BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79988_g1_i1 len=755 path=[733:0-754]

Length=755
                                                                      Score     E

ref|XP_009591583.1|  PREDICTED: pEARLI1-like lipid transfer prote...    120   5e-30   
ref|XP_009782252.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    118   2e-29   
dbj|BAF46299.1|  extensin like protein                                  118   3e-29   Ipomoea nil [qian niu]
ref|XP_009601879.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    118   3e-29   
ref|XP_009798258.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    118   3e-29   
ref|XP_009783170.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    117   4e-29   
ref|XP_006440347.1|  hypothetical protein CICLE_v10022825mg             115   2e-28   
emb|CDY08680.1|  BnaC04g19890D                                          115   2e-28   
emb|CDP09931.1|  unnamed protein product                                115   4e-28   
ref|XP_009123402.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    114   6e-28   
emb|CDY32208.1|  BnaA03g54590D                                          114   6e-28   
ref|XP_006355478.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    113   2e-27   
gb|ABG91752.1|  HyPRP2                                                  111   1e-26   Gossypium hirsutum [American cotton]
ref|NP_001233824.1|  arachidonic acid-induced DEA1 precursor            110   2e-26   
ref|XP_004245750.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    109   5e-26   
ref|XP_011001498.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    108   1e-25   
gb|ABQ88334.1|  lipid transfer protein                                  108   2e-25   Capsicum annuum
emb|CAI51313.1|  arachidonic acid-induced DEA1                          108   2e-25   Capsicum chinense [bonnet pepper]
ref|XP_006355477.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    108   2e-25   
ref|XP_009795308.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    107   2e-25   
gb|ABP35529.1|  proline-rich protein                                    107   2e-25   Ipomoea batatas [batate]
ref|XP_006391856.1|  hypothetical protein EUTSA_v10023747mg             107   5e-25   
gb|AFK41425.1|  unknown                                                 105   1e-24   
ref|XP_004299470.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    105   2e-24   
emb|CAI48077.1|  extensin-like protein                                  105   2e-24   Capsicum chinense [bonnet pepper]
ref|XP_011081227.1|  PREDICTED: pEARLI1-like lipid transfer prote...    105   2e-24   
ref|XP_007039886.1|  14 kDa proline-rich protein DC2.15, putative       104   3e-24   
ref|XP_006369032.1|  HyPRP family protein                               104   4e-24   
gb|AAM47507.1|  extensin-like protein                                   104   4e-24   Citrus junos [kuzu]
ref|XP_002271619.1|  PREDICTED: 14 kDa proline-rich protein DC2.15      104   4e-24   Vitis vinifera
ref|XP_008808739.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    103   4e-24   
ref|XP_004306948.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    103   9e-24   
ref|XP_004299469.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    103   2e-23   
gb|EYU30298.1|  hypothetical protein MIMGU_mgv1a017316mg                101   2e-23   
ref|XP_010055514.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    102   2e-23   
gb|KFK31985.1|  hypothetical protein AALP_AA6G185200                    102   3e-23   
gb|AAD01800.1|  HyPRP                                                   102   4e-23   Fragaria x ananassa
ref|XP_003608743.1|  14 kDa proline-rich protein DC2.15                 101   8e-23   
ref|XP_009333597.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    100   2e-22   
gb|EYU30296.1|  hypothetical protein MIMGU_mgv1a015783mg              99.8    3e-22   
ref|XP_006289733.1|  hypothetical protein CARUB_v10003301mg           99.8    3e-22   
ref|XP_009388037.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  99.4    3e-22   
ref|XP_006289141.1|  hypothetical protein CARUB_v10002564mg           99.4    3e-22   
ref|XP_009333675.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  99.8    4e-22   
ref|XP_006355479.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  98.6    5e-22   
ref|NP_001237154.1|  uncharacterized protein LOC100500124 precursor   98.6    7e-22   
gb|ACE82175.1|  extensin-like protein                                 98.6    7e-22   
ref|XP_008392581.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  98.2    8e-22   
ref|XP_004299468.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  99.0    9e-22   
ref|XP_009388030.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  98.2    1e-21   
ref|XP_008786988.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  97.8    1e-21   
ref|XP_009113072.1|  PREDICTED: lipid transfer protein EARLI 1        98.2    1e-21   
ref|XP_008796820.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  97.4    1e-21   
ref|XP_002271593.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    97.8    1e-21   Vitis vinifera
ref|NP_567391.1|  bifunctional inhibitor/lipid-transfer protein/s...  97.4    1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002874779.1|  hypothetical protein ARALYDRAFT_911652           97.4    2e-21   
ref|XP_010422224.1|  PREDICTED: lipid transfer protein EARLI 1-like   97.4    2e-21   
ref|XP_010933689.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  97.1    2e-21   
gb|AAC60566.1|  proline-rich SAC51                                    97.4    2e-21   Brassica napus [oilseed rape]
ref|XP_010433369.1|  PREDICTED: lipid transfer protein EARLI 1-like   97.1    2e-21   
ref|XP_010455699.1|  PREDICTED: lipid transfer protein EARLI 1-like   97.1    2e-21   
ref|XP_010455698.1|  PREDICTED: lipid transfer protein EARLI 1-like   97.1    2e-21   
ref|XP_010676150.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  97.4    3e-21   
ref|XP_011070106.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  96.7    3e-21   
gb|KHN04346.1|  14 kDa proline-rich protein DC2.15                    96.7    3e-21   
ref|NP_001238293.1|  uncharacterized protein LOC100527330 precursor   96.7    3e-21   
ref|XP_010258987.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    96.7    3e-21   
gb|EYU30301.1|  hypothetical protein MIMGU_mgv1a018370mg              95.9    4e-21   
ref|XP_006600137.1|  PREDICTED: uncharacterized protein LOC100500...  96.3    4e-21   
gb|AIX10944.1|  PRP2-like protein                                     96.7    5e-21   
ref|XP_010906608.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  95.9    5e-21   
emb|CDX90834.1|  BnaA03g25140D                                        95.9    6e-21   
ref|XP_010919520.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  96.3    6e-21   
ref|XP_010041843.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  95.5    6e-21   
ref|XP_010053929.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    95.9    7e-21   
ref|XP_010422222.1|  PREDICTED: lipid transfer protein EARLI 1-li...  95.9    7e-21   
ref|XP_009134274.1|  PREDICTED: lipid transfer protein EARLI 1-like   95.5    7e-21   
ref|NP_176440.1|  bifunctional inhibitor/lipid-transfer protein/s...  95.9    9e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004245748.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  95.5    1e-20   
ref|XP_003549906.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  95.1    1e-20   
ref|XP_004516838.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  95.9    1e-20   
ref|XP_010433379.1|  PREDICTED: lipid transfer protein EARLI 1-like   95.1    1e-20   
ref|XP_008437107.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  95.1    1e-20   
ref|NP_001235642.1|  uncharacterized protein LOC100500016 precursor   94.7    2e-20   
ref|XP_007039887.1|  Bifunctional inhibitor/lipid-transfer protei...  94.7    2e-20   
ref|XP_008786990.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  94.4    2e-20   
emb|CAA59472.1|  hybrid proline-rich protein                          94.7    2e-20   Catharanthus roseus [chatas]
ref|XP_009333674.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  94.7    2e-20   
emb|CDX90837.1|  BnaA03g25170D                                        93.6    2e-20   
emb|CAA81526.1|  14 kDa polypeptide                                   94.7    2e-20   Catharanthus roseus [chatas]
ref|XP_009134275.1|  PREDICTED: lipid transfer protein EARLI 1-like   94.4    2e-20   
ref|XP_009333598.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  94.4    2e-20   
gb|KFK25909.1|  hypothetical protein AALP_AA8G178400                  95.1    2e-20   
ref|XP_006396747.1|  hypothetical protein EUTSA_v10029313mg           94.4    2e-20   
ref|XP_010430305.1|  PREDICTED: lipid transfer protein EARLI 1        94.7    2e-20   
ref|XP_002874778.1|  hypothetical protein ARALYDRAFT_911651           94.4    2e-20   
ref|XP_009134276.1|  PREDICTED: putative lipid-binding protein AIR1   94.0    2e-20   
ref|XP_009333630.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  94.4    3e-20   
ref|XP_010553463.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  94.4    3e-20   
ref|XP_010473467.1|  PREDICTED: lipid transfer protein EARLI 1-like   94.7    3e-20   
ref|XP_010418243.1|  PREDICTED: lipid transfer protein EARLI 1-like   94.7    3e-20   
ref|XP_006302912.1|  hypothetical protein CARUB_v10021046mg           95.1    3e-20   
ref|XP_010053450.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    93.6    3e-20   
ref|XP_010422223.1|  PREDICTED: lipid transfer protein EARLI 1-li...  94.0    3e-20   
ref|XP_008808738.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  94.0    3e-20   
ref|XP_008338137.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  94.0    4e-20   
gb|KDP25645.1|  hypothetical protein JCGZ_20801                       94.0    4e-20   
emb|CDY31241.1|  BnaC08g15360D                                        93.6    4e-20   
ref|XP_010906607.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  93.2    5e-20   
gb|EPS71802.1|  hypothetical protein M569_02964                       94.0    5e-20   
ref|XP_011018292.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    93.6    5e-20   
ref|XP_010919519.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  93.6    5e-20   
ref|XP_003525814.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  93.2    5e-20   
gb|KHN04347.1|  14 kDa proline-rich protein DC2.15                    93.2    6e-20   
ref|XP_006477234.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  93.2    6e-20   
ref|XP_008381149.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  93.2    6e-20   
ref|XP_009589966.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  92.8    7e-20   
ref|XP_002874777.1|  hypothetical protein ARALYDRAFT_911650           93.6    7e-20   
ref|XP_010553464.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    92.8    8e-20   
gb|ACV74341.1|  proline-rich protein                                  92.8    8e-20   Jatropha curcas
ref|XP_006440346.1|  hypothetical protein CICLE_v10022839mg           92.8    8e-20   
ref|XP_002533292.1|  14 kDa proline-rich protein DC2.15 precursor...  92.8    9e-20   Ricinus communis
ref|XP_006289270.1|  hypothetical protein CARUB_v10002736mg           92.4    9e-20   
sp|P14009.1|14KD_DAUCA  RecName: Full=14 kDa proline-rich protein...  92.8    1e-19   Daucus carota [carrots]
ref|XP_003559027.1|  PREDICTED: putative glycine-rich cell wall s...  94.0    1e-19   
dbj|BAK05563.1|  predicted protein                                    94.0    1e-19   
ref|XP_010422226.1|  PREDICTED: putative lipid-binding protein AIR1   92.4    1e-19   
ref|XP_009382414.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  92.8    1e-19   
ref|XP_009110670.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    92.4    1e-19   
ref|XP_006368194.1|  HyPRP family protein                             92.4    1e-19   
ref|XP_010433333.1|  PREDICTED: putative lipid-binding protein AIR1   92.0    1e-19   
ref|NP_001235008.1|  uncharacterized protein LOC100499716 precursor   93.2    1e-19   
ref|XP_006440349.1|  hypothetical protein CICLE_v10022832mg           92.0    1e-19   
gb|KDP25650.1|  hypothetical protein JCGZ_20806                       92.0    1e-19   
emb|CDP09932.1|  unnamed protein product                              92.4    1e-19   
ref|XP_003549907.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  92.0    2e-19   
ref|XP_009376589.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  92.0    2e-19   
ref|XP_002533299.1|  14 kDa proline-rich protein DC2.15 precursor...  91.7    2e-19   Ricinus communis
ref|XP_006396750.1|  hypothetical protein EUTSA_v10029060mg           92.0    2e-19   
emb|CDY21275.1|  BnaC03g29590D                                        91.7    2e-19   
emb|CDY31240.1|  BnaC08g15350D                                        91.7    2e-19   
ref|XP_010053452.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  91.7    2e-19   
ref|XP_010933688.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  91.7    2e-19   
ref|XP_007209745.1|  hypothetical protein PRUPE_ppa013010mg           92.0    2e-19   
gb|KDO61485.1|  hypothetical protein CISIN_1g047179mg                 91.7    2e-19   
ref|XP_010493743.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  91.7    2e-19   
ref|XP_009375766.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  91.7    2e-19   
emb|CDY21276.1|  BnaC03g29600D                                        90.9    2e-19   
ref|XP_008238564.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  91.7    3e-19   
ref|XP_010695115.1|  PREDICTED: putative lipid-binding protein AIR1B  90.9    3e-19   
ref|XP_006304906.1|  hypothetical protein CARUB_v10011959mg           91.3    3e-19   
ref|XP_006477231.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.9    3e-19   
ref|XP_002529775.1|  14 kDa proline-rich protein DC2.15 precursor...  91.3    4e-19   Ricinus communis
ref|XP_011033953.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  91.3    4e-19   
ref|XP_010264242.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.9    4e-19   
gb|KFK28807.1|  hypothetical protein AALP_AA7G051200                  90.9    4e-19   
gb|EYU24741.1|  hypothetical protein MIMGU_mgv1a016172mg              90.9    4e-19   
ref|XP_006417265.1|  hypothetical protein EUTSA_v10009083mg           90.9    4e-19   
emb|CDY61290.1|  BnaCnng37610D                                        90.9    4e-19   
ref|XP_006417266.1|  hypothetical protein EUTSA_v10009061mg           90.9    4e-19   
ref|XP_002270769.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    90.9    4e-19   Vitis vinifera
ref|XP_003608748.1|  14 kDa proline-rich protein DC2.15               91.7    5e-19   
gb|KHN04345.1|  14 kDa proline-rich protein DC2.15                    91.3    5e-19   
gb|KDP25647.1|  hypothetical protein JCGZ_20803                       90.5    5e-19   
ref|XP_010906606.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.5    5e-19   
emb|CDY21034.1|  BnaA08g24910D                                        90.5    6e-19   
ref|XP_002892674.1|  hypothetical protein ARALYDRAFT_471359           90.5    6e-19   
gb|ACU21436.1|  unknown                                               91.3    6e-19   Glycine max [soybeans]
ref|XP_003525810.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  91.3    6e-19   
ref|XP_004165754.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.5    7e-19   
ref|XP_010093706.1|  hypothetical protein L484_019047                 90.1    7e-19   
ref|NP_172673.1|  extensin-like protein                               90.5    7e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010458633.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.5    7e-19   
gb|ADA67933.1|  putative 14 kDa proline-rich protein DC2.15           90.1    7e-19   Wolffia arrhiza
gb|EYU18564.1|  hypothetical protein MIMGU_mgv1a016162mg              90.1    7e-19   
gb|AAM75351.1|AF520576_1  extensin-like protein                       91.3    8e-19   Glycine max [soybeans]
ref|XP_008232588.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.1    8e-19   
ref|XP_006396753.1|  hypothetical protein EUTSA_v10029038mg           90.5    8e-19   
ref|XP_007155641.1|  hypothetical protein PHAVU_003G218900g           90.1    8e-19   
ref|XP_010258985.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.1    9e-19   
ref|XP_009148613.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.1    9e-19   
ref|XP_006286053.1|  hypothetical protein CARUB_v10007585mg           90.1    1e-18   
ref|NP_001237899.1|  uncharacterized protein LOC100527818 precursor   89.7    1e-18   
ref|XP_009134277.1|  PREDICTED: putative lipid-binding protein AIR1   89.4    1e-18   
ref|XP_009384469.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.7    1e-18   
ref|XP_010493734.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.7    1e-18   
ref|XP_009397884.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.7    1e-18   
ref|XP_004516836.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.1    1e-18   
ref|XP_007155640.1|  hypothetical protein PHAVU_003G218800g           91.3    1e-18   
ref|XP_004147199.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.4    1e-18   
ref|XP_010476166.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.7    1e-18   
gb|KFK43474.1|  hypothetical protein AALP_AA1G129700                  89.7    1e-18   
ref|XP_008392579.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.4    1e-18   
ref|XP_007155639.1|  hypothetical protein PHAVU_003G218800g           91.3    1e-18   
ref|XP_010455702.1|  PREDICTED: putative lipid-binding protein AIR1   89.4    2e-18   
ref|XP_010539616.1|  PREDICTED: lipid transfer protein EARLI 1-like   89.7    2e-18   
ref|XP_010919517.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.7    2e-18   
ref|XP_008238566.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.4    2e-18   
dbj|BAA11854.1|  extensin like protein                                89.4    2e-18   Populus nigra [black poplar]
ref|XP_009110671.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    89.0    2e-18   
ref|XP_004152410.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.0    2e-18   
emb|CDY16710.1|  BnaA09g20880D                                        88.2    2e-18   
ref|XP_002533294.1|  14 kDa proline-rich protein DC2.15 precursor...  89.0    2e-18   Ricinus communis
gb|ABF93505.1|  retrotransposon protein, putative, Ty1-copia subc...  89.7    3e-18   Oryza sativa Japonica Group [Japonica rice]
gb|EAY88189.1|  hypothetical protein OsI_09636                        89.7    3e-18   Oryza sativa Indica Group [Indian rice]
ref|NP_001048668.1|  Os03g0103300                                     89.7    3e-18   Oryza sativa Japonica Group [Japonica rice]
dbj|BAG50511.1|  qLTG-3-1                                             89.7    3e-18   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ08379.1|  qLTG3-1                                              89.7    3e-18   
ref|XP_008448867.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  88.6    3e-18   
ref|XP_008437101.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  88.6    3e-18   
ref|XP_008786992.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  88.6    3e-18   
dbj|BAJ08384.1|  qLTG3-1                                              89.7    3e-18   
dbj|BAJ08383.1|  qLTG3-1                                              89.7    3e-18   
dbj|BAJ08381.1|  qLTG3-1                                              89.7    3e-18   
dbj|BAJ08382.1|  qLTG3-1                                              89.7    4e-18   
dbj|BAJ08386.1|  qLTG3-1                                              89.7    4e-18   
ref|XP_010041938.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  87.8    4e-18   
ref|XP_009373377.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  88.2    4e-18   
ref|XP_004986077.1|  PREDICTED: putative glycine-rich cell wall s...  89.7    4e-18   
dbj|BAJ08385.1|  qLTG3-1                                              89.7    4e-18   
ref|XP_006306558.1|  hypothetical protein CARUB_v10012658mg           87.8    5e-18   
ref|XP_011070108.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  87.8    5e-18   
emb|CDP09930.1|  unnamed protein product                              87.8    5e-18   
gb|KCW71996.1|  hypothetical protein EUGRSUZ_E00449                   86.7    5e-18   
ref|XP_009411010.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  87.8    6e-18   
ref|XP_011081228.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  87.8    6e-18   
gb|KCW77747.1|  hypothetical protein EUGRSUZ_D02041                   87.4    6e-18   
ref|XP_010422221.1|  PREDICTED: lipid transfer protein EARLI 1        88.2    6e-18   
ref|XP_010448889.1|  PREDICTED: putative lipid-binding protein AIR1   87.8    6e-18   
ref|XP_009114615.1|  PREDICTED: putative lipid-binding protein AIR1   87.4    6e-18   
ref|XP_007155638.1|  hypothetical protein PHAVU_003G218700g           88.6    6e-18   
ref|XP_006366172.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  87.4    6e-18   
ref|XP_010053451.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  87.4    6e-18   
ref|XP_002874775.1|  hypothetical protein ARALYDRAFT_490053           88.6    6e-18   
emb|CDY21277.1|  BnaC03g29610D                                        87.0    6e-18   
emb|CDY64848.1|  BnaC05g49400D                                        87.8    6e-18   
tpg|DAA37198.1|  TPA: hypothetical protein ZEAMMB73_187029            87.8    7e-18   
gb|KCW77749.1|  hypothetical protein EUGRSUZ_D02043                   87.8    7e-18   
ref|XP_008669243.1|  PREDICTED: uncharacterized protein LOC103646289  89.0    7e-18   
gb|EPS73889.1|  hypothetical protein M569_00868                       87.4    7e-18   
ref|XP_007210550.1|  hypothetical protein PRUPE_ppa014094mg           86.3    8e-18   
ref|XP_010434049.1|  PREDICTED: putative lipid-binding protein AIR1   87.4    8e-18   
ref|NP_192985.1|  putative lipid transfer protein                     88.2    8e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010053449.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    87.0    9e-18   
gb|KHG02760.1|  14 kDa proline-rich DC2                               87.0    1e-17   
ref|XP_007218576.1|  hypothetical protein PRUPE_ppa013120mg           87.0    1e-17   
ref|XP_011081223.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  86.7    2e-17   
ref|XP_011081229.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  86.7    2e-17   
ref|XP_007052129.1|  Bifunctional inhibitor/lipid-transfer protei...  86.7    2e-17   
ref|XP_009626056.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  86.3    2e-17   
ref|XP_010439335.1|  PREDICTED: putative lipid-binding protein AIR1   86.3    2e-17   
ref|XP_002533291.1|  lipid binding protein, putative                  85.9    2e-17   Ricinus communis
ref|XP_002874776.1|  hypothetical protein ARALYDRAFT_911648           87.4    2e-17   
ref|XP_002867769.1|  hypothetical protein ARALYDRAFT_914370           86.3    2e-17   
emb|CBI31906.3|  unnamed protein product                              85.5    2e-17   
ref|XP_006413657.1|  hypothetical protein EUTSA_v10026536mg           86.3    2e-17   
ref|XP_004152413.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  85.9    2e-17   
ref|XP_002533293.1|  14 kDa proline-rich protein DC2.15 precursor...  85.9    2e-17   Ricinus communis
gb|KGN50238.1|  hypothetical protein Csa_5G161870                     85.9    3e-17   
ref|XP_009623719.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  85.9    3e-17   
ref|XP_009598876.1|  PREDICTED: lipid transfer protein EARLI 1-like   84.7    3e-17   
emb|CDX94516.1|  BnaC09g23200D                                        85.1    3e-17   
ref|XP_003608746.1|  14 kDa proline-rich protein DC2.15               85.9    3e-17   
ref|XP_004298650.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  85.9    3e-17   
tpg|DAA42812.1|  TPA: hypothetical protein ZEAMMB73_664289            87.0    3e-17   
ref|XP_004150818.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  85.9    3e-17   
ref|XP_006289530.1|  hypothetical protein CARUB_v10003073mg           86.3    3e-17   
ref|XP_010676148.1|  PREDICTED: pEARLI1-like lipid transfer prote...  86.3    4e-17   
ref|XP_006396754.1|  hypothetical protein EUTSA_v10029528mg           86.3    4e-17   
ref|XP_010529481.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  85.9    4e-17   
ref|NP_566036.1|  protease inhibitor/seed storage/lipid transfer ...  85.1    4e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008786991.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  85.1    5e-17   
ref|XP_008362163.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  85.5    5e-17   
ref|XP_010676151.1|  PREDICTED: putative lipid-binding protein AIR1B  85.1    5e-17   
ref|XP_010433390.1|  PREDICTED: lipid transfer protein EARLI 1-like   85.5    5e-17   
gb|EYU31726.1|  hypothetical protein MIMGU_mgv1a019851mg              84.7    5e-17   
ref|XP_008796819.1|  PREDICTED: lipid transfer protein EARLI 1-like   84.7    5e-17   
ref|NP_001152584.1|  cortical cell-delineating protein precursor      84.7    6e-17   Zea mays [maize]
ref|XP_008344389.1|  PREDICTED: lipid transfer protein EARLI 1-like   84.7    7e-17   
emb|CDY21274.1|  BnaC03g29580D                                        85.5    7e-17   
ref|XP_006295216.1|  hypothetical protein CARUB_v10024298mg           84.7    7e-17   
gb|AEX33654.1|  lipid transfer protein                                84.7    7e-17   
ref|XP_002454525.1|  hypothetical protein SORBIDRAFT_04g032660        84.3    7e-17   
gb|ADD11814.1|  hybrid proline-rich protein                           84.7    7e-17   
ref|NP_192987.1|  bifunctional inhibitor/lipid-transfer protein/s...  85.5    8e-17   
ref|XP_002454523.1|  hypothetical protein SORBIDRAFT_04g032640        84.0    8e-17   
ref|NP_001237995.1|  uncharacterized protein LOC100305616 precursor   84.3    9e-17   
ref|XP_003525817.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  84.3    9e-17   
ref|XP_010539605.1|  PREDICTED: putative lipid-binding protein AIR1   84.3    1e-16   
ref|XP_002271461.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    84.3    1e-16   
ref|XP_004251936.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  84.0    1e-16   
ref|XP_009114618.1|  PREDICTED: lipid transfer protein EARLI 1        85.1    1e-16   
gb|KFK31980.1|  hypothetical protein AALP_AA6G184800                  84.7    1e-16   
gb|AFK37038.1|  unknown                                               84.0    1e-16   
emb|CDX90833.1|  BnaA03g25130D                                        84.7    1e-16   
ref|XP_010264240.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  84.0    1e-16   
ref|XP_010093705.1|  hypothetical protein L484_019046                 83.6    1e-16   
ref|NP_001235511.1|  uncharacterized protein LOC100500518 precursor   84.0    1e-16   
ref|NP_192986.1|  Bifunctional inhibitor/lipid-transfer protein/s...  85.1    1e-16   
ref|XP_009134272.1|  PREDICTED: lipid transfer protein EARLI 1-like   84.7    1e-16   
gb|KHN09801.1|  14 kDa proline-rich protein DC2.15                    82.8    1e-16   
ref|XP_008437103.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  84.0    1e-16   
ref|NP_192984.1|  azelaic acid induced 1                              84.3    2e-16   
ref|XP_003609035.1|  Proline-rich protein                             83.6    2e-16   
gb|AAK30571.1|AF346659_1  extensin-like protein                       84.0    2e-16   
ref|XP_010055513.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  83.6    2e-16   
ref|XP_006289038.1|  hypothetical protein CARUB_v10002422mg           84.0    2e-16   
ref|XP_009338026.1|  PREDICTED: vegetative cell wall protein gp1-...  86.7    2e-16   
ref|XP_004171279.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  83.6    2e-16   
ref|XP_010657904.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    85.1    2e-16   
ref|XP_008448871.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  83.6    2e-16   
ref|XP_006445312.1|  hypothetical protein CICLE_v10022835mg           83.2    2e-16   
ref|XP_002454524.1|  hypothetical protein SORBIDRAFT_04g032650        83.2    2e-16   
ref|XP_006289359.1|  hypothetical protein CARUB_v10002845mg           82.8    2e-16   
ref|XP_010422216.1|  PREDICTED: pEARLI1-like lipid transfer prote...  84.0    2e-16   
ref|XP_010493725.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  83.6    2e-16   
ref|NP_001238461.1|  uncharacterized protein LOC100499693 precursor   83.2    2e-16   
ref|XP_008437105.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  83.2    3e-16   
ref|XP_010919518.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  82.8    3e-16   
gb|KHN09805.1|  14 kDa proline-rich protein DC2.15                    82.8    3e-16   
ref|XP_006579357.1|  PREDICTED: uncharacterized protein LOC100499...  82.8    3e-16   
ref|NP_001047650.1|  Os02g0662000                                     82.8    3e-16   
emb|CDX94514.1|  BnaC09g23220D                                        83.6    4e-16   
gb|ADU20204.1|  hypothetical protein                                  82.4    4e-16   
ref|NP_001235027.1|  uncharacterized protein LOC100500229 precursor   82.4    4e-16   
ref|XP_009333632.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  82.8    4e-16   
ref|XP_008437102.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  82.8    4e-16   
ref|NP_001053511.1|  Os04g0554500                                     82.4    4e-16   
ref|NP_001235888.1|  uncharacterized protein LOC100500033 precursor   82.4    4e-16   
ref|XP_008437111.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  82.8    4e-16   
gb|KDP28790.1|  hypothetical protein JCGZ_14561                       82.4    4e-16   
ref|XP_004152415.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  82.4    4e-16   
gb|EAY95110.1|  hypothetical protein OsI_16927                        82.4    4e-16   
ref|XP_006396751.1|  hypothetical protein EUTSA_v10029036mg           82.8    5e-16   
ref|XP_006396752.1|  hypothetical protein EUTSA_v10029040mg           82.8    5e-16   
ref|NP_001053512.1|  Os04g0554600                                     82.4    5e-16   
ref|XP_006396746.1|  hypothetical protein EUTSA_v10029045mg           82.4    5e-16   
ref|XP_010088890.1|  hypothetical protein L484_020878                 82.0    6e-16   
emb|CDX82944.1|  BnaC01g13940D                                        82.0    6e-16   
ref|XP_009346905.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  82.4    6e-16   
ref|XP_010422218.1|  PREDICTED: lipid transfer protein EARLI 1-like   82.4    6e-16   
ref|XP_006375281.1|  hypothetical protein POPTR_0014s05870g           82.0    6e-16   
gb|ABK95307.1|  unknown                                               82.0    6e-16   
gb|KDP25648.1|  hypothetical protein JCGZ_20804                       84.3    6e-16   
ref|XP_010539640.1|  PREDICTED: lipid transfer protein EARLI 1-like   82.0    6e-16   
ref|XP_006290087.1|  hypothetical protein CARUB_v10003726mg           81.6    6e-16   
ref|XP_004298648.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  82.0    6e-16   
ref|XP_004152411.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  82.0    6e-16   
ref|XP_009346906.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  82.0    7e-16   
ref|XP_010455697.1|  PREDICTED: lipid transfer protein EARLI 1-like   82.0    7e-16   
ref|XP_003608741.1|  Cortical cell-delineating protein                81.6    7e-16   
ref|XP_010258988.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  81.6    7e-16   
ref|XP_009135928.1|  PREDICTED: putative lipid-binding protein AIR1   81.6    8e-16   
ref|XP_010433403.1|  PREDICTED: pEARLI1-like lipid transfer prote...  82.4    8e-16   
ref|XP_002511665.1|  14 kDa proline-rich protein DC2.15 precursor...  81.6    8e-16   
gb|AFW63295.1|  cortical cell-delineating protein                     81.6    8e-16   
ref|XP_006290090.1|  hypothetical protein CARUB_v10003735mg           80.9    9e-16   
ref|XP_004152412.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  81.6    9e-16   
gb|KDP25651.1|  hypothetical protein JCGZ_20807                       83.6    1e-15   
gb|EYU30297.1|  hypothetical protein MIMGU_mgv1a015941mg              81.6    1e-15   
ref|XP_004165755.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  81.6    1e-15   
gb|AFK47547.1|  unknown                                               81.6    1e-15   
ref|XP_010455695.1|  PREDICTED: pEARLI1-like lipid transfer prote...  82.0    1e-15   
ref|XP_007209690.1|  hypothetical protein PRUPE_ppa012402mg           82.0    1e-15   
emb|CDP05328.1|  unnamed protein product                              80.9    1e-15   
ref|XP_010433400.1|  PREDICTED: lipid transfer protein EARLI 1-like   81.6    1e-15   
ref|NP_001152585.1|  LOC100286225 precursor                           80.9    1e-15   
ref|XP_008238565.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.5    1e-15   
ref|XP_008646032.1|  PREDICTED: cortical cell-delineating protein...  80.9    2e-15   
ref|XP_010518131.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.9    2e-15   
ref|XP_008238562.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.9    2e-15   
gb|AFK47889.1|  unknown                                               80.1    2e-15   
ref|XP_006289684.1|  hypothetical protein CARUB_v10003241mg           80.9    2e-15   
ref|XP_004169260.1|  PREDICTED: putative lipid-binding protein At...  82.0    2e-15   
gb|KGN50240.1|  hypothetical protein Csa_5G161890                     80.9    2e-15   
ref|XP_002880164.1|  hypothetical protein ARALYDRAFT_483654           80.5    2e-15   
ref|XP_009801825.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.5    2e-15   
ref|XP_007155637.1|  hypothetical protein PHAVU_003G218600g           80.5    2e-15   
gb|KDP25644.1|  hypothetical protein JCGZ_20800                       80.1    2e-15   
ref|XP_009796139.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.9    2e-15   
ref|XP_010264239.1|  PREDICTED: putative lipid-binding protein At...  80.1    2e-15   
ref|XP_011076346.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.9    3e-15   
ref|XP_010455696.1|  PREDICTED: lipid transfer protein EARLI 1-like   80.9    3e-15   
ref|XP_009600481.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  80.9    3e-15   
dbj|BAA13150.1|  NT16 polypeptide                                     80.9    3e-15   
ref|XP_004235151.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.3    3e-15   
ref|XP_006289892.1|  hypothetical protein CARUB_v10003507mg           80.9    3e-15   
ref|XP_010544621.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    80.1    4e-15   
emb|CDX79156.1|  BnaA01g12230D                                        79.7    4e-15   
ref|XP_006289150.1|  hypothetical protein CARUB_v10002588mg           80.9    4e-15   
ref|XP_006286641.1|  hypothetical protein CARUB_v10002511mg           79.0    4e-15   
ref|XP_002436327.1|  hypothetical protein SORBIDRAFT_10g000510        79.7    4e-15   
ref|XP_004976456.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.3    4e-15   
ref|XP_004291444.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.7    5e-15   
ref|XP_004516837.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.3    5e-15   
dbj|BAA05471.1|  tumor-related protein                                78.2    5e-15   
ref|XP_009796138.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.7    5e-15   
ref|XP_010422217.1|  PREDICTED: lipid transfer protein EARLI 1-like   80.1    6e-15   
ref|XP_009783445.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.7    6e-15   
ref|XP_004165505.1|  PREDICTED: LOW QUALITY PROTEIN: 14 kDa proli...  79.3    6e-15   
ref|XP_010506455.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.0    6e-15   
ref|XP_009617786.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.3    7e-15   
ref|XP_011018291.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    79.0    7e-15   
ref|XP_009399043.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.0    8e-15   
ref|XP_004516834.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.0    8e-15   
ref|NP_001152564.1|  cortical cell-delineating protein precursor      78.6    9e-15   
ref|XP_009782706.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  79.3    9e-15   
ref|XP_011033419.1|  PREDICTED: putative lipid-binding protein At...  78.6    9e-15   
ref|XP_009401672.1|  PREDICTED: pEARLI1-like lipid transfer prote...  78.6    1e-14   
ref|XP_008448870.1|  PREDICTED: lipid transfer protein EARLI 1-like   80.1    1e-14   
ref|XP_003546415.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  78.6    1e-14   
ref|XP_002466039.1|  hypothetical protein SORBIDRAFT_01g050420        78.6    1e-14   
ref|XP_002446914.1|  hypothetical protein SORBIDRAFT_06g024780        78.2    1e-14   
ref|XP_009397888.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  78.2    1e-14   
ref|XP_002446915.1|  hypothetical protein SORBIDRAFT_06g024790        78.2    1e-14   
ref|XP_008663526.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  78.2    1e-14   
ref|NP_001152587.1|  cortical cell-delineating protein precursor      78.2    1e-14   
ref|XP_008648736.1|  PREDICTED: pEARLI1-like lipid transfer prote...  78.2    1e-14   
ref|XP_004976455.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.8    1e-14   
ref|XP_010456924.1|  PREDICTED: putative lipid-binding protein AIR1   77.4    1e-14   
ref|XP_002454527.1|  hypothetical protein SORBIDRAFT_04g032680        77.8    1e-14   
ref|XP_007039884.1|  Bifunctional inhibitor/lipid-transfer protei...  78.2    2e-14   
ref|XP_009798259.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  78.2    2e-14   
ref|XP_003526352.1|  PREDICTED: extensin-like                         79.7    2e-14   
ref|XP_004976453.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.8    2e-14   
ref|XP_006368193.1|  hypothetical protein POPTR_0001s00400g           77.8    2e-14   
gb|KHN04344.1|  14 kDa proline-rich protein DC2.15                    77.4    2e-14   
ref|XP_009619251.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  78.2    2e-14   
ref|XP_009619252.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  78.2    2e-14   
ref|XP_007218581.1|  hypothetical protein PRUPE_ppa013196mg           77.8    2e-14   
ref|XP_004976454.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.4    2e-14   
gb|KFK37310.1|  hypothetical protein AALP_AA4G240600                  77.4    2e-14   
ref|XP_007155643.1|  hypothetical protein PHAVU_003G219100g           77.4    2e-14   
ref|XP_009795761.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.8    2e-14   
ref|XP_009611018.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.4    3e-14   
ref|XP_009795760.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.8    3e-14   
ref|XP_007011824.1|  Bimodular protein                                77.4    3e-14   
ref|XP_010433300.1|  PREDICTED: putative lipid-binding protein AIR1   76.6    3e-14   
ref|XP_002529777.1|  14 kDa proline-rich protein DC2.15 precursor...  77.0    3e-14   
ref|XP_004235416.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.6    3e-14   
ref|XP_004151035.1|  PREDICTED: uncharacterized protein LOC101220...  79.0    3e-14   
ref|XP_010431835.1|  PREDICTED: putative lipid-binding protein AIR1   76.3    3e-14   
ref|XP_004235149.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.3    3e-14   
ref|XP_010431799.1|  PREDICTED: putative lipid-binding protein AIR1   76.3    4e-14   
ref|XP_004235150.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.3    4e-14   
gb|ADW80126.1|  hybrid proline-rich protein                           76.6    4e-14   
gb|EMS52512.1|  14 kDa proline-rich protein DC2.15                    77.0    4e-14   
ref|XP_006847372.1|  hypothetical protein AMTR_s01045p00008470        77.0    4e-14   
ref|XP_010455705.1|  PREDICTED: pEARLI1-like lipid transfer prote...  77.4    4e-14   
ref|NP_849366.1|  Bifunctional inhibitor/lipid-transfer protein/s...  76.3    4e-14   
dbj|BAA99575.1|  DC2.15 like protein                                  76.6    4e-14   
ref|NP_192992.1|  auxin-Induced in Root cultures 1                    76.3    4e-14   
ref|XP_004151036.1|  PREDICTED: uncharacterized protein LOC101220...  78.2    4e-14   
ref|XP_006652622.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.3    5e-14   
ref|XP_008232586.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.6    5e-14   
ref|XP_009795762.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  77.0    5e-14   
ref|XP_010433312.1|  PREDICTED: putative lipid-binding protein AIR1   76.6    5e-14   
gb|KDP34267.1|  hypothetical protein JCGZ_12836                       75.9    6e-14   
gb|AAX20042.1|  proline-rich protein                                  76.3    6e-14   
ref|XP_010508203.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.3    6e-14   
emb|CAN80712.1|  hypothetical protein VITISV_033379                   76.6    6e-14   
ref|XP_010422379.1|  PREDICTED: putative lipid-binding protein AIR1   75.5    6e-14   
emb|CDP18670.1|  unnamed protein product                              76.6    6e-14   
dbj|BAB16428.1|  P-rich protein EIG-I30                               76.6    6e-14   
gb|AAM63191.1|  putative cell wall-plasma membrane disconnecting ...  75.9    6e-14   
ref|XP_004245729.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  76.3    6e-14   
dbj|BAK03206.1|  predicted protein                                    76.3    7e-14   
ref|XP_006397698.1|  hypothetical protein EUTSA_v10001680mg           76.3    7e-14   
ref|XP_007137003.1|  hypothetical protein PHAVU_009G092000g           76.6    7e-14   
ref|XP_010431811.1|  PREDICTED: putative lipid-binding protein AIR1   75.5    7e-14   
ref|XP_004235155.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.5    7e-14   
gb|KFK43475.1|  hypothetical protein AALP_AA1G129800                  75.9    9e-14   
gb|KGN55880.1|  hypothetical protein Csa_3G026160                     79.0    1e-13   
ref|NP_001275620.1|  uncharacterized protein LOC102590907 precursor   75.5    1e-13   
ref|XP_002285197.1|  PREDICTED: putative lipid-binding protein At...  75.5    1e-13   
ref|XP_010456925.1|  PREDICTED: putative lipid-binding protein AIR1   74.7    1e-13   
ref|XP_002464967.1|  hypothetical protein SORBIDRAFT_01g029610        75.1    1e-13   
ref|XP_010676152.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.9    1e-13   
ref|NP_199500.1|  bifunctional inhibitor/lipid-transfer protein/s...  75.5    1e-13   
ref|XP_006357014.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.5    1e-13   
ref|XP_002446913.1|  hypothetical protein SORBIDRAFT_06g024770        75.5    1e-13   
ref|XP_010433325.1|  PREDICTED: putative lipid-binding protein AIR1B  74.7    1e-13   
ref|XP_010422228.1|  PREDICTED: putative lipid-binding protein AIR1   75.5    1e-13   
gb|AAM62750.1|  extA                                                  75.1    1e-13   
ref|XP_010455703.1|  PREDICTED: putative lipid-binding protein AIR1B  74.7    1e-13   
ref|XP_010422227.1|  PREDICTED: putative lipid-binding protein AIR1B  74.7    1e-13   
ref|XP_010695114.1|  PREDICTED: lipid transfer protein EARLI 1-like   76.3    1e-13   
ref|XP_003603362.1|  Proline-rich protein                             75.1    1e-13   
gb|KFK31983.1|  hypothetical protein AALP_AA6G185000                  77.0    2e-13   
emb|CAN77080.1|  hypothetical protein VITISV_025477                   74.7    2e-13   
ref|XP_010264241.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.1    2e-13   
ref|XP_010458632.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.1    2e-13   
ref|XP_004245730.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.1    2e-13   
ref|XP_010493717.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.1    2e-13   
ref|XP_006355500.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  75.1    2e-13   
gb|KHN08148.1|  Putative lipid-binding protein                        75.9    2e-13   
ref|XP_003588785.1|  14 kDa proline-rich protein DC2.15               75.1    2e-13   
gb|AAC62610.1|  similar to the C-terminus of putative plasma memb...  74.3    2e-13   
ref|XP_010099842.1|  hypothetical protein L484_008499                 74.7    2e-13   
emb|CDX95635.1|  BnaC03g25160D                                        74.7    2e-13   



