BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79983_g1_i1 len=1790 path=[1:0-1789]

Length=1790
                                                                      Score     E

ref|XP_009623966.1|  PREDICTED: uncharacterized protein LOC104115101    305   3e-94   
ref|XP_004238084.1|  PREDICTED: uncharacterized protein LOC101256871    303   2e-93   
ref|XP_009797570.1|  PREDICTED: uncharacterized protein LOC104243980    302   5e-92   
ref|XP_007018475.1|  Uncharacterized protein TCM_034686                 268   6e-80   
ref|XP_004290979.1|  PREDICTED: uncharacterized protein LOC101290919    261   2e-77   
ref|XP_006472310.1|  PREDICTED: uncharacterized protein LOC102628317    251   1e-73   
ref|XP_003589055.1|  hypothetical protein MTR_1g017920                  251   2e-73   
ref|XP_006433645.1|  hypothetical protein CICLE_v10001560mg             249   7e-73   
ref|XP_007226649.1|  hypothetical protein PRUPE_ppa021982mg             249   1e-72   
ref|XP_009375150.1|  PREDICTED: uncharacterized protein LOC103963994    248   2e-72   
ref|XP_008337033.1|  PREDICTED: uncharacterized protein LOC103400129    247   5e-72   
ref|XP_009360856.1|  PREDICTED: uncharacterized protein LOC103951...    246   8e-72   
ref|XP_007160923.1|  hypothetical protein PHAVU_001G028500g             246   1e-71   
ref|XP_008220378.1|  PREDICTED: uncharacterized protein LOC103320476    246   1e-71   
ref|XP_009360865.1|  PREDICTED: uncharacterized protein LOC103951...    246   2e-71   
ref|XP_002510084.1|  conserved hypothetical protein                     245   2e-71   Ricinus communis
ref|XP_011074345.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    244   5e-71   
ref|XP_008377953.1|  PREDICTED: uncharacterized protein LOC103441030    243   2e-70   
gb|KDP41608.1|  hypothetical protein JCGZ_16015                         242   5e-70   
ref|XP_010105063.1|  hypothetical protein L484_000375                   239   3e-69   
ref|XP_011017104.1|  PREDICTED: uncharacterized protein LOC105120550    235   1e-67   
ref|XP_011013752.1|  PREDICTED: uncharacterized protein LOC105117702    234   4e-67   
ref|XP_002301145.1|  hypothetical protein POPTR_0002s11850g             232   3e-66   Populus trichocarpa [western balsam poplar]
ref|XP_003545343.1|  PREDICTED: uncharacterized protein LOC100800670    226   3e-64   
ref|XP_002283353.1|  PREDICTED: uncharacterized protein LOC100262679    226   4e-64   Vitis vinifera
ref|XP_008452651.1|  PREDICTED: uncharacterized protein LOC103493608    220   7e-62   
ref|XP_003549376.1|  PREDICTED: uncharacterized protein LOC100778232    219   1e-61   
gb|KHN36974.1|  hypothetical protein glysoja_009002                     218   4e-61   
ref|XP_004498989.1|  PREDICTED: uncharacterized protein LOC101511029    218   5e-61   
ref|XP_004141406.1|  PREDICTED: uncharacterized protein LOC101210181    216   4e-60   
ref|XP_002320025.1|  hypothetical protein POPTR_0014s01560g             213   3e-59   Populus trichocarpa [western balsam poplar]
gb|KGN55278.1|  hypothetical protein Csa_4G643080                       214   4e-59   
gb|KFK28109.1|  hypothetical protein AALP_AA8G473800                    210   2e-58   
gb|KDO81494.1|  hypothetical protein CISIN_1g019820mg                   207   2e-57   
ref|XP_006415756.1|  hypothetical protein EUTSA_v10009308mg             206   1e-56   
ref|XP_006304471.1|  hypothetical protein CARUB_v10011167mg             202   2e-55   
ref|XP_010555762.1|  PREDICTED: uncharacterized protein LOC104825172    202   1e-54   
ref|NP_001117365.1|  uncharacterized protein                            199   3e-54   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28018.1|  unknown                                                 199   3e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010687868.1|  PREDICTED: serum response factor homolog B         197   2e-53   
ref|XP_010061650.1|  PREDICTED: uncharacterized protein LOC104449253    197   2e-53   
ref|XP_010999888.1|  PREDICTED: uncharacterized protein LOC105107597    194   1e-52   
ref|XP_010556467.1|  PREDICTED: uncharacterized protein LOC104825782    193   7e-52   
ref|XP_010478086.1|  PREDICTED: uncharacterized protein LOC104757070    193   9e-52   
ref|XP_010274397.1|  PREDICTED: uncharacterized protein LOC104609720    191   9e-51   
ref|XP_010460506.1|  PREDICTED: uncharacterized protein LOC104741358    190   1e-50   
ref|XP_009109800.1|  PREDICTED: uncharacterized protein LOC103835392    189   5e-50   
emb|CDX90090.1|  BnaA08g18940D                                          187   6e-50   
emb|CAN72846.1|  hypothetical protein VITISV_013936                     184   2e-49   Vitis vinifera
ref|XP_010274490.1|  PREDICTED: uncharacterized protein LOC104609803    186   3e-49   
ref|XP_009113761.1|  PREDICTED: uncharacterized protein LOC103839036    184   7e-49   
emb|CDY27618.1|  BnaA09g27890D                                          191   5e-48   
emb|CDY56190.1|  BnaC05g51090D                                          187   1e-46   
ref|XP_010942767.1|  PREDICTED: uncharacterized protein LOC105060671    177   1e-46   
gb|AAF99742.1|AC004557_21  F17L21.26                                    186   2e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893469.1|  F17L21.26                                          180   2e-44   
tpg|DAA41256.1|  TPA: hypothetical protein ZEAMMB73_982240              161   5e-41   
ref|NP_001145615.1|  hypothetical protein                               160   1e-40   Zea mays [maize]
ref|XP_009413661.1|  PREDICTED: uncharacterized protein LOC103994922    157   1e-39   
ref|NP_001145067.1|  uncharacterized protein LOC100278263               157   2e-39   Zea mays [maize]
gb|AGT95993.1|  seed dormancy protein                                   157   2e-39   
ref|XP_002460936.1|  hypothetical protein SORBIDRAFT_02g037770          152   9e-38   Sorghum bicolor [broomcorn]
gb|AGT95990.1|  seed dormancy protein                                   150   4e-37   
gb|AGT95989.1|  seed dormancy protein                                   150   5e-37   
ref|XP_010501615.1|  PREDICTED: uncharacterized protein LOC104778901    149   1e-36   
gb|AGT95991.1|  seed dormancy protein                                   145   2e-35   
ref|XP_004958157.1|  PREDICTED: uncharacterized protein LOC101773030    139   2e-33   
ref|XP_008795678.1|  PREDICTED: uncharacterized protein LOC103711346    124   1e-28   
ref|XP_006857157.1|  hypothetical protein AMTR_s00065p00165110          125   5e-28   
ref|XP_003560029.1|  PREDICTED: uncharacterized protein LOC100841082    115   8e-25   
gb|EYU36389.1|  hypothetical protein MIMGU_mgv1a014853mg                108   1e-23   
gb|AFI99126.1|  zinc finger protein Sdr4                                110   6e-23   
gb|EAZ04505.1|  hypothetical protein OsI_26656                          110   8e-23   Oryza sativa Indica Group [Indian rice]
ref|NP_001175277.1|  Os07g0585700                                       107   5e-22   
gb|AFI99127.1|  zinc finger protein Sdr4                                107   5e-22   
gb|AFI99128.1|  zinc finger protein Sdr4                                103   1e-20   
gb|EEE67487.1|  hypothetical protein OsJ_24915                          100   9e-20   Oryza sativa Japonica Group [Japonica rice]
emb|CDY11806.1|  BnaC03g57720D                                        89.7    8e-18   
gb|EPS65028.1|  hypothetical protein M569_09753                       89.7    8e-18   
emb|CDY11796.1|  BnaC03g57820D                                        85.9    2e-16   
emb|CBI19393.3|  unnamed protein product                              89.0    4e-16   
ref|XP_006651523.1|  PREDICTED: uncharacterized protein LOC102702271  89.0    5e-16   
ref|XP_010501616.1|  PREDICTED: uncharacterized protein LOC104778902  80.5    2e-13   
tpg|DAA45925.1|  TPA: hypothetical protein ZEAMMB73_041604            80.5    3e-13   
ref|XP_004986877.1|  PREDICTED: uncharacterized protein LOC101752712  75.5    2e-11   
emb|CDY11795.1|  BnaC03g57830D                                        68.6    1e-09   
ref|XP_001778474.1|  predicted protein                                69.7    4e-09   
ref|XP_004986768.1|  PREDICTED: uncharacterized protein LOC101783930  68.2    5e-09   
ref|XP_001751813.1|  predicted protein                                64.7    2e-07   
ref|XP_001763429.1|  predicted protein                                63.9    3e-07   
ref|XP_002465070.1|  hypothetical protein SORBIDRAFT_01g031577        56.6    1e-05   Sorghum bicolor [broomcorn]
ref|XP_004965172.1|  PREDICTED: uncharacterized protein LOC101781072  51.2    2e-04   
ref|NP_001170581.1|  uncharacterized protein LOC100384611             51.2    2e-04   Zea mays [maize]
ref|XP_006850275.1|  hypothetical protein AMTR_s00020p00118800        53.5    3e-04   



>ref|XP_009623966.1| PREDICTED: uncharacterized protein LOC104115101 [Nicotiana tomentosiformis]
Length=358

 Score =   305 bits (781),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 178/372 (48%), Positives = 232/372 (62%), Gaps = 52/372 (14%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADNN--ALPENIRKSAFLRNVWPH  336
             MMQ ++PY   S++ AEI+ARYRPIAPKPE PTSP ++NN   LP NI KS FLRNVWP 
Sbjct  1     MMQTLNPYPSTSKT-AEIMARYRPIAPKPEVPTSPVSENNPSGLPANINKSPFLRNVWPQ  59

Query  337   LQARPTRTRKRGRSAFALPPLKRARSCFQGFapaaapppppYHQVLNSSAAANTWANYPT  516
             LQARPTRTRKRGR+A   P +KRAR+ +            P++QV+ +S A     + P 
Sbjct  60    LQARPTRTRKRGRTALGPPTMKRARTNY------LPAVQFPHYQVMAASPA-----HRPN  108

Query  517   GFPQIPMIHHPNLPPL------------------------MDSPAAAETSGGGRVLRGID  624
               P   +I  PNL PL                        ++ P        G  +RGID
Sbjct  109   AVPHFSII--PNLVPLKCGLGTPVTTPANSIALPLLSCTTINLPMLVTEKSSGEEIRGID  166

Query  625   LNREAAESPEEFDFMPQL---------QPVITPHPVRLIGSTVFVGCILHSDPPAPPYTT  777
             LN  AA+ PEE DFMPQL         + VITP PVR +GS++ +GCI    P       
Sbjct  167   LNL-AADVPEELDFMPQLMQGSTSPKSRGVITPRPVRPVGSSISIGCINEEAPDGGTNKK  225

Query  778   SLKTaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTI  957
              +K   +VE E EA +LP ++SD NNKVRL NSAYKE+VGQPEC WLD +    + CK I
Sbjct  226   CMKKPEEVEEEVEAEALPAVISDSNNKVRLTNSAYKEMVGQPECCWLDYM--RGNACKRI  283

Query  958   SGEVAIQFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWR  1137
              GEV ++F +S ++P+SS+ FTCWV++EW  + GKK +V+AFC+AV+LAC SKDYLF+WR
Sbjct  284   GGEVMLEFLDSKSVPMSSDGFTCWVKIEWGADKGKKNSVKAFCNAVRLACQSKDYLFEWR  343

Query  1138  FHTSDNNSSKSA  1173
             FHT+D+++ +SA
Sbjct  344   FHTTDDDAPESA  355



>ref|XP_004238084.1| PREDICTED: uncharacterized protein LOC101256871 [Solanum lycopersicum]
Length=360

 Score =   303 bits (776),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 185/372 (50%), Positives = 236/372 (63%), Gaps = 51/372 (14%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADNN--ALPENIRKSAFLRNVWPH  336
             MMQ ++PY   S++ AEI+ARYRPIAPKPEAPTSP +++N   LP NI+KS FLRNVWP 
Sbjct  1     MMQTLNPYPSTSKT-AEIMARYRPIAPKPEAPTSPVSEDNPTGLPPNIQKSPFLRNVWPQ  59

Query  337   LQARPTRTRKRGRSAFALPPLKRARSCFQGFapaaapppppYHQVLNSSAAANTWANYPT  516
             LQARPTRTRKRGR+A   P +KRAR  +       A   P YHQV+ +S +       P 
Sbjct  60    LQARPTRTRKRGRTALGPPSMKRARGNY-----FPAGQFPNYHQVVAASPSYR-----PN  109

Query  517   GFPQIPMIHHPNLPPL--------------MDSPAAAETSG---------GGRVLRGIDL  627
               PQ  +I  PNL PL              +  P  A T+           G  +RGIDL
Sbjct  110   VVPQFTLI--PNLLPLKCGLGTSVTTPSNSITLPLMACTTTTLPMLVEKHSGEEIRGIDL  167

Query  628   NREAAESPEEFDFMPQLQP-------VITPHPVRLIGSTVFVGCILHSDPPAPPYTTS--  780
             N  AA+ PEE DFMPQLQ        VITP PVR +GS++ +GCI   + P    T    
Sbjct  168   NL-AADGPEELDFMPQLQGPKTPGPVVITPQPVRPVGSSISIGCINEEEAPDGGATNKKF  226

Query  781   LKTaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTIS  960
             +K   +VE E EA +LP +VSD NNKVRL N+AYKE+VGQPEC WLD +    + CK I 
Sbjct  227   IKKPEEVEEEVEAEALPAVVSDSNNKVRLTNAAYKEMVGQPECCWLDYM--VGNACKRIG  284

Query  961   GEVAIQF-SNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWR  1137
             GEV ++F  +S ++P+SS+ F CWV++EW    GKK +V+AFC+AVKLAC SKDY+F+WR
Sbjct  285   GEVILEFLDSSCSVPMSSDGFNCWVKIEWGAAQGKKNSVKAFCNAVKLACQSKDYVFEWR  344

Query  1138  FHTSDNNSSKSA  1173
             FHT+D+N+ +SA
Sbjct  345   FHTTDDNTPESA  356



>ref|XP_009797570.1| PREDICTED: uncharacterized protein LOC104243980 [Nicotiana sylvestris]
Length=431

 Score =   302 bits (773),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 180/373 (48%), Positives = 233/373 (62%), Gaps = 54/373 (14%)
 Frame = +1

Query  160   RMMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADNN--ALPENIRKSAFLRNVWP  333
             +MMQ ++PY   S++ AEI+ARYRPIAPKPE PTSP ++NN   LP NI KS FLRNVWP
Sbjct  75    KMMQTLNPYPSTSKT-AEIMARYRPIAPKPEVPTSPVSENNPSGLPANINKSPFLRNVWP  133

Query  334   HLQARPTRTRKRGRSAFALPPLKRARSCFQGFapaaapppppYHQVLNSSAAANTWANYP  513
             HLQARPTRTRKRGR+A   P +KRAR+ +            P++QV+ +S A     + P
Sbjct  134   HLQARPTRTRKRGRTALGPPTMKRARTNY------LPAGQFPHYQVMAASPA-----HRP  182

Query  514   TGFPQIPMIHHPNLPPL------------------------MDSPAAAETSGGGRVLRGI  621
                PQ  +I  PNL PL                           P   E + G    RGI
Sbjct  183   NVIPQFSII--PNLVPLKCGLGTPVTTPANSIALPLLSCTTTTLPLLVEKNSGEE--RGI  238

Query  622   DLNREAAESPEEFDFMPQLQP---------VITPHPVRLIGSTVFVGCILHSDPPAPPYT  774
             DLN  AA+ PEE DFMPQL           VITP PVR +GS++ +GCI    P      
Sbjct  239   DLNL-AADVPEELDFMPQLMQGSTSPKSPGVITPRPVRPVGSSISIGCINEEAPDGGTNK  297

Query  775   TSLKTaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKT  954
               +K   +VE E EA +LP ++SD NNKVRL NSAYKE+VGQPEC WLD +    + CK 
Sbjct  298   KCVKKPEEVEEEVEAEALPAVISDSNNKVRLTNSAYKEMVGQPECCWLDYMS--GNACKR  355

Query  955   ISGEVAIQFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQW  1134
             I GEV ++F +S ++P+SS+ FTCWV++EW  + GKK +V+AFC+AV+LAC SKDY+F+W
Sbjct  356   IGGEVMLEFLDSKSVPMSSDGFTCWVKIEWGADKGKKNSVKAFCNAVRLACQSKDYVFEW  415

Query  1135  RFHTSDNNSSKSA  1173
             RFHT+D+++ +SA
Sbjct  416   RFHTTDDDAPESA  428



>ref|XP_007018475.1| Uncharacterized protein TCM_034686 [Theobroma cacao]
 gb|EOY15700.1| Uncharacterized protein TCM_034686 [Theobroma cacao]
Length=364

 Score =   268 bits (685),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 161/370 (44%), Positives = 223/370 (60%), Gaps = 40/370 (11%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHLQ  342
             M++ ++PYS  +++ AEI++RYRPIAPKPE P +   +N+A+ + IR+S +LRN+WP LQ
Sbjct  1     MIKTLNPYSTTAKT-AEIMSRYRPIAPKPEVPANSLNENSAMSQKIRQSPYLRNLWPQLQ  59

Query  343   ARPTRTRKRGRSAFALPPLKRARSCFQGFapaaapppppYHQVL----------------  474
             ARPTRTRKRGR+A + P LKRAR+   G +  +    P  +  L                
Sbjct  60    ARPTRTRKRGRAALSPPTLKRARTHVLGLSSPSPVTSPAKNLSLQGFSHGIPQLSVPNFV  119

Query  475   NSSAAANTWANYPTGFPQIPMIHHPNLPPLMDSPA------AAETSGGGRVLRGIDLNRE  636
             N+          P     +P++  P   P+  + A        E  GG +V   IDLN  
Sbjct  120   NTGGGLEISCAPPASLVTLPLLPCPPSGPIAANKATLPALNCMEPCGGEKV---IDLN-T  175

Query  637   AAESPEEFDFMPQLQ-----PVITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKTaadv  801
              AE PEE D + QLQ      VI P P+R +GS++ VGCI   DP   P     K + +V
Sbjct  176   VAEIPEEKDLLKQLQGPVTSGVIAPQPIRPVGSSISVGCI-SEDPSLTPPMQVPKKSEEV  234

Query  802   eseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFH-----SPCKTISGE  966
             E E E+ +LP ++SD NNKVRLANSAYKE+VGQPEC WLD +         + CK I GE
Sbjct  235   EEEVESEALPAVISDSNNKVRLANSAYKEMVGQPECPWLDSMVTVEGRAGGNSCKRICGE  294

Query  967   VAIQFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHT  1146
             V +  S+S  +PV+SNRF+CWVR++W  +DGKK+++ AFCD ++L+C SKDYLF WRFHT
Sbjct  295   VMLHLSDS-RVPVTSNRFSCWVRIDW-GSDGKKSSINAFCDVIRLSCQSKDYLFTWRFHT  352

Query  1147  SDNNSSKSAC  1176
              +  ++ S+C
Sbjct  353   HNREATHSSC  362



>ref|XP_004290979.1| PREDICTED: uncharacterized protein LOC101290919 [Fragaria vesca 
subsp. vesca]
Length=376

 Score =   261 bits (668),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 163/368 (44%), Positives = 223/368 (61%), Gaps = 49/368 (13%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSK-AEILARYRPIAPKPE-APTSPSADNNALPENIRKSAFLRNVWPH  336
             M++ ++PY+  + +K AEI++RYRPIAPKPE +PT+P+ ++ AL + IR S +LRN+WP 
Sbjct  1     MIKTLNPYNSTNTAKTAEIMSRYRPIAPKPETSPTTPTGESPALSQKIRDSPYLRNLWPQ  60

Query  337   LQARPTRTRKRGRSAFALPPLKRARSCFQ-GFapaaapppppYHQVLNSSAAANTWANYP  513
             LQARPTRTRKRGR+A + P LKR R+    G +PA     P  +  L+      T    P
Sbjct  61    LQARPTRTRKRGRAAISPPTLKRQRTSHVFGLSPACHVTSPVNNLTLDGFPHPLTQLALP  120

Query  514   ------------TGFPQIPMIHHPNLPPLMDSPAAAET-------------SGGGRVLRG  618
                         T    +P++ +P+  P++ + A                 SGG ++   
Sbjct  121   NQLGSASSGLESTSLVTLPLLSYPSSVPIVPNQAVVTNQAVVPAELNLLKPSGGEKL---  177

Query  619   IDLNREAAESPEEFDFMPQLQP------------VITPHPVRLIGSTVFVGCILHSDPPA  762
             IDLN   AE PEE D + QLQ             VI P P+R +GS++ VGCI  +DP +
Sbjct  178   IDLN-SVAEIPEEKDLLKQLQGTPSPATTPTSPNVIAPQPIRPVGSSISVGCI-STDPSS  235

Query  763   PPYTTSLKTaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHS  942
              P   + K   DVE E E+ +LP ++SD +NKVR+AN+AYKE+VGQPEC WLD +    +
Sbjct  236   APAVQAPKKPEDVEKEMESEALPAIISDSHNKVRMANAAYKEMVGQPECSWLDSM--VAT  293

Query  943   PCKTISGEVAIQFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDY  1122
             PCK ISGEVA+Q S++  +P SSN F+CWVR+EW  N+  K  + AFCD +KLAC SKDY
Sbjct  294   PCKRISGEVALQLSDT-RVPTSSNGFSCWVRIEW-GNEMDKHAINAFCDVIKLACESKDY  351

Query  1123  LFQWRFHT  1146
             LF WRFHT
Sbjct  352   LFTWRFHT  359



>ref|XP_006472310.1| PREDICTED: uncharacterized protein LOC102628317 [Citrus sinensis]
Length=369

 Score =   251 bits (642),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 160/381 (42%), Positives = 220/381 (58%), Gaps = 57/381 (15%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSK-AEILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHL  339
             M++ +SP+S  + +K AEI++RYRPIAPKPEAP SP +++      IR+S +LRN+WP L
Sbjct  1     MIKTMSPFSAATTAKTAEIMSRYRPIAPKPEAPVSPMSES----AKIRQSPYLRNLWPQL  56

Query  340   QARPTRTRKRGRSAFALPPLKRARS-------------------CFQGFapaaapppppY  462
             QARPTRTRKRGR+A + P +KR+R+                     QGFA   A     +
Sbjct  57    QARPTRTRKRGRAAISPPTIKRSRTHLFGLSSPCHVTSSPAKNPSLQGFAHPHAHGVAQF  116

Query  463   H------------QVLNSSAAANTWANYPTGFPQIP---MIHHPNLPPLMDSPAAAETSG  597
                           + N ++ A T        P +P   ++     P  ++     E+ G
Sbjct  117   TLPNHLATVPASCSLDNPASTATTITTNLVTLPLLPCTPVVSEQTTP--LELSNCVESFG  174

Query  598   GGRVLRGIDLNREAAESPEEFDFMPQLQP-------VITPHPVRLIGSTVFVGCILHSDP  756
               +V   IDLN+  AE PEE D + QLQ        VI+P PVR +GS++ VGCI     
Sbjct  175   EVKV---IDLNK-VAEIPEEKDLLLQLQGPPSPTNNVISPRPVRPVGSSISVGCINEDSR  230

Query  757   PAPPYTTSLKTaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPF  936
               P      K   +VE E E+ +LP ++SD +N+VR+ANSA+KE+VGQPEC WLDL+   
Sbjct  231   LTPEAQVVTKKPEEVEEEVESEALPTVISDSHNRVRMANSAFKEMVGQPECSWLDLMVIN  290

Query  937   HSPCKTISGEVAIQFSNSVNLP-VSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHS  1113
             +S CK I GEV + FS+S  +P  SSN F+CWVR+EW  +DGKK +V AFCD ++L+C  
Sbjct  291   NSSCKRICGEVMLNFSDSAGMPNNSSNGFSCWVRIEW-GSDGKKNSVDAFCDVIRLSCEI  349

Query  1114  KDYLFQWRFHTSDNNSSKSAC  1176
             KDYLF WRFH     +S+S C
Sbjct  350   KDYLFAWRFHP---QASQSCC  367



>ref|XP_003589055.1| hypothetical protein MTR_1g017920 [Medicago truncatula]
 gb|AES59306.1| hypothetical protein MTR_1g017920 [Medicago truncatula]
Length=366

 Score =   251 bits (641),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 159/374 (43%), Positives = 217/374 (58%), Gaps = 46/374 (12%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEA------PTSPSADNNALPENIRKSAFLRN  324
             M++ ++PY   +++ AEI++RYRPIAPKPE        +  S+ +N+L + I++S +LRN
Sbjct  1     MIKTLNPYPNPAKT-AEIMSRYRPIAPKPETCSSNNSTSDGSSSSNSLSQKIKQSPYLRN  59

Query  325   VWPHLQARPTRTRKRGRSAFALPP-LKRARSCFQGFapaaapppppYHQVLNSSAAANTW  501
             +WP LQARPTRTRKRGR+  +LP  LKR ++   GF        P  +  L  +      
Sbjct  60    LWPQLQARPTRTRKRGRAPISLPSSLKRQKTHVLGFCQPLHVTSPIKNLTLQGNFVP---  116

Query  502   ANYPTGFPQIPMIHH--------------PNLPPLMDSPAAAETSGGGRVLR----GIDL  627
                P+  PQ+P+ +H              PNL  L   P +  +      L+     IDL
Sbjct  117   ---PSSLPQLPLPNHGVGVLNCNKNSTTNPNLVTLPLLPCSPNSPNNNNALKFELEVIDL  173

Query  628   NREAAESPEEFDFMPQLQP----------VITPHPVRLIGSTVFVGCILHSDPPAPPYTT  777
             N    E P+E D + QLQ           VI+P P+R IGS + VGCI       P  T 
Sbjct  174   NNTKVEVPQERDLLQQLQKPASSTNNVINVISPQPIRPIGSCINVGCISEVSA-IPCVTK  232

