BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79959_g1_i1 len=1735 path=[1:0-1734]

Length=1735
                                                                      Score     E

ref|XP_006351861.1|  PREDICTED: serine carboxypeptidase-like 42-like    657   0.0      
ref|XP_009767155.1|  PREDICTED: serine carboxypeptidase-like 42 i...    657   0.0      
ref|XP_009586680.1|  PREDICTED: serine carboxypeptidase-like 42         650   0.0      
ref|XP_010245825.1|  PREDICTED: serine carboxypeptidase-like 42         650   0.0      
ref|XP_011074776.1|  PREDICTED: serine carboxypeptidase-like 42         650   0.0      
ref|XP_010315077.1|  PREDICTED: serine carboxypeptidase-like 42 i...    648   0.0      
ref|XP_004230572.1|  PREDICTED: serine carboxypeptidase-like 42 i...    647   0.0      
ref|XP_011101717.1|  PREDICTED: serine carboxypeptidase-like 42         643   0.0      
gb|EYU17411.1|  hypothetical protein MIMGU_mgv1a005783mg                643   0.0      
ref|XP_010679983.1|  PREDICTED: serine carboxypeptidase-like 42         641   0.0      
ref|XP_004237734.1|  PREDICTED: serine carboxypeptidase-like 42         640   0.0      
ref|XP_009600050.1|  PREDICTED: serine carboxypeptidase-like 42         640   0.0      
ref|XP_006356286.1|  PREDICTED: serine carboxypeptidase-like 42-like    640   0.0      
ref|XP_009798650.1|  PREDICTED: serine carboxypeptidase-like 42 i...    639   0.0      
ref|XP_002278193.1|  PREDICTED: serine carboxypeptidase-like 42 i...    637   0.0      Vitis vinifera
gb|KDP43043.1|  hypothetical protein JCGZ_25229                         638   0.0      
ref|XP_002526159.1|  serine carboxypeptidase, putative                  634   0.0      Ricinus communis
ref|XP_003544740.2|  PREDICTED: serine carboxypeptidase-like 42-l...    634   0.0      
ref|XP_007019397.1|  Serine carboxypeptidase-like 42 isoform 1          632   0.0      
ref|XP_010244030.1|  PREDICTED: serine carboxypeptidase-like 42 i...    632   0.0      
ref|XP_004290564.1|  PREDICTED: serine carboxypeptidase-like 42-like    631   0.0      
ref|XP_002268397.1|  PREDICTED: serine carboxypeptidase-like 42         631   0.0      Vitis vinifera
ref|XP_010244029.1|  PREDICTED: serine carboxypeptidase-like 42 i...    630   0.0      
gb|KHN05260.1|  Serine carboxypeptidase-like 42                         627   0.0      
ref|XP_008786550.1|  PREDICTED: serine carboxypeptidase-like 42         627   0.0      
ref|XP_003527966.2|  PREDICTED: serine carboxypeptidase-like 42-l...    627   0.0      
ref|XP_008237677.1|  PREDICTED: serine carboxypeptidase-like 42         626   0.0      
ref|XP_009767156.1|  PREDICTED: serine carboxypeptidase-like 42 i...    625   0.0      
gb|KHF97371.1|  Serine carboxypeptidase-like 42                         626   0.0      
ref|XP_004490638.1|  PREDICTED: serine carboxypeptidase-like 42-l...    624   0.0      
ref|XP_002300939.1|  serine carboxypeptidase S10 family protein         624   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004148827.1|  PREDICTED: serine carboxypeptidase-like 42-like    622   0.0      
ref|XP_010930631.1|  PREDICTED: serine carboxypeptidase-like 42         621   0.0      
ref|XP_003522555.2|  PREDICTED: serine carboxypeptidase-like 42-l...    621   0.0      
ref|XP_010062160.1|  PREDICTED: serine carboxypeptidase-like 42         620   0.0      
ref|XP_009360732.1|  PREDICTED: serine carboxypeptidase-like 42         620   0.0      
ref|XP_008373913.1|  PREDICTED: serine carboxypeptidase-like 42         620   0.0      
ref|XP_010530237.1|  PREDICTED: serine carboxypeptidase-like 42         620   0.0      
ref|XP_009414969.1|  PREDICTED: serine carboxypeptidase-like 42         620   0.0      
ref|XP_008461495.1|  PREDICTED: serine carboxypeptidase-like 42 i...    620   0.0      
ref|XP_011027377.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    619   0.0      
ref|XP_003615811.1|  Serine carboxypeptidase-like protein               619   0.0      
ref|XP_006472927.1|  PREDICTED: serine carboxypeptidase-like 42-like    619   0.0      
ref|XP_009406489.1|  PREDICTED: serine carboxypeptidase-like 42         618   0.0      
gb|KGN44500.1|  hypothetical protein Csa_7G319000                       618   0.0      
ref|XP_009377699.1|  PREDICTED: serine carboxypeptidase-like 42         616   0.0      
ref|XP_008373914.1|  PREDICTED: serine carboxypeptidase-like 42         615   0.0      
ref|XP_010519388.1|  PREDICTED: serine carboxypeptidase-like 42         614   0.0      
ref|XP_004979109.1|  PREDICTED: serine carboxypeptidase-like 42-like    613   0.0      
ref|XP_007137531.1|  hypothetical protein PHAVU_009G134900g             613   0.0      
ref|XP_006434388.1|  hypothetical protein CICLE_v10000998mg             612   0.0      
ref|XP_002449388.1|  hypothetical protein SORBIDRAFT_05g009120          611   0.0      Sorghum bicolor [broomcorn]
ref|XP_003577714.1|  PREDICTED: serine carboxypeptidase-like 42         610   0.0      
ref|XP_004490637.1|  PREDICTED: serine carboxypeptidase-like 42-l...    611   0.0      
emb|CDP12019.1|  unnamed protein product                                609   0.0      
gb|AFW60600.1|  serine carboxypeptidase F13S12.6                        608   0.0      
ref|XP_004977164.1|  PREDICTED: serine carboxypeptidase-like 42-l...    608   0.0      
ref|NP_001151858.1|  serine carboxypeptidase F13S12.6 precursor         607   0.0      Zea mays [maize]
ref|XP_002865546.1|  hypothetical protein ARALYDRAFT_494806             606   0.0      
ref|XP_009377698.1|  PREDICTED: serine carboxypeptidase-like 42         605   0.0      
ref|NP_199039.1|  serine carboxypeptidase-like 42                       605   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006663298.1|  PREDICTED: serine carboxypeptidase-like 42-like    605   0.0      
ref|NP_001067496.1|  Os11g0213600                                       603   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006280410.1|  hypothetical protein CARUB_v10026343mg             603   0.0      
gb|KHN23425.1|  Serine carboxypeptidase-like 42                         600   0.0      
ref|XP_010442147.1|  PREDICTED: serine carboxypeptidase-like 42         600   0.0      
emb|CDY48945.1|  BnaA08g04690D                                          600   0.0      
ref|XP_009107652.1|  PREDICTED: serine carboxypeptidase-like 44 i...    598   0.0      
ref|XP_009107650.1|  PREDICTED: serine carboxypeptidase-like 44 i...    598   0.0      
ref|XP_009107648.1|  PREDICTED: serine carboxypeptidase-like 44 i...    598   0.0      
ref|NP_001183841.1|  hypothetical protein precursor                     598   0.0      
ref|XP_009107653.1|  PREDICTED: serine carboxypeptidase-like 44 i...    597   0.0      
ref|XP_009377728.1|  PREDICTED: serine carboxypeptidase-like 42         598   0.0      
gb|EEE51848.1|  hypothetical protein OsJ_33355                          597   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010482006.1|  PREDICTED: serine carboxypeptidase-like 42         597   0.0      
gb|ACM17527.1|  putative serine carboxy peptidase                       595   0.0      Oryza australiensis
emb|CDX80725.1|  BnaC08g05590D                                          595   0.0      
ref|XP_010479023.1|  PREDICTED: serine carboxypeptidase-like 44         595   0.0      
gb|KFK24266.1|  hypothetical protein AALP_AAs40498U001000               595   0.0      
ref|XP_002863806.1|  hypothetical protein ARALYDRAFT_331179             593   0.0      
ref|XP_006307408.1|  hypothetical protein CARUB_v10009034mg             593   0.0      