>ref|XP_009591583.1| PREDICTED: pEARLI1-like lipid transfer protein 1 [Nicotiana tomentosiformis]
Length=135

 Score =   120 bits (300),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 111/133 (83%), Gaps = 6/133 (5%)
 Frame = +3

Query  81   RAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcp------tDALKLGVC  242
            ++ ALFLV NILFFT VSAC+TCP PKPKPKPKP P P             TDALKLGVC
Sbjct  3    KSLALFLVFNILFFTVVSACSTCPGPKPKPKPKPKPKPCPPPPSSQGGKCPTDALKLGVC  62

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            ANVLNGLLN+T+G PP KPCCSLIENLVDLEAAVCLCTA+KANILGINLN+P+SL+LLLN
Sbjct  63   ANVLNGLLNVTLGTPPVKPCCSLIENLVDLEAAVCLCTALKANILGINLNLPISLNLLLN  122

Query  423  VCSKKVPKGFTCP  461
            VCSKK PKGFTCP
Sbjct  123  VCSKKAPKGFTCP  135



>ref|XP_009782252.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=133

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 108/131 (82%), Gaps = 4/131 (3%)
 Frame = +3

Query  81   RAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcp----tDALKLGVCAN  248
            ++ ALFLV NI+FFT VSAC+TCP P PKPKPKP P P           TDALKLGVCAN
Sbjct  3    KSLALFLVFNIVFFTVVSACSTCPGPGPKPKPKPKPCPPPPSSQGGKCPTDALKLGVCAN  62

Query  249  VLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslslllnVC  428
            VLNGLLN+T+G PP KPCCSLI NLVDLEAAVCLCTA+KANIL INLN+P+SL+LLLNVC
Sbjct  63   VLNGLLNVTLGTPPVKPCCSLIGNLVDLEAAVCLCTALKANILSINLNLPISLNLLLNVC  122

Query  429  SKKVPKGFTCP  461
            SKK PKGFTCP
Sbjct  123  SKKAPKGFTCP  133



>dbj|BAF46299.1| extensin like protein [Ipomoea nil]
Length=133

 Score =   118 bits (295),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            M SK T   ALF+V NILF T VSAC TCPSPKPKPKPKPTP+PS+KGKCP DALKLGVC
Sbjct  1    MASKKTSVLALFIVFNILFCTMVSACGTCPSPKPKPKPKPTPSPSNKGKCPKDALKLGVC  60

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            ANVL  LL + +GNPPKKPCCSLIE LVDLEAAVCLCTAIKANILGINLN+PLSLSLLLN
Sbjct  61   ANVLGNLLGLVVGNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILGINLNVPLSLSLLLN  120

Query  423  VCSKKVPKGFTCP  461
            VC KKVP GF CP
Sbjct  121  VCGKKVPSGFQCP  133



>ref|XP_009601879.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=128

 Score =   118 bits (295),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 109/127 (86%), Gaps = 1/127 (1%)
 Frame = +3

Query  81   RAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVCANVLNG  260
            ++ ALFLV NILFFT VSACNTCPSPKP PKP P P+PS       DALKLGVCANVLNG
Sbjct  3    KSLALFLVFNILFFTVVSACNTCPSPKPTPKPTPNPSPSEGKCPT-DALKLGVCANVLNG  61

Query  261  LLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslslllnVCSKKV  440
            LLN+T+G PP KPCCSLI NLVDLEAAVCLCTA+KANILGINLNIP+SLSLLLNVCSK +
Sbjct  62   LLNVTLGTPPVKPCCSLIGNLVDLEAAVCLCTALKANILGINLNIPISLSLLLNVCSKDI  121

Query  441  PKGFTCP  461
            PKGF CP
Sbjct  122  PKGFACP  128



>ref|XP_009798258.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=135

 Score =   118 bits (295),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 109/133 (82%), Gaps = 6/133 (5%)
 Frame = +3

Query  81   RAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcp------tDALKLGVC  242
            ++ ALF++ NILFFT VSAC+TCP P PKPKPKP P P             TDALKLGVC
Sbjct  3    KSLALFVIFNILFFTVVSACSTCPGPSPKPKPKPKPKPCPPPPSSQGGKCPTDALKLGVC  62

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            ANVLNGLLN+T+G PP KPCCSLIENLVDLEAAVCLCTA+KA ILG+NLN+P+SL+LLLN
Sbjct  63   ANVLNGLLNVTLGTPPVKPCCSLIENLVDLEAAVCLCTALKAKILGVNLNLPISLNLLLN  122

Query  423  VCSKKVPKGFTCP  461
            VCSKK PKGFTCP
Sbjct  123  VCSKKAPKGFTCP  135



>ref|XP_009783170.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=126

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 102/127 (80%), Gaps = 3/127 (2%)
 Frame = +3

Query  81   RAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVCANVLNG  260
            ++ ALFLV NILFFT VSAC    +              S+GKCPTDALKLGVCANVLNG
Sbjct  3    KSLALFLVFNILFFTAVSAC---YTCPSPKAKPTPTPSPSEGKCPTDALKLGVCANVLNG  59

Query  261  LLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslslllnVCSKKV  440
            LLN+T+G PP KPCCSL+ NLVDLEAAVCLCTA+KANILGINLNIP+SLSLLLNVCSK +
Sbjct  60   LLNVTLGTPPVKPCCSLLGNLVDLEAAVCLCTALKANILGINLNIPISLSLLLNVCSKDI  119

Query  441  PKGFTCP  461
            PKGFTCP
Sbjct  120  PKGFTCP  126



>ref|XP_006440347.1| hypothetical protein CICLE_v10022825mg [Citrus clementina]
 ref|XP_006477232.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Citrus sinensis]
 gb|ESR53587.1| hypothetical protein CICLE_v10022825mg [Citrus clementina]
 gb|KDO61486.1| hypothetical protein CISIN_1g044385mg [Citrus sinensis]
Length=132

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            M SK++ + ALFL +NILFF  V+AC +CPSPKPKPKPKPTP+PS       DALKLGVC
Sbjct  1    MGSKTSASLALFLAVNILFFALVTACGSCPSPKPKPKPKPTPSPSGASCPR-DALKLGVC  59

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            ANVLNGLLN+TIG PP +PCC+LI+ L DLEAAVCLCTAIKANILGINLNIPLSLSLLLN
Sbjct  60   ANVLNGLLNVTIGTPPVQPCCTLIQGLADLEAAVCLCTAIKANILGINLNIPLSLSLLLN  119

Query  423  VCSKKVPKGFTC  458
            VCSK VP+GF C
Sbjct  120  VCSKSVPRGFQC  131



>emb|CDY08680.1| BnaC04g19890D [Brassica napus]
Length=137

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 100/137 (73%), Gaps = 5/137 (4%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACN-----tcpspkpkpkpkptptpsskgkcptDAL  227
            MDS++T A  +FL++NILFFTT+SAC      +                 +  KCP DAL
Sbjct  1    MDSRTTSALDIFLILNILFFTTISACGNCGCPSPKPKPNPEPKPTPSPSPATAKCPRDAL  60

Query  228  KLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplsl  407
            KLGVCANVLNGLLN+T+G PP +PCC+LI+ L DLEAA CLCTA+KANILG NLNIP+SL
Sbjct  61   KLGVCANVLNGLLNVTLGQPPVEPCCTLIKGLADLEAAACLCTALKANILGNNLNIPISL  120

Query  408  slllnVCSKKVPKGFTC  458
            SLLLNVCSKKVP GF C
Sbjct  121  SLLLNVCSKKVPPGFQC  137



>emb|CDP09931.1| unnamed protein product [Coffea canephora]
Length=129

 Score =   115 bits (287),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 97/129 (75%), Gaps = 5/129 (4%)
 Frame = +3

Query  72   KSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVCANV  251
             +TRA ALFL  N+LFFT  SA          P           GKCP DALKLGVCANV
Sbjct  5    NTTRAIALFLCFNVLFFTFASA-----CGGGCPPKPKPKPKPKPGKCPKDALKLGVCANV  59

Query  252  LNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslslllnVCS  431
            L+GLLNITIGNPPKKPCC+LI+ L DLEAAVCLCTAIKANILGINLNIPLSLSLLLNVCS
Sbjct  60   LSGLLNITIGNPPKKPCCTLIQGLADLEAAVCLCTAIKANILGINLNIPLSLSLLLNVCS  119

Query  432  KKVPKGFTC  458
            K VPKGF C
Sbjct  120  KNVPKGFVC  128



>ref|XP_009123402.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Brassica 
rapa]
Length=137

 Score =   114 bits (286),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 99/137 (72%), Gaps = 5/137 (4%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACN-----tcpspkpkpkpkptptpsskgkcptDAL  227
            M S++T + A+FL++NILFFTT+SAC                        +  KCP DAL
Sbjct  1    MSSRTTSSLAIFLILNILFFTTISACGNCGCPFPKPKPNPEPKPTPSPSPATAKCPRDAL  60

Query  228  KLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplsl  407
            KLGVCANVLNGLLN+T+G PP +PCC+LI+ L DLEAA CLCTA+KANILG NLNIP+SL
Sbjct  61   KLGVCANVLNGLLNVTLGQPPVEPCCTLIKGLADLEAAACLCTALKANILGNNLNIPISL  120

Query  408  slllnVCSKKVPKGFTC  458
            SLLLNVCSKKVP GF C
Sbjct  121  SLLLNVCSKKVPPGFQC  137



>emb|CDY32208.1| BnaA03g54590D [Brassica napus]
Length=137

 Score =   114 bits (286),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 100/137 (73%), Gaps = 5/137 (4%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACN-----tcpspkpkpkpkptptpsskgkcptDAL  227
            M S++T + A+FL++NILFFTT+SAC      +                 +  KCP DAL
Sbjct  1    MSSRTTSSLAIFLILNILFFTTISACGNCGCPSPKPKPNPEPKPTPSPSPATAKCPRDAL  60

Query  228  KLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplsl  407
            KLGVCANVLNGLLN+T+G PP +PCC+LI+ L DLEAA CLCTA+KANILG NLNIP+SL
Sbjct  61   KLGVCANVLNGLLNVTLGQPPVEPCCTLIKGLADLEAAACLCTALKANILGNNLNIPISL  120

Query  408  slllnVCSKKVPKGFTC  458
            SLLLNVCSKKVP GF C
Sbjct  121  SLLLNVCSKKVPPGFQC  137



>ref|XP_006355478.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=132

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 110/130 (85%), Gaps = 3/130 (2%)
 Frame = +3

Query  81   RAFALFLVINILFFTTVSACNt---cpspkpkpkpkptptpsskgkcptDALKLGVCANV  251
            ++ ALFLV N+LFFT VSAC T      P PKP P P+P+P+S+ KCP DALKLG+CANV
Sbjct  3    KSLALFLVFNVLFFTMVSACYTCPGPIKPNPKPTPTPSPSPNSQTKCPKDALKLGICANV  62

Query  252  LNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslslllnVCS  431
            LNGLLN+T+G PP KPCCSLI NLVDLEAAVCLCTA+KANILGINLNIP+SLSLLLNVCS
Sbjct  63   LNGLLNVTLGTPPVKPCCSLIGNLVDLEAAVCLCTALKANILGINLNIPISLSLLLNVCS  122

Query  432  KKVPKGFTCP  461
            K+ PKGF CP
Sbjct  123  KEAPKGFICP  132



>gb|ABG91752.1| HyPRP2 [Gossypium hirsutum]
Length=137

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 107/136 (79%), Gaps = 4/136 (3%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcp----tDALK  230
            M SK T + ALF  +NILFF+ VSAC +CPSP PKPKPKP P P+           DALK
Sbjct  1    MGSKRTASLALFFALNILFFSLVSACGSCPSPNPKPKPKPKPNPTPSPSSSGKCPRDALK  60

Query  231  LGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplsls  410
            LGVCA++L GLLN+TIG PP +PCCSLI+ L DLEAAVCLCTAIKANILGINLN+PLSLS
Sbjct  61   LGVCADLLGGLLNVTIGTPPVQPCCSLIQGLADLEAAVCLCTAIKANILGINLNVPLSLS  120

Query  411  lllnVCSKKVPKGFTC  458
            LLLNVCSKKVP GF C
Sbjct  121  LLLNVCSKKVPSGFQC  136



>ref|NP_001233824.1| arachidonic acid-induced DEA1 precursor [Solanum lycopersicum]
 gb|AAS80139.1| arachidonic acid-induced DEA1 [Solanum lycopersicum]
Length=138

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 107/137 (78%), Gaps = 4/137 (3%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcp----tDALK  230
            M SK T + ALF+++N+LFFT VSAC TCP PKPKPKPKP P P+           D LK
Sbjct  1    MASKRTTSLALFVLVNLLFFTLVSACGTCPGPKPKPKPKPKPKPTPSPSSKGKCPIDTLK  60

Query  231  LGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplsls  410
            LGVCANVL  LL + +GNPPKKPCCSLIE LVDLEAA+CLCTAIKANILGINLN+PLSLS
Sbjct  61   LGVCANVLGNLLGVVLGNPPKKPCCSLIEGLVDLEAALCLCTAIKANILGINLNVPLSLS  120

Query  411  lllnVCSKKVPKGFTCP  461
            LLLNVC KK P GF CP
Sbjct  121  LLLNVCGKKAPSGFQCP  137



>ref|XP_004245750.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum lycopersicum]
Length=131

 Score =   109 bits (273),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 98/129 (76%), Gaps = 1/129 (1%)
 Frame = +3

Query  75   STRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkc-ptDALKLGVCANV  251
            +  + ALFLV N+LFFT VSAC TCP P             +     P DALKLGVCANV
Sbjct  2    AKSSLALFLVFNVLFFTMVSACYTCPGPIKPNPKPTPSPSPNSQTKCPRDALKLGVCANV  61

Query  252  LNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslslllnVCS  431
            LNGLLN+T+G PP KPCCSL+ NLVDLEAAVCLCTA+KANILGINL+IP+SLSLLLNVC+
Sbjct  62   LNGLLNVTLGTPPVKPCCSLLGNLVDLEAAVCLCTALKANILGINLDIPISLSLLLNVCT  121

Query  432  KKVPKGFTC  458
            K+ PKGF C
Sbjct  122  KEAPKGFIC  130



>ref|XP_011001498.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Populus euphratica]
Length=132

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 101/133 (76%), Gaps = 1/133 (1%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            M SKST + ALFL +N+LFF+ V+A  +   P P           S GKCP DALKLGVC
Sbjct  1    MASKSTTSLALFLAVNLLFFSLVTA-KSSSCPPPPKPKPTPTPSPSGGKCPKDALKLGVC  59

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            A +L  LLN+T+G PP +PCCS+I+ L+DLEAAVCLCTAIKANILGINLNIP+SLSLLLN
Sbjct  60   AGLLGSLLNVTVGTPPVQPCCSVIQGLLDLEAAVCLCTAIKANILGINLNIPVSLSLLLN  119

Query  423  VCSKKVPKGFTCP  461
            VC KKVPKGF CP
Sbjct  120  VCGKKVPKGFQCP  132



>gb|ABQ88334.1| lipid transfer protein [Capsicum annuum]
Length=142

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 111/141 (79%), Gaps = 8/141 (6%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcp--------t  218
            M SK T   ALF+++N+LFF+ VSAC TCPSPKPKPKPKP PTP+ K             
Sbjct  1    MASKKTTTLALFILVNLLFFSLVSACGTCPSPKPKPKPKPKPTPTPKPTPSPGSKGKCPV  60