Query  778   SLKTaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTI  957
             + K   ++E E E+  LP ++SD NN+VR+ANSAYKE+VGQPEC WL++     S CK I
Sbjct  233   TPKKPEELEQEVESEELPAVISDSNNRVRMANSAYKEMVGQPECPWLEIQ--CGSSCKRI  290

Query  958   SGEVAIQFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLAC-HSKDYLFQW  1134
             SGEV +Q S+S N+P+SSN F+CWVR+EW NN  KK  V AFCD VKL C  S+DY+F W
Sbjct  291   SGEVTLQLSDSSNIPISSNGFSCWVRIEWENNGQKKNCVNAFCDVVKLCCDQSRDYVFTW  350

Query  1135  RFHTSDNNSSKSAC  1176
             RFHT    +S+S+C
Sbjct  351   RFHTRSREASQSSC  364



>ref|XP_006433645.1| hypothetical protein CICLE_v10001560mg [Citrus clementina]
 gb|ESR46885.1| hypothetical protein CICLE_v10001560mg [Citrus clementina]
Length=369

 Score =   249 bits (637),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 160/381 (42%), Positives = 219/381 (57%), Gaps = 57/381 (15%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSK-AEILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHL  339
             M++ +SP+S  + +K AEI++RYRPIAPKPEAP SP +++      IR+S +LRN+WP L
Sbjct  1     MIRTMSPFSAATTAKTAEIMSRYRPIAPKPEAPVSPMSES----AKIRQSPYLRNLWPQL  56

Query  340   QARPTRTRKRGRSAFALPPLKRARS-------------------CFQGFapaaapppppY  462
             QARPTRTRKRGR+A + P +KR+R+                     QGFA   A     +
Sbjct  57    QARPTRTRKRGRAAISPPTIKRSRTHLFGLSSPCHATSSPAKNPSLQGFAHPHAHGVAQF  116

Query  463   H------------QVLNSSAAANTWANYPTGFPQIP---MIHHPNLPPLMDSPAAAETSG  597
                           + N ++ A T        P +P   ++     P  ++     E+ G
Sbjct  117   TLPNHLATVPASCSLDNPASTATTITTNLVTLPLLPCTPVVSEQTTP--LELSNCVESFG  174

Query  598   GGRVLRGIDLNREAAESPEEFDFMPQLQP-------VITPHPVRLIGSTVFVGCILHSDP  756
                V   IDLN+  AE PEE D + QLQ        VI+P PVR +GS++ VGCI     
Sbjct  175   EVNV---IDLNK-VAEIPEEKDLLLQLQGPPSPTNNVISPRPVRPVGSSISVGCINEDSR  230

Query  757   PAPPYTTSLKTaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPF  936
               P      K   +VE E E+ +LP ++SD +N+VR+ANSA+KE+VGQPEC WLDL+   
Sbjct  231   LTPEAQVVTKKPEEVEEEVESEALPAVISDSHNRVRMANSAFKEMVGQPECSWLDLMVIN  290

Query  937   HSPCKTISGEVAIQFSNSVNLP-VSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHS  1113
             +S CK I GEV + FS+S  +P  SSN F+CWVR+EW  +DGKK +V AFCD ++L+C  
Sbjct  291   NSSCKRICGEVMLNFSDSAGMPNNSSNGFSCWVRIEW-GSDGKKNSVDAFCDVIRLSCEI  349

Query  1114  KDYLFQWRFHTSDNNSSKSAC  1176
             KDYLF WRFH     +S+S C
Sbjct  350   KDYLFAWRFHP---QASQSCC  367



>ref|XP_007226649.1| hypothetical protein PRUPE_ppa021982mg [Prunus persica]
 gb|EMJ27848.1| hypothetical protein PRUPE_ppa021982mg [Prunus persica]
Length=377

 Score =   249 bits (636),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 161/372 (43%), Positives = 210/372 (56%), Gaps = 52/372 (14%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHLQ  342
             M++ ++PY+  +   AEI++RYRPIAPKPE P + + +N +L + IR+S +LRN+WP LQ
Sbjct  1     MIKTLNPYNSNTEKTAEIMSRYRPIAPKPETPANSAGENPSLSQKIRESPYLRNLWPQLQ  60

Query  343   ARPTRTRKRGRSAFALPPLKRARS--CFQGFapaaapppppYHQVLNSSAAANTWANYPT  516
             ARPTRTRKRGRSA +    KR R+   F GF+       P  +  L+  A A +    PT
Sbjct  61    ARPTRTRKRGRSALSPTTFKRQRTHHVF-GFSTPCHVTSPAKNLTLDGFAHALSQLPIPT  119

Query  517   GFPQIPMIHHPNLPPLMDS------------------------PAAAE----TSGGGRVL  612
              F  +       LP L                           PA  E      G  ++ 
Sbjct  120   SFDAVKSTSLMTLPLLQYPPPPPSPPPPPPTSSVPVVTNQAMVPAEFELIKPCEGEEKL-  178

Query  613   RGIDLNREAAESPEEFDFMPQLQP---------VITPHPVRLIGSTVFVGCILHSDPPAP  765
               IDLN   AE PEE D + QLQ          VI P PVR +GS++ VGCI  +DP   
Sbjct  179   --IDLNT-VAEIPEEKDLLQQLQGSAPTPTTINVIAPQPVRPVGSSISVGCI-KTDPSLA  234

Query  766   PYTTSLKTaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFH--  939
             P   + K   DVE E E+ +LP ++SD +NKVR+ANSAYKE+VGQPEC WLD +      
Sbjct  235   PAEQAPKKPEDVEDEVESEALPAIISDSHNKVRMANSAYKEMVGQPECSWLDSMVASDGR  294

Query  940   ---SPCKTISGEVAIQFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACH  1110
                S CK ISGEV ++ S S  +PVSSN F+CWVR+EW  N+  K  + AFCD +KL+C 
Sbjct  295   FGGSSCKRISGEVILELSES-GVPVSSNGFSCWVRIEW-GNEMNKHAINAFCDVIKLSCE  352

Query  1111  SKDYLFQWRFHT  1146
             +KDYLF WRFHT
Sbjct  353   TKDYLFSWRFHT  364



>ref|XP_009375150.1| PREDICTED: uncharacterized protein LOC103963994 [Pyrus x bretschneideri]
Length=367

 Score =   248 bits (634),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 160/369 (43%), Positives = 216/369 (59%), Gaps = 38/369 (10%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHLQ  342
             M++ ++PY+   ++ AEI++RYRPIAPKP  P++P+ ++ ++ + IR S +LRN+WP LQ
Sbjct  1     MIKTLNPYTNTEKT-AEIMSRYRPIAPKPVTPSNPAGESPSMSQKIRDSPYLRNLWPQLQ  59

Query  343   ARPTRTRKRGRSAFALPPLKRARS-CFQGFapaaapppppYHQVLNSSA---------AA  492
             ARPTRTRKRGRSA +    KR RS    GF+       P  +  L+  A          +
Sbjct  60    ARPTRTRKRGRSALSPTTFKRQRSHHMLGFSTPCHVQSPVKNPRLDGFARVLPKLPIPTS  119

Query  493   NTWANYPTGFPQIPMIHH--PNLPPLMDSPAAAETS------GGGRVLRGIDLNREAAES  648
                AN  TG   +P++ H  P   P++ +PA            GG  L  IDLN  AAE 
Sbjct  120   LDAANNSTGLMTLPLLPHIPPASVPIVTNPAVVPPEFELIKPCGGEEL--IDLNTVAAEI  177

Query  649   PEEFDFMPQLQP-----------VITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKTaa  795
             PEE D + QLQ            VI P P+R +GS++ VGCI  +DP         K   
Sbjct  178   PEEKDLLKQLQENSPAPPPTSTNVIAPQPIRPVGSSISVGCI-SADPSLTLAAQVPKKPE  236

Query  796   dveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHS---PCKTISGE  966
             DVE E E+ +LP ++SD +NKVR+ANSAYKE+VGQPEC WLD +          K ISGE
Sbjct  237   DVEEEMESEALPAIISDSHNKVRMANSAYKEMVGQPECPWLDAMVAGGDGRFGGKRISGE  296

Query  967   VAIQFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHT  1146
             V++Q S+S  +PVSSN F+CWVR+EW   D  K  +  FCD +KL+C SKDYLF+WRFHT
Sbjct  297   VSLQLSDS-GVPVSSNGFSCWVRIEW-GKDMNKHAINTFCDVMKLSCKSKDYLFEWRFHT  354

Query  1147  SDNNSSKSA  1173
                   +S+
Sbjct  355   RSREGCQSS  363



>ref|XP_008337033.1| PREDICTED: uncharacterized protein LOC103400129 [Malus domestica]
Length=363

 Score =   247 bits (630),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 158/364 (43%), Positives = 214/364 (59%), Gaps = 34/364 (9%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHLQ  342
             M++ ++PY+   ++ AEI++RYRPIAP+PE   +P+    ++ + IR S++LRN+WP  Q
Sbjct  1     MIKTLNPYTDAEKT-AEIMSRYRPIAPQPEITANPAGXXPSMSQKIRDSSYLRNLWPRFQ  59

Query  343   ARPTRTRKRGRSAFALPPLKRARS-CFQGFapaaapppppYHQVLNSSAAANTWANYPTG  519
             ARPTRTRKRGR+A +    KR RS    GF+       P  +  L+  A A  + ++ T 
Sbjct  60    ARPTRTRKRGRTALSPITFKRQRSHHMLGFSTXCHVQSPVKNLRLDGFARA-LYGSFDTA  118

Query  520   -------FPQIPMIHHPNLPPLMDS---PAAAET---SGGGRVLRGIDLNREAAESPEEF  660
                     P +P I   ++P   +    PA  E     GG   L  IDLN  AAE PEE 
Sbjct  119   NTAALMTLPLLPYIPPSSVPIATNQAVVPAELELMKPCGGEENL--IDLNIVAAEIPEEK  176

Query  661   DFMPQLQP-----------VITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKTaadves  807
             D + QLQ            VI P P+RL+GS + VGCI  +DP   P   + K   DVE 
Sbjct  177   DLLKQLQGNSPAPPPTNNNVIEPQPIRLVGSNISVGCI-SADPSLAPAAQAPKKPDDVEE  235

Query  808   eaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHS--PCKTISGEVAIQF  981
             E E+ +LP ++SD + KVR+ANSAYKE+VGQPEC WLD +         K ISGEV++Q 
Sbjct  236   EMESKALPAVISDSHKKVRIANSAYKEMVGQPECPWLDXIVAGDGRFGGKRISGEVSLQL  295

Query  982   SNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHTSDNNS  1161
             S S  +PVSSN F+CWVR+EW  N+  K T+  FCD +KL+C SKDYLF+WRFHT     
Sbjct  296   SGS-GVPVSSNGFSCWVRIEW-GNEMNKHTINTFCDVMKLSCESKDYLFEWRFHTHSREG  353

Query  1162  SKSA  1173
              +S+
Sbjct  354   CQSS  357



>ref|XP_009360856.1| PREDICTED: uncharacterized protein LOC103951252 isoform X1 [Pyrus 
x bretschneideri]
Length=367

 Score =   246 bits (629),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 162/370 (44%), Positives = 216/370 (58%), Gaps = 40/370 (11%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHLQ  342
             M++ ++PY+   ++ AEI++RYRPIAPKPE   +P+ DN ++ + IR S +LRN+ P LQ
Sbjct  1     MIKTLNPYTDTEKT-AEIMSRYRPIAPKPEITANPAGDNPSMSQKIRDSPYLRNLRPQLQ  59

Query  343   ARPTRTRKRGRSAFALPPLKRARS---------C----------FQGFapaaapppppYH  465
             ARPTRTRKRGRSA +    KR RS         C            GF  A +  P P  
Sbjct  60    ARPTRTRKRGRSALSPTTFKRQRSHHMLRFSTPCHVQSPVKNLRLDGFTRALSKLPIPTS  119

Query  466   QVLNSSAAANTWANYPTGFPQ-IPMIHHPNLPPLMDSPAAAETSGGGRVLRGIDLNREAA  642
                +++AA  T    P   P  +P+  +P + P        +T GGG     IDLN  AA
Sbjct  120   LDTDNTAALMTLPLLPYTPPSSVPIATNPAVVPA--ELELIKTCGGGEE-NLIDLNTVAA  176

Query  643   ESPEEFDFMPQLQP-----------VITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKT  789
             E PEE D + QLQ            VI P P+R +GS++ VGCI  +DP   P   + K 
Sbjct  177   EIPEEKDLLKQLQGNSPAPPPTNTNVIEPQPIRPVGSSISVGCI-SADPCLIPAAQAPKK  235

Query  790   aadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHS--PCKTISG  963
             A DVE E E+ +LP+++SD  NKVR+AN+AYKE+VGQPEC WLD +         K ISG
Sbjct  236   AEDVEEEMESEALPVILSDSRNKVRMANAAYKEMVGQPECPWLDAMVAGDGRFGGKRISG  295

Query  964   EVAIQFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFH  1143
             EV++Q S+ + +PVSSN F+CWVR+EW  N+  K  V  FCD  KL+C SKDYLF+WRFH
Sbjct  296   EVSLQLSD-LGVPVSSNGFSCWVRIEW-GNEINKNAVNTFCDVTKLSCESKDYLFEWRFH  353

Query  1144  TSDNNSSKSA  1173
             T      +S+
Sbjct  354   THSREGCQSS  363



>ref|XP_007160923.1| hypothetical protein PHAVU_001G028500g [Phaseolus vulgaris]
 gb|ESW32917.1| hypothetical protein PHAVU_001G028500g [Phaseolus vulgaris]
Length=364

 Score =   246 bits (628),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 170/374 (45%), Positives = 226/374 (60%), Gaps = 48/374 (13%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPE-APTSPSADNNALPENIRKSAFLRNVWPHL  339
             M++ ++PY   +++ AEI++RYRPIAPKPE +P S +  +++L   I++S +LRN+WP L
Sbjct  1     MIKTLNPYPNPAKT-AEIMSRYRPIAPKPETSPNSMTEGSSSLSHKIKQSPYLRNLWPQL  59

Query  340   QARPTRTRKRGRSAFALPP--LKRARS------------------CFQGFapaaappppp  459
             QARPTRTRKRGR+   LPP   KR ++                   FQGFAP   P P P
Sbjct  60    QARPTRTRKRGRAPLTLPPSSFKRHKTHILGFCPPCHVTSPGNNLSFQGFAPPPLPLPHP  119

Query  460   YHQV--LNSSAAANTWAN-YPTGFPQIPMIHHPNLP-PLMDSPAAAETS---GGGRVLRG  618
              H +  LN S   N+  N      P +P    P  P P +DS  A  T+   GGG     
Sbjct  120   NHGLGMLNRSIEKNSLMNPSLVTLPLLPC--SPGAPAPKLDSITATTTTKPCGGGV----  173

Query  619   IDLNREAAESPEEFDFMPQLQP-----VITPHPVRLIGSTVFVGCILHSDPPAPPYTTSL  783
             IDLN +A+  PEE D + QLQ      VI PHPVR IGS++ V CI   D   P  T   
Sbjct  174   IDLNTKAS-VPEERDLLQQLQKPVSNNVIQPHPVRPIGSSITVVCI-GEDSTLPSQTP--  229

Query  784   KTaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLL---PPFHSPCKT  954
             K + +VE+E E+ SLP+++SD N++VR+ANSAYKE+VGQP C WL+ +      +  CK 
Sbjct  230   KRSQEVEAEVESESLPVVISDSNHRVRMANSAYKEMVGQPLCPWLESMVNAGAGNLQCKR  289

Query  955   ISGEVAIQFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQW  1134
             ISGEVA+  S S N+P SSN F+CWVR+EW ++  KK  V AFCD +KL C S+DYLF W
Sbjct  290   ISGEVALHLSES-NIPTSSNGFSCWVRIEWQSDQQKKCCVNAFCDVMKLTCESRDYLFTW  348

Query  1135  RFHTSDNNSSKSAC  1176
             RFHT    + +S+C
Sbjct  349   RFHTRTREACQSSC  362



>ref|XP_008220378.1| PREDICTED: uncharacterized protein LOC103320476 [Prunus mume]
Length=373

 Score =   246 bits (629),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 158/381 (41%), Positives = 212/381 (56%), Gaps = 54/381 (14%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHLQ  342
             M++ ++PY+  +   AEI++RYRPIAPKPE P + + +N +L + IR+S +LRN+WP LQ
Sbjct  1     MIKTLNPYNTNTEKTAEIMSRYRPIAPKPETPANSAGENPSLSQKIRESPYLRNLWPQLQ  60

Query  343   ARPTRTRKRGRSAFALPPLKRARS--CFQGFapaaapppppYHQVLNSSAAANTWANYPT  516
             ARPTRTRKRGRSA +    +R R+   F GF+       P  +  L+  A A +    PT
Sbjct  61    ARPTRTRKRGRSALSPTTFRRQRTHHVF-GFSTPCHVTSPAKNLTLDGFAHALSQLPIPT  119

Query  517   GFPQIP----------------------------MIHHPNLPPLMDSPAAAETSGGGRVL  612
              F  +                             + +   +P   +   + E   G   L
Sbjct  120   SFDAVKSTSLMTLPLLQYPPPPSPPPPPPLSVPVVTNQAMVPAEFELIKSCE---GEEKL  176

Query  613   RGIDLNREAAESPEEFDFMPQLQP---------VITPHPVRLIGSTVFVGCILHSDPPAP  765
               IDLN   AE PEE D + QLQ          VI P PVR +GS++ VGCI  +DP   
Sbjct  177   --IDLN-TVAEIPEEKDLLQQLQGSAPTLTPINVIAPQPVRPVGSSISVGCI-KTDPSLA  232

Query  766   PYTTSLKTaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFH--  939
             P   + K   DVE E E+ +LP ++SD  NKVR+ANSAYKE+VGQPEC WLD +      
Sbjct  233   PAEQAPKKPEDVEDEVESEALPAIISDSQNKVRMANSAYKEMVGQPECSWLDSMVASDGR  292

Query  940   ---SPCKTISGEVAIQFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACH  1110
                S CK ISGEV ++ S S  +PVSSN F+CWVR+EW  N+  K  + AFCD +KL+C 
Sbjct  293   FGGSSCKRISGEVILELSES-GVPVSSNGFSCWVRIEW-GNEMNKHAINAFCDVIKLSCE  350

Query  1111  SKDYLFQWRFHTSDNNSSKSA  1173
             +KDYLF WRFHT     + S+
Sbjct  351   TKDYLFSWRFHTQSKEGTSSS  371



>ref|XP_009360865.1| PREDICTED: uncharacterized protein LOC103951252 isoform X2 [Pyrus 
x bretschneideri]
Length=367

 Score =   246 bits (627),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 160/370 (43%), Positives = 216/370 (58%), Gaps = 40/370 (11%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHLQ  342
             M++ ++PY+   ++ AEI++RYRPIAPKPE   +P+ DN ++ + IR S +LRN+ P LQ
Sbjct  1     MIKTLNPYTDTEKT-AEIMSRYRPIAPKPEITANPAGDNPSMSQKIRDSPYLRNLRPQLQ  59

Query  343   ARPTRTRKRGRSAFALPPLKRARS---------C----------FQGFapaaapppppYH  465
             ARPTRTRK+GR+A +    KR RS         C            GF  A +  P P  
Sbjct  60    ARPTRTRKQGRTALSTTTFKRQRSHHMLRFSTPCHVQSPVKNLRLDGFTRALSKLPIPTS  119

Query  466   QVLNSSAAANTWANYPTGFPQ-IPMIHHPNLPPLMDSPAAAETSGGGRVLRGIDLNREAA  642
                +++AA  T    P   P  +P+  +P + P        +T GGG     IDLN  AA
Sbjct  120   LDTDNTAALMTLPLLPYTPPSSVPIATNPAVVPA--ELELIKTCGGGEE-NLIDLNTVAA  176

Query  643   ESPEEFDFMPQLQP-----------VITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKT  789
             E PEE D + QLQ            VI P P+R +GS++ VGCI  +DP   P   + K 
Sbjct  177   EIPEEKDLLKQLQGNSPAPPPTNTNVIEPQPIRPVGSSISVGCI-SADPCLIPAAQAPKK  235

Query  790   aadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHS--PCKTISG  963
             A DVE E E+ +LP+++SD  NKVR+AN+AYKE+VGQPEC WLD +         K ISG
Sbjct  236   AEDVEEEMESEALPVILSDSRNKVRMANAAYKEMVGQPECPWLDAMVAGDGRFGGKRISG  295

Query  964   EVAIQFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFH  1143
             EV++Q S+ + +PVSSN F+CWVR+EW  N+  K  V  FCD  KL+C SKDYLF+WRFH
Sbjct  296   EVSLQLSD-LGVPVSSNGFSCWVRIEW-GNEINKNAVNTFCDVTKLSCESKDYLFEWRFH  353

Query  1144  TSDNNSSKSA  1173
             T      +S+
Sbjct  354   THSREGCQSS  363



>ref|XP_002510084.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52271.1| conserved hypothetical protein [Ricinus communis]
Length=363

 Score =   245 bits (626),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 152/365 (42%), Positives = 214/365 (59%), Gaps = 33/365 (9%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHLQ  342
             M++ +SPYS  +++ AEI++RYRPIAPKPE P++   +++++ + I +S +LRN+WP LQ
Sbjct  1     MIKTLSPYSTTAKT-AEIMSRYRPIAPKPEGPSNSFGESSSMSQKISQSPYLRNLWPQLQ  59

Query  343   ARPTRTRKRGRSAFALPPLKRARSCFQGFapaaapppppYHQVLNSSAAANTWANYPTGF  522
             ARPTRTRKRGR+A + P +KR R+   G +  +    P  H  L   A   +  + P+  
Sbjct  60    ARPTRTRKRGRAAISPPTIKRPRTHVLGLSSTSHVISPARHLSLQGFAHGLSQLSVPSLV  119

Query  523   PQIPMIHHPN-----------LP-----PLMDSPAAAETSGGGRVLRG--IDLNREAAES  648
                  +++P            LP     P++D+   A         R   IDLN   AE 
Sbjct  120   GVSSSLNNPVTTNSDLVTLSLLPCQPPVPVVDNQVTAPEISCMEARRQVIIDLN-TVAEI  178

Query  649   PEEFDFMPQLQP-----VITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKTaadvesea  813
             PEE DF+ QLQ      VI P P+R +GS++ VGC+   D  + P     K   +VE E 
Sbjct  179   PEEKDFLQQLQEPPTNNVIAPQPIRPVGSSISVGCV-SEDTNSTPQVQVPKKPEEVEEEI  237

Query  814   eavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFH-----SPCKTISGEVAIQ  978
             E  +LP ++ D N KVRLANSAYKE+VGQPEC WLD +         + CK I GEV + 
Sbjct  238   ECEALPTVICDSNYKVRLANSAYKEMVGQPECPWLDSMVAGDGRFGGNSCKRICGEVILH  297

Query  979   FSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHTSDNN  1158
              ++S  +P SSN+F+CWV +EW  ++GKKT   AFCD ++L+C SKDYLF WRFHT    
Sbjct  298   LADS-RVPSSSNKFSCWVNIEW-GHEGKKTAATAFCDVIRLSCESKDYLFAWRFHTHSRE  355

Query  1159  SSKSA  1173
              S+S+
Sbjct  356   GSQSS  360



>ref|XP_011074345.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105159096 
[Sesamum indicum]
Length=355

 Score =   244 bits (623),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 166/371 (45%), Positives = 211/371 (57%), Gaps = 59/371 (16%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPT--SPSA-DNNALPENIRKSAFLRNVWP  333
             M+Q +SPY+  S   AEI++RYRPIAPKPEAP+  SP+  DN+ALP  IRKS +LRNVW 
Sbjct  1     MIQTISPYA--SARTAEIMSRYRPIAPKPEAPSPNSPAENDNSALPNGIRKSPYLRNVWA  58

Query  334   HLQARPTRTRKRGRSA-FALPPLKRARSCFQGFapaaapppppYHQVLNSSAAAN-TWAN  507
             HLQARPTRTRKRGR+A FA P +KR R+C QG +P         +QV+ SS A N     
Sbjct  59    HLQARPTRTRKRGRTAAFAPPSVKRTRTCLQGLSPP--------YQVITSSPAKNLAMHG  110

Query  508   YPTGFPQIPMIHHPNLPPLMDSPAAAETSGGGRVL-------------------------  612
             +  G PQI ++  PNL PL      A T+    V                          
Sbjct  111   FSHGPPQISLL--PNLVPLKCGLDTAVTTLAESVALPLLCCTAAAAAAVQAPIFNPGKEM  168

Query  613   -----RGIDLNREAA-ESPEEFDFMPQLQP-----VITPHPVRLIGSTVFVGCILHSDPP  759
                  +GIDLN  A  + PEE DF+PQLQ      VI+P PVR +GS + V  I  ++ P
Sbjct  169   DNSCSKGIDLNMTATDQGPEELDFLPQLQEPVKPSVISPRPVRPVGSIIIVSNI--AEDP  226

Query  760   APPYTTSLKTaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFH  939
                 TT    A +VE+  EA  +P +VSD NNKVR+ NSAYKE+VGQPECR         
Sbjct  227   GRQMTTLKARAEEVEAAVEAEEIPAIVSDSNNKVRITNSAYKEMVGQPECRRHK---ERR  283

Query  940   SPCKTISGEVAIQFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKD  1119
               CK I GEV + F +S +   S+  F+C V++EW +  GKK +V A C+ VKL C +KD
Sbjct  284   RACKRIGGEVLLHFEDSEHQIASAGGFSCRVKIEWESK-GKKNSVNACCEGVKLGCQAKD  342

Query  1120  YLFQWRFHTSD  1152
             Y F WRF   +
Sbjct  343   YQFLWRFRAME  353



>ref|XP_008377953.1| PREDICTED: uncharacterized protein LOC103441030 [Malus domestica]
Length=369

