA  615
              + C              NCP    PD DF + PM+     NG+   +V A QKSG  WA
Sbjct  304   NVGCGLNIPGVFTLPPNANCPNPKGPDWDFAQGPMLFG--KNGNAGQLVGAGQKSGMFWA  361

Query  614   LDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLN-------FTLLPSKN  456
              D D G + W T+  PGG  GG  WG+ATD + +Y +++NS           + L     
Sbjct  362   FDADTGALRWSTQVAPGGLTGGLQWGSATDGQSIYVAVSNSGMTGAGTTPGVWQLAQGGG  421

Query  455   VTIGGGWVAMDAQTGKILWSTAVP-DTGLSNPVTVANGVLFAGSV-HPRGPVFAINAKTG  282
              T  GGW ++D  TG + W+T  P  +     V+VANGV+F  ++ +  G ++A++A  G
Sbjct  422   TTTSGGWASLDVNTGAVKWTTPDPLGSRAEAAVSVANGVVFGCNLDYVNGTMYALDASNG  481

Query  281   EILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
             ++LW + +G     G ++++G VY G+G            TG    FAF L
Sbjct  482   KVLWPFKSGGACNAGPAIADGVVYWGSGSTSG--------TGPLKFFAFGL  524



>ref|WP_014898563.1| polyvinylalcohol dehydrogenase [Burkholderia cepacia]
 ref|YP_006617480.1| polyvinylalcohol dehydrogenase [Burkholderia cepacia GG4]
 gb|AFQ49786.1| polyvinylalcohol dehydrogenase [Burkholderia cepacia GG4]
Length=521

 Score =   239 bits (611),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 174/518 (34%), Positives = 263/518 (51%), Gaps = 49/518 (9%)
 Frame = -1

Query  1646  ASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSW  1467
             A+ +W+  G  + N R A  E+ I    VS+L  +W      +++ATP +  G VY P +
Sbjct  37    AAADWVFAGQGVDNTRTAPDEHVIGVDNVSQLAPRWTLDTDGNVAATPTVANGTVYVPDF  96

Query  1466  NGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIG-----I  1302
              G L+AV+A+ G + W++ + + +G++            SR++P+     LI G      
Sbjct  97    GGSLWAVDAASGKVKWKKKITEYSGVDND---------ASRTSPAYWEGMLIFGQGTQIA  147

Query  1301  YGP--AVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCC  1128
               P  A ++  K   G  +W T +D  P  +IT S     G  YVG SS  E  +     
Sbjct  148   NNPTGAFIMAAKAEDGAPVWRTKVDSDPTAIITQSPIVDRGVVYVGLSSRAE--ALKDKP  205

Query  1127  TFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLY  948
             T+RG    LD  TGK+LW+T+M+P  KG    Y G ++WG++ ++D   G +Y+ TGN +
Sbjct  206   TYRGAVVALDGKTGKMLWKTYMVP--KG----YTGGSVWGNTAAVDHDTGLLYVTTGNNF  259

Query  947   SAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFI  768
             S P    +   ++N +  TPT         N  DS +ALDL TGK+ W  +         
Sbjct  260   SVPPGHCRFPTQKNCQPDTPT---------NMIDSFVALDLKTGKVVWHSR---------  301

Query  767   ACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMV  588
               + +  + N      PD DFG  P +    +NG  + +V A  KSG  WALD   G+++
Sbjct  302   -TLAADMSTNYDHDDGPDYDFGSGPNLFKATINGKQKTLVGAGAKSGVYWALDPKTGKVI  360

Query  587   WYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKN---VTIGGGWVAMDAQ  417
             W+T+ GPG  +GG  WG A D +R+Y SI N +  +  +    N    T GG W A+DA 
Sbjct  361   WHTQVGPGSLLGGMLWGTAADGKRIYVSIGNLDGKSIDVDNGPNGEKTTKGGIWAAVDAA  420

Query  416   TGKILWSTAVPDTGLSN-PVTVANGVLFAGSVHPRGP-VFAINAKTGEILWSYYTGATVY  243
             TGK+LW TA P   +    ++ ANGV++AGS+   G  ++A++A TG I WSY     V 
Sbjct  421   TGKVLWRTADPQGKMDTVAMSAANGVVYAGSLAGTGASMYALDAATGAIKWSYENNGAVV  480

Query  242   GGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
              G ++ +G VY G GY   +  G+P       L+AF L
Sbjct  481   SGAAIVDGTVYWGAGYHTKV-LGLPYDGTSHKLYAFGL  517



>gb|EQB44371.1| hypothetical protein CGLO_16897 [Colletotrichum gloeosporioides 
Cg-14]
Length=543

 Score =   238 bits (607),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 174/521 (33%), Positives = 262/521 (50%), Gaps = 34/521 (7%)
 Frame = -1

Query  1640  GNWLNHGGDIYNRRYACGENKISPSTVSKL-KLKWEFYAGKDISATPAILKGVVYFPSWN  1464
             G W+  GG I+NRR A  +  I+   V  L K   + Y    +SA+P ++ G+ Y+P+W 
Sbjct  24    GVWVGWGGSIHNRRMAGPDVVIAQKNVGLLVKTCEQRYEPAGVSASPLVVDGIAYYPTWT  83

Query  1463  GYLYAVNASDGSLLWERNL-QKLTGLNATVRTGNVTAI--VSRSTPSIVGETLIIGIYGP  1293
             G L A++     + W  N+ QK+            + +  VSRS+P   G+ L IG    
Sbjct  84    GLLVALDYKSCHVQWTANITQKILDFAPLTDFQRASGVNPVSRSSPVTDGDHLFIGTLAH  143

Query  1292  AVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA---HCCTF  1122
             A+V+ + + TG L+    +D HP  +IT S T Y G   VG SS E  S+     +CC  
Sbjct  144   ALVLAIDKETGSLVSHLQVDNHPVAMITQSPTCYAGQLLVGASSFEVISASLANYNCCDH  203

Query  1121  RGRFAKLDVWTG--KVLWQTFMLPDNKGKRGE-YAGAAIWGSSPSIDAHRGHVYIATGNL  951
              G    + +  G  ++ W+T M+   +   G+ ++GA++WGSSP +D  RG VYIATGN 
Sbjct  204   VGSMNSVALEDGNLRLQWKTMMMTQPQNLTGDPFSGASVWGSSPVVDTSRGSVYIATGNT  263

Query  950   YSAPKHVLKCQEKQN-NKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVF  774
             +S P  +  CQ   N N TT P   D C+ P+ + +S+LALDL TG IKW RQLG  DV+
Sbjct  264   HSVPDEIAACQLASNQNGTTFP---DPCLPPDIYQESVLALDLKTGNIKWARQLGVLDVW  320

Query  773   FIACINSSSTPNCPPGPNPDADFGEAPMML--SVVVNGSTRDIVVAVQKSGFAWALDRDN  600
              +AC+       CPP    D+DF   P ++          +D++V  QK+G  + +D ++
Sbjct  321   NLACVLDPRGAECPPVVGLDSDFSMGPTLVPGDDAKTPGGKDLIVIGQKNGNLYGIDAES  380

Query  599   GEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNV--TIGGGWVAM  426
             GE++W T+A P G  GG +WG A D+  VY +  N+ R  + L+  + +   + G    +
Sbjct  381   GEVLWLTKASPAGLEGGLSWGVAADDVAVYFTAINNARTPYALVNGQTIQNAVFGAAALL  440

Query  425   DAQTGKILWSTAVP-DTGLSNPVTVANGVLFAGSV---------HPRGPVFAINAKTGEI  276
             D   GKI+W T  P DT      TV N V+  GS             G +  ++  TGE+
Sbjct  441   D---GKIMWQTPSPNDTASMITPTVVNDVVVTGSTGKTGENGFPQGSGSLVLLDKSTGEV  497

Query  275   LWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGG  153
             +          GG++V    +  G GY   +    P F GG
Sbjct  498   IREDQLADFFKGGIAVVQNYLMFGTGYWSGLQ---PPFAGG  535



>ref|XP_009219017.1| hypothetical protein GGTG_02975 [Gaeumannomyces graminis var. 
tritici R3-111a-1]
 gb|EJT77872.1| hypothetical protein GGTG_02975 [Gaeumannomyces graminis var. 
tritici R3-111a-1]
Length=568

 Score =   238 bits (607),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 177/511 (35%), Positives = 254/511 (50%), Gaps = 31/511 (6%)
 Frame = -1

Query  1649  PASGNWLNHGGDIYNRRYACGENKISPSTVSKL-KLKWEFYAGKDISATPAILKGVVYFP  1473
             PA GNWL  G   YN R+A  +  +S   ++ L K+    Y+G   SA P +  GV Y+P
Sbjct  47    PAGGNWLGWGAGPYNNRWAASDAVVSTKNIANLTKVCSVPYSGAGQSAAPLVTGGVAYYP  106

Query  1472  SWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIV--GETLIIGIY  1299
             ++ G L A++    S +W  N+ ++      V       +VSR+TP++   G+ L IG  
Sbjct  107   TFTGLLVALDYQACSEVWSINVTRIIEDFGPVPIEYAKPMVSRTTPALDKDGDVLFIGTL  166

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEG-SSKAHCCTF  1122
               A+V+ + R++G L+    LD +P  ++T S T+Y G  Y G SS E    S   CC+F
Sbjct  167   AHALVLAIDRSSGRLIDSIQLDTNPYAILTQSQTFYGGRLYAGVSSTESVVPSVGACCSF  226

Query  1121  RGRFAKLDVWTGKVL--WQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLY  948
              G    + +  G++   W    LP       +  GAA+WGS PSID  R  V+  +GNLY
Sbjct  227   VGSLNAVSLVGGRLRHEWGVQTLPHTSPANADLGGAAVWGSQPSIDPIRKQVFFGSGNLY  286

Query  947   SAPKHVLKCQEKQNNKTTTP---TTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDV  777
             + P   + C  +  N +         D C+  E + DSI+A+DL+TG++ W +QLG  D 
Sbjct  287   NIPPDFVDCVRQTANISIIEQGLVGRDPCLPIETYQDSIMAVDLETGRVNWAKQLGQLDA  346

Query  776   FFIACIN--SSSTPNCPPGPNPDADFGEAPMMLSVVVNGST-----RDIVVAVQKSGFAW  618
             +   C    +++   CP  P PDADFG AP      V GS      +DI+VA QKSG  +
Sbjct  347   WNAGCFEGFAAAPGTCPETPGPDADFGMAPTF----VPGSPETPAGQDIIVAGQKSGKLY  402

Query  617   ALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGG  438
             AL    G + W  + GPGG  GG TWG A D++ VY +  NS+R  FT +P   V     
Sbjct  403   ALYAQTGTVAWAIQTGPGGLEGGLTWGVAVDDKAVYFTNTNSDRKPFT-MPDGQVISNSA  461

Query  437   WVAMDAQTGKILWSTAVPDTGLSNPV-TVANGVLFAGS-------VHPRGPVF--AINAK  288
             + A   + G+ILW T  PD   S    TV N V+  G+       + P GP +   ++  
Sbjct  462   FGAASLKDGRILWLTPAPDNHDSFVAPTVVNDVVLTGTTGARGERLDPIGPGYLTPLDKN  521

Query  287   TGEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
             TG IL      A   GGM+     V  G GY
Sbjct  522   TGNILRQIEMDAVFRGGMAAVGDYVLFGTGY  552



>ref|WP_039323860.1| hypothetical protein, partial [Burkholderia sp. A9]
Length=478

 Score =   235 bits (599),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 172/510 (34%), Positives = 258/510 (51%), Gaps = 49/510 (10%)
 Frame = -1

Query  1622  GGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVN  1443
             G  + N R A  E+ I    VS+L  +W      +++ATP +  G VY P + G L+AV+
Sbjct  2     GQGVDNTRTAPDEHVIGVDNVSQLAPRWTLDTDGNVAATPTVANGTVYVPDFGGSLWAVD  61

Query  1442  ASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIG-----IYGP--AVV  1284
             A+ G + W++ + + +G++            SR++P+     LI G        P  A +
Sbjct  62    AASGKVKWKKKITEYSGVDND---------ASRTSPAYWEGMLIFGQGTQIANNPTGAFI  112

Query  1283  IGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAK  1104
             +  K   G  +W T +D  P  +IT S     G  YVG SS  E  +     T+RG    
Sbjct  113   MAAKAEDGAPVWRTKVDSDPTAIITQSPIVDRGVVYVGLSSRAE--ALKDKPTYRGAVVA  170

Query  1103  LDVWTGKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLK  924
             LD  TGK+LW+T+M+P  KG    Y G ++WG++ ++D   G +Y+ TGN +S P    +
Sbjct  171   LDGKTGKMLWKTYMVP--KG----YTGGSVWGNTAAVDHDTGLLYVTTGNNFSVPPGHCR  224

Query  923   CQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSST  744
                ++N +  TPT         N  DS +ALDL TGK+ W  +           + +  +
Sbjct  225   FPTQKNCQPDTPT---------NMIDSFVALDLKTGKVVWHSR----------TLAADMS  265

Query  743   PNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpg  564
              N      PD DFG  P +    +NG  + +V A  KSG  WALD   G+++W+T+ GPG
Sbjct  266   TNYDHDDGPDYDFGSGPNLFKATINGKQKTLVGAGAKSGVYWALDPKTGKVIWHTQVGPG  325

Query  563   gfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKN---VTIGGGWVAMDAQTGKILWST  393
               +GG  WG A D +R+Y SI N +  +  +    N    T GG W A+DA TGK+LW T
Sbjct  326   SLLGGMLWGTAADGKRIYVSIGNLDGKSIDVDNGPNGEKTTKGGIWAAVDAATGKVLWRT  385

Query  392   AVPDTGLSN-PVTVANGVLFAGSVHPRGP-VFAINAKTGEILWSYYTGATVYGGMSVSNG  219
             A P   +    ++ ANGV++AGS+   G  ++A++A TG I WSY     V  G ++ +G
Sbjct  386   ADPQGKMDTVAMSAANGVVYAGSLAGTGASMYALDAATGAIKWSYENNGAVVSGAAIVDG  445

Query  218   CVYVGNGYRVSIGAGIPIFTGGTSLFAFCL  129
              VY G GY   +  G+P       L+AF L
Sbjct  446   TVYWGAGYHTKV-LGLPYDGTSHKLYAFGL  474



>gb|ELQ35660.1| hypothetical protein OOU_Y34scaffold00696g2 [Magnaporthe oryzae 
Y34]
 gb|ELQ64482.1| hypothetical protein OOW_P131scaffold00611g4 [Magnaporthe oryzae 
P131]
Length=603

 Score =   231 bits (590),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 185/529 (35%), Positives = 256/529 (48%), Gaps = 28/529 (5%)
 Frame = -1

Query  1697  ISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKL-KLKWEFYAGK  1521
             +  TA  +  I     P+ GNWL  G  +YN R+A  +  +  S V+ L K+    YA  
Sbjct  43    LQTTAALDEQIPDAQPPSGGNWLGWGAGVYNNRWAGSDAVVDASNVANLTKVCSVQYATA  102

Query  1520  DISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRS  1341
               SA P +  GV Y+P+W G L AV+      +W  N+ ++          N  A VSR+
Sbjct  103   GQSAPPLVTGGVAYYPTWTGLLEAVDYRLCERVWTVNVTRIIDGYRPGPVQNGKAKVSRT  162

Query  1340  TPSI--VGETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGT  1167
             TP++   GETL +G    A+V+ + R TG L+    LD HP  ++T S T+Y+G  Y G 
Sbjct  163   TPALGDDGETLFVGTVAHALVLALDRRTGRLVDSLQLDAHPFAILTQSPTFYDGRLYAGV  222

Query  1166  SSLEEGSSKAH-CCTFRGRFAKLDVWTGK--VLWQTFMLPDNKGKRGE---YAGAAIWGS  1005
             SS E  +   H CC+F G    + +  G+  +LW    +P +     +   ++GAA+WGS
Sbjct  223   SSSESAAFPGHPCCSFVGSLHAVALRRGRLQLLWSAQTIPRHSPADRDDPKFSGAAVWGS  282

Query  1004  SPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTP---TTSDKCVEPENHSDSILA  834
              PSID  R  V++ TG LYS P    +CQ +  N T      T  D C+    + +SILA
Sbjct  283   QPSIDPIRRQVFVGTGQLYSLPPEFEECQRQTANVTVIRQGLTGHDPCLPRTAYQNSILA  342

Query  833   LDLDTGKIKWFRQLGGYDVFFIACINSSSTP----NCPPGPNPDADFGEAP-MMLSVVVN  669
             LDLDTG++ W RQLG  D +   CI+    P     CP  P  DADFG AP  +L     
Sbjct  343   LDLDTGRVNWARQLGPLDAWNAGCIDFPGVPPNPGACPDLPGQDADFGMAPTFVLGSAAT  402

Query  668   GSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSN  489
                 D+VVA QK+G  W L    G   W T+ GPGG  GG TWG A D+  VY    NS 
Sbjct  403   PFGVDMVVAGQKNGMLWGLCAATGTTAWATQTGPGGLEGGLTWGVAVDDAAVYFVNTNSE  462

Query  488   RLNFTLLPS-KNVTIGGGWVAMDAQTGKILWSTAVPDTGLS--NPVTVANGVLFAGS---  327
                F +  S  +V     + A     G+ILW T  P    S   P  V + VL   S   
Sbjct  463   HRRFAMPGSGGDVVSNSAFGAASLADGRILWLTPAPHNHDSYVAPAVVNDVVLVGTSGAR  522