ref|XP_006858474.1|  hypothetical protein AMTR_s00071p00113850          592   0.0      
ref|NP_175046.1|  serine carboxypeptidase-like 44                       588   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002891272.1|  predicted protein                                  587   0.0      
ref|XP_004502581.1|  PREDICTED: serine carboxypeptidase-like 42-like    585   0.0      
ref|XP_010493597.1|  PREDICTED: serine carboxypeptidase-like 42         585   0.0      
ref|XP_006393769.1|  hypothetical protein EUTSA_v10011445mg             584   0.0      
ref|XP_007019399.1|  Serine carboxypeptidase-like 42 isoform 3          577   0.0      
ref|NP_199038.1|  serine carboxypeptidase-like 41                       577   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_003602149.1|  Serine carboxypeptidase-like protein               574   0.0      
ref|XP_002865553.1|  hypothetical protein ARALYDRAFT_494807             574   0.0      
ref|XP_006279617.1|  hypothetical protein CARUB_v10026338mg             574   0.0      
ref|XP_007019398.1|  Serine carboxypeptidase-like 42 isoform 2          569   0.0      
ref|XP_006596272.1|  PREDICTED: serine carboxypeptidase-like 42-l...    570   0.0      
ref|XP_009136205.1|  PREDICTED: serine carboxypeptidase-like 42         568   0.0      
ref|XP_008461496.1|  PREDICTED: serine carboxypeptidase-like 42 i...    563   0.0      
ref|XP_004515138.1|  PREDICTED: serine carboxypeptidase-like 42-like    563   0.0      
ref|XP_010110480.1|  Serine carboxypeptidase-like 42                    560   0.0      
ref|XP_010468548.1|  PREDICTED: serine carboxypeptidase-like 43         561   0.0      
gb|AAD28662.1|  putative serine carboxypeptidase II                     560   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010664883.1|  PREDICTED: serine carboxypeptidase-like 42 i...    557   0.0      
ref|XP_009112251.1|  PREDICTED: serine carboxypeptidase-like 42         559   0.0      
gb|KGN47484.1|  hypothetical protein Csa_6G338160                       569   0.0      
ref|XP_006299245.1|  hypothetical protein CARUB_v10015394mg             555   0.0      
ref|XP_009123167.1|  PREDICTED: serine carboxypeptidase-like 42         556   0.0      
ref|XP_004173353.1|  PREDICTED: serine carboxypeptidase-like 42-like    548   0.0      
ref|XP_006578942.1|  PREDICTED: serine carboxypeptidase-like 42-l...    550   0.0      
emb|CDY23340.1|  BnaA08g12060D                                          548   0.0      
gb|KEH35413.1|  serine carboxypeptidase-like protein                    548   0.0      
ref|XP_004977165.1|  PREDICTED: serine carboxypeptidase-like 42-l...    544   0.0      
emb|CDY66139.1|  BnaAnng21620D                                          539   0.0      
emb|CAN74668.1|  hypothetical protein VITISV_005686                     532   0.0      Vitis vinifera
gb|KDO83614.1|  hypothetical protein CISIN_1g0117641mg                  530   0.0      
gb|ABK25236.1|  unknown                                                 531   0.0      Picea sitchensis
gb|EAY80352.1|  hypothetical protein OsI_35523                          531   4e-180   Oryza sativa Indica Group [Indian rice]
gb|EMT33269.1|  Serine carboxypeptidase-like 42                         530   5e-180   
emb|CDX93108.1|  BnaA03g38300D                                          528   9e-180   
emb|CDY70042.1|  BnaCnng66490D                                          527   1e-179   
ref|XP_006434389.1|  hypothetical protein CICLE_v10000998mg             521   9e-178   
gb|EMS56738.1|  Serine carboxypeptidase-like 42                         513   2e-174   
ref|XP_009107654.1|  PREDICTED: serine carboxypeptidase-like 44 i...    512   2e-174   
ref|NP_178937.2|  serine carboxypeptidase-like 43                       506   2e-171   Arabidopsis thaliana [mouse-ear cress]
gb|KDO83613.1|  hypothetical protein CISIN_1g0117641mg                  503   6e-171   
ref|NP_001031351.1|  serine carboxypeptidase-like 43                    501   1e-169   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010463193.1|  PREDICTED: serine carboxypeptidase-like 44         498   1e-168   
ref|XP_002885858.1|  predicted protein                                  496   2e-167   
emb|CDX81435.1|  BnaC09g08460D                                          483   5e-163   
emb|CDY51660.1|  BnaC03g66990D                                          483   2e-162   
ref|XP_004139740.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    508   1e-160   
emb|CDY37202.1|  BnaA09g08230D                                          477   6e-160   
ref|XP_002967656.1|  serine carboxypeptidase-like enzyme                473   3e-158   
ref|XP_010239229.1|  PREDICTED: serine carboxypeptidase-like 42         469   4e-158   
gb|KDO83622.1|  hypothetical protein CISIN_1g0117641mg                  468   2e-157   
ref|XP_002964377.1|  serine carboxypeptidase-like enzyme                470   4e-157   
gb|AFW60601.1|  hypothetical protein ZEAMMB73_172356                    462   2e-155   
ref|XP_002974500.1|  serine carboxypeptidase-like enzyme                460   6e-153   
ref|XP_002990798.1|  serine carboxypeptidase-like enzyme                456   1e-151   
ref|XP_010315079.1|  PREDICTED: serine carboxypeptidase-like 42 i...    452   1e-151   
ref|XP_010315078.1|  PREDICTED: serine carboxypeptidase-like 42 i...    451   2e-151   
ref|XP_002971138.1|  serine carboxypeptidase-like enzyme                449   8e-149   
ref|XP_002961948.1|  serine carboxypeptidase-like enzyme                448   2e-148   
gb|EMS54298.1|  Serine carboxypeptidase-like 42                         442   6e-147   
gb|EMT31513.1|  Serine carboxypeptidase-like 42                         442   2e-146   
gb|KDO83623.1|  hypothetical protein CISIN_1g0117641mg                  437   5e-146   
ref|XP_006581614.1|  PREDICTED: serine carboxypeptidase-like 42-l...    437   5e-145   
ref|XP_007201403.1|  hypothetical protein PRUPE_ppa008027mg             432   8e-144   
ref|XP_002972012.1|  serine carboxypeptidase-like enzyme                434   8e-143   
ref|XP_002972549.1|  serine carboxypeptidase-like enzyme                431   5e-142   
ref|XP_008677381.1|  PREDICTED: serine carboxypeptidase F13S12.6 ...    431   3e-141   
gb|ACR37620.1|  unknown                                                 419   2e-139   Zea mays [maize]
dbj|BAJ87921.1|  predicted protein                                      417   8e-139   
gb|KDO83617.1|  hypothetical protein CISIN_1g0117641mg                  417   9e-139   
ref|XP_006830556.1|  hypothetical protein AMTR_s00117p00106310          422   8e-138   
ref|XP_007161488.1|  hypothetical protein PHAVU_001G0732000g            407   7e-135   
ref|XP_004167283.1|  PREDICTED: serine carboxypeptidase-like 42-like    403   3e-132   
ref|XP_007021534.1|  Serine carboxypeptidase 44                         393   7e-127   
ref|XP_007021532.1|  Serine carboxypeptidase 44                         390   5e-126   
ref|XP_007021681.1|  Serine carboxypeptidase 44                         388   4e-125   
ref|XP_010271868.1|  PREDICTED: serine carboxypeptidase-like 45 i...    384   8e-123   
ref|XP_002862434.1|  hypothetical protein ARALYDRAFT_497456             345   1e-122   
ref|XP_010271867.1|  PREDICTED: serine carboxypeptidase-like 45 i...    383   2e-122   
ref|XP_009778790.1|  PREDICTED: serine carboxypeptidase-like 45         380   4e-122   
ref|XP_008222371.1|  PREDICTED: serine carboxypeptidase-like 45 i...    380   5e-122   