 Score =   243 bits (621),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 159/371 (43%), Positives = 216/371 (58%), Gaps = 40/371 (11%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHLQ  342
             M++ ++PY+   ++ AEI++RYRPIAPKP  P++P+ ++ ++ + IR S +LRN+WP LQ
Sbjct  1     MIKTLNPYTNTEKT-AEIMSRYRPIAPKPVTPSNPAGESPSMSQKIRDSPYLRNLWPQLQ  59

Query  343   ARPTRTRKRGRSAFALPPLKRARS-CFQGFapaaapppppYHQVLNSSA---------AA  492
             ARPTRTRKRGRSA +    KR RS    GFA       P  +  L+  A          +
Sbjct  60    ARPTRTRKRGRSALSPTTFKRQRSHQMLGFATPCHVQSPVKNPRLDGFARVLPKLPIPXS  119

Query  493   NTWANYPTGFPQIPMIHH--PNLPPLMDSPAAA--------ETSGGGRVLRGIDLNREAA  642
                AN  TG   +P++ +  P   P++ +PA             GG   L  IDLN  AA
Sbjct  120   LDAANNSTGXMTLPLLPYIPPASAPIVTNPAVVPPEFELIKPCRGGEEEL--IDLNTVAA  177

Query  643   ESPEEFDFMPQLQP-----------VITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKT  789
             E PEE D + QLQ            VI P P+R +GS++ VGCI  +DP         K 
Sbjct  178   EIPEEKDLLKQLQGNSPAPPPTPTNVIAPQPIRPVGSSISVGCI-SADPSLTLAAQVPKK  236

Query  790   aadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHS---PCKTIS  960
               DVE E E+ +LP ++SD +NKVR+ANSAYKE+VGQPEC WLD +          K I+
Sbjct  237   PEDVEEEMESEALPAIISDSHNKVRMANSAYKEMVGQPECPWLDAMVAGGDGRFGGKRIN  296

Query  961   GEVAIQFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRF  1140
             GEV++Q S+S  +PVSSN F+CWVR+EW   D  K  +  FCD +KL+C SKDYLF+WRF
Sbjct  297   GEVSLQLSDS-GVPVSSNGFSCWVRIEW-GKDMNKHAINTFCDVMKLSCESKDYLFEWRF  354

Query  1141  HTSDNNSSKSA  1173
             HT      +S+
Sbjct  355   HTHSREGCQSS  365



>gb|KDP41608.1| hypothetical protein JCGZ_16015 [Jatropha curcas]
Length=374

 Score =   242 bits (618),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 154/370 (42%), Positives = 212/370 (57%), Gaps = 43/370 (12%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHLQ  342
             M++ +SPYS  +++ AEI++RYRPIAPKPE P +   +++++ + IR+S +LRN+WP LQ
Sbjct  1     MLKTLSPYSTTAKT-AEIMSRYRPIAPKPEPPANSLGESSSMSQKIRQSPYLRNLWPQLQ  59

Query  343   ARPTRTRKRGRSAFALPPLKRARSC-------------------FQGFapaaapppppYH  465
             ARPTRTRKRGR+A + P +KR R+                     +GFA   +  P    
Sbjct  60    ARPTRTRKRGRAAISPPTIKRPRTTHFLGLSSPGHLITSARDLSLRGFAHGISQLPVANL  119

Query  466   QVLNSSAAAN--TWANYPTGFPQIPMIHHPNLPPLMDSPAAAETSGGGRVLRGIDLNREA  639
               +NS+   N  T ++       +P    P++P +    +  E  G  +V   IDLN   
Sbjct  120   AGVNSTCLENPVTTSSDLVTLSLLPC--QPSVPAVAPEISCMERRGEKKV---IDLNI-V  173

Query  640   AESPEEFDFMPQLQP-------VITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKTaad  798
             AE PE+ D + QLQ        VI P P+R +GS + VGCI   DP   P     K   +
Sbjct  174   AEIPEDKDLLQQLQEPPASLTNVIAPQPIRPVGSRISVGCITE-DPNLAPSLELPKKPGE  232

Query  799   veseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPP-----FHSPCKTISG  963
             VE E E+ +LP ++SD N KVRLANSAYKE+VGQPEC WLD +           CK I G
Sbjct  233   VEEEVESEALPAVISDSNYKVRLANSAYKEMVGQPECLWLDSMITGDGRFVGGSCKRICG  292

Query  964   EVAIQFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFH  1143
             EV +    S  +PVSSN F+CWVR+EW  ++GKK  + +FCD ++L+C SKDYL+ WRFH
Sbjct  293   EVMLNLDGS-RVPVSSNGFSCWVRIEW-GHEGKKKAINSFCDVIRLSCESKDYLYIWRFH  350

Query  1144  TSDNNSSKSA  1173
             T      K A
Sbjct  351   TQSREVLKPA  360



>ref|XP_010105063.1| hypothetical protein L484_000375 [Morus notabilis]
 ref|XP_010108040.1| hypothetical protein L484_004007 [Morus notabilis]
 gb|EXC17686.1| hypothetical protein L484_004007 [Morus notabilis]
 gb|EXC49238.1| hypothetical protein L484_000375 [Morus notabilis]
Length=347

 Score =   239 bits (610),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 157/362 (43%), Positives = 214/362 (59%), Gaps = 41/362 (11%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHLQ  342
             M++ ++PY+  +++ AEI++RYRPIAPKPE PTSP+++  +  + IR+S +LRN+WP LQ
Sbjct  1     MIKTLNPYATTAKT-AEIMSRYRPIAPKPETPTSPTSETTSTSQKIRQSPYLRNLWPQLQ  59

Query  343   ARPTRTRKRGRSAFALPPLKRARSC--------------FQGFapaaapppppYHQVLNS  480
             ARPTRTRKRGR+A + P LKR R+                QGF+       P     L  
Sbjct  60    ARPTRTRKRGRAALSPPSLKRQRTNNALGLTPPYNHLPPLQGFSTHGLQQIPTTSLTLEK  119

Query  481   SAAANTWANYPTGFPQIPMIHHPNLPPLMDSPAAAE---TSGGGRVLRGIDLNREAAESP  651
              AA             +P++  P+ P + +  A +E       G   + IDLN   AE P
Sbjct  120   PAA---------NLVTLPLL--PSTPIVTNQAAVSELDWMKACGEEKQLIDLN-TVAEIP  167

Query  652   EEFDFMPQLQ------PVITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKTaadvesea  813
             EE D + QLQ       VI P PVR +GS++ V CI      A     + K   +VE E 
Sbjct  168   EEKDLLQQLQRVPVPATVIAPQPVRPVGSSICVRCISEDPKLASQAAQAPKKPEEVEEEV  227

Query  814   eavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTISGEVAIQFSNSV  993
             E+  LP ++SD NNKVR+ANSAYKE+VGQPEC WLD +    S CK I GEV +Q S+S 
Sbjct  228   ESEILPAVISDSNNKVRMANSAYKEMVGQPECSWLDSM--MTSSCKRIGGEVILQLSDS-  284

Query  994   NLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHTSDN-NSSKS  1170
              +P+SSN F+CWVR+EW  +D  K +V AFCD ++L+C SKDY+F WRFH      +S+S
Sbjct  285   RVPISSNGFSCWVRIEW-GSDENKNSVNAFCDVIRLSCESKDYVFTWRFHIHHTREASQS  343

Query  1171  AC  1176
             +C
Sbjct  344   SC  345



>ref|XP_011017104.1| PREDICTED: uncharacterized protein LOC105120550 [Populus euphratica]
Length=363

 Score =   235 bits (600),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 151/368 (41%), Positives = 202/368 (55%), Gaps = 57/368 (15%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHLQ  342
             M++ +SP S  +++ AEI++RYRPIAP+PE   S   +++++ + IR+S +LR +WP +Q
Sbjct  1     MIKTLSPCSNTAKT-AEIMSRYRPIAPRPEGSASSMDESSSMSQKIRESPYLRTLWPQMQ  59

Query  343   ARPTRTRKRGRSAFALPPLKRARSCFQGFapaaapppppYHQVLNSSAAANTWANYPTGF  522
             ARPTRTRKRGR+  + P +KR R+   G +  +    P  H  L           +  G 
Sbjct  60    ARPTRTRKRGRAVVSPPNIKRPRTHLLGLSSPSHETSPAKHLSLQ---------GFVHGI  110

Query  523   PQIPMIHHPNLP-------------------PLMDSPAAAETSGGGRVL-----------  612
             PQ+P+   PNL                    PL+ SP           +           
Sbjct  111   PQLPV---PNLVGVNSGLENSVTMSSNLVTLPLLQSPTTVTVVANQAAVPEPSCLEPNRD  167

Query  613   RGIDLNREAAESPEEFDFMPQLQP-----VITPHPVRLIGSTVFVGCILHSDPPAPPYTT  777
             + IDLN   AE PEE D + QLQ      VI P PVRL+GS++ + CI   DP   P   
Sbjct  168   KVIDLN-TVAEFPEEKDLLQQLQVPPTNNVIAPQPVRLVGSSISIACI-SEDPSFIPLVR  225

Query  778   SLKTaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHS-----  942
               K   +VE E E+  LP ++SD NNKVRLANSAYKE+VGQPEC WLD +          
Sbjct  226   VPKKPEEVEEEVESQVLPTVISDSNNKVRLANSAYKEMVGQPECSWLDSMMTGDGSFAGR  285

Query  943   PCKTISGEVAIQFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDY  1122
              CK I GEV +  S+ + +P SSN F+CWVR+EW N  G K  +  FCD +KL+C SKDY
Sbjct  286   SCKRICGEVELHLSD-LRVPESSNGFSCWVRIEWCNK-GTKNVIVTFCDVIKLSCASKDY  343

Query  1123  LFQWRFHT  1146
             LF WRFHT
Sbjct  344   LFSWRFHT  351



>ref|XP_011013752.1| PREDICTED: uncharacterized protein LOC105117702 [Populus euphratica]
Length=363

 Score =   234 bits (597),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 150/368 (41%), Positives = 202/368 (55%), Gaps = 57/368 (15%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHLQ  342
             M++ +SP S  +++ AEI++RYRPIAP+PE   S   +++++ + IR+S +LR +WP +Q
Sbjct  1     MIKTLSPCSNTAKT-AEIMSRYRPIAPRPEGSASSMDESSSMSQKIRESPYLRTLWPQMQ  59

Query  343   ARPTRTRKRGRSAFALPPLKRARSCFQGFapaaapppppYHQVLNSSAAANTWANYPTGF  522
             ARPTRTRKRGR+  + P +KR R+   G +  +    P  H  L           +  G 
Sbjct  60    ARPTRTRKRGRAVVSPPNIKRPRTHLLGLSSPSHETSPAKHLSLQ---------GFVHGI  110

Query  523   PQIPMIHHPNLP-------------------PLMDSPAAAETSGGGRVL-----------  612
             PQ+P+   PNL                    PL+ SP           +           
Sbjct  111   PQLPV---PNLVGVNSGLENSVTMSSNLVTLPLLQSPTTVTVVANQAAVPEPSCLEPNRD  167

Query  613   RGIDLNREAAESPEEFDFMPQLQP-----VITPHPVRLIGSTVFVGCILHSDPPAPPYTT  777
             + IDLN   AE PEE D + QLQ      VI P PVRL+GS++ + CI   DP   P   
Sbjct  168   KVIDLN-TVAEFPEEKDLLQQLQVPPTNNVIAPQPVRLVGSSISIACI-SEDPSFIPLVR  225

Query  778   SLKTaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHS-----  942
               K   +VE E E+  LP ++SD NNKVRLANSAYKE+VGQPEC WLD +          
Sbjct  226   VPKKPEEVEEEVESQVLPTVISDSNNKVRLANSAYKEMVGQPECSWLDSMMTGDGSFAGR  285

Query  943   PCKTISGEVAIQFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDY  1122
              CK I GEV +  S+ + +P SSN F+CWVR+EW N  G K  +  FCD ++L+C SKDY
Sbjct  286   SCKRICGEVELHLSD-LRVPESSNGFSCWVRIEWCNK-GTKNVIVTFCDVIRLSCASKDY  343

Query  1123  LFQWRFHT  1146
             LF WRFHT
Sbjct  344   LFSWRFHT  351



>ref|XP_002301145.1| hypothetical protein POPTR_0002s11850g [Populus trichocarpa]
 gb|EEE80418.1| hypothetical protein POPTR_0002s11850g [Populus trichocarpa]
Length=363

 Score =   232 bits (591),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 148/368 (40%), Positives = 202/368 (55%), Gaps = 57/368 (15%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHLQ  342
             M++ +SP S  +++ AEI++RYRPIAP+PE   S   +++++ + IR+S +LR +WP +Q
Sbjct  1     MIKTLSPCSNTAKT-AEIMSRYRPIAPRPEGSASSMDESSSMSQKIRESPYLRTLWPQMQ  59

Query  343   ARPTRTRKRGRSAFALPPLKRARSCFQGFapaaapppppYHQVLNSSAAANTWANYPTGF  522
             ARPTRTRKRGR+  + P +KR R+   G +  +    P  H  L           +  G 
Sbjct  60    ARPTRTRKRGRAVVSPPNIKRPRTHLLGLSSPSHVTSPAKHLSLQ---------GFVHGI  110

Query  523   PQIPMIHHPNLP-------------------PLMDSPAAAETSGGGRVL-----------  612
             PQ+P+   PNL                    PL+ SP           +           
Sbjct  111   PQLPV---PNLVGVNSGLENSVTMSSNLVTLPLLQSPTTVTVVANQAAVPELSCMEPNRD  167

Query  613   RGIDLNREAAESPEEFDFMPQLQP-----VITPHPVRLIGSTVFVGCILHSDPPAPPYTT  777
             + IDLN   AE PEE D + QLQ      VI P P+RL+GS++ + CI   DP   P   
Sbjct  168   KVIDLN-TVAEFPEEKDLLQQLQVPPTNNVIAPQPLRLVGSSISIACI-SEDPSFIPLVR  225

Query  778   SLKTaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHS-----  942
               K   +VE E E+  LP ++SD NNKVRLANSAYKE+VGQPEC WLD +          
Sbjct  226   VPKKPEEVEEEVESEVLPTVISDSNNKVRLANSAYKEMVGQPECSWLDSMMTGDGSFAGR  285

Query  943   PCKTISGEVAIQFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDY  1122
              CK I GEV +  S+ + +P SSN F+CWVR+EW N  G K  +  FCD ++L+C S+DY
Sbjct  286   SCKRICGEVELHLSD-LRVPASSNGFSCWVRIEWCNK-GTKNVIITFCDVIRLSCASRDY  343

Query  1123  LFQWRFHT  1146
             LF WRFHT
Sbjct  344   LFSWRFHT  351



>ref|XP_003545343.1| PREDICTED: uncharacterized protein LOC100800670 [Glycine max]
 gb|KHN17161.1| hypothetical protein glysoja_010620 [Glycine soja]
Length=368

 Score =   226 bits (577),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 158/378 (42%), Positives = 215/378 (57%), Gaps = 52/378 (14%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADNNA-----LPENIRKSAFLRNV  327
             M++ ++PY   +++ AEI++RYRPIAPKPE  TSP++  +      L + I +S +LRN+
Sbjct  1     MIKTLNPYPNPAKT-AEIMSRYRPIAPKPE--TSPNSSMSEGSCSSLSQKINQSPYLRNL  57

Query  328   WPHLQARPTRTRKRGRSAFALPP--LKRARSC---------------------FQGFapa  438
             WP LQARPTRTRKRGR+   LP   LKR ++                      FQGFAP 
Sbjct  58    WPQLQARPTRTRKRGRAPLTLPSSSLKRHKTTHILGFCPPCHVVTSSPAKNLSFQGFAPL  117

Query  439   aapppppYHQVLNSSAAANTWANYPTGFPQIPMIHHPNLP-PLMDSPAAAETSGGGRVLR  615
                       VLN +   N           +P++     P P ++S +       G V  
Sbjct  118   PNHGLG----VLNCTMENNNTLTANPSLVTLPLLPCSPCPAPKLESNSTLTKPCVGEV--  171

Query  616   GIDLNREAAESPEEFDFMPQLQP-------VITPHPVRLIGSTVFVGCILHSDPPAPPYT  774
              IDLN + +  PEE D + QLQ        VITP PVR IGS++ V CI   D   PP +
Sbjct  172   -IDLNTKVS-VPEEKDLLQQLQKPVSSNINVITPQPVRPIGSSISVVCI-SEDLTLPPLS  228

Query  775   TSLKTaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHS--PC  948
              + K   +VE E E   LP ++SD N+++R+ANSAYKE+VGQP C WL+ +   +    C
Sbjct  229   QTPKRPNEVEQEVENEPLPAVISDSNHRIRMANSAYKEMVGQPLCPWLESMVNNNGGGEC  288

Query  949   KTISGEVAIQFSNSVNLPVSSNRFTCWVRMEW-SNNDGKKTTVRAFCDAVKLACHSKDYL  1125
             K ISGEV +  S+S  +P SSN F+CWVR+EW S ++ KK  V AFCD +KLAC S+DYL
Sbjct  289   KRISGEVTLHLSDSTIVPTSSNGFSCWVRIEWQSEHNNKKNCVNAFCDVMKLACESRDYL  348

Query  1126  FQWRFHT-SDNNSSKSAC  1176
             F WRFHT +   +S+S+C
Sbjct  349   FTWRFHTRTTREASQSSC  366



>ref|XP_002283353.1| PREDICTED: uncharacterized protein LOC100262679 [Vitis vinifera]
Length=361

 Score =   226 bits (576),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 147/361 (41%), Positives = 204/361 (57%), Gaps = 32/361 (9%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHLQ  342
             M++ ++PY+  +++ AEI++RYRPIAPKPE P +P  +  ++ + +R+S +LRN+WP LQ
Sbjct  1     MIRTLNPYNSTAKT-AEIMSRYRPIAPKPEPPVNPMFERPSMSQKMRESPYLRNLWPQLQ  59

Query  343   ARPTRTRKRGRSAFALPPLKRARSCFQGFap--------aaapppppYHQVLNSSAAANT  498
             ARPTR+RKRGR  F+   LKR R+   GF+                  H  L     A +
Sbjct  60    ARPTRSRKRGRPGFSPAALKRPRTHLVGFSTPSHVTSPAKNLSMHGFTHSPLQLPVPAPS  119

Query  499   WANYPTGFPQIPMIHHPNLPPLMDSPAAAETSG------------GGRVLRGIDLNREAA  642
             +A    GF +        L  L   P                   GG V+  ++ +  AA
Sbjct  120   FAPLNGGFERAISTTADGLMTLPLLPCPPPQLPVVPNDFNCLNPCGGNVIFDLNTSVVAA  179

Query  643   ESPEEFDFMPQLQ-------PVITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKTaadv  801
               PEE D + QLQ        VI+P PVR IGS++ V C+     P P     LK   +V
Sbjct  180   RIPEEKDLLQQLQRAPANTTNVISPQPVRPIGSSISVRCMRDDLSPIPEVQI-LKKPEEV  238

Query  802   eseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLD-LLPPFHSPCKTISGEVAIQ  978
             E E E+ +LP ++SD NNK+R+ANSAYKE+VGQPEC WL+ ++    S    ISGEV + 
Sbjct  239   EEEMESETLPAVISDSNNKIRMANSAYKEMVGQPECPWLNSMVTCGASVGNRISGEVMLH  298

Query  979   FSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHTSDNN  1158
              S+S  +PV+SN F+CW  +EW  + G K++V AFCDA +LAC SKDYLF WRFHT+   
Sbjct  299   LSDS-KVPVASNGFSCWASIEWG-SAGNKSSVNAFCDATRLACESKDYLFTWRFHTNTEA  356

Query  1159  S  1161
             S
Sbjct  357   S  357



>ref|XP_008452651.1| PREDICTED: uncharacterized protein LOC103493608 [Cucumis melo]
Length=368

 Score =   220 bits (561),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 151/357 (42%), Positives = 205/357 (57%), Gaps = 38/357 (11%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADN--NALPENIRKSA----FLRN  324
             M++ + P+    ++ AEI++RYRPIAPKPE+P  P++D+  N +P +   S+    FLRN
Sbjct  1     MIKTLPPFPSTDKT-AEIMSRYRPIAPKPESPF-PTSDHSLNNIPHSSSSSSSSSSFLRN  58

Query  325   VWPHLQARPTRTRKRGRSAFALP-PLKRARSCFQGFapaaapppppYHQVLNSSAAANTW  501
             VWP LQARPTRTRKR R     P  LKRAR           P    +H   +S     + 
Sbjct  59    VWPQLQARPTRTRKRSRPPPISPHSLKRAR-------ITPPPNFSLHHPFPSSLLPHLSL  111

Query  502   ANYPTGF----PQIPMIHHPNLPPLMDSPAAAETSGGGRVL-----RGIDLNREAA---E  645
              +  +GF        ++  P LP + D       S    +      +G++ N ++A   E
Sbjct  112   PSINSGFHDSSSNSNLVTLPLLPSVSDETETTPVSEINFIKSFDEEKGVEFNVDSAVVSE  171

Query  646   SPEEFDFMPQLQ------PVITPHPVRLIGSTVFVGCILHSDPPAPPYTTSL--KTaadv  801
              P+E D + QLQ       VITPHPVR +GS++ VGCI  +  P     T    K   +V
Sbjct  172   IPQEKDLLQQLQCPVSVSNVITPHPVRPVGSSIRVGCINEAQNPVHSNNTPQLPKKPDEV  231

Query  802   eseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKT--ISGEVAI  975
             E E E+  LP ++SD NN+VR+ANSAYKE+VGQPEC WLD +       K   I GEV +
Sbjct  232   EKEVESEVLPAVISDSNNRVRMANSAYKEMVGQPECLWLDSMVTGDERLKGRRIGGEVML  291

Query  976   QFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHT  1146
               S++  +P SSN F+CWVR+EW N+DGKK +V AFCD +KL+C S+DYLF WRFHT
Sbjct  292   HLSDAAAVPHSSNGFSCWVRIEWGNSDGKKNSVTAFCDVIKLSCVSRDYLFTWRFHT  348



>ref|XP_003549376.1| PREDICTED: uncharacterized protein LOC100778232 [Glycine max]
Length=364

 Score =   219 bits (559),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 158/378 (42%), Positives = 218/378 (58%), Gaps = 56/378 (15%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADNNALP-----ENIRKSAFLRNV  327
             M++ ++PY   +++ AEI++RYRPIAPKPE  TSP++ +         + I++S +LRN+
Sbjct  1     MIKTLNPYPNPAKT-AEIMSRYRPIAPKPE--TSPNSMSEGPSSSSLSQKIKQSPYLRNL  57

Query  328   WPHLQARPTRTRKRGRSAFALP--PLKRARSCFQ---GFapaaapppppYHQVLNSSAAA  492
             WP LQARPTRTRKRGR+   LP   LKR ++      GF        PP H V+ SS+++
Sbjct  58    WPQLQARPTRTRKRGRAPLTLPSSSLKRHKTTHHHVLGF-------CPPCHHVVTSSSSS  110

Query  493   NTWANYPTGF-PQIPMIHH-----------------PNLPPLMDSPAAAETSGGGRVLRG  618
              +      GF P  P+ HH                   LP L  SP        G V   
Sbjct  111   PSKNLSLQGFAPPHPLPHHLGVLNCTMEKNNTNPSLVTLPLLPCSPTLTTKPCAGEV---  167

Query  619   IDLNREAAESPEEFDFMPQLQP--------VITPHPVRLIGSTVFVGCILHSDPPAPPYT  774
             I+LN +A+  PEE D + QLQ         VITP P+R IGS++ V CI   D    P  
Sbjct  168   INLNTKAS-VPEEKDLLQQLQKPVSNNIINVITPQPIRPIGSSISVVCI-SEDSTLSPLA  225

Query  775   TSLKTaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKT  954
              + K   +VE E E  +LP ++SD N+++R+ANSAYKE+VGQP C WL+ +      C+ 
Sbjct  226   QTPKKPNEVEQEVENEALPTVISDSNHRIRMANSAYKEMVGQPVCPWLESMGNLLQ-CRR  284

Query  955   ISGEVAIQFSNSVN-LPVSSNRFTCWVRMEW--SNNDGKKTTVRAFCDAVKLACHSKDYL  1125
             ISGEV +  S+S   +P SSN F+CWVR+EW   +N+ KK  + AFCD +KLAC S+DYL
Sbjct  285   ISGEVTLNLSDSSTVIPTSSNGFSCWVRIEWLSEHNNKKKNCINAFCDVMKLACESRDYL  344

Query  1126  FQWRFHT-SDNNSSKSAC  1176
             F WRFHT +   +S+S+C
Sbjct  345   FTWRFHTRTTREASQSSC  362



>gb|KHN36974.1| hypothetical protein glysoja_009002 [Glycine soja]
Length=364

 Score =   218 bits (555),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 157/378 (42%), Positives = 217/378 (57%), Gaps = 56/378 (15%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADNNALP-----ENIRKSAFLRNV  327
             M++ ++PY   +++ AEI++RYRPIAPKPE  TSP++ +         + I++S +LRN+
Sbjct  1     MIKTLNPYPNPAKT-AEIMSRYRPIAPKPE--TSPNSMSEGPSSSSLSQKIKQSPYLRNL  57

Query  328   WPHLQARPTRTRKRGRSAFALP--PLKRARSCFQ---GFapaaapppppYHQVLNSSAAA  492
             WP LQARPTRTRKRGR+   LP   LKR ++      GF        PP H V+ SS+++
Sbjct  58    WPQLQARPTRTRKRGRAPLTLPSSSLKRHKTTHHHVLGF-------CPPCHHVVTSSSSS  110

Query  493   NTWANYPTGF-PQIPMIHH-----------------PNLPPLMDSPAAAETSGGGRVLRG  618
              +      GF P  P+ HH                   LP L  SP        G V   
Sbjct  111   PSKNLSLQGFAPPHPLPHHLGVLNCTMEKNNTNPSLVTLPLLPCSPTLTTKPCAGEV---  167

Query  619   IDLNREAAESPEEFDFMPQLQP--------VITPHPVRLIGSTVFVGCILHSDPPAPPYT  774
             I+LN + +  PEE D + QLQ         VITP P+R IGS++ V CI   D    P  
Sbjct  168   INLNTKVS-VPEEKDLLQQLQKPVSNNIINVITPQPIRPIGSSISVVCI-SEDSTLSPLA  225