Query  326   ---VHPRGPVF--AINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
                + P GP +   ++ +TG +L      A + GG +     V+ G GY
Sbjct  523   GDFLEPVGPGYLTPLDKRTGSVLRRIKLDAVLRGGPATVGEYVFFGTGY  571



>gb|AFK45688.1| unknown [Lotus japonicus]
Length=189

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 151/189 (80%), Gaps = 1/189 (1%)
 Frame = -1

Query  692  MMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERV  513
            MML++  N S  D+VVAVQKSGFAWAL RD+G+++W TE GPGG  GGGTWGAATD +RV
Sbjct  1    MMLTIKANESKHDVVVAVQKSGFAWALHRDDGKLMWSTEVGPGGIAGGGTWGAATDKKRV  60

Query  512  YTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSN-PVTVANGVLF  336
            YT+IANS   NFTL PS  +T  GGWVAM+A++GKILWS A P    SN PV+VANGV+F
Sbjct  61   YTNIANSGGKNFTLKPSNKITNSGGWVAMEARSGKILWSVANPSNATSNGPVSVANGVVF  120

Query  335  AGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTG  156
             GS + +G V+AIN+KTG+ILW+Y TG+TVYGGMS+S+GC+Y GNGY V +G  IP  TG
Sbjct  121  VGSANRKGSVYAINSKTGKILWTYETGSTVYGGMSISDGCIYFGNGYTVGLGTLIPNLTG  180

Query  155  GTSLFAFCL  129
            GTSL+AFC+
Sbjct  181  GTSLYAFCV  189



>ref|XP_007282941.1| pyrrolo-quinoline quinone [Colletotrichum gloeosporioides Nara 
gc5]
 gb|ELA27985.1| pyrrolo-quinoline quinone [Colletotrichum gloeosporioides Nara 
gc5]
Length=548

 Score =   224 bits (572),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 171/494 (35%), Positives = 251/494 (51%), Gaps = 35/494 (7%)
 Frame = -1

Query  1559  SKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKL----TG  1392
             S +K+  + Y    +SA+P ++ G+ Y+ +W G L A++     + W  N+ ++      
Sbjct  58    SLVKICEQRYEPAGVSASPLVVDGIAYYLTWTGLLVALDYKSCHVQWTANITQMILDFAP  117

Query  1391  LNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLI  1212
             L    R   V   VSRS+P   G+ L IG    A+V+ + R TG L+    +D HP  +I
Sbjct  118   LTDIQRASGVNP-VSRSSPVTDGDHLFIGTLAHALVLAIDRETGSLVSHLQIDDHPVAMI  176

Query  1211  TMSGTYYNGAFYVGTSSLEEGSSKA---HCCTFRGRFAKLDVWTG--KVLWQTFMLPDNK  1047
             T S T+Y G   VG SS E  S+      CC   G    + +  G  K+LW+T M+   +
Sbjct  177   TQSPTWYAGQLLVGASSFEVISASLANYKCCDHVGSMNSVALEDGILKLLWKTMMMTQPE  236

Query  1046  GKRGE-YAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQN-NKTTTPTTSDK  873
                G+ ++GA++WGSSP +D  R  VYIATGN +S P  V  CQ   N N T  P   D 
Sbjct  237   NFTGDPFSGASVWGSSPVVDTIRNCVYIATGNTHSVPDEVAACQLASNQNGTVLP---DP  293

Query  872   CVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAP  693
             C+ P+ + +S+LALDL  G IKW RQLG  D + +AC+ +     CPP    D+DFG  P
Sbjct  294   CLPPDIYQESVLALDLVIGSIKWVRQLGVLDAWNLACVLNPRGAECPPVVGLDSDFGMGP  353

Query  692   MML----SVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTD  525
              ++    +   NG  +D++V  QK+G  + +D ++GE++W T+A P G  GG +WG A D
Sbjct  354   TLVPGAGAKTPNG--KDLIVIGQKNGNLYGIDAESGEVLWLTKASPAGLEGGLSWGIAAD  411

Query  524   NERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVP-DTGLSNPVTVAN  348
             +  VY +  N+ R  +  L +  +     + A     GKILW TA P DT      TV N
Sbjct  412   HVAVYFTAINNARTPYA-LANGQIIQNAAFGAAALADGKILWKTASPNDTASMIAPTVVN  470

Query  347   GVLFAGSV-------HPRGP--VFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGY  195
              VL  GS         P+GP  +  ++  TG+IL          GG++V    +  G GY
Sbjct  471   DVLVTGSTGRTGENGFPQGPGSLVLLDKLTGKILREEKLADFFKGGIAVVQNYLMFGTGY  530

Query  194   RVSIGAGIPIFTGG  153
                +    P F GG
Sbjct  531   WSGLQ---PPFAGG  541



>ref|XP_001696369.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP08346.1| predicted protein [Chlamydomonas reinhardtii]
Length=544

 Score =   220 bits (560),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 161/437 (37%), Positives = 227/437 (52%), Gaps = 41/437 (9%)
 Frame = -1

Query  1523  KDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSR  1344
             +D+S TP I+ G  YF  W G LY V+A  G + W  N+ +L         G   A+ +R
Sbjct  22    QDVSCTPTIIGGHAYFGDWAGQLYKVDAVTGQVAWALNVTELVWPGGA---GATNAVQTR  78

Query  1343  STPS-------IVGETLIIGIYGP----AVVIGVKRATGDLLWMTLLDRHPAGLITMSGT  1197
             ++P+       I+G   I+    P      V+ +K + G + W  + D HP  +IT S T
Sbjct  79    TSPTDDGAGNIIIGTQTIVPPGNPKGVQGYVVSLKASDGSVNWRAVPDSHPFAIITASPT  138

Query  1196  YYNGAFYVGTSSLEE--GSSKAHCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYAG  1023
              Y GA YVG SS EE        CCTFRG   KLD+ TG   WQ    PDN GK   ++G
Sbjct  139   VYKGAVYVGVSSNEELVDGIGLECCTFRGSVVKLDLKTGAKQWQFHTAPDNGGKVDGWSG  198

Query  1022  AAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVE-PENHSD  846
              A+WGS+P+I   +G V +ATGN YS P  V +C +      TTP    KCV+ P N  +
Sbjct  199   NAVWGSAPTIVEKQGLVVVATGNTYSVPADVEQCLD----AATTPVEKGKCVQVPGNWFN  254

Query  845   SILALDLDTGKIKWFRQLGGYDVFFIACIN-SSSTPNCPPGPNPDADFGEAPMMLSVVVN  669
             S+L +++  G + W  ++  +DV+   CI       +CP   +PD DFG+AP+       
Sbjct  255   SVLGINMANGSLAWGSRVSYFDVWTTTCIPLIPGVADCPVKDSPDYDFGQAPLYFPNTKC  314

Query  668   GS-TRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNER-VYTSIAN  495
             GS T+DI+VA QKSG+A+  D   G+M+W   AGPG   GG  WG+ATD ++ V+   AN
Sbjct  315   GSETKDILVAAQKSGWAYGFDAHTGKMLWSKSAGPGSASGGSQWGSATDGKKTVFLQNAN  374

Query  494   SNRLNFTLL---PSKNVTIGGGW-VAMDAQTGKILWSTAVPDTGLSNPVTVANGVLFAGS  327
                 N TL+   P  +   GGG+  A+D  TG I W +A+P T + +  T+         
Sbjct  375   FAFENVTLVNPAPGSSPVAGGGFGTAIDVCTGSIKWQSAMPITPVKSSSTM---------  425

Query  326   VHPRGPVFAINAKTGEI  276
                 GP   + AK GE+
Sbjct  426   ----GPPTYVMAKGGEV  438



>ref|XP_003621146.1| hypothetical protein MTR_7g009760 [Medicago truncatula]
 gb|AES77364.1| polyvinylalcohol dehydrogenase-like protein [Medicago truncatula]
Length=326

 Score =   209 bits (532),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 133/180 (74%), Gaps = 9/180 (5%)
 Frame = -1

Query  1724  VCIIIFLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKL  1545
             +C+++F + +         +  F+     +W+NHGGD++NRRYA  E+KI+P TVS L L
Sbjct  6     LCLLLFCVHV---------VLVFASSLQSDWINHGGDLFNRRYAYNEHKINPETVSNLSL  56

Query  1544  KWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGN  1365
             KW+F AGKDI+ATP I  G +YFP WNG +YA+   DGSL+W++NL++LTGLNAT     
Sbjct  57    KWKFNAGKDITATPTIYNGTIYFPCWNGNIYAIKQIDGSLVWKQNLEELTGLNATGIIKA  116

Query  1364  VTAIVSRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNG  1185
             V   V+R+TP++  + LI+GIYGPAVVIG++R TG+L+W+T LD HPAG+ITMSGTYYNG
Sbjct  117   VNWSVARATPTVAEDLLIVGIYGPAVVIGLERRTGELIWLTHLDNHPAGVITMSGTYYNG  176


 Score =   154 bits (390),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 101/134 (75%), Gaps = 3/134 (2%)
 Frame = -1

Query  527  DNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSN-PVTVA  351
            D +RVYT+IANS+  NF LLP+   T  GGWV MDA  G+I+W+TA P    +N PV+VA
Sbjct  195  DEKRVYTNIANSDAKNFKLLPTNMNTTSGGWVGMDAMNGEIIWTTANPSNNSANGPVSVA  254

Query  350  NGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGI  171
            N V+FAGS+   G ++A+NAK G+I+WSY TGA VYGGMS+S+GC+YVG+GY VS+  G 
Sbjct  255  NEVVFAGSMDRLGHIYALNAKNGKIVWSYETGANVYGGMSISDGCIYVGHGYNVSL--GY  312

Query  170  PIFTGGTSLFAFCL  129
            P   GGTSLFAFC+
Sbjct  313  PRRIGGTSLFAFCV  326



>ref|XP_003345090.1| hypothetical protein SMAC_09311 [Sordaria macrospora k-hell]
 emb|CCC09940.1| unnamed protein product [Sordaria macrospora k-hell]
Length=557

 Score =   213 bits (543),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 171/513 (33%), Positives = 245/513 (48%), Gaps = 42/513 (8%)
 Frame = -1

Query  1634  WLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYA-GKDISATPAILKGVVYFPSWNGY  1458
             W+  GG  YN R+A   +KI  S +  +         G  I+ATP++ +G+ YFP+WNG 
Sbjct  42    WIGWGGSNYNNRWASTNSKIFSSNIRSVSEHCHVPGYGGGITATPSVAEGIAYFPAWNGS  101

Query  1457  LYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAI---VSRSTPSIVGETLII--GIYGP  1293
             L A + +   + W+ N+ ++    A V           VSR+TP +  E  II       
Sbjct  102   LVAFDYTSCKVKWDINVTQVILDYAPVDPLQAAVAPYPVSRTTPQLDLENNIIYFATLWN  161

Query  1292  AVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSS-----KAHCC  1128
             A+++     TG +L    ++ HP   +T S T      Y G SS EE           CC
Sbjct  162   ALLVAADLRTGKILAKHRINAHPLAQVTQSPTLLGDIVYSGASSAEESVGFLPGVNYTCC  221

Query  1127  TFRG-----RFAKLDVWTGKVLWQTFMLP--DNKGKRGEYAGAAIWGSSPSIDAHRGHVY  969
             TF G     RF +        LW   M+P  D+  + G ++G+AIWGS PSID  R  ++
Sbjct  222   TFIGNAIAVRFNR-KARKFTTLWDVPMMPPNDDPSEPGFWSGSAIWGSQPSIDPKRRTIF  280

Query  968   IATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPEN-HSDSILALDLDTGKIKWFRQL  792
              ATGNLYS P   L C     + T        C  P     ++++ALDL+TG +KW R+L
Sbjct  281   YATGNLYSVPDPWLACTADPAHPT--------CELPSRVWQEAVVALDLETGNVKWVRRL  332

Query  791   GGYDVFFIACINSSSTPN-CPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWA  615
             G  D + +AC+N++     CP  P PDADFG AP  +        +D+VV  QK+G  ++
Sbjct  333   GVLDAWSVACLNATFDAGLCPQTPGPDADFGMAPAFVP-GKGKKGKDVVVVGQKNGNLYS  391

Query  614   LDRDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSK--------  459
             L  D G++ W    GPGG  GG TWG A D+ RVY    NS    +T  P +        
Sbjct  392   LAADTGDLEWAVSTGPGGQGGGLTWGIAVDDRRVYYVTVNSEGETWTPAPQQPQSRSGPA  451

Query  458   NVTIGGGWVAMDAQTGKILWSTAVPDTGL-SNPVTVANGVLFAG---SVHPRGPVFAINA  291
               T G  + A D +TG+ILW T  PD  L  NP TV   +L  G       +G +  +  
Sbjct  452   KSTNGSAYGAADLETGEILWETPAPDNWLVGNPPTVVGDLLLLGRKVDTPAQGQLVVLKK  511

Query  290   KTGEILWSYYTGATVYGGMSVSNGCVYVGNGYR  192
              TGEI+      +   GG++V+   +  G G+ 
Sbjct  512   STGEIILDKALDSHFTGGIAVAGKNLLFGTGFH  544



>gb|AFK48302.1| unknown [Lotus japonicus]
Length=224

 Score =   200 bits (508),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 131/186 (70%), Gaps = 10/186 (5%)
 Frame = -1

Query  1730  YCVCIIIFLICISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACGENKISPSTVSKL  1551
             +C C+   L  I+A+A   W     S   S +WLNHGGD++NRRYA  ENKISP +   L
Sbjct  13    FC-CLFFCLHIITASASSYWVEEDHS---SQDWLNHGGDLFNRRYASKENKISPKSAPNL  68

Query  1550  KLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRT  1371
             +LKW+FYAG++I+ATPAI KG +YFPSWNG +YAV A DGSL+WE+++Q LTG+ +    
Sbjct  69    RLKWKFYAGREITATPAIFKGTIYFPSWNGNIYAVKACDGSLVWEQSIQNLTGIKSPGSV  128

Query  1370  GNVTAIVSRSTPSIVG----ETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMS  1203
              NVT   +R+TP++ G    + L++GIYGPAVVI + R  G L+WMT LD H  G+ITMS
Sbjct  129   TNVT--FARATPTLAGDDHHDLLVVGIYGPAVVIALNRIDGKLVWMTQLDSHNTGVITMS  186

Query  1202  GTYYNG  1185
             GTYY G
Sbjct  187   GTYYKG  192



>emb|CAN79118.1| hypothetical protein VITISV_005773 [Vitis vinifera]
Length=1368

 Score =   215 bits (547),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 132/177 (75%), Gaps = 12/177 (7%)
 Frame = -1

Query  1133  CCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGE------YAGAAIWGSSPSIDAHRGHV  972
             C   RGR+  L   +   +   FM+  N+G   +       AGAAIWGSSPSID  R  V
Sbjct  1164  CIPKRGRYGPL--ISAISICPRFMI--NRGDPCQTRPLPFLAGAAIWGSSPSIDVRRNLV  1219

Query  971   YIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQL  792
             Y+ATGNLYSAP  + +CQE+QNN+T  PT  D+C+EP+NHS+SILA+DLD+ KIKW+RQL
Sbjct  1220  YVATGNLYSAPLSIRECQEQQNNQTV-PTQPDQCIEPDNHSNSILAIDLDSDKIKWYRQL  1278

Query  791   GGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFA  621
             GGYD +F+AC N+ STPNCPPGPNPDADFGEAPMMLS+ VNG+ RDIV+AVQK+  A
Sbjct  1279  GGYDAWFLAC-NNLSTPNCPPGPNPDADFGEAPMMLSIYVNGTMRDIVIAVQKTAVA  1334



>ref|XP_010068791.1| PREDICTED: uncharacterized protein LOC104455754 [Eucalyptus grandis]
Length=199

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/224 (46%), Positives = 139/224 (62%), Gaps = 25/224 (11%)
 Frame = -1

Query  1448  VNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGVKR  1269
             +NA DGSL+W++NL +LTGL  T    NVT  +SRSTP+I  + LI+ I GP VVI + R
Sbjct  1     MNAFDGSLVWKQNLSELTGLRGTTIV-NVT--LSRSTPTIAEKLLIVSICGPVVVIAMNR  57

Query  1268  ATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKAHCCTFRGRFAKLDVWT  1089
             + G L+W T LD HP  +IT S T Y G                      G   KL++  
Sbjct  58    SNGRLVWSTQLDPHPRAVITTSRTAYLG----------------------GSLVKLNILP  95

Query  1088  GKVLWQTFMLPDNKGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQ  909
             G +LWQT+ LPDN G+   Y GA+IWGSSP+ID  R   Y ATGN Y+ P  V +CQ +Q
Sbjct  96    GAILWQTYTLPDNGGELRGYDGASIWGSSPAIDPKRRLAYAATGNHYTGPAKVRECQARQ  155

Query  908   NNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDV  777
             NN+T  PT  D+C+ P+ + +SI+A ++++G+I+W  QLGGYDV
Sbjct  156   NNQTIPPTAPDQCIGPDVNFNSIIAFEMESGRIRWAPQLGGYDV  199



>ref|XP_006603583.1| PREDICTED: uncharacterized protein LOC102659955 [Glycine max]
Length=209