ref|XP_009415855.1|  PREDICTED: serine carboxypeptidase-like 45         380   6e-122   
gb|ABK25202.1|  unknown                                                 379   8e-122   Picea sitchensis
ref|XP_007021444.1|  Serine carboxypeptidase 44 isoform 2               379   8e-122   
ref|XP_007021443.1|  Serine carboxypeptidase 44 isoform 1               380   9e-122   
ref|XP_010413849.1|  PREDICTED: serine carboxypeptidase-like 46         379   1e-121   
ref|XP_004501743.1|  PREDICTED: serine carboxypeptidase-like 45-like    379   1e-121   
ref|XP_008222370.1|  PREDICTED: serine carboxypeptidase-like 45 i...    379   1e-121   
ref|XP_009599118.1|  PREDICTED: serine carboxypeptidase-like 45         379   1e-121   
ref|XP_010469459.1|  PREDICTED: serine carboxypeptidase-like 46         379   2e-121   
ref|XP_010929656.1|  PREDICTED: serine carboxypeptidase-like 45         378   4e-121   
ref|XP_009378815.1|  PREDICTED: serine carboxypeptidase-like 45         377   7e-121   
ref|XP_007223032.1|  hypothetical protein PRUPE_ppa005360mg             377   9e-121   
gb|KDO83181.1|  hypothetical protein CISIN_1g012396mg                   377   1e-120   
ref|XP_007038110.1|  Serine carboxypeptidase-like 45 isoform 1          376   1e-120   
ref|XP_004235841.1|  PREDICTED: serine carboxypeptidase-like 45 i...    376   1e-120   
ref|XP_006483005.1|  PREDICTED: serine carboxypeptidase-like 45-like    376   2e-120   
ref|XP_002318164.2|  hypothetical protein POPTR_0012s10730g             376   2e-120   Populus trichocarpa [western balsam poplar]
ref|XP_007223033.1|  hypothetical protein PRUPE_ppa005360mg             376   2e-120   
ref|XP_007021448.1|  Serine carboxypeptidase 44                         376   2e-120   
ref|XP_010509871.1|  PREDICTED: serine carboxypeptidase-like 46         376   2e-120   
ref|XP_010249188.1|  PREDICTED: serine carboxypeptidase-like 45         377   3e-120   
ref|XP_009143848.1|  PREDICTED: serine carboxypeptidase-like 46         375   4e-120   
ref|XP_002268172.1|  PREDICTED: serine carboxypeptidase-like 45         375   5e-120   Vitis vinifera
ref|XP_006844530.1|  hypothetical protein AMTR_s00016p00162700          375   5e-120   
emb|CBI32794.3|  unnamed protein product                                374   6e-120   
gb|KHN31265.1|  Serine carboxypeptidase-like 45                         374   6e-120   
gb|ABR16719.1|  unknown                                                 374   7e-120   Picea sitchensis
ref|XP_009359890.1|  PREDICTED: serine carboxypeptidase-like 45         374   8e-120   
ref|XP_008791046.1|  PREDICTED: serine carboxypeptidase-like 45         374   8e-120   
ref|XP_006578724.1|  PREDICTED: serine carboxypeptidase-like 45-like    374   9e-120   
ref|XP_010653629.1|  PREDICTED: serine carboxypeptidase-like 45         374   1e-119   
emb|CDO98312.1|  unnamed protein product                                374   1e-119   
ref|XP_010549305.1|  PREDICTED: serine carboxypeptidase-like 45 i...    374   1e-119   
ref|XP_008390188.1|  PREDICTED: serine carboxypeptidase-like 45         374   1e-119   
ref|XP_002512656.1|  serine carboxypeptidase, putative                  373   2e-119   Ricinus communis
emb|CDY19500.1|  BnaC04g10990D                                          373   2e-119   
ref|XP_006294161.1|  hypothetical protein CARUB_v10023154mg             373   3e-119   
ref|XP_006341487.1|  PREDICTED: serine carboxypeptidase-like 45-like    373   3e-119   
gb|KDO83625.1|  hypothetical protein CISIN_1g0117641mg                  368   3e-119   
ref|XP_006438864.1|  hypothetical protein CICLE_v10031451mg             373   4e-119   
ref|XP_010239839.1|  PREDICTED: serine carboxypeptidase-like 45         372   4e-119   
ref|XP_010549304.1|  PREDICTED: serine carboxypeptidase-like 45 i...    372   5e-119   
ref|NP_850212.1|  serine carboxypeptidase-like 46                       372   6e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011036160.1|  PREDICTED: serine carboxypeptidase-like 45 i...    372   6e-119   
ref|XP_006430527.1|  hypothetical protein CICLE_v10011695mg             371   9e-119   
ref|XP_006482059.1|  PREDICTED: serine carboxypeptidase-like 45-like    371   1e-118   
ref|XP_002307963.1|  hypothetical protein POPTR_0006s03490g             371   1e-118   Populus trichocarpa [western balsam poplar]
ref|XP_009759845.1|  PREDICTED: serine carboxypeptidase-like 45         371   1e-118   
ref|XP_006415698.1|  hypothetical protein EUTSA_v10007573mg             371   1e-118   
gb|KEH35690.1|  serine carboxypeptidase-like protein                    370   1e-118   
ref|XP_011073181.1|  PREDICTED: serine carboxypeptidase-like 45         371   2e-118   
ref|XP_006304410.1|  hypothetical protein CARUB_v10010972mg             371   2e-118   
ref|XP_010044871.1|  PREDICTED: serine carboxypeptidase-like 45         371   2e-118   
ref|XP_002511104.1|  serine carboxypeptidase, putative                  370   3e-118   Ricinus communis
ref|XP_011036159.1|  PREDICTED: serine carboxypeptidase-like 45 i...    370   3e-118   
gb|AAB80670.1|  putative serine carboxypeptidase II                     370   4e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009380118.1|  PREDICTED: serine carboxypeptidase-like 45 i...    370   5e-118   
ref|XP_009615672.1|  PREDICTED: serine carboxypeptidase-like 45 i...    369   7e-118   
ref|XP_004241645.1|  PREDICTED: serine carboxypeptidase-like 45         369   7e-118   
ref|XP_003528093.2|  PREDICTED: serine carboxypeptidase-like 45-like    369   1e-117   
ref|XP_002297872.2|  serine carboxypeptidase S10 family protein         369   1e-117   Populus trichocarpa [western balsam poplar]
ref|XP_009380117.1|  PREDICTED: serine carboxypeptidase-like 45 i...    370   1e-117   
gb|KDP23272.1|  hypothetical protein JCGZ_23105                         369   2e-117   
ref|XP_007159978.1|  hypothetical protein PHAVU_002G282700g             369   2e-117   
ref|XP_009337518.1|  PREDICTED: serine carboxypeptidase-like 45         369   2e-117   
ref|XP_009334311.1|  PREDICTED: serine carboxypeptidase-like 45         368   2e-117   
ref|XP_011020860.1|  PREDICTED: serine carboxypeptidase-like 45         368   2e-117   
ref|XP_004492026.1|  PREDICTED: serine carboxypeptidase-like 45-like    368   2e-117   
ref|XP_008777393.1|  PREDICTED: serine carboxypeptidase-like 45 i...    368   3e-117   
ref|XP_002881286.1|  hypothetical protein ARALYDRAFT_482299             367   3e-117   
ref|XP_004310134.1|  PREDICTED: serine carboxypeptidase-like 45-like    367   3e-117   
ref|XP_002280796.2|  PREDICTED: serine carboxypeptidase-like 45         368   3e-117   Vitis vinifera
ref|XP_007139316.1|  hypothetical protein PHAVU_008G019100g             367   4e-117   
ref|XP_010250555.1|  PREDICTED: serine carboxypeptidase-like 45         368   6e-117   
emb|CDX90124.1|  BnaA08g18600D                                          367   7e-117   
ref|XP_010678341.1|  PREDICTED: serine carboxypeptidase-like 45         367   7e-117   
ref|XP_007021438.1|  Serine carboxypeptidase 44                         369   8e-117   
gb|KHN09723.1|  Serine carboxypeptidase-like 45                         366   8e-117   
ref|XP_007137891.1|  hypothetical protein PHAVU_009G164600g             367   8e-117   
ref|XP_003531913.1|  PREDICTED: serine carboxypeptidase-like 45-l...    367   8e-117   
emb|CDY11750.1|  BnaC03g58280D                                          366   9e-117   
ref|XP_011040748.1|  PREDICTED: serine carboxypeptidase-like 45 i...    366   1e-116   