Query  775   TSLKTaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKT  954
              + K   +VE E E  +LP ++SD N+++R+ANSAYKE+VGQP C WL+ +      C+ 
Sbjct  226   QTPKKPNEVEQEVENEALPTVISDSNHRIRMANSAYKEMVGQPVCPWLESMGNLLQ-CRR  284

Query  955   ISGEVAIQFSNSVN-LPVSSNRFTCWVRMEW--SNNDGKKTTVRAFCDAVKLACHSKDYL  1125
             ISGEV +  S+S   +P SSN F+CWVR+EW   +N+ KK  + AFCD +KLAC S+DYL
Sbjct  285   ISGEVTLNLSDSSTVIPTSSNGFSCWVRIEWLSEHNNKKKNCINAFCDVMKLACESRDYL  344

Query  1126  FQWRFHT-SDNNSSKSAC  1176
             F WRFHT +   +S+S+C
Sbjct  345   FTWRFHTRTTREASQSSC  362



>ref|XP_004498989.1| PREDICTED: uncharacterized protein LOC101511029 [Cicer arietinum]
Length=380

 Score =   218 bits (556),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 148/389 (38%), Positives = 213/389 (55%), Gaps = 62/389 (16%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEAP--TSPSADNNALP-ENIRKSAFLRNVWP  333
             M++ ++PY   +++ AEI++RYRPIAPKPE    T PS  ++    + I++S +LRN+WP
Sbjct  1     MIKTLNPYPNPAKT-AEIMSRYRPIAPKPETSSITEPSNSSSNSLSQKIKQSPYLRNLWP  59

Query  334   HLQARPTRTRKRGRSAFALP-PLKRARSCFQGFapaaapppppYHQVLNSSAAANTWA--  504
              LQARPTRTRKRGR+  +LP  LKR ++    F+          HQ L+ ++++   +  
Sbjct  60    QLQARPTRTRKRGRAPLSLPSSLKRPKTHVLAFS----------HQPLHVTSSSKNLSLQ  109

Query  505   --------------NYPTG-----FPQIPMIHHPNLPPLMDSPAAAETSGGGRVLRG---  618
                           N+  G     F +    +   LP L  SP+    S    +      
Sbjct  110   GFAPPPSLPQLPLPNHRIGVLNCNFEKSNSTNLVTLPLLPCSPSQHNVSKFDIITNNNNP  169

Query  619   ---IDLNREAAESPEEFDFMPQLQP-------------VITPHPVRLIGSTVFVGCILHS  750
                IDLN  + E P+E D + QLQ              VI P P+R IGS + VGCI   
Sbjct  170   FEIIDLNNTSIEIPQERDLLQQLQKPACNNNNNNNVTNVIAPQPIRPIGSCISVGCINQD  229

Query  751   DPPAPPYTTSLKTaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLP  930
                      + K   ++E E E+  LP ++SD NN++R+ANSAYKE+VGQPEC WL  + 
Sbjct  230   STLPSAVKKTPKKPEELEQEVESEILPAVISDSNNRIRMANSAYKEMVGQPECSWLGSMI  289

Query  931   PFHSP----CKTISGEVAIQFSNSVNLPVSSNRFTCWVRMEWSNN-DGKKTTVRAFCDAV  1095
                +     CK ISGEV +   +S+N+P+ SN F+CWV++EW N+ + KK  V AFCD V
Sbjct  290   SNGNDGKVQCKRISGEVTLHLCDSLNIPICSNGFSCWVKIEWENHEEKKKMCVNAFCDVV  349

Query  1096  KLAC-HSKDYLFQWRFHTSD-NNSSKSAC  1176
             KL C  S+DY+F WRFHT +   +S+S+C
Sbjct  350   KLCCDQSRDYVFTWRFHTRNCREASESSC  378



>ref|XP_004141406.1| PREDICTED: uncharacterized protein LOC101210181 [Cucumis sativus]
 ref|XP_004163252.1| PREDICTED: uncharacterized protein LOC101226673 [Cucumis sativus]
Length=370

 Score =   216 bits (549),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 146/357 (41%), Positives = 197/357 (55%), Gaps = 36/357 (10%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADN--NALPENIRKSA---FLRNV  327
             M++ + P    +   AEI++RYRPIAPKPE+P  P++D+  N +P +   S+   FLRNV
Sbjct  1     MIKTLPPPFPSTDKTAEIMSRYRPIAPKPESPF-PTSDHSLNNIPHSSSSSSSSSFLRNV  59

Query  328   WPHLQARPTRTRKRGRSAFALP-PLKRARSCFQGFapaaapppppYHQVLNSSAAANTWA  504
             WP LQARPTRTRKR R     P  LKR R         +      +H   +S     +  
Sbjct  60    WPQLQARPTRTRKRSRPPPISPHSLKRTR------ITPSPNFSLHHHPFSSSLLPHLSLP  113

Query  505   NYPTGF----PQIPMIHHPNLPPLMDSPAAAETSGGGRVLRGIDLNREA---------AE  645
             +  +GF        ++  P LP + D             ++  D  +           +E
Sbjct  114   SINSGFRDSSSNSNLVTLPLLPSVSDETETTTPVSEINFIKSFDEEKGVEFSVDSSVVSE  173

Query  646   SPEEFDFMPQLQ------PVITPHPVRLIGSTVFVGCILHSDPPAPPYTTSL--KTaadv  801
              P+E D + QLQ       VITPHPVR +GS++ VGCI  +  P     T    K   +V
Sbjct  174   IPQEKDLLQQLQCPVSISNVITPHPVRPVGSSIRVGCINEAQNPVHSNNTPQLPKKPDEV  233

Query  802   eseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKT--ISGEVAI  975
             E E E+  LP ++SD NN+VR+ANSAYKE+VGQPEC WLD +       K   I GEV +
Sbjct  234   EKEVESEVLPAVISDSNNRVRMANSAYKEMVGQPECLWLDSMVTGDERLKGRRIGGEVML  293

Query  976   QFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHT  1146
               S++  +P SSN F+CWVR+EW N+DGKK +V AFCD +KL+C S+DYLF WRFHT
Sbjct  294   HLSDAAAVPHSSNGFSCWVRIEWGNSDGKKNSVTAFCDVIKLSCVSRDYLFTWRFHT  350



>ref|XP_002320025.1| hypothetical protein POPTR_0014s01560g [Populus trichocarpa]
 gb|EEE98340.1| hypothetical protein POPTR_0014s01560g [Populus trichocarpa]
Length=353

 Score =   213 bits (541),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 146/365 (40%), Positives = 199/365 (55%), Gaps = 43/365 (12%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHLQ  342
             M++ +SP S  +++ AEI++RYRPIAPKPE  T  S    ++P       FLR +WP + 
Sbjct  1     MIKTLSPCSNTAKT-AEIMSRYRPIAPKPEGSTDESP---SMP------PFLRTLWPQMH  50

Query  343   ARPTRTRKRGRSAFALPPLKRARSCFQGFapaaapppppYHQVLNSSAAANTWANYP---  513
             ARPTRTRKRGR+A +   +KR R+   G +  +       H  L   A   T    P   
Sbjct  51    ARPTRTRKRGRAAVSPLTIKRPRTHLLGLSSPSHATYSAKHLSLQGFAHGITQLPVPNLV  110

Query  514   -------------TGFPQIPMIHHPNLPPLMDSPAAAETSGGG-RVLRGIDLNREAAESP  651
                          +    +P++  P +P + +  AA E S       + IDLN   AE+ 
Sbjct  111   GINCGMENSVTVSSNLVTLPLLQSPTVPVVENQAAAPELSCQEPNRDKVIDLN-TVAETS  169

Query  652   EEFDFMPQLQP-----VITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKTaadveseae  816
             EE D + QLQ      VI P PVR + S++ V  I + DP   P     K   ++E E E
Sbjct  170   EERDPLQQLQEPSTSNVIAPQPVRPVCSSISVASI-NEDPSLIPPVKVPKKPEEIEEEVE  228

Query  817   avsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFH-----SPCKTISGEVAIQF  981
             +  LPI+++D NNKVRLANSAYKE+VGQPEC WL  +         S CK I GEV    
Sbjct  229   SEVLPIVITDSNNKVRLANSAYKEMVGQPECSWLGSMMTSDGRFAGSSCKRICGEVVFHL  288

Query  982   SNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFH--TSDN  1155
             S+ + +P SSN F+CWVR+EW N   K   +  FCD ++L+C SKDYLF+WRFH  TS +
Sbjct  289   SD-LRVPESSNGFSCWVRIEWCNK-VKSNVINTFCDVIRLSCESKDYLFRWRFHIRTSKD  346

Query  1156  NSSKS  1170
             + SK+
Sbjct  347   SLSKT  351



>gb|KGN55278.1| hypothetical protein Csa_4G643080 [Cucumis sativus]
Length=427

 Score =   214 bits (546),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 146/357 (41%), Positives = 197/357 (55%), Gaps = 36/357 (10%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADN--NALPENIRKSA---FLRNV  327
             M++ + P    +   AEI++RYRPIAPKPE+P  P++D+  N +P +   S+   FLRNV
Sbjct  58    MIKTLPPPFPSTDKTAEIMSRYRPIAPKPESPF-PTSDHSLNNIPHSSSSSSSSSFLRNV  116

Query  328   WPHLQARPTRTRKRGRSAFALP-PLKRARSCFQGFapaaapppppYHQVLNSSAAANTWA  504
             WP LQARPTRTRKR R     P  LKR R         +      +H   +S     +  
Sbjct  117   WPQLQARPTRTRKRSRPPPISPHSLKRTR------ITPSPNFSLHHHPFSSSLLPHLSLP  170

Query  505   NYPTGF----PQIPMIHHPNLPPLMDSPAAAETSGGGRVLRGIDLNREA---------AE  645
             +  +GF        ++  P LP + D             ++  D  +           +E
Sbjct  171   SINSGFRDSSSNSNLVTLPLLPSVSDETETTTPVSEINFIKSFDEEKGVEFSVDSSVVSE  230

Query  646   SPEEFDFMPQLQ------PVITPHPVRLIGSTVFVGCILHSDPPAPPYTTSL--KTaadv  801
              P+E D + QLQ       VITPHPVR +GS++ VGCI  +  P     T    K   +V
Sbjct  231   IPQEKDLLQQLQCPVSISNVITPHPVRPVGSSIRVGCINEAQNPVHSNNTPQLPKKPDEV  290

Query  802   eseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKT--ISGEVAI  975
             E E E+  LP ++SD NN+VR+ANSAYKE+VGQPEC WLD +       K   I GEV +
Sbjct  291   EKEVESEVLPAVISDSNNRVRMANSAYKEMVGQPECLWLDSMVTGDERLKGRRIGGEVML  350

Query  976   QFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHT  1146
               S++  +P SSN F+CWVR+EW N+DGKK +V AFCD +KL+C S+DYLF WRFHT
Sbjct  351   HLSDAAAVPHSSNGFSCWVRIEWGNSDGKKNSVTAFCDVIKLSCVSRDYLFTWRFHT  407



>gb|KFK28109.1| hypothetical protein AALP_AA8G473800 [Arabis alpina]
Length=334

 Score =   210 bits (534),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 143/340 (42%), Positives = 192/340 (56%), Gaps = 45/340 (13%)
 Frame = +1

Query  208   AEILARYRPIAPKPEAPTSPSADNNA-LPENIRKSAFLRNVWPHLQARPTRTRKRGRSAF  384
             AEIL++YRPIAP+P  P     D+++ +   I +S +LRN+WP LQARPTRTRKRGR   
Sbjct  21    AEILSKYRPIAPRPGTPRVNEDDSSSSMSHRINQSPYLRNLWPQLQARPTRTRKRGRGGM  80

Query  385   ALPP---LKRARSCFQGFapaaapppppYHQVLNSSAAANTWANYPTGFPQIPMIHHPNL  555
                    LKR +   Q              +VL +     ++  +    PQ+       L
Sbjct  81    GPSSHLSLKRHKPSTQ--------------RVL-APIKTLSFQAFTHRLPQVGSSALVTL  125

Query  556   PPLMDSPAAAETSGGGRVLRG---IDLNREAAESPEEFDFMPQLQP----------VITP  696
             P L  SP +++     +V +G   IDLN E AE  +E DF+ QLQ           VI P
Sbjct  126   PLLQCSPPSSKCMEPDQV-KGKCVIDLN-ETAEVIQERDFLKQLQGPITTTTTTSRVIAP  183

Query  697   HPVRLIGSTVFVGCILHSDPPAPPYTTSLKTaadveseaeavsLPILVSDVNNKVRLANS  876
              P+R + S + V CI     P+     S K+  +VE E E+  LP ++SD NNKVRL NS
Sbjct  184   QPIRPVCSRINVACI----NPSTQSQISKKSPEEVEEEVESDDLPAMISDSNNKVRLVNS  239

Query  877   AYKELVGQPECRWLDLLPPFHSPCKTISGEVAIQFSNSVNLPVSSNRFTCWVRMEWSNND  1056
              YKE++GQPEC WLD +       K I GEV I FS+   +PV+ N F+CWV++EW   D
Sbjct  240   KYKEMMGQPECSWLDSMVRG----KRICGEVMIHFSHH-KIPVN-NGFSCWVKIEW-GRD  292

Query  1057  GKKTTVRAFCDAVKLACHSKDYLFQWRFHTSDNNSSKSAC  1176
             GK+ +V AFCD ++LACHSKDYLF WRFHT+  +  +SAC
Sbjct  293   GKEESVHAFCDVMRLACHSKDYLFTWRFHTTTTDCRESAC  332



>gb|KDO81494.1| hypothetical protein CISIN_1g019820mg [Citrus sinensis]
Length=335

 Score =   207 bits (527),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 140/345 (41%), Positives = 195/345 (57%), Gaps = 54/345 (16%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSK-AEILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHL  339
             M++ +SP+S  + +K AEI++RYRPIAPKPEAP SP +++      IR+S +LRN+WP L
Sbjct  1     MIRTMSPFSAATTAKTAEIMSRYRPIAPKPEAPVSPMSES----AKIRQSPYLRNLWPQL  56

Query  340   QARPTRTRKRGRSAFALPPLKRARS-------------------CFQGFapaaapppppY  462
             QARPTRTRKRGR+A + P +KR+R+                     QGFA   A     +
Sbjct  57    QARPTRTRKRGRAAISPPTIKRSRTHLFGLSSPCHATSSPAKNPSLQGFAHPHAHGVAQF  116

Query  463   H------------QVLNSSAAANTWANYPTGFPQIP---MIHHPNLPPLMDSPAAAETSG  597
                           + N ++ A T        P +P   ++     P  ++     E+ G
Sbjct  117   TLPNHLATVPASCSLDNPASTATTITTNLVTLPLLPCTPVVSEQTTP--LELSNCVESFG  174

Query  598   GGRVLRGIDLNREAAESPEEFDFMPQLQP-------VITPHPVRLIGSTVFVGCILHSDP  756
                V   IDLN+  AE PEE D + QLQ        VI+P PVR +GS++ VGCI     
Sbjct  175   EVNV---IDLNK-VAEIPEEKDLLLQLQGPPSPTNNVISPRPVRPVGSSISVGCINEDSR  230

Query  757   PAPPYTTSLKTaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPF  936
               P      K   +VE E E+ +LP ++SD +N+VR+ANSA+KE+VGQPEC WLDL+   
Sbjct  231   LTPEAQVVTKKPEEVEEEVESEALPTVISDSHNRVRMANSAFKEMVGQPECSWLDLMVIN  290

Query  937   HSPCKTISGEVAIQFSNSVNLP-VSSNRFTCWVRMEWSNNDGKKT  1068
             +S CK I GEV + FS+S  +P  SSN F+CWVR+EW  +DG++T
Sbjct  291   NSSCKRICGEVMLNFSDSAGMPNNSSNGFSCWVRIEW-GSDGRRT  334



>ref|XP_006415756.1| hypothetical protein EUTSA_v10009308mg [Eutrema salsugineum]
 gb|ESQ34109.1| hypothetical protein EUTSA_v10009308mg [Eutrema salsugineum]
Length=371

 Score =   206 bits (524),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 140/357 (39%), Positives = 186/357 (52%), Gaps = 44/357 (12%)
 Frame = +1

Query  208   AEILARYRPIAPKPEAPTSPSADNN---ALPENIRKSAFLRNVWPHLQARPTRTRKRGRS  378
             AEIL++YRPIAPKP   +S   DN+   ++   I +S +LRN+WP LQARPTRTRKRGR 
Sbjct  23    AEILSKYRPIAPKPGTTSSQVNDNDTSSSMSHKISQSPYLRNLWPQLQARPTRTRKRGRG  82

Query  379   AFA-LPPLKRARSCFQGFapaaapppppYHQVLNSSAAANTWANYPTGFPQIPMIHHP--  549
                   PL   R      +   +         +       ++  +P G P +  + +   
Sbjct  83    GMGPTSPLALKRPKSSSPSATISSTTTTTTPRVFGPIKTLSFQAFPHGLPSLAQVGYTLE  142

Query  550   ----------NLPPLMDSP----AAAETSGGGRVLRGIDLNREAAESPEEFDFMPQLQP-  684
                        LP L  SP       E    G+V+  IDLN+  AE  +E DF+ QLQ  
Sbjct  143   NNGGGSSALVTLPLLQCSPPPPSKCMEPEVKGKVV--IDLNK-TAEVIQERDFLKQLQGP  199

Query  685   -------------VITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKTaadveseaeavs  825
                          VI P  +R + S + V CI     P+PPY  S K   +VE E E+  
Sbjct  200   TVTTTATDTNTSRVIAPQAIRPVCSRINVACINPLTNPSPPYQISKKLPQEVEEEVESDD  259

Query  826   LPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTISGEVAIQFSNSVNLPV  1005
             LP ++SD  N+VRL NSAYKE++GQPEC WLD +       K I GEV I    +  +P 
Sbjct  260   LPTIISDSKNRVRLVNSAYKEMMGQPECSWLDSM----VRGKRICGEVMIHLCET-KIP-  313

Query  1006  SSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHTSDNNSSKSAC  1176
              +N F+CWVR+EW   DGK+  V AFCD +KLAC SKDY+F WRFHT    + +S+C
Sbjct  314   ENNGFSCWVRIEW-GRDGKEEFVHAFCDVMKLACDSKDYVFTWRFHTRTRETCQSSC  369



>ref|XP_006304471.1| hypothetical protein CARUB_v10011167mg [Capsella rubella]
 gb|EOA37369.1| hypothetical protein CARUB_v10011167mg [Capsella rubella]
Length=362

 Score =   202 bits (515),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 140/370 (38%), Positives = 196/370 (53%), Gaps = 42/370 (11%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSAD-NNALPENIRKSAFLRNVWPHL  339
             M++ ++P+S  +   AEIL++YRPIAPKP  P     D ++++   I +S +LRN+WP L
Sbjct  1     MIKILNPHSTTTLKTAEILSKYRPIAPKPGTPRVNDDDPSSSMSHKISQSPYLRNLWPQL  60

Query  340   QARPTRTRKRGRSAFALPPLKRARSCFQGFapaaapppppYHQVLNSSAAANTWANYPTG  519
             QARPTRTRKRGR       L   R      +   +       +V+      +  A    G
Sbjct  61    QARPTRTRKRGRGGMGPSSLAMKRPKSSCVSSPTSSSTTTTQRVIGPIKTLSFQAFTHHG  120

Query  520   FPQIPMIHHP----------NLPPLMDSP------AAAETSGGGRVLRGIDLNREAAESP  651
              P +  + +            LP L  SP         E  G G     IDLN+  AE  
Sbjct  121   LPSLTQVGYALENGASSALVTLPLLQCSPPLPSKCMEPEIKGKGV----IDLNK-TAEVI  175

Query  652   EEFDFMPQLQP-----------VITPHPVRLIGSTVFVGCILHSDPPAP-PYTTSLKTaa  795
             +E DF+ QLQ            VI+P P+R + S + V  I     P+P P  TS K+ +
Sbjct  176   QEIDFLKQLQGPITTTTTTTSRVISPQPIRPLCSKINVAYINPLTNPSPLPNQTSKKSPS  235

Query  796   dveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTISGEVAI  975
             +VE E E+  LP +++D +N+VRL NSAYKE++GQPEC WLD +       + I GEV I
Sbjct  236   EVEEEVESDDLPSVITDSSNRVRLVNSAYKEMMGQPECSWLDSM----VRGRRICGEVMI  291

Query  976   QFSNS-VNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFH--T  1146
              F  S + +   +N F+CWVR+EW   DGK+  + AFCD +KLAC SKDY+F WRFH  T
Sbjct  292   HFCESKIPMMTENNGFSCWVRIEW-GRDGKEEYMHAFCDVMKLACESKDYVFTWRFHATT  350

Query  1147  SDNNSSKSAC  1176
                 + +S+C
Sbjct  351   DRREACQSSC  360



>ref|XP_010555762.1| PREDICTED: uncharacterized protein LOC104825172 [Tarenaya hassleriana]
Length=431

 Score =   202 bits (514),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 140/350 (40%), Positives = 192/350 (55%), Gaps = 40/350 (11%)
 Frame = +1

Query  208   AEILARYRPIAPKPEAPTSPSADNN---ALPENIRKSAFLRNVWPHLQARPTRTRKRGRS  378
             AEIL++YRPIAPKPE  TSPS +++   ++   I +S +LR++WP LQARPTRTRKRGR 
Sbjct  91    AEILSKYRPIAPKPE--TSPSNNDDPSSSMSHKINQSPYLRSLWPQLQARPTRTRKRGRG  148

Query  379   AFALPP-----LKRARSC----------FQGFapaaapppppYHQVLNSSAAANTWANYP  513
             +    P     LKR ++           F G    +    P   QV    A  N   +  
Sbjct  149   SMTSSPPTLLGLKRTKTTVTPTSQHVLGFPGVQTLSFQAIPGLAQV--GFALENVVGS--  204

Query  514   TGFPQIPMIHHPNLPPLMDSPAAAETSGGGRVLRGIDLNREAAESPEEFDFMPQLQP---  684
             +G   +P++      PL       E  G  +  R IDLN  +AES +E DF+ QLQ    
Sbjct  205   SGLVTLPLLQCSTTSPLSGETKCMELEGKEK--RVIDLNM-SAESLKERDFLGQLQGPSI  261

Query  685   ------VITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKTaadveseaeavsLPILVSD  846
                   VI PHP+R +GS + V CI + D  +P      KT+ +VE E E+  LP L++D
Sbjct  262   ATTTNRVIAPHPIRPVGSKISVSCI-NPDKNSPIRYQITKTSQEVEEEVESDDLPALITD  320

Query  847   VNNKVRLANSAYKELVGQPECRWLD-LLPPFHSPCKTISGEVAIQFSNSVNLPVSSNRFT  1023
              NN+VRL NSA+KE+VGQPEC W+D ++    +  K I GEV +   +    P S N F+
Sbjct  321   SNNRVRLVNSAFKEMVGQPECSWMDSMVNGKTNRGKRICGEVILCLCDP-RPPFSDNGFS  379

Query  1024  CWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHTSDNNSSKSA  1173
             CW R+EW  ++ KK  V   C   +L+C SK+Y+F WRFHT+   SS S 
Sbjct  380   CWARIEWGRDEDKK-LVDTLCHVARLSCMSKNYIFSWRFHTNTKGSSCSG  428



>ref|NP_001117365.1| uncharacterized protein [Arabidopsis thaliana]
 gb|ABF59135.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30835.1| uncharacterized protein AT1G27461 [Arabidopsis thaliana]
Length=354

 Score =   199 bits (507),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 140/365 (38%), Positives = 197/365 (54%), Gaps = 47/365 (13%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSK----AEILARYRPIAPKPEAPTSPSAD-NNALPENIRKSAFLRNV  327
             M++ ++P+S  S++     AEIL++YRPIAPKP  P     D ++++   I +S +LRN+
Sbjct  1     MIKILNPHSHHSQTTTLKTAEILSKYRPIAPKPGTPRVNDDDPSSSMSHKISQSPYLRNL  60

Query  328   WPHLQARPTRTRKRGRSAFALPPLKRARSCFQGFapaaapppppYHQVLNSSAAANTWAN  507
             WP LQARPTRTRKRGR       L   R   +    +++       +VL      +  A 
Sbjct  61    WPQLQARPTRTRKRGRGGMGPSSLAMKRP--KSSCGSSSTSTISTQRVLGPIKTLSFQAF  118

Query  508   YPTGFPQIPMIHHP----------NLPPLMDSPAAA-----ETSGGGRVLRGIDLNREAA  642
                  P +P + +            LP L  SP ++     E  G G     IDLN+  A
Sbjct  119   THHRLPNLPQVGYGFENGVSSTLVTLPLLQCSPPSSKCMEPEIKGKGV----IDLNK-TA  173

Query  643   ESPEEFDFMPQLQP------------VITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLK  786
             E  +E DF+ QLQ             VI+P P+R + S + V  I     P+P   TS K
Sbjct  174   EVIQERDFLTQLQGPITTTTTATTSRVISPQPIRPVCSKINVAYINPLTNPSPTSQTSKK  233

Query  787   TaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTISGE  966
             +  +VE + E+  LP +++D N++VRL NSAYKE++GQPEC WLD +       K I GE
Sbjct  234   SPREVEEDVESDDLPSVITDSNSRVRLVNSAYKEMMGQPECSWLDSM----VRGKRICGE  289

Query  967   VAIQFSNSVNLPV--SSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRF  1140
             V I F  S  +PV   +N F+CWVR++W   DGK+  + AFCD  KLAC SKDY+F WRF
Sbjct  290   VMINFCES-KIPVMTENNGFSCWVRIDW-GRDGKEEYMHAFCDVTKLACDSKDYVFTWRF  347

Query  1141  HTSDN  1155
             HT+ +
Sbjct  348   HTTTD  352



>gb|ABK28018.1| unknown [Arabidopsis thaliana]
Length=355

 Score =   199 bits (507),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 140/365 (38%), Positives = 197/365 (54%), Gaps = 47/365 (13%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSK----AEILARYRPIAPKPEAPTSPSAD-NNALPENIRKSAFLRNV  327
             M++ ++P+S  S++     AEIL++YRPIAPKP  P     D ++++   I +S +LRN+
Sbjct  1     MIKILNPHSHHSQTTTLKTAEILSKYRPIAPKPGTPRVNDDDPSSSMSHKISQSPYLRNL  60