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 117/158 (74%), Gaps = 1/158 (1%)
 Frame = -1

Query  1655  SCPASGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYF  1476
             S   + NWLNHGGDIYNRRYA  E+KIS  T S L LKWEFYAGKDI+ATPAI  G +YF
Sbjct  43    STEKTQNWLNHGGDIYNRRYASMEHKISVETFSNLSLKWEFYAGKDITATPAIFDGTLYF  102

Query  1475  PSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIV-GETLIIGIY  1299
             P WNG ++AV A  GSL+W++NL  LTGL+AT     V   V+R+TP+I   + LI+GIY
Sbjct  103   PCWNGDIFAVRAKYGSLVWKQNLGNLTGLSATGFVAGVNWTVARATPTIAEDDLLIVGIY  162

Query  1298  GPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNG  1185
             GPAVVI VKR+TGDL+W T LD H + ++TMSGTY  G
Sbjct  163   GPAVVIAVKRSTGDLVWETRLDSHNSSVVTMSGTYLRG  200



>ref|XP_002517484.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45026.1| conserved hypothetical protein [Ricinus communis]
Length=182

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 135/189 (71%), Gaps = 9/189 (5%)
 Frame = -1

Query  692  MMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwgaaTDNERV  513
            MMLS+ VNG+ + +VVA+QKSGFAWA+DR  G  +  TEAGPGG  GGG WGAA D +RV
Sbjct  1    MMLSIYVNGTMQGLVVAIQKSGFAWAVDRITGSHIRSTEAGPGGLGGGGYWGAAIDEKRV  60

Query  512  YTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGL-SNPVTVANGVLF  336
            YT+IANS    FTL PSK  T  GGWV MDA+ G+ILWS   P  G  S+ VT+ANGVLF
Sbjct  61   YTNIANSESKIFTLKPSKKNTTAGGWVGMDAKNGEILWSVGDPSNGTASDHVTIANGVLF  120

Query  335  AGSVHPRGPVFAINAKTGEILWSYYTGATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTG  156
             GS + +GP++A+NA+ G ILW + T A++YGG+SVS+GCVY GNGYR         F  
Sbjct  121  GGSTYKKGPIYALNARNGRILWLHETEASIYGGVSVSDGCVYFGNGYRG--------FVA  172

Query  155  GTSLFAFCL  129
            GTSL AFC+
Sbjct  173  GTSLLAFCI  181



>ref|WP_030428312.1| hypothetical protein [Allokutzneria albata]
Length=534

 Score =   189 bits (479),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 162/531 (31%), Positives = 236/531 (44%), Gaps = 103/531 (19%)
 Frame = -1

Query  1724  VCIIIFLIC-----ISATAKPEWHITRFSCPASGNWLNHGGDIYNRRYACGENKISPSTV  1560
             V I +  +C     +SA A P+    R     +  W +   D+   R+   E KI+  TV
Sbjct  12    VLIGLLALCLAGTTVSAAAPPDPDRGR-----AAEWTSWQKDLVGSRHNAAERKITERTV  66

Query  1559  SKLKLKWEFYAGK----DISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTG  1392
             + LKLKW F   K       + PAI+ G +YF   +G  +A++A  G+  W   L+ +  
Sbjct  67    ADLKLKWAFAFPKVPFLTAHSQPAIVDGTMYFGGPDGLFHALDAKTGATKWTFTLKTVDP  126

Query  1391  LNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLI  1212
                     N+   V R++P + G  +  G      +  +K  TG L W T LD HP  LI
Sbjct  127   --------NLRRAVVRNSPVVAGGKVYFGDLR-GYMYALKAGTGALEWATRLDTHPEALI  177

Query  1211  TMSGTYYNGAFYVGTSSLEEGSSKAH-CCTFRGRFAKLDVWTGKVLWQTFMLPDNK----  1047
             T S  ++ G  +VG SS E  ++  + CCTFRG+FA +D  TGKVLW+ + +P+ K    
Sbjct  178   TSSPIHFAGKLFVGVSSDESSAAADYPCCTFRGQFASIDAATGKVLWRHYTVPEPKAVGT  237

Query  1046  ----GKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTS  879
                   R E +GAA+W +SPS+D   G V+I TG  Y                  T T  
Sbjct  238   WPSGATRFEPSGAAVW-ASPSVDPVTGTVFIGTGQNY------------------TGTAG  278

Query  878   DKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTP-NCPPGPNP---DA  711
             D        SD++LALD  TGK++W RQ+   D + + C++ S+ P +CP   N    D 
Sbjct  279   D--------SDTVLALDAFTGKVRWKRQMTHPDTWRLICVDPSAPPGHCPGMENGTALDF  330

Query  710   DFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDNGEMVWYteagpggfvgggtwga-  534
             D G  P + +V      R +V   QKSG    LD   GE VW  +         G  G  
Sbjct  331   DIGSLPNVFTV----KGRTLVGIGQKSGVYHVLDARTGEFVWQRQLSKPRPNDLGQSGIL  386

Query  533   ---aTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLS--  369
                + D ER+Y +  ++                G   A+D  TG +LW T  P  G S  
Sbjct  387   WGGSYDGERLYVATNDAKP--------------GALHALDPATGALLWKTENPANGCSWG  432

Query  368   --------------NPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYT  258
                             V+   GV++ GS    G + A +A+ G +LW + T
Sbjct  433   GSAQYPDECILANRPAVSTTPGVVYEGSAD--GKMRAYSARDGRVLWEFDT  481



>ref|WP_035701718.1| cytochrome Cbb3 [Bradyrhizobium sp. CCBAU 43298]
Length=610

 Score =   189 bits (479),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 171/521 (33%), Positives = 252/521 (48%), Gaps = 87/521 (17%)
 Frame = -1

Query  1637  NWLNHGGDIYNRRYACGENK-ISPSTVSKLKLKWEF-YAGKDIS-ATPAILKGVVYFPSW  1467
              W   G D+ N R+   +   +S + V  L+LKW + + G  +S A P I+ G+++    
Sbjct  118   RWNGWGVDVRNSRFQPADMAGLSAAQVPHLRLKWAYAFPGASVSFAPPTIVGGMLFIGGT  177

Query  1466  NGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAV  1287
             +  ++A++A  G  LW         L+A VR     AI     P      +  G    A 
Sbjct  178   DRKVHALDARSGCTLWT------LALDAAVRA----AISFAPLPGSDQFAIFFGDL-RAN  226

Query  1286  VIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGS-SKA--HCCTFRG  1116
                V   TG L+W T ++ H A  IT + T ++G  YV  SS+EE + S+A   CCTFRG
Sbjct  227   AYAVNALTGALIWKTKVEEHAAARITGAPTLHSGVLYVPVSSIEEAAGSQASYECCTFRG  286

Query  1115  RFAKLDVWTGKVLWQTFMLPDNKGKRGEYA---------GAAIWGSSPSIDAHRGHVYIA  963
                 LD  TGK +WQ + +P+     G+ A         GAAIW S+P+IDA R  VY+A
Sbjct  287   SVVALDAATGKTIWQAYTIPEVPHPTGKNAKGTQLFGPSGAAIW-SAPTIDAQRTAVYVA  345

Query  962   TGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGY  783
             T N YS P                         P   +D++LA +L TGK+ W +Q    
Sbjct  346   TSNSYSNP-------------------------PAATADAVLAFELATGKLLWKQQATPK  380

Query  782   DVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRD  603
             D F +AC  +  T NCP  P PD DFG++P +L+ + +G  R ++   QKSG   A D D
Sbjct  381   DAFVVACYAADKT-NCPDDPGPDHDFGQSP-ILATLHDG--RRVLAIAQKSGVVHAFDPD  436

Query  602   N-GEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNV--TIGGGWV  432
             + G++ W T  G GG +GG  WG+A D ER+Y  +ANS+ + FT   ++ +  T GGG  
Sbjct  437   DGGKIQWQTRIGKGGPLGGSEWGSAADGERIY--VANSD-VRFTRDGTRQLDSTQGGGLF  493

Query  431   AMDAQTGKILWSTAVPDTG--------LSNPVTVANGVLFAGSVHPRGPVFAINAKTGEI  276
              +D  TGK++        G        LS  V++  GV+F+G V      +A +   G++
Sbjct  494   GLDLATGKVVMQVPPVACGERLQCSPALSAAVSLIPGVVFSGGVSGFLRAYATD---GKL  550

Query  275   LWSYYT--------GATVYGGM------SVSNGCVYVGNGY  195
             LW + T        G   +GG        ++ G VY  +GY
Sbjct  551   LWEFDTARDFKAVNGIPAHGGAIDGPGPVIAGGMVYTNSGY  591



>ref|WP_018322182.1| cytochrome CBB3 [Bradyrhizobium sp. WSM2793]
Length=610

 Score =   188 bits (478),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 170/522 (33%), Positives = 253/522 (48%), Gaps = 89/522 (17%)
 Frame = -1

Query  1637  NWLNHGGDIYNRRYACGENK-ISPSTVSKLKLKWEF-YAGKDIS-ATPAILKGVVYFPSW  1467
              W   G D  N R+   +   ++   V +L+LKW + + G  +S A P I+ G+++    
Sbjct  118   RWNGWGVDTNNSRFQPADMAGLTAEQVPRLRLKWAYAFPGASVSFAPPTIVGGMLFIGGT  177

Query  1466  NGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAV  1287
             +  ++A++A  G  LW         ++A VR     AI     P      +  G    A 
Sbjct  178   DRKVHALDARSGCTLWT------LAIDAAVRA----AISFAPLPGSDQFAIFFGDL-RAN  226

Query  1286  VIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGS-SKA--HCCTFRG  1116
             V  V   TG L+W T ++ H A  IT + T ++G  YV  SS+EE + S+A   CCTFRG
Sbjct  227   VYAVNALTGALIWKTKVEEHAAARITGAPTLHSGVLYVPVSSIEEAAGSQASYECCTFRG  286

Query  1115  RFAKLDVWTGKVLWQTFMLPD-----NKGKRGEY----AGAAIWGSSPSIDAHRGHVYIA  963
                 LD  TGK++WQ + +P+      K  RG      +GAAIW S+P+IDA RG VY+A
Sbjct  287   SVVALDAATGKLVWQAYTIPEVPHPTGKSARGTQLFGPSGAAIW-SAPTIDAKRGAVYVA  345

Query  962   TGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGY  783
             T N YS P                         P   +D+ILA +L TGK+ W +Q    
Sbjct  346   TSNSYSNP-------------------------PAATADAILAFELATGKLLWKQQATPK  380

Query  782   DVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRD  603
             D F +AC  +  + NCP    PD DFG++P+++++      R ++V  QKSG   ALD D
Sbjct  381   DAFVVACFTADKS-NCPEDHGPDHDFGQSPILVTLR---DGRRMLVIAQKSGVVHALDPD  436

Query  602   N-GEMVWYteagpggfvgggtwgaaTDNERVYTSIANSN-RLNFTLLPSKNVTIGGGWVA  429
             + G+++W T  G GG +GG  WG+A D ER+Y  +ANS+ R         + T GGG   
Sbjct  437   DGGKILWQTRIGKGGALGGSEWGSAADGERIY--VANSDVRFMRDGTRQLDSTQGGGLFG  494

Query  428   MDAQTGKILWSTAVP----------DTGLSNPVTVANGVLFAGSVHPRGPVFAINAKTGE  279
             +D  +GKI  +  VP             LS  V++  GV+F+G V      +A +   G+
Sbjct  495   LDLASGKI--AMEVPPVACGDRPKCSPALSAAVSLIPGVVFSGGVSGFLRAYATD---GK  549

Query  278   ILWSYYT--------GATVYGGM------SVSNGCVYVGNGY  195
             +LW + T        G   +GG        ++ G +Y  +GY
Sbjct  550   LLWEFDTAQDFKAVNGVPAHGGAIDGPGPVIAGGMLYTNSGY  591



>ref|WP_035726524.1| cytochrome Cbb3, partial [Bradyrhizobium elkanii]
Length=503

 Score =   186 bits (472),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 179/553 (32%), Positives = 263/553 (48%), Gaps = 101/553 (18%)
 Frame = -1

Query  1658  FSCPASG-NWLNHGGDIYNRRYA-CGENKISPSTVSKLKLKWEF-YAGKDIS-ATPAILK  1491
             F  P  G  W   G DI N R+       ++P  V +L+LKW F + G   + A P I+ 
Sbjct  2     FPHPLDGPRWNGWGADINNSRFQPAAMAGLTPDQVPRLRLKWAFGFPGASAANAQPTIVG  61

Query  1490  GVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLI  1311
             G+++    +  +YA++A  G + WE   +      A VRT     ++S +  S V     
Sbjct  62    GLLFVGGGDRKVYALDAKSGCIRWEFATE------AVVRTAISVGLLSGTDQSAV-----  110

Query  1310  IGIYGP--AVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA  1137
                +G   A    +   TG LLW T ++ HPA  I  + T ++   YV  SS EE +   
Sbjct  111   --FFGDVHANAYALNATTGALLWKTKVEDHPAARIVGAPTLHSSVLYVPVSSFEEATGSK  168

Query  1136  ---HCCTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEY---------AGAAIWGSSPSI  993
                 CCTFR     L+  TG  +W+ + +P+      +          +GAA+W S+P+I
Sbjct  169   PDYQCCTFRDSVVALESATGSQIWKAYTIPEAPRPTKQNVIGTQLYGPSGAAVW-SAPTI  227

Query  992   DAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGK  813
             D  R  +Y+ATGN YS P                         P   SD+ILA DL TG+
Sbjct  228   DVQRQALYVATGNSYSNP-------------------------PAETSDAILAFDLATGR  262

Query  812   IKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQK  633
             + W RQ+  +D + + C+ +  T NCP    PD+DFG++P+++S + NG  + ++   QK
Sbjct  263   MLWHRQVTPHDSYVVGCLGADQT-NCPEDRGPDSDFGQSPILVS-LRNG--QRVLAVGQK  318

Query  632   SGFAWALDRDN-GEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKN  456
             SG   ALD D  G+++W T  G GG +GG  WG+A D ERVY  +ANS   +   LP   
Sbjct  319   SGVVHALDPDQEGKILWQTRIGKGGPLGGIMWGSAADEERVY--VANS---DLRFLPDGT  373

Query  455   VTI----GGGWVAMDAQTGKI-LWSTAVP-------DTGLSNPVTVANGVLFAGSVHPRG  312
             +++    GGG  A+D  TGKI +  + VP          LS  VTV  GV+F+G V   G
Sbjct  374   MSLDPSAGGGLFALDLATGKISMQVSPVPCGHRSRCSPALSAAVTVIPGVVFSGGVS--G  431

Query  311   PVFAINAKTGEILWSYYTG---ATVYG-----------GMSVSNGCVYVGNGYRVSIGAG  174
              + A       +LW   T    ATV G           G ++  G +YV +GY  +  +G
Sbjct  432   YLRAYATADARLLWEIDTARKYATVNGVSANGGAMDGPGPTIVGGMLYVASGY--AQWSG  489

Query  173   IPIFTGGTSLFAF  135
             +P    G  L AF
Sbjct  490   LP----GNVLLAF  498



>ref|WP_035113987.1| hypothetical protein [Fischerella sp. PCC 9339]
Length=522

 Score =   186 bits (472),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 172/564 (30%), Positives = 250/564 (44%), Gaps = 121/564 (21%)
 Frame = -1

Query  1637  NWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEF-YAGKDI-SATPAILKGVVYFPSWN  1464
             +W + G DI N R+   E  I    ++KL+L W F + G  I S+ PA++   +Y  SWN
Sbjct  16    DWSSWGHDILNSRFNLLERTIRLDNLNKLQLAWAFVFPGTTIASSQPAVVGNTLYVGSWN  75

Query  1463  GYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIV------GETLIIGI  1302
             G  YA+NA  G L W  N  + TG        NVT  V R+ P++       G+TL    
Sbjct  76    GVFYALNARTGELKWSYNTTEFTG----SLPSNVTNSV-RNGPAVAEGRVHFGDTL----  126

Query  1301  YGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEG---SSKAHC  1131
                  +  +  ATG L+W   +D HP+  IT S   + G  Y G SS +          C
Sbjct  127   ---GNLYTLNAATGALIWAKRIDSHPSARITSSPIVWQGRLYQGVSSFDSVYAIDPTYPC  183

Query  1130  CTFRGRFAKLDVWTGKVLWQTFMLPDNKGKRGEY---------AGAAIWGSSPSIDAHRG  978
             C+FRG    LD   G  LW+ + +  +    G           +GA+IW S+P+++   G
Sbjct  184   CSFRGSMVALDAANGTELWRYYTISQSAELTGVNEIGTPQFGPSGASIW-STPALNPLTG  242

Query  977   HVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFR  798
              +Y  T   YS P                           + SD+++ALD  TG+ +W  
Sbjct  243   LLYFGTSQNYSNPA-------------------------TDRSDALIALDALTGQQRWAI  277

Query  797   QLGGYDVFFIAC------INSSSTPNCPPG--PNPDADFGEAPMMLSVVVNGSTRDIVVA  642
             QL   D + ++C      + S +T NCP     N D DFG +P +     NG  R +V A
Sbjct  278   QLTPNDRWNLSCNPELVGLPSDATANCPTPRVDNYDFDFGASPNLFLAYHNGQLRTLVGA  337