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLG+CANVL  LL + +GNPPKKPCCSLI+ LVDLEAA+CLCTA+KANILGINLN+P
Sbjct  61   DALKLGICANVLGNLLGVVLGNPPKKPCCSLIQGLVDLEAALCLCTALKANILGINLNVP  120

Query  399  lslslllnVCSKKVPKGFTCP  461
            +SLSLLLNVC KKVP GF CP
Sbjct  121  ISLSLLLNVCGKKVPSGFQCP  141



>emb|CAI51313.1| arachidonic acid-induced DEA1 [Capsicum chinense]
Length=142

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 111/141 (79%), Gaps = 8/141 (6%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcp--------t  218
            M SK T   ALF+++N+LFF+ VSAC TCPSPKPKPKPKP PTP+ K             
Sbjct  1    MASKKTTTLALFILVNLLFFSLVSACGTCPSPKPKPKPKPKPTPTPKPTPSPGSKGKCPI  60

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLG+CANVL  LL + +GNPPKKPCCSLI+ LVDLEAA+CLCTA+KANILGINLN+P
Sbjct  61   DALKLGICANVLGNLLGVVLGNPPKKPCCSLIQGLVDLEAALCLCTALKANILGINLNVP  120

Query  399  lslslllnVCSKKVPKGFTCP  461
            +SLSLLLNVC KKVP GF CP
Sbjct  121  ISLSLLLNVCGKKVPSGFQCP  141



>ref|XP_006355477.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=138

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 107/137 (78%), Gaps = 4/137 (3%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcp----tDALK  230
            M SK T + ALF+++N+LFFT VSAC TCPSPKPKPKPKP P P+           D LK
Sbjct  1    MASKRTTSLALFVLVNLLFFTLVSACGTCPSPKPKPKPKPKPKPTPSPSSKGKCPIDTLK  60

Query  231  LGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplsls  410
            LGVCANVL  +L + +GNPPKKPCCSLIE LVDLEAA+CLCTAIKANILGINLN+PLSLS
Sbjct  61   LGVCANVLGNVLGVVLGNPPKKPCCSLIEGLVDLEAALCLCTAIKANILGINLNVPLSLS  120

Query  411  lllnVCSKKVPKGFTCP  461
            LLLN C KK P GF CP
Sbjct  121  LLLNACGKKAPSGFQCP  137



>ref|XP_009795308.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=132

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            M SK T + ALF+++N+LFF+ VSAC TCPSPKPKPKPKP+P+PS       D LKLGVC
Sbjct  1    MASKKTTSLALFILVNLLFFSLVSACGTCPSPKPKPKPKPSPSPSKGKCPI-DTLKLGVC  59

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            ANVL  LL + IGNPPKKPCC+LI+ + DLEAAVCLCTAIKANILGINLN+PLSLSLLLN
Sbjct  60   ANVLGNLLGLVIGNPPKKPCCTLIQGVADLEAAVCLCTAIKANILGINLNVPLSLSLLLN  119

Query  423  VCSKKVPKGFTC  458
            VC KKVP GF C
Sbjct  120  VCGKKVPSGFQC  131



>gb|ABP35529.1| proline-rich protein [Ipomoea batatas]
Length=132

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 104/133 (78%), Gaps = 1/133 (1%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            M SK T   ALF+V NI F   VSAC TCPSPKPKPKPKPTP+P        DALKLGVC
Sbjct  1    MASKKTSVLALFIVFNIFFCPMVSACGTCPSPKPKPKPKPTPSPFKGKCPK-DALKLGVC  59

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            ANVL  LL + +GNPPKKPCCS IE LVDLEAAVCLCTAIKAN+LGINLN+PLSLSL LN
Sbjct  60   ANVLGNLLGLVVGNPPKKPCCSFIEGLVDLEAAVCLCTAIKANVLGINLNVPLSLSLFLN  119

Query  423  VCSKKVPKGFTCP  461
            VC KKVP GF CP
Sbjct  120  VCGKKVPFGFQCP  132



>ref|XP_006391856.1| hypothetical protein EUTSA_v10023747mg [Eutrema salsugineum]
 gb|ESQ29142.1| hypothetical protein EUTSA_v10023747mg [Eutrema salsugineum]
Length=147

 Score =   107 bits (267),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 99/147 (67%), Gaps = 15/147 (10%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACN---------------tcpspkpkpkpkptptps  197
            M S++T + ALFL++NILFFTT+SAC                                  
Sbjct  1    MASRTTTSLALFLILNILFFTTISACGNCGCPSPKPKHKPSHKPKPNPKPKPTPSPSPTP  60

Query  198  skgkcptDALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnil  377
            +  KCP DALKLGVCANVLNGLLNIT+G PP +PCC+LI+ L DLEAA CLCTA+K NIL
Sbjct  61   TTEKCPRDALKLGVCANVLNGLLNITLGKPPVEPCCNLIKGLADLEAAACLCTALKGNIL  120

Query  378  ginlniplslslllnVCSKKVPKGFTC  458
            GINLNIPLSLSLLLNVCSKKVP GF C
Sbjct  121  GINLNIPLSLSLLLNVCSKKVPPGFQC  147



>gb|AFK41425.1| unknown [Lotus japonicus]
Length=142

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 97/141 (69%), Gaps = 9/141 (6%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcp---------  215
            M SK+  + A+FL +N++FF+ VSACN+                      P         
Sbjct  1    MASKTCSSLAVFLTLNLIFFSLVSACNSGCPGPNPKPKPSPSPKPKPNPNPSPSSGGSCP  60

Query  216  tDALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlni  395
             DALKLGVCANVLNGLLN+T+G PP  PCC+L++ LVDLEAAVCLCTA+KANILGINLN+
Sbjct  61   RDALKLGVCANVLNGLLNVTLGQPPVTPCCTLLDGLVDLEAAVCLCTALKANILGINLNL  120

Query  396  plslslllnVCSKKVPKGFTC  458
            P+SLSLLLNVCSKKVP+ F C
Sbjct  121  PISLSLLLNVCSKKVPRDFQC  141



>ref|XP_004299470.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform 3 
[Fragaria vesca subsp. vesca]
Length=144

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 106/143 (74%), Gaps = 11/143 (8%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVS-ACNt----------cpspkpkpkpkptptpsskgk  209
            M S+ST + ALFLV+N+LFFT V+ ACNT           P P+P P P    TPS    
Sbjct  1    MASRSTASLALFLVVNLLFFTMVANACNTCPRPKPKPRPRPRPRPTPSPGTPSTPSGTAT  60

Query  210  cptDALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginl  389
            CP DALKLG+CANVLN LLN+TIG PP +PCC+LI+ L DLEAAVCLCTAI+A+ILGINL
Sbjct  61   CPRDALKLGICANVLNNLLNVTIGTPPVQPCCTLIQGLADLEAAVCLCTAIRASILGINL  120

Query  390  niplslslllnVCSKKVPKGFTC  458
            NIP++LSLLLN C  +VP+GF C
Sbjct  121  NIPIALSLLLNACGNQVPRGFQC  143



>emb|CAI48077.1| extensin-like protein [Capsicum chinense]
Length=137

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVLNGLLN+T+G PP +PCCSLIENLVDLEAAVCLCTA+KANILGI LN+P
Sbjct  57   DALKLGVCANVLNGLLNVTLGKPPVEPCCSLIENLVDLEAAVCLCTALKANILGIKLNLP  116

Query  399  lslslllnVCSKKVPKGFTCP  461
            +SL+LLLNVCSKK PKGFTCP
Sbjct  117  ISLNLLLNVCSKKAPKGFTCP  137



>ref|XP_011081227.1| PREDICTED: pEARLI1-like lipid transfer protein 1 [Sesamum indicum]
Length=139

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 107/138 (78%), Gaps = 6/138 (4%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcp------tDA  224
            M +K   + ALFLV+N++FFT  SAC TCP+PKPKPKPKP P        P       DA
Sbjct  1    MATKKQTSIALFLVLNLVFFTLSSACGTCPTPKPKPKPKPKPNCPPPPASPGKATCPRDA  60

Query  225  LKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnipls  404
            LKLGVCAN+L GL+++TIG PPK PCC+LIE L D+EAAVCLCTAIKAN+LGINLN+PLS
Sbjct  61   LKLGVCANLLGGLIDLTIGTPPKTPCCTLIEGLADVEAAVCLCTAIKANVLGINLNVPLS  120

Query  405  lslllnVCSKKVPKGFTC  458
            LSLLLNVCSKKVP GF C
Sbjct  121  LSLLLNVCSKKVPPGFQC  138



>ref|XP_007039886.1| 14 kDa proline-rich protein DC2.15, putative [Theobroma cacao]
 gb|EOY24387.1| 14 kDa proline-rich protein DC2.15, putative [Theobroma cacao]
Length=140

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 109/139 (78%), Gaps = 7/139 (5%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcpt-------D  221
            M SK + + ALF  +NILFF+ VSAC +CPSPKPKPKP P  +PS+    P+       D
Sbjct  1    MASKRSASLALFFALNILFFSLVSACGSCPSPKPKPKPTPCSSPSTPCPTPSGGGKCPRD  60

Query  222  ALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnipl  401
            ALKLG+CA++L GLLN+T+G PP +PCCSLI+ L DLEAAVCLCTAIKANILGINLNIP+
Sbjct  61   ALKLGICADLLGGLLNVTVGKPPVQPCCSLIQGLADLEAAVCLCTAIKANILGINLNIPV  120

Query  402  slslllnVCSKKVPKGFTC  458
            SLSLLLNVCSK VP GF C
Sbjct  121  SLSLLLNVCSKNVPSGFQC  139



>ref|XP_006369032.1| HyPRP family protein [Populus trichocarpa]
 gb|ERP65601.1| HyPRP family protein [Populus trichocarpa]
Length=132

 Score =   104 bits (260),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            M SKST + ALFL +N+LFF+ V+A      P P           S GKCP DALKLGVC
Sbjct  1    MASKSTTSLALFLAVNLLFFSLVTA-KRSSCPPPPKPKPTPTPSPSGGKCPKDALKLGVC  59

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            A++L  LLN+T+G PP +PCCSLI+ L+DLEAAVCLCTAIKANILGINLNIP+SLSLLLN
Sbjct  60   ADLLGSLLNVTVGTPPVEPCCSLIQGLLDLEAAVCLCTAIKANILGINLNIPVSLSLLLN  119

Query  423  VCSKKVPKGFTC  458
            VC KKVPK F C
Sbjct  120  VCGKKVPKDFQC  131



>gb|AAM47507.1| extensin-like protein [Citrus junos]
Length=143

 Score =   104 bits (260),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 107/127 (84%), Gaps = 1/127 (1%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            M SK++ + ALFL +NILFF  V+AC +CPSPKPKPKPKPTP+PS       DALKLGVC
Sbjct  1    MGSKTSASLALFLAVNILFFALVTACGSCPSPKPKPKPKPTPSPSGASCPR-DALKLGVC  59

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            ANVLNGLLN+TIG PP +PCC+LI+ L DLEAAVCLCTAIKANILGINLNIPLSLSLLLN
Sbjct  60   ANVLNGLLNVTIGTPPVQPCCTLIQGLADLEAAVCLCTAIKANILGINLNIPLSLSLLLN  119

Query  423  VCSKKVP  443
            VCSK  P
Sbjct  120  VCSKGCP  126



>ref|XP_002271619.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
Length=133

 Score =   104 bits (259),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            MDSKST + ALFL IN++ F  VS C+TCP PK KP P PTP   + G CP DALKLGVC
Sbjct  1    MDSKSTSSAALFLSINLVLFALVSGCDTCPQPKSKPTPTPTPANPNSGSCPIDALKLGVC  60

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            ANVL+GL+ + IG PP  PCC+L++ L+DLEAA+CLCTAIKANILGINL+I LSLSLL+N
Sbjct  61   ANVLSGLVGVVIGTPPDTPCCALLDGLLDLEAAICLCTAIKANILGINLDIHLSLSLLIN  120

Query  423  VCSKKVPKGFTC  458
             C K +PK F C
Sbjct  121  TCGKTLPKDFQC  132



>ref|XP_008808739.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=126

 Score =   103 bits (258),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 91/132 (69%), Gaps = 7/132 (5%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            M SK T AFALFL+ N L FT  SAC +CP          +           DALKLGVC
Sbjct  1    MASK-TSAFALFLIFNSLLFTFASACGSCPPKPSTTPSPSSGKCPI------DALKLGVC  53

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            A+VL GLLNITIG PPK+PCCSL+  LVDLE AVCLC AIKA+ILGINLNIP+ LSLL+N
Sbjct  54   ADVLGGLLNITIGTPPKEPCCSLLSGLVDLEVAVCLCIAIKASILGINLNIPVDLSLLVN  113

Query  423  VCSKKVPKGFTC  458
             C KKVP GF C
Sbjct  114  YCGKKVPSGFQC  125



>ref|XP_004306948.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Fragaria 
vesca subsp. vesca]
Length=135

 Score =   103 bits (257),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 98/131 (75%), Gaps = 0/131 (0%)
 Frame = +3

Query  66   DSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVCA  245
             SK+    AL L +NI+FFTTVSA +  P P P   PK  PTP +   CP D LKLGVCA
Sbjct  4    SSKAVATIALLLSLNIVFFTTVSANHYVPCPPPPKTPKHPPTPPAAATCPKDTLKLGVCA  63

Query  246  NVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslslllnV  425
            N+LN L+++ +G PPK PCCSLIE LVDLEAAVCLCTA+KAN+LGINLN+P+SLSLLLN 
Sbjct  64   NLLNDLVHLVVGTPPKTPCCSLIEGLVDLEAAVCLCTALKANVLGINLNVPISLSLLLNY  123

Query  426  CSKKVPKGFTC  458
            C K VP GF C
Sbjct  124  CGKGVPAGFQC  134



>ref|XP_004299469.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform 2 
[Fragaria vesca subsp. vesca]
Length=152

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 103/151 (68%), Gaps = 19/151 (13%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVS-ACNt------------------cpspkpkpkpkpt  185
            M S+ST + ALFLV+N+LFFT V+ ACNT                   P     P P   
Sbjct  1    MASRSTASLALFLVVNLLFFTMVANACNTCPRPKPKPRPRPRPRPTPSPGTPSTPSPGTP  60

Query  186  ptpsskgkcptDALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIK  365
             TPS    CP DALKLG+CANVLN LLN+TIG PP +PCC+LI+ L DLEAAVCLCTAI+
Sbjct  61   STPSGTATCPRDALKLGICANVLNNLLNVTIGTPPVQPCCTLIQGLADLEAAVCLCTAIR  120

Query  366  AnilginlniplslslllnVCSKKVPKGFTC  458
            A+ILGINLNIP++LSLLLN C  +VP+GF C
Sbjct  121  ASILGINLNIPIALSLLLNACGNQVPRGFQC  151



>gb|EYU30298.1| hypothetical protein MIMGU_mgv1a017316mg [Erythranthe guttata]
Length=82

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = -2

Query  454  VKPFGTFLLQTLRSKLRERGILRLIPRMFALMAVQRHTAASRSTRFSMRLQHGFLGGFPI  275
            +K FGTFL QTLRSKL ERG  R IPR FALMAVQR TAASRS   +MRLQHG  GG PI
Sbjct  1    MKSFGTFLEQTLRSKLSERGTFRFIPRTFALMAVQRQTAASRSANPAMRLQHGVFGGVPI  60

Query  274  VMLSNPFRTLAQTPNFRASVGH  209
            V   NP   L  TP+FR S G 
Sbjct  61   VRPINPPSKLVHTPSFRVSFGQ  82



>ref|XP_010055514.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
 gb|KCW71995.1| hypothetical protein EUGRSUZ_E00448 [Eucalyptus grandis]
Length=135

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 105/131 (80%), Gaps = 1/131 (1%)
 Frame = +3

Query  69   SKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkc-ptDALKLGVCA  245
            SKS+ + A+FL +N+LFF  VS+C TCP PKPKP PKP+P+        P DALKLGVCA
Sbjct  4    SKSSASLAIFLTLNLLFFALVSSCGTCPGPKPKPTPKPSPSSGPSTGACPRDALKLGVCA  63

Query  246  NVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslslllnV  425
            +VL  LLN+T+G PP  PCCSL+  LVDLEAAVCLCTAIKANILGINLNIP+SLSLLLNV
Sbjct  64   DVLGNLLNVTVGKPPVTPCCSLLNGLVDLEAAVCLCTAIKANILGINLNIPISLSLLLNV  123

Query  426  CSKKVPKGFTC  458
            CSK+VP GF C
Sbjct  124  CSKQVPPGFKC  134



>gb|KFK31985.1| hypothetical protein AALP_AA6G185200 [Arabis alpina]
Length=133

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            M SK + +  LFL  NILFFT  SAC++  +P  KPKPKPTP PSS GKCP D ++LGVC
Sbjct  1    MASKISASLTLFLTFNILFFTLTSACSSGCNPISKPKPKPTPNPSSSGKCPKDTIRLGVC  60

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            ANVL  LL I +G PP KPCCSLI+ LVDLEAA CLCTA+KAN+LGI LNIP+SL+LLLN
Sbjct  61   ANVLKDLLKIKLGTPPVKPCCSLIDGLVDLEAAACLCTALKANVLGIKLNIPISLNLLLN  120

Query  423  VCSKKVPKGFTC  458
            VC KKVP GF C
Sbjct  121  VCGKKVPSGFKC  132



>gb|AAD01800.1| HyPRP [Fragaria x ananassa]
 gb|AAS76505.1| HyPRP [Fragaria x ananassa]
Length=156

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 104/155 (67%), Gaps = 23/155 (15%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVS-ACNt----------------------cpspkpkpk  173
            M S+ST + ALFLV+N+LFFT V+ ACNT                       PSP     
Sbjct  1    MASRSTASLALFLVVNLLFFTMVANACNTCPRPKPKPRPRPRPTPSPGTPSTPSPGTPST  60

Query  174  pkptptpsskgkcptDALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLC  353
            P    TPS    CP DALKLG+CANVLN LLN+TIG PP +PCC+LI+ L DLEAAVCLC
Sbjct  61   PGTPSTPSGTATCPRDALKLGICANVLNNLLNVTIGTPPVQPCCTLIQGLADLEAAVCLC  120

Query  354  TAIKAnilginlniplslslllnVCSKKVPKGFTC  458
            TAI+A+ILGINLNIP++LSLLLN C  +VP+GF C
Sbjct  121  TAIRASILGINLNIPIALSLLLNACGNQVPRGFQC  155



>ref|XP_003608743.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula]
 gb|AES90940.1| Lipid transfer protein [Medicago truncatula]
 gb|AFK42391.1| unknown [Medicago truncatula]
Length=143

 Score =   101 bits (251),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 96/142 (68%), Gaps = 10/142 (7%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcp----------spkpkpkpkptptpsskgkc  212
            M SK+  + A+FL IN+LFF+ VSAC +                           S G C
Sbjct  1    MASKTCSSLAIFLTINLLFFSLVSACGSYSCNPTPNPTPKPKPRPNPNPNPNPTPSSGTC  60

Query  213  ptDALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginln  392
            P DALKLGVCANVL+GLLN+T+G PP  PCCSL+  LVDLEAA CLCTA+KANILGINLN
Sbjct  61   PRDALKLGVCANVLSGLLNLTLGKPPVTPCCSLLNGLVDLEAAACLCTALKANILGINLN  120

Query  393  iplslslllnVCSKKVPKGFTC  458
            +P+SLSLLLNVCS+KVP  F C
Sbjct  121  LPISLSLLLNVCSRKVPHDFQC  142



>ref|XP_009333597.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=145

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVLNGLLNIT+GNPP +PCCSLI+ LVDLEAAVCLCTAI+ANILGINLNIP
Sbjct  65   DTLKLGVCANVLNGLLNITVGNPPVQPCCSLIQGLVDLEAAVCLCTAIRANILGINLNIP  124

Query  399  lslslllnVCSKKVPKGFTC  458
            LSLSLLLNVC  KVPKGF C
Sbjct  125  LSLSLLLNVCGNKVPKGFQC  144



>gb|EYU30296.1| hypothetical protein MIMGU_mgv1a015783mg [Erythranthe guttata]
Length=146

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 98/143 (69%), Gaps = 12/143 (8%)
 Frame = +3

Query  66   DSKSTRAFALFLVINILFFTTVSACNt------------cpspkpkpkpkptptpsskgk  209
             +K+T   A+FLV+N+LFFT  SAC +                     P P   P  K  
Sbjct  3    SNKTTSIIAIFLVLNLLFFTFSSACGSCPDTPKPKPKPKPKPKPKPSCPPPPAGPGDKTT  62

Query  210  cptDALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginl  389
            CP DALKLGVCA++L GL+ +TIG+PPK PCCSLIE L DLEAAVCLCTAIKAN+LGINL
Sbjct  63   CPRDALKLGVCADLLGGLIGLTIGSPPKTPCCSLIEGLADLEAAVCLCTAIKANVLGINL  122

Query  390  niplslslllnVCSKKVPKGFTC  458
            N+P+SLSLLLNVCSK +P GF C
Sbjct  123  NVPISLSLLLNVCSKNIPPGFQC  145



>ref|XP_006289733.1| hypothetical protein CARUB_v10003301mg [Capsella rubella]
 gb|EOA22631.1| hypothetical protein CARUB_v10003301mg [Capsella rubella]
Length=135

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 97/134 (72%), Gaps = 2/134 (1%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcp--tDALKLG  236
            M SK +    LFL  NILFFT  +AC    SP PKPKPKP PTPS         D LKLG
Sbjct  1    MASKISAPLVLFLTFNILFFTLTTACGGGCSPVPKPKPKPKPTPSHSSTGSCPKDTLKLG  60

Query  237  VCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsll  416
            VCANVL  LL I +G PP KPCCSLI+ LVDLEAA CLCTAIKAN+LGINLN+P+SLSLL
Sbjct  61   VCANVLKDLLKIELGTPPVKPCCSLIKGLVDLEAAACLCTAIKANVLGINLNVPISLSLL  120

Query  417  lnVCSKKVPKGFTC  458
            LNVC KKVP GF C
Sbjct  121  LNVCGKKVPSGFVC  134



>ref|XP_009388037.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=129

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLG+CANVL GLLN+T+G PPK+PCCSL+E LVDLEAAVCLCTA+K N+LG+ LNIP
Sbjct  49   DALKLGICANVLRGLLNVTLGTPPKQPCCSLLEGLVDLEAAVCLCTALKGNVLGLKLNIP  108

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLL+N C KKVPKGF C
Sbjct  109  VSLSLLINYCGKKVPKGFLC  128



>ref|XP_006289141.1| hypothetical protein CARUB_v10002564mg [Capsella rubella]
 gb|EOA22039.1| hypothetical protein CARUB_v10002564mg [Capsella rubella]
Length=135

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 98/134 (73%), Gaps = 2/134 (1%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcp--tDALKLG  236
            M SK + +  +FL  NILFFT  +AC    SP PKPKPKP PTPS         D LKLG
Sbjct  1    MASKISASLVIFLTFNILFFTLTTACGGGCSPVPKPKPKPKPTPSHSSTGSCPKDTLKLG  60

Query  237  VCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsll  416
            VCANVL  LL I +G PP KPCCSLI+ LVDLEAA CLCTAIKAN+LGINLN+P+SLSLL
Sbjct  61   VCANVLKDLLKIELGTPPVKPCCSLIKGLVDLEAAACLCTAIKANVLGINLNVPVSLSLL  120

Query  417  lnVCSKKVPKGFTC  458
            LNVC KKVP GF C
Sbjct  121  LNVCGKKVPSGFKC  134



>ref|XP_009333675.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=153

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVLNGLLNIT+GNPP +PCCSLI+ LVDLEAAVCLCTAI+ANILGINLNIP
Sbjct  73   DTLKLGVCANVLNGLLNITVGNPPVQPCCSLIQGLVDLEAAVCLCTAIRANILGINLNIP  132

Query  399  lslslllnVCSKKVPKGFTC  458
            LSLSLLLNVC  KVP+GF C
Sbjct  133  LSLSLLLNVCGNKVPRGFQC  152



>ref|XP_006355479.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=131

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVL+GLLN+T+G PP KPCCSLI NLVDLEAAVCLCTA+KANILGINLNIP
Sbjct  51   DALKLGVCANVLSGLLNVTLGTPPVKPCCSLIGNLVDLEAAVCLCTALKANILGINLNIP  110

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCSK VPKGF C
Sbjct  111  ISLSLLLNVCSKDVPKGFIC  130



>ref|NP_001237154.1| uncharacterized protein LOC100500124 precursor [Glycine max]
 gb|ACU15034.1| unknown [Glycine max]
Length=136

 Score = 98.6 bits (244),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 108/136 (79%), Gaps = 5/136 (4%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtc----pspkpkpkpkptptpsskgkcptDALK  230
            M SK+  + ALFL +N++FF+ VSAC       P+PKP+P P P P PS  G CP DALK
Sbjct  1    MASKTCSSLALFLTLNLIFFSLVSACGYTPCPGPNPKPRPNPNPNPNPSPSGSCPRDALK  60

Query  231  LGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplsls  410
            LGVCANVLN L+N+T+G PP  PCC+L++ LVDLEAAVCLCTA+KANILGINLN+P+SLS
Sbjct  61   LGVCANVLN-LVNVTLGQPPVTPCCTLLDGLVDLEAAVCLCTALKANILGINLNLPISLS  119

Query  411  lllnVCSKKVPKGFTC  458
            LLL+VCS+KVP+ F C
Sbjct  120  LLLDVCSRKVPRDFQC  135



>gb|ACE82175.1| extensin-like protein [Glycine max]
 gb|KHN04348.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=136

 Score = 98.6 bits (244),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 108/136 (79%), Gaps = 5/136 (4%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtc----pspkpkpkpkptptpsskgkcptDALK  230
            M SK+  + ALFL +N++FF+ VSAC       P+PKP+P P P P PS  G CP DALK
Sbjct  1    MASKTCSSLALFLTLNLIFFSLVSACGYTPCPGPNPKPRPNPNPNPNPSPSGSCPRDALK  60

Query  231  LGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplsls  410
            LGVCANVLN L+N+T+G PP  PCC+L++ LVDLEAAVCLCTA+KANILGINLN+P+SLS
Sbjct  61   LGVCANVLN-LVNVTLGQPPVTPCCTLLDGLVDLEAAVCLCTALKANILGINLNLPISLS  119

Query  411  lllnVCSKKVPKGFTC  458
            LLLNVCS+KVP+ F C
Sbjct  120  LLLNVCSRKVPRDFQC  135



>ref|XP_008392581.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=137

 Score = 98.2 bits (243),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVLNGLLNITIG PP +PCCSLI+ L DLEAAVCLCTAIKANILGINLNIP
Sbjct  57   DTLKLGVCANVLNGLLNITIGKPPVEPCCSLIQGLADLEAAVCLCTAIKANILGINLNIP  116

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVC  KVPKGF C
Sbjct  117  ISLSLLLNVCGNKVPKGFQC  136



>ref|XP_004299468.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform 1 
[Fragaria vesca subsp. vesca]
Length=166

 Score = 99.0 bits (245),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 104/165 (63%), Gaps = 33/165 (20%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVS-ACN--------------------------------  143
            M S+ST + ALFLV+N+LFFT V+ ACN                                
Sbjct  1    MASRSTASLALFLVVNLLFFTMVANACNTCPRPKPKPRPRPRPRPTPSPGTPSTPSPGTP  60

Query  144  tcpspkpkpkpkptptpsskgkcptDALKLGVCANVLNGLLNITIGNPPKKPCCSLIENL  323
            + PSP     P    TPS    CP DALKLG+CANVLN LLN+TIG PP +PCC+LI+ L
Sbjct  61   STPSPGTPSTPGTPSTPSGTATCPRDALKLGICANVLNNLLNVTIGTPPVQPCCTLIQGL  120

Query  324  VDLEAAVCLCTAIKAnilginlniplslslllnVCSKKVPKGFTC  458
             DLEAAVCLCTAI+A+ILGINLNIP++LSLLLN C  +VP+GF C
Sbjct  121  ADLEAAVCLCTAIRASILGINLNIPIALSLLLNACGNQVPRGFQC  165



>ref|XP_009388030.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=143

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLG+CANVL GLLN+T+G PPK+PCCSL+E LVDLEAAVCLCTA+K N+LG+ LNIP
Sbjct  63   DALKLGICANVLRGLLNVTLGTPPKQPCCSLLEGLVDLEAAVCLCTALKGNVLGLKLNIP  122