ref|XP_003551804.1|  PREDICTED: serine carboxypeptidase-like 45-like    366   1e-116   
ref|XP_009109757.1|  PREDICTED: serine carboxypeptidase-like 45         366   1e-116   
ref|XP_010460580.1|  PREDICTED: serine carboxypeptidase-like 45         367   1e-116   
gb|KHN13827.1|  Serine carboxypeptidase-like 45                         366   1e-116   
ref|XP_006584695.1|  PREDICTED: serine carboxypeptidase-like 45-l...    366   1e-116   
ref|XP_006434390.1|  hypothetical protein CICLE_v10000998mg             361   1e-116   
ref|XP_011040747.1|  PREDICTED: serine carboxypeptidase-like 45 i...    366   1e-116   
ref|XP_011086871.1|  PREDICTED: serine carboxypeptidase-like 45         366   2e-116   
ref|XP_010478165.1|  PREDICTED: serine carboxypeptidase-like 45         367   2e-116   
ref|XP_008369640.1|  PREDICTED: serine carboxypeptidase-like 45         365   2e-116   
ref|XP_007043816.1|  Serine carboxypeptidase-like 45 isoform 1          365   3e-116   
gb|KHG09716.1|  Serine carboxypeptidase-like 45                         365   4e-116   
gb|AES77859.2|  serine carboxypeptidase-like protein                    365   4e-116   
ref|XP_009615670.1|  PREDICTED: serine carboxypeptidase-like 45 i...    365   4e-116   
ref|XP_009368797.1|  PREDICTED: serine carboxypeptidase-like 45         365   5e-116   
ref|NP_564298.1|  serine carboxypeptidase-like 45                       364   5e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010055744.1|  PREDICTED: serine carboxypeptidase-like 45 i...    365   6e-116   
ref|XP_006410496.1|  hypothetical protein EUTSA_v10016623mg             364   8e-116   
ref|XP_010499305.1|  PREDICTED: serine carboxypeptidase-like 45         365   1e-115   
ref|XP_002893504.1|  SCPL45                                             363   1e-115   
ref|XP_004975453.1|  PREDICTED: serine carboxypeptidase-like 45-like    365   1e-115   
ref|XP_008441654.1|  PREDICTED: serine carboxypeptidase-like 42         362   1e-115   
gb|AAG51475.1|AC069471_6  serine carboxypeptidase II, putative          363   1e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007203526.1|  hypothetical protein PRUPE_ppa026347mg             363   2e-115   
gb|KDP37690.1|  hypothetical protein JCGZ_06347                         363   2e-115   
ref|XP_002517289.1|  serine carboxypeptidase, putative                  363   2e-115   Ricinus communis
ref|XP_008240683.1|  PREDICTED: serine carboxypeptidase-like 45         362   2e-115   
ref|XP_007159977.1|  hypothetical protein PHAVU_002G282700g             363   2e-115   
gb|KHN47533.1|  Serine carboxypeptidase-like 45                         362   2e-115   
ref|XP_009355265.1|  PREDICTED: serine carboxypeptidase-like 45         363   3e-115   
ref|XP_011002097.1|  PREDICTED: serine carboxypeptidase-like 45         362   4e-115   
ref|XP_010099600.1|  Serine carboxypeptidase-like 45                    362   5e-115   
gb|KFK44682.1|  hypothetical protein AALP_AA1G289900                    362   5e-115   
gb|EAY93940.1|  hypothetical protein OsI_15713                          362   6e-115   Oryza sativa Indica Group [Indian rice]
ref|XP_003532390.1|  PREDICTED: serine carboxypeptidase-like 45-l...    361   9e-115   
ref|XP_006662960.1|  PREDICTED: serine carboxypeptidase-like 45-like    361   1e-114   
ref|XP_010942380.1|  PREDICTED: serine carboxypeptidase-like 45         361   1e-114   
ref|XP_010055754.1|  PREDICTED: serine carboxypeptidase-like 45         362   1e-114   
ref|XP_009113703.1|  PREDICTED: serine carboxypeptidase-like 45         360   2e-114   
ref|XP_002446348.1|  hypothetical protein SORBIDRAFT_06g014580          361   2e-114   
gb|EEC68261.1|  hypothetical protein OsI_36290                          361   2e-114   
ref|XP_009355269.1|  PREDICTED: serine carboxypeptidase-like 45         360   2e-114   
ref|XP_011042948.1|  PREDICTED: serine carboxypeptidase-like 45         360   2e-114   
ref|NP_001176565.1|  Os11g0522900                                       360   2e-114   
ref|XP_003577529.1|  PREDICTED: serine carboxypeptidase-like 45         360   2e-114   
ref|NP_001052663.1|  Os04g0396800                                       360   3e-114   
gb|KHN08898.1|  Serine carboxypeptidase-like 45                         359   4e-114   
ref|XP_003554110.2|  PREDICTED: serine carboxypeptidase-like 45-like    360   4e-114   
ref|XP_008667417.1|  PREDICTED: hypothetical protein isoform X1         359   6e-114   
ref|XP_004503800.1|  PREDICTED: serine carboxypeptidase-like 45-like    359   8e-114   
ref|XP_008667418.1|  PREDICTED: hypothetical protein isoform X2         359   9e-114   
ref|XP_008777392.1|  PREDICTED: serine carboxypeptidase-like 45 i...    358   1e-113   
ref|NP_001150027.1|  serine carboxypeptidase K10B2.2 precursor          358   1e-113   
tpg|DAA38059.1|  TPA: hypothetical protein ZEAMMB73_252249              358   1e-113   
ref|XP_010271866.1|  PREDICTED: serine carboxypeptidase-like 45 i...    360   2e-113   
ref|XP_010271865.1|  PREDICTED: serine carboxypeptidase-like 45 i...    360   2e-113   
gb|KCW90016.1|  hypothetical protein EUGRSUZ_A02215                     358   3e-113   
emb|CBI32795.3|  unnamed protein product                                357   3e-113   
ref|XP_010682654.1|  PREDICTED: serine carboxypeptidase-like 45         358   3e-113   
gb|EYU21824.1|  hypothetical protein MIMGU_mgv1a006099mg                357   6e-113   
ref|XP_007145476.1|  hypothetical protein PHAVU_007G242200g             357   6e-113   
ref|XP_002277400.2|  PREDICTED: serine carboxypeptidase-like 45         356   7e-113   
emb|CDY61693.1|  BnaC05g51120D                                          355   1e-112   
ref|XP_008374178.1|  PREDICTED: serine carboxypeptidase-like 45         356   1e-112   
ref|XP_008239549.1|  PREDICTED: serine carboxypeptidase-like 45         356   1e-112   
ref|XP_010271869.1|  PREDICTED: serine carboxypeptidase-like 45 i...    355   3e-112   
gb|EMS58238.1|  Serine carboxypeptidase-like 45                         354   4e-112   
ref|XP_006363923.1|  PREDICTED: serine carboxypeptidase-like 45-like    355   4e-112   
ref|XP_007209121.1|  hypothetical protein PRUPE_ppa005457mg             354   5e-112   
ref|XP_009404114.1|  PREDICTED: serine carboxypeptidase-like 45         354   6e-112   
ref|XP_004298533.1|  PREDICTED: serine carboxypeptidase-like 45-like    354   8e-112   
gb|EMT30771.1|  Serine carboxypeptidase-like 45                         353   8e-112   
ref|XP_003630573.1|  Serine carboxypeptidase                            353   8e-112   
gb|KDO83619.1|  hypothetical protein CISIN_1g0117641mg                  346   1e-111   
ref|XP_010023719.1|  PREDICTED: serine carboxypeptidase-like 45         353   3e-111   
ref|XP_002520628.1|  serine carboxypeptidase, putative                  352   4e-111   
ref|XP_009355267.1|  PREDICTED: serine carboxypeptidase-like 45 i...    352   5e-111   
ref|XP_002282978.2|  PREDICTED: serine carboxypeptidase-like 45         351   5e-111   
ref|XP_003633850.1|  PREDICTED: serine carboxypeptidase-like 46         352   6e-111   
ref|XP_007162065.1|  hypothetical protein PHAVU_001G120700g             351   7e-111   
gb|EYU28449.1|  hypothetical protein MIMGU_mgv1a004999mg                352   8e-111   
ref|XP_004228838.1|  PREDICTED: serine carboxypeptidase-like 45 i...    352   9e-111   
ref|XP_007046208.1|  Serine carboxypeptidase 46 isoform 1               352   1e-110   
gb|KEH33274.1|  serine carboxypeptidase-like protein                    350   1e-110   