Query  641   VQKSGFAWALDRDNGEMVWYteagpggfvgggtwg--aaTDNERVY--TSIANSNRLNFT  474
              QKSG   ALD   GE++W T+   GG  G G     ++ D +R+Y  T+ AN   LN  
Sbjct  338   GQKSGIYHALDAATGEIIWQTQLSIGGTSGIGGIQWGSSWDGKRLYVATNRANPGSLN--  395

Query  473   LLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTGLSNPVTVAN---------------GVL  339
                           A+D  TG++LWST  P  G + P T+ +               G++
Sbjct  396   --------------ALDPGTGQVLWSTNNPANGCNTPNTIGDPSCYLAMPSATSSIPGLV  441

Query  338   FAGSVHPRGPVFAINAKTGEILWSYYT--------------GATVYGGMSVSNGCVYVGN  201
             F GS+   G + A N++TG I+W Y T              G+   GG ++ NG +Y+ +
Sbjct  442   FQGSLD--GKLRAFNSRTGAIVWEYDTRRSFVGTNGLVGQGGSIDSGGATIVNGMLYINS  499

Query  200   GYRVSIGAGIPIFTGGTSLFAFCL  129
             GY  S   G+     G  L AF L
Sbjct  500   GYYQSASTGM----AGNVLLAFGL  519



>ref|WP_007611725.1| cytochrome CBB3 [Bradyrhizobium sp. WSM471]
 gb|EHR04161.1| glucose dehydrogenase [Bradyrhizobium sp. WSM471]
Length=612

 Score =   187 bits (474),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 172/542 (32%), Positives = 258/542 (48%), Gaps = 87/542 (16%)
 Frame = -1

Query  1697  ISATAKPEWHITRFSCPASG-NWLNHGGDIYNRRYA-CGENKISPSTVSKLKLKWEF-YA  1527
             + A  +    +  F  P  G  W   G D  N R+   G   ++   V +L+LKW + + 
Sbjct  98    VDAEGRCTQQLNFFPQPLDGPRWNGWGVDAGNSRFQPAGMAGLTAEEVPRLRLKWAYAFP  157

Query  1526  GKDIS-ATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIV  1350
             G  +S A P I+ G+++    +  ++A++A  G  LW          +A VR     AI 
Sbjct  158   GASVSFAPPTIVGGLLFIGGTDRKVHALDARSGCTLWTLPT------DAAVRA----AIS  207

Query  1349  SRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVG  1170
                 P      +  G    A    V   TG L+W T ++ HPA  IT + T ++G  YV 
Sbjct  208   FGPLPGTDRFAIFFGDL-RANAYAVNALTGALIWKTKIEEHPAARITGAPTLHSGVLYVP  266

Query  1169  TSSLEEGS-SKA--HCCTFRGRFAKLDVWTGKVLWQTFMLPD-----NKGKRGEY----A  1026
              SSLEE + S+A   CCTFRG    L+  TGK +WQ + +P+      K  RG      +
Sbjct  267   VSSLEEAAGSQASYECCTFRGSVVALEAVTGKQVWQAYTIPEVPHPTGKNARGTQLFGPS  326

Query  1025  GAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSD  846
             GAA+W S+P+ID  R  VY+AT N YS P                         P   +D
Sbjct  327   GAAVW-SAPTIDPKRNAVYVATSNSYSNP-------------------------PAATAD  360

Query  845   SILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNG  666
             ++LA +L TGK+ W +Q    D F +AC  +  T NCP    PD DFG++P+++++    
Sbjct  361   AVLAFELATGKLLWKQQATPSDAFIVACFGADKT-NCPEDHGPDHDFGQSPILVTLR---  416

Query  665   STRDIVVAVQKSGFAWALDRDN-GEMVWYteagpggfvgggtwgaaTDNERVYTSIANSN  489
               R ++   QKSG   ALD D+ G+++W T  G GG +GG  WG+A D +R+Y  +ANS+
Sbjct  417   DGRRVLAIAQKSGVVHALDPDDGGKILWQTRIGKGGALGGSEWGSAADQDRIY--VANSD  474

Query  488   RLNFTLLPSKNV--TIGGGWVAMDAQTGKILWSTAVPDTG--------LSNPVTVANGVL  339
              + F    ++ +  T GGG   +D  +GKI    +    G        LS  V++  GV+
Sbjct  475   -VRFLRDGTRRLDSTQGGGLFGLDLASGKIAMEVSPVACGDRLQCSPALSAAVSLIPGVV  533

Query  338   FAGSVHPRGPVFAINAKTGEILWSYYT--------GATVYGGM------SVSNGCVYVGN  201
             F+G V   G + A     G++LW Y T        GA  +GG        ++ G +Y  +
Sbjct  534   FSGGVS--GFLRAYATADGKLLWEYDTARDYTTVNGAAAHGGAIDGPGPIIAGGMLYTNS  591

Query  200   GY  195
             GY
Sbjct  592   GY  593



>ref|WP_027554611.1| cytochrome Cbb3 [Bradyrhizobium sp. Cp5.3]
Length=611

 Score =   186 bits (472),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 171/523 (33%), Positives = 258/523 (49%), Gaps = 90/523 (17%)
 Frame = -1

Query  1637  NWLNHGGDIYNRRYACGENK-ISPSTVSKLKLKWEF-YAGKDIS-ATPAILKGVVYFPSW  1467
              W   G D  N R+   E   +S   V +L+LKW + + G  +S A P ++ G+++    
Sbjct  118   RWNGWGVDTSNSRFQPTEMAGLSAEQVPRLRLKWAYAFPGASLSFAPPTVVGGLLFIGGT  177

Query  1466  NGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYG--P  1293
             +  + A++A  G  LW          +A VR        + S   + G       +G   
Sbjct  178   DRKVRALDAKTGCTLWT------FATDAAVR-------AAISFAPLAGTDRFAIFFGDLK  224

Query  1292  AVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEE--GSSKAH-CCTF  1122
             A    V   TG L+W   ++ HPA  IT + T ++G  YV  SS+EE  GS  ++ CCTF
Sbjct  225   ANAYAVNALTGALIWKVKVEEHPAARITGAPTLHSGVLYVPVSSIEEVAGSQPSYECCTF  284

Query  1121  RGRFAKLDVWTGKVLWQTFMLPD-----NKGKRGEY----AGAAIWGSSPSIDAHRGHVY  969
             RG    LD  TGK  WQ + +P+      K  +G      +GA++W S+P+IDA R  VY
Sbjct  285   RGSVVALDAATGKTGWQAYTIPEVPHPTEKNAKGTQLFGPSGASVW-SAPTIDAKRNAVY  343

Query  968   IATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLG  789
             +AT N YS P                         P   +D+ILALD+ TGK+ W +Q  
Sbjct  344   VATSNSYSNP-------------------------PSATADAILALDIATGKLLWKQQAT  378

Query  788   GYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALD  609
               D + +AC  +  T NCP    PD DFG++P++++  ++   R +V+A QKSG   ALD
Sbjct  379   PKDAYIVACYGADKT-NCPEDHGPDHDFGQSPILVN--LHDGKRLLVIA-QKSGVVHALD  434

Query  608   RDN-GEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNV--TIGGG  438
              D+ G+++W T  G GG +GG  WG+A D +R+Y  +ANS+ + F    ++ +  T GGG
Sbjct  435   PDDGGKILWQTRVGKGGALGGSEWGSAADGKRIY--VANSD-VRFLRDGTRRLDSTQGGG  491

Query  437   WVAMDAQTGKI-LWSTAVP-------DTGLSNPVTVANGVLFAGSVHPRGPVFAINAKTG  282
                +D +TGKI +    VP          LS  V++  GV+F+GSV   G + A  A  G
Sbjct  492   LFGLDLETGKIEMEVPPVPCGDRPQCSPALSAAVSLIPGVVFSGSVS--GFLRAYAAADG  549

Query  281   EILWSYYT--------GATVYGGM------SVSNGCVYVGNGY  195
             ++LW + T        G   YGG        +++G +Y  +GY
Sbjct  550   KLLWEFDTAQDYTAVNGIPAYGGAIDGPGPVIADGMLYTNSGY  592



>dbj|BAE98075.1| putative polyvinylalcohol dehydrogenase [Streptoalloteichus hindustanus]
Length=561

 Score =   185 bits (470),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 167/561 (30%), Positives = 249/561 (44%), Gaps = 112/561 (20%)
 Frame = -1

Query  1643  SGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYA--------GKDISA--TPAIL  1494
             + +W     D+   R    E +I+P  V  L+LKW F          G  ++A   PA++
Sbjct  58    AADWPTWQKDLSGSRSNRAERRITPDNVENLRLKWAFTHPQPKGLPDGVRLTARSQPAVV  117

Query  1493  KGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETL  1314
              GV YF S +G  YAVNA  G   WE +L ++   +        TA+  R++P++ G  +
Sbjct  118   NGVAYFGSTDGKFYAVNARTGKTKWELDLNEVNSGSG------FTAV--RNSPAVSGGKI  169

Query  1313  IIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEE-GSSKA  1137
               G Y    +  V + +G+L+W T +D HP GL T S   + G  YVG SS E  G  + 
Sbjct  170   FFGDYA-GHLYAVDQKSGELVWSTKIDNHPQGLTTSSPIVHGGRVYVGVSSAENTGGIET  228

Query  1136  HCCTFRGRFAKLDVWTGKVLWQTFMLPD--------NKGKRGEYAGAAIWGSSPSIDAHR  981
              CCTFRG    LD  TG ++W+ + +P+        N   R E +G  +W SSP ID   
Sbjct  229   ACCTFRGHVDALDANTGALVWRHYTVPEAKAVGTWPNGATRYEPSGGGVW-SSPVIDPST  287

Query  980   GHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWF  801
               +Y+ TG  Y+                            E  +D++LALD+  G+++W 
Sbjct  288   RTLYVGTGQNYTG--------------------------KEGETDTVLALDIANGEVRWK  321

Query  800   RQLGGYDVFFIACINSSSTPNCPPGPNP----DADFGEAPMMLSVVVNGSTRDIVVAVQK  633
             RQ+   DV+   C + S+ P   PG       D DFG  P + S   NG  R +V   QK
Sbjct  322   RQMTFPDVWRQVCADPSAPPGYCPGAKEGAALDYDFGAMPNIFS--ANG--RKLVGIGQK  377

Query  632   SGFAWALDRDNGEMVWYteagp---ggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPS  462
             +G     D   GE+VW  + G     G VGG  WGA+ D +R+Y +   ++         
Sbjct  378   NGMYHVFDAHTGEVVWQRQLGKPWPNGGVGGIQWGASYDGKRLYVATWFADP--------  429

Query  461   KNVTIGGGWVAMDAQTGKILWSTAVPDTGLSN----------------PVTVANGVLFAG  330
                   G   A+D  TG+ LW T  P  G S                  V+ + G+++ G
Sbjct  430   ------GSLFALDPATGRTLWETKHPANGCSTGGAAKHPEVCALANTPAVSTSPGLVYEG  483

Query  329   SVHPRGPVFAINAKTGEILWSYYT-------------GATVYGGMSVSNGCVYVGNGYRV  189
             S    G + A +A+ G++LW + T             G  + GG  +++G +YV +GY  
Sbjct  484   SAD--GKMRAYSAENGKVLWEFDTIREFQGVNGLTGHGQGISGGAVIADGVLYVNSGYFG  541

Query  188   SIGAGIPIFTGGTSLFAFCLE  126
               G   P    G+ L AF L 
Sbjct  542   QYGRFYPT-DKGSVLLAFSLR  561



>ref|WP_038943595.1| cytochrome Cbb3 [Bradyrhizobium japonicum]
Length=610

 Score =   185 bits (469),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 169/532 (32%), Positives = 254/532 (48%), Gaps = 86/532 (16%)
 Frame = -1

Query  1670  HITRFSCPASG-NWLNHGGDIYNRRYACGENK-ISPSTVSKLKLKWEF-YAGKDIS-ATP  1503
              I+ F  P  G  W   G D+ N R+   +   ++ + V +L+LKW + + G  +S A P
Sbjct  106   QISGFPQPLDGPRWNGWGVDLNNSRFQPADMAGLTAAQVPRLRLKWAYAFPGASVSFAPP  165

Query  1502  AILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVG  1323
              I+ G+++    +  ++A++A  G  LW         ++A VR     AI     P    
Sbjct  166   TIMGGLLFIGGTDRKVHALDARTGCTLWT------FAIDAAVRA----AITVAPLPGSDQ  215

Query  1322  ETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGS-  1146
               +  G    A    V   TG L+W T ++ HPA  IT +   ++G  YV  SSLEE + 
Sbjct  216   FAIFFGDL-RANAYAVNALTGALIWKTKVEEHPAARITGAPVLHSGVLYVPVSSLEEAAG  274

Query  1145  SKA--HCCTFRGRFAKLDVWTGKVLWQTFMLPD-----NKGKRGEY----AGAAIWGSSP  999
             S+A   CCTFRG    LD  TGK +WQ + +P+     +K  RG      +GAAIW S+P
Sbjct  275   SQASYECCTFRGSVVALDAATGKPVWQAYTIPEVPHPTDKNARGVQLFGPSGAAIW-SAP  333

Query  998   SIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDT  819
             +ID  RG +Y+AT N YS P                         P   SD+ILA +L T
Sbjct  334   TIDVKRGAIYVATSNSYSNP-------------------------PSATSDAILAFELAT  368

Query  818   GKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAV  639
             GK+ W RQ    D + +AC     T NCP    PD DFG++P+++++      R ++   
Sbjct  369   GKLLWSRQATPKDAYVVACYGVDKT-NCPEDHGPDHDFGQSPILVTLR---DGRRVLAIA  424

Query  638   QKSGFAWALDRDN-GEMVWYteagpggfvgggtwgaaTDNERVYTSIANSN-RLNFTLLP  465
             QKSG   ALD D+ G+++W T  G GG +GG  WG+A D +R+Y  +ANS+ R       
Sbjct  425   QKSGVVHALDPDDGGKILWQTRIGKGGALGGSEWGSAADQDRIY--VANSDVRFLGDGTR  482

Query  464   SKNVTIGGGWVAMDAQTGKILWSTAVPDTG--------LSNPVTVANGVLFAGSVHPRGP  309
               + T GGG   +D  +G ++        G        LS  V++  GV+F+G V     
Sbjct  483   RLDSTQGGGLFGLDLASGTVVMEVPPVACGDRLQCSPALSAAVSLIPGVVFSGGVSGFLR  542

Query  308   VFAINAKTGEILWSYYT--------GATVYGGM------SVSNGCVYVGNGY  195
              +A ++K   +LW + T        G   +GG        ++ G +Y  +GY
Sbjct  543   AYASDSK---LLWEFDTAQDYKAVNGVPAHGGAIDGPGPVIAGGMLYTNSGY  591



>ref|WP_027549085.1| cytochrome Cbb3 [Bradyrhizobium sp. WSM2254]
Length=612

 Score =   185 bits (469),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 171/541 (32%), Positives = 256/541 (47%), Gaps = 85/541 (16%)
 Frame = -1

Query  1697  ISATAKPEWHITRFSCPASG-NWLNHGGDIYNRRYACGENK-ISPSTVSKLKLKWEF-YA  1527
             I A  +    ++ F  P  G  W   G D  N R+   +   ++   V +L+LKW + + 
Sbjct  98    IDAQGRCAQQVSAFPEPLDGPRWNGWGVDAGNSRFQPADMAGLTAEEVPRLRLKWAYAFP  157

Query  1526  GKDIS-ATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIV  1350
             G  +S A P I+ G+++    +  ++A++A  G  LW          +A VR     AI 
Sbjct  158   GASVSFAPPTIVGGLLFIGGTDRKVHALDARSGCTLWTLPT------DAAVRA----AIS  207

Query  1349  SRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVG  1170
                 P      +  G    A    V   TG L+W T ++ HPA  IT + T ++G  YV 
Sbjct  208   FAPLPGTDQFAIFFGDL-RANAYAVNALTGTLIWKTKVEEHPAARITGAPTLHSGVLYVP  266

Query  1169  TSSLEEGS-SKA--HCCTFRGRFAKLDVWTGKVLWQTFMLPD-----NKGKRGEY----A  1026
              SSLEE + S+A   CCTFRG    L+  TGK +WQ + +P+     +K  RG      +
Sbjct  267   VSSLEEAAGSQASYECCTFRGSVVALEAVTGKPVWQAYTIPEVPHPTSKNTRGTQLFGPS  326

Query  1025  GAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSD  846
             GAA+W S+P+ID  R  VY+AT N YS P                         P   +D
Sbjct  327   GAAVW-SAPTIDPKRNAVYVATSNSYSNP-------------------------PAATAD  360

Query  845   SILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNG  666
             +ILA +L TGK+ W +Q    D F +AC  +  T NCP    PD DFG++P+++++    
Sbjct  361   AILAFELATGKLLWKQQATPKDAFIVACYGADRT-NCPDEHGPDHDFGQSPILVTLR---  416

Query  665   STRDIVVAVQKSGFAWALDRDN-GEMVWYteagpggfvgggtwgaaTDNERVYTSIANSN  489
               R ++   QKSG   ALD D+ G+++W T  G GG +GG  WG+A D +R+Y  +ANS+
Sbjct  417   DGRRVLAIAQKSGVVHALDPDDGGKILWQTRVGKGGALGGSEWGSAADQDRIY--VANSD  474