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLL+N C KKVPKGF C
Sbjct  123  VSLSLLINYCGKKVPKGFLC  142



>ref|XP_008786988.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=136

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DAL+LGVCANVL GL+N+ +GNPPKKPCCSL+E+LVDLEAAVCLCTAIKANILGINLN+P
Sbjct  56   DALELGVCANVLQGLINLQLGNPPKKPCCSLLEDLVDLEAAVCLCTAIKANILGINLNVP  115

Query  399  lslslllnVCSKKVPKGFTC  458
            + LSLLLN C KKVP G+ C
Sbjct  116  VDLSLLLNYCGKKVPAGYAC  135



>ref|XP_009113072.1| PREDICTED: lipid transfer protein EARLI 1 [Brassica rapa]
 emb|CDY19562.1| BnaC09g13410D [Brassica napus]
 emb|CDY12952.1| BnaA09g13220D [Brassica napus]
Length=147

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 95/147 (65%), Gaps = 15/147 (10%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACN---------------tcpspkpkpkpkptptps  197
            M S++    A+FL++NILF TT+SA                                   
Sbjct  1    MASRTKSFLAIFLILNILFCTTISAYGNCGCPSPKPKPHPSHKPKPNPKPRPTPTPTPSP  60

Query  198  skgkcptDALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnil  377
               KCP DALKLGVCANVL+GLLNIT+G PP KPCC+LI+ L DLEAA CLCTA+KANIL
Sbjct  61   VTAKCPRDALKLGVCANVLSGLLNITLGKPPVKPCCTLIKGLADLEAAACLCTALKANIL  120

Query  378  ginlniplslslllnVCSKKVPKGFTC  458
            GINLNIP+SLSLLLNVCSKKVP GF C
Sbjct  121  GINLNIPISLSLLLNVCSKKVPPGFQC  147



>ref|XP_008796820.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=124

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVL GL+N+ +G PPKKPCCSL+E LVDLEAAVCLCTA++ANILGI LN+P
Sbjct  44   DALKLGVCANVLKGLINLNLGKPPKKPCCSLLEGLVDLEAAVCLCTALRANILGIKLNLP  103

Query  399  lslslllnVCSKKVPKGFTCP  461
            + LSLLLN C KK PKGF CP
Sbjct  104  IHLSLLLNYCGKKTPKGFQCP  124



>ref|XP_002271593.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
 emb|CAN80709.1| hypothetical protein VITISV_033376 [Vitis vinifera]
 emb|CBI31903.3| unnamed protein product [Vitis vinifera]
Length=132

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 95/132 (72%), Gaps = 1/132 (1%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            MDSK + + ALFL IN+LFF  VSA N   SP        TP+  S G CP DALKLGVC
Sbjct  1    MDSKGSSSAALFLSINLLFFALVSA-NKPCSPPKPTPTPSTPSTPSNGSCPRDALKLGVC  59

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            A +LNG +   +G PP  PCCSL+E L+DLE A CLCTAIKANILGI+L+IP+SLSLL+N
Sbjct  60   AKLLNGTVGAVVGTPPVTPCCSLLEGLLDLEVAACLCTAIKANILGIHLDIPVSLSLLVN  119

Query  423  VCSKKVPKGFTC  458
            +C KK+PK F C
Sbjct  120  ICGKKLPKDFQC  131



>ref|NP_567391.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 ref|NP_567392.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 emb|CAB41721.1| pEARLI 1-like protein [Arabidopsis thaliana]
 emb|CAB41722.1| pEARLI 1-like protein [Arabidopsis thaliana]
 emb|CAB78294.1| pEARLI 1-like protein [Arabidopsis thaliana]
 emb|CAB78295.1| pEARLI 1-like protein [Arabidopsis thaliana]
 gb|AAO23622.1| At4g12520 [Arabidopsis thaliana]
 dbj|BAE99415.1| pEARLI 1-like protein [Arabidopsis thaliana]
 gb|AEE83141.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 gb|AEE83142.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=129

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 93/132 (70%), Gaps = 4/132 (3%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            M SK + +  +FL  NILFFT  +AC    S  PKPKPKP  T S       D LKLGVC
Sbjct  1    MASKISASLVIFLTFNILFFTLTTACGGGCSSTPKPKPKPKSTGSCPK----DTLKLGVC  56

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            ANVL  LL I +G PP KPCCSL+  LVDLEAA CLCTA+KA +LGINLN+P+SLSLLLN
Sbjct  57   ANVLKDLLKIQLGTPPVKPCCSLLNGLVDLEAAACLCTALKAKVLGINLNVPVSLSLLLN  116

Query  423  VCSKKVPKGFTC  458
            VC KKVP GF C
Sbjct  117  VCGKKVPSGFVC  128



>ref|XP_002874779.1| hypothetical protein ARALYDRAFT_911652 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51038.1| hypothetical protein ARALYDRAFT_911652 [Arabidopsis lyrata subsp. 
lyrata]
Length=129

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 95/132 (72%), Gaps = 4/132 (3%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            M SK++ +  +FL  NILFFT  +AC    SP PKPKPKP  T S       D LKLGVC
Sbjct  1    MASKTSASLVIFLTFNILFFTLTTACGGGCSPTPKPKPKPKSTGSCPR----DTLKLGVC  56

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            ANVL  LL I +G PP KPCCSL++ LVDLEAA CLCTA+KAN+LG  LN+P+SLSLLLN
Sbjct  57   ANVLKDLLKIQLGTPPVKPCCSLLKGLVDLEAAACLCTALKANVLGNKLNVPVSLSLLLN  116

Query  423  VCSKKVPKGFTC  458
            VC +KVP GF C
Sbjct  117  VCGRKVPSGFVC  128



>ref|XP_010422224.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 96/134 (72%), Gaps = 2/134 (1%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcp--tDALKLG  236
            M SK + +  +FL  NILFFT  +AC    SP PKPKP P PTPS         D LKLG
Sbjct  1    MASKMSASLVIFLTFNILFFTLTTACGGGCSPVPKPKPNPKPTPSHSSTGSCPRDTLKLG  60

Query  237  VCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsll  416
            VCANVL  LL I +G PP KPCCSL+  LVDLEAA CLCTA+KAN+LGINLN+P+SLSLL
Sbjct  61   VCANVLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLGINLNVPISLSLL  120

Query  417  lnVCSKKVPKGFTC  458
            LNVC KKVP GF C
Sbjct  121  LNVCGKKVPSGFVC  134



>ref|XP_010933689.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=134

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVLNGL+N+ +G PPKKPCCSL++ LVDLEAAVCLCTA+KAN+LGI LN+P
Sbjct  54   DALKLGVCANVLNGLINVHLGRPPKKPCCSLLDGLVDLEAAVCLCTALKANVLGIKLNLP  113

Query  399  lslslllnVCSKKVPKGFTCP  461
            + LSLLLN C K  PKGF CP
Sbjct  114  IHLSLLLNYCGKNTPKGFQCP  134



>gb|AAC60566.1| proline-rich SAC51 [Brassica napus]
Length=147

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 95/147 (65%), Gaps = 15/147 (10%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACN---------------tcpspkpkpkpkptptps  197
            M S++    A+FL++NILF TT+SA                                   
Sbjct  1    MASRTKSFLAIFLILNILFCTTISAYGNCGCPSPKPKPDPSHKPKPNPKPKPTPTPTPSP  60

Query  198  skgkcptDALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnil  377
               KCP DALKLGVCANVL+GLLNIT+G PP KPCC+LI+ L DLEAA CLCTA+KANIL
Sbjct  61   VTAKCPRDALKLGVCANVLSGLLNITLGKPPVKPCCTLIKGLADLEAAACLCTALKANIL  120

Query  378  ginlniplslslllnVCSKKVPKGFTC  458
            GINLNIP+SLSLLLNVCSKKVP GF C
Sbjct  121  GINLNIPISLSLLLNVCSKKVPPGFQC  147



>ref|XP_010433369.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 96/134 (72%), Gaps = 2/134 (1%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcp--tDALKLG  236
            M SK + +  +FL  NILFFT  +AC    SP PKPKPKP PTPS         D LKLG
Sbjct  1    MASKISSSLIIFLTFNILFFTLTTACGGGCSPVPKPKPKPKPTPSHSSSGSCPRDTLKLG  60

Query  237  VCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsll  416
            VCANVL  LL I +G PP KPCCSL+  LVDLEAA CLCTA+KAN+LGI LN+P+SLSLL
Sbjct  61   VCANVLKDLLKIELGKPPVKPCCSLLNGLVDLEAAACLCTALKANVLGIKLNVPVSLSLL  120

Query  417  lnVCSKKVPKGFTC  458
            LNVC KKVP GF C
Sbjct  121  LNVCGKKVPSGFVC  134



>ref|XP_010455699.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
 ref|XP_010455700.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 97/134 (72%), Gaps = 2/134 (1%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcp--tDALKLG  236
            M SK + +  +FL  NILFFT  +AC    SP PKPKPKP PTPS         D LKLG
Sbjct  1    MASKISASLVIFLTFNILFFTLTTACGGGCSPVPKPKPKPKPTPSHSSTGSCPRDTLKLG  60

Query  237  VCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsll  416
            VCANVL  LL I +G PP KPCCSL+  LVDLEAA CLCTA+KAN+LGINLN+P+SLSLL
Sbjct  61   VCANVLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLGINLNVPISLSLL  120

Query  417  lnVCSKKVPKGFTC  458
            LNVC KKVP GF C
Sbjct  121  LNVCGKKVPSGFVC  134



>ref|XP_010455698.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 96/134 (72%), Gaps = 2/134 (1%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcp--tDALKLG  236
            M SK + +  +FL  NILFFT  +AC    SP PKPKP P PTPS         D LKLG
Sbjct  1    MASKISASLVIFLTFNILFFTLTTACGGGCSPVPKPKPNPKPTPSHSSTGSCPRDTLKLG  60

Query  237  VCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsll  416
            VCANVL  LL I +G PP KPCCSL+  LVDLEAA CLCTA+KAN+LGINLN+P+SLSLL
Sbjct  61   VCANVLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLGINLNVPISLSLL  120

Query  417  lnVCSKKVPKGFTC  458
            LNVC KKVP GF C
Sbjct  121  LNVCGKKVPSGFVC  134



>ref|XP_010676150.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Beta vulgaris 
subsp. vulgaris]
Length=150

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 91/150 (61%), Gaps = 17/150 (11%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcp---------  215
            M SK  ++ ALFLV+N+ F + VSAC  C S                             
Sbjct  1    MASKLFKSLALFLVLNLFFVSLVSACGECGSGTSPNPKPKPKPKPRPTPGYSGSPSTGGS  60

Query  216  --------tDALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAn  371
                     DALKLGVCANVLNGLL++TIG PPK PCC LI+ L+D EAAVCLCTAIKAN
Sbjct  61   TSSSGTCPIDALKLGVCANVLNGLLDLTIGTPPKSPCCPLIQGLIDAEAAVCLCTAIKAN  120

Query  372  ilginlniplslslllnVCSKKVPKGFTCP  461
            +LGINL IPLS+SLL+N C  ++P GF CP
Sbjct  121  VLGINLEIPLSISLLVNYCGCQLPHGFQCP  150



>ref|XP_011070106.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=127

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCA++L GLL ITIG PPK PCC+LIE L DLEAAVCLCTAIKANILGINLN+P
Sbjct  47   DTLKLGVCADLLGGLLGITIGTPPKTPCCTLIEGLADLEAAVCLCTAIKANILGINLNVP  106

Query  399  lslslllnVCSKKVPKGFTC  458
            LSLSLLLNVCSKKVPKGF C
Sbjct  107  LSLSLLLNVCSKKVPKGFVC  126



>gb|KHN04346.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=136

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 107/136 (79%), Gaps = 5/136 (4%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtc----pspkpkpkpkptptpsskgkcptDALK  230
            M SK+  + ALFL +N++FF+ VSAC       P+PKP+P P P P PS  G CP DALK
Sbjct  1    MASKTCSSLALFLTLNLVFFSLVSACGYTPCPGPNPKPRPNPNPNPNPSPSGSCPRDALK  60

Query  231  LGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplsls  410
            LGVCANVLN L+N T+G PP  PCC+L++ LVDLEAAVCLCTA+KANILGINLN+P+SLS
Sbjct  61   LGVCANVLN-LVNATLGQPPVTPCCTLLDGLVDLEAAVCLCTALKANILGINLNLPISLS  119

Query  411  lllnVCSKKVPKGFTC  458
            LLLNVCS+KVP+ F C
Sbjct  120  LLLNVCSRKVPRNFQC  135



>ref|NP_001238293.1| uncharacterized protein LOC100527330 precursor [Glycine max]
 gb|ACU16403.1| unknown [Glycine max]
Length=136

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 102/136 (75%), Gaps = 5/136 (4%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcp----tDALK  230
            M SK   + ALFL +N++FF+ VSAC   P P P P+P+P P P+           DALK
Sbjct  1    MASKICSSLALFLTLNLVFFSLVSACGYTPCPGPNPRPRPNPNPNPNPSRSGSCPRDALK  60

Query  231  LGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplsls  410
            LGVCANVLN L+N T+G PP  PCC+L++ LVDLEAAVCLCTA+KANILGINLN+P+SLS
Sbjct  61   LGVCANVLN-LVNATLGQPPVTPCCTLLDGLVDLEAAVCLCTALKANILGINLNLPISLS  119

Query  411  lllnVCSKKVPKGFTC  458
            LLLNVCS+KVP+ F C
Sbjct  120  LLLNVCSRKVPRNFQC  135



>ref|XP_010258987.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Nelumbo nucifera]
Length=135

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 98/135 (73%), Gaps = 4/135 (3%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcpt---DALKL  233
            MDSKS+ + ALFL IN++FF   SAC +C SP      KPTPT        T   DALKL
Sbjct  1    MDSKSSASIALFLSINLVFFAFASACGSCSSPSKPQPIKPTPTSPIPAAKGTCPRDALKL  60

Query  234  GVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsl  413
            GVCANVL  L+++++G PP  PCCSLI++L DLEAA CLCTAIKA +LGINLN+P+SLSL
Sbjct  61   GVCANVLK-LVSVSVGTPPYLPCCSLIKDLADLEAAACLCTAIKAKVLGINLNVPVSLSL  119

Query  414  llnVCSKKVPKGFTC  458
            +LN C KKVP GF C
Sbjct  120  ILNNCGKKVPTGFKC  134



>gb|EYU30301.1| hypothetical protein MIMGU_mgv1a018370mg [Erythranthe guttata]
Length=119

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCA++LNGLLN+T+G PPK PCCSLIE LVDLEAAVCLCTAIKAN+LGIN+++P
Sbjct  39   DTLKLGVCADLLNGLLNVTVGTPPKTPCCSLIEGLVDLEAAVCLCTAIKANVLGINIDVP  98

Query  399  lslslllnVCSKKVPKGFTC  458
            +SL+LLLNVC+K VPK F C
Sbjct  99   ISLTLLLNVCTKSVPKDFVC  118



>ref|XP_006600137.1| PREDICTED: uncharacterized protein LOC100500016 isoform X1 [Glycine 
max]
 gb|KHN09802.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=137

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 106/136 (78%), Gaps = 5/136 (4%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtc----pspkpkpkpkptptpsskgkcptDALK  230
            M SK+  + ALFL +N++FF+ VSAC       P+PKP+P P P P PS  G CP DALK
Sbjct  1    MASKTCSSLALFLTLNLVFFSLVSACGYTPCPGPNPKPRPNPNPNPNPSPSGSCPRDALK  60

Query  231  LGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplsls  410
            LGVCANVLN L+N T+G PP  PCCSL++ LVDLEAAVCLCTA+KANILGINLN+P+SLS
Sbjct  61   LGVCANVLN-LVNATLGQPPVTPCCSLLDGLVDLEAAVCLCTALKANILGINLNLPISLS  119

Query  411  lllnVCSKKVPKGFTC  458
            LLLNVCS+K P+ F C
Sbjct  120  LLLNVCSRKAPRDFQC  135



>gb|AIX10944.1| PRP2-like protein [Gardenia jasminoides]
Length=147

 Score = 96.7 bits (239),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 97/147 (66%), Gaps = 16/147 (11%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcpt--------  218
            M SK+T   ALFL  N++FFT VSAC  CP P+P         P      P         
Sbjct  1    MGSKATTTLALFLAFNLIFFTRVSACGDCPKPRPPKPKPKPSPPPPVPCRPPPYSPTPTP  60

Query  219  -------DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnil  377
                   DALKLGVCA++L GL+ I+IG+PP KPCCSL+E L DLEAAVCLCTAIKANIL
Sbjct  61   SKKTCPGDALKLGVCADLL-GLIGISIGSPPTKPCCSLLEGLADLEAAVCLCTAIKANIL  119

Query  378  ginlniplslslllnVCSKKVPKGFTC  458
            GINLN+P+SLSL+LN C K VPKGF C
Sbjct  120  GINLNVPISLSLILNNCGKSVPKGFQC  146



>ref|XP_010906608.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=129

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCA+VL+GLLN+TIG PPK+PCCSL+  LVDLEAAVCLCTAIKANILGINLNIP
Sbjct  49   DALKLGVCADVLSGLLNVTIGTPPKEPCCSLLSGLVDLEAAVCLCTAIKANILGINLNIP  108

Query  399  lslslllnVCSKKVPKGFTC  458
            + LSLLLN C KKVP GF C
Sbjct  109  VDLSLLLNYCGKKVPSGFQC  128



>emb|CDX90834.1| BnaA03g25140D [Brassica napus]
Length=133

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 98/132 (74%), Gaps = 0/132 (0%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            M SK + +  +FL  NILFFT  +AC       PKPKPKPTP+PSS   CP   LKLGVC
Sbjct  1    MASKISASLIIFLTFNILFFTLTTACGGGCGSIPKPKPKPTPSPSSSASCPRKTLKLGVC  60

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            ANVL  LL I +G+PP KPCCSL++ LVDLEAA CLCTA+KAN+LG+ LN+P+SLSLLLN
Sbjct  61   ANVLKDLLKIELGSPPVKPCCSLLKGLVDLEAAACLCTALKANVLGVKLNVPVSLSLLLN  120

Query  423  VCSKKVPKGFTC  458
             C +K P+GF C
Sbjct  121  ACGRKTPRGFIC  132



>ref|XP_010919520.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=140

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALK GVCANVL GL+N+ +GNPPKKPCCSL+E L DLEAAVCLCTAIKANILG NLN+P
Sbjct  60   DALKFGVCANVLQGLINVQLGNPPKKPCCSLLEGLADLEAAVCLCTAIKANILGTNLNVP  119

Query  399  lslslllnVCSKKVPKGFTC  458
            + LSLLLN C KKVP G+ C
Sbjct  120  VDLSLLLNYCGKKVPAGYKC  139



>ref|XP_010041843.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
 ref|XP_010042382.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
Length=121

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 92/132 (70%), Gaps = 12/132 (9%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            M SK+  + AL L +NI+F +  +A    P+P                    +ALKLGVC
Sbjct  1    MASKNYPSLALVLSLNIIFASLATAWTPKPTPTAAASCPE------------NALKLGVC  48

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
             ++L  L+N+T+G PPK+PCCSLI+ LVDLEAAVCLCTAI+AN+LG++L++PLSLSLLLN
Sbjct  49   LDLLGSLVNVTVGTPPKEPCCSLIQGLVDLEAAVCLCTAIRANVLGLHLDVPLSLSLLLN  108

Query  423  VCSKKVPKGFTC  458
            VCSKKVP GF C
Sbjct  109  VCSKKVPPGFQC  120



>ref|XP_010053929.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Eucalyptus grandis]
 gb|KCW78308.1| hypothetical protein EUGRSUZ_D02488 [Eucalyptus grandis]
Length=133

 Score = 95.9 bits (237),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 92/133 (69%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkc-ptDALKLGV  239
            M SK T A    L+IN+LFFT VS+ +    P     PK    PS      P D LKLGV
Sbjct  1    MASK-TVATGAILLINLLFFTMVSSTHVPCPPPHPKIPKHPSLPSPAAATCPRDTLKLGV  59

Query  240  CANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslslll  419
            CAN+LN LL++ +G PPK PCCSLIE L DLEAAVCLCTAIKANILG NLNIP+SLSLLL
Sbjct  60   CANLLNDLLHLVVGTPPKTPCCSLIEGLADLEAAVCLCTAIKANILGNNLNIPISLSLLL  119

Query  420  nVCSKKVPKGFTC  458
            N C + VPKGF C
Sbjct  120  NYCGQGVPKGFQC  132



>ref|XP_010422222.1| PREDICTED: lipid transfer protein EARLI 1-like isoform X1 [Camelina 
sativa]
Length=135

 Score = 95.9 bits (237),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 97/134 (72%), Gaps = 2/134 (1%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcp--tDALKLG  236
            M SK + +  +FL  +ILFFT  +AC    SP PKPKPKP PTPS         D LKLG
Sbjct  1    MASKMSASLVIFLTFSILFFTLTTACGGGCSPVPKPKPKPKPTPSHSSTGSCPRDTLKLG  60

Query  237  VCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsll  416
            VCANVL  LL I +G PP KPCCSL+  LVDLEAA CLCTA+KAN+LGINLN+P+SLSLL
Sbjct  61   VCANVLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLGINLNVPISLSLL  120

Query  417  lnVCSKKVPKGFTC  458
            LNVC KKVP GF C
Sbjct  121  LNVCGKKVPSGFVC  134



>ref|XP_009134274.1| PREDICTED: lipid transfer protein EARLI 1-like [Brassica rapa]
Length=133

 Score = 95.5 bits (236),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 98/132 (74%), Gaps = 0/132 (0%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            M SK + +  +FL  NILFFT  +AC       PKPKPKPTP+PSS G CP   LKLGVC
Sbjct  1    MASKISASLIIFLTFNILFFTLTTACGGGCGSIPKPKPKPTPSPSSSGSCPRKTLKLGVC  60

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            ANVL  LL I +G PP KPCCSL++ LVDLEAA CLCTA+KAN+LGI LN+P+SLSLLLN
Sbjct  61   ANVLKDLLKIELGTPPVKPCCSLLKGLVDLEAAACLCTALKANVLGIKLNVPVSLSLLLN  120

Query  423  VCSKKVPKGFTC  458
             C +K P+GF C
Sbjct  121  ACGRKTPRGFIC  132



>ref|NP_176440.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
 gb|AAD43608.1|AC005698_7 T3P18.7 [Arabidopsis thaliana]
 gb|AAQ65111.1| At1g62510 [Arabidopsis thaliana]
 dbj|BAD95067.1| At1g62510 [Arabidopsis thaliana]
 dbj|BAD93991.1| similar to 14KD proline-rich protein DC2.15 precursor [Arabidopsis 
thaliana]
 dbj|BAD94286.1| At1g62510 [Arabidopsis thaliana]
 dbj|BAF01655.1| similar to 14KD proline-rich protein DC2.15 precursor sp|P14009 
[Arabidopsis thaliana]
 dbj|BAF02193.1| similar to 14KD proline-rich protein DC2.15 precursor sp|P14009 
[Arabidopsis thaliana]
 gb|AEE33973.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
Length=149

 Score = 95.9 bits (237),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVLNGLLN+T+G PP +PCC+LI+ L DLEAA CLCTA+KANILGINLNIP
Sbjct  70   DALKLGVCANVLNGLLNVTLGKPPVEPCCTLIQGLADLEAAACLCTALKANILGINLNIP  129

Query  399  lslslllnVCSKKVPKGFTC  458
            LSLSLLLNVCSKKVP+GF C
Sbjct  130  LSLSLLLNVCSKKVPRGFQC  149



>ref|XP_004245748.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum lycopersicum]
Length=135

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVL+GLLN+T+G PP KPCCSLI NLVDLEAA CLCTA+KAN+LGINLNIP
Sbjct  55   DTLKLGVCANVLSGLLNVTLGTPPVKPCCSLIGNLVDLEAAACLCTALKANVLGINLNIP  114

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCSK VPKGF C
Sbjct  115  ISLSLLLNVCSKDVPKGFIC  134



>ref|XP_003549906.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Glycine max]
 gb|KHN09800.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=136

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 106/136 (78%), Gaps = 5/136 (4%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtc----pspkpkpkpkptptpsskgkcptDALK  230
            M SK+  + ALFL +N++FF+ VSAC       P+PKP+P P P P PS  G CP DALK
Sbjct  1    MASKTCSSLALFLTLNLVFFSLVSACGYTPCPGPNPKPRPNPNPNPNPSPSGSCPRDALK  60

Query  231  LGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplsls  410
            LGVCANVLN L+N T+G PP  PCC+L++ LVDLEAAVCLCTA+KANILGINLN+P+SLS
Sbjct  61   LGVCANVLN-LVNATLGQPPVTPCCTLLDGLVDLEAAVCLCTALKANILGINLNLPISLS  119

Query  411  lllnVCSKKVPKGFTC  458
            LLLNVCS+K P+ F C
Sbjct  120  LLLNVCSRKAPRDFQC  135



>ref|XP_004516838.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cicer arietinum]
Length=166

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVLNGLLN+T+G PP  PCCSL++ LVDLEAAVCLCTA+KANILGINLN+P
Sbjct  86   DALKLGVCANVLNGLLNVTLGQPPVTPCCSLLQGLVDLEAAVCLCTALKANILGINLNLP  145

Query  399  lslslllnVCSKKVPKGFTCP  461
            +SLSLLLNVCS++ P+ F CP
Sbjct  146  ISLSLLLNVCSRQAPRDFQCP  166



>ref|XP_010433379.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 96/134 (72%), Gaps = 2/134 (1%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcp--tDALKLG  236
            M SK + +  +FL  NILFFT  +AC    SP PKPKPKP PTPS         D LKLG
Sbjct  1    MASKISASLVIFLTFNILFFTLTNACGGGCSPVPKPKPKPKPTPSHSSTGSCPRDTLKLG  60

Query  237  VCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsll  416
            VCAN+L  LL I +G PP KPCCSL+  LVDLEAA CLCTA+KAN++GI LN+P+SLSLL
Sbjct  61   VCANLLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVIGIKLNVPVSLSLL  120

Query  417  lnVCSKKVPKGFTC  458
            LNVC +KVP GF C
Sbjct  121  LNVCGRKVPSGFVC  134



>ref|XP_008437107.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis melo]
Length=138

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 90/138 (65%), Gaps = 6/138 (4%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcp------tDA  224
            M SK+T + A+ L +N+LFFT VSAC+ C  P P         P+             DA
Sbjct  1    MASKATASLAIILSLNLLFFTFVSACDNCYVPAPPKPKPKPCPPTKPNPPSNHGKCPKDA  60

Query  225  LKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnipls  404
            LK+GVCA +L GL+++TIG PP  PCC+L+E L DLEAA CLCTAIKA++LG  + IPL 
Sbjct  61   LKIGVCAKLLGGLVDLTIGKPPVTPCCTLVEGLADLEAAACLCTAIKASVLGNKIKIPLH  120

Query  405  lslllnVCSKKVPKGFTC  458
            LSLLLNVC K +P GF C
Sbjct  121  LSLLLNVCKKNLPNGFQC  138



>ref|NP_001235642.1| uncharacterized protein LOC100500016 precursor [Glycine max]
 gb|ACU14605.1| unknown [Glycine max]
Length=137

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 105/136 (77%), Gaps = 5/136 (4%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtc----pspkpkpkpkptptpsskgkcptDALK  230
            M SK+  + ALFL +N++FF+ VSAC       P+PKP+P P P P PS  G CP DALK
Sbjct  1    MASKTCSSLALFLTLNLVFFSLVSACGYTPCPGPNPKPRPNPNPNPNPSPSGSCPRDALK  60

Query  231  LGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplsls  410
            LGVCANVLN L+N T+G PP  PCCSL++ L DLEAAVCLCTA+KANILGINLN+P+SLS
Sbjct  61   LGVCANVLN-LVNATLGQPPVTPCCSLLDGLADLEAAVCLCTALKANILGINLNLPISLS  119

Query  411  lllnVCSKKVPKGFTC  458
            LLLNVCS+K P+ F C
Sbjct  120  LLLNVCSRKAPRDFQC  135



>ref|XP_007039887.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
 gb|EOY24388.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
Length=132

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            MDSK   +  L L IN+LFFT VS CNTC  P+P P P+PTP+P +K     DALKLGVC
Sbjct  1    MDSKRCSSTILLLAINLLFFTLVSGCNTCVQPRPNPNPRPTPSPPTKSCPR-DALKLGVC  59