Query  328   WPHLQARPTRTRKRGRSAFALPPLKRARSCFQGFapaaapppppYHQVLNSSAAANTWAN  507
             WP LQARPTRTRKRGR       L   R   +    +++       +VL      +  A 
Sbjct  61    WPQLQARPTRTRKRGRGGMGPSSLAMKRP--KSSCGSSSTSTISTQRVLGPIKTLSFQAF  118

Query  508   YPTGFPQIPMIHHP----------NLPPLMDSPAAA-----ETSGGGRVLRGIDLNREAA  642
                  P +P + +            LP L  SP ++     E  G G     IDLN+  A
Sbjct  119   THHRLPNLPQVGYGFENGVSSTLVTLPLLQCSPPSSKCMEPEIKGKGV----IDLNK-TA  173

Query  643   ESPEEFDFMPQLQP------------VITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLK  786
             E  +E DF+ QLQ             VI+P P+R + S + V  I     P+P   TS K
Sbjct  174   EVIQERDFLTQLQGPITTTTTATTSRVISPQPIRPVCSKINVAYINPLTNPSPTSQTSKK  233

Query  787   TaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTISGE  966
             +  +VE + E+  LP +++D N++VRL NSAYKE++GQPEC WLD +       K I GE
Sbjct  234   SPREVEEDVESDDLPSVITDSNSRVRLVNSAYKEMMGQPECSWLDSM----VRGKRICGE  289

Query  967   VAIQFSNSVNLPV--SSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRF  1140
             V I F  S  +PV   +N F+CWVR++W   DGK+  + AFCD  KLAC SKDY+F WRF
Sbjct  290   VMINFCES-KIPVMTENNGFSCWVRIDW-GRDGKEEYMHAFCDVTKLACDSKDYVFTWRF  347

Query  1141  HTSDN  1155
             HT+ +
Sbjct  348   HTTTD  352



>ref|XP_010687868.1| PREDICTED: serum response factor homolog B [Beta vulgaris subsp. 
vulgaris]
Length=367

 Score =   197 bits (502),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 149/386 (39%), Positives = 203/386 (53%), Gaps = 72/386 (19%)
 Frame = +1

Query  163   MMQAVS-PYSGGSRSKAEILARYRPIAPKPEAPTSPSA-----------DNNALPENIRK  306
             M+QA++ PYS  +    EI++RYRPIAPKPE P S S+           D   +PE  R+
Sbjct  1     MIQALNIPYSSKTD---EIMSRYRPIAPKPEFPASNSSTNNNANNNNNYDVPLVPEKFRQ  57

Query  307   SAFLRNVWPHLQARPTRTRKRG-RSAFALPPLKRARSCFQGFapaaapppppYHQVLNSS  483
             S +LRN+W HLQARPTRTRKRG RS+  + P   A +  +             + ++ +S
Sbjct  58    SPYLRNIWSHLQARPTRTRKRGGRSSSGISP-AAAAALLRKQQHHQHQQQEQTNNMVTAS  116

Query  484   AAANTWANYPTGFPQIPMIHHPNLP--------------PLMDSPAAAETSGGGRVLRGI  621
                    +    F ++ +  +                  PL+  P  +  +        +
Sbjct  117   PTFMGLCSPSQAFARLYIDPNNTTNNSNNSNNSNNVVELPLLSCPMLSHET--------V  168

Query  622   DLNREAAESP--EEFDFMPQLQP------------------VITPHPVRLIGSTVFVGCI  741
             DLN+ A E+   EE D + QLQ                   VI+P PVR +GS++ +   
Sbjct  169   DLNKVAVETTVLEERDLLLQLQVPSCSSGGRSGGSGGGNGNVISPRPVRPVGSSISIVGQ  228

Query  742   LHSDPPAPPYTTSLKTaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLD  921
             +  D  +      +K   +VE+ AEA  LP ++SD NNKVR+ NSAYKELVGQPEC WLD
Sbjct  229   ISEDYES---QVVVKAPEEVEAAAEAELLPSIISDRNNKVRMVNSAYKELVGQPECVWLD  285

Query  922   LLPPFHSPCKT--ISGEVAIQFSN-SVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDA  1092
                   S C    ISGEV +Q S  S  LPVSSN F+CWVR+EW  +DGKK ++ AFC+ 
Sbjct  286   ------SMCSGGRISGEVMLQLSKYSSGLPVSSNGFSCWVRIEW-ESDGKKISMNAFCEV  338

Query  1093  VKLACHSKDYLFQWRFHTSDNNSSKS  1170
              +LAC SKDYLF WRFHT + + S S
Sbjct  339   ARLACLSKDYLFSWRFHTREVSPSAS  364



>ref|XP_010061650.1| PREDICTED: uncharacterized protein LOC104449253 [Eucalyptus grandis]
 gb|KCW68638.1| hypothetical protein EUGRSUZ_F02242 [Eucalyptus grandis]
Length=378

 Score =   197 bits (502),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 141/369 (38%), Positives = 199/369 (54%), Gaps = 44/369 (12%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKA---EILARYRPIAPKPEAPTSPSADNNALPEN----IRKSAFLR  321
             M++ +SPYS    + A   EI++RYRPIAPKPE   S ++     P +    IR+S +LR
Sbjct  1     MIKTLSPYSTTPAATAKTAEIMSRYRPIAPKPETVPSAASSAAESPTSMSPKIRQSPYLR  60

Query  322   NVWPHLQARPTRTRKRGRSAFALPPLKRARSCFQGFapaaapppppYHQVLNSSAAANTW  501
             N+WP LQARPTRTRKRGR+A + P +KR ++        A  P P       S     + 
Sbjct  61    NLWPQLQARPTRTRKRGRTAISPPAIKRPKTAATAAGAPAGVPSPCALPPTKSL----SL  116

Query  502   ANYPTGFPQIPMIHHPNLPPLMDS------------------PAAAETSGGGRV----LR  615
               +  G P IP+      PP+  +                  P + E +    V      
Sbjct  117   QVFTHGLPHIPLAGLMESPPVALAGSAAAASSPRSLVTLPLLPCSPELNCMNTVRVEEAA  176

Query  616   GIDLNREAAES--PEEFDFMPQLQP-------VITPHPVRLIGSTVFVGCILHSDPPAPP  768
              +DLN  +A    P+E D + QLQ        VI+P PVR +GS + VGCI     P  P
Sbjct  177   AVDLNVNSAVETIPKEKDLLLQLQGPASGSGNVISPRPVRPVGSRISVGCISEDRRPDSP  236

Query  769   YTTSLKTaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPC  948
                + +   +VE E E+ +LP ++SD  N+VR+ NSAYKE+VGQPEC WL+ +    +  
Sbjct  237   APRARQKPEEVEEEVESEALPAVISDSKNRVRVVNSAYKEMVGQPECPWLEAMARLGAAG  296

Query  949   KTISG-EVAIQFSNS-VNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDY  1122
                 G EVAI+  +    +PV +  F+CW R+EW  + G+K++V+AFCDA++L C SKDY
Sbjct  297   GRRIGGEVAIRMCDEEAKVPVWAEGFSCWARIEWVGSGGEKSSVKAFCDAIRLRCDSKDY  356

Query  1123  LFQWRFHTS  1149
             LF WRFHT+
Sbjct  357   LFTWRFHTN  365



>ref|XP_010999888.1| PREDICTED: uncharacterized protein LOC105107597 [Populus euphratica]
Length=339

 Score =   194 bits (493),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 135/347 (39%), Positives = 186/347 (54%), Gaps = 39/347 (11%)
 Frame = +1

Query  217   LARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHLQARPTRTRKRGRSAFALPP  396
             ++RYRPIAPKPE P S   ++++ P       +LR +W  +QARPTRTRKRGR+A +   
Sbjct  1     MSRYRPIAPKPEGPVSSMDESSSTP------PYLRTLWTQMQARPTRTRKRGRAAVSPLA  54

Query  397   LKRARSCFQGFapaaapppppYHQVLNSSAAANTWANYP----------------TGFPQ  528
             +KR R+   G + A        +  L   A   T    P                +    
Sbjct  55    IKRPRTHSLGLSSATHATYSAKNLSLQGFAHGITQLPVPNLVGINCGMENSVTVSSNLVT  114

Query  529   IPMIHHPNLPPLMDSPAAAETSGGG-RVLRGIDLNREAAESPEEFDFMPQLQP-----VI  690
             +P++  P +  + +  AA E S       + ID+N   AE+ EE D + QLQ      VI
Sbjct  115   LPLLLSPTVSVVENQAAAPELSCQEPNRNKVIDVN-TVAETSEERDPLQQLQEPSTSNVI  173

Query  691   TPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKTaadveseaeavsLPILVSDVNNKVRLA  870
             TP P R + S + V  I + DP   P     K   ++E E E+  LPI+++D NNKVRLA
Sbjct  174   TPQPFRPVCSNISVASI-NEDPSFIPPVKVPKKLEEIEEEVESEVLPIVITDSNNKVRLA  232

Query  871   NSAYKELVGQPECRWLDLLPPFH-----SPCKTISGEVAIQFSNSVNLPVSSNRFTCWVR  1035
             NSAYKE+VGQPEC WL  +         S  K I GEV +  S+ + +P SS  F+CWVR
Sbjct  233   NSAYKEMVGQPECSWLGSMMTSDGRFAGSSSKRICGEVVLHLSD-LRVPESSTGFSCWVR  291

Query  1036  MEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFH--TSDNNSSKS  1170
             +EWSN   K   +  FCD ++L+C SKDYLF+WRFH  TS ++ SK+
Sbjct  292   IEWSNK-VKSNVINTFCDVIRLSCESKDYLFRWRFHIRTSKDSLSKT  337



>ref|XP_010556467.1| PREDICTED: uncharacterized protein LOC104825782 [Tarenaya hassleriana]
Length=376

 Score =   193 bits (491),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 142/371 (38%), Positives = 193/371 (52%), Gaps = 64/371 (17%)
 Frame = +1

Query  208   AEILARYRPIAPKPEAPTSPSADNN-------ALPENIRKSAFLRNVWPHLQARPTRTRK  366
             AEIL++YRPIAPKPE P  P  D++       ++ + I +S +LR++WP LQARPTRTRK
Sbjct  21    AEILSKYRPIAPKPETP--PLNDDDPSSSSSSSMSQKINQSPYLRSIWPQLQARPTRTRK  78

Query  367   RGRSAFALPP------LKRARSC-----------------FQGFapaaapppppYHQVLN  477
             RGRS+ A PP      LKR ++                  FQ F P           + N
Sbjct  79    RGRSSMAPPPHRNLLGLKRTKTTATSQHVLGFSGGVQMLSFQAFPPLVPGLSQVGFALEN  138

Query  478   SSAAANTWANYPTGFPQIPMIHHPNLPPLMDSPAAAETSG---GGRVLRGIDLNREAAES  648
                ++        G   +P++   + P    SP + ET      G   R IDLN+ +AE 
Sbjct  139   VVGSS--------GLVTLPLLQCSSSP----SPVSTETQFMEPEGEERRVIDLNK-SAEL  185

Query  649   PEEFDFMPQLQ---------PVITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKTaadv  801
              EE DF+ QLQ          VI P P+R +GS + V CI + +  +     S KTA +V
Sbjct  186   LEERDFLGQLQRPSMAEPTNKVIAPQPIRPVGSKIIVSCI-NPNKKSADGDQSSKTAQEV  244

Query  802   eseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLP--PFHSPCKTISGEVAI  975
             E E E+   P L++D  N+VRL NSAYKE+VGQPEC W+D +      +  K I GEV +
Sbjct  245   EEEVESDDSPALITDYENRVRLVNSAYKEMVGQPECSWMDSMVNNGRATRGKRICGEVML  304

Query  976   QFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTT---VRAFCDAVKLACHSKDYLFQWRFHT  1146
              FS+   +PVS N F+CW R+EW  +D  K     V  FCD V+L C S  Y+  WRF  
Sbjct  305   CFSDR-KVPVSDNGFSCWTRIEWGRDDDMKKDKKLVDGFCDVVRLNCRSNGYVLSWRFRP  363

Query  1147  SDNNSSKSACF  1179
             +   +S+S C 
Sbjct  364   NTKETSQSGCV  374



>ref|XP_010478086.1| PREDICTED: uncharacterized protein LOC104757070 [Camelina sativa]
Length=372

 Score =   193 bits (490),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 137/362 (38%), Positives = 189/362 (52%), Gaps = 51/362 (14%)
 Frame = +1

Query  208   AEILARYRPIAPKPEAPTSPSAD-NNALPENIRKSAFLRNVWPHLQARPTRTRKRGRSAF  384
             AEIL++YRPIAPKP  P     D ++++   I +S +LRN+WP LQARPTRTRKRGR   
Sbjct  21    AEILSKYRPIAPKPGTPRVNDDDPSSSMSHKISQSPYLRNLWPQLQARPTRTRKRGRGGM  80

Query  385   ALPPLKRAR---SCFQ-------------------GFapaaapppppYHQVLNSSAAANT  498
                 L   R   SC                     G     +     +H + N +     
Sbjct  81    GPSSLAMKRPKSSCVSSPTSSTTTTTTTTTTQRVIGPIKTLSFQAFTHHGLPNLTQVGYA  140

Query  499   WANY-PTGFPQIPMIHHPNLPPLMDSPAAAETSGGGRVLRGIDLNREAAESPEEFDFMPQ  675
               N   +    +P++   + PPL       E  G G     IDLN+  AE  +E DF+ Q
Sbjct  141   LENGGSSALVTLPLLQC-SPPPLPSKCMEPEIKGKGV----IDLNK-TAEVIQEIDFLKQ  194

Query  676   LQP-----------VITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKTaadveseaeav  822
             LQ            VI+P P+R + S + V  I     P+P   T+ K+ ++VE E E+ 
Sbjct  195   LQGPIVTTTITTSRVISPQPIRPVCSKINVAYINPLTNPSPLPQTNKKSQSEVEEEVESD  254

Query  823   sLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTISGEVAIQFSNSVNLP  1002
              LP +++D +N+VR+ NSAYKE++GQPEC WLD +       K I GEV I F  S  +P
Sbjct  255   ELPSVITDSSNRVRVVNSAYKEMMGQPECSWLDSM----VRGKRICGEVMIHFCES-KIP  309

Query  1003  VSS--NRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFH--TSDNNSSKS  1170
             V++  N F+CWVR+EW   +GK+  + AFCD  KLAC SKDY+F WRFH  T    + +S
Sbjct  310   VTTENNGFSCWVRIEW-EREGKEKYMHAFCDVTKLACESKDYVFTWRFHATTDRRGTCQS  368

Query  1171  AC  1176
             +C
Sbjct  369   SC  370



>ref|XP_010274397.1| PREDICTED: uncharacterized protein LOC104609720 [Nelumbo nucifera]
Length=388

 Score =   191 bits (484),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 142/383 (37%), Positives = 198/383 (52%), Gaps = 65/383 (17%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHLQ  342
             +M +++ YS  S++  EI++RYRPIAPKP  P  P  D             L+N+ P L 
Sbjct  22    LMNSLNIYSSSSKTD-EIMSRYRPIAPKPHIPIHPLLDG---------PTTLKNLSPRLP  71

Query  343   ARPTRTRKRGRSAFALPPLKRARSCFQGFapaaapppppYHQVLNSS--AAANTWANYPT  516
              RP+R RKR R+  +   LKRA    +GF+          + +L  S  + A+ + ++PT
Sbjct  72    TRPSRARKRNRTGISPATLKRAGMHLRGFSSPCHTLSLAKNALLGLSLQSLAHGFLSFPT  131

Query  517   GFPQIPM-----------IHHPNLP---------------PLMDSPAAAETSGGGRVLRG  618
               P I +            H   L                P MD      +    ++L  
Sbjct  132   STPSIGIGASLEEATAKASHLATLTFLSRPCSVPVAAKSTPEMDGINLCSSQTEEKIL--  189

Query  619   IDLNREAAESPEEFDFM---------------PQLQPVITPHPVRLIGSTVFVGCILHSD  753
              DLN  + + PEE + +               P    VITP PVR IGS++ VG I  S+
Sbjct  190   -DLN-TSIDIPEERNLLHEPPPEDPLQKLQEPPNCPSVITPQPVRPIGSSISVGFI--SE  245

Query  754   PPAPPYTT-SLKTaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLP  930
              P+P     + K   +VE E E+ +LP +VSD NN+VRLANSAYKE+VGQPEC WLD   
Sbjct  246   YPSPSCAMRTTKRPEEVEEEVESEALPAIVSDSNNRVRLANSAYKEMVGQPECPWLDATY  305

Query  931   PFHS---PCKTISGEVAIQFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKL  1101
                S   PCK I GEV +    S N+P+ SN F+C VR+EW  N GKK+++ A CD ++L
Sbjct  306   DGASRGRPCKRIGGEVMLDIPGS-NVPIYSNGFSCRVRIEWGTN-GKKSSITAPCDVIRL  363

Query  1102  ACHSKDYLFQWRFHTSDNNSSKS  1170
             +C+SK+YLF WRFHTS+ +   S
Sbjct  364   SCNSKNYLFTWRFHTSETSEGSS  386



>ref|XP_010460506.1| PREDICTED: uncharacterized protein LOC104741358 [Camelina sativa]
Length=368

 Score =   190 bits (482),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 138/357 (39%), Positives = 187/357 (52%), Gaps = 45/357 (13%)
 Frame = +1

Query  208   AEILARYRPIAPKPEAPTSPSAD-NNALPENIRKSAFLRNVWPHLQARPTRTRKRGRSAF  384
             AEIL++YRPIAPKP  P     D ++ +   I +S +LRN+WP LQA+PTRTRKRGR   
Sbjct  21    AEILSKYRPIAPKPGTPRVNDDDPSSYMSHKISQSPYLRNLWPQLQAQPTRTRKRGRGGM  80

Query  385   ALPPL--KRARSCFQGFapaaapppppYHQVLNSSAAANTWANYPTGFPQIPMIHH----  546
                 L  KR +S       ++        +V+      +  A    G P +  + +    
Sbjct  81    GPSSLAMKRPKSSCVSSPTSSTTTTTTTQRVIGPIKTLSFQAFTHHGLPNLTQVGYALEN  140

Query  547   ---------PNL---PPLMDSPAAAETSGGGRVLRGIDLNREAAESPEEFDFMPQLQP--  684
                      P L   PPL       E  G G     IDLN   AE  +E DF+ QLQ   
Sbjct  141   GGSSALVTLPLLQCSPPLPSKCMEPEIKGKGV----IDLN-NTAEVVQEIDFLKQLQGPI  195

Query  685   ---------VITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKTaadveseaeavsLPIL  837
                      VI+P P+R + S + V  I     P+P   T+ KT ++VE E E+  LP +
Sbjct  196   TTTTITTSGVISPQPIRPVCSKINVAYINPLTNPSPLPQTNKKTPSEVEEEVESDELPSV  255

Query  838   VSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTISGEVAIQFSNSVNLPV--SS  1011
             ++D +N+VR+ NSAYKE++GQPEC WLD +       K I GEV I F  S  +PV   +
Sbjct  256   ITDSSNRVRVVNSAYKEMMGQPECSWLDSM----VRGKRICGEVMIHFCES-KIPVMNEN  310

Query  1012  NRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFH--TSDNNSSKSAC  1176
             N F+CWVR+EW   +GK+  + AFCD  KLAC SKDY+F WRFH  T    + +S+C
Sbjct  311   NGFSCWVRIEWE-REGKEEYMHAFCDVTKLACDSKDYVFTWRFHPTTDRRETCRSSC  366



>ref|XP_009109800.1| PREDICTED: uncharacterized protein LOC103835392 [Brassica rapa]
Length=408

 Score =   189 bits (480),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 135/361 (37%), Positives = 184/361 (51%), Gaps = 67/361 (19%)
 Frame = +1

Query  208   AEILARYRPIAPKPEAPTSPSADNNA-----LPENIRKSAFLRNVWPHLQARPTRTRKRG  372
             AEIL++YRPIAP+P   T+   DN +     +   I +S +LR++WP LQARPTRTRKRG
Sbjct  69    AEILSKYRPIAPRPG--TNQLNDNESSSSSYMSHKISQSPYLRHLWPQLQARPTRTRKRG  126

Query  373   RSAF---ALPPLKRARS-------------------CFQGFapaaapppppYHQVLNSSA  486
             R      +   LKR +S                    FQ F+          H  L +  
Sbjct  127   RGGMGPTSHLSLKRPKSLATSAKTPTQRVFRPIKTLAFQAFS----------HAGLPNLT  176

Query  487   AANTWANYPTGFPQIPMIHHPNLPPLMDSPAAAETSGGGRVLRGIDLNREAAESPEEFDF  666
                 +A    G P +  +     PPL       E    G     IDLN+ + E+ +E DF
Sbjct  177   TQVGYALENGGSPALVTLPLLQCPPLSSKCMEPEIKVKGL----IDLNK-SLETIQERDF  231

Query  667   MPQLQP--------------VITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKTaadve  804
             + QLQ               VITP P+R + S + V CI   +P + P   S K+  +VE
Sbjct  232   LTQLQGPITTTTKTAAAASRVITPQPIRPVCSRINVACI---NPLSNPSQISKKSPQEVE  288

Query  805   seaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTISGEVAIQFS  984
              E E+  LP ++SD NNKV+L NSAYKE++GQPEC WLD +      C    GEV IQF 
Sbjct  289   EEVESDVLPAIISDSNNKVKLVNSAYKEMMGQPECSWLDSMVKVKRMC----GEVVIQFC  344

Query  985   NSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHTSDNNSS  1164
              S  +  ++N ++CWV++EW   DGK+  V AFCD +K  C SKDY+F WRFH +   + 
Sbjct  345   ES-KISENNNGYSCWVKIEW-GRDGKEELVHAFCDVMKRECDSKDYVFTWRFHITAKETC  402

Query  1165  K  1167
             +
Sbjct  403   Q  403



>emb|CDX90090.1| BnaA08g18940D [Brassica napus]
Length=363

 Score =   187 bits (476),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 137/356 (38%), Positives = 187/356 (53%), Gaps = 69/356 (19%)
 Frame = +1

Query  208   AEILARYRPIAPKPEAPTSPSADNNA------LPENIRKSAFLRNVWPHLQARPTRTRKR  369
             AEIL++YRPIAP+P   T+   DN++      +   I +S +LR++WP LQARPTRTRKR
Sbjct  24    AEILSKYRPIAPRPG--TTQVNDNDSSSSSSYMSHKISQSPYLRHLWPQLQARPTRTRKR  81

Query  370   GRSAFALPP---LKRARS-------------------CFQGFapaaapppppYHQVLNSS  483
             GR          LKR +S                    FQ F+          H  L + 
Sbjct  82    GRGGMGPTSHLSLKRPKSLATSTKTPTQRVFGPIKTLAFQAFS----------HAGLPNL  131

Query  484   AAANTWANYPTGFPQIPMIHHPNLPPLMDSPAAAETSGGGRVLRG-IDLNREAAESPEEF  660
                  +A    G P +       LP L  SP +++        RG IDLN+ + E+ +E 
Sbjct  132   TTQVGYALENGGSPALV-----TLPLLQCSPLSSKCMEPEIKERGLIDLNK-SVETIQER  185

Query  661   DFMPQLQP------------VITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKTa-adv  801
             DF+ QLQ             VITP P+R + S + V CI   +P + P   S K++  +V
Sbjct  186   DFLTQLQGPITTTTAAEASRVITPQPIRPVCSRINVACI---NPLSNPSQISKKSSPQEV  242

Query  802   eseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTISGEVAIQF  981
             E E E+  LP ++SD NNKV+L NSAYKE++GQPEC WLD +      C    GEV IQF
Sbjct  243   EEEVESDVLPAIISDSNNKVKLVNSAYKEMMGQPECSWLDSMVKVKRMC----GEVVIQF  298

Query  982   SNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHTS  1149
               S  +  ++N ++CWV++EW   DGK+  V AFCD +K  C SKDY+F WRFH +
Sbjct  299   CES-KISENNNGYSCWVKIEW-GRDGKEELVHAFCDVMKRECDSKDYVFTWRFHIT  352



>emb|CAN72846.1| hypothetical protein VITISV_013936 [Vitis vinifera]
Length=303

 Score =   184 bits (467),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 125/341 (37%), Positives = 178/341 (52%), Gaps = 58/341 (17%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHLQ  342
             M++ ++PY+  +++ AEI++RYRPIAPKPE P +P  +  ++ + +R+S +LRN+WP LQ
Sbjct  1     MIRTLNPYNSTAKT-AEIMSRYRPIAPKPEPPVNPMFERPSMSQKMRESPYLRNLWPQLQ  59

Query  343   ARPTRTRKRGRSAFALPPLKRARSCFQGFapaaapppp-----pYHQVLNSSAAANTWAN  507
             ARPTR+RKRGR  F+   LKR R+   GF     P         + + ++++A       
Sbjct  60    ARPTRSRKRGRPGFSPAALKRPRTHLVGFLFQTRPQASPRLNGGFXRAISTTADGLMTLP  119

Query  508   YPTGFPQIPMIHHPNLPPLMDSPAAAETSGGGRVLRGIDLNREAAESPEEFDFMPQLQ--  681
                  P    +   +   L           GG V   ++ +   A  PEE D + QLQ  
Sbjct  120   LLPCPPPQLPVVPNDFNCL--------NPCGGNVXFDLNTSVVXARIPEEKDLLQQLQRA  171

Query  682   -----PVITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKTaadveseaeavsLPILVSD  846
                   VI+P PVR IGS++ V C+     P P     LK   +VE E E+ +LP ++SD
Sbjct  172   PANTTNVISPQPVRPIGSSISVRCMRDDLSPIPEVQI-LKKPEEVEEEMESETLPAVISD  230

Query  847   VNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTISGEVAIQFSNSVNLPVSSNRFTC  1026
              NNK+R+ANSAYKE+V                                   PV SN F+C
Sbjct  231   SNNKIRMANSAYKEMV-----------------------------------PVXSNGFSC  255