Query  488   -RLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTG--------LSNPVTVANGVLF  336
              R         + T GGG   +D  +GKI    +    G        LS  V++  GV+F
Sbjct  475   VRFLHDGTRRLDSTQGGGLFGLDLASGKIAMEVSPVACGDRLQCSPALSAAVSLIPGVVF  534

Query  335   AGSVHPRGPVFAINAKTGEILWSYYT--------GATVYGGM------SVSNGCVYVGNG  198
             +G V   G + A     G++LW + T        G   +GG        ++ G +Y  +G
Sbjct  535   SGGVS--GFLRAYATADGKLLWEFDTARDYTAVNGVPAHGGAIDGPGPVIAGGMLYTNSG  592

Query  197   Y  195
             Y
Sbjct  593   Y  593



>ref|WP_026232942.1| cytochrome Cbb3 [Bradyrhizobium sp. WSM4349]
Length=612

 Score =   184 bits (468),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 170/541 (31%), Positives = 254/541 (47%), Gaps = 85/541 (16%)
 Frame = -1

Query  1697  ISATAKPEWHITRFSCPASG-NWLNHGGDIYNRRYACGENK-ISPSTVSKLKLKWEF-YA  1527
             + A  +    +  F  P  G  W   G D  N R+   E   ++   V +L+LKW + + 
Sbjct  98    VDAEGRCTQQVNFFPQPLDGPRWNGWGVDAANSRFQSTEMAGLTAEEVPRLRLKWAYAFP  157

Query  1526  GKDIS-ATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIV  1350
             G  +S A P I+ G+++    +  ++A++A  G   W          +A VR     AI 
Sbjct  158   GASVSFAPPTIVGGLLFIGGTDRKVHALDARSGCTRWTLPT------DAAVRA----AIS  207

Query  1349  SRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVG  1170
                 P      +  G    A    V   TG L+W T ++ HPA  IT + T ++G  Y+ 
Sbjct  208   FGPLPGTDQFAIFFGDL-RANAYAVNALTGALIWKTKVEEHPAARITGAPTLHSGVLYIP  266

Query  1169  TSSLEEGS-SKA--HCCTFRGRFAKLDVWTGKVLWQTFMLPD-----NKGKRGEY----A  1026
              SSLEE + S+A   CCTFRG    L+  TGK +WQ + +P+      K  RG      +
Sbjct  267   VSSLEEAAGSQASYECCTFRGSVVALEAVTGKPVWQAYTIPEVAHPTGKNARGTQLFGPS  326

Query  1025  GAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSD  846
             GAA+W S+P+ID  R  VY+AT N YS P                         P   +D
Sbjct  327   GAAVW-SAPTIDPKRNAVYVATSNSYSNP-------------------------PAATAD  360

Query  845   SILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNG  666
             ++LA +L TGK+ W +Q    D F +AC  +  T NCP    PD DFG++P+++++    
Sbjct  361   AVLAFELATGKLLWKQQATPSDAFIVACFGADKT-NCPEDHGPDHDFGQSPILVTLR---  416

Query  665   STRDIVVAVQKSGFAWALDRDN-GEMVWYteagpggfvgggtwgaaTDNERVYTSIANSN  489
               R ++   QKSG   ALD D+ G+++W T  G GG +GG  WG+A D +R+Y  +ANS+
Sbjct  417   DGRRVLAIAQKSGVVHALDPDDGGKILWQTRIGKGGALGGSEWGSAADQDRIY--VANSD  474

Query  488   -RLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVPDTG--------LSNPVTVANGVLF  336
              R         + T GGG   +D  +GKI    +    G        LS  V++  GV+F
Sbjct  475   VRFLRDGTRRLDATQGGGLFGLDLASGKIAMEVSPVACGDRLQCSPALSAAVSLIPGVVF  534

Query  335   AGSVHPRGPVFAINAKTGEILWSYYT--------GATVYGGM------SVSNGCVYVGNG  198
             +G V   G + A     G++LW Y T        GA  +GG        ++ G +Y  +G
Sbjct  535   SGGVS--GFLRAYATADGKLLWEYDTARDYTTVNGAPAHGGAIDGPGPIIAGGMLYTNSG  592

Query  197   Y  195
             Y
Sbjct  593   Y  593



>ref|WP_026312652.1| cytochrome Cbb3 [Bradyrhizobium japonicum]
Length=611

 Score =   184 bits (468),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 173/537 (32%), Positives = 255/537 (47%), Gaps = 85/537 (16%)
 Frame = -1

Query  1637  NWLNHGGDIYNRRYACGENK-ISPSTVSKLKLKWEF-YAGKDIS-ATPAILKGVVYFPSW  1467
             +W   G D+ N R+   +   ++   V  L+LKW + + G  +S A P I+ GV++    
Sbjct  119   HWNGWGVDLNNSRFQPADMAGLTAEQVPHLRLKWAYAFPGASVSFAPPTIMGGVLFIGGT  178

Query  1466  NGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGP--  1293
             +  ++A++A  G  LW                G V A +S +   + G    +  +G   
Sbjct  179   DRKVHALDARSGCTLWT-----------FATDGAVRAAISFA--QLPGSDQFVVFFGDLR  225

Query  1292  AVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSSKA---HCCTF  1122
             A    V   TG L+W T ++ H A  IT + T ++G  YV  SSLEE +       CCTF
Sbjct  226   ANAYAVNALTGALIWKTKVEEHAAARITGAPTLHSGVLYVPVSSLEEAAGSQPSYECCTF  285

Query  1121  RGRFAKLDVWTGKVLWQTFMLPD-----NKGKRGEY----AGAAIWGSSPSIDAHRGHVY  969
             RG    L   TGK++WQ + +P+     +K  RG      +GAAIW S+P+ID  R  VY
Sbjct  286   RGSVVALQAATGKLVWQAYTIPEVPHPTSKNARGTQLFGPSGAAIW-SAPTIDPKRNAVY  344

Query  968   IATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLG  789
             +AT N YS P                         P   +D+ILA +L TGK+ W +Q  
Sbjct  345   VATSNSYSNP-------------------------PAATADAILAFELGTGKLLWKQQAT  379

Query  788   GYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALD  609
               D + +AC  +  T NCP    PD DFG++P +L+ + +G  R ++   QKSG   ALD
Sbjct  380   PKDAYVVACYGADKT-NCPDDHGPDHDFGQSP-ILATLHDG--RRVLAIAQKSGVVHALD  435

Query  608   RDN-GEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNV--TIGGG  438
              D+ G+++W T  G GG +GG  WG+A D ER+Y  +ANS+ + FT   ++ +  T GGG
Sbjct  436   PDDGGKILWQTRIGKGGALGGSEWGSAADGERIY--VANSD-VRFTRDGTRQLDSTQGGG  492

Query  437   WVAMDAQTGKILWST-AVP-------DTGLSNPVTVANGVLFAGSVHPRGPVFAINAKTG  282
                +D  +GKI      VP          LS  V++  GV+F+GSV      +A +   G
Sbjct  493   LFGLDLASGKIAMEVPPVPCGDRRQCSPALSAAVSLIPGVVFSGSVSGFLRAYATD---G  549

Query  281   EILWSYYT--------GATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAF  135
             ++LW + T        G   +GG     G V  G     + G G      G  L AF
Sbjct  550   KLLWEFDTAQDFKAVNGVPAHGGAIDGPGPVIAGGMLYTNAGYGQWSGVAGNVLLAF  606



>ref|WP_028141086.1| MULTISPECIES: cytochrome Cbb3 [Bradyrhizobium]
Length=610

 Score =   184 bits (466),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 168/522 (32%), Positives = 250/522 (48%), Gaps = 89/522 (17%)
 Frame = -1

Query  1637  NWLNHGGDIYNRRYACGENK-ISPSTVSKLKLKWEF-YAGKDIS-ATPAILKGVVYFPSW  1467
              W   G D  N R+   +   ++   V +L+LKW + + G  +S A P I+ G+++    
Sbjct  118   RWNGWGVDTNNSRFQPADMAGLTAEQVPRLRLKWAYAFPGASVSFAPPTIVGGMLFIGGT  177

Query  1466  NGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAV  1287
             +  ++A++A  G  LW         ++A VR     AI     P      +  G    A 
Sbjct  178   DRKMHALDARSGCTLWT------LAIDAAVRA----AISFAPLPGSDQFAIFFGDL-RAN  226

Query  1286  VIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGS-SKA--HCCTFRG  1116
                V   TG L+W T ++ H A  IT + T ++G  YV  SSLEE + S+A   CCTFRG
Sbjct  227   AYAVNALTGALIWKTKVEEHAAARITGAPTLHSGVLYVPVSSLEEAAGSQASYECCTFRG  286

Query  1115  RFAKLDVWTGKVLWQTFMLPD-----NKGKRGEY----AGAAIWGSSPSIDAHRGHVYIA  963
                 LD  TGK++WQ + +P+      K  RG      +GAAIW S+P+ID  R  VY+A
Sbjct  287   SVVALDAATGKLVWQAYTIPEVPHPTGKNARGTQLFGPSGAAIW-SAPTIDVKRNAVYVA  345

Query  962   TGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGY  783
             T N YS P                         P   +D+ILA +L TGK+ W +Q    
Sbjct  346   TSNSYSNP-------------------------PAATADAILAFELGTGKLLWKQQATPK  380

Query  782   DVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRD  603
             D F +AC  +  + NCP    PD DFG++P+++++      R ++V  QKSG   ALD D
Sbjct  381   DAFVVACFTADKS-NCPEDHGPDHDFGQSPILVALR---DGRRVLVIAQKSGVVHALDPD  436

Query  602   N-GEMVWYteagpggfvgggtwgaaTDNERVYTSIANSN-RLNFTLLPSKNVTIGGGWVA  429
             + G+++W T  G GG +GG  WG+A D ER+Y  +ANS+ R         + T GGG   
Sbjct  437   DGGKILWQTRIGKGGALGGSEWGSAADGERIY--VANSDVRFMRDGTRQLDSTQGGGLFG  494

Query  428   MDAQTGKILWSTAVP----------DTGLSNPVTVANGVLFAGSVHPRGPVFAINAKTGE  279
             +D  +GKI  +  VP             LS  V++  GV+F+G V      +A +   G+
Sbjct  495   LDLVSGKI--AMEVPPVACGDRPKCSPALSAAVSLIPGVVFSGGVSGFLRAYATD---GK  549

Query  278   ILWSYYT--------GATVYGGM------SVSNGCVYVGNGY  195
             +LW + T        G   +GG        ++ G +Y  +GY
Sbjct  550   LLWEFDTAQDFKAVNGVPAHGGAIDGPGPVIAGGMLYTNSGY  591



>ref|WP_038972366.1| cytochrome Cbb3 [Bradyrhizobium sp. CCBAU 15635]
Length=610

 Score =   183 bits (465),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 168/522 (32%), Positives = 251/522 (48%), Gaps = 89/522 (17%)
 Frame = -1

Query  1637  NWLNHGGDIYNRRYACGENK-ISPSTVSKLKLKWEF-YAGKDIS-ATPAILKGVVYFPSW  1467
              W   G D  N R+   +   ++   V +L+LKW + + G  +S A P I+ G+++    
Sbjct  118   RWNGWGVDTNNSRFQPADMAGLTAEQVPRLRLKWAYAFPGASVSFAPPIIVGGMLFIGGT  177

Query  1466  NGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAV  1287
             +  ++A++A  G  LW         ++A VR     AI     P      +  G    A 
Sbjct  178   DRKVHALDARSGCTLWT------LAIDAAVRA----AISFAPLPGSDQFAIFFGDL-RAN  226

Query  1286  VIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGS-SKA--HCCTFRG  1116
                V   TG L+W T ++ H A  IT + T ++G  YV  SSLEE + S+A   CCTFRG
Sbjct  227   AYAVNALTGALIWKTKVEEHAAARITGAPTLHSGVLYVPVSSLEEAAGSQASYECCTFRG  286

Query  1115  RFAKLDVWTGKVLWQTFMLPD-----NKGKRGEY----AGAAIWGSSPSIDAHRGHVYIA  963
                 LD  TGK++WQ + +P+      K  RG      +GAAIW S+P+ID +R  VY+A
Sbjct  287   SVVALDAATGKLVWQAYTIPEVPHPTGKNARGTQLFGPSGAAIW-SAPTIDVNRNAVYVA  345

Query  962   TGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGY  783
             T N YS P                         P   +D+ILA +L TGK+ W +Q    
Sbjct  346   TSNSYSNP-------------------------PAATADAILAFELGTGKLLWKQQATPK  380

Query  782   DVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRD  603
             D F +AC  +  + NCP    PD DFG++P+++++      R ++V  QKSG   ALD D
Sbjct  381   DAFVVACFTADKS-NCPEDHGPDHDFGQSPILVTLR---DGRRVLVIAQKSGVVHALDPD  436

Query  602   N-GEMVWYteagpggfvgggtwgaaTDNERVYTSIANSN-RLNFTLLPSKNVTIGGGWVA  429
             + G+++W T  G GG +GG  WG+A D ER+Y  +ANS+ R         + T GGG   
Sbjct  437   DGGKILWQTRIGKGGALGGSEWGSAADGERIY--VANSDVRFMRDGTRQLDSTQGGGLFG  494

Query  428   MDAQTGKILWSTAVP----------DTGLSNPVTVANGVLFAGSVHPRGPVFAINAKTGE  279
             +D  +GKI  +  VP             LS  V++  GV+F+G V      +A +   G+
Sbjct  495   LDLVSGKI--AMEVPPVACGDRPKCSPALSAAVSLIPGVVFSGGVSGFLRAYATD---GK  549

Query  278   ILWSYYT--------GATVYGGM------SVSNGCVYVGNGY  195
             +LW + T        G   +GG        ++ G +Y  +GY
Sbjct  550   LLWEFDTAQDFKAVNGVPAHGGAIDGPGPVIAGGMLYTNSGY  591



>ref|XP_010661140.1| PREDICTED: uncharacterized protein LOC104881707 [Vitis vinifera]
Length=156

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 111/153 (73%), Gaps = 8/153 (5%)
 Frame = -1

Query  1643  SGNWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWN  1464
             S NWLNHGGD++NR++A  E KISP TVSKL LKW+F AGKDI+ATPAI    +YFPSWN
Sbjct  8     STNWLNHGGDLHNRKHASSETKISPETVSKLCLKWKFCAGKDITATPAIFNRTLYFPSWN  67

Query  1463  GYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVV  1284
              YL+AV A DGSL+WE+ LQ+LTGLNAT    NV   VS+STP+I  + LI+GIYG AVV
Sbjct  68    EYLHAVRALDGSLVWEQKLQELTGLNATGFINNVNLTVSKSTPTIASDMLIVGIYGLAVV  127

Query  1283  IGVKRATG--DLL-WMTLLDRHPAGLITMSGTY  1194
             + +    G   LL W+ +L      L+TMSGT+
Sbjct  128   VALDLQDGLCSLLGWIAVLL-----LVTMSGTF  155



>ref|WP_039147385.1| cytochrome Cbb3 [Bradyrhizobium japonicum]
 gb|AHY49696.1| polyvinyl-alcohol dehydrogenase [Bradyrhizobium japonicum SEMIA 
5079]
Length=610

 Score =   182 bits (463),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 164/531 (31%), Positives = 251/531 (47%), Gaps = 84/531 (16%)
 Frame = -1

Query  1670  HITRFSCPASG-NWLNHGGDIYNRRYACGENK-ISPSTVSKLKLKWEF-YAGKDIS-ATP  1503
              I+ F  P  G  W   G D+ N R+   +   ++ + V +L+LKW + + G  +S A P
Sbjct  106   QISGFPQPLDGPRWNGWGVDLNNSRFQPADMAGLTAAQVPRLRLKWAYAFPGASVSFAPP  165

Query  1502  AILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVG  1323
              I+ G+++    +  ++A++A  G  LW         ++A VR     AI     P    
Sbjct  166   TIMGGLLFIGGTDRKVHALDARTGCTLWT------FAIDAAVRA----AITVAPLPGSDQ  215

Query  1322  ETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGS-  1146
               +  G    A    V   TG L+W T ++ HPA  IT +   ++G  YV  SSLEE + 
Sbjct  216   FAIFFGDL-RANAYAVNALTGALIWKTKVEEHPAARITGAPVLHSGVLYVPVSSLEEAAG  274

Query  1145  SKA--HCCTFRGRFAKLDVWTGKVLWQTFMLPD-----NKGKRGEY----AGAAIWGSSP  999
             S+A   CCTFRG    L+  TGK +WQ + +P+     +K  +G      +GAAIW S+P
Sbjct  275   SQASYECCTFRGSVVALEAATGKPVWQAYTIPEVPHPTDKNAKGVQLFGPSGAAIW-SAP  333

Query  998   SIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDT  819
             +ID  RG +Y+AT N YS P                         P   SD+ILA DL T
Sbjct  334   TIDVKRGAIYVATSNSYSNP-------------------------PSATSDAILAFDLAT  368

Query  818   GKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAV  639
             GK+ W +Q    D + +AC     T NCP    PD DFG++P+++++      R ++   
Sbjct  369   GKLLWSQQATPKDAYVVACYGVDKT-NCPEDHGPDHDFGQSPILVTLR---DGRRVLAIA  424