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            A +LNG +   +GNPP  PCCS++  LVDLEAAVCLCTAIKAN+LGIN+NIP+SLSLL+N
Sbjct  60   AKLLNGTIGGVVGNPPDTPCCSVLSGLVDLEAAVCLCTAIKANVLGININIPISLSLLIN  119

Query  423  VCSKKVPKGFTC  458
             C K++P  F C
Sbjct  120  TCGKQLPSDFIC  131



>ref|XP_008786990.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=127

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVLNGL+N+ +G PPKKPCCSLI+ L DLEAAVCLCTA+KANILGI LNIP
Sbjct  47   DTLKLGVCANVLNGLINLNLGKPPKKPCCSLIKGLADLEAAVCLCTALKANILGIKLNIP  106

Query  399  lslslllnVCSKKVPKGFTCP  461
            + LSLL+N C KKVP GF CP
Sbjct  107  VDLSLLINYCGKKVPTGFQCP  127



>emb|CAA59472.1| hybrid proline-rich protein [Catharanthus roseus]
Length=138

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 107/137 (78%), Gaps = 5/137 (4%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcp-----tDAL  227
            M SKST A ALFL +N++FFT VSAC  CP PKPKPKPKP P+       P      DAL
Sbjct  1    MASKSTSALALFLALNLIFFTLVSACGDCPKPKPKPKPKPKPSCPPPPYVPKATCPRDAL  60

Query  228  KLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplsl  407
            KLGVCA++L GL++  IG PPK PCCSLIE L DLEAAVCLCTAIKAN+LGINLN+P+SL
Sbjct  61   KLGVCADLLGGLISAVIGAPPKTPCCSLIEGLADLEAAVCLCTAIKANVLGINLNVPVSL  120

Query  408  slllnVCSKKVPKGFTC  458
            SLLLNVCSKKVP+GF C
Sbjct  121  SLLLNVCSKKVPEGFIC  137



>ref|XP_009333674.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=136

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 89/135 (66%), Gaps = 3/135 (2%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSA---CNtcpspkpkpkpkptptpsskgkcptDALKL  233
            MDSKS+   ALFL +N LF    S    C   P              ++   CP D+LKL
Sbjct  1    MDSKSSSTLALFLSVNFLFCVLASGWYTCPQQPHQPITNPKPNPIPSAASKSCPRDSLKL  60

Query  234  GVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsl  413
            GVCA +LNG++   +GNPP  PCC+L+E LVDLE AVCLCTAIKANILGINLNIP++LSL
Sbjct  61   GVCAKLLNGVVGAVVGNPPDHPCCALLEGLVDLEVAVCLCTAIKANILGINLNIPIALSL  120

Query  414  llnVCSKKVPKGFTC  458
            +++ C+K VP GF C
Sbjct  121  VIDGCAKNVPAGFKC  135



>emb|CDX90837.1| BnaA03g25170D [Brassica napus]
Length=107

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 86/129 (67%), Gaps = 24/129 (19%)
 Frame = +3

Query  75   STRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVCANVL  254
            S  + A+FLV+NILFF    A  +                          +KLGVC N L
Sbjct  3    SRNSLAIFLVLNILFFALTEAARSGY-----------------------TVKLGVCVNAL  39

Query  255  NGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslslllnVCSK  434
            N LLN+T+G PP KPCCSLI+ LVDLEAAVCLCTA+KA+ILGIN+N+P++LSLLLNVCS+
Sbjct  40   N-LLNVTLGAPPVKPCCSLIDGLVDLEAAVCLCTALKASILGININLPINLSLLLNVCSR  98

Query  435  KVPKGFTCP  461
            K P+GF CP
Sbjct  99   KAPRGFQCP  107



>emb|CAA81526.1| 14 kDa polypeptide [Catharanthus roseus]
Length=138

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 107/137 (78%), Gaps = 5/137 (4%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcp-----tDAL  227
            M SKST A ALFL +N++FFT VSAC  CP PKPKPKPKP P+       P      DAL
Sbjct  1    MASKSTSALALFLALNLIFFTLVSACGDCPKPKPKPKPKPKPSCPPPPYVPKATCPRDAL  60

Query  228  KLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplsl  407
            KLGVCA++L GL++  IG PPK PCCSLIE L DLEAAVCLCTAIKAN+LGINLN+P+SL
Sbjct  61   KLGVCADLLGGLISAVIGAPPKTPCCSLIEGLADLEAAVCLCTAIKANVLGINLNVPVSL  120

Query  408  slllnVCSKKVPKGFTC  458
            +LLLNVCSKKVP+GF C
Sbjct  121  TLLLNVCSKKVPEGFIC  137



>ref|XP_009134275.1| PREDICTED: lipid transfer protein EARLI 1-like [Brassica rapa]
 emb|CDX90835.1| BnaA03g25150D [Brassica napus]
Length=133

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 97/132 (73%), Gaps = 0/132 (0%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            M SK + +  +FL  NILFFT  +AC       PKPKPKPTPTPSS G CP   LKLGVC
Sbjct  1    MASKISASLIIFLTFNILFFTLTTACGGGCGSIPKPKPKPTPTPSSSGSCPRKTLKLGVC  60

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            ANVL  LL I +G PP KPCCSL+  LVDLEAA CLCTA+KAN+LGI LN+P+SLSLLLN
Sbjct  61   ANVLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLGIKLNVPVSLSLLLN  120

Query  423  VCSKKVPKGFTC  458
             C +K P+GF C
Sbjct  121  ACGRKTPRGFIC  132



>ref|XP_009333598.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=136

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 93/135 (69%), Gaps = 3/135 (2%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcpt---DALKL  233
            MDSKS+   ALFL +N LF    S C TCP    +P   P P P       +   D+LKL
Sbjct  1    MDSKSSSTLALFLSVNFLFCVLASGCYTCPQQPHQPITNPKPNPIPSAASKSCPRDSLKL  60

Query  234  GVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsl  413
            GVCA +LNG++   +GNPP  PCC+L+E LVDLE AVCLCTAIKANILGINLNIP++LSL
Sbjct  61   GVCAKLLNGVVGAVVGNPPDHPCCALLEGLVDLEVAVCLCTAIKANILGINLNIPIALSL  120

Query  414  llnVCSKKVPKGFTC  458
            +++ C+K VP GF C
Sbjct  121  VIDGCAKNVPAGFKC  135



>gb|KFK25909.1| hypothetical protein AALP_AA8G178400 [Arabis alpina]
Length=157

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVLNGLLNIT+G PP +PCC+LI+ L DLEAA CLCTA+KANILGINLNIP
Sbjct  78   DALKLGVCANVLNGLLNITLGKPPVEPCCTLIQGLADLEAAACLCTALKANILGINLNIP  137

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCSKKVP GF C
Sbjct  138  ISLSLLLNVCSKKVPPGFQC  157



>ref|XP_006396747.1| hypothetical protein EUTSA_v10029313mg [Eutrema salsugineum]
 gb|ESQ38200.1| hypothetical protein EUTSA_v10029313mg [Eutrema salsugineum]
Length=129

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 96/126 (76%), Gaps = 2/126 (2%)
 Frame = +3

Query  84   AFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVCANVLNGL  263
            + A+FL +NILFF    A      P    KPKPTP+  +   CP DALKLGVC N LN L
Sbjct  6    SLAIFLALNILFFALTEA-GRSGYPPSPYKPKPTPSAPAIETCPKDALKLGVCVNALN-L  63

Query  264  LNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslslllnVCSKKVP  443
            LN+T+G PP +PCCSLI+ LVDLEAAVCLCTA+KA+ILGIN+N+P++LSLLLNVCS+K P
Sbjct  64   LNVTLGAPPVQPCCSLIDGLVDLEAAVCLCTALKASILGININLPINLSLLLNVCSRKAP  123

Query  444  KGFTCP  461
            +GF CP
Sbjct  124  RGFQCP  129



>ref|XP_010430305.1| PREDICTED: lipid transfer protein EARLI 1 [Camelina sativa]
Length=149

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVLNGLLNIT+G PP +PCC+LI+ L DLEAA CLCTA+KANILGINLNIP
Sbjct  70   DALKLGVCANVLNGLLNITLGKPPVEPCCTLIQGLADLEAAACLCTALKANILGINLNIP  129

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCSKKVP GF C
Sbjct  130  ISLSLLLNVCSKKVPPGFQC  149



>ref|XP_002874778.1| hypothetical protein ARALYDRAFT_911651 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51037.1| hypothetical protein ARALYDRAFT_911651 [Arabidopsis lyrata subsp. 
lyrata]
Length=129

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 94/132 (71%), Gaps = 4/132 (3%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            M SK++ +  +FL  +ILFFT  +AC    SP PKPKPKP  T S       D LKLGVC
Sbjct  1    MASKTSASLVIFLTFSILFFTLTTACGGGCSPTPKPKPKPQSTGSCPR----DTLKLGVC  56

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            ANVL  LL I +G PP KPCCSL++ LVDLEAA CLCTA+KAN+LG  LN+P+SLSLLLN
Sbjct  57   ANVLKDLLKIQLGTPPVKPCCSLLKGLVDLEAAACLCTALKANVLGTKLNVPVSLSLLLN  116

Query  423  VCSKKVPKGFTC  458
            VC +KVP  F C
Sbjct  117  VCGRKVPSKFVC  128



>ref|XP_009134276.1| PREDICTED: putative lipid-binding protein AIR1 [Brassica rapa]
Length=127

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 92/129 (71%), Gaps = 4/129 (3%)
 Frame = +3

Query  75   STRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVCANVL  254
            S  + A+FLV+NILFF    A  +   P P       P   +  K   D +KLGVC N L
Sbjct  3    SRNSLAIFLVLNILFFALTEAARSGCPPGPYKPKPTPPAIQTCPK---DTVKLGVCVNAL  59

Query  255  NGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslslllnVCSK  434
            N LLN+T+G PP KPCCSLI+ LVDLEAAVCLCTA+KA+ILGIN+N+P++LSLLLNVCS+
Sbjct  60   N-LLNVTLGAPPVKPCCSLIDGLVDLEAAVCLCTALKASILGININLPINLSLLLNVCSR  118

Query  435  KVPKGFTCP  461
            K P+GF CP
Sbjct  119  KAPRGFQCP  127



>ref|XP_009333630.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=135

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVLNGLLNI++G PP +PCCSLI+ L D+EAAVCLCTA+KANILGINLNIP
Sbjct  55   DTLKLGVCANVLNGLLNISVGKPPVEPCCSLIQGLADIEAAVCLCTALKANILGINLNIP  114

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVC  KVPKGF C
Sbjct  115  ISLSLLLNVCGNKVPKGFQC  134



>ref|XP_010553463.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Tarenaya 
hassleriana]
Length=143

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVLNGLLN+T+G PP +PCC+LI+ L D+EAA CLCTA+KANILGINLN+P
Sbjct  63   DALKLGVCANVLNGLLNVTLGQPPVEPCCTLIQGLADVEAAACLCTALKANILGINLNLP  122

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCSKKVP GF C
Sbjct  123  ISLSLLLNVCSKKVPPGFQC  142



>ref|XP_010473467.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=157

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVLNGLLNIT+G PP +PCC+LI+ L DLEAA CLCTA+KANILGINLNIP
Sbjct  78   DALKLGVCANVLNGLLNITLGKPPVEPCCTLIQGLADLEAAACLCTALKANILGINLNIP  137

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCSKKVP GF C
Sbjct  138  ISLSLLLNVCSKKVPPGFQC  157



>ref|XP_010418243.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=157

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVLNGLLNIT+G PP +PCC+LI+ L DLEAA CLCTA+KANILGINLNIP
Sbjct  78   DALKLGVCANVLNGLLNITLGKPPVEPCCTLIQGLADLEAAACLCTALKANILGINLNIP  137

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCSKKVP GF C
Sbjct  138  ISLSLLLNVCSKKVPPGFQC  157



>ref|XP_006302912.1| hypothetical protein CARUB_v10021046mg [Capsella rubella]
 gb|EOA35810.1| hypothetical protein CARUB_v10021046mg [Capsella rubella]
Length=170

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVLNGLLNIT+G PP +PCC+LI+ L DLEAA CLCTA+KANILGINLNIP
Sbjct  91   DALKLGVCANVLNGLLNITLGKPPVEPCCTLIKGLADLEAAACLCTALKANILGINLNIP  150

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCSKKVP GF C
Sbjct  151  VSLSLLLNVCSKKVPPGFQC  170



>ref|XP_010053450.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Eucalyptus grandis]
 gb|KCW77748.1| hypothetical protein EUGRSUZ_D02042 [Eucalyptus grandis]
Length=121

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 90/132 (68%), Gaps = 12/132 (9%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            M SK+    AL L +NI+F +  +A    P+P                    +ALKLGVC
Sbjct  1    MASKNYPTLALVLSLNIIFASLATAWTPKPTPTAAASCPE------------NALKLGVC  48

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
             ++L  L+N+T+G PPK+PCCSLI+ L DLEAAVCLCTAI+A++LG++L++PLSLSLLLN
Sbjct  49   LDLLGSLVNVTVGTPPKEPCCSLIQGLADLEAAVCLCTAIRADVLGLHLDVPLSLSLLLN  108

Query  423  VCSKKVPKGFTC  458
            VCSKKVP GF C
Sbjct  109  VCSKKVPPGFQC  120



>ref|XP_010422223.1| PREDICTED: lipid transfer protein EARLI 1-like isoform X2 [Camelina 
sativa]
Length=135

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 96/134 (72%), Gaps = 2/134 (1%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcp--tDALKLG  236
            M SK + +  +FL  +ILFFT  +AC    SP PKPKPKP PTPS         D LKLG
Sbjct  1    MASKMSASLVIFLTFSILFFTLTTACGGGCSPVPKPKPKPKPTPSHSSTGSCPRDTLKLG  60

Query  237  VCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsll  416
            VCANVL  LL I +G PP KPCCSL+  LVDLEAA CLCTA+KAN+LGINLN+P+SLSLL
Sbjct  61   VCANVLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLGINLNVPISLSLL  120

Query  417  lnVCSKKVPKGFTC  458
            LNVC KK P GF C
Sbjct  121  LNVCGKKFPSGFVC  134



>ref|XP_008808738.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=131

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            +ALKLGVCANVLNGL+N+++G PPKKPCC+L+E LVDLEAAVCLCTA+KANILGI LN+P
Sbjct  51   NALKLGVCANVLNGLINVSLGKPPKKPCCTLLEGLVDLEAAVCLCTALKANILGIKLNLP  110

Query  399  lslslllnVCSKKVPKGFTC  458
            + LSLLLN C KKVP G+ C
Sbjct  111  VDLSLLLNYCGKKVPAGWKC  130



>ref|XP_008338137.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
 ref|XP_008389722.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=139

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVLNGLLNI++G PP +PCCSLI+ L DLEAAVCLCTA+KANILGINLNIP
Sbjct  59   DTLKLGVCANVLNGLLNISVGKPPVEPCCSLIQGLADLEAAVCLCTALKANILGINLNIP  118

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVC  KVPKGF C
Sbjct  119  VSLSLLLNVCGNKVPKGFQC  138



>gb|KDP25645.1| hypothetical protein JCGZ_20801 [Jatropha curcas]
Length=138

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCA VL  LLNITIG+PP KPCCSL+E LVDLEAAVCLCTAIKANILGINLN+P
Sbjct  58   DALKLGVCAKVLGSLLNITIGDPPVKPCCSLLEGLVDLEAAVCLCTAIKANILGINLNVP  117

Query  399  lslslllnVCSKKVPKGFTC  458
            LSLSLLLNVCSKKVP  F C
Sbjct  118  LSLSLLLNVCSKKVPSDFQC  137



>emb|CDY31241.1| BnaC08g15360D [Brassica napus]
Length=132

 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 95/132 (72%), Gaps = 1/132 (1%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            M+S  + + ALFL +N++FF  VS CNTC  PKP P P P   P+       DALKLGVC
Sbjct  1    MESNRSFSAALFLSLNLMFFACVSGCNTCLPPKPIPNPNPISNPTKHSCPR-DALKLGVC  59

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            A +L+G +   IGNPP  PCCS ++ LVDLEAAVCLCTAIKANILGI++NIP+SLSLL+N
Sbjct  60   AKILDGAVGTVIGNPPDTPCCSFLQGLVDLEAAVCLCTAIKANILGIDINIPISLSLLIN  119

Query  423  VCSKKVPKGFTC  458
             C KK+P  F C
Sbjct  120  TCGKKLPSDFIC  131



>ref|XP_010906607.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=129

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCA+VL+GLLN+TIG PPK+PCCSL+  LVDLE AVCLCT IKA+ILGINLNIP
Sbjct  49   DALKLGVCADVLSGLLNVTIGTPPKEPCCSLLSGLVDLEVAVCLCTVIKASILGINLNIP  108

Query  399  lslslllnVCSKKVPKGFTC  458
            + LSLL+N C KKVP GF C
Sbjct  109  VDLSLLVNYCGKKVPSGFQC  128



>gb|EPS71802.1| hypothetical protein M569_02964 [Genlisea aurea]
Length=146

 Score = 94.0 bits (232),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCAN+L  LL + IG PPK+PCCS+I+ LVDLEAAVCLCTAIKA+ILGINLNIP
Sbjct  66   DTLKLGVCANLLGDLLGVVIGTPPKEPCCSVIQGLVDLEAAVCLCTAIKADILGINLNIP  125

Query  399  lslslllnVCSKKVPKGFTCP  461
            +SLS+LLNVCSKKVP GF CP
Sbjct  126  VSLSVLLNVCSKKVPPGFICP  146



>ref|XP_011018292.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Populus euphratica]
Length=140

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCA++L  LLN+TIG+PP KPCCS+I+ L+DLEAAVCLCTAIKANILGINLNIP
Sbjct  60   DALKLGVCADLLGSLLNVTIGSPPVKPCCSVIQGLLDLEAAVCLCTAIKANILGINLNIP  119

Query  399  lslslllnVCSKKVPKGFTCP  461
            LSLSLL+NVC KKVPK F CP
Sbjct  120  LSLSLLVNVCGKKVPKDFQCP  140



>ref|XP_010919519.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=143

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVLNGL+N+T+G PPKKPCCSLI+ L DLEAAVCLCTA+KANILG NLNIP
Sbjct  63   DTLKLGVCANVLNGLINLTLGKPPKKPCCSLIKGLADLEAAVCLCTALKANILGANLNIP  122

Query  399  lslslllnVCSKKVPKGFTC  458
            + LSLL+N C KKVP GF C
Sbjct  123  IDLSLLINYCGKKVPTGFQC  142



>ref|XP_003525814.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Glycine max]
Length=134

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVL GLLN+T+G PP  PCCSL++ LVDLEAAVCLCTA+KAN+LGINLN+P
Sbjct  54   DALKLGVCANVLKGLLNVTLGQPPVTPCCSLLDGLVDLEAAVCLCTALKANVLGINLNLP  113

Query  399  lslslllnVCSKKVPKGFTC  458
            LSLSLLLNVCS+KVP+ F C
Sbjct  114  LSLSLLLNVCSRKVPRDFQC  133



>gb|KHN04347.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=134

 Score = 93.2 bits (230),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVL GLLN+T+G PP  PCCSL++ LVDLEAAVCLCTA+KANILGINLN+P
Sbjct  54   DALKLGVCANVLKGLLNVTLGQPPVTPCCSLLDGLVDLEAAVCLCTALKANILGINLNLP  113

Query  399  lslslllnVCSKKVPKGFTC  458
            LSLSLLLNVCS+KVP+ F C
Sbjct  114  LSLSLLLNVCSRKVPRDFQC  133



>ref|XP_006477234.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Citrus sinensis]
Length=134

 Score = 93.2 bits (230),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 88/124 (71%), Gaps = 1/124 (1%)
 Frame = +3

Query  90   ALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkc-ptDALKLGVCANVLNGLL  266
            AL L +N++FFT VS+      P P         P +     P D LKLGVCANVLN L+
Sbjct  10   ALLLSLNLIFFTLVSSTYVPCPPPPPKSHNHHKHPPAPKPTCPRDTLKLGVCANVLNDLV  69

Query  267  NITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslslllnVCSKKVPK  446
            ++ +G PPK PCCSLI+ LVDLEAAVCLCTAIKANILGINLN+P+SLSLLLN C KKVP 
Sbjct  70   HLVVGTPPKTPCCSLIKGLVDLEAAVCLCTAIKANILGINLNVPVSLSLLLNFCGKKVPS  129

Query  447  GFTC  458
            GF C
Sbjct  130  GFQC  133



>ref|XP_008381149.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
 ref|XP_008365739.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=136

 Score = 93.2 bits (230),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 92/135 (68%), Gaps = 3/135 (2%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSAC---NtcpspkpkpkpkptptpsskgkcptDALKL  233
            M+SK++   ALFL IN+LF    S C   +  P    +         +S   CP D+LKL
Sbjct  1    MNSKTSSTLALFLSINLLFCVLASGCYTCSQQPHQPIRNPRPNPIPSASPKSCPRDSLKL  60

Query  234  GVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsl  413
            GVCA +LNG +   +GNPP  PCC+L+E LVDLE AVCLCTAIKANILGINLNIP++LSL
Sbjct  61   GVCAKLLNGAVGAVVGNPPDHPCCALLEGLVDLEVAVCLCTAIKANILGINLNIPIALSL  120

Query  414  llnVCSKKVPKGFTC  458
            +++ C+K VP+GF C
Sbjct  121  VIDGCAKNVPEGFKC  135



>ref|XP_009589966.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
 dbj|BAB16431.1| P-rich protein NtEIG-C29 [Nicotiana tabacum]
Length=130

 Score = 92.8 bits (229),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVL  LL + IGNPPKKPCC+LI+ + DLEAA+CLCTAIKANILGINLN+P
Sbjct  50   DTLKLGVCANVLGNLLGLVIGNPPKKPCCTLIQGVADLEAAICLCTAIKANILGINLNVP  109

Query  399  lslslllnVCSKKVPKGFTCP  461
            LSLSLLLNVC K+VP GF CP
Sbjct  110  LSLSLLLNVCGKQVPSGFQCP  130



>ref|XP_002874777.1| hypothetical protein ARALYDRAFT_911650 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51036.1| hypothetical protein ARALYDRAFT_911650 [Arabidopsis lyrata subsp. 
lyrata]
Length=150

 Score = 93.6 bits (231),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 98/149 (66%), Gaps = 17/149 (11%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSA----CNtcpspkpkpkpkptptpsskgkcpt----  218
            M SK++ + ALF  +NILFFT   A    CN  P   P+      P PS           
Sbjct  1    MASKNSASLALFFALNILFFTLTVATDCKCNPSPKHSPRVPTPRVPIPSVPTPSVPTPST  60

Query  219  ---------DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAn  371
                     DAL+LGVCANVL+GLLN+ +G P  +PCCSLI+ LVDL+AA+CLCTA++AN
Sbjct  61   PGSSRNCPIDALRLGVCANVLSGLLNVQLGQPSAQPCCSLIQGLVDLDAAICLCTALRAN  120

Query  372  ilginlniplslslllnVCSKKVPKGFTC  458
            +LGINLN+P+SLS+LLNVC++++P GF C
Sbjct  121  VLGINLNVPISLSVLLNVCNRRLPSGFQC  149



>ref|XP_010553464.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Tarenaya hassleriana]
Length=128

 Score = 92.8 bits (229),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 94/132 (71%), Gaps = 5/132 (4%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            MD K +   ALF+  N+LFFT VS+CNTC  PKP P P PT     +     DALKLGVC
Sbjct  1    MDPKRSFLLALFISFNLLFFTHVSSCNTCVQPKPIPNPNPTKRSCPR-----DALKLGVC  55

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            A +L+G +   +G PP  PCCS+++ LVDLEAAVCLCTAIKANILGI++NIP+SLSLL+N
Sbjct  56   AKILDGAVGTVVGGPPDMPCCSVLQGLVDLEAAVCLCTAIKANILGIDINIPISLSLLIN  115

Query  423  VCSKKVPKGFTC  458
             C K +P  F C
Sbjct  116  TCGKSLPPDFVC  127



>gb|ACV74341.1| proline-rich protein [Jatropha curcas]
Length=138

 Score = 92.8 bits (229),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCA VL  LLNITIG+PP KPCCSL+E LVDLEAAVCLCTAIKANILGI LN+P
Sbjct  58   DALKLGVCAKVLGSLLNITIGDPPVKPCCSLLEGLVDLEAAVCLCTAIKANILGITLNVP  117

Query  399  lslslllnVCSKKVPKGFTC  458
            LSLSLLLNVCSKKVP  F C
Sbjct  118  LSLSLLLNVCSKKVPFDFQC  137



>ref|XP_006440346.1| hypothetical protein CICLE_v10022839mg [Citrus clementina]
 gb|ESR53586.1| hypothetical protein CICLE_v10022839mg [Citrus clementina]
Length=130

 Score = 92.8 bits (229),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 95/132 (72%), Gaps = 3/132 (2%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            MDSK +    +F  IN++FF  VS CNTC  P+P P P P PT     +   DALKLGVC
Sbjct  1    MDSKRSIWITVFFSINVIFFALVSGCNTCVQPRPIPNPNPNPTSRRCPR---DALKLGVC  57

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            A VL+G +   +GNPP  PCCS+++ L+DLEAAVCLCTAIKANILGIN+NIP+SLSLL+N
Sbjct  58   AKVLDGTVGAVVGNPPDFPCCSVLQGLLDLEAAVCLCTAIKANILGININIPISLSLLIN  117

Query  423  VCSKKVPKGFTC  458
             C KK+P  F C
Sbjct  118  TCGKKLPSDFIC  129



>ref|XP_002533292.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF29086.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=137

 Score = 92.8 bits (229),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 92/136 (68%), Gaps = 4/136 (3%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSAC----NtcpspkpkpkpkptptpsskgkcptDALK  230
            M S++  + A  L IN+LFFT VS+     +      P P        S   KCP D LK
Sbjct  1    MASRTLASTAFLLSINLLFFTLVSSTYCPPSAPKGHAPHPIKPSPVPSSKPAKCPRDTLK  60

Query  231  LGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplsls  410
            LGVC ++L  LL++T+G PPK PCCSLI +LVDLEAAVCLCT IKA++LGINL++P+ LS
Sbjct  61   LGVCVDLLKDLLSVTVGTPPKTPCCSLIADLVDLEAAVCLCTTIKASLLGINLSVPVDLS  120

Query  411  lllnVCSKKVPKGFTC  458
            LLLN C KKVP+GF C
Sbjct  121  LLLNYCGKKVPEGFKC  136



>ref|XP_006289270.1| hypothetical protein CARUB_v10002736mg [Capsella rubella]
 gb|EOA22168.1| hypothetical protein CARUB_v10002736mg [Capsella rubella]
Length=131

 Score = 92.4 bits (228),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 98/127 (77%), Gaps = 2/127 (2%)
 Frame = +3

Query  84   AFALFLVINILFFT-TVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVCANVLNG  260
            + A+FL  NILFF  T +A + CP      KPKPTP+  +   CP DALKLGVC   LN 
Sbjct  6    SLAIFLAFNILFFALTEAARSGCPPSSSYNKPKPTPSAPAIETCPKDALKLGVCVQALN-  64

Query  261  LLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslslllnVCSKKV  440
            L+N+T+G PP KPCCSLI+ LVDLEAAVCLCTAIKA+ILGIN+N+P++LSLLLNVCS+K 
Sbjct  65   LVNVTLGAPPVKPCCSLIDGLVDLEAAVCLCTAIKASILGININLPINLSLLLNVCSRKA  124

Query  441  PKGFTCP  461
            P+GF CP
Sbjct  125  PRGFQCP  131



>sp|P14009.1|14KD_DAUCA RecName: Full=14 kDa proline-rich protein DC2.15; Flags: Precursor 
[Daucus carota]
 emb|CAA33476.1| unnamed protein product [Daucus carota]
Length=137

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 93/136 (68%), Gaps = 4/136 (3%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSAC----NtcpspkpkpkpkptptpsskgkcptDALK  230
            M SK++ + ALF  +NILFF  VS+     +                  S GKCP DALK
Sbjct  1    MGSKNSASVALFFTLNILFFALVSSTEKCPDPYKPKPKPTPKPTPTPYPSAGKCPRDALK  60

Query  231  LGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplsls  410
            LGVCA+VLN + N+ IG+PP  PCCSL+E LV+LEAAVCLCTAIKANILG NLN+P++LS
Sbjct  61   LGVCADVLNLVHNVVIGSPPTLPCCSLLEGLVNLEAAVCLCTAIKANILGKNLNLPIALS  120