Query  1027  WVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHTS  1149
             W  +EW  + G K++V AFCDA +LAC SKDYLF WRFHT+
Sbjct  256   WASIEWG-SAGNKSSVNAFCDATRLACESKDYLFTWRFHTN  295



>ref|XP_010274490.1| PREDICTED: uncharacterized protein LOC104609803 [Nelumbo nucifera]
Length=374

 Score =   186 bits (472),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 143/383 (37%), Positives = 199/383 (52%), Gaps = 67/383 (17%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHLQ  342
             +M +++ YS  S++  EI++RYRPIAPKP+ P  P  ++   P+N            HL+
Sbjct  6     IMNSLNIYSSSSKTD-EIMSRYRPIAPKPQIPMHPILESPTAPKNFSS---------HLR  55

Query  343   ARPTRTRKRGRSAFALPPLKRARSCFQGFapaaapppppYHQVLNSS--AAANTWANYPT  516
             ARPT +RKR R+  +    KR R+  +GF+          + +L  S    A+ +  +P 
Sbjct  56    ARPTVSRKRSRTGISPATNKRTRAHLRGFSSLYHTASLAKNTLLGLSLQGFAHGFLRFPI  115

Query  517   ---GFPQIPMIHHPN-----------LP------------PLMDSPAAAETSGGGRVLRG  618
                GF   P +  P            LP            P MDS     +    ++L  
Sbjct  116   PTPGFGPSPSMEEPTAKPSNPVTLPLLPCPSPVPVAAQSVPEMDSTNPYCSQNEEKLL--  173

Query  619   IDLNREAAESPEEFDFMPQLQP-----------------VITPHPVRLIGSTVFVGCILH  747
              DLN    E PEE D + +LQ                  VITP PVR IGS++ V  +  
Sbjct  174   -DLNSRI-EIPEEKDLLQKLQEPPNDLLRRMQEPPSCRSVITPQPVRPIGSSISV--VFI  229

Query  748   SDPPAPPYTT-SLKTaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDL  924
             S+ P P +   + K   +VE E E+ +LP +VSD N+KVRLANSAYKE+VGQPEC WLD 
Sbjct  230   SENPTPTFNMHTSKRPEEVEEEVESEALPAVVSDSNHKVRLANSAYKEMVGQPECPWLDA  289

Query  925   LPPFH---SPCKTISGEVAIQFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAV  1095
                     S CK ISGEV +     + +PVSSN F+C V +EW +N GKK ++ A CD +
Sbjct  290   TYDGRLRGSACKRISGEVMLDIPG-LKVPVSSNGFSCRVTIEWGSN-GKKCSINAPCDVI  347

Query  1096  KLACHSKDYLFQWRFHTSDNNSS  1164
             +L+C SKDYLF W+FHTS+ + S
Sbjct  348   RLSCESKDYLFTWKFHTSEASKS  370



>ref|XP_009113761.1| PREDICTED: uncharacterized protein LOC103839036 [Brassica rapa]
Length=357

 Score =   184 bits (468),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 142/372 (38%), Positives = 196/372 (53%), Gaps = 49/372 (13%)
 Frame = +1

Query  163   MMQAVSPYSGGSR-----SKAEILARYRPIAPKPEAPTSPSADNN-----ALPENIRKSA  312
             M++ +SP++  S        AEIL++YRPIAPKP   T+P  ++N     ++   I +S 
Sbjct  1     MIKILSPHNSHSTTTTTLKTAEILSKYRPIAPKPG--TTPQVNDNDSSSSSMSHKISQSP  58

Query  313   FLRNVWPHLQARPTRTRKRGRSAFA-LPPLKRARSCFQGFapaaapppppYHQVLNSSAA  489
             +LRN+ P LQARPTRTRKRGR       PL   R      + +A+       +V      
Sbjct  59    YLRNLRPQLQARPTRTRKRGRGGMGPTSPLSLKR---HKPSSSASTTTTTPQRVFGPIKT  115

Query  490   ANTWANYPTGFPQIPMIHHP----------NLPPLMDSPAAAETSG-GGRVLRGIDLNRE  636
              +  A    G P +  + +            LP L  SP  ++      +V   IDLN+ 
Sbjct  116   LSFQAFSHAGIPNLAQVGYALENGGSPALVTLPLLQCSPPPSKCMEPEIKVKEAIDLNK-  174

Query  637   AAESPEEFDFMPQLQP---------VITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKT  789
              AE  +E DF+ QLQ          VI P  +R + S + V CI   +P   P     K+
Sbjct  175   TAEVIQERDFLKQLQEPITTTTTSKVIAPQAIRPVCSRINVACI---NPLTNPSQIIKKS  231

Query  790   aadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTISGEV  969
               DVE E E+  LP ++SD NN+VRL NSAYKE++GQPEC WLD +       K I GEV
Sbjct  232   PQDVEEEFESDDLPAIISDANNRVRLVNSAYKEMMGQPECSWLDSM----VRGKRICGEV  287

Query  970   AIQFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHTS  1149
              I+   +  +P  +N F+CWVR+EW    GK+  V AFCD +KL C SKDY+F WRFHT+
Sbjct  288   MIRCCEA-KIP-ENNGFSCWVRIEWGRG-GKEEFVHAFCDVMKLECDSKDYVFTWRFHTT  344

Query  1150  --DNNSSKSACF  1179
               +N S+K +C 
Sbjct  345   TRENLSTKLSCL  356



>emb|CDY27618.1| BnaA09g27890D [Brassica napus]
Length=1147

 Score =   191 bits (486),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 143/369 (39%), Positives = 193/369 (52%), Gaps = 60/369 (16%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSK-----AEILARYRPIAPKPEAPTSPSADNN-----ALPENIRKSA  312
             M++ +SP++  S +      AEIL++YRPIAPKP   T+P  ++N     ++   I +S 
Sbjct  808   MIKILSPHNSHSTTTTTLKTAEILSKYRPIAPKP--GTTPQVNDNDSSSSSMSHKISQSP  865

Query  313   FLRNVWPHLQARPTRTRKRGRSAFA-LPPLKRARSCFQGFapaaapppppYHQVLNSSAA  489
             +LRN+WP LQARPTRTRKRGR       PL   R                 H+  +S++ 
Sbjct  866   YLRNLWPQLQARPTRTRKRGRGGMGPTSPLSLKR-----------------HKPSSSAST  908

Query  490   ANTWANY---PTGFPQIPMIHHPNLPPLMDSPAAAETSGG-----GRVLRGIDLNREAAE  645
               T       P          H  +P L     A E  G       +V   IDLN+  AE
Sbjct  909   TTTTPQRVFGPIKTLSFQAFSHAGIPNLAQVGYALENGGSPALPEIKVKEAIDLNK-TAE  967

Query  646   SPEEFDFMPQLQP---------VITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKTaad  798
               +E DF+ QLQ          VI P  +R + S + V CI   +P   P     K+  D
Sbjct  968   VIQERDFLKQLQEPITTTTTSKVIAPQAIRPVCSRINVACI---NPLTNPSQIIKKSPQD  1024

Query  799   veseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTISGEVAIQ  978
             VE E E+  LP ++SD NN+VRL NSAYKE++GQPEC WLD +       K I GEV I+
Sbjct  1025  VEEEFESDDLPAIISDANNRVRLVNSAYKEMMGQPECSWLDSM----VRGKRICGEVMIR  1080

Query  979   FSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHTS--D  1152
                +  +P  +N F+CWVR+EW    GK+  V AFCD +KL C SKDY+F WRFHT+  +
Sbjct  1081  CCEA-KIP-ENNGFSCWVRIEWGRG-GKEEFVHAFCDVMKLECDSKDYVFTWRFHTTTRE  1137

Query  1153  NNSSKSACF  1179
             N S+K +C 
Sbjct  1138  NLSTKLSCL  1146



>emb|CDY56190.1| BnaC05g51090D [Brassica napus]
Length=1152

 Score =   187 bits (476),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 146/376 (39%), Positives = 198/376 (53%), Gaps = 60/376 (16%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSK-----AEILARYRPIAPKPEAPTSPSADNN-----ALPENIRKSA  312
             M++ +SP++  S +      AEIL++YRPIAPKP   TS   + N     ++   I +S 
Sbjct  799   MIKILSPHNSHSTTTTTLKTAEILSKYRPIAPKP--GTSQVINENDSSSSSMSHKISQSP  856

Query  313   FLRNVWPHLQARPTRTRKRGRSAFALPP---LKRARSCFQGFapaaapppppYHQVLNSS  483
             +LRN+WP LQARPTRTRKRGR          LKR +      +     P   +  +   S
Sbjct  857   YLRNLWPQLQARPTRTRKRGRGGMGPTSPLSLKRHKPSSSSASTTTTTPQRVFGPIKTLS  916

Query  484   AAANTWANYPTGFPQIPMIHHP----------NLPPLMDSPAAA---ETSGGGRVLRGID  624
               A + A    G P +  + +            LP L  SP+     E  G       ID
Sbjct  917   FQAFSHA----GIPNLAKVGYALENGGSPALVTLPLLQCSPSKCMEPEIKGV------ID  966

Query  625   LNREAAESPEEFDFMPQLQP---------VITPHPVRLIGSTVFVGCILHSDPPAPPYTT  777
             LN+  AE  +E DF+ QLQ          VI P  +R + S + V CI   +P   P  T
Sbjct  967   LNK-TAEVIQERDFLKQLQEPIITTTTSRVIAPQAIRPVCSRINVACI---NPLTNPSRT  1022

Query  778   SLKTaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTI  957
               K+  DVE E E+  +P ++SD NN+VRL NSAYKE++GQPEC WLD +       K I
Sbjct  1023  IKKSPQDVEEEFESDDVPAIISDSNNRVRLVNSAYKEMMGQPECLWLDSM----VRGKRI  1078

Query  958   SGEVAIQFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWR  1137
              GEV I+   +  +P  +N F+CWVR+EW   DGK+  V AFCD +KL C SKDY+F WR
Sbjct  1079  CGEVMIRCCEA-KIP-ENNGFSCWVRIEW-GRDGKEEFVHAFCDVMKLECDSKDYVFTWR  1135

Query  1138  FHTS--DNNSSKSACF  1179
             FHT+  +N S+K +C 
Sbjct  1136  FHTTTRENLSTKLSCL  1151



>ref|XP_010942767.1| PREDICTED: uncharacterized protein LOC105060671 [Elaeis guineensis]
Length=329

 Score =   177 bits (450),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 130/336 (39%), Positives = 175/336 (52%), Gaps = 43/336 (13%)
 Frame = +1

Query  211   EILARYRPIAPKPEAP---TSPSADNNALPENIRKSAFLRNVWPHLQARPTRTRKRGRSA  381
             EI+AR+RPIAPKP  P     PS  ++  P     +A L     HL+ARP R RKRGRS 
Sbjct  15    EIMARFRPIAPKPALPPLSDGPSDHHSPSPSFASATAAL-----HLRARPCRARKRGRST  69

Query  382   FALPPLKRARSCFQGFapaaapppppYHQVLNSSAAANTWANYPTGFPQIPMIHHPNLPP  561
              A  P KR R+ F             + ++L S+  A        G P +P    P  PP
Sbjct  70    LASLPSKRPRTPF-------------FPRLLPSTTPAQL--GLARGLPLLPTFSTPEKPP  114

Query  562   LMDSPAAAETSGGGRVLRGIDLNREAAES------PEEFDFMPQLQ--PVITPHPVRLIG  717
             +  S     T          D++R+          P E D + +LQ   VI P PVR +G
Sbjct  115   IKTS-GDLLTLSLLPPTPSPDVDRDLVPVAPQRGIPVERDLLQKLQQPKVIVPQPVRPVG  173

Query  718   STVFVGCILHSDPPAPPYTTSLKTaadveseaeavsLPILVSDVNNKVRLANSAYKELVG  897
             S++ +G I     P PP  T  K   +VE E E+  LP ++SD  N+VRLANSAYKE+VG
Sbjct  174   SSITIGPITLDTGPTPPAPT--KKREEVEEEVESDLLPAVISDSRNQVRLANSAYKEMVG  231

Query  898   QPECRWLDLLPPFHS-------PCKTISGEVAIQFSNSVNLPVSSNRFTCWVRMEWSNND  1056
             QPEC WLD + P            + ISG V +  S S ++P++S  F+C  R++W+ N 
Sbjct  232   QPECPWLDSMVPVGGHRIGMRLASRRISGGVMLDLSES-SVPLTSKGFSCRARIQWACN-  289

Query  1057  GKKTTVRAFCDAVKLACHSKDYLFQWRFHTSDNNSS  1164
             G KT + A CD  +L+C SKDYLF WRFHT++ + S
Sbjct  290   GTKTLINAPCDVRRLSCDSKDYLFTWRFHTAEASVS  325



>gb|AAF99742.1|AC004557_21 F17L21.26 [Arabidopsis thaliana]
Length=1034

 Score =   186 bits (472),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 131/341 (38%), Positives = 180/341 (53%), Gaps = 43/341 (13%)
 Frame = +1

Query  223   RYRPIAPKPEAPTSPSAD-NNALPENIRKSAFLRNVWPHLQARPTRTRKRGRSAFALPPL  399
             + RPIAPKP  P     D ++++   I +S +LRN+WP LQARPTRTRKRGR       L
Sbjct  705   KRRPIAPKPGTPRVNDDDPSSSMSHKISQSPYLRNLWPQLQARPTRTRKRGRGGMGPSSL  764

Query  400   KRARSCFQGFapaaapppppYHQVLNSSAAANTWANYPTGFPQIPMIHHP----------  549
                R   +    +++       +VL      +  A      P +P + +           
Sbjct  765   AMKRP--KSSCGSSSTSTISTQRVLGPIKTLSFQAFTHHRLPNLPQVGYGFENGVSSTLV  822

Query  550   NLPPLMDSPAAA-----ETSGGGRVLRGIDLNREAAESPEEFDFMPQLQP----------  684
              LP L  SP ++     E  G G     IDLN+  AE  +E DF+ QLQ           
Sbjct  823   TLPLLQCSPPSSKCMEPEIKGKGV----IDLNK-TAEVIQERDFLTQLQGPITTTTTATT  877

Query  685   --VITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKTaadveseaeavsLPILVSDVNNK  858
               VI+P P+R + S + V  I     P+P   TS K+  +VE + E+  LP +++D N++
Sbjct  878   SRVISPQPIRPVCSKINVAYINPLTNPSPTSQTSKKSPREVEEDVESDDLPSVITDSNSR  937

Query  859   VRLANSAYKELVGQPECRWLDLLPPFHSPCKTISGEVAIQFSNSVNLPV--SSNRFTCWV  1032
             VRL NSAYKE++GQPEC WLD +       K I GEV I F  S  +PV   +N F+CWV
Sbjct  938   VRLVNSAYKEMMGQPECSWLDSM----VRGKRICGEVMINFCES-KIPVMTENNGFSCWV  992

Query  1033  RMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHTSDN  1155
             R++W   DGK+  + AFCD  KLAC SKDY+F WRFHT+ +
Sbjct  993   RIDW-GRDGKEEYMHAFCDVTKLACDSKDYVFTWRFHTTTD  1032



>ref|XP_002893469.1| F17L21.26 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69728.1| F17L21.26 [Arabidopsis lyrata subsp. lyrata]
Length=1048

 Score =   180 bits (457),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 132/348 (38%), Positives = 177/348 (51%), Gaps = 45/348 (13%)
 Frame = +1

Query  229   RPIAPKPEAPTSPSAD-NNALPENIRKSAFLRNVWPHLQARPTRTRKRGRSAFALPPLKR  405
              PIAPKP  P     D ++++   I +S +LRN+WP LQARPTRTRKRGR       L  
Sbjct  712   EPIAPKPGTPRVNDDDPSSSMSHKISQSPYLRNLWPQLQARPTRTRKRGRGGMGPSSLAM  771

Query  406   ARSCFQGFapaaapppppYHQVLNSSAAANTWANYPTGFPQIPMIHHP----------NL  555
              R   +    ++        +VL         A    G P +  + +            L
Sbjct  772   KRP--KSLCGSSPTSTNSTQRVLGPIKTLPFQAFTHHGLPNLAQVGYALDNGGSSALVTL  829

Query  556   PPLMDSP-----AAAETSGGGRVLRGIDLNREAAESPEEFDFMPQLQP------------  684
             P L   P        E  G G     IDLN+  AE  +E DF+ QLQ             
Sbjct  830   PLLQCYPPPSKCMEPEIKGKGV----IDLNK-TAEVIQERDFLTQLQGPITTPTTATTSR  884

Query  685   VITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKTaadveseaeavsLPILVSDVNNKVR  864
             VI+P  +R + S + V  I     P+PP  TS K+  +VE E E+  LP +++D NN+VR
Sbjct  885   VISPQAIRPVCSKINVAYINPLTNPSPPSQTSKKSPREVEEEVESDDLPSVITDSNNRVR  944

Query  865   LANSAYKELVGQPECRWLDLLPPFHSPCKTISGEVAIQFSNSVNLPV--SSNRFTCWVRM  1038
             L NSAYKE++GQPEC WLD +       K I GEV I F  S  +PV   +N F+CWVR+
Sbjct  945   LVNSAYKEMMGQPECSWLDSM----VRGKRICGEVMINFCES-KIPVMTENNGFSCWVRI  999

Query  1039  EWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHTSDN--NSSKSAC  1176
             +W    GK+  + AFCD  KLAC SKDY+F WRFHT+ +  ++  S+C
Sbjct  1000  DWGRV-GKEVYMHAFCDVTKLACDSKDYVFTWRFHTTTDRRDTCHSSC  1046



>tpg|DAA41256.1| TPA: hypothetical protein ZEAMMB73_982240 [Zea mays]
Length=312

 Score =   161 bits (407),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 127/350 (36%), Positives = 170/350 (49%), Gaps = 64/350 (18%)
 Frame = +1

Query  166   MQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHLQA  345
             M  V P     ++  EILAR+RPIAPKP          N              V  HLQ 
Sbjct  1     MAMVQPADATVKAN-EILARFRPIAPKPTLAAEGVVAAN-------------RVLCHLQG  46

Query  346   RPTRTRKRGRSAFAL----------PPLKRARSCFQGFapaaapppppYHQVLNSSAAAN  495
             RP R RKRGR   A+          PP KR R+              PY  +  +   A+
Sbjct  47    RPCRARKRGRPGPAVVAPSPESGLQPPAKRKRA------------TTPYPPLRCTGPRAS  94

Query  496   TWANYPTGFPQIPMIHHPNLPPLMDSPAAAETSGGGRVLRGIDLNREAAES---PEEFDF  666
                    G P    +   +LPP          +G G      DL + AAE    P E D 
Sbjct  95    AAVPGSAGLP----LASASLPP----------AGAG---AAEDLAKVAAEGRHVPVERDL  137

Query  667   MPQ-LQP-VITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKTaadveseaeavsLPILV  840
             + + L+P VI+P  VR + S + VGCI  +D       +  KTA  VE+E E  +LP +V
Sbjct  138   LRKLLEPKVISPRAVRPVCSAIHVGCIHRADATCAAAVS--KTAVRVEAELEVDALPAVV  195

Query  841   SDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTISGEVAIQFSNSVNLPVSSNRF  1020
             SD +N+VRL N AYKE+VGQPEC WLD +    +  + ISGEVA+  +N  +LP S   F
Sbjct  196   SDASNRVRLVNDAYKEMVGQPECPWLDAV---AATSRRISGEVALVVANQSSLPESYGVF  252

Query  1021  TCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHTSDNNSSKS  1170
             TC  ++EW  +DGK  ++   CD  +L C S++YLF WRF T+D ++  S
Sbjct  253   TCTAKIEW-EDDGKVASIDVPCDVSRLQCESREYLFVWRFRTADADADAS  301



>ref|NP_001145615.1| hypothetical protein [Zea mays]
 gb|ACG48911.1| hypothetical protein [Zea mays]
 tpg|DAA63362.1| TPA: hypothetical protein ZEAMMB73_126358 [Zea mays]
Length=327

 Score =   160 bits (405),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 129/346 (37%), Positives = 174/346 (50%), Gaps = 41/346 (12%)
 Frame = +1

Query  166   MQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRN-VWPHLQ  342
             M  V P     ++  EILAR+RPIAPKP    + +A    + +   +     N V  HLQ
Sbjct  1     MAMVQPADTAVKAN-EILARFRPIAPKPTLAAAAAAAAAPVAQAAAEGVVAANRVLCHLQ  59

Query  343   ARPTRTRKRGR--------SAFALPPLKRARSCFQGFapaaapppppYHQVLNSSAAANT  498
             +RP R RKRGR         + A PP KR R+              PY  +    AAA T
Sbjct  60    SRPCRARKRGRPTVVPVSPKSGAQPPAKRRRA------------STPYPPL--RCAAATT  105

Query  499   WANYPTGFPQIPMIHHPNLPPLMDSPAAAETSGGGRVLRGIDLNREAAESPEEFDFMPQ-  675
              A+     P         LPP   + A  E           +  R+    P E D + + 
Sbjct  106   GAHVSAVVP-----GSARLPP---ASAGVEDIAKAAAAAATEEGRDV---PVERDLLRKL  154

Query  676   LQP-VITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKTaadveseaeavsLPILVSDVN  852
             L+P VI+P  VR + S + VGCI  +D  A       KTA  VE+E E  +LP +VSD  
Sbjct  155   LEPRVISPRAVRPVWSAIHVGCIHRTDDAACTDAAVSKTAVQVEAELEVDALPAVVSDSG  214

Query  853   NKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTISGEVAIQFSNSVNLPVSSNRFTCWV  1032
             N+VRL N AYKE+VGQPEC WLD +    +  + ISGEVA+  ++  +LP S   FTC  
Sbjct  215   NRVRLVNDAYKEMVGQPECPWLDAV---AATSRRISGEVALVVADRSSLPDSYGAFTCTA  271

Query  1033  RMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHTSDNNSSKS  1170
             ++EW  +DGK T++ A CD  +L C S+DYLF WRF T+  ++  S
Sbjct  272   KIEW-EDDGKVTSIAAPCDVSRLQCESRDYLFAWRFRTAAADADAS  316



>ref|XP_009413661.1| PREDICTED: uncharacterized protein LOC103994922 [Musa acuminata 
subsp. malaccensis]
Length=300

 Score =   157 bits (397),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 123/330 (37%), Positives = 164/330 (50%), Gaps = 53/330 (16%)
 Frame = +1

Query  214   ILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHLQARPTRTRKRGRSAFALP  393
             I+AR+RPIAPKP  P    A+     + +  +  LR   P    R  R RKRGR+  A  
Sbjct  7     IMARFRPIAPKPSLPRPQLAEGTC--QKVTSAGALRLRAP----RSCRARKRGRAELAPN  60

Query  394   PLKRARSCFQGFapaaapppppYHQVLNSSAAANTWAN----YPTGFPQIPMIHHPNLPP  561
             P KR RS                  +L   AAA   A     YPT  P        ++P 
Sbjct  61    PNKRQRS------------------ILPVLAAAGPQAQLSPTYPTFVPFTCQKSACDIPT  102

Query  562   LMDSPAAAETSGGGRVLRGIDLNREAAESPEEFDFMPQLQP--VITPHPVRLIGSTVFVG  735
             L   P + E      VL              E D + +LQ   VI P PVR +GS++ VG
Sbjct  103   LTVLPLSPEAKADAAVL-------------VEQDLLQKLQEPRVIVPQPVRPVGSSISVG  149

Query  736   CILHSDPPAPPYTTSLKTaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRW  915
              I H D  A P     K   +VE E E+  LP +VSD  N+VRLANSAYKE+VGQPEC W
Sbjct  150   SICH-DASAVPAVPVSKRPEEVEEEVESDELPAVVSDSQNRVRLANSAYKEMVGQPECPW  208

Query  916   LDLLP-------PFHSPCKTISGEVAIQFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTV  1074
             LD +        P  S  + ISGEV +   +S ++P +S+ F+C V++EW+ N G+K  V
Sbjct  209   LDSMILSGRGMLPMKSLPRRISGEVMLDVKDS-SVPKTSSGFSCKVKIEWACN-GRKNLV  266

Query  1075  RAFCDAVKLACHSKDYLFQWRFHTSDNNSS  1164
                C+ ++L C S+DYLF WRF  S  +++
Sbjct  267   NVPCNVIRLFCQSRDYLFAWRFDISKASAT  296



>ref|NP_001145067.1| uncharacterized protein LOC100278263 [Zea mays]
 gb|ACG44764.1| hypothetical protein [Zea mays]
Length=312

 Score =   157 bits (396),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 123/335 (37%), Positives = 164/335 (49%), Gaps = 63/335 (19%)
 Frame = +1

Query  211   EILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHLQARPTRTRKRGRSAFAL  390
             EILAR+RPIAP P          N              V  HLQ++P R RKRGR   A+
Sbjct  15    EILARFRPIAPNPTLAAEGVVAAN-------------RVLCHLQSKPCRARKRGRPGPAV  61

Query  391   ----------PPLKRARSCFQGFapaaapppppYHQVLNSSAAANTWANYPTGFPQIPMI  540
                       PP KR R+              PY  +      A+       G P    +
Sbjct  62    VAPSPESGLQPPAKRKRA------------TTPYPPLRCRGPRASAAVPGSAGLP----L  105

Query  541   HHPNLPPLMDSPAAAETSGGGRVLRGIDLNREAAES---PEEFDFMPQL-QP-VITPHPV  705
                +LPP          +G G      DL + AAE    P E D + +L +P VI+P  V
Sbjct  106   ASASLPP----------AGAGT---AEDLAKVAAEGRDVPVERDLLRKLLEPKVISPRAV  152

Query  706   RLIGSTVFVGCILHSDPPAPPYTTSLKTaadveseaeavsLPILVSDVNNKVRLANSAYK  885
             R + S + VGCI  +D  A       KTA  VE+E E  +LP +VSD +N+VRL N AYK
Sbjct  153   RPVCSAIHVGCIHRAD--ATCTAAVSKTAVRVEAELEVDALPAVVSDASNRVRLVNDAYK  210