Query  638   QKSGFAWALDRDN-GEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPS  462
             QKSG    LD D+ G+++W T  G GG +GG  WG+A D +R+Y +I++   L       
Sbjct  425   QKSGVVHGLDPDDGGKILWQTRIGKGGALGGSEWGSAADQDRIYVAISDVRFLRDGTR-R  483

Query  461   KNVTIGGGWVAMDAQTGKILWSTAVPDTG--------LSNPVTVANGVLFAGSVHPRGPV  306
              + T GGG  ++D  +G ++        G        LS  V++  GV+F+G V      
Sbjct  484   LDSTQGGGLFSLDLASGTVVMEVPPVACGDRLQCSPALSAAVSLIPGVVFSGGVS---GF  540

Query  305   FAINAKTGEILWSYYT--------GATVYGGM------SVSNGCVYVGNGY  195
                 A  G++LW + T        G   +GG        ++ G +Y  +GY
Sbjct  541   LRAYASDGKLLWEFDTAQDYKAVNGVPAHGGAIDGPGPVIAGGMLYTNSGY  591



>ref|WP_038950513.1| cytochrome Cbb3, partial [Bradyrhizobium sp. CCBAU 15544]
Length=476

 Score =   180 bits (456),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 163/501 (33%), Positives = 244/501 (49%), Gaps = 88/501 (18%)
 Frame = -1

Query  1577  ISPSTVSKLKLKWEF-YAGKDIS-ATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQ  1404
             ++   V +L+LKW + + G  +S A P I+ G+++    +  ++A++A  G  LW     
Sbjct  5     LTAEQVPRLRLKWAYAFPGASVSFAPPIIVGGMLFIGGTDRKVHALDARSGCTLWT----  60

Query  1403  KLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHP  1224
                 ++A VR     AI     P      +  G    A    V   TG L+W T ++ H 
Sbjct  61    --LAIDAAVRA----AISFAPLPGSDQFAIFFGDL-RANAYAVNALTGALIWKTKVEEHA  113

Query  1223  AGLITMSGTYYNGAFYVGTSSLEE--GSSKAH-CCTFRGRFAKLDVWTGKVLWQTFMLPD  1053
             A  IT + T ++G  YV  SSLEE  GS  ++ CCTFRG    LD  TGK++WQ + +P+
Sbjct  114   AARITGAPTLHSGVLYVPVSSLEEAAGSQASYECCTFRGSVVALDAATGKLVWQAYTIPE  173

Query  1052  -----NKGKRGEY----AGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNK  900
                   K  RG      +GAAIW S+P+ID +R  VY+AT N YS P             
Sbjct  174   VPHPTGKNARGTQLFGPSGAAIW-SAPTIDVNRNAVYVATSNSYSNP-------------  219

Query  899   TTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPN  720
                         P   +D+ILA +L TGK+ W +Q    D F +AC  +  + NCP    
Sbjct  220   ------------PAATADAILAFELGTGKLLWKQQATPKDAFVVACFTADKS-NCPEDHG  266

Query  719   PDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRDN-GEMVWYteagpggfvgggt  543
             PD DFG++P+++++      R ++V  QKSG   ALD D+ G+++W T  G GG +GG  
Sbjct  267   PDHDFGQSPILVTLR---DGRRVLVIAQKSGVVHALDPDDGGKILWQTRIGKGGALGGSE  323

Query  542   wgaaTDNERVYTSIANSN-RLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVP------  384
             WG+A D ER+Y  +ANS+ R         + T GGG   +D  +GKI  +  VP      
Sbjct  324   WGSAADGERIY--VANSDVRFMRDGTRQLDSTQGGGLFGLDLVSGKI--AMEVPPVACGD  379

Query  383   ----DTGLSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYT--------GATVYG  240
                    LS  V++  GV+F+G V      +A +   G++LW + T        G   +G
Sbjct  380   RPKCSPALSAAVSLIPGVVFSGGVSGFLRAYATD---GKLLWEFDTAQDFKAVNGVPAHG  436

Query  239   GM------SVSNGCVYVGNGY  195
             G        ++ G +Y  +GY
Sbjct  437   GAIDGPGPVIAGGMLYTNSGY  457



>ref|WP_028154794.1| cytochrome Cbb3 [Bradyrhizobium japonicum]
 gb|KGT75713.1| cytochrome Cbb3 [Bradyrhizobium japonicum]
Length=610

 Score =   182 bits (461),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 168/533 (32%), Positives = 254/533 (48%), Gaps = 88/533 (17%)
 Frame = -1

Query  1670  HITRFSCPASG-NWLNHGGDIYNRRYACGENK-ISPSTVSKLKLKWEF-YAGKDIS-ATP  1503
              I+ F  P  G  W   G D+ N R+   +   ++ + V +L+LKW + + G  +S A P
Sbjct  106   QISGFPQPLDGPRWNGWGVDLNNSRFQPTDMAGLTAAQVPRLRLKWAYAFPGASVSFAPP  165

Query  1502  AILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVG  1323
              I+ G+++    +  ++A++A  G  LW         ++A VR     AI     P    
Sbjct  166   TIMGGLLFIGGTDRKVHALDARTGCTLWT------FAIDAAVRA----AITVAPLPGSDQ  215

Query  1322  ETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGS-  1146
               +  G    A    V   TG  +W T ++ HPA  IT +   ++G  YV  SSLEE + 
Sbjct  216   FAIFFGDL-RANAYAVNALTGASIWKTKVEEHPAARITGAPVLHSGVLYVPVSSLEEAAG  274

Query  1145  SKA--HCCTFRGRFAKLDVWTGKVLWQTFMLPD-----NKGKRGEY----AGAAIWGSSP  999
             S+A   CCTFRG    LD  TGK LWQ + +P+     +K  +G      +GAAIW S+P
Sbjct  275   SQASYECCTFRGSVVALDAATGKPLWQAYTIPEVPHPTDKNAKGVQLFGPSGAAIW-SAP  333

Query  998   SIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDT  819
             +ID  RG +Y+AT N YS P                         P   SD+ILA DL T
Sbjct  334   TIDVKRGAIYVATSNSYSNP-------------------------PSATSDAILAFDLAT  368

Query  818   GKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAV  639
             GK+ W +Q    D + +AC     T NCP    PD DFG++P+++++      R ++   
Sbjct  369   GKLLWGQQATPKDAYVVACYGVDKT-NCPEDHGPDHDFGQSPILVTLR---DGRRVLAIA  424

Query  638   QKSGFAWALDRDN-GEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPS  462
             QKSG    LD D+ G+++W T  G GG +GG  WG+A D +R+Y  +ANS+ + F    +
Sbjct  425   QKSGVVHGLDPDDGGKILWQTRIGKGGALGGSEWGSAADQDRIY--VANSD-VRFLRDGT  481

Query  461   KNV--TIGGGWVAMDAQTGKILWSTAVPDTG--------LSNPVTVANGVLFAGSVHPRG  312
             + +  T GGG   +D  +G ++        G        LS  V++  GV+F+GSV    
Sbjct  482   RRLDSTQGGGLFGLDLASGTVVMEVPPIACGDRLQCSPALSAAVSLIPGVVFSGSVS---  538

Query  311   PVFAINAKTGEILWSYYT--------GATVYGGM------SVSNGCVYVGNGY  195
                   A  G++LW + T        G   +GG        ++ G +Y  +GY
Sbjct  539   GFLRAYASDGKLLWEFDTAQDYKAVNGVPAHGGAIDGPGPVIAGGMLYTNSGY  591



>ref|WP_038935979.1| cytochrome Cbb3 [Bradyrhizobium japonicum]
Length=610

 Score =   182 bits (461),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 166/533 (31%), Positives = 255/533 (48%), Gaps = 88/533 (17%)
 Frame = -1

Query  1670  HITRFSCPASG-NWLNHGGDIYNRRYACGENK-ISPSTVSKLKLKWEF-YAGKDIS-ATP  1503
              I+ F  P  G  W   G D+ N R+   +   ++ + V +L+LKW + + G  +S A P
Sbjct  106   QISGFPQPLDGPRWNGWGVDLNNSRFQPADMAGLTAAQVPRLRLKWAYAFPGASVSFAPP  165

Query  1502  AILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVG  1323
              I+ G+++    +  ++A++A  G  LW         ++A VR     AI     P    
Sbjct  166   TIMGGLLFIGGTDRKVHALDARTGCTLWT------FAIDAAVRA----AITVAPLPGSDQ  215

Query  1322  ETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGS-  1146
               +  G    A    V   TG L+W T ++ HPA  IT +   ++G  YV  SSLEE + 
Sbjct  216   FAIFFGDL-RANAYAVNALTGALIWKTKVEEHPAARITGAPVLHSGVLYVPVSSLEEAAG  274

Query  1145  SKA--HCCTFRGRFAKLDVWTGKVLWQTFMLPD-----NKGKRGEY----AGAAIWGSSP  999
             S+A   CCTFRG    L+  TGK +WQ + +P+     +K  +G      +GAAIW S+P
Sbjct  275   SQASYECCTFRGSVVALEAATGKPVWQAYTIPEVPHPTDKNAKGVQLFGPSGAAIW-SAP  333

Query  998   SIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDT  819
             +ID  RG +Y+AT N YS P                         P   SD+ILA DL T
Sbjct  334   TIDVKRGAIYVATSNSYSNP-------------------------PSATSDAILAFDLAT  368

Query  818   GKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAV  639
             GK+ W +Q    D + +AC     T NCP    PD DFG++P+++++      R ++   
Sbjct  369   GKLLWSQQATPKDAYVVACYGVDKT-NCPEDHGPDHDFGQSPILVTLR---DGRRVLAIA  424

Query  638   QKSGFAWALDRDN-GEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPS  462
             QKSG    LD D+ G+++W T  G GG +GG  WG+A D +R+Y  +ANS+ + F    +
Sbjct  425   QKSGVVHGLDPDDGGKILWQTRIGKGGALGGSEWGSAADQDRIY--VANSD-VRFLRDGT  481

Query  461   KNV--TIGGGWVAMDAQTGKILWSTAVPDTG--------LSNPVTVANGVLFAGSVHPRG  312
             + +  T GGG  ++D  +G ++        G        LS  V++  GV+F+G V    
Sbjct  482   RRLDSTQGGGLFSLDLASGTVVMEVPPVACGDRLQCSPALSAAVSLIPGVVFSGGVS---  538

Query  311   PVFAINAKTGEILWSYYT--------GATVYGGM------SVSNGCVYVGNGY  195
                   A  G++LW + T        G   +GG        ++ G +Y  +GY
Sbjct  539   GFLRAYASDGKLLWEFDTAQDYKAVNGVPAHGGAIDGPGPVIAGGMLYTNSGY  591



>ref|WP_035517536.1| dehydrogenase [Pseudohaliea rubra]
Length=558

 Score =   180 bits (457),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 166/527 (31%), Positives = 240/527 (46%), Gaps = 91/527 (17%)
 Frame = -1

Query  1679  PEWHITRFSCPASGNWLNHGGDIYNRRY-ACGENKISPSTVSKLKLKWEFY--AGKDISA  1509
             P   +  F  PA   W   G  + N R+ A  +  ++P TV  L+LKW F         +
Sbjct  54    PAQALEDFQAPALAGW---GLTLGNTRFVAAADAGLTPETVPALELKWAFAFPGATRARS  110

Query  1508  TPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSI  1329
              P +  G V+  S +G +YA++ S G   W          +A VRTG +T  +    P+ 
Sbjct  111   QPTVANGTVFVGSQSGEVYALDLSSGCAHWTFKA------DAEVRTG-ITVTMEEGEPAA  163

Query  1328  VGETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEG  1149
                     +Y       +  ++G+L W   LD HPA  IT S  YYN   YV  SS E  
Sbjct  164   YFGDFAGNVYR------INASSGELRWRATLDDHPALTITGSPRYYNDRLYVPMSSTEWA  217

Query  1148  SSKA---HCCTFRGRFAKLDVWTGKVLWQTFMLPDNK---GKRGEY-------AGAAIWG  1008
             S+      CCTFRG  A     +G+ LW T+ +P+     G++ +        +GA IW 
Sbjct  218   SAADPGYACCTFRGGVAAFSAQSGERLWTTYTIPEAARPTGRKNDLGVAILAPSGAPIW-  276

Query  1007  SSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALD  828
             +SP+IDA RG +Y+ TG  Y++P H                          +SDS+LA+D
Sbjct  277   NSPTIDASRGLLYVGTGESYTSPAH-------------------------RNSDSVLAMD  311

Query  827   LDTGKIKWFRQLGGYDVFFIAC-INSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDI  651
             L+TG+++W  Q    D + +AC +      NCP    PD D G  P++         R++
Sbjct  312   LETGELRWSYQALAGDAWNMACNLPEGQRSNCPEEDGPDLDIGAPPVLWQ---GADGREL  368

Query  650   VVAVQKSGFAWALD--RDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNF  477
             ++  QKSG   ALD  RD GE+VW    G GGF GG  WG ATD +R++   A+++ +  
Sbjct  369   LLVGQKSGMVHALDPARD-GELVWRRRVGRGGFAGGVHWGMATDGDRLFVPNADTDFIGK  427

Query  476   TLLPSKNVTIGGGWVAMDAQTGKILWSTAVP-----------DTGLSNPVTVANGVLFAG  330
                  K      G  A+D ++G+  W T              D GLS  +T   GV+FAG
Sbjct  428   WKGERKP-----GLFALDPESGETRWFTPAGDHCAEADKPACDPGLSAAITAIPGVVFAG  482

Query  329   SVHPRGPVFAINAKTGEILWSYYT--------GATVYGGMSVSNGCV  213
                  G + A  A +GE+LWS+ T        G    GG   S+G V
Sbjct  483   GFD--GVLKAYAAGSGEVLWSFNTNDEFPAVSGGVARGGSIESDGPV  527



>ref|WP_014494373.1| cytochrome CBB3 [Bradyrhizobium japonicum]
 ref|YP_005609114.1| polyvinyl-alcohol dehydrogenase [Bradyrhizobium japonicum USDA 
6]
 dbj|BAL09526.1| polyvinyl-alcohol dehydrogenase [Bradyrhizobium japonicum USDA 
6]
 gb|AJA62481.1| cytochrome Cbb3 [Bradyrhizobium japonicum]
Length=610

 Score =   181 bits (459),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 166/533 (31%), Positives = 255/533 (48%), Gaps = 88/533 (17%)
 Frame = -1

Query  1670  HITRFSCPASG-NWLNHGGDIYNRRYACGENK-ISPSTVSKLKLKWEF-YAGKDIS-ATP  1503
              I+ F  P  G  W   G D+ N R+   +   ++ + V +L+LKW + + G  +S A P
Sbjct  106   QISGFPQPLDGPRWNGWGVDLNNSRFQPADMAGLTAAQVPRLRLKWAYAFPGASVSFAPP  165

Query  1502  AILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVG  1323
              I+ G+++    +  ++A++A  G  LW         ++A VR     AI     P    
Sbjct  166   TIVGGLLFIGGTDRKVHALDARTGCTLWT------FAIDAAVRA----AITVAPLPGSDQ  215

Query  1322  ETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGS-  1146
               +  G    A    V   TG L+W T ++ HPA  IT +   ++G  YV  SSLEE + 
Sbjct  216   FAIFFGDL-RANAYAVNALTGALIWKTKVEEHPAARITGAPVLHSGVLYVPVSSLEEAAG  274

Query  1145  SKA--HCCTFRGRFAKLDVWTGKVLWQTFMLPD-----NKGKRGEY----AGAAIWGSSP  999
             S+A   CCTFRG    L+  TGK +WQ + +P+     +K  +G      +GAAIW S+P
Sbjct  275   SQASYECCTFRGSVVALEAATGKPVWQAYTIPEVPHPTDKNAKGVQLFGPSGAAIW-SAP  333

Query  998   SIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDT  819
             +ID  RG +Y+AT N YS P                         P   SD+ILA DL T
Sbjct  334   TIDVKRGAIYVATSNSYSNP-------------------------PSATSDAILAFDLAT  368

Query  818   GKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAV  639
             GK+ W +Q    D + +AC     T NCP    PD DFG++P+++++      R ++   
Sbjct  369   GKLLWSQQATPKDAYVVACYGVDKT-NCPEDHGPDHDFGQSPILVTLR---DGRRVLAIA  424

Query  638   QKSGFAWALDRDN-GEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPS  462
             QKSG    LD D+ G+++W T  G GG +GG  WG+A D +R+Y  +ANS+ + F    +
Sbjct  425   QKSGVVHGLDPDDGGKILWQTRIGKGGALGGSEWGSAADQDRIY--VANSD-VRFLRDGT  481

Query  461   KNV--TIGGGWVAMDAQTGKILWSTAVPDTG--------LSNPVTVANGVLFAGSVHPRG  312
             + +  T GGG  ++D  +G ++        G        LS  V++  GV+F+G V    
Sbjct  482   RRLDSTQGGGLFSLDLASGTVVMEVPPVACGDRLQCSPALSAAVSLIPGVVFSGGVS---  538

Query  311   PVFAINAKTGEILWSYYT--------GATVYGGM------SVSNGCVYVGNGY  195
                   A  G++LW + T        G   +GG        ++ G +Y  +GY
Sbjct  539   GFLRAYASDGKLLWEFDTAQDYKAVNGVPAHGGAIDGPGPVIAGGMLYTNSGY  591