Query  411  lllnVCSKKVPKGFTC  458
            L+LN C K+VP GF C
Sbjct  121  LVLNNCGKQVPNGFEC  136



>ref|XP_003559027.1| PREDICTED: putative glycine-rich cell wall structural protein 
1 [Brachypodium distachyon]
 gb|ACF22748.1| proline-rich protein [Brachypodium distachyon]
Length=186

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVLNGL+N+ +G PPKKPCC+LI+ L DLEAAVCLCTA++ANILGINLN+P
Sbjct  106  DALKLGVCANVLNGLINLELGTPPKKPCCTLIQGLADLEAAVCLCTALRANILGINLNVP  165

Query  399  lslslllnVCSKKVPKGFTCP  461
            + LSLL+N C K+VP GF CP
Sbjct  166  IDLSLLVNYCGKRVPTGFQCP  186



>dbj|BAK05563.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=193

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVLNGL+N+ +G PPKKPCC+LI+ L DLEAAVCLCTA+KANILGINLN+P
Sbjct  112  DALKLGVCANVLNGLINLQLGTPPKKPCCTLIQGLADLEAAVCLCTALKANILGINLNVP  171

Query  399  lslslllnVCSKKVPKGFTCP  461
            + LSLL+N C K VP GF CP
Sbjct  172  IDLSLLVNYCGKNVPAGFQCP  192



>ref|XP_010422226.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=131

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 93/127 (73%), Gaps = 2/127 (2%)
 Frame = +3

Query  84   AFALFLVINILFFT-TVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVCANVLNG  260
            + A+FL +NILFF  T +A + CP            +  +   CP DALKLGVC   LN 
Sbjct  6    SLAIFLALNILFFALTEAARSGCPPSSSNKPKPTPSSAPAIETCPKDALKLGVCVQALN-  64

Query  261  LLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslslllnVCSKKV  440
            L+N+T+G PP KPCCSLI+ LVDLEAAVCLCTA+KA+ILGIN+N+P++LSLLLNVCS+K 
Sbjct  65   LVNVTLGAPPVKPCCSLIDGLVDLEAAVCLCTALKASILGININLPINLSLLLNVCSRKA  124

Query  441  PKGFTCP  461
            P+GF CP
Sbjct  125  PRGFQCP  131



>ref|XP_009382414.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Musa acuminata 
subsp. malaccensis]
Length=145

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVL GLLNIT+G PPK+PCC+L++ LVDLEAAVCLCTA+K N+LG+ LN+P
Sbjct  65   DALKLGVCANVLGGLLNITLGTPPKEPCCTLLQGLVDLEAAVCLCTALKGNVLGLVLNLP  124

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLN C K+VP GF C
Sbjct  125  ISLSLLLNYCGKEVPTGFLC  144



>ref|XP_009110670.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Brassica rapa]
Length=134

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 96/133 (72%), Gaps = 1/133 (1%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkc-ptDALKLGV  239
            M+S  + + ALFL +N++FF  V+ CNTC  PKP P P P P  +      P DALKLGV
Sbjct  1    MESNRSFSAALFLSLNLMFFACVNGCNTCLPPKPIPNPNPNPISNPTKHSCPRDALKLGV  60

Query  240  CANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslslll  419
            CA +L+G +   IGNPP  PCCS ++ LVDLEAAVCLCTAIKANILGI+++IP+SLSLL+
Sbjct  61   CAKILDGAVGTVIGNPPDTPCCSFLQGLVDLEAAVCLCTAIKANILGIDIDIPISLSLLI  120

Query  420  nVCSKKVPKGFTC  458
            N C KK+P  F C
Sbjct  121  NTCGKKLPSDFIC  133



>ref|XP_006368194.1| HyPRP family protein [Populus trichocarpa]
 gb|ABK92650.1| unknown [Populus trichocarpa]
 gb|ERP64763.1| HyPRP family protein [Populus trichocarpa]
Length=140

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCA++L  LLN+TIG+PP KPCCS+I+ L+DLEAA+CLCTAIKANILGINLNIP
Sbjct  60   DALKLGVCADLLGSLLNVTIGSPPVKPCCSVIQGLLDLEAAICLCTAIKANILGINLNIP  119

Query  399  lslslllnVCSKKVPKGFTCP  461
            +SLSLL+NVC KKVPK F CP
Sbjct  120  ISLSLLINVCGKKVPKDFQCP  140



>ref|XP_010433333.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=131

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 96/127 (76%), Gaps = 2/127 (2%)
 Frame = +3

Query  84   AFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkc-ptDALKLGVCANVLNG  260
            + A+FLV+NILFF    A  +   P    KPKPTP+     +  P DALKLGVC   LN 
Sbjct  6    SLAIFLVLNILFFALTEATRSGCPPSFSNKPKPTPSSPPAIETCPKDALKLGVCVQALN-  64

Query  261  LLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslslllnVCSKKV  440
            L+N+T+G PP KPCCSLI+ LVDLEAAVCLCTA+KA+ILGIN+N+P++LSLLLNVCS+K 
Sbjct  65   LVNVTLGAPPVKPCCSLIDGLVDLEAAVCLCTALKASILGININLPINLSLLLNVCSRKA  124

Query  441  PKGFTCP  461
            P+GF CP
Sbjct  125  PRGFQCP  131



>ref|NP_001235008.1| uncharacterized protein LOC100499716 precursor [Glycine max]
 gb|ACU13356.1| unknown [Glycine max]
Length=170

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVLNGLLN+T+G PP  PCCSL+  LVDLEAAVCLCTA++ANILGINLN+P
Sbjct  90   DALKLGVCANVLNGLLNVTLGQPPVTPCCSLLNGLVDLEAAVCLCTALRANILGINLNLP  149

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCS++VP+ F C
Sbjct  150  ISLSLLLNVCSRQVPRDFQC  169



>ref|XP_006440349.1| hypothetical protein CICLE_v10022832mg [Citrus clementina]
 gb|ESR53589.1| hypothetical protein CICLE_v10022832mg [Citrus clementina]
 gb|KDO61488.1| hypothetical protein CISIN_1g035808mg [Citrus sinensis]
Length=131

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 91/123 (74%), Gaps = 2/123 (2%)
 Frame = +3

Query  90   ALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVCANVLNGLLN  269
            AL L +N++FFT VS+  T     P P       P+ K  CP D LKLGVCANVLN L++
Sbjct  10   ALLLSLNLIFFTLVSS--TYVPCPPPPPKSHKHPPAPKPTCPRDTLKLGVCANVLNDLVH  67

Query  270  ITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslslllnVCSKKVPKG  449
            + +G PPK PCCSLI+ LVDLEAAVCLCTAIKANILGINLN+P+SLSLLLN C KKVP G
Sbjct  68   LVVGTPPKTPCCSLIKGLVDLEAAVCLCTAIKANILGINLNVPVSLSLLLNFCGKKVPSG  127

Query  450  FTC  458
            F C
Sbjct  128  FQC  130



>gb|KDP25650.1| hypothetical protein JCGZ_20806 [Jatropha curcas]
Length=130

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCA+VL GLLN+T+G PPK PCCSL+ +LVDLEAAVCLCT IKA++LGINLN+P
Sbjct  50   DTLKLGVCADVLKGLLNVTVGTPPKTPCCSLLGDLVDLEAAVCLCTTIKASLLGINLNLP  109

Query  399  lslslllnVCSKKVPKGFTC  458
            + LSLLLN C KKVP+GF C
Sbjct  110  IDLSLLLNYCGKKVPEGFKC  129



>emb|CDP09932.1| unnamed protein product [Coffea canephora]
Length=147

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 97/147 (66%), Gaps = 16/147 (11%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACN---------------tcpspkpkpkpkptptps  197
            M SK+T   ALFL  N++FFT VSAC                  P+    P P       
Sbjct  1    MGSKATTTLALFLAFNLIFFTLVSACGDCPKPKPPKPKPKPSPPPTVPCPPPPYSPTPNP  60

Query  198  skgkcptDALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnil  377
             +  CP DALKLGVCAN+LN ++ I+IG+PP +PCCSL++ L DLEAA+CLCTAIKANIL
Sbjct  61   PQKSCPRDALKLGVCANLLN-IIGISIGSPPTEPCCSLLQGLADLEAALCLCTAIKANIL  119

Query  378  ginlniplslslllnVCSKKVPKGFTC  458
            GINLN+P+SLS++LN C KKVP GF C
Sbjct  120  GINLNVPVSLSVILNDCGKKVPNGFQC  146



>ref|XP_003549907.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Glycine max]
Length=138

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVL GLLN+T+G PP  PCC+L++ LVDLEAAVCLCTA+KAN+LGINLN+P
Sbjct  58   DALKLGVCANVLKGLLNVTLGQPPVTPCCTLLDGLVDLEAAVCLCTALKANVLGINLNLP  117

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCS++VP+ F C
Sbjct  118  ISLSLLLNVCSRQVPRDFQC  137



>ref|XP_009376589.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
 ref|XP_009376590.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=136

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 91/135 (67%), Gaps = 3/135 (2%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSAC---NtcpspkpkpkpkptptpsskgkcptDALKL  233
            M+SK     ALFL IN+LF    S C   +  P  + +         +S   CP D+LKL
Sbjct  1    MNSKRYSTLALFLSINLLFCVLASGCYTCSQQPHQQIRNPRPNPIPSASPKSCPRDSLKL  60

Query  234  GVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsl  413
            GVCA +LNG +   +GNPP  PCC+L+E LVDLE AVCLCTAIKANILGINLNIP++LSL
Sbjct  61   GVCAKLLNGAVGAVVGNPPDHPCCALLEGLVDLEVAVCLCTAIKANILGINLNIPIALSL  120

Query  414  llnVCSKKVPKGFTC  458
            +++ C+K VP+GF C
Sbjct  121  VIDGCAKNVPEGFKC  135



>ref|XP_002533299.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF29093.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=133

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVL  LLN+ IG PP +PCCSLI+ LVDLEAAVCLCTAIKANILGINLNIP
Sbjct  53   DALKLGVCANVLGSLLNLNIGKPPVEPCCSLIQGLVDLEAAVCLCTAIKANILGINLNIP  112

Query  399  lslslllnVCSKKVPKGFTC  458
            LSLSLLLNVC KK P GF C
Sbjct  113  LSLSLLLNVCGKKTPSGFQC  132



>ref|XP_006396750.1| hypothetical protein EUTSA_v10029060mg [Eutrema salsugineum]
 gb|ESQ38203.1| hypothetical protein EUTSA_v10029060mg [Eutrema salsugineum]
Length=135

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 95/134 (71%), Gaps = 2/134 (1%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcp--tDALKLG  236
            M S+ + +  +FL  NILFFT  +AC    SP PKPKPKP PTP          D LKLG
Sbjct  1    MASRISASLIIFLTFNILFFTLTTACGGGCSPIPKPKPKPKPTPKPSSSISCPRDTLKLG  60

Query  237  VCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsll  416
            VCANVL  LL I +G PP KPCCS+++ LVDLEAA CLCTA+KAN+LGI LN+P+SLSLL
Sbjct  61   VCANVLKDLLKIDVGKPPVKPCCSVLKGLVDLEAAACLCTALKANVLGIKLNVPISLSLL  120

Query  417  lnVCSKKVPKGFTC  458
            LNVC +K P GF C
Sbjct  121  LNVCGRKTPSGFIC  134



>emb|CDY21275.1| BnaC03g29590D [Brassica napus]
Length=135

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 95/134 (71%), Gaps = 2/134 (1%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcp--tDALKLG  236
            M +K++ +  +FL  NILFFT  +AC       PKPKPKP PTP+           LKLG
Sbjct  1    MAAKNSASLIIFLTFNILFFTLTTACGGGCGSIPKPKPKPKPTPTPSSSGSCPRKTLKLG  60

Query  237  VCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsll  416
            VCANVL  LL I +G+PP KPCCSL++ LVDLEAA CLCTA+KAN+LGI LN+P+SLSLL
Sbjct  61   VCANVLKDLLKIELGSPPVKPCCSLLKGLVDLEAAACLCTALKANVLGIKLNVPVSLSLL  120

Query  417  lnVCSKKVPKGFTC  458
            LN C +K P+GF C
Sbjct  121  LNACGRKTPRGFIC  134



>emb|CDY31240.1| BnaC08g15350D [Brassica napus]
Length=137

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVLNGLL++T+G PP KPCCSLI+ L D+EAAVCLCTA+KAN+LGINLN+P
Sbjct  58   DTLKLGVCANVLNGLLDLTLGKPPVKPCCSLIQGLADVEAAVCLCTALKANVLGINLNLP  117

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCSK+VP GF C
Sbjct  118  ISLSLLLNVCSKQVPPGFQC  137



>ref|XP_010053452.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
 gb|KCW77751.1| hypothetical protein EUGRSUZ_D02045 [Eucalyptus grandis]
Length=134

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCA++LNGL+NI +G PPK PCCSL+E L DLEAAVCLCTAIKA++LGINLN+P
Sbjct  54   DALKLGVCADLLNGLVNIVVGTPPKTPCCSLLEGLADLEAAVCLCTAIKASVLGINLNVP  113

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLN C K VP GF C
Sbjct  114  VSLSLLLNYCGKDVPYGFQC  133



>ref|XP_010933688.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=131

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            +ALKLGVCANVLNGL+N+ +GNPPKKPCC+L++ L DLE AVCLCTA+KANILGI+LN+P
Sbjct  51   NALKLGVCANVLNGLINLNLGNPPKKPCCTLLQGLADLEVAVCLCTALKANILGISLNVP  110

Query  399  lslslllnVCSKKVPKGFTCP  461
            + LSLL+N C K  P GF CP
Sbjct  111  IDLSLLINYCGKNAPTGFQCP  131



>ref|XP_007209745.1| hypothetical protein PRUPE_ppa013010mg [Prunus persica]
 gb|EMJ10944.1| hypothetical protein PRUPE_ppa013010mg [Prunus persica]
Length=144

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVLNGLLNITIG PP  PCCSLI+ L D+EAAVCLCTAIKANILGINLNIP
Sbjct  64   DTLKLGVCANVLNGLLNITIGKPPVAPCCSLIQGLADVEAAVCLCTAIKANILGINLNIP  123

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVC  KVPK F C
Sbjct  124  ISLSLLLNVCGNKVPKDFQC  143



>gb|KDO61485.1| hypothetical protein CISIN_1g047179mg [Citrus sinensis]
Length=130

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 95/132 (72%), Gaps = 3/132 (2%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            MDSK +    +FL INI+ F  VS CNTC  P+P P P P PT     +   DALKLGVC
Sbjct  1    MDSKRSIWITVFLSINIISFALVSGCNTCVQPRPIPNPNPNPTSRRCPR---DALKLGVC  57

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            A VL+G +   +GNPP  PCCS+++ L+DLEAAVCLCTAIKANILGIN+NIP+SLSLL+N
Sbjct  58   AKVLDGTVGAVVGNPPDFPCCSVLQGLLDLEAAVCLCTAIKANILGININIPISLSLLIN  117

Query  423  VCSKKVPKGFTC  458
             C KK+P  F C
Sbjct  118  TCGKKLPSDFIC  129



>ref|XP_010493743.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=132

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            M+S  + + ALFL  N++ F  VS CNTC   KP P P P   P+       DALKLGVC
Sbjct  1    MESHRSFSAALFLSFNLMLFAYVSGCNTCLPTKPIPNPNPISNPTKHSCPK-DALKLGVC  59

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            A +L+G +   IGNPP  PCCS+++ LVDLEAAVCLCTAIKANILGIN++IP+SLSLL+N
Sbjct  60   AKILDGAVGTVIGNPPDAPCCSVLQGLVDLEAAVCLCTAIKANILGINIDIPISLSLLIN  119

Query  423  VCSKKVPKGFTC  458
             C KK+P  F C
Sbjct  120  TCGKKLPSDFIC  131



>ref|XP_009375766.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=142

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 91/139 (65%), Gaps = 8/139 (6%)
 Frame = +3

Query  66   DSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkc--------ptD  221
             SK+    AL + +NI+FFTTVSA +      P P PK    P +            P D
Sbjct  3    SSKAVATIALLISLNIVFFTTVSAHHHASKCPPPPPPKTPKCPPTASPLNPPAKASCPKD  62

Query  222  ALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnipl  401
             LKLGVC ++LN L+ I +G PPK PCCSLI  L DLEAAVCLCTAIKAN+LGINL++P+
Sbjct  63   TLKLGVCGDLLNDLVTIVVGTPPKTPCCSLIGGLTDLEAAVCLCTAIKANVLGINLDVPV  122

Query  402  slslllnVCSKKVPKGFTC  458
            SLSLLLN C K VPKGF C
Sbjct  123  SLSLLLNYCGKSVPKGFQC  141



>emb|CDY21276.1| BnaC03g29600D [Brassica napus]
Length=107

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 84/129 (65%), Gaps = 24/129 (19%)
 Frame = +3

Query  75   STRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVCANVL  254
            S  + A+FL +NILFF    A  +                          +KLGVC N L
Sbjct  3    SRNSLAIFLALNILFFALTEAARSGY-----------------------TVKLGVCVNAL  39

Query  255  NGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslslllnVCSK  434
            N LLN+T+G PP KPCCSLI  LVDLEAAVCLCTA+KA+ILGIN+N+P++LSLLLNVCS+
Sbjct  40   N-LLNVTLGAPPVKPCCSLIAGLVDLEAAVCLCTALKASILGININLPINLSLLLNVCSR  98

Query  435  KVPKGFTCP  461
            K P+GF CP
Sbjct  99   KAPRGFQCP  107



>ref|XP_008238564.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Prunus mume]
Length=147

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVLNGLLNITIG PP  PCCSLI+ L D+EAAVCLCTAIKANILGINLNIP
Sbjct  67   DTLKLGVCANVLNGLLNITIGKPPVAPCCSLIQGLADVEAAVCLCTAIKANILGINLNIP  126

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVC  KVPK F C
Sbjct  127  ISLSLLLNVCGNKVPKDFQC  146



>ref|XP_010695115.1| PREDICTED: putative lipid-binding protein AIR1B [Beta vulgaris 
subsp. vulgaris]
Length=116

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 85/134 (63%), Gaps = 19/134 (14%)
 Frame = +3

Query  63   MDSKSTR-AFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGV  239
            M SKST  A   FL  N++FF+ VSA +   +                     D LKL V
Sbjct  1    MGSKSTNIAIVFFLSFNLIFFSLVSATHPPATCPF------------------DTLKLKV  42

Query  240  CANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslslll  419
            CANVLNGLL +TIG PP+  CCSLI+ L DL+AAVCLCTA++AN+LGI LN+P+SLSLLL
Sbjct  43   CANVLNGLLGLTIGTPPRHSCCSLIQGLADLDAAVCLCTALRANVLGIRLNVPISLSLLL  102

Query  420  nVCSKKVPKGFTCP  461
            N C    P GFTCP
Sbjct  103  NACGCNYPDGFTCP  116



>ref|XP_006304906.1| hypothetical protein CARUB_v10011959mg [Capsella rubella]
 gb|EOA37804.1| hypothetical protein CARUB_v10011959mg [Capsella rubella]
Length=138

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVLNGLL++T+G PP +PCCSLI+ L D+EAAVCLCTA+KAN+LGINLN+P
Sbjct  59   DTLKLGVCANVLNGLLDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKANVLGINLNVP  118

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCSK++P GF C
Sbjct  119  ISLSLLLNVCSKQLPSGFQC  138



>ref|XP_006477231.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Citrus sinensis]
Length=130

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 95/132 (72%), Gaps = 3/132 (2%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            MDSK +    +FL INI+ F  VS CNTC  P+P P P P PT     +   DALKLG+C
Sbjct  1    MDSKRSIWITVFLSINIISFALVSGCNTCVQPRPIPNPNPNPTSRRCPR---DALKLGIC  57

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            A VL+G +   +GNPP  PCCS+++ L+DLEAAVCLCTAIKANILGIN+NIP+SLSLL+N
Sbjct  58   AKVLDGTVGAVVGNPPDFPCCSVLQGLLDLEAAVCLCTAIKANILGININIPISLSLLIN  117

Query  423  VCSKKVPKGFTC  458
             C KK+P  F C
Sbjct  118  TCGKKLPSDFIC  129



>ref|XP_002529775.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF32589.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=139

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCA+VL  LLNITIG PP +PCCSLI+ LVDLEAAVCLCTAIKANILGINLNIP
Sbjct  59   DALKLGVCADVLGSLLNITIGKPPVEPCCSLIQGLVDLEAAVCLCTAIKANILGINLNIP  118

Query  399  lslslllnVCSKKVPKGFTC  458
            LSLSLLLNVCSKK P  F C
Sbjct  119  LSLSLLLNVCSKKTPSDFQC  138



>ref|XP_011033953.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Populus euphratica]
Length=137

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCA++L  LLN+T+GNPP KPCCS+I+ L+DLE+AVCLCTAIKANILGINLNIP
Sbjct  57   DALKLGVCADLLGSLLNVTVGNPPVKPCCSVIQGLLDLESAVCLCTAIKANILGINLNIP  116

Query  399  lslslllnVCSKKVPKGFTC  458
            LSLSLLLNVC KKVPK F C
Sbjct  117  LSLSLLLNVCGKKVPKDFQC  136



>ref|XP_010264242.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nelumbo nucifera]
Length=133

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCAN+LN L+++ IG PPK PCC+LIE L DLEAAVCLCTAIKANILGI+LN+P
Sbjct  53   DTLKLGVCANLLNDLVHLVIGTPPKYPCCTLIEGLADLEAAVCLCTAIKANILGIHLNVP  112

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLN C KKVP GF C
Sbjct  113  VSLSLLLNYCGKKVPSGFQC  132



>gb|KFK28807.1| hypothetical protein AALP_AA7G051200 [Arabis alpina]
Length=133

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 93/128 (73%), Gaps = 2/128 (2%)
 Frame = +3

Query  84   AFALFLVINILFFTTVSACNtc--pspkpkpkpkptptpsskgkcptDALKLGVCANVLN  257
            + A FL+ NILFFT  SA  +   P P  K        P++ G CP D +KLGVC N LN
Sbjct  6    SLARFLLFNILFFTLTSATRSTNCPPPPRKHNKHKPSPPTTTGTCPLDTIKLGVCVNALN  65

Query  258  GLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslslllnVCSKK  437
             L ++T+G PP  PCCSLI+ LVDLEAAVCLCTA+KA++LGINLN+P++LSLLLNVCS+K
Sbjct  66   LLNDVTLGTPPVTPCCSLIKGLVDLEAAVCLCTALKASVLGINLNLPINLSLLLNVCSRK  125

Query  438  VPKGFTCP  461
             P+GF CP
Sbjct  126  APRGFQCP  133



>gb|EYU24741.1| hypothetical protein MIMGU_mgv1a016172mg [Erythranthe guttata]
Length=132

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            M S+   +  L ++ N++FFT VS+    P P P            K  CP D LKLGVC
Sbjct  1    MASRVATSTILLVMFNLVFFTMVSS-TYVPCPPPPSHEHKHHHHHPKATCPKDTLKLGVC  59

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            AN+LN L+++ +G+PPK PCCSLI  LVDLEAAVCLCTA+KAN+LGINLN+P+SLSLLLN
Sbjct  60   ANLLNDLVHLVVGSPPKTPCCSLIGGLVDLEAAVCLCTAVKANVLGINLNVPVSLSLLLN  119

Query  423  VCSKKVPKGFTC  458
             C KKVP GF C
Sbjct  120  YCGKKVPSGFQC  131



>ref|XP_006417265.1| hypothetical protein EUTSA_v10009083mg [Eutrema salsugineum]
 gb|ESQ35618.1| hypothetical protein EUTSA_v10009083mg [Eutrema salsugineum]
Length=134

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkc-ptDALKLGV  239
            M+S  +     FL +N++FF  VS CNTC  PKP P P P P  +      P DALKLGV
Sbjct  1    MESYRSFHAVFFLSLNLMFFAYVSGCNTCLPPKPIPNPNPNPISNPTKHSCPRDALKLGV  60

Query  240  CANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslslll  419
            CA +L+G +   IGNPP  PCCS+++ LVDLEAAVCLCTAIKANILGIN++IP+SLSLL+
Sbjct  61   CAKILDGAVGTVIGNPPDTPCCSVLQGLVDLEAAVCLCTAIKANILGINIDIPISLSLLI  120

Query  420  nVCSKKVPKGFTC  458
            N C KK+P  F C
Sbjct  121  NTCGKKLPSDFIC  133



>emb|CDY61290.1| BnaCnng37610D [Brassica napus]
Length=135

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 95/134 (71%), Gaps = 2/134 (1%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcp--tDALKLG  236
            M +K++ +  +FL  NILFFT  +AC       PKPKPKP PTP+           LKLG
Sbjct  1    MAAKNSASLIIFLTFNILFFTLTTACGGGCGSIPKPKPKPKPTPTPSSSGSCPRKTLKLG  60

Query  237  VCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsll  416
            VCANVL  LL I +G+PP KPCCSL++ LVD+EAA CLCTA+KAN+LGI LN+P+SLSLL
Sbjct  61   VCANVLKDLLKIELGSPPVKPCCSLLKGLVDIEAAACLCTALKANVLGIKLNVPVSLSLL  120

Query  417  lnVCSKKVPKGFTC  458
            LN C +K P+GF C
Sbjct  121  LNACGRKTPRGFIC  134



>ref|XP_006417266.1| hypothetical protein EUTSA_v10009061mg [Eutrema salsugineum]
 gb|ESQ35619.1| hypothetical protein EUTSA_v10009061mg [Eutrema salsugineum]
Length=139

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVLNGLL++T+G PP +PCCSLI+ L D+EAAVCLCTA+KAN+LGINLN+P
Sbjct  60   DTLKLGVCANVLNGLLDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKANVLGINLNLP  119

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCSK+VP GF C
Sbjct  120  ISLSLLLNVCSKQVPPGFQC  139



>ref|XP_002270769.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
 emb|CAN65287.1| hypothetical protein VITISV_042739 [Vitis vinifera]
Length=135

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCAN+L GL+   +G PPK PCCSLI+ L DLEAAVCLCTAIKAN+LGINLNIP
Sbjct  55   DTLKLGVCANLLGGLIGAVVGTPPKTPCCSLIQGLADLEAAVCLCTAIKANVLGINLNIP  114

Query  399  lslslllnVCSKKVPKGFTC  458
            LSLSLLLNVCSKKVP GF C
Sbjct  115  LSLSLLLNVCSKKVPPGFQC  134



>ref|XP_003608748.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula]
 gb|AES90945.1| Lipid transfer protein [Medicago truncatula]
 gb|AFK34609.1| unknown [Medicago truncatula]
Length=169

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVLNGLLN+T+G PP  PCC+L+  LVDLEAAVCLCTA+KANILGINLN+P
Sbjct  89   DALKLGVCANVLNGLLNVTLGQPPVTPCCTLLNGLVDLEAAVCLCTALKANILGINLNLP  148

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCSK+ P+ F C
Sbjct  149  ISLSLLLNVCSKQAPRDFQC  168



>gb|KHN04345.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=166

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVLNGLLN+T+G PP  PCCSL+  LVDLEAAVCLCTA+KANILGINLN+P
Sbjct  86   DALKLGVCANVLNGLLNVTLGQPPVTPCCSLLNGLVDLEAAVCLCTALKANILGINLNLP  145

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCS+  P+ F C
Sbjct  146  ISLSLLLNVCSRNAPRDFQC  165



>gb|KDP25647.1| hypothetical protein JCGZ_20803 [Jatropha curcas]
Length=130

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVC +VL GLLN+T+G PPK PCCSL+ +LVDLEAAVCLCT IKA++LGINLN+P
Sbjct  50   DTLKLGVCVDVLKGLLNVTVGKPPKTPCCSLLGDLVDLEAAVCLCTTIKASLLGINLNLP  109

Query  399  lslslllnVCSKKVPKGFTC  458
            + LSLLLN C KKVP+GF C
Sbjct  110  IDLSLLLNYCGKKVPEGFKC  129



>ref|XP_010906606.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=132

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            + LKLGVCA VLNGL+N+++G PPKKPCC+L+E LVDLEAAVCLCTA+KA+ILGI LN+P
Sbjct  52   NTLKLGVCAKVLNGLINVSLGKPPKKPCCTLLEGLVDLEAAVCLCTALKASILGIKLNVP  111

Query  399  lslslllnVCSKKVPKGFTC  458
            + LSLLLN C KKVP G+ C
Sbjct  112  VDLSLLLNYCGKKVPAGWKC  131