ref|XP_007043818.1|  Serine carboxypeptidase-like 45 isoform 3          350   2e-110   
ref|XP_006431096.1|  hypothetical protein CICLE_v10013839mg             350   3e-110   
gb|EPS60190.1|  hypothetical protein M569_14612                         343   3e-110   
ref|XP_003621641.1|  Serine carboxypeptidase-like protein               350   4e-110   
ref|XP_008378883.1|  PREDICTED: serine carboxypeptidase-like 45         349   6e-110   
ref|XP_003520486.1|  PREDICTED: serine carboxypeptidase-like 45-l...    348   1e-109   
ref|XP_006589008.1|  PREDICTED: serine carboxypeptidase-like 45-like    348   2e-109   
ref|XP_009355268.1|  PREDICTED: serine carboxypeptidase-like 45 i...    347   2e-109   
emb|CAN72076.1|  hypothetical protein VITISV_041583                     347   2e-109   
gb|KHN07932.1|  Serine carboxypeptidase-like 45                         347   3e-109   
gb|KDO72509.1|  hypothetical protein CISIN_1g037032mg                   347   3e-109   
ref|XP_006652227.1|  PREDICTED: serine carboxypeptidase-like 45-like    347   4e-109   
ref|XP_004152156.1|  PREDICTED: serine carboxypeptidase-like 45-like    346   7e-109   
ref|XP_011075459.1|  PREDICTED: serine carboxypeptidase-like 45         346   9e-109   
ref|XP_010318664.1|  PREDICTED: serine carboxypeptidase-like 45 i...    344   1e-108   
ref|XP_008454133.1|  PREDICTED: serine carboxypeptidase-like 45         345   1e-108   
ref|XP_007162064.1|  hypothetical protein PHAVU_001G120600g             344   4e-108   
ref|NP_001151474.1|  LOC100285107 precursor                             345   5e-108   
ref|XP_002277201.1|  PREDICTED: serine carboxypeptidase-like 45 i...    344   5e-108   
gb|KDO72510.1|  hypothetical protein CISIN_1g039529mg                   344   6e-108   
ref|XP_007021530.1|  Serine carboxypeptidase 44                         343   7e-108   
ref|XP_002321745.2|  hypothetical protein POPTR_0015s11610g             344   8e-108   
ref|XP_007224935.1|  hypothetical protein PRUPE_ppa021576mg             342   8e-108   
ref|XP_002322611.2|  hypothetical protein POPTR_0016s03390g             342   9e-108   
emb|CBI22166.3|  unnamed protein product                                346   1e-107   
ref|XP_004979352.1|  PREDICTED: serine carboxypeptidase-like 45-like    343   1e-107   
ref|XP_009355272.1|  PREDICTED: serine carboxypeptidase-like 45 i...    342   2e-107   
ref|XP_006431097.1|  hypothetical protein CICLE_v10013776mg             343   2e-107   
ref|XP_006482672.1|  PREDICTED: serine carboxypeptidase-like 46-like    342   3e-107   
ref|XP_010100042.1|  Serine carboxypeptidase-like 45                    341   5e-107   
emb|CBI32802.3|  unnamed protein product                                350   8e-107   
gb|EYU18606.1|  hypothetical protein MIMGU_mgv1a004861mg                342   8e-107   
ref|XP_011091773.1|  PREDICTED: serine carboxypeptidase-like 40         342   1e-106   
ref|XP_007099702.1|  Serine carboxypeptidase 46                         340   2e-106   
ref|XP_010916829.1|  PREDICTED: serine carboxypeptidase II-3-like       340   2e-106   
gb|KHG07552.1|  Serine carboxypeptidase-like 45                         340   2e-106   
gb|KHN08897.1|  Serine carboxypeptidase-like 45                         338   4e-106   
ref|XP_002517286.1|  serine carboxypeptidase, putative                  338   4e-106   
ref|XP_004513403.1|  PREDICTED: serine carboxypeptidase-like 45-like    338   5e-106   
ref|XP_010661029.1|  PREDICTED: serine carboxypeptidase-like 45 i...    339   5e-106   
ref|XP_003554111.1|  PREDICTED: serine carboxypeptidase-like 45-like    338   7e-106   
ref|XP_009762845.1|  PREDICTED: serine carboxypeptidase-like 45         338   1e-105   
ref|XP_009355270.1|  PREDICTED: serine carboxypeptidase-like 45 i...    338   2e-105   
ref|XP_009355271.1|  PREDICTED: serine carboxypeptidase-like 45 i...    338   2e-105   
ref|XP_011088748.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    337   2e-105   
ref|XP_009627244.1|  PREDICTED: serine carboxypeptidase-like 46         337   4e-105   
ref|XP_010068797.1|  PREDICTED: serine carboxypeptidase-like 46         337   4e-105   
ref|XP_004231124.2|  PREDICTED: serine carboxypeptidase-like 40         338   5e-105   
ref|XP_006345489.1|  PREDICTED: serine carboxypeptidase-like 40-like    336   6e-105   
ref|XP_010068798.1|  PREDICTED: serine carboxypeptidase-like 45         337   6e-105   
gb|KCW64996.1|  hypothetical protein EUGRSUZ_G02538                     336   6e-105   
ref|XP_006438918.1|  hypothetical protein CICLE_v10031327mg             335   3e-104   
ref|XP_006482952.1|  PREDICTED: serine carboxypeptidase-like 40-like    335   4e-104   
gb|KDP27243.1|  hypothetical protein JCGZ_19942                         333   6e-104   
ref|XP_004136792.1|  PREDICTED: serine carboxypeptidase-like 45-like    332   9e-104   
ref|XP_007009790.1|  Serine carboxypeptidase-like 28                    332   2e-103   
ref|XP_007216267.1|  hypothetical protein PRUPE_ppa017321mg             332   3e-103   
ref|XP_002449560.1|  hypothetical protein SORBIDRAFT_05g019090          332   3e-103   
ref|XP_011008273.1|  PREDICTED: serine carboxypeptidase-like 40         332   5e-103   
ref|XP_006383613.1|  hypothetical protein POPTR_0005s21010g             327   5e-103   
ref|XP_003552566.1|  PREDICTED: serine carboxypeptidase-like 25-l...    330   8e-103   
ref|XP_006482671.1|  PREDICTED: serine carboxypeptidase-like 44-like    333   1e-102   
ref|XP_010265020.1|  PREDICTED: serine carboxypeptidase-like 45         330   1e-102   
ref|XP_011098746.1|  PREDICTED: serine carboxypeptidase-like 25         330   1e-102   
ref|XP_008243007.1|  PREDICTED: serine carboxypeptidase 24              330   1e-102   
ref|XP_002324116.2|  serine carboxypeptidase S10 family protein         330   2e-102   
ref|XP_010032541.1|  PREDICTED: serine carboxypeptidase-like 25         332   2e-102   
gb|AIC80774.1|  serine carboxypeptidase                                 328   2e-102   
ref|XP_004136793.1|  PREDICTED: serine carboxypeptidase-like 45-like    330   2e-102   
ref|XP_009631140.1|  PREDICTED: serine carboxypeptidase 24-like         329   3e-102   
ref|XP_007204505.1|  hypothetical protein PRUPE_ppa019210mg             328   3e-102   
ref|XP_010261659.1|  PREDICTED: serine carboxypeptidase-like 40         329   5e-102   
ref|XP_009792407.1|  PREDICTED: serine carboxypeptidase 24-like         328   5e-102   
ref|XP_009596929.1|  PREDICTED: serine carboxypeptidase-like 25         328   6e-102   
gb|KHN41581.1|  Serine carboxypeptidase-like 25                         328   7e-102   
ref|XP_009592799.1|  PREDICTED: serine carboxypeptidase-like 40         333   7e-102   
ref|XP_004231125.1|  PREDICTED: serine carboxypeptidase-like 40 i...    328   9e-102   
gb|KEH21654.1|  serine carboxypeptidase-like protein                    328   9e-102   
ref|XP_010265559.1|  PREDICTED: serine carboxypeptidase 24-like i...    327   1e-101   
ref|XP_006585840.1|  PREDICTED: serine carboxypeptidase-like 45-l...    326   1e-101   
ref|XP_004229673.1|  PREDICTED: serine carboxypeptidase-like 40         328   1e-101   
ref|XP_010496048.1|  PREDICTED: serine carboxypeptidase-like 43         322   2e-101   
gb|KHG14577.1|  Serine carboxypeptidase 24 -like protein                327   2e-101   
ref|XP_011079399.1|  PREDICTED: serine carboxypeptidase 24              327   2e-101   
ref|XP_006354958.1|  PREDICTED: serine carboxypeptidase-like 40-like    327   3e-101   
ref|XP_004303115.1|  PREDICTED: serine carboxypeptidase-like 40-like    327   4e-101   