>ref|WP_028175890.1| MULTISPECIES: cytochrome Cbb3 [Bradyrhizobium]
Length=612

 Score =   181 bits (459),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 168/547 (31%), Positives = 257/547 (47%), Gaps = 93/547 (17%)
 Frame = -1

Query  1703  ICISATAKPEWHITRFSCPASG-NWLNHGGDIYNRRYACGENK-ISPSTVSKLKLKWEF-  1533
             +   A  +    +  F  P  G  W   G D  N R+   +   ++   V +L+LKW + 
Sbjct  96    VAADAEGRCAQQVRGFPEPLDGPRWNGWGVDAGNSRFQPADMAGLTAEEVPRLRLKWAYA  155

Query  1532  YAGKDIS-ATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTA  1356
             + G  +S A P I+ G+++    +  ++A++A  G  LW          +A VR      
Sbjct  156   FPGASVSFAPPTIMGGLLFIGGTDRKVHALDARSGCTLWT------FATDAAVR------  203

Query  1355  IVSRSTPSIVGETLIIGIYGP--AVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGA  1182
               + S   + G    +  +G   A    V   TG L+W T ++ HPA  IT + T ++G 
Sbjct  204   -AAISFAPLPGTDQFVIFFGDLRANAYAVNALTGALIWKTKVEEHPAARITGAPTLHSGV  262

Query  1181  FYVGTSSLEEGS-SKA--HCCTFRGRFAKLDVWTGKVLWQTFMLPD-----NKGKRGEY-  1029
              YV  SSLEE + S+A   CCTFRG    L+  TGK +WQ + +P+      K  +G   
Sbjct  263   LYVPVSSLEEAAGSQASYECCTFRGSVVALEAVTGKPVWQAYTIPEVPHPTGKNTKGTQL  322

Query  1028  ---AGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPE  858
                +GAA+W S+P++D  R  VY+AT N YS P                         P 
Sbjct  323   FGPSGAAVW-SAPTVDPKRNAVYVATSNSYSNP-------------------------PA  356

Query  857   NHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSV  678
               +D+ILA +L TGK+ W +Q    D F +AC  +  T NCP    PD DFG++P+++++
Sbjct  357   ATADAILAFELATGKLLWKQQATPKDAFIVACYGADRT-NCPDEHGPDHDFGQSPILVTL  415

Query  677   VVNGSTRDIVVAVQKSGFAWALDRDN-GEMVWYteagpggfvgggtwgaaTDNERVYTSI  501
                   R ++   QKSG   ALD D+ G+++W T  G GG +GG  WG+A D +R+Y  +
Sbjct  416   R---DGRRVLAIAQKSGVVHALDPDDGGKILWQTRIGKGGALGGSEWGSAADQDRIY--V  470

Query  500   ANSN-RLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVP----------DTGLSNPVTV  354
             ANS+ R         + T GGG   +D  +GKI  +  VP             LS  V++
Sbjct  471   ANSDVRFLHDGTRRLDSTQGGGLFGLDLASGKI--AMEVPPVACGDRLQCSPALSAAVSL  528

Query  353   ANGVLFAGSVHPRGPVFAINAKTGEILWSYYT--------GATVYGGM------SVSNGC  216
               GV+F+G V   G + A     G++LW + T        G   +GG        ++ G 
Sbjct  529   IPGVVFSGGVS--GVLRAYATADGKLLWEFDTARDYTAVNGVPAHGGAIDGPGPVIAGGM  586

Query  215   VYVGNGY  195
             +Y  +GY
Sbjct  587   LYTNSGY  593



>gb|KGJ71079.1| putative polyvinyl-alcohol dehydrogenase [Bradyrhizobium diazoefficiens 
SEMIA 5080]
Length=626

 Score =   181 bits (459),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 168/547 (31%), Positives = 257/547 (47%), Gaps = 93/547 (17%)
 Frame = -1

Query  1703  ICISATAKPEWHITRFSCPASG-NWLNHGGDIYNRRYACGENK-ISPSTVSKLKLKWEF-  1533
             +   A  +    +  F  P  G  W   G D  N R+   +   ++   V +L+LKW + 
Sbjct  110   VAADAEGRCAQQVRGFPEPLDGPRWNGWGVDAGNSRFQPADMAGLTAEEVPRLRLKWAYA  169

Query  1532  YAGKDIS-ATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTA  1356
             + G  +S A P I+ G+++    +  ++A++A  G  LW          +A VR      
Sbjct  170   FPGASVSFAPPTIMGGLLFIGGTDRKVHALDARSGCTLWT------FATDAAVR------  217

Query  1355  IVSRSTPSIVGETLIIGIYGP--AVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGA  1182
               + S   + G    +  +G   A    V   TG L+W T ++ HPA  IT + T ++G 
Sbjct  218   -AAISFAPLPGTDQFVIFFGDLRANAYAVNALTGALIWKTKVEEHPAARITGAPTLHSGV  276

Query  1181  FYVGTSSLEEGS-SKA--HCCTFRGRFAKLDVWTGKVLWQTFMLPD-----NKGKRGEY-  1029
              YV  SSLEE + S+A   CCTFRG    L+  TGK +WQ + +P+      K  +G   
Sbjct  277   LYVPVSSLEEAAGSQASYECCTFRGSVVALEAVTGKPVWQAYTIPEVPHPTGKNTKGTQL  336

Query  1028  ---AGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPE  858
                +GAA+W S+P++D  R  VY+AT N YS P                         P 
Sbjct  337   FGPSGAAVW-SAPTVDPKRNAVYVATSNSYSNP-------------------------PA  370

Query  857   NHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSV  678
               +D+ILA +L TGK+ W +Q    D F +AC  +  T NCP    PD DFG++P+++++
Sbjct  371   ATADAILAFELATGKLLWKQQATPKDAFIVACYGADRT-NCPDEHGPDHDFGQSPILVTL  429

Query  677   VVNGSTRDIVVAVQKSGFAWALDRDN-GEMVWYteagpggfvgggtwgaaTDNERVYTSI  501
                   R ++   QKSG   ALD D+ G+++W T  G GG +GG  WG+A D +R+Y  +
Sbjct  430   R---DGRRVLAIAQKSGVVHALDPDDGGKILWQTRIGKGGALGGSEWGSAADQDRIY--V  484

Query  500   ANSN-RLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVP----------DTGLSNPVTV  354
             ANS+ R         + T GGG   +D  +GKI  +  VP             LS  V++
Sbjct  485   ANSDVRFLHDGTRRLDSTQGGGLFGLDLASGKI--AMEVPPVACGDRLQCSPALSAAVSL  542

Query  353   ANGVLFAGSVHPRGPVFAINAKTGEILWSYYT--------GATVYGGM------SVSNGC  216
               GV+F+G V   G + A     G++LW + T        G   +GG        ++ G 
Sbjct  543   IPGVVFSGGVS--GVLRAYATADGKLLWEFDTARDYTAVNGVPAHGGAIDGPGPVIAGGM  600

Query  215   VYVGNGY  195
             +Y  +GY
Sbjct  601   LYTNSGY  607



>ref|WP_027525615.1| cytochrome Cbb3 [Bradyrhizobium sp. Ec3.3]
Length=613

 Score =   181 bits (458),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 168/533 (32%), Positives = 250/533 (47%), Gaps = 76/533 (14%)
 Frame = -1

Query  1637  NWLNHGGDIYNRRYA-CGENKISPSTVSKLKLKWEF-YAGKDIS-ATPAILKGVVYFPSW  1467
              W   G D+ N R+   G   ++   V  L LKW + + G  +S A P ++ G+++    
Sbjct  121   RWNGWGADLNNSRFQPAGMAGLTAEQVPHLTLKWAYAFPGATLSFAQPTVVGGLLFVGGP  180

Query  1466  NGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGPAV  1287
             +  + A++A  G  LW         +  ++  G V        P      +  G  G A 
Sbjct  181   DRKVRALDAKSGCTLW--TFASDLAVRGSISFGQV--------PGTDQFAVFFG-DGRAN  229

Query  1286  VIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEE--GSSKAH-CCTFRG  1116
                V   TG L+W   ++ HPA  IT    +++G  YV  SSLEE  GS  ++ CCTFRG
Sbjct  230   AYAVNALTGALIWKVNVEEHPAARITGGVVFHSGVLYVPVSSLEEVAGSEPSYECCTFRG  289

Query  1115  RFAKLDVWTGKVLWQTFMLPD-----NKGKRGEY----AGAAIWGSSPSIDAHRGHVYIA  963
                 L+  TGK++W+   +P+      +  RG      +GAAIW S+P+ID  R  +Y+A
Sbjct  290   SLVALEAATGKLIWKANTIPEVPHPTTRNARGTQLYGPSGAAIW-SAPTIDTQRNAIYVA  348

Query  962   TGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGY  783
             TGN YS P                         P   +D++LA +L TG++ W +Q    
Sbjct  349   TGNSYSNP-------------------------PAATADAVLAFELATGRLLWKQQASPK  383

Query  782   DVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALDRD  603
             D F +AC  ++ T NCP    PD DFG++P++  V ++   R IV+  QKSG   ALD D
Sbjct  384   DAFVVACFGANQT-NCPDDHGPDHDFGQSPIL--VTLHDGKRVIVIG-QKSGVVHALDPD  439

Query  602   N-GEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGGWVAM  426
             N G+++W T  G GG +GG  WG+A D +R+Y ++++   L        + T GGG  A+
Sbjct  440   NEGKILWQTRIGKGGPLGGTEWGSAADQDRIYVALSDVRFLRDGTR-RLDSTQGGGLFAL  498

Query  425   DAQTGKILWSTA-VP-------DTGLSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILW  270
             D  +GK+L   A VP          LS  ++V  GV+F+G V   G + A      ++LW
Sbjct  499   DLASGKVLTEVAPVPCGERPQCSPALSAAISVIPGVVFSGGVS--GYLRAYATADAKLLW  556

Query  269   SYYT--------GATVYGGMSVSNGCVYVGNGYRVSIGAGIPIFTGGTSLFAF  135
              + T        G   +GG     G V V      + G G    T G  L AF
Sbjct  557   EFDTSRDYKAVNGVPAFGGAIDGPGPVIVDGMLYTNSGYGQWSGTAGNVLLAF  609



>ref|WP_027582751.1| cytochrome Cbb3 [Bradyrhizobium sp. Ai1a-2]
Length=615

 Score =   181 bits (458),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 170/543 (31%), Positives = 255/543 (47%), Gaps = 96/543 (18%)
 Frame = -1

Query  1637  NWLNHGGDIYNRRYACGENK-ISPSTVSKLKLKWEF-YAG-KDISATPAILKGVVYFPSW  1467
              W+  G D+ N R+   E   +    V +L+LKW F + G    +A PA++ G+++    
Sbjct  122   RWIGWGADLNNSRFQAAEMAGLRADQVPRLRLKWAFGFPGVSSANAQPAVIGGMLFVGGA  181

Query  1466  NGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGP--  1293
             +  + A++A  G   W          +A VRT       + S   + G+      +G   
Sbjct  182   DSKVRALDARSGCTFWT------LATDAPVRT-------AISFGPLPGKNEFAIFFGDVR  228

Query  1292  AVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGS-SKA--HCCTF  1122
             A    V    G L+W   ++ HPA  IT +   ++G  YV  SS+EE + S+A   CCTF
Sbjct  229   ANAYAVDATAGALIWKQKVEDHPAARITGTPALFSGVLYVPVSSIEEATGSRASYECCTF  288

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYA---------GAAIWGSSPSIDAHRGHVY  969
             RG    LD  TG  +W+++ +P+        A         GA++W S+P+ID  R  +Y
Sbjct  289   RGSVVALDAATGGPIWKSYTIPETPRPTTRNAMGVQLYGPSGASVW-SAPTIDVKRQALY  347

Query  968   IATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLG  789
             IAT N YS P                         P + SDSI+A DL TG++ W RQ  
Sbjct  348   IATSNSYSNP-------------------------PADTSDSIIAFDLKTGRMLWHRQAT  382

Query  788   GYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALD  609
               D + +AC     T NCP  P PD DFG++P+++S+      R ++V  QKSG   A D
Sbjct  383   PKDSYVVACYGYDKT-NCPEDPGPDHDFGQSPILVSL---SDGRRMLVIGQKSGVVHAFD  438

Query  608   RDN-GEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNV--TIGGG  438
              D+ G+++W T  G GG +GG  WG+A D ERVY  +ANS+ + F    ++ +    GGG
Sbjct  439   PDDEGKILWQTRVGKGGPLGGMEWGSAADQERVY--VANSD-VRFLRDGTRRLDPNAGGG  495

Query  437   WVAMDAQTGKILWSTA-VP-------DTGLSNPVTVANGVLFAGSVHPRGPVFAINAKTG  282
                ++   GK+    A VP          LS  V+   GV+F+GSV   G + A  +   
Sbjct  496   LFGLNLADGKVTMQVAPVPCDDRERCSPALSAAVSAIPGVVFSGSVS--GYLRAYASDDA  553

Query  281   EILWSYYT--------GATVYGGMS------VSNGCVYVGNGYRVSIGAGIPIFTGGTSL  144
              +LW + T        G   +GG        + +G +YV +GY  +   GIP    G +L
Sbjct  554   RLLWEFDTARDYKTVNGIAAHGGAMDGPGPVIVDGMLYVNSGY--AQWGGIP----GNAL  607

Query  143   FAF  135
              AF
Sbjct  608   LAF  610



>gb|KGE03706.1| Polyvinyl-alcohol dehydrogenase, PQQ-dependent [Haliea rubra 
DSM 19751]
Length=628

 Score =   181 bits (458),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 166/527 (31%), Positives = 240/527 (46%), Gaps = 91/527 (17%)
 Frame = -1

Query  1679  PEWHITRFSCPASGNWLNHGGDIYNRRY-ACGENKISPSTVSKLKLKWEFY--AGKDISA  1509
             P   +  F  PA   W   G  + N R+ A  +  ++P TV  L+LKW F         +
Sbjct  124   PAQALEDFQAPALAGW---GLTLGNTRFVAAADAGLTPETVPALELKWAFAFPGATRARS  180

Query  1508  TPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSI  1329
              P +  G V+  S +G +YA++ S G   W          +A VRTG +T  +    P+ 
Sbjct  181   QPTVANGTVFVGSQSGEVYALDLSSGCAHWTFKA------DAEVRTG-ITVTMEEGEPAA  233

Query  1328  VGETLIIGIYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEG  1149
                     +Y       +  ++G+L W   LD HPA  IT S  YYN   YV  SS E  
Sbjct  234   YFGDFAGNVYR------INASSGELRWRATLDDHPALTITGSPRYYNDRLYVPMSSTEWA  287

Query  1148  SSKA---HCCTFRGRFAKLDVWTGKVLWQTFMLPDNK---GKRGEY-------AGAAIWG  1008
             S+      CCTFRG  A     +G+ LW T+ +P+     G++ +        +GA IW 
Sbjct  288   SAADPGYACCTFRGGVAAFSAQSGERLWTTYTIPEAARPTGRKNDLGVAILAPSGAPIW-  346

Query  1007  SSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALD  828
             +SP+IDA RG +Y+ TG  Y++P H                          +SDS+LA+D
Sbjct  347   NSPTIDASRGLLYVGTGESYTSPAH-------------------------RNSDSVLAMD  381

Query  827   LDTGKIKWFRQLGGYDVFFIAC-INSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDI  651
             L+TG+++W  Q    D + +AC +      NCP    PD D G  P++         R++
Sbjct  382   LETGELRWSYQALAGDAWNMACNLPEGQRSNCPEEDGPDLDIGAPPVLWQ---GADGREL  438

Query  650   VVAVQKSGFAWALD--RDNGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNF  477
             ++  QKSG   ALD  RD GE+VW    G GGF GG  WG ATD +R++   A+++ +  
Sbjct  439   LLVGQKSGMVHALDPARD-GELVWRRRVGRGGFAGGVHWGMATDGDRLFVPNADTDFIGK  497

Query  476   TLLPSKNVTIGGGWVAMDAQTGKILWSTAVP-----------DTGLSNPVTVANGVLFAG  330
                  K      G  A+D ++G+  W T              D GLS  +T   GV+FAG
Sbjct  498   WKGERKP-----GLFALDPESGETRWFTPAGDHCAEADKPACDPGLSAAITAIPGVVFAG  552

Query  329   SVHPRGPVFAINAKTGEILWSYYT--------GATVYGGMSVSNGCV  213
                  G + A  A +GE+LWS+ T        G    GG   S+G V
Sbjct  553   GFD--GVLKAYAAGSGEVLWSFNTNDEFPAVSGGVARGGSIESDGPV  597



>ref|WP_038967515.1| cytochrome Cbb3 [Bradyrhizobium sp. CCBAU 41267]
Length=612

 Score =   180 bits (457),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 168/547 (31%), Positives = 257/547 (47%), Gaps = 93/547 (17%)
 Frame = -1

Query  1703  ICISATAKPEWHITRFSCPASG-NWLNHGGDIYNRRYACGENK-ISPSTVSKLKLKWEF-  1533
             +   A  +    +  F  P  G  W   G D  N R+   +   ++   V +L+LKW + 
Sbjct  96    VAADAEGRCTQQVRGFPEPLDGPRWNGWGVDAGNSRFQPADMAGLTAEEVPRLRLKWAYA  155