>emb|CDY21034.1| BnaA08g24910D [Brassica napus]
Length=134

 Score = 90.5 bits (223),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 96/133 (72%), Gaps = 1/133 (1%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkc-ptDALKLGV  239
            M+S  + + ALFL ++++FF  V+ CNTC  PKP P P P P  +      P DALKLGV
Sbjct  1    MESNRSFSAALFLSLSLMFFACVNGCNTCLPPKPIPNPNPNPISNPTKHSCPRDALKLGV  60

Query  240  CANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslslll  419
            CA +L+G +   IGNPP  PCCS ++ LVDLEAAVCLCTAIKANILGI+++IP+SLSLL+
Sbjct  61   CAKILDGAVGTVIGNPPDTPCCSFLQGLVDLEAAVCLCTAIKANILGIDIDIPISLSLLI  120

Query  420  nVCSKKVPKGFTC  458
            N C KK+P  F C
Sbjct  121  NTCGKKLPSDFIC  133



>ref|XP_002892674.1| hypothetical protein ARALYDRAFT_471359 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68933.1| hypothetical protein ARALYDRAFT_471359 [Arabidopsis lyrata subsp. 
lyrata]
Length=140

 Score = 90.5 bits (223),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVLNGLL++T+G PP +PCCSLI+ L D+EAAVCLCTA+KANILGINLN+P
Sbjct  61   DTLKLGVCANVLNGLLDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKANILGINLNLP  120

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCSK++P GF C
Sbjct  121  ISLSLLLNVCSKQLPPGFQC  140



>gb|ACU21436.1| unknown [Glycine max]
Length=172

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVLNGLLN+T+G PP  PCCSL+  LVDLEAAVCLCTA+KANILGINLN+P
Sbjct  92   DALKLGVCANVLNGLLNVTLGQPPVTPCCSLLNGLVDLEAAVCLCTALKANILGINLNLP  151

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCS+  P+ F C
Sbjct  152  ISLSLLLNVCSRNAPRDFQC  171



>ref|XP_003525810.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Glycine max]
Length=172

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVLNGLLN+T+G PP  PCCSL+  LVDLEAAVCLCTA+KANILGINLN+P
Sbjct  92   DALKLGVCANVLNGLLNVTLGQPPVTPCCSLLNGLVDLEAAVCLCTALKANILGINLNLP  151

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCS+  P+ F C
Sbjct  152  ISLSLLLNVCSRNAPRDFQC  171



>ref|XP_004165754.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
 gb|KGN50241.1| HyPRP2 [Cucumis sativus]
Length=140

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCA +L GLL+ITIG PP  PCCSLIE L DLEAAVCLCTAIKA+ILGINLN+P
Sbjct  61   DTLKLGVCAKLLGGLLDITIGKPPVTPCCSLIEGLADLEAAVCLCTAIKADILGINLNVP  120

Query  399  lslslllnVCSKKVPKGFTC  458
            LSLSLLLNVC K VPKGF C
Sbjct  121  LSLSLLLNVCQKNVPKGFQC  140



>ref|XP_010093706.1| hypothetical protein L484_019047 [Morus notabilis]
 gb|EXB54486.1| hypothetical protein L484_019047 [Morus notabilis]
Length=133

 Score = 90.1 bits (222),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALK+GVCANVL GL+N T+GNPP  PCC+LI+ L DLEAA+CLCTAI+A+ILGIN+NIP
Sbjct  53   DALKIGVCANVLGGLVNATVGNPPVTPCCTLIQGLADLEAALCLCTAIRASILGININIP  112

Query  399  lslslllnVCSKKVPKGFTCP  461
            ++LSLLLNVCS+  P GF CP
Sbjct  113  VNLSLLLNVCSRNSPPGFQCP  133



>ref|NP_172673.1| extensin-like protein [Arabidopsis thaliana]
 gb|AAC17607.1| Contains homology to extensin-like protein gb|D83227 from Populus 
nigra. ESTs gb|H76425, gb|T13883, gb|T45348, gb|H37743, 
gb|AA042634, gb|Z26960 and gb|Z25951 come from this gene. There 
is a similar ORF on the opposite strand [Arabidopsis thaliana]
 gb|AAC98387.1| extensin-like protein [Arabidopsis thaliana]
 gb|AAL25599.1| At1g12090/T28K15.14 [Arabidopsis thaliana]
 gb|AAM14027.1| putative pEARLI 1 [Arabidopsis thaliana]
 gb|AAM51297.1| putative pEARLI 1 [Arabidopsis thaliana]
 gb|AEE28836.1| extensin-like protein [Arabidopsis thaliana]
Length=137

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVLNGLL++T+G PP +PCCSLI+ L D+EAAVCLCTA+KANILGINLN+P
Sbjct  58   DTLKLGVCANVLNGLLDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKANILGINLNLP  117

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCSK++P GF C
Sbjct  118  ISLSLLLNVCSKQLPPGFQC  137



>ref|XP_010458633.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=143

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVLNGLL++T+G PP +PCCSLI+ L D+EAAVCLCTA+KAN+LGINLN+P
Sbjct  63   DTLKLGVCANVLNGLLDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKANVLGINLNLP  122

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCSK++P GF C
Sbjct  123  ISLSLLLNVCSKQLPPGFQC  142



>gb|ADA67933.1| putative 14 kDa proline-rich protein DC2.15 [Wolffia arrhiza]
Length=135

 Score = 90.1 bits (222),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 86/135 (64%), Gaps = 2/135 (1%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkc-ptDALKLGV  239
            M +K+  + ALF+++N+LFF+ V+A    P                     P D LKLGV
Sbjct  1    MAAKTGTSAALFVLLNVLFFSLVTATYCPPDTPKPTPIPTPKPTPKPTGKCPVDTLKLGV  60

Query  240  CANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip-lslsll  416
            CAN+LNGL+NI +G PPK PCC+LI+ L DLEAA+CLCT +KAN+LG+      ++LSLL
Sbjct  61   CANLLNGLINIQLGTPPKTPCCNLIKGLADLEAALCLCTVLKANVLGLISLNLPINLSLL  120

Query  417  lnVCSKKVPKGFTCP  461
            +N C K VP GF CP
Sbjct  121  VNYCGKSVPTGFICP  135



>gb|EYU18564.1| hypothetical protein MIMGU_mgv1a016162mg [Erythranthe guttata]
Length=132

 Score = 90.1 bits (222),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            M S++  +  L ++ N++FFT VS+    P P P            K  CP D LKLGVC
Sbjct  1    MASRAATSTILLVMFNLVFFTMVSS-TYVPCPPPPSHEHKHHHYHPKATCPKDTLKLGVC  59

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            AN+LN L+++ +G+PPK PCCSLI  L DLEAAVCLCTA+KAN+LGINLN+P+SLSLLLN
Sbjct  60   ANLLNDLVHLVVGSPPKTPCCSLIGGLADLEAAVCLCTAVKANVLGINLNVPVSLSLLLN  119

Query  423  VCSKKVPKGFTC  458
             C KKVP GF C
Sbjct  120  YCGKKVPSGFQC  131



>gb|AAM75351.1|AF520576_1 extensin-like protein [Glycine max]
Length=179

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVLNGLLN+T+G PP  PCCSL+  LVDLEAAVCLCTA+KANILGINLN+P
Sbjct  99   DALKLGVCANVLNGLLNVTLGQPPVTPCCSLLNGLVDLEAAVCLCTALKANILGINLNLP  158

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCS+  P+ F C
Sbjct  159  ISLSLLLNVCSRNAPRDFQC  178



>ref|XP_008232588.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Prunus mume]
Length=139

 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 94/136 (69%), Gaps = 5/136 (4%)
 Frame = +3

Query  66   DSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcpt-----DALK  230
             SK+    AL L +N++FFTTVS+ +  P+  P PK    P PS+           D LK
Sbjct  3    SSKAIATIALLLSLNLVFFTTVSSNHHVPNCPPPPKTPKHPPPSTSIPPAKASCPKDTLK  62

Query  231  LGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplsls  410
            LGVC ++LNGL+++ +G PPK PCCSLI  L D+EAAVCLCTAIKAN+LGINLN+P+SLS
Sbjct  63   LGVCGDLLNGLVHLVMGTPPKTPCCSLIGGLADVEAAVCLCTAIKANVLGINLNVPVSLS  122

Query  411  lllnVCSKKVPKGFTC  458
            LLLN C K VP GF C
Sbjct  123  LLLNYCGKSVPTGFQC  138



>ref|XP_006396753.1| hypothetical protein EUTSA_v10029038mg [Eutrema salsugineum]
 gb|ESQ38206.1| hypothetical protein EUTSA_v10029038mg [Eutrema salsugineum]
Length=153

 Score = 90.5 bits (223),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 99/152 (65%), Gaps = 20/152 (13%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSA----CNtcpspkpkpkpkptptpsskgkcpt----  218
            M SK++ + ALF  +NILFFT  +A    CN  P PKP P P P P        P     
Sbjct  1    MSSKNSASLALFFALNILFFTLTTATDCGCNPSPKPKPSPSPMPKPPKHVPSPNPMPVPP  60

Query  219  ------------DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAI  362
                        D LKLGVCANVL+GLLNI +G P  + CCSL++ LVDLEAAVCLCTA+
Sbjct  61   PSTPGSSENCPIDVLKLGVCANVLSGLLNIQLGQPSTQECCSLVQGLVDLEAAVCLCTAL  120

Query  363  KAnilginlniplslslllnVCSKKVPKGFTC  458
            +AN+LGINLN+P+SLS+LLN C+KKVP GF C
Sbjct  121  RANVLGINLNVPISLSVLLNKCNKKVPSGFEC  152



>ref|XP_007155641.1| hypothetical protein PHAVU_003G218900g [Phaseolus vulgaris]
 gb|ESW27635.1| hypothetical protein PHAVU_003G218900g [Phaseolus vulgaris]
Length=133

 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVLNGL+N T+G PP  PCC+L++ LVDLEAAVCLCTA+KANILGINLN+P
Sbjct  53   DALKLGVCANVLNGLVNATLGQPPVTPCCTLLDGLVDLEAAVCLCTALKANILGINLNLP  112

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCS++ P+ F C
Sbjct  113  ISLSLLLNVCSRQAPRDFQC  132



>ref|XP_010258985.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nelumbo nucifera]
Length=137

 Score = 90.1 bits (222),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCAN+LN L+++ +G PPK PCCSLIE L DLEAAVCLCTAIKANILGI+LN+P
Sbjct  57   DTLKLGVCANLLNDLVHLVVGTPPKYPCCSLIEGLADLEAAVCLCTAIKANILGIHLNVP  116

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLN C KKVP GF C
Sbjct  117  VSLSLLLNYCGKKVPSGFQC  136



>ref|XP_009148613.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Brassica 
rapa]
 emb|CDY53347.1| BnaA06g38220D [Brassica napus]
Length=137

 Score = 90.1 bits (222),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D L+LGVCANVLNGLL++T+G PP +PCCSLI+ L D+EAAVCLCTA+KAN+LGINLN+P
Sbjct  58   DTLQLGVCANVLNGLLDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKANVLGINLNLP  117

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCSK+VP GF C
Sbjct  118  ISLSLLLNVCSKQVPPGFQC  137



>ref|XP_006286053.1| hypothetical protein CARUB_v10007585mg [Capsella rubella]
 gb|EOA18951.1| hypothetical protein CARUB_v10007585mg [Capsella rubella]
Length=137

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVC N LN L ++T+G PP  PCCSLIE LVDLEAAVCLCTA+KA++LGINL +P
Sbjct  57   DALKLGVCVNALNLLKDVTLGTPPVTPCCSLIEGLVDLEAAVCLCTALKASVLGINLYLP  116

Query  399  lslslllnVCSKKVPKGFTCP  461
            ++LSLLLNVCS+K P+GF CP
Sbjct  117  INLSLLLNVCSRKAPRGFQCP  137



>ref|NP_001237899.1| uncharacterized protein LOC100527818 precursor [Glycine max]
 gb|ACU17007.1| unknown [Glycine max]
 gb|KHN09797.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=135

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 94/132 (71%), Gaps = 1/132 (1%)
 Frame = +3

Query  66   DSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkc-ptDALKLGVC  242
             S+++   ALFL IN+LFF   S C TC  PKP P P P P PS   K  P DALKLGVC
Sbjct  3    SSRTSTTLALFLTINLLFFVMASGCYTCTQPKPNPIPFPYPNPSPAAKSCPRDALKLGVC  62

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            ANVLNG +   +G+PP  PCCS++E L+DLE AVCLCTAIKANILGINLNIP+SLSL+LN
Sbjct  63   ANVLNGPIGAIVGSPPDHPCCSVLEGLLDLEVAVCLCTAIKANILGINLNIPISLSLILN  122

Query  423  VCSKKVPKGFTC  458
             C K  P  F C
Sbjct  123  ACEKSPPSDFLC  134



>ref|XP_009134277.1| PREDICTED: putative lipid-binding protein AIR1 [Brassica rapa]
 emb|CDX90838.1| BnaA03g25180D [Brassica napus]
Length=113

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 89/128 (70%), Gaps = 18/128 (14%)
 Frame = +3

Query  75   STRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVCANVL  254
            S  + ALFL +N+LFFT  SA                 T  + G CP D+L+LGVCANVL
Sbjct  3    SRTSLALFLAVNLLFFTYTSA-----------------TCYNTGSCPRDSLQLGVCANVL  45

Query  255  NGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslslllnVCSK  434
              L+++T+GNPP KPCCSLI  L DLEAAVCLCT +KANILGI LN+P++LS+LLNVCS+
Sbjct  46   K-LVDLTLGNPPVKPCCSLIAGLADLEAAVCLCTVLKANILGIKLNLPINLSVLLNVCSR  104

Query  435  KVPKGFTC  458
            K PK F C
Sbjct  105  KAPKNFQC  112



>ref|XP_009384469.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384470.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Musa acuminata 
subsp. malaccensis]
Length=138

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 98/139 (71%), Gaps = 7/139 (5%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcp------tDA  224
            M SK+T + ALFL+ N+LF+   SAC  CP+P PKPKPKP P P              D 
Sbjct  1    MASKTTSSIALFLLFNVLFWVLTSACGYCPTPTPKPKPKPKPKPKPTPSPAPSGKCPVDT  60

Query  225  LKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnipls  404
            LK   C++VL  L+N+ IG PPKKPCCSL+E L D EAA+CLCTA+KAN+LG NLNIP+S
Sbjct  61   LKFAACSDVLK-LINVEIGKPPKKPCCSLVEGLADDEAALCLCTALKANVLGANLNIPIS  119

Query  405  lslllnVCSKKVPKGFTCP  461
            LSLL+N C KKVP+GF CP
Sbjct  120  LSLLVNYCGKKVPEGFQCP  138



>ref|XP_010493734.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=132

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 94/132 (71%), Gaps = 1/132 (1%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            M+S  + + ALFL  N++ F  VS CNTC   KP P P P   P++      DALKLGVC
Sbjct  1    MESHISFSAALFLSSNLILFACVSGCNTCLPTKPIPNPNPISNPTTHSCPK-DALKLGVC  59

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            A +L+G +   IGNPP  PCCS+++ LVDLEAAVCLCTAIKANILGIN++IP+SLSLL++
Sbjct  60   AKILDGAVGTVIGNPPDTPCCSVLQGLVDLEAAVCLCTAIKANILGINIDIPISLSLLIS  119

Query  423  VCSKKVPKGFTC  458
             C KK+P  F C
Sbjct  120  TCGKKLPSDFIC  131



>ref|XP_009397884.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Musa acuminata 
subsp. malaccensis]
Length=132

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D +KLG CANVL GL+N+ IG PPKKPCCSLIE L D EAA+CLCTAIKANILGI+LN+ 
Sbjct  52   DTVKLGACANVLGGLINLQIGTPPKKPCCSLIEGLADFEAALCLCTAIKANILGISLNVD  111

Query  399  lslslllnVCSKKVPKGFTC  458
            + L+LLLN C KKVP G+ C
Sbjct  112  VDLTLLLNYCGKKVPYGYLC  131



>ref|XP_004516836.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cicer arietinum]
Length=157

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVLNGLLNI +G PP  PCCSL+E L DL+AA CLCTA+KANILGINLN+P
Sbjct  77   DTLKLGVCANVLNGLLNIKLGQPPVAPCCSLLEGLTDLQAAACLCTALKANILGINLNLP  136

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCSKKVP+ F C
Sbjct  137  ISLSLLLNVCSKKVPRDFQC  156



>ref|XP_007155640.1| hypothetical protein PHAVU_003G218800g [Phaseolus vulgaris]
 gb|ESW27634.1| hypothetical protein PHAVU_003G218800g [Phaseolus vulgaris]
Length=205

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVLNGL+N+T+G PP  PCC+L+  LVDLEAAVCLCTA++ANILGINLN+P
Sbjct  125  DALKLGVCANVLNGLVNVTLGQPPVSPCCTLLNGLVDLEAAVCLCTALRANILGINLNLP  184

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCS++VP+ F C
Sbjct  185  ISLSLLLNVCSRQVPRDFQC  204



>ref|XP_004147199.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
 ref|XP_004166720.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
 gb|KGN55878.1| proline-rich protein DC2.15 [Cucumis sativus]
Length=136

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCA++L+GL+++ IG PPK PCC+LI++LVDLEAA+CLCTA+KA  LG+ +++ 
Sbjct  55   DTLKLGVCADLLDGLVHVVIGAPPKTPCCTLIQDLVDLEAALCLCTAVKAKALGLKIDLS  114

Query  399  lslslllnVCSKKVPKGFTCP  461
            +SLSLLLN C KKVP GF CP
Sbjct  115  VSLSLLLNYCGKKVPNGFKCP  135



>ref|XP_010476166.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=143

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVLNGLL++T+G PP +PCCSLI+ L +LEAAVCLCTA+KAN+LGINLN+P
Sbjct  63   DTLKLGVCANVLNGLLDLTLGKPPVEPCCSLIQGLANLEAAVCLCTALKANVLGINLNLP  122

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCSK++P GF C
Sbjct  123  ISLSLLLNVCSKQLPSGFQC  142



>gb|KFK43474.1| hypothetical protein AALP_AA1G129700 [Arabis alpina]
Length=140

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVLNGLL++T+G PP +PCCSLI+ L D+EAAVCLCTA+KAN+LGINLN+P
Sbjct  61   DTLKLGVCANVLNGLLDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKANVLGINLNLP  120

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCSKKVP  F C
Sbjct  121  ISLSLLLNVCSKKVPSDFQC  140



>ref|XP_008392579.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=136

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 92/135 (68%), Gaps = 3/135 (2%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcpt---DALKL  233
            MDSKS+   ALFL +N+LF    S C TCP    +P   P P P       +   D+LKL
Sbjct  1    MDSKSSSTLALFLSVNLLFCVLASGCYTCPQXPHQPMTNPKPNPIPSAAPKSCPRDSLKL  60

Query  234  GVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsl  413
            GVCA +LN  +   +GNPP  PCC+L+E LV+LE AVCLCTAIKANILGINLNIP++LSL
Sbjct  61   GVCAKLLNRAVGAVVGNPPDHPCCALLEGLVELEVAVCLCTAIKANILGINLNIPIALSL  120

Query  414  llnVCSKKVPKGFTC  458
            +++ C+K VP GF C
Sbjct  121  IIDGCAKNVPSGFKC  135



>ref|XP_007155639.1| hypothetical protein PHAVU_003G218800g [Phaseolus vulgaris]
 gb|ESW27633.1| hypothetical protein PHAVU_003G218800g [Phaseolus vulgaris]
Length=208

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVLNGL+N+T+G PP  PCC+L+  LVDLEAAVCLCTA++ANILGINLN+P
Sbjct  128  DALKLGVCANVLNGLVNVTLGQPPVSPCCTLLNGLVDLEAAVCLCTALRANILGINLNLP  187

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCS++VP+ F C
Sbjct  188  ISLSLLLNVCSRQVPRDFQC  207



>ref|XP_010455702.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=131

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 93/127 (73%), Gaps = 2/127 (2%)
 Frame = +3

Query  84   AFALFLVINILFFT-TVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVCANVLNG  260
            + A+FL +NILFF  T +  + CP            +P +   CP DALKLGVC   LN 
Sbjct  6    SLAIFLALNILFFAFTEAGRSGCPPSSSNKPKPTPSSPPAIDTCPKDALKLGVCVQALN-  64

Query  261  LLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslslllnVCSKKV  440
            L+N+T+G PP KPCCSLI+ LVDLEAAVCLCTA+KA+ILGIN+N+P++LSLLLNVCS+K 
Sbjct  65   LVNVTLGAPPVKPCCSLIDGLVDLEAAVCLCTALKASILGININLPINLSLLLNVCSRKP  124

Query  441  PKGFTCP  461
            P+GF CP
Sbjct  125  PRGFQCP  131



>ref|XP_010539616.1| PREDICTED: lipid transfer protein EARLI 1-like [Tarenaya hassleriana]
Length=142

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 73/81 (90%), Gaps = 1/81 (1%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D+LKLGVC N LN LLN+T+G+PP KPCCSLI+ L DLEAAVCLCTA+KA+ILGINLN+P
Sbjct  63   DSLKLGVCVNALN-LLNVTLGSPPVKPCCSLIQGLADLEAAVCLCTALKASILGINLNVP  121

Query  399  lslslllnVCSKKVPKGFTCP  461
            ++L+LLLNVCS+K P+GF CP
Sbjct  122  INLTLLLNVCSRKAPRGFQCP  142



>ref|XP_010919517.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=157

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVLNGL+N+  G PPK PCCSL++ LVDLEAAVCLCT +KANILGI LN+P
Sbjct  77   DALKLGVCANVLNGLINLKAGKPPKLPCCSLLDGLVDLEAAVCLCTVLKANILGIKLNLP  136

Query  399  lslslllnVCSKKVPKGFTCP  461
            + LSLLLN C K  P+GF CP
Sbjct  137  IHLSLLLNYCGKNTPRGFQCP  157



>ref|XP_008238566.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Prunus mume]
Length=136

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 86/135 (64%), Gaps = 3/135 (2%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSAC---NtcpspkpkpkpkptptpsskgkcptDALKL  233
            MDSK     ALFL IN+LF    + C   +  P               +   CP DALKL
Sbjct  1    MDSKRCSTLALFLSINLLFCVLANGCYTCSWQPHQPITAPKTNPIPSVATKSCPRDALKL  60

Query  234  GVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsl  413
            GVCAN+L G +   IGNPP  PCC+L+E L+DLE AVCLCTAIKANILGINLNIP++LSL
Sbjct  61   GVCANLLKGAVGAIIGNPPDTPCCALLEGLLDLEVAVCLCTAIKANILGINLNIPIALSL  120

Query  414  llnVCSKKVPKGFTC  458
            +++ C+K  P GF C
Sbjct  121  VIDGCAKTFPPGFQC  135



>dbj|BAA11854.1| extensin like protein [Populus nigra]
 dbj|BAA11855.1| extensin like protein [Populus nigra]
Length=141

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCA++L  LLN+T+G PP KPCCS+I+ L+DLEAAVCLCTAIKANILGINLNIP
Sbjct  61   DALKLGVCADLLGSLLNVTVGTPPVKPCCSVIQGLLDLEAAVCLCTAIKANILGINLNIP  120

Query  399  lslslllnVCSKKVPKGFTC  458
            LSLSLLLNVC KKVPK F C
Sbjct  121  LSLSLLLNVCGKKVPKDFQC  140



>ref|XP_009110671.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Brassica rapa]
 emb|CDY21033.1| BnaA08g24920D [Brassica napus]
Length=137

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVL+GLL++T+G PP +PCCSLI+ L D+EAAVCLCTA+KAN+LGINLN+P
Sbjct  58   DTLKLGVCANVLSGLLDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKANVLGINLNLP  117

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCSK+VP GF C
Sbjct  118  ISLSLLLNVCSKQVPPGFQC  137



>ref|XP_004152410.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
Length=140

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCA +L GLL+ITIG PP  PCCSLI+ L DLEAAVCLCTAIKA+ILGINLN+P
Sbjct  61   DTLKLGVCAKLLGGLLDITIGKPPVTPCCSLIDGLADLEAAVCLCTAIKADILGINLNVP  120

Query  399  lslslllnVCSKKVPKGFTC  458
            LSLSLLLNVC K VPKGF C
Sbjct  121  LSLSLLLNVCQKNVPKGFQC  140



>emb|CDY16710.1| BnaA09g20880D [Brassica napus]
Length=107

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 82/126 (65%), Gaps = 24/126 (19%)
 Frame = +3

Query  84   AFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVCANVLNGL  263
            + A+FL  NILFF    A  +                          +KLGVC N LN L
Sbjct  6    SLAIFLAFNILFFALTEAARSGY-----------------------TVKLGVCVNALN-L  41

Query  264  LNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslslllnVCSKKVP  443
            LN T+G PP KPCCSLI+ LVDLEAAVCLCTA+KA+ILGIN+N+P++LSLLLNVCS+K P
Sbjct  42   LNATLGAPPVKPCCSLIDGLVDLEAAVCLCTALKASILGININLPINLSLLLNVCSRKAP  101

Query  444  KGFTCP  461
            +GF CP
Sbjct  102  RGFQCP  107



>ref|XP_002533294.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF29088.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=140

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVC ++L  LL++TIG PPK PCCSLI +LVDLEAAVCLCT+IKA++LGINLN+P
Sbjct  60   DTLKLGVCVDLLKDLLSVTIGKPPKTPCCSLIGDLVDLEAAVCLCTSIKASLLGINLNLP  119

Query  399  lslslllnVCSKKVPKGFTCP  461
            + LSL+LN C KKVP+GF CP
Sbjct  120  VDLSLVLNYCGKKVPEGFQCP  140



>gb|ABF93505.1| retrotransposon protein, putative, Ty1-copia subclass, expressed 
[Oryza sativa Japonica Group]
Length=179

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVLNGL+N+ +G PP++PCCSLI+ L DLEAAVCLCTA++ANILGINLN+P
Sbjct  98   DTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINLNLP  157

Query  399  lslslllnVCSKKVPKGFTC  458
            ++LSLL+N C + VP GF C
Sbjct  158  INLSLLVNYCGRSVPSGFQC  177



>gb|EAY88189.1| hypothetical protein OsI_09636 [Oryza sativa Indica Group]
 dbj|BAJ08376.1| qLTG3-1 [Oryza sativa Indica Group]
 dbj|BAJ08377.1| qLTG3-1 [Oryza sativa Indica Group]
 dbj|BAJ08378.1| qLTG3-1 [Oryza sativa Indica Group]
 dbj|BAJ08380.1| qLTG3-1 [Oryza sativa Indica Group]
Length=178

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVLNGL+N+ +G PP++PCCSLI+ L DLEAAVCLCTA++ANILGINLN+P
Sbjct  97   DTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINLNLP  156

Query  399  lslslllnVCSKKVPKGFTC  458
            ++LSLL+N C + VP GF C
Sbjct  157  INLSLLVNYCGRSVPSGFQC  176



>ref|NP_001048668.1| Os03g0103300 [Oryza sativa Japonica Group]
 gb|ABF93504.1| retrotransposon protein, putative, Ty1-copia subclass, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF10582.1| Os03g0103300 [Oryza sativa Japonica Group]
 gb|EAZ25261.1| hypothetical protein OsJ_09069 [Oryza sativa Japonica Group]
 dbj|BAI60003.1| Low-temperature germinability 3-1 [Oryza sativa Japonica Group]
 dbj|BAJ08375.1| qLTG3-1 [Oryza sativa Japonica Group]
Length=184

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVLNGL+N+ +G PP++PCCSLI+ L DLEAAVCLCTA++ANILGINLN+P
Sbjct  103  DTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINLNLP  162

Query  399  lslslllnVCSKKVPKGFTC  458
            ++LSLL+N C + VP GF C
Sbjct  163  INLSLLVNYCGRSVPSGFQC  182



>dbj|BAG50511.1| qLTG-3-1 [Oryza sativa Japonica Group]
 dbj|BAJ08371.1| qLTG3-1 [Oryza sativa Indica Group]
 dbj|BAJ08372.1| qLTG3-1 [Oryza sativa Indica Group]
 dbj|BAJ08373.1| qLTG3-1 [Oryza sativa Japonica Group]
 dbj|BAJ08374.1| qLTG3-1 [Oryza sativa Indica Group]
 dbj|BAN84541.1| QTL for low-temperature germinability 3-1 [Oryza sativa Japonica 
Group]
Length=184

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVLNGL+N+ +G PP++PCCSLI+ L DLEAAVCLCTA++ANILGINLN+P
Sbjct  103  DTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINLNLP  162