Query  886   ELVGQPECRWLDLLPPFHSPCKTISGEVAIQFSNSVNLPVSSNRFTCWVRMEWSNNDGKK  1065
             E+VGQPEC WLD +    +  + ISGEVA+  +N  +LP S   FTC  ++EW  +DGK 
Sbjct  211   EMVGQPECPWLDAV---AATSRRISGEVALVVANQSSLPESYGVFTCTAKIEW-EDDGKV  266

Query  1066  TTVRAFCDAVKLACHSKDYLFQWRFHTSDNNSSKS  1170
              ++   CD  +L C S++YLF WRF T+D ++  S
Sbjct  267   ASIDVPCDVSRLQCESREYLFVWRFRTADADADAS  301



>gb|AGT95993.1| seed dormancy protein [Triticum aestivum]
Length=328

 Score =   157 bits (396),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 114/324 (35%), Positives = 162/324 (50%), Gaps = 20/324 (6%)
 Frame = +1

Query  211   EILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHLQARPTRTRKRGRSAFAL  390
             EILAR+RPIAPKP  P SP+   +   +          V  HLQ+RP R RKRGR +   
Sbjct  15    EILARFRPIAPKPALPASPAQAIDGAADR---------VLCHLQSRPCRARKRGRPSAVP  65

Query  391   PPLKRARSCFQGFapaa-apppppYHQVLNSSAAANTWANYPTGFPQIPMIHHPNLPPLM  567
                  A +  +  A                 SAA   + + P G   +P     +LPP  
Sbjct  66    VSAPAAAAKRKRAAYPVPLRCAAAATTDAVVSAATRAYVSVP-GSACMPF---ASLPPAT  121

Query  568   DSPAAAETSGGGRVLRGIDLNREAAESPEEFDFMPQL-QP-VITPHPVRLIGSTVFVGCI  741
              S     T     V    +      + P E D + +L +P VI+P  +R +GST+ V  I
Sbjct  122   ASTGGNLTMLSTMVAGDEEEEERERDVPVERDLLRKLLEPKVISPRAMRPVGSTIHVESI  181

Query  742   LHSDPPAPPYTTSLKTaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLD  921
             +H    A   T + KTA +VE++ E  +LP +V+D +N+VRL N AYKE+VG PEC WL 
Sbjct  182   VHGAVDAASCTAASKTAEEVEADVETDALPAVVTDSSNRVRLVNDAYKEMVGAPECLWLG  241

Query  922   LLPPFHSPCKTISGEVAIQFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKL  1101
              +    +  + ISGEVA+  +    LP S   F+C  ++EW    G++ +  A CD  +L
Sbjct  242   AV----AASRRISGEVALVVAEQATLPESPGGFSCTAKIEWECGGGERASFHAACDVSRL  297

Query  1102  ACHSKDYLFQWRFHTSDNNSSKSA  1173
              C  + YLF WRF T+D +SS S+
Sbjct  298   QCEYRHYLFAWRFRTADASSSGSS  321



>ref|XP_002460936.1| hypothetical protein SORBIDRAFT_02g037770 [Sorghum bicolor]
 gb|EER97457.1| hypothetical protein SORBIDRAFT_02g037770 [Sorghum bicolor]
Length=325

 Score =   152 bits (384),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 126/346 (36%), Positives = 178/346 (51%), Gaps = 45/346 (13%)
 Frame = +1

Query  166   MQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHLQA  345
             M  V P     ++  EILAR+RPIAPKP   T+ +A +               V  HLQ+
Sbjct  1     MAMVQPADTAVKAN-EILARFRPIAPKPTLATAAAAASPVAQAAAEGVVAANRVLCHLQS  59

Query  346   RPTRTRKRGR-----------SAFALPPLKRARSCFQGFapaaapppppYHQVLNSSAAA  492
             RP R RKRGR            + A  P KR R+              PY  +  ++A A
Sbjct  60    RPCRARKRGRPTVVPVSPPKSGSGAQSPAKRKRA------------ATPYPPLRCAAATA  107

Query  493   NTWANYPTGFPQIPMIHHPNLPPLMDSPAAAETSGGGRVLRGIDLNREAAESPEEFDFMP  672
              + +       ++P+    +LPP   + A AE         G D+       P E D + 
Sbjct  108   CSASAVVPVSARLPLA---SLPP---ASAGAEDLAKVAAAEGRDV-------PVERDLLR  154

Query  673   QL-QP-VITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKTaadveseaeavsLPILVSD  846
             +L +P VI+P  VR + S + VGCI  +D  A     + KTAA VE+E E  +LP +VSD
Sbjct  155   KLLEPKVISPRAVRPVCSAIHVGCIHRTD--ATCTAAASKTAAQVEAELEVDALPAVVSD  212

Query  847   VNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTISGEVAIQFSNSVNLPVSSNRFTC  1026
              +N+VRL N AYKE+VGQPEC WL  +    +  + ISGEVA+  ++  +LP +   FTC
Sbjct  213   SSNRVRLVNDAYKEMVGQPECPWLYAV---AATSRRISGEVALVVADQSSLPETYGVFTC  269

Query  1027  WVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHTSDNNSS  1164
               ++EW  +DGK T++   CD  +L C S+DYLF WRF T+D ++S
Sbjct  270   TAKIEW-EDDGKVTSIAVPCDVSRLHCESRDYLFTWRFRTADADAS  314



>gb|AGT95990.1| seed dormancy protein [Triticum aestivum]
Length=330

 Score =   150 bits (380),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 117/325 (36%), Positives = 163/325 (50%), Gaps = 28/325 (9%)
 Frame = +1

Query  211   EILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHLQARPTRTRKRGRSAFAL  390
             EILAR+RPIAPKP  P SP     A  + I  +A    V  HLQ+RP R RKRGR +   
Sbjct  15    EILARFRPIAPKPALPASP-----AQAQAIDGAA--DRVLCHLQSRPCRARKRGRPSAVP  67

Query  391   PPLKRARSCFQGFapaaapppppYHQVLNSSAAANTWANYPTGFPQIPMIHHPNLPPLMD  570
                          A AA      Y   L  +AAA T A   T       +      P   
Sbjct  68    ---------VSAPAAAAKRKRAAYPVPLRCAAAAATDAVVSTATRAYVSVPGSACMPFAS  118

Query  571   SPAAAETSGGGRVLRGIDLNREAA------ESPEEFDFMPQL-QP-VITPHPVRLIGSTV  726
              P A  ++GG   +    +  +        + P E D + +L +P VI+P  +R +GST+
Sbjct  119   LPPATASTGGNLTMLSTMVAGDEEEEEEERDIPVERDLLRKLLEPKVISPRAMRPVGSTI  178

Query  727   FVGCILHSDPPAPPYTTSLKTaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPE  906
              V  I+H    A   T + KTA +VE+E E  +LP +V+D +N+VRL N AYKE+VG PE
Sbjct  179   HVESIVHGAVDAASSTAASKTAEEVEAEVETDALPAIVTDSSNRVRLVNDAYKEMVGAPE  238

Query  907   CRWLDLLPPFHSPCKTISGEVAIQFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFC  1086
             C WL  +    +  + ISGEVA+  +    LP S   F+C  ++EW    G++ ++ A C
Sbjct  239   CLWLGAV----AASRRISGEVALVVAEQATLPESPGGFSCTAKIEWECGGGERASIHAAC  294

Query  1087  DAVKLACHSKDYLFQWRFHTSDNNS  1161
             D  +L C  + YLF WRF  +D +S
Sbjct  295   DVSRLQCEYRHYLFAWRFRAADASS  319



>gb|AGT95989.1| seed dormancy protein [Triticum aestivum]
Length=330

 Score =   150 bits (379),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 117/325 (36%), Positives = 163/325 (50%), Gaps = 28/325 (9%)
 Frame = +1

Query  211   EILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHLQARPTRTRKRGRSAFAL  390
             EILAR+RPIAPKP  P SP     A  + I  +A    V  HLQ+RP R RKRGR +   
Sbjct  15    EILARFRPIAPKPALPASP-----AQAQAIDGAA--DRVLCHLQSRPCRARKRGRPSAVP  67

Query  391   PPLKRARSCFQGFapaaapppppYHQVLNSSAAANTWANYPTGFPQIPMIHHPNLPPLMD  570
                          A AA      Y   L  +AAA T A   T       +      P   
Sbjct  68    ---------VSAPAAAAKRKRAAYPVPLRCAAAAATDAVVSTATRAYVSVPGSACMPFAS  118

Query  571   SPAAAETSGGGRVLRGIDLNREAA------ESPEEFDFMPQL-QP-VITPHPVRLIGSTV  726
              P A  ++GG   +    +  +        + P E D + +L +P VI+P  +R +GST+
Sbjct  119   LPPATASTGGNLTMLSTMVAGDEEEEEEERDIPVERDLLRKLLEPKVISPRAMRPVGSTI  178

Query  727   FVGCILHSDPPAPPYTTSLKTaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPE  906
              V  I+H    A   T + KTA +VE+E E  +LP +V+D +N+VRL N AYKE+VG PE
Sbjct  179   HVESIVHGAVDAASSTAASKTAEEVEAEVETDALPAVVTDSSNRVRLVNDAYKEMVGAPE  238

Query  907   CRWLDLLPPFHSPCKTISGEVAIQFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFC  1086
             C WL  +    +  + ISGEVA+  +    LP S   F+C  ++EW    G++ ++ A C
Sbjct  239   CLWLGAV----AASRRISGEVALVVAEQATLPESPGGFSCTAKIEWECGGGERASIHAAC  294

Query  1087  DAVKLACHSKDYLFQWRFHTSDNNS  1161
             D  +L C  + YLF WRF  +D +S
Sbjct  295   DVSRLQCEYRHYLFAWRFRAADASS  319



>ref|XP_010501615.1| PREDICTED: uncharacterized protein LOC104778901 [Camelina sativa]
Length=332

 Score =   149 bits (376),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 119/318 (37%), Positives = 163/318 (51%), Gaps = 43/318 (14%)
 Frame = +1

Query  208   AEILARYRPIAPKPEAPTSPSAD-NNALPENIRKSAFLRNVWPHLQARPTRTRKRGRSAF  384
             AEIL++YRPIAPKP  P     D ++++   I +S +LRN+WP LQARPTRTRKRGR   
Sbjct  21    AEILSKYRPIAPKPGTPRVNDDDPSSSMSHKISQSPYLRNLWPQLQARPTRTRKRGRGGM  80

Query  385   ALPPL--KRARSCFQGFapaaapppppYHQVLNSSAAANTWANYPTGFPQIPMIHH----  546
                 L  KR +S       ++        +V+      +  A    G P +  + +    
Sbjct  81    GPSSLAMKRPKSSCVSSPTSSTTTTTTTQRVIGPIKTLSFQAFTHHGLPNLTQVGYALEN  140

Query  547   ---------PNL---PPLMDSPAAAETSGGGRVLRGIDLNREAAESPEEFDFMPQLQP--  684
                      P L   PPL       E  G G     IDLN   AE  +E DF+ QLQ   
Sbjct  141   GGSSALVTLPLLQCSPPLPSKCMEPEIKGKGV----IDLN-NTAEVVQEIDFLKQLQGPI  195

Query  685   ---------VITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKTaadveseaeavsLPIL  837
                      VI+P P+R + S + V  I     P+P   T+ KT ++VE E E+  LP +
Sbjct  196   TTTTITTSRVISPQPIRPVCSKINVAYINPLTNPSPLPQTNKKTPSEVEEEVESDELPSV  255

Query  838   VSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTISGEVAIQFSNSVNLPV--SS  1011
             ++D +N+VR+ NSAYKE++GQPEC WLD +       K I GEV I F  S  +PV   +
Sbjct  256   ITDSSNRVRVVNSAYKEMMGQPECSWLDSM----VRGKRICGEVMIHFCES-KIPVMNEN  310

Query  1012  NRFTCWVRMEWSNNDGKK  1065
             N F+CWVR+EW   +GK+
Sbjct  311   NGFSCWVRIEWE-REGKE  327



>gb|AGT95991.1| seed dormancy protein [Triticum aestivum]
 gb|AGT95992.1| seed dormancy protein [Triticum aestivum]
Length=326

 Score =   145 bits (366),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 116/323 (36%), Positives = 160/323 (50%), Gaps = 20/323 (6%)
 Frame = +1

Query  211   EILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHLQARPTRTRKRGRSAFAL  390
             EILAR+RPIAPKP  P SP    +   +          V  HLQ RP R RKRGR +   
Sbjct  15    EILARFRPIAPKPALPASPVQAIDGAADR---------VLCHLQNRPCRARKRGRPSAVP  65

Query  391   PPLKRARSCFQGFapaaapppppYHQVLNSSAAANTWANYPTGFPQIPMIHHPNLPPLMD  570
                  A         AA P P        + A  +T        P    +   +LPP   
Sbjct  66    VSAPAA---AAKRKRAAYPVPLRCAAAAATDAVVSTATRAYVSVPGSACMPFASLPPATA  122

Query  571   SPAAAETSGGGRVLRGIDLNREAAESPEEFDFMPQL-QP-VITPHPVRLIGSTVFVGCIL  744
             S     T     ++ G D   E  + P E D + +L +P VI+P  +R +GST+ V  I+
Sbjct  123   STGGNLTMLSTTMVAGDD-EEEERDVPVERDLLRKLLEPKVISPRAMRPVGSTIHVESIV  181

Query  745   HSDPPAPPYTTSLKTaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDL  924
                  A   T + KTA +VE+E E  +LP +V+D +N+VRL N AYKE+VG PEC WL  
Sbjct  182   PGAVDAT-STAASKTAEEVEAEVETDALPAVVTDSSNRVRLVNDAYKEMVGAPECLWLGA  240

Query  925   LPPFHSPCKTISGEVAIQFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLA  1104
             +    +  + ISGEVA+  +    LP S   F+C  ++EW    G++ +  A CD  +L 
Sbjct  241   V----AASRRISGEVALVVAEQATLPESPGGFSCTAKIEWECRGGERASFHAACDVSRLQ  296

Query  1105  CHSKDYLFQWRFHTSDNNSSKSA  1173
             C  + YLF WRF T+D +SS S+
Sbjct  297   CEYRHYLFAWRFRTADASSSGSS  319



>ref|XP_004958157.1| PREDICTED: uncharacterized protein LOC101773030 [Setaria italica]
Length=319

 Score =   139 bits (351),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 127/331 (38%), Positives = 166/331 (50%), Gaps = 50/331 (15%)
 Frame = +1

Query  211   EILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHLQARPTRTRKRGRSAF--  384
             +ILAR+RPIAPKP A  + S    A  E +  +     V   LQ RP R RKRGR     
Sbjct  15    QILARFRPIAPKP-ALAAASPVAQAAAEGVVAA---NRVLCQLQNRPCRARKRGRPTVVP  70

Query  385   ------ALPPLKRARSCFQGFapaaapppppYHQVLNSSAAANTWANYPTGFPQIPMIHH  546
                   A P  KR R+                +  L  +AA  T A+     P    +  
Sbjct  71    VSPKSPAQPAAKRKRA-------------EAPYPPLRCAAATATRAHVSVVVPDSACLPL  117

Query  547   PNLPPLMDSPAAAETSGGGRVLRGIDLNREAAES---PEEFDFMPQL-QP-VITPHPVRL  711
              +LPP       A T  G       DL + AAE    P E D + +L +P VI+P  VR 
Sbjct  118   ASLPP-------ATTVAG-------DLVKVAAEERDVPVERDLLRKLLEPKVISPRAVRP  163

Query  712   IGSTVFVGCILHSDPPAPPYTTSLKTaadveseaeavsLPILVSDVNNKVRLANSAYKEL  891
             + ST++V  I  +D       +  KTAA+VE E EA +LP +VSD +N+VRL N AYKE+
Sbjct  164   VCSTIYVERIHRTDATCTAVVS--KTAAEVEVELEADALPAVVSDSSNRVRLVNDAYKEM  221

Query  892   VGQPECRWLDLLPPFHSPCKTISGEVAIQFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTT  1071
             VGQ EC WLD +    +  + ISGEVA+      +LP     FTC  R+EW    GK T+
Sbjct  222   VGQSECPWLDAV---AAASRRISGEVALVVGEPASLPEPHGVFTCTARIEWEYG-GKCTS  277

Query  1072  VRAFCDAVKLACHSKDYLFQWRFHTSDNNSS  1164
             + A CD  +L C S+DYLF WRF T D ++S
Sbjct  278   ILAPCDVSRLQCESRDYLFTWRFRTVDADAS  308



>ref|XP_008795678.1| PREDICTED: uncharacterized protein LOC103711346 [Phoenix dactylifera]
Length=256

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 89/237 (38%), Positives = 125/237 (53%), Gaps = 32/237 (14%)
 Frame = +1

Query  517   GFPQIPMIHHPNLPPLMDSPAAAETSGGGRVLRGI------DLNREAAES------PEEF  660
             G P +P    P  PP+       +TSG    L  +      D +R+          P E 
Sbjct  27    GLPLLPSFSAPEKPPI-------KTSGDPLTLSLLPPNPSPDSDRDLVSVAPPRGIPVER  79

Query  661   DFMPQLQ--PVITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKTaadveseaeavsLPI  834
             D + +LQ   VI P P+R +GS++ +G I       P      K   +VE E E+  LP 
Sbjct  80    DLLQKLQQPKVIVPLPIRPVGSSITIGPITLDT--GPAPPAPAKKPQEVEEEVESDLLPA  137

Query  835   LVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHS-------PCKTISGEVAIQFSNSV  993
             +VSD  N+VR+ANSAYKE+VGQPEC WLDL+    S         + ISG V +  S S 
Sbjct  138   VVSDSRNRVRIANSAYKEMVGQPECPWLDLMASVGSRSLGMRLASRRISGAVMLDLSES-  196

Query  994   NLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHTSDNNSS  1164
             ++P++S  F+C  R++W++N G KT +   CD  +L C SKDYLF WRF T++ + S
Sbjct  197   SVPLTSKGFSCRARIQWASN-GTKTLIHVPCDVRRLYCDSKDYLFTWRFRTAEASVS  252



>ref|XP_006857157.1| hypothetical protein AMTR_s00065p00165110 [Amborella trichopoda]
 gb|ERN18624.1| hypothetical protein AMTR_s00065p00165110 [Amborella trichopoda]
Length=383

 Score =   125 bits (315),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 128/377 (34%), Positives = 182/377 (48%), Gaps = 57/377 (15%)
 Frame = +1

Query  154   PARMMQAVSPYSGGSRSKAE-ILARYRPIAPKPEAPTSPSADNNA---LPENIRKSAFLR  321
             P      V+P +  + SK E I++RYRPIAPKP+   SPS + +    L EN   +A L 
Sbjct  5     PENTAAIVNPLNMFTPSKTEQIMSRYRPIAPKPQFQQSPSPNFDCTAPLSENPLTAA-LS  63

Query  322   NVWP--HLQARPTRT--RKRGRSA------------FALPPLKRARSCF-----------  420
                P  H + RP R   R+ G  A            F   PL    S F           
Sbjct  64    TTLPASHPKTRPARVRKRRNGAQACGARKKAKTNMWFFNTPLPEPISPFSHQNILLGLPF  123

Query  421   ----QGFapaaapppppYHQVLNSSAAANTWANYPTGFPQIPMIHHPNLPPLMDSPAAAE  588
                 +GF     P       + NSS  +       T    +P++  P+   +  S     
Sbjct  124   QGLTRGFPLYTFPATVSQGDLENSSRVS-------TDLVTLPLLPFPSTSVVSQSIPEEA  176

Query  589   TSGGGRVLRGIDLNREAAESPEEFDF-----MPQLQPVITPHPVRLIGSTVFVGCILHSD  753
              +   R+  G  L  E  ++P          +P    VITP PVR +GS++ V CI   +
Sbjct  177   MNYDQRMPEG-KLVMEKLQAPITCKLPTTSSVP-FSGVITPQPVRPVGSSISVECISDCN  234

Query  754   PPAPPYTTSLKTaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLD--LL  927
                    +  K + +VE E E  +LP ++SD NNKVRLANSAYK++VGQPEC WL+  L 
Sbjct  235   H-FSSSLSMSKKSVEVEEELELEALPGVISDANNKVRLANSAYKKMVGQPECSWLESTLS  293

Query  928   PPFHSPCK--TISGEVAIQFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKL  1101
                  P +   I+GEV +   +S+ +P+SSN FTC V++EW+N  G++T V+A    ++L
Sbjct  294   SQRKKPEEPTRINGEVMLILEDSL-VPISSNAFTCRVKIEWANK-GQRTLVKAPGRVIRL  351

Query  1102  ACHSKDYLFQWRFHTSD  1152
             +C SKDY+F WRF T D
Sbjct  352   SCDSKDYVFAWRFLTGD  368



>ref|XP_003560029.1| PREDICTED: uncharacterized protein LOC100841082 [Brachypodium 
distachyon]
Length=329

 Score =   115 bits (288),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 79/189 (42%), Positives = 110/189 (58%), Gaps = 10/189 (5%)
 Frame = +1

Query  622   DLNREAAESPEEFDFMPQL-QP-VITPHPVRLIGSTVFV---GCILHSDPPAPPYTTSLK  786
             D NR+    P E D + +L +P VI+P  VR +GSTV +    C +        Y  S K
Sbjct  138   DDNRDV---PVERDLLRKLLEPKVISPRAVRPLGSTVHILEPVCAVAGTNNDNTYAASSK  194

Query  787   TaadveseaeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTISGE  966
             TA +VE+  EA +LP LVSD +N+VRL N AYK++VG PEC WL  L    +  + ISGE
Sbjct  195   TAQEVEAALEADALPALVSDSSNRVRLVNDAYKKMVGAPECAWLSALAAAAAS-RRISGE  253

Query  967   VAIQFSNSVNLPVSSNR-FTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFH  1143
             VA+    +  +P S N  F+C  ++EW    G++ +V A CD  +L C ++DYLF WR  
Sbjct  254   VALVVPAAAMMPESQNGGFSCAAKIEWELRGGERASVHAACDVTRLHCEARDYLFAWRLR  313

Query  1144  TSDNNSSKS  1170
             T+D+ S  S
Sbjct  314   TADDASPSS  322



>gb|EYU36389.1| hypothetical protein MIMGU_mgv1a014853mg [Erythranthe guttata]
Length=176

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 80/115 (70%), Gaps = 13/115 (11%)
 Frame = +1

Query  163  MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSA---DNNALPENIRKSAFLRNVWP  333
            M+Q ++PY+  +   AEI++RYRPIAPKPE+P + SA   D++A+P  IRKS +LRNVW 
Sbjct  1    MIQTINPYA--TARTAEIMSRYRPIAPKPESPATGSAAENDSSAVPSGIRKSPYLRNVWA  58

Query  334  HLQARPTRTRKRGR-SAFALPPLKRARSCFQGFapaaapppppYHQVLNSSAAAN  495
            HLQARPTRTRKRGR +AF+ P +KRAR+C QG          PY  V+  S A N
Sbjct  59   HLQARPTRTRKRGRAAAFSPPSVKRARTCLQGL-------ASPYQGVITGSPAKN  106



>gb|AFI99126.1| zinc finger protein Sdr4 [Oryza sativa]
Length=332

 Score =   110 bits (274),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 104/176 (59%), Gaps = 13/176 (7%)
 Frame = +1

Query  655   EFDFMPQL-QP-VITPHPVRLIGSTVFVGCILHSDPPAPPYTTSL---KTaadveseaea  819
             E D + +L +P VI+P  VR +GST+ V  + H D        +    KTA +VE+E E+
Sbjct  160   ERDLLRKLLEPKVISPRAVRPVGSTIHVESV-HIDVGRTTVAAAAAAPKTAEEVEAELES  218

Query  820   vsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTISGEVAIQFSN----  987
              SLP +VSD +N+VRL N AYK +VGQPEC WLD +    S  + ISGEVA+  S     
Sbjct  219   DSLPAVVSDSSNRVRLVNDAYKRMVGQPECPWLDAVATAAS--RRISGEVALVVSEPPAA  276

Query  988   SVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHTSDN  1155
             +  LP +   F+C  ++ W   DGK ++V A CD  +L C S+DY+F WRF  + +
Sbjct  277   AAALPETCKGFSCSAKIAW-ERDGKWSSVHAPCDVTRLQCESRDYVFAWRFRAAGD  331



>gb|EAZ04505.1| hypothetical protein OsI_26656 [Oryza sativa Indica Group]
 dbj|BAI79300.1| putative zinc finger protein Sdr4 [Oryza sativa Indica Group]
Length=342

 Score =   110 bits (274),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 104/177 (59%), Gaps = 13/177 (7%)
 Frame = +1

Query  655   EFDFMPQL-QP-VITPHPVRLIGSTVFVGCILHSDPPAPPYTTSL---KTaadveseaea  819
             E D + +L +P VI+P  VR +GST+ V  + H D        +    KTA +VE+E E+
Sbjct  159   ERDLLRKLLEPKVISPRAVRPVGSTIHVESV-HIDVGRTTAAAAAAAPKTAEEVEAELES  217

Query  820   vsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTISGEVAIQFSN----  987
              SLP +VSD +N+VRL N AYK +VGQPEC WLD +    S  + ISGEVA+  S     
Sbjct  218   DSLPAVVSDSSNRVRLVNDAYKRMVGQPECPWLDAVATAAS--RRISGEVALVVSEPPAA  275

Query  988   SVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHTSDNN  1158
             +  LP +   F+C  ++ W   DGK ++V A CD  +L C S+DY+F WRF  + + 
Sbjct  276   AAALPETCKGFSCSAKIAW-ERDGKWSSVHAPCDVTRLQCESRDYVFAWRFRAAGDE  331



>ref|NP_001175277.1| Os07g0585700 [Oryza sativa Japonica Group]
 dbj|BAC22280.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAH94005.1| Os07g0585700 [Oryza sativa Japonica Group]
 dbj|BAI79301.1| putative zinc finger protein Sdr4 [Oryza sativa Japonica Group]
Length=343

 Score =   107 bits (268),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 102/178 (57%), Gaps = 14/178 (8%)
 Frame = +1