ref|XP_007032748.1|  Serine carboxypeptidase-like 25 isoform 1          328   6e-101   
ref|XP_011000079.1|  PREDICTED: serine carboxypeptidase-like 25         326   6e-101   
ref|XP_010694765.1|  PREDICTED: serine carboxypeptidase-like 40         327   7e-101   
ref|XP_002884303.1|  hypothetical protein ARALYDRAFT_477440             325   8e-101   
ref|XP_008670742.1|  PREDICTED: serine carboxypeptidase-like 45         325   9e-101   
ref|XP_002298413.2|  putative serine carboxypeptidase family protein    326   1e-100   
gb|KHG25905.1|  Serine carboxypeptidase-like 27                         325   1e-100   
ref|XP_009771074.1|  PREDICTED: serine carboxypeptidase-like 25         325   1e-100   
ref|XP_002529402.1|  serine carboxypeptidase, putative                  325   1e-100   
ref|XP_011009401.1|  PREDICTED: serine carboxypeptidase-like 25 i...    325   1e-100   
ref|XP_006345395.1|  PREDICTED: serine carboxypeptidase-like 40-like    326   1e-100   
emb|CDP10248.1|  unnamed protein product                                324   1e-100   
ref|XP_006853073.1|  hypothetical protein AMTR_s00038p00085900          325   1e-100   
ref|XP_006474013.1|  PREDICTED: serine carboxypeptidase 24-like         324   2e-100   
ref|XP_006453596.1|  hypothetical protein CICLE_v10008182mg             324   2e-100   
ref|XP_010068795.1|  PREDICTED: serine carboxypeptidase-like 45         325   2e-100   
gb|KCW64994.1|  hypothetical protein EUGRSUZ_G02536                     324   3e-100   
emb|CDO99730.1|  unnamed protein product                                323   3e-100   
ref|XP_004229672.1|  PREDICTED: serine carboxypeptidase-like 40         324   4e-100   
ref|XP_010463602.1|  PREDICTED: serine carboxypeptidase-like 25         323   5e-100   
gb|AFK37459.1|  unknown                                                 323   5e-100   
ref|XP_004304228.1|  PREDICTED: serine carboxypeptidase-like 25-like    323   5e-100   
ref|NP_186860.1|  serine carboxypeptidase-like 25                       323   6e-100   
ref|XP_002280058.1|  PREDICTED: serine carboxypeptidase-like 25         323   6e-100   
ref|XP_010324807.1|  PREDICTED: serine carboxypeptidase-like 40 i...    324   7e-100   
emb|CBI21207.3|  unnamed protein product                                323   7e-100   
gb|AAM65698.1|  putative serine carboxypeptidase II                     323   7e-100   
ref|XP_002878712.1|  hypothetical protein ARALYDRAFT_320208             323   8e-100   
ref|XP_009117259.1|  PREDICTED: serine carboxypeptidase-like 22         322   8e-100   
ref|XP_011088747.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    324   8e-100   
ref|XP_007032749.1|  Serine carboxypeptidase-like 25 isoform 2          323   9e-100   
ref|XP_009792171.1|  PREDICTED: serine carboxypeptidase-like 40         323   1e-99    
ref|XP_010445019.1|  PREDICTED: serine carboxypeptidase-like 25         322   1e-99    
ref|XP_010047069.1|  PREDICTED: serine carboxypeptidase 24-like         322   1e-99    
ref|XP_004238587.1|  PREDICTED: putative serine carboxypeptidase-...    322   2e-99    
ref|XP_004242603.2|  PREDICTED: serine carboxypeptidase 24 isofor...    322   2e-99    
ref|XP_010258045.1|  PREDICTED: serine carboxypeptidase-like 25         322   3e-99    
ref|XP_009399563.1|  PREDICTED: serine carboxypeptidase 24-like         321   3e-99    
ref|XP_002275684.1|  PREDICTED: serine carboxypeptidase 24 isofor...    321   4e-99    
ref|XP_006338367.1|  PREDICTED: serine carboxypeptidase-like 25-like    321   4e-99    
ref|XP_004232164.1|  PREDICTED: serine carboxypeptidase-like 25         321   4e-99    
ref|XP_002306020.2|  serine carboxypeptidase S10 family protein         321   5e-99    
ref|XP_002314060.2|  hypothetical protein POPTR_0009s06090g             322   5e-99    
ref|XP_006345491.1|  PREDICTED: serine carboxypeptidase-like 40-like    321   6e-99    
ref|NP_179978.2|  serine carboxypeptidase-like 22                       320   7e-99    
ref|XP_004288721.1|  PREDICTED: serine carboxypeptidase 24-like         319   8e-99    
ref|XP_007011905.1|  Alpha/beta-Hydrolases superfamily protein          320   9e-99    
gb|KFK29637.1|  hypothetical protein AALP_AA7G159500                    320   1e-98    
ref|XP_011083949.1|  PREDICTED: serine carboxypeptidase 24-like i...    320   1e-98    
emb|CBI29056.3|  unnamed protein product                                320   1e-98    
ref|XP_009358402.1|  PREDICTED: serine carboxypeptidase II-2            320   2e-98    
ref|XP_008363303.1|  PREDICTED: serine carboxypeptidase-like 40         320   2e-98    
ref|XP_010655923.1|  PREDICTED: serine carboxypeptidase-like 34         320   2e-98    
ref|XP_003599510.1|  Serine carboxypeptidase-like protein               320   2e-98    
ref|XP_010551814.1|  PREDICTED: serine carboxypeptidase-like 25 i...    319   3e-98    
ref|XP_010279511.1|  PREDICTED: serine carboxypeptidase-like 40 i...    319   3e-98    
ref|XP_004514571.1|  PREDICTED: serine carboxypeptidase-like 40-like    320   3e-98    
ref|XP_004287151.1|  PREDICTED: serine carboxypeptidase-like 29-l...    318   4e-98    
ref|XP_008460255.1|  PREDICTED: serine carboxypeptidase-like 25 i...    318   4e-98    
ref|XP_010551812.1|  PREDICTED: serine carboxypeptidase-like 25 i...    318   5e-98    
ref|XP_004954211.1|  PREDICTED: serine carboxypeptidase 24-like         318   5e-98    
ref|XP_008394291.1|  PREDICTED: serine carboxypeptidase II-2            318   5e-98    
ref|XP_007028219.1|  Serine carboxypeptidase-like 45                    322   6e-98    
ref|XP_009592794.1|  PREDICTED: serine carboxypeptidase-like 40         319   6e-98    
ref|XP_010273635.1|  PREDICTED: serine carboxypeptidase 24-like         317   8e-98    
ref|XP_002452974.1|  hypothetical protein SORBIDRAFT_04g035810          318   8e-98    
ref|XP_006845388.1|  hypothetical protein AMTR_s00019p00053910          317   1e-97    
ref|XP_002308408.1|  BRI1 SUPPRESSOR 1 family protein                   317   1e-97    
ref|XP_002528403.1|  serine carboxypeptidase, putative                  317   1e-97    
ref|XP_010429355.1|  PREDICTED: putative serine carboxypeptidase-...    317   1e-97    
ref|XP_006373364.1|  hypothetical protein POPTR_0017s12960g             317   1e-97    
ref|XP_006294162.1|  hypothetical protein CARUB_v10023155mg             317   1e-97    
ref|XP_008243035.1|  PREDICTED: serine carboxypeptidase II-2            317   2e-97    
ref|XP_010103278.1|  Serine carboxypeptidase-like 40                    318   2e-97    
ref|XP_009368057.1|  PREDICTED: serine carboxypeptidase-like 40         318   2e-97    
ref|XP_008670270.1|  PREDICTED: serine carboxypeptidase II-3-like       315   2e-97    
ref|XP_010429353.1|  PREDICTED: serine carboxypeptidase-like 22         316   3e-97    
ref|XP_007017345.1|  Serine carboxypeptidase 40, putative               319   3e-97    
ref|XP_002312024.1|  serine carboxypeptidase S10 family protein         315   4e-97    
ref|XP_008394313.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    316   4e-97    
ref|XP_010417140.1|  PREDICTED: serine carboxypeptidase-like 22         316   4e-97    
gb|KHG19786.1|  Serine carboxypeptidase-like 40                         317   4e-97    
ref|XP_011018040.1|  PREDICTED: serine carboxypeptidase 24-like i...    315   4e-97    
sp|O82229.2|SCP23_ARATH  RecName: Full=Putative serine carboxypep...    315   4e-97    
ref|XP_010264739.1|  PREDICTED: serine carboxypeptidase-like 27         315   4e-97    