Query  399  lslslllnVCSKKVPKGFTC  458
            ++LSLL+N C + VP GF C
Sbjct  163  INLSLLVNYCGRSVPSGFQC  182



>dbj|BAJ08379.1| qLTG3-1 [Oryza sativa Indica Group]
Length=190

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVLNGL+N+ +G PP++PCCSLI+ L DLEAAVCLCTA++ANILGINLN+P
Sbjct  109  DTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINLNLP  168

Query  399  lslslllnVCSKKVPKGFTC  458
            ++LSLL+N C + VP GF C
Sbjct  169  INLSLLVNYCGRSVPSGFQC  188



>ref|XP_008448867.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis melo]
Length=136

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCA++L+GL+ + IG PPK PCC+LI++LVDLEAA+CLCTA+KA  LG+N+++ 
Sbjct  55   DTLKLGVCADLLDGLVRVVIGTPPKTPCCTLIKDLVDLEAALCLCTAVKAKALGLNIDLS  114

Query  399  lslslllnVCSKKVPKGFTCP  461
            +SLSLLLN C KKVP GF CP
Sbjct  115  VSLSLLLNYCGKKVPNGFKCP  135



>ref|XP_008437101.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis melo]
Length=140

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCA +L GL+++TIG PP  PCCSLIE L DLEAAVCLCTAIKAN+LG+NLNIP
Sbjct  61   DTLKLGVCAKLLGGLVDVTIGKPPVTPCCSLIEGLADLEAAVCLCTAIKANLLGLNLNIP  120

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVC K VPKGF C
Sbjct  121  VSLSLLLNVCQKNVPKGFQC  140



>ref|XP_008786992.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=143

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCA+VLNGL+++ +G PPK PCCSL++ LVDLEAAVCLCT +KANILGI LN+P
Sbjct  63   DALKLGVCADVLNGLIHLKLGKPPKLPCCSLLDGLVDLEAAVCLCTVLKANILGIKLNLP  122

Query  399  lslslllnVCSKKVPKGFTCP  461
            + LSLLLN C K  PKGF CP
Sbjct  123  IHLSLLLNYCGKNTPKGFQCP  143



>dbj|BAJ08384.1| qLTG3-1 [Oryza longistaminata]
Length=194

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVLNGL+N+ +G PP++PCCSLI+ L DLEAAVCLCTA++ANILGINLN+P
Sbjct  113  DTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINLNLP  172

Query  399  lslslllnVCSKKVPKGFTC  458
            ++LSLL+N C + VP GF C
Sbjct  173  INLSLLVNYCGRSVPSGFQC  192



>dbj|BAJ08383.1| qLTG3-1 [Oryza glumipatula]
Length=194

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVLNGL+N+ +G PP++PCCSLI+ L DLEAAVCLCTA++ANILGINLN+P
Sbjct  113  DTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINLNLP  172

Query  399  lslslllnVCSKKVPKGFTC  458
            ++LSLL+N C + VP GF C
Sbjct  173  INLSLLVNYCGRSVPSGFQC  192



>dbj|BAJ08381.1| qLTG3-1 [Oryza rufipogon]
Length=194

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVLNGL+N+ +G PP++PCCSLI+ L DLEAAVCLCTA++ANILGINLN+P
Sbjct  113  DTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINLNLP  172

Query  399  lslslllnVCSKKVPKGFTC  458
            ++LSLL+N C + VP GF C
Sbjct  173  INLSLLVNYCGRSVPSGFQC  192



>dbj|BAJ08382.1| qLTG3-1 [Oryza barthii]
Length=198

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVLNGL+N+ +G PP++PCCSLI+ L DLEAAVCLCTA++ANILGINLN+P
Sbjct  117  DTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINLNLP  176

Query  399  lslslllnVCSKKVPKGFTC  458
            ++LSLL+N C + VP GF C
Sbjct  177  INLSLLVNYCGRSVPSGFQC  196



>dbj|BAJ08386.1| qLTG3-1 [Oryza meridionalis]
Length=199

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVLNGL+N+ +G PP++PCCSLI+ L DLEAAVCLCTA++ANILGINLN+P
Sbjct  118  DTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINLNLP  177

Query  399  lslslllnVCSKKVPKGFTC  458
            ++LSLL+N C + VP GF C
Sbjct  178  INLSLLVNYCGRSVPSGFQC  197



>ref|XP_010041938.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
Length=121

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 85/133 (64%), Gaps = 12/133 (9%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            M SK+    AL L +NI+F +  +A    P+P                    +ALKLGVC
Sbjct  1    MASKNYPTLALVLSLNIIFASLATAWTPKPTPTAAASCPE------------NALKLGVC  48

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
             ++L  LLN+T+G PPK+PCCSLI  L+D+EAA CLC AI A+ILG+ +++ LSLSLLL+
Sbjct  49   LDLLGSLLNVTVGTPPKEPCCSLIGGLLDVEAAACLCIAIDADILGLQIDVELSLSLLLD  108

Query  423  VCSKKVPKGFTCP  461
             CSKKVP GF CP
Sbjct  109  ACSKKVPPGFQCP  121



>ref|XP_009373377.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
 ref|XP_009373378.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
 ref|XP_009346904.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=140

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 97/140 (69%), Gaps = 9/140 (6%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtc--------pspkpkpkpkptptpsskgkcpt  218
            M SK+  + AL + +N+LFFT V++ N            PK      P P PS    CP 
Sbjct  1    MASKALASTALLVSLNLLFFTLVTSTNVVCPPPAKKGHQPKHASPALPNPNPSKPATCPR  60

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLG CA+VLNGL+++ +G PPK PCCSLIE LVDL+AAVCLCTAIKAN++GINLNIP
Sbjct  61   DTLKLGACADVLNGLVHLVVG-PPKFPCCSLIEGLVDLDAAVCLCTAIKANVMGINLNIP  119

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLN C K+VP G+ C
Sbjct  120  ISLSLLLNYCGKQVPTGYEC  139



>ref|XP_004986077.1| PREDICTED: putative glycine-rich cell wall structural protein 
1-like [Setaria italica]
Length=203

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVL GL+N+T+G PP+ PCC+LI+ L DLEAAVCLCTA++AN+LGI +N+P
Sbjct  123  DALKLGVCANVLQGLINVTLGTPPRTPCCTLIQGLADLEAAVCLCTALRANVLGITINLP  182

Query  399  lslslllnVCSKKVPKGFTC  458
            ++LSLL+N C ++VP GF C
Sbjct  183  INLSLLVNYCGRRVPNGFQC  202



>dbj|BAJ08385.1| qLTG3-1 [Oryza longistaminata]
Length=204

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVLNGL+N+ +G PP++PCCSLI+ L DLEAAVCLCTA++ANILGINLN+P
Sbjct  123  DTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINLNLP  182

Query  399  lslslllnVCSKKVPKGFTC  458
            ++LSLL+N C + VP GF C
Sbjct  183  INLSLLVNYCGRSVPSGFQC  202



>ref|XP_006306558.1| hypothetical protein CARUB_v10012658mg [Capsella rubella]
 gb|EOA39456.1| hypothetical protein CARUB_v10012658mg [Capsella rubella]
Length=132

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            M+S  + + ALFL  N++F   VS CNTC   KP P P P   P+       DAL+LGVC
Sbjct  1    MESHRSFSAALFLSFNLMFLAYVSGCNTCLPTKPIPNPNPISNPTKHSCPK-DALQLGVC  59

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            A +L+G +   IGNPP  PCCS+++ LVDLEAAVCLCTAIKAN+LGIN++IP+SLSLL+N
Sbjct  60   AKILDGAVGTVIGNPPDTPCCSVLKGLVDLEAAVCLCTAIKANVLGINIDIPISLSLLIN  119

Query  423  VCSKKVPKGFTC  458
             C K +P  F C
Sbjct  120  TCGKTLPSNFIC  131



>ref|XP_011070108.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=137

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCAN+LN L+++ +G PPK PCCSLI  L DLEAAVCLCTAIKAN+LGINLN+P
Sbjct  57   DTLKLGVCANLLNDLVHLVVGTPPKTPCCSLIGGLADLEAAVCLCTAIKANVLGINLNVP  116

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLN C KKVP GF C
Sbjct  117  VSLSLLLNYCGKKVPSGFQC  136



>emb|CDP09930.1| unnamed protein product [Coffea canephora]
Length=130

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 97/132 (73%), Gaps = 3/132 (2%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            MDSK +++  +FL INI FF  VSACNT   P PKP P PTPTP+       DALKLGVC
Sbjct  1    MDSKRSKSTVIFLSINIFFFVLVSACNTPSPPMPKPIPNPTPTPAKGSCPR-DALKLGVC  59

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
            A +L+  +   IGNPP  PCCS++  L+DLEAA+CLCTA++ANILGINLNIP+SLSLL+N
Sbjct  60   AKLLS--IGTVIGNPPDTPCCSILGGLLDLEAAICLCTALRANILGINLNIPISLSLLVN  117

Query  423  VCSKKVPKGFTC  458
             C KK+P  F C
Sbjct  118  TCGKKLPSDFIC  129



>gb|KCW71996.1| hypothetical protein EUGRSUZ_E00449 [Eucalyptus grandis]
Length=86

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = -2

Query  415  SKLRERGILRLIPRMFALMAVQRHTAASRSTRFSMRLQHGFLGGFPIVMLSNPFRTLAQT  236
            SKLRE G+LRLIPRM ALMAVQR TAASRS R S   Q G  GG P++ L+ P  TLA T
Sbjct  2    SKLREMGMLRLIPRMLALMAVQRQTAASRSRRPSRTEQQGMSGGVPMMALTGPSSTLAHT  61

Query  235  PNFRASVGHL-PFDE  194
            P+F AS+G L P  E
Sbjct  62   PSFSASLGQLEPLGE  76



>ref|XP_009411010.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Musa acuminata 
subsp. malaccensis]
Length=137

 Score = 87.8 bits (216),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLG CANVL+GL++  +G PPK+PCCSLI+ LVDLEAAVCLCTAIKAN+LGI+LN+P
Sbjct  57   DALKLGGCANVLDGLIHAKVGEPPKEPCCSLIDGLVDLEAAVCLCTAIKANVLGIHLNLP  116

Query  399  lslslllnVCSKKVPKGFTC  458
            ++LSLLLN C K+ P GF C
Sbjct  117  INLSLLLNYCGKQSPTGFKC  136



>ref|XP_011081228.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=133

 Score = 87.8 bits (216),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCAN+LN L+++ +G PPK PCC+LIE L DLEAAVCLCTAIKAN+LGINLN+P
Sbjct  53   DTLKLGVCANLLNDLVHLVVGTPPKTPCCTLIEGLADLEAAVCLCTAIKANVLGINLNVP  112

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLN C KK P GF C
Sbjct  113  VSLSLLLNYCGKKAPSGFQC  132



>gb|KCW77747.1| hypothetical protein EUGRSUZ_D02041 [Eucalyptus grandis]
Length=121

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 85/133 (64%), Gaps = 12/133 (9%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            M SK+  + AL L +NI+F +  +A    P+P                    +ALKLGVC
Sbjct  1    MASKNYPSLALVLSLNIIFASLATAWTPNPTPTAAASCPE------------NALKLGVC  48

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
             ++L  LLN+T+G PPK+PCCSLI  L DLEAA CLC  I A++LG+ +++PLSLSLLL+
Sbjct  49   LDLLGSLLNVTVGTPPKEPCCSLIGGLADLEAAACLCIVIDADVLGLQIDVPLSLSLLLD  108

Query  423  VCSKKVPKGFTCP  461
             CSKKVP GF CP
Sbjct  109  ACSKKVPPGFQCP  121



>ref|XP_010422221.1| PREDICTED: lipid transfer protein EARLI 1 [Camelina sativa]
Length=149

 Score = 88.2 bits (217),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 96/148 (65%), Gaps = 16/148 (11%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSA----CNtcpspkpkpkpkptptpsskgkcp-----  215
            M SK++ + ALF  INI+FFT  +A    CN  P       P P+    +          
Sbjct  1    MASKNSASLALFFAINIIFFTLTAATDCGCNPNPKVPTPSVPSPSVPSPNPRPVTPPNTP  60

Query  216  -------tDALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAni  374
                    DAL+LGVCANVL+ LLN+ +G P  + CCSLI+ LVDL+AA+CLCTA++AN+
Sbjct  61   GSSGKCPIDALRLGVCANVLSSLLNVQLGQPSSQSCCSLIQGLVDLDAAICLCTALRANV  120

Query  375  lginlniplslslllnVCSKKVPKGFTC  458
            LGINLN+P+SLS+LLNVC++K+P GF C
Sbjct  121  LGINLNVPISLSVLLNVCNRKLPSGFQC  148



>ref|XP_010448889.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=136

 Score = 87.8 bits (216),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVC N LN L ++T+G PP  PCCSLI+ LVDLEAAVCLCTA+KA++LGINLN+P
Sbjct  56   DALKLGVCVNALNLLNDVTLGTPPVTPCCSLIQGLVDLEAAVCLCTALKASVLGINLNLP  115

Query  399  lslslllnVCSKKVPKGFTCP  461
            ++LSLLLNVCS+K P+GF CP
Sbjct  116  INLSLLLNVCSRKAPRGFQCP  136



>ref|XP_009114615.1| PREDICTED: putative lipid-binding protein AIR1 [Brassica rapa]
Length=129

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 87/126 (69%), Gaps = 2/126 (2%)
 Frame = +3

Query  84   AFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVCANVLNGL  263
            + A+FL  NILFF    A      P          TP+ +     D +KLGVC N LN L
Sbjct  6    SLAIFLAFNILFFALTEAARYGCPPSSYKPKPGPTTPAIETCPK-DTVKLGVCVNALN-L  63

Query  264  LNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslslllnVCSKKVP  443
            LN T+G PP KPCCSLI+ LVDLEAAVCLCTA+KA+ILGIN+N+P++LSLLLNVC++K P
Sbjct  64   LNATLGAPPVKPCCSLIDGLVDLEAAVCLCTALKASILGININLPINLSLLLNVCNRKAP  123

Query  444  KGFTCP  461
            +GF CP
Sbjct  124  RGFQCP  129



>ref|XP_007155638.1| hypothetical protein PHAVU_003G218700g [Phaseolus vulgaris]
 gb|ESW27632.1| hypothetical protein PHAVU_003G218700g [Phaseolus vulgaris]
Length=172

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVLNGL+N+T+G PP  PCCSL+  LVDLEAAVCLCTA++ANILGINLN+P
Sbjct  92   DALKLGVCANVLNGLVNVTLGQPPVTPCCSLLSGLVDLEAAVCLCTALRANILGINLNLP  151

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCS + P+ F C
Sbjct  152  ISLSLLLNVCSIQAPRDFQC  171



>ref|XP_006366172.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=120

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 88/133 (66%), Gaps = 14/133 (11%)
 Frame = +3

Query  63   MDSKSTRA-FALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGV  239
            M SK++++   LFL +NIL F  VS  N   +   +                 D LKLGV
Sbjct  1    MASKTSQSSVTLFLSLNILLFALVSGTNDTGNCGGQQTCSI------------DTLKLGV  48

Query  240  CANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslslll  419
            CAN+LN L+N+ +G+PP  PCCSLI+ L DLEAAVCLCTAI+AN+LGINLN+PLSLSL+L
Sbjct  49   CANILN-LVNVIVGSPPTLPCCSLIQGLTDLEAAVCLCTAIRANVLGINLNVPLSLSLIL  107

Query  420  nVCSKKVPKGFTC  458
            N C K  P GFTC
Sbjct  108  NSCGKNPPTGFTC  120



>ref|XP_010053451.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
Length=131

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D +KLGVCANVL  LL++ +G PPK PCCSLI  L DLEAAVCLCTAIKAN+LG+NLN+P
Sbjct  51   DTIKLGVCANVLKNLLHLVVGTPPKTPCCSLINGLADLEAAVCLCTAIKANVLGLNLNVP  110

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLN C KKVP GF C
Sbjct  111  VSLSLLLNYCGKKVPSGFQC  130



>ref|XP_002874775.1| hypothetical protein ARALYDRAFT_490053 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51034.1| hypothetical protein ARALYDRAFT_490053 [Arabidopsis lyrata subsp. 
lyrata]
Length=168

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVL+ LLNI +G P  +PCCSLI+ LVDL+AA+CLCTA++AN+LGINLN+P
Sbjct  88   DALKLGVCANVLSSLLNIQLGQPSAQPCCSLIQGLVDLDAAICLCTALRANVLGINLNVP  147

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLS+LLNVC++KVP GF C
Sbjct  148  ISLSVLLNVCNRKVPSGFQC  167



>emb|CDY21277.1| BnaC03g29610D [Brassica napus]
Length=113

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 88/128 (69%), Gaps = 18/128 (14%)
 Frame = +3

Query  75   STRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVCANVL  254
            S  + ALFL +N+L FT  SA                 T  + G CP D+L+LGVCANVL
Sbjct  3    SRTSLALFLAVNLLLFTYTSA-----------------TCYNTGSCPRDSLQLGVCANVL  45

Query  255  NGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslslllnVCSK  434
              L+++T+GNPP KPCCSLI  L DLEAAVCLCT +KANILGI LN+P++LS+LLNVCS+
Sbjct  46   K-LVDLTLGNPPVKPCCSLIAGLADLEAAVCLCTVLKANILGIKLNLPINLSVLLNVCSR  104

Query  435  KVPKGFTC  458
            K PK F C
Sbjct  105  KAPKNFQC  112



>emb|CDY64848.1| BnaC05g49400D [Brassica napus]
Length=137

 Score = 87.8 bits (216),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D L+LGVCANVLNGLL++T+G PP +PCCSLI+ L D+EAAVCLCTA+KAN+LGINLN+P
Sbjct  58   DTLQLGVCANVLNGLLDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKANVLGINLNLP  117

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCSK+VP  F C
Sbjct  118  ISLSLLLNVCSKQVPPSFQC  137



>tpg|DAA37198.1| TPA: hypothetical protein ZEAMMB73_187029 [Zea mays]
 tpg|DAA42811.1| TPA: hypothetical protein ZEAMMB73_664289 [Zea mays]
Length=142

 Score = 87.8 bits (216),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCAN+LNGL+N T+G PP+ PCC+LI+ L DLEAAVCLCT ++AN+LGINLN+P
Sbjct  62   DALKLGVCANLLNGLINATLGTPPRTPCCTLIQGLADLEAAVCLCTVLRANVLGINLNLP  121

Query  399  lslslllnVCSKKVPKGFTC  458
            ++LSLL+N C ++VP GF C
Sbjct  122  INLSLLVNYCGRRVPSGFQC  141



>gb|KCW77749.1| hypothetical protein EUGRSUZ_D02043, partial [Eucalyptus grandis]
Length=147

 Score = 87.8 bits (216),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D +KLGVCANVL  LL++ +G PPK PCCSLI  L DLEAAVCLCTAIKAN+LG+NLN+P
Sbjct  67   DTIKLGVCANVLKNLLHLVVGTPPKTPCCSLINGLADLEAAVCLCTAIKANVLGLNLNVP  126

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLN C KKVP GF C
Sbjct  127  VSLSLLLNYCGKKVPSGFQC  146



>ref|XP_008669243.1| PREDICTED: uncharacterized protein LOC103646289 [Zea mays]
Length=201

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCAN+LNGL+N T+G PP+ PCC+LI+ L DLEAAVCLCT ++AN+LGINLN+P
Sbjct  121  DALKLGVCANLLNGLINATLGTPPRTPCCTLIQGLADLEAAVCLCTVLRANVLGINLNLP  180

Query  399  lslslllnVCSKKVPKGFTC  458
            ++LSLL+N C ++VP GF C
Sbjct  181  INLSLLVNYCGRRVPSGFQC  200



>gb|EPS73889.1| hypothetical protein M569_00868, partial [Genlisea aurea]
Length=137

 Score = 87.4 bits (215),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCA++L  LL + IG PPK PCCSLIE L DLEAAVCLCTAIKAN+LGI+L++P
Sbjct  58   DTLKLGVCADLLGSLLGLVIGTPPKTPCCSLIEGLADLEAAVCLCTAIKANVLGISLDVP  117

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLN CSKK+P GF C
Sbjct  118  ISLSLLLNDCSKKLPTGFQC  137



>ref|XP_007210550.1| hypothetical protein PRUPE_ppa014094mg [Prunus persica]
 gb|EMJ11749.1| hypothetical protein PRUPE_ppa014094mg [Prunus persica]
Length=87

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = -2

Query  415  SKLRERGILRLIPRMFALMAVQRHTAASRSTRFSMRLQHGFLGGFPIVMLSNPFRTLAQT  236
            +KL+  GILRLIPR+ ALMAVQRH A SRS   S + Q G  GGFPI+  + P   LAQT
Sbjct  2    TKLKAMGILRLIPRILALMAVQRHIATSRSRSPSSKAQQGVSGGFPIIAPTAPLSKLAQT  61

Query  235  PNFRASVGHL  206
            PNFRAS+G L
Sbjct  62   PNFRASLGQL  71



>ref|XP_010434049.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa]
Length=136

 Score = 87.4 bits (215),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVC N LN L ++T+G PP  PCCSLI+ LVDLEAAVCLCTA+KA++LGINLN+P
Sbjct  56   DALKLGVCVNALNLLNDVTLGTPPVTPCCSLIKGLVDLEAAVCLCTALKASVLGINLNLP  115

Query  399  lslslllnVCSKKVPKGFTCP  461
            ++LSLLLNVCS+K P+GF CP
Sbjct  116  INLSLLLNVCSRKAPRGFQCP  136



>ref|NP_192985.1| putative lipid transfer protein [Arabidopsis thaliana]
 sp|Q39176.1|ERLI1_ARATH RecName: Full=Lipid transfer protein EARLI 1; AltName: Full=Protein 
EARLY ARABIDOPSIS ALUMINUM INDUCED 1; Short=pEARLI1; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL06564.1|AF412111_1 AT4g12480/T1P17_70 [Arabidopsis thaliana]
 gb|AAC37471.1| pEARLI 1 [Arabidopsis thaliana]
 emb|CAB41718.1| pEARLI 1 [Arabidopsis thaliana]
 emb|CAB78291.1| pEARLI 1 [Arabidopsis thaliana]
 gb|AAM91484.1| AT4g12480/T1P17_70 [Arabidopsis thaliana]
 dbj|BAF02055.1| pEARLI 1 [Arabidopsis thaliana]
 gb|AEE83138.1| putative lipid transfer protein [Arabidopsis thaliana]
Length=168

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DAL+LGVCANVL+ LLNI +G P  +PCCSLI+ LVDL+AA+CLCTA++AN+LGINLN+P
Sbjct  88   DALRLGVCANVLSSLLNIQLGQPSAQPCCSLIQGLVDLDAAICLCTALRANVLGINLNVP  147

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLS+LLNVC++KVP GF C
Sbjct  148  ISLSVLLNVCNRKVPSGFQC  167



>ref|XP_010053449.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Eucalyptus grandis]
 gb|KCW77745.1| hypothetical protein EUGRSUZ_D02039 [Eucalyptus grandis]
Length=121

 Score = 87.0 bits (214),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 84/133 (63%), Gaps = 12/133 (9%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVC  242
            M SK+    AL L +NI+F +  +A    P+P                    +ALKLGVC
Sbjct  1    MASKNYPTLALVLSLNIIFASLATAWTPKPTPTAAASCPE------------NALKLGVC  48

Query  243  ANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslsllln  422
             ++L  LLN+T+G PPK+PCCSLI  L DLEAA CLC  I A++LG+ +++PLSLSLLL+
Sbjct  49   LDLLGSLLNVTVGTPPKEPCCSLIGGLADLEAAACLCIVIDADVLGLQIDVPLSLSLLLD  108

Query  423  VCSKKVPKGFTCP  461
             CSKKVP GF CP
Sbjct  109  ACSKKVPPGFQCP  121



>gb|KHG02760.1| 14 kDa proline-rich DC2 [Gossypium arboreum]
Length=132

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 1/80 (1%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            DALKLGVCANVLN L+N+T+G+PP  PCCSL+  LVDLEAA CLCTAI+ANILGINLNIP
Sbjct  54   DALKLGVCANVLN-LVNVTVGSPPVMPCCSLLNGLVDLEAAACLCTAIRANILGINLNIP  112

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLNVCS+ VP GF C
Sbjct  113  VSLSLLLNVCSRNVPTGFQC  132



>ref|XP_007218576.1| hypothetical protein PRUPE_ppa013120mg [Prunus persica]
 gb|EMJ19775.1| hypothetical protein PRUPE_ppa013120mg [Prunus persica]
Length=139

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 92/136 (68%), Gaps = 5/136 (4%)
 Frame = +3

Query  66   DSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcpt-----DALK  230
             S +    AL L +N++FFTTVS+ +  P+  P PK    P PS+           D LK
Sbjct  3    SSMAIATIALLLSLNLVFFTTVSSNHHVPNCPPPPKTPKHPPPSTPIPPAKASCPKDTLK  62

Query  231  LGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplsls  410
            LGVC  +LNGL+++ +G PPK PCCSLI  L D+EAAVCLCTAIKAN+LGINLN+P+SLS
Sbjct  63   LGVCGALLNGLVHLVVGTPPKTPCCSLIGGLADVEAAVCLCTAIKANVLGINLNVPVSLS  122

Query  411  lllnVCSKKVPKGFTC  458
            LLLN C K VP GF C
Sbjct  123  LLLNYCGKSVPTGFQC  138



>ref|XP_011081223.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=137

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 85/136 (63%), Gaps = 4/136 (3%)
 Frame = +3

Query  63   MDSKSTRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcp----tDALK  230
            MDSK + +  LFL IN++FF  VS C    +              +          DALK
Sbjct  1    MDSKKSSSAILFLCINLMFFALVSGCYLGCNNPVPKPNPNPNPNPNPNPVKGTCPRDALK  60

Query  231  LGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplsls  410
            LG+CA +LNG +   IG+PP  PCCS +  L+DLEAAVCLCTA+KANILGINLNIP+SLS
Sbjct  61   LGICAKLLNGSVGTEIGSPPDHPCCSALGGLLDLEAAVCLCTALKANILGINLNIPISLS  120

Query  411  lllnVCSKKVPKGFTC  458
            LL+N C K +PK F C
Sbjct  121  LLINTCGKTLPKDFIC  136



>ref|XP_011081229.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=133

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCAN+LN L+++ +G PPK PCC+LI+ L DLEAAVCLCTAIKAN+LG +LNIP
Sbjct  53   DTLKLGVCANLLNDLVHLVVGTPPKTPCCTLIKGLADLEAAVCLCTAIKANVLGNDLNIP  112

Query  399  lslslllnVCSKKVPKGFTC  458
            LSLSLLLN C KKVP GF C
Sbjct  113  LSLSLLLNYCGKKVPTGFQC  132



>ref|XP_007052129.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
 gb|EOX96286.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
Length=139

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  219  DALKLGVCANVLNGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlnip  398
            D LKLGVCANVLN L+++ +G PPK PCC LI+ L DLEAAVCLCTAIKANILGINLN+P
Sbjct  59   DTLKLGVCANVLNDLIHLVVGTPPKTPCCPLIQGLADLEAAVCLCTAIKANILGINLNVP  118

Query  399  lslslllnVCSKKVPKGFTC  458
            +SLSLLLN C K VPKGF C
Sbjct  119  VSLSLLLNYCGKNVPKGFQC  138



>ref|XP_009626056.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=128

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 97/129 (75%), Gaps = 3/129 (2%)
 Frame = +3

Query  75   STRAFALFLVINILFFTTVSACNtcpspkpkpkpkptptpsskgkcptDALKLGVCANVL  254
            S  + ALFL +N++ F+ VS C TCP PKPKP P P  + ++      D LKLGVCA+VL
Sbjct  3    SKHSVALFLCLNLVLFSMVSGCRTCPKPKPKPCPPPPSSETATCPI--DTLKLGVCADVL  60

Query  255  NGLLNITIGNPPKKPCCSLIENLVDLEAAVCLCTAIKAnilginlniplslslllnVCSK  434
             GL+N  IG+PP  PCCSL+  L ++EAA+CLCTAIKANILGINLN+P+SLSLLLNVCSK
Sbjct  61   -GLVNAVIGSPPVTPCCSLLSGLANVEAALCLCTAIKANILGINLNVPISLSLLLNVCSK  119

Query  435  KVPKGFTCP  461
            + P GF CP
Sbjct  120  EAPSGFQCP  128



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1340246911422