Query  655   EFDFMPQL---QPVITPHPVRLIGSTVFVGCILHSDPPAPPYTTSL---KTaadveseae  816
             E D + +L   + ++ P  VR +GST+ V  + H D        +    KTA +VE+E E
Sbjct  159   ERDLLRKLLEPRKLLEPRAVRPVGSTIHVESV-HIDVGRTTAAAAAAAPKTAEEVEAELE  217

Query  817   avsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTISGEVAIQFSN---  987
             + SLP +VSD +N+VRL N AYK +VGQPEC WLD +    S  + ISGEVA+  S    
Sbjct  218   SDSLPAVVSDSSNRVRLVNDAYKRMVGQPECPWLDAVATAAS--RRISGEVALVVSEPAA  275

Query  988   -SVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHTSDNN  1158
              +  LP +   F+C  ++ W   DGK ++V A CD  +L C S+DY+F WRF  + + 
Sbjct  276   AAAALPETCKGFSCSAKIAW-ERDGKWSSVHAPCDVTRLQCESRDYVFAWRFRAAGDE  332



>gb|AFI99127.1| zinc finger protein Sdr4 [Oryza sativa Japonica Group]
Length=332

 Score =   107 bits (267),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 102/177 (58%), Gaps = 14/177 (8%)
 Frame = +1

Query  655   EFDFMPQL---QPVITPHPVRLIGSTVFVGCILHSDPPAPPYTTSL---KTaadveseae  816
             E D + +L   + ++ P  VR +GST+ V  + H D        +    KTA +VE+E E
Sbjct  159   ERDLLRKLLEPRKLLEPRAVRPVGSTIHVESV-HIDVGRTTVAAAAAAPKTAEEVEAELE  217

Query  817   avsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTISGEVAIQFSN---  987
             + SLP +VSD +N+VRL N AYK +VGQPEC WLD +    S  + ISGEVA+  S    
Sbjct  218   SDSLPAVVSDSSNRVRLVNDAYKRMVGQPECPWLDAVATAAS--RRISGEVALVVSEPAA  275

Query  988   -SVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHTSDN  1155
              +  LP +   F+C  ++ W   DGK ++V A CD  +L C S+DY+F WRF  + +
Sbjct  276   AAAALPETCKGFSCSAKIAW-ERDGKWSSVHAPCDVTRLQCESRDYVFAWRFRAAGD  331



>gb|AFI99128.1| zinc finger protein Sdr4 [Oryza sativa Japonica Group]
Length=332

 Score =   103 bits (256),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 102/176 (58%), Gaps = 13/176 (7%)
 Frame = +1

Query  655   EFDFMPQL-QP-VITPHPVRLIGSTVFVGCILHSDPPAPPYTTSL---KTaadveseaea  819
             E D + +L +P VI+P  VR +GST+ V  + H D        +    KTA +VE+E E+
Sbjct  160   ERDLLRKLLEPKVISPRAVRPVGSTIHVESV-HIDVGRTTVAAAAAAPKTAEEVEAELES  218

Query  820   vsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTISGEVAIQFSN----  987
              SLP +VSD +N+VRL N AYK +VGQPEC WLD +    S  + IS EVA+  S     
Sbjct  219   DSLPAVVSDSSNRVRLVNDAYKRMVGQPECPWLDAVATAAS--RRISVEVALVVSEPPAA  276

Query  988   SVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHTSDN  1155
             +  LP +   F+C  ++ W   DGK ++V A CD  +L C S+DY+F WR   + +
Sbjct  277   AAALPETCKGFSCSAKIAW-ERDGKWSSVHAPCDVTRLQCESRDYVFAWRSRAAGD  331



>gb|EEE67487.1| hypothetical protein OsJ_24915 [Oryza sativa Japonica Group]
Length=328

 Score =   100 bits (250),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 99/170 (58%), Gaps = 14/170 (8%)
 Frame = +1

Query  655   EFDFMPQL---QPVITPHPVRLIGSTVFVGCILHSDP---PAPPYTTSLKTaadveseae  816
             E D + +L   + ++ P  VR +GST+ V  + H D     A     + KTA +VE+E E
Sbjct  142   ERDLLRKLLEPRKLLEPRAVRPVGSTIHVESV-HIDVGRITAAVAAAAPKTAEEVEAELE  200

Query  817   avsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTISGEVAIQFSN---  987
             + SLP +VSD +N+VRL N AYK +VGQPEC WLD +    S  + ISGEVA+  S    
Sbjct  201   SDSLPAVVSDSSNRVRLVNDAYKRMVGQPECPWLDAVATAAS--RRISGEVALVVSEPAA  258

Query  988   -SVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQW  1134
              +  LP +   F+C  ++ W   DGK ++V A CD  +L C S+DY+F W
Sbjct  259   AAAALPETCKGFSCSAKIAW-ERDGKWSSVHAPCDVTRLQCESRDYVFAW  307



>emb|CDY11806.1| BnaC03g57720D [Brassica napus]
Length=91

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 43/95 (45%), Positives = 57/95 (60%), Gaps = 10/95 (11%)
 Frame = +1

Query  892   VGQPECRWLDLLPPFHSPCKTISGEVAIQFSNSVNLPVSSNRFTCWVRMEWSNNDGKKTT  1071
             +GQPEC WLD +      C    GEV IQF  S  +  ++N ++CWV++EW   DGK+  
Sbjct  1     MGQPECSWLDSMVKVKRMC----GEVVIQFCES-KISENNNGYSCWVKIEWGR-DGKEEL  54

Query  1072  VRAFCDAVKLACHSKDYLFQWRFHTSDNNSSKSAC  1176
             V AFCD +K  C SKDY+F WRFH     ++K  C
Sbjct  55    VHAFCDVMKRECDSKDYVFTWRFHI----TAKETC  85



>gb|EPS65028.1| hypothetical protein M569_09753, partial [Genlisea aurea]
Length=94

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 53/73 (73%), Gaps = 2/73 (3%)
 Frame = +1

Query  163  MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHLQ  342
            M+Q +SPY+  +   AEI++RYRPIAPKPEAP +       LP  I KS +LRNVW HLQ
Sbjct  1    MIQTISPYA--ASKTAEIMSRYRPIAPKPEAPAAGEDSAGGLPNGISKSPYLRNVWAHLQ  58

Query  343  ARPTRTRKRGRSA  381
            ARPTRTRKR RSA
Sbjct  59   ARPTRTRKRNRSA  71



>emb|CDY11796.1| BnaC03g57820D [Brassica napus]
Length=91

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 55/97 (57%), Gaps = 14/97 (14%)
 Frame = +1

Query  892   VGQPECRWLDLLPPFHSPCKTISGEVAIQFSNSVNLPVSSNR--FTCWVRMEWSNNDGKK  1065
             +GQPEC WLD +      C    GEV IQF  S    +S N   ++CWV++EW   DGK+
Sbjct  1     MGQPECSWLDSMVKVKRMC----GEVVIQFCES---KISENNIGYSCWVKIEWGR-DGKE  52

Query  1066  TTVRAFCDAVKLACHSKDYLFQWRFHTSDNNSSKSAC  1176
                 AFCD +K  C SKDY+F WRFH     ++K  C
Sbjct  53    ELAHAFCDVMKRECDSKDYVFTWRFHI----TAKETC  85



>emb|CBI19393.3| unnamed protein product [Vitis vinifera]
Length=279

 Score = 89.0 bits (219),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 91/302 (30%), Positives = 139/302 (46%), Gaps = 69/302 (23%)
 Frame = +1

Query  163   MMQAVSPYSGGSRSKAEILARYRPIAPKPEAPTSPSADNNALPENIRKSAFLRNVWPHLQ  342
             M++ ++PY+  +++ AEI++RYRPIAPKPE P +P      +P                 
Sbjct  1     MIRTLNPYNSTAKT-AEIMSRYRPIAPKPEPPVNP------IP-----------------  36

Query  343   ARPTRTRKRGRSAFALPPLKRARSCFQGFapaaapppppYHQVLNSSAAANTWANYPTGF  522
                          F+   LKR R+   GF+  +            +S A N   +   GF
Sbjct  37    ------------GFSPAALKRPRTHLVGFSTPSHV----------TSPAKNLSMH---GF  71

Query  523   PQIPM---IHHPNLPPLMDSPAAAETSGGGRVLRGIDLNREAAESPEEFDFMPQLQ----  681
                P+   +  P+  PL      A ++    ++    L     + P E D + QLQ    
Sbjct  72    THSPLQLPVPAPSFAPLNGGFERAISTTADGLMTLPLLPCPPPQLPVEKDLLQQLQRAPA  131

Query  682   ---PVITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKTaadveseaeavsLPILVSDVN  852
                 VI+P PVR IGS++ V C+     P P     LK   +VE E E+ +LP ++SD N
Sbjct  132   NTTNVISPQPVRPIGSSISVRCMRDDLSPIPEVQI-LKKPEEVEEEMESETLPAVISDSN  190

Query  853   NKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTISGEVAIQFSNSVNLPVSSNRFTCWV  1032
             NK+R+ANSAYKE+VGQPEC WL+ +         ++  V   F +++   +   RF   V
Sbjct  191   NKIRMANSAYKEMVGQPECPWLNSM---------VTCIVLSTFVDALLTIIYEGRFCFLV  241

Query  1033  RM  1038
             +M
Sbjct  242   QM  243



>ref|XP_006651523.1| PREDICTED: uncharacterized protein LOC102702271 [Oryza brachyantha]
Length=308

 Score = 89.0 bits (219),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 96/180 (53%), Gaps = 15/180 (8%)
 Frame = +1

Query  649   PEEFDFMPQLQP--VITPHPVRLIGSTVFVGCILHSDPPAPPYT---TSLKTaadvesea  813
             P E D + +L+   V  P P+R + +T+   CI  S      +        TA  VE+E 
Sbjct  128   PMECDLLRKLEEPRVTMPRPMRPLRTTI---CIDTSSIEGANWEKMPVCRMTALQVEAEL  184

Query  814   eavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTISGEVAIQFS--N  987
             EA  +P +VS  NN V L N AYK LVGQP C WLD LP   +  + I+GEV +      
Sbjct  185   EADIIPAIVSGPNNHVCLVNDAYKALVGQPVCPWLDSLPCTGTS-RRINGEVYLDVRRYT  243

Query  988   SVNLPV---SSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHTSDNN  1158
             + + P+   +   F+C  R+ W +N GK  +V A CD ++LAC+ ++YLF WRF T+   
Sbjct  244   ATDQPIREAAGGAFSCNSRISWEHN-GKLASVAASCDVMRLACNYREYLFVWRFDTTKGT  302



>ref|XP_010501616.1| PREDICTED: uncharacterized protein LOC104778902 [Camelina sativa]
Length=222

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 69/205 (34%), Positives = 94/205 (46%), Gaps = 35/205 (17%)
 Frame = +1

Query  208  AEILARYRPIAPKPEAPTSPSAD-NNALPENIRKSAFLRNVWPHLQARPTRTRKRGRSAF  384
            AEIL++YRPIAPKP  P     D ++++   I +S +LRN+WP LQARPTRTRKRGR   
Sbjct  21   AEILSKYRPIAPKPGTPRVNDDDPSSSMSHKISQSPYLRNLWPQLQARPTRTRKRGRGGM  80

Query  385  ALPPL--KRARSCFQGFapaaapppppYHQVLNSSAAANTWANYPTGFPQIPMIHH----  546
                L  KR +S       ++        +V+      +  A    G P +  + +    
Sbjct  81   GPSSLAMKRPKSSCVSSPTSSTTTTTTTQRVIGPIKTLSFQAFTHHGLPNLTQVGYALEN  140

Query  547  ---------PNL---PPLMDSPAAAETSGGGRVLRGIDLNREAAESPEEFDFMPQLQP--  684
                     P L   PPL       E  G G     IDLN+  AE  +E DF+ QLQ   
Sbjct  141  GGSSALVTLPLLQCSPPLPSKCMEPEIKGKGV----IDLNK-TAEVVQEIDFLKQLQGPI  195

Query  685  ---------VITPHPVRLIGSTVFV  732
                     VI+P P+R + S + V
Sbjct  196  TTTTITTSRVISPQPIRPVCSKINV  220



>tpg|DAA45925.1| TPA: hypothetical protein ZEAMMB73_041604 [Zea mays]
Length=310

 Score = 80.5 bits (197),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 59/181 (33%), Positives = 84/181 (46%), Gaps = 15/181 (8%)
 Frame = +1

Query  649   PEEFDFMPQLQ--PVITPHPVRLIGSTVFVG----CILHSDPPAPPYTTSLKTaadvese  810
             P E D + +LQ   VI P P R + +T+ +      ++ S P      ++          
Sbjct  122   PVERDLISKLQVPKVIRPRPARPLWTTICIDSSNIAVVGSGPETAASASNKTAREVEAEL  181

Query  811   aeavsLPILVSDVNNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTISGEVAIQ---F  981
                 +LP +VS   N+V L N AYK +VGQP C WLD LP   +  + I+G VA+    F
Sbjct  182   ELPGALPAVVSGPRNRVHLVNDAYKAMVGQPVCPWLDALPGAGA-SRRINGIVALDVRTF  240

Query  982   SNSVNLP----VSSNRFTCWVRMEWSNNDGKK-TTVRAFCDAVKLACHSKDYLFQWRFHT  1146
               +  LP     SS+ F C  R+ W +  G    ++   C    LA  S DY F WRF +
Sbjct  241   GPAPRLPKNAGSSSDAFPCTARITWEHGGGSAIASLTVPCAVEHLAGGSGDYRFIWRFDS  300

Query  1147  S  1149
             S
Sbjct  301   S  301



>ref|XP_004986877.1| PREDICTED: uncharacterized protein LOC101752712 [Setaria italica]
Length=315

 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 91/177 (51%), Gaps = 11/177 (6%)
 Frame = +1

Query  655   EFDFMPQLQ--PVITPHPVRLIGSTVFVGC--ILHSDPPAPPYTTSLKTaadveseaea-  819
             E D + +LQ   VI PHP R   +T+ + C  I+ S         S KT  +VE+E E  
Sbjct  135   ERDLISKLQVPKVIKPHPTRPKRTTICIDCSNIVESTTWLVEVAVSKKTTREVEAELELP  194

Query  820   vsLPILVSDVNN-KVRLANSAYKELVGQPECRWLDLLPPFHSPCKTISGEVAI---QFSN  987
              +LP +VS  NN +V L N AYK++VGQP C WL+ L    +  + ++GEV +    FS 
Sbjct  195   NALPAIVSGCNNNRVHLTNDAYKKMVGQPLCPWLNSLLGAGAS-RRMNGEVVLYVQMFSI  253

Query  988   SVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHTSDNN  1158
                LP +   F C  ++ W + DG  + +   C    L  +S DY F WRF +  ++
Sbjct  254   VSCLPSNRCAFPCTAKISWQHEDGTASLIVP-CAVEHLTGNSDDYCFIWRFDSKKSS  309



>emb|CDY11795.1| BnaC03g57830D [Brassica napus]
Length=215

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 88/200 (44%), Gaps = 48/200 (24%)
 Frame = +1

Query  208  AEILARYRPIAPKPEAPTSPSADNNA---LPENIRKSAFLRNVWPHLQARPTRTRKRGRS  378
            AEIL++YRPIAP+P   T+ + DN++   +   I +S +LR++WP LQARPTRTRKRGR 
Sbjct  23   AEILSKYRPIAPRPG--TTQANDNDSSSFMSHKINQSPYLRHLWPQLQARPTRTRKRGRG  80

Query  379  AFALP---PLKRARSCFQGFapaaapppppYHQVLNSSAAANTWANY-PTGFPQIPMIHH  546
                     LKR +S                   L +SA   T   + P          H
Sbjct  81   GIGPTSHLSLKRPKS-------------------LATSAKTPTQRVFGPIKTLAFQAFSH  121

Query  547  PNLPPLMDSPAAAETSGGGRVLRGIDLNR-----EAAESPE--EFDFMPQLQP-------  684
              LP L      A  +GG   L  + L +          PE  E DF+ QLQ        
Sbjct  122  AGLPNLTTQVGYALKNGGSPALVTLPLLQCSPLSSKCMEPEIKEKDFLKQLQGPIRTTTA  181

Query  685  ------VITPHPVRLIGSTV  726
                  VITP P+R + S +
Sbjct  182  ATAASRVITPQPIRPVCSRI  201



>ref|XP_001778474.1| predicted protein [Physcomitrella patens]
 gb|EDQ56749.1| predicted protein [Physcomitrella patens]
Length=793

 Score = 69.7 bits (169),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/157 (30%), Positives = 72/157 (46%), Gaps = 9/157 (6%)
 Frame = +1

Query  685   VITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKTaadveseaeavsLPILVSDVNNKVR  864
             VI P PV  +GST+ V  I   DP A P +   ++  +  S  +   +P +++D+  +V+
Sbjct  589   VIAPLPVSALGSTITVESIESLDPHAAPLSEDFESVLETLSTVD---MPSVITDLRFRVK  645

Query  865   LANSAYKELVGQPECRWL-----DLLPPFHSPCKTISGEVAIQFSNSVNLPVSSNRFTCW  1029
               N+AYK +VGQP+C WL       +    SP     G   +   +   LP     FTC 
Sbjct  646   WINTAYKIMVGQPKCSWLASTVGGAVDHVDSPASHRLGGDVLLVCDGTQLPEGIAAFTCR  705

Query  1030  VRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRF  1140
             V + WS+  G         + V+L   +   LF W F
Sbjct  706   VGIRWSHQ-GDHCATSVPSEVVRLDDETAGGLFVWGF  741



>ref|XP_004986768.1| PREDICTED: uncharacterized protein LOC101783930 [Setaria italica]
Length=315

 Score = 68.2 bits (165),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 60/172 (35%), Positives = 84/172 (49%), Gaps = 11/172 (6%)
 Frame = +1

Query  655   EFDFMPQLQ--PVITPHPVRLIGSTVFV--GCILHSDPPAPPYTTSLKTaadveseaea-  819
             E D + +LQ   VI P P R   +T+ +    I+ S         S KT  +VE+E    
Sbjct  135   EHDLISKLQVPKVIKPRPTRPKRTTIRIERSNIIDSTNLLVEVVVSKKTPREVEAELALP  194

Query  820   vsLPILVSDVN-NKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTISGEVAI---QFSN  987
              +LP +VS  N N+V L N AYKE+VGQP C WL+ L    +P + I+GEV +    FS 
Sbjct  195   NALPAIVSGCNSNRVHLTNDAYKEMVGQPLCPWLNSLLGAGAP-RRINGEVVLYVQTFST  253

Query  988   SVNLPVSSNRFTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFH  1143
                L  +   F C  R+ W + D     +   C   ++  +S DY F WRF 
Sbjct  254   VSCLQSTWCAFPCTARISWEDEDA-TVFLTVPCAIERVTGNSDDYCFIWRFD  304



>ref|XP_001751813.1| predicted protein [Physcomitrella patens]
 gb|EDQ83248.1| predicted protein [Physcomitrella patens]
Length=781

 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 80/165 (48%), Gaps = 11/165 (7%)
 Frame = +1

Query  676   LQPVITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKTaadveseaeavsLPILVSDVNN  855
             L  VI P PVR +GST+ V  I+  D  + P T   +   +   +A+    P +V+D   
Sbjct  606   LANVIAPQPVRAVGSTITVQTIVSLDRHSVPLTEPFQDVQERLDKADK---PSVVTDSRF  662

Query  856   KVRLANSAYKELVGQPECRWLDLLPPF-----HSPCKT-ISGEVAIQFSNSVNLPVSSNR  1017
             +V+  N+AYK LVGQP+  WL            SP    ++G+V++   +   LP     
Sbjct  663   RVKWVNTAYKRLVGQPKLFWLASTGSSSEDHEDSPAALRLAGDVSL-ICDGTQLPDGIAA  721

Query  1018  FTCWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHTSD  1152
             FTC V ++WS+  G+ + +    +  +L   + D ++ W F   D
Sbjct  722   FTCRVGIQWSHQ-GEHSAMSVPSEVFRLEDGAIDSMYVWGFDVYD  765



>ref|XP_001763429.1| predicted protein [Physcomitrella patens]
 gb|EDQ71618.1| predicted protein [Physcomitrella patens]
Length=616

 Score = 63.9 bits (154),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 77/163 (47%), Gaps = 13/163 (8%)
 Frame = +1

Query  685   VITPHPVRLIGSTVFVGCILHSDPPAPPYTTSLKTaadveseaeavsLPILVSDVNNKVR  864
             VI P PVR +GST+ V  I+  D  + P T   +T  DV+   +   +P +V+D+  +V+
Sbjct  444   VIAPQPVRAVGSTITVQTIVSFDRHSVPLT---ETFQDVQERLDKGDMPYVVTDLKFRVK  500

Query  865   LANSAYKELVGQPECRWLDLLPPFHSPCKTISGEVAIQFSNSVNLPVSSNR-------FT  1023
               N+AYK LVGQP+  W  L     S         +++ +  V+L     +       FT
Sbjct  501   WVNTAYKRLVGQPKLSW--LASTVGSGADHEDSPASLRLAGDVSLVCDGAQIMDEIAAFT  558

Query  1024  CWVRMEWSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHTSD  1152
             C V + WS+  G+ + +    +  +L   +   ++ W F   D
Sbjct  559   CRVGIHWSHQ-GEHSAMSVPSEVFRLEDGTAGSMYVWGFDVCD  600



>ref|XP_002465070.1| hypothetical protein SORBIDRAFT_01g031577 [Sorghum bicolor]
 gb|EER92068.1| hypothetical protein SORBIDRAFT_01g031577 [Sorghum bicolor]
Length=215

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 60/208 (29%), Positives = 85/208 (41%), Gaps = 41/208 (20%)
 Frame = +1

Query  637   AAESPEEFDFMPQLQ--PVITPHPVRLIGSTVFVGCILHSDPP--------APPYTTSLK  786
             AA  P E D + +LQ   VI P P R + +T+   CI  S+          A P TTS  
Sbjct  3     AAAVPVERDLISKLQVPKVIKPRPARPLCTTI---CIDSSNIADAVDGGGVAYPETTSTV  59

Query  787   Taadveseaeav------sLPILVSDVN-NKVRLANSAYKELVGQPECRWLDLLP-----  930
             + +   +           +LP +VS  + N+V L N AYK +VGQP C WLD LP     
Sbjct  60    SVSSKTAREVETELELPGALPAVVSGHHHNRVHLVNDAYKAMVGQPVCPWLDYLPGGAGA  119

Query  931   PFHSPCKTISGEVAIQF-------------SNSVNLPVSSNRFTCWVRMEWSNNDGKKTT  1071
                +  + I+G V +                + V   V +  F C  R+ W    G    
Sbjct  120   GVSTTSRRINGIVVLDVRKFGPAAAPPRRPPDVVGGSVDAA-FPCTARITWEQGGGNAIA  178

Query  1072  VRAFCDAVK--LACHSKDYLFQWRFHTS  1149
                    V+  +   S DY + WRF +S
Sbjct  179   SLTVPCTVEHLIGSRSGDYRYIWRFDSS  206



>ref|XP_004965172.1| PREDICTED: uncharacterized protein LOC101781072 [Setaria italica]
Length=104

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 48/95 (51%), Gaps = 5/95 (5%)
 Frame = +1

Query  871   NSAYKELVGQPECRWLDLLPPFHSPCKTISGEVAI---QFSNSVNLPVSSNRFTCWVRME  1041
             N AYKE+VGQP C+WLD LP   +  + I+G+V +   ++S    +P +   F C   + 
Sbjct  2     NDAYKEMVGQPLCQWLDSLPGADAS-RRINGKVVLYAQKYSTVSYMPSTRCVFPCTTNIS  60

Query  1042  WSNNDGKKTTVRAFCDAVKLACHSKDYLFQWRFHT  1146
             W + D   T++   C    L     +Y F  RF +
Sbjct  61    WEDGDA-TTSLIVPCAVEHLTSSPNEYCFIRRFDS  94



>ref|NP_001170581.1| uncharacterized protein LOC100384611 [Zea mays]
 gb|ACR34107.1| unknown [Zea mays]
Length=103

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 47/95 (49%), Gaps = 9/95 (9%)
 Frame = +1

Query  889   LVGQPECRWLDLLPPFHSPCKTISGEVAIQ---FSNSVNLP----VSSNRFTCWVRMEWS  1047
             +VGQP C WLD LP   +  + I+G VA+    F  +  LP     SS+ F C  R+ W 
Sbjct  1     MVGQPVCPWLDALPGAGAS-RRINGIVALDVRTFGPAPRLPKNAGSSSDAFPCTARITWE  59

Query  1048  NNDGKK-TTVRAFCDAVKLACHSKDYLFQWRFHTS  1149
             +  G    ++   C    LA  S DY F WRF +S
Sbjct  60    HGGGSAIASLTVPCAVEHLAGGSGDYRFIWRFDSS  94



>ref|XP_006850275.1| hypothetical protein AMTR_s00020p00118800 [Amborella trichopoda]
 gb|ERN11856.1| hypothetical protein AMTR_s00020p00118800 [Amborella trichopoda]
Length=340

 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 44/159 (28%), Positives = 76/159 (48%), Gaps = 22/159 (14%)
 Frame = +1

Query  685   VITPHPVRLIGSTVFVGCI-----LHSDPPAPPYTTSLKTaadveseaeavsLPILVSDV  849
             V+ P P+R +GS+V + CI     L  +       +   +A +++   E    PILVSD 
Sbjct  189   VVVPQPMRRVGSSVTLECITNECILVCNGSEFSMNSLAPSAEEMQKLLEWDESPILVSDS  248

Query  850   NNKVRLANSAYKELVGQPECRWLDLLPPFHSPCKTISGEVAIQFSNSVNLPVSSNRFTCW  1029
             +N+V   N AY +LVG+P   W               GE+ + ++    LP+SS+ F+C 
Sbjct  249   SNRVVWTNQAYLQLVGRPP-EWCG---------GGGRGEMVVLWTRE-KLPLSSSSFSCR  297

Query  1030  VRMEWSNNDGKKTTVRAFCDAVKLACH-SKDYLFQWRFH  1143
              +++WS+N     T+   CD  ++    +  Y + W+  
Sbjct  298   AKIQWSSN-----TLMVPCDVWRVCSEPAAIYYYAWKLD  331



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5313667069557