>ref|XP_006351861.1| PREDICTED: serine carboxypeptidase-like 42-like [Solanum tuberosum]
Length=478

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/448 (76%), Positives = 388/448 (87%), Gaps = 3/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLV  LPGQP+V FRQ++GYVDVDEKAGRSLFYYFVEAEKD H+ LPLTLWLNGGPG
Sbjct  27    PIEDLVDNLPGQPKVGFRQYAGYVDVDEKAGRSLFYYFVEAEKDAHK-LPLTLWLNGGPG  85

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPFFP GDG GL  N+KSWNKASNLLF+ESPAGVGWSYSNTSSDYTCG
Sbjct  86    CSSIGGGAFTELGPFFPRGDGHGLRRNTKSWNKASNLLFIESPAGVGWSYSNTSSDYTCG  145

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA+DML FM KWYEKF E   RPLFLTGESYAGHYIPQLA++++D+NK  K  KFN+
Sbjct  146   DESTAKDMLNFMLKWYEKFSELKSRPLFLTGESYAGHYIPQLANVILDYNKQSKDFKFNL  205

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL++DRDVPAV E+ WSHG+ISDE +  I+  CDFDDY F  PHN S +CN 
Sbjct  206   KGVAIGNPLLRVDRDVPAVYEYYWSHGMISDELFLIIKENCDFDDYEFPVPHNVSITCNQ  265

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI++  + +SDY+NVYDVI+DVCYPSIV+QELRLHK VTKMS+G+DVCM SER FYFNLP
Sbjct  266   AIDEAYKLISDYVNVYDVILDVCYPSIVQQELRLHKQVTKMSVGVDVCMTSERYFYFNLP  325

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRTNLPY+W  C+D  +L Y+Q+DGD +++P LK ++QH +PLWI+SGDQDS
Sbjct  326   EVQKALHANRTNLPYEWSMCSD--VLNYSQSDGDIDMLPSLKNIIQHDVPLWIFSGDQDS  383

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA D+K   TVPY AWFHKGQVGGWQ EYG  LTFATVRGAAHMVPY
Sbjct  384   VVPLIGSRTLVRELARDLKFKTTVPYGAWFHKGQVGGWQVEYGEKLTFATVRGAAHMVPY  443

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP RALHLF++F+ GRRLPNTT IPI+
Sbjct  444   AQPSRALHLFTTFVHGRRLPNTTHIPIN  471



>ref|XP_009767155.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Nicotiana 
sylvestris]
Length=475

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/447 (76%), Positives = 387/447 (87%), Gaps = 3/447 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLV  LPGQP+V FRQ++GYVDVDEKAGRSLFYYFVEAEKD  + LPLTLWLNGGPG
Sbjct  31    PIEDLVENLPGQPKVGFRQYAGYVDVDEKAGRSLFYYFVEAEKDADK-LPLTLWLNGGPG  89

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPFFP GDGRGL  N+KSWNKASNLLF+ESPAGVGWSYSNTSSDYTCG
Sbjct  90    CSSIGGGAFTELGPFFPRGDGRGLRRNTKSWNKASNLLFIESPAGVGWSYSNTSSDYTCG  149

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D  TA+DML FM +WYEKF E   +PLFLTGESYAGHYIPQLA++++D+NK  K  KFN+
Sbjct  150   DDPTAKDMLTFMLRWYEKFSELKSKPLFLTGESYAGHYIPQLANVILDYNKQSKDFKFNL  209

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+LDRDVPAV E+ WSHG+ISDE Y  I+  C+FDDY F  PHNE  SCN 
Sbjct  210   KGVAIGNPLLRLDRDVPAVYEYYWSHGMISDELYLRIKEHCNFDDYEFPVPHNEPISCNQ  269

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI++  + +SDYINVYDVI+DVCYPSIV+QELRLHK VTKMS+G+DVCM SER FYFNLP
Sbjct  270   AIDEAYKVISDYINVYDVILDVCYPSIVQQELRLHKQVTKMSVGVDVCMTSERYFYFNLP  329

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRTNLPY+W  C+D  +L Y+Q+DGD +++P LK ++QH +PLWI+SGDQDS
Sbjct  330   EVQKALHANRTNLPYEWTMCSD--VLNYSQSDGDTDMLPSLKNIIQHDVPLWIFSGDQDS  387

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA D+KM  TV Y AWFHKGQVGGWQ EYG+ LTFATVRGAAHMVPY
Sbjct  388   VVPLIGSRTLVRELANDLKMKTTVAYGAWFHKGQVGGWQIEYGDKLTFATVRGAAHMVPY  447

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPI  1492
             AQP RALHLFSSF+ GRRLPNTT IPI
Sbjct  448   AQPSRALHLFSSFVHGRRLPNTTRIPI  474



>ref|XP_009586680.1| PREDICTED: serine carboxypeptidase-like 42 [Nicotiana tomentosiformis]
Length=470

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/447 (75%), Positives = 384/447 (86%), Gaps = 3/447 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLV  LPGQP+V FRQ++GYVDVDEKAGRSLFYYFVEAEKD  + LPLTLWLNGGPG
Sbjct  26    PIEDLVENLPGQPKVGFRQYAGYVDVDEKAGRSLFYYFVEAEKDADK-LPLTLWLNGGPG  84

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPFFP GDGRGL  N+KSWNKASNLLF+ESPAGVGWSYSNTSSDYTCG
Sbjct  85    CSSIGGGAFTELGPFFPRGDGRGLRRNTKSWNKASNLLFIESPAGVGWSYSNTSSDYTCG  144

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA+DML FM +WY KF E   +PLFLTGESYAGHYIPQLA++++D+NK     KFN+
Sbjct  145   DDSTAKDMLTFMIRWYAKFSELKSKPLFLTGESYAGHYIPQLANVILDYNKQSNDFKFNL  204

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+LDRDVPAV E+ WSHG+ISDE Y  I+  C+FDDY F  PHNE  SCN 
Sbjct  205   KGVAIGNPLLRLDRDVPAVYEYYWSHGMISDEIYLRIKEHCNFDDYEFPVPHNEPISCNQ  264

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI++  + +SDYINVYDVI+DVCYPSIV+QELRLHK VTKMS+G+DVCM SER FYFNLP
Sbjct  265   AIDEAYKIISDYINVYDVILDVCYPSIVQQELRLHKQVTKMSVGVDVCMTSERYFYFNLP  324

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRTNLPY+W  C+D  +L Y+Q+DGD +++P LK ++QH +PLWI+SGDQDS
Sbjct  325   EVQKALHANRTNLPYEWSMCSD--VLNYSQSDGDTDMLPSLKNIIQHDVPLWIFSGDQDS  382

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA D+ +  TV Y AWFHKGQVGGWQ EYG+ LTFATVRGAAHMVPY
Sbjct  383   VVPLIGSRTLVRELANDLNLKTTVAYGAWFHKGQVGGWQVEYGHKLTFATVRGAAHMVPY  442

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPI  1492
             AQP RALHLFSSF+ GRRLPN T IPI
Sbjct  443   AQPSRALHLFSSFVHGRRLPNATRIPI  469



>ref|XP_010245825.1| PREDICTED: serine carboxypeptidase-like 42 [Nelumbo nucifera]
Length=470

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/443 (76%), Positives = 380/443 (86%), Gaps = 3/443 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLV+ LPGQP+V FRQF+GYVDVDEKAGRSLFYYFVEAE +  ++ PLTLWLNGGPG
Sbjct  25    PVEDLVLKLPGQPKVDFRQFAGYVDVDEKAGRSLFYYFVEAEGEPEKK-PLTLWLNGGPG  83

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGG+FTELGPFFP GDGRGL  N+KSWNKASNLLFVESPAGVGWSYSNT+SDYTCG
Sbjct  84    CSSVGGGSFTELGPFFPRGDGRGLQRNTKSWNKASNLLFVESPAGVGWSYSNTTSDYTCG  143

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DM IF  KW+EK+PE+  R LFLTGESYAGHYIPQLA++++DHNKH +G KFNI
Sbjct  144   DASTARDMHIFFLKWFEKYPEYKSRDLFLTGESYAGHYIPQLANVLLDHNKHSRGFKFNI  203

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLLKLDRD+PA  EF WSHG+ISDE    I NECDFDDY F  PHN S SCN 
Sbjct  204   KGVAIGNPLLKLDRDIPATYEFFWSHGMISDEIGLTITNECDFDDYVFSSPHNVSHSCNK  263

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI + N+ V DYIN YDVI+DVCYPSIVEQELRL K  TK+S+G+DVCM  ER FYFNLP
Sbjct  264   AIAEANQVVGDYINPYDVILDVCYPSIVEQELRLRKLATKISIGVDVCMSYERRFYFNLP  323

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
              VQ+ALHANRT LPY W  C+D  LL Y+ TDG+ N++P+LK++++H IP+W++SGDQDS
Sbjct  324   SVQQALHANRTKLPYSWTMCSD--LLNYSGTDGNINILPILKRIIKHHIPVWVFSGDQDS  381

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA D+   +TVPY AWFHKGQVGGW TEYGNLLTFATVRGAAHMVPY
Sbjct  382   VVPLLGSRTLVRELARDLNFKVTVPYGAWFHKGQVGGWATEYGNLLTFATVRGAAHMVPY