Query  1532  YAGKDIS-ATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTA  1356
             + G  +S A P I+ G+++    +  ++A++A  G  LW          +A VR      
Sbjct  156   FPGASVSFAPPTIMGGLLFIGGTDRKVHALDARSGCTLWT------FATDAAVR------  203

Query  1355  IVSRSTPSIVGETLIIGIYGP--AVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGA  1182
               + S   + G    +  +G   A    V   TG L+W T ++ HPA  IT + T ++G 
Sbjct  204   -AAISFAPLPGTDQFVIFFGDLRANAYAVNALTGALIWKTKVEEHPAARITGAPTLHSGV  262

Query  1181  FYVGTSSLEEGS-SKA--HCCTFRGRFAKLDVWTGKVLWQTFMLPD-----NKGKRGEY-  1029
              YV  SSLEE + S+A   CCTFRG    L+  TGK +WQ + +P+      K  +G   
Sbjct  263   LYVPVSSLEEAAGSQASYECCTFRGSVVALEAVTGKPVWQAYTIPEVPHPTGKNTKGTQL  322

Query  1028  ---AGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPE  858
                +GAA+W S+P++D  R  VY+AT N YS P                         P 
Sbjct  323   FGPSGAAVW-SAPTVDPKRNAVYVATSNSYSNP-------------------------PA  356

Query  857   NHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSV  678
               +D+ILA +L TGK+ W +Q    D F +AC  +  T NCP    PD DFG++P+++++
Sbjct  357   ATADAILAFELATGKLLWKQQATPKDAFIVACYGADRT-NCPDEHGPDHDFGQSPILVTL  415

Query  677   VVNGSTRDIVVAVQKSGFAWALDRDN-GEMVWYteagpggfvgggtwgaaTDNERVYTSI  501
                   R ++   QKSG   ALD D+ G+++W T  G GG +GG  WG+A D +R+Y  +
Sbjct  416   R---DGRRVLAIAQKSGVVHALDPDDGGKILWQTRIGKGGALGGSEWGSAADQDRIY--V  470

Query  500   ANSN-RLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVP----------DTGLSNPVTV  354
             ANS+ R         + T GGG   +D  +GKI  +  VP             LS  V++
Sbjct  471   ANSDVRFLHDGTRRLDSTQGGGLFGLDLASGKI--AMEVPPVACGDRLQCSPALSAAVSL  528

Query  353   ANGVLFAGSVHPRGPVFAINAKTGEILWSYYT--------GATVYGGM------SVSNGC  216
               GV+F+G V   G + A     G++LW + T        G   +GG        ++ G 
Sbjct  529   IPGVVFSGGVS--GFLRAYATADGKLLWEFDTARDYTAVNGVPAHGGAIDGPGPVIAGGM  586

Query  215   VYVGNGY  195
             +Y  +GY
Sbjct  587   LYTNSGY  593



>ref|WP_011088252.1| cytochrome CBB3 [Bradyrhizobium diazoefficiens]
 ref|NP_772144.1| polyvinyl-alcohol dehydrogenase [Bradyrhizobium diazoefficiens 
USDA 110]
 dbj|BAC50769.1| bll5504 [Bradyrhizobium diazoefficiens USDA 110]
Length=635

 Score =   180 bits (456),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 168/547 (31%), Positives = 257/547 (47%), Gaps = 93/547 (17%)
 Frame = -1

Query  1703  ICISATAKPEWHITRFSCPASG-NWLNHGGDIYNRRYACGENK-ISPSTVSKLKLKWEF-  1533
             +   A  +    +  F  P  G  W   G D  N R+   +   ++   V +L+LKW + 
Sbjct  119   VAADAEGRCTQQVRGFPEPLDGPRWNGWGVDAGNSRFQPADMAGLTAEEVPRLRLKWAYA  178

Query  1532  YAGKDIS-ATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTA  1356
             + G  +S A P I+ G+++    +  ++A++A  G  LW          +A VR      
Sbjct  179   FPGASVSFAPPTIMGGLLFIGGTDRKVHALDARSGCTLWT------FATDAAVR------  226

Query  1355  IVSRSTPSIVGETLIIGIYGP--AVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGA  1182
               + S   + G    +  +G   A    V   TG L+W T ++ HPA  IT + T ++G 
Sbjct  227   -AAISFAPLPGTDQFVIFFGDLRANAYAVNALTGALIWKTKVEEHPAARITGAPTLHSGV  285

Query  1181  FYVGTSSLEEGS-SKA--HCCTFRGRFAKLDVWTGKVLWQTFMLPD-----NKGKRGEY-  1029
              YV  SSLEE + S+A   CCTFRG    L+  TGK +WQ + +P+      K  +G   
Sbjct  286   LYVPVSSLEEAAGSQASYECCTFRGSVVALEAVTGKPVWQAYTIPEVPHPTGKNTKGTQL  345

Query  1028  ---AGAAIWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPE  858
                +GAA+W S+P++D  R  VY+AT N YS P                         P 
Sbjct  346   FGPSGAAVW-SAPTVDPKRNAVYVATSNSYSNP-------------------------PA  379

Query  857   NHSDSILALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSV  678
               +D+ILA +L TGK+ W +Q    D F +AC  +  T NCP    PD DFG++P+++++
Sbjct  380   ATADAILAFELATGKLLWKQQATPKDAFIVACYGADRT-NCPDEHGPDHDFGQSPILVTL  438

Query  677   VVNGSTRDIVVAVQKSGFAWALDRDN-GEMVWYteagpggfvgggtwgaaTDNERVYTSI  501
                   R ++   QKSG   ALD D+ G+++W T  G GG +GG  WG+A D +R+Y  +
Sbjct  439   R---DGRRVLAIAQKSGVVHALDPDDGGKILWQTRIGKGGALGGSEWGSAADQDRIY--V  493

Query  500   ANSN-RLNFTLLPSKNVTIGGGWVAMDAQTGKILWSTAVP----------DTGLSNPVTV  354
             ANS+ R         + T GGG   +D  +GKI  +  VP             LS  V++
Sbjct  494   ANSDVRFLHDGTRRLDSTQGGGLFGLDLASGKI--AMEVPPVACGDRLQCSPALSAAVSL  551

Query  353   ANGVLFAGSVHPRGPVFAINAKTGEILWSYYT--------GATVYGGM------SVSNGC  216
               GV+F+G V   G + A     G++LW + T        G   +GG        ++ G 
Sbjct  552   IPGVVFSGGVS--GFLRAYATADGKLLWEFDTARDYTAVNGVPAHGGAIDGPGPVIAGGM  609

Query  215   VYVGNGY  195
             +Y  +GY
Sbjct  610   LYTNSGY  616



>ref|WP_007992272.1| hypothetical protein [Glaciecola chathamensis]
 dbj|GAC12583.1| hypothetical protein GCHA_4666 [Glaciecola chathamensis S18K6]
Length=614

 Score =   178 bits (452),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 168/544 (31%), Positives = 250/544 (46%), Gaps = 113/544 (21%)
 Frame = -1

Query  1664  TRFSCPASG----------NWLNHGGDIYNRRYACGENKISPSTVSKLKLKWEFY--AGK  1521
             T ++C ++G           W   GG   N RY   ++ ++P  V+ LKLKW F      
Sbjct  111   TTYTCKSTGINLPKTMSQLAWNGWGGKTGNTRYQDNDSGLTPDNVADLKLKWAFAFPEAT  170

Query  1520  DISATPAILKGVVYFPSWNGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRS  1341
              + A P I + +VY  S  G +YA+NA  G + WE                 V     R 
Sbjct  171   RVRAQPIISQDMVYVGSQAGIIYALNAETGCVQWEY----------------VAVTEVRG  214

Query  1340  TPSIVGETLIIG-IYGPAVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTS  1164
                +  +TL+ G + G A  +  +  +G+L W T +  +P  +IT S        YV  S
Sbjct  215   ALFLQQDTLLFGDLEGNAYALDAQ--SGELKWRTKVHPNPLAVITGSVIADEKKVYVPVS  272

Query  1163  SLE---EGSSKAHCCTFRGRFAKLDVWTGKVLWQTFML----PDNKGKRGEY----AGAA  1017
             SLE      +   CC+FRG    +D+ +GK +W TF      P  K   G      +GA 
Sbjct  273   SLEIIPAARADYECCSFRGAVVAIDIQSGKKVWSTFTTDVPKPTYKTSAGTQQHGPSGAP  332

Query  1016  IWGSSPSIDAHRGHVYIATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSIL  837
             +W S P++D  R  +Y  TG  YS P                             SD++L
Sbjct  333   VW-SGPTLDIKRNLLYATTGQNYSTPA-------------------------TGTSDAVL  366

Query  836   ALDLDTGKIKWFRQLGGYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTR  657
             AL+LD+G+I+W  Q+   D +  AC  S +TPNCP    PD D G A  MLS  V G  +
Sbjct  367   ALNLDSGEIEWITQVTKGDAWNGAC--SRNTPNCPKEDGPDYDIG-ASAMLSSPVKG--K  421

Query  656   DIVVAVQKSGFAWALDRD-NGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLN  480
             ++++  QKSG  +ALD D  G++VW    G GG +GG  WG +TDN+ VY  +++     
Sbjct  422   ELLIIGQKSGMVYALDPDAKGKVVWKQRVGSGGTMGGVHWGMSTDNQNVYVGVSD-----  476

Query  479   FTLLPSKN-VTIGG---GWVAMDAQTGKILWSTAVPDT-----------GLSNPVTVANG  345
                LP+ N   +G    G  ++D QTG+  W T +P+            G+S  V+ +  
Sbjct  477   ---LPTNNPYNVGAPHPGLHSLDLQTGEFRWRTTLPNVCPKDIKFLCFPGISAAVSSSAD  533

Query  344   VLFAGSVHPRGPVFAINAKTGEILWSYYTGATV--------YGGM------SVSNGCVYV  207
             +++AGS+     +F+  A  GEILW Y T  TV        +GG        ++NG +Y+
Sbjct  534   LVYAGSLDGMFRIFS--ASKGEILWEYDTKQTVTTINGVKGFGGSIESDGPVIANGKIYL  591

Query  206   GNGY  195
              +GY
Sbjct  592   SSGY  595



>ref|WP_028164459.1| cytochrome Cbb3 [Bradyrhizobium elkanii]
Length=615

 Score =   178 bits (452),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 169/543 (31%), Positives = 254/543 (47%), Gaps = 96/543 (18%)
 Frame = -1

Query  1637  NWLNHGGDIYNRRYACGENK-ISPSTVSKLKLKWEF-YAGKDIS-ATPAILKGVVYFPSW  1467
              W   G DI N R+   E   ++   V +L+LKW F + G   + A PA++ GV++    
Sbjct  122   RWTGWGADINNSRFQAAEMAGLTADEVPRLRLKWAFGFPGVSTANAQPAVIGGVLFVGGA  181

Query  1466  NGYLYAVNASDGSLLWERNLQKLTGLNATVRTGNVTAIVSRSTPSIVGETLIIGIYGP--  1293
             +  ++A++A  G   W          +A VRT    AI     P   G+      +G   
Sbjct  182   DSKVHALDARSGCTFW------TFATDAPVRT----AISFGPLP---GKNEFAIFFGDIR  228

Query  1292  AVVIGVKRATGDLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEE--GSSKAH-CCTF  1122
             A    V   TG L+W   ++ HPA  IT +   ++G  YV  SS+EE  GS  A+ CCTF
Sbjct  229   ANAYAVNATTGALIWKQKVEDHPAARITGTPALFSGVLYVPVSSIEEATGSRPAYECCTF  288

Query  1121  RGRFAKLDVWTGKVLWQTFMLPDNKGKRGEYA---------GAAIWGSSPSIDAHRGHVY  969
             RG    LD  TG  +W+++ +PD        A         GA++W S+P+ID  R  +Y
Sbjct  289   RGSVVALDAATGAPIWKSYTIPDAPRPTTRNATGVQLYGPSGASVW-SAPTIDVKREALY  347

Query  968   IATGNLYSAPKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLG  789
             +AT N YS P                         P + SD+I+A DL +G++ W RQ  
Sbjct  348   VATSNSYSNP-------------------------PADTSDAIVAFDLKSGRMLWHRQAT  382

Query  788   GYDVFFIACINSSSTPNCPPGPNPDADFGEAPMMLSVVVNGSTRDIVVAVQKSGFAWALD  609
               D + +AC     T NCP  P PD DFG++P+++S+      R ++V  QKSG   A D
Sbjct  383   PKDSYVVACYGYDKT-NCPEDPGPDHDFGQSPILVSLP---DGRRMLVIGQKSGIVHAFD  438

Query  608   RDN-GEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNV--TIGGG  438
              D+ G+++W T  G GG +GG  WG+A D +R+Y  +ANS+ + F    ++ +    GGG
Sbjct  439   PDDEGKIIWQTRVGKGGPLGGSEWGSAADQQRIY--VANSD-VRFLRDGTRRLDPNAGGG  495

Query  437   WVAMDAQTGKILWSTAVPDTG--------LSNPVTVANGVLFAGSVHPRGPVFAINAKTG  282
                ++   GK+    A    G        LS  V+   GV+F+G V   G + A      
Sbjct  496   LFGLNLADGKVTMQVAPVSCGERERCSPALSAAVSALPGVVFSGGVS--GYLRAYATDDA  553

Query  281   EILWSYYT--------GATVYGGM------SVSNGCVYVGNGYRVSIGAGIPIFTGGTSL  144
              +LW + T        G   +GG        + +G +YV +GY  +  +G+P    G  L
Sbjct  554   RLLWEFDTARDYETVNGVPAHGGAIDGPGPVIVDGMLYVNSGY--AQWSGVP----GNVL  607

Query  143   FAF  135
              AF
Sbjct  608   LAF  610



>ref|XP_003657063.1| hypothetical protein THITE_122540 [Thielavia terrestris NRRL 
8126]
 gb|AEO70727.1| hypothetical protein THITE_122540 [Thielavia terrestris NRRL 
8126]
Length=503

 Score =   176 bits (445),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 148/493 (30%), Positives = 218/493 (44%), Gaps = 68/493 (14%)
 Frame = -1

Query  1607  NRRYACGENKISPSTVSKLKLKWEFYAGKDISATPAILKGVVYFPSWNGYLYAVNASDGS  1428
             N  +A   + ++ +TVS L L  +       SA PAI   V Y+P++NG   A+N S   
Sbjct  35    NNHWAADNHDLNSTTVSSLSLHCKIPDSVGQSAPPAIRGEVAYYPTYNGSFVALNYSSCE  94

Query  1427  LLWERNL-QKLTGLNA-TVRTGNVTAIVSRSTPSI--VGETLIIGIYGPAVVIGVKRATG  1260
             +LW  N+ Q L    A +     V   +SR++P I      +  G    A+++     +G
Sbjct  95    VLWRINVTQVLVNFRAISALQLLVNTPISRTSPQIDTANNVIYFGTQIHALLVAADLTSG  154

Query  1259  DLLWMTLLDRHPAGLITMSGTYYNGAFYVGTSSLEEGSS-----KAHCCTFRG-----RF  1110
              +L +T  + H    IT S T+Y+G   VG SS EE ++        CC+F G     RF
Sbjct  155   TVLGVTQTNPHELATITTSPTFYDGLVIVGVSSGEEDAAFFSNGTYQCCSFIGNAAAFRF  214

Query  1109  AKLDVWTGK--VLWQTFMLPDN---KGKRGEYAGAAIWGSSPSIDAHRGHVYIATGNLYS  945
              +    TG+   +W    +P N        +++GAAIWGS PSID  R  V+ ATGN+YS
Sbjct  215   KRTGRSTGRFTTIWNVTTIPTNLPPANGTSQWSGAAIWGSQPSIDVRRRQVFFATGNMYS  274

Query  944   APKHVLKCQEKQNNKTTTPTTSDKCVEPENHSDSILALDLDTGKIKWFRQLGGYDVFFIA  765
              P     C +  +           C       +S+LA DL TG   W R+L   D + + 
Sbjct  275   VPDAYAHCVDDPDV---------HCFPSYIWQESVLAFDLYTGHANWVRRLDSLDAWTLV  325

Query  764   CINS---SSTPNCPPGPNPDADFGEAPMMLSVVVNGST---RDIVVAVQKSGFAWALDRD  603
             C       +T  CP  P  DADFG AP  +       T   RD++   QKSG  + L  D
Sbjct  326   CGGGGLPRNTTLCPQNPGTDADFGMAPTFIPGGSGSRTPQGRDLLAVGQKSGVLYGLAAD  385

Query  602   NGEMVWYteagpggfvgggtwgaaTDNERVYTSIANSNRLNFTLLPSKNVTIGGG-WVAM  426
             +G+++W T   PG  + G +WG A D+ RVY +  N  +  + L P     +    + A 
Sbjct  386   SGDVLWSTLTSPGSELAGLSWGVAADDRRVYYTGINDGQKTWVLQPQNTTAVNNSIFGAA  445

Query  425   DAQTGKILWSTAVPDTGLSNPVTVANGVLFAGSVHPRGPVFAINAKTGEILWSYYTGATV  246
             D + G +LW   +PD                               TGE+LWSY      
Sbjct  446   DLRDGSLLWQ--IPD-------------------------------TGEVLWSYELVGGF  472

Query  245   YGGMSVSNGCVYV  207
              GG++V    V++
Sbjct  473   QGGVAVQGKYVFL  485



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5168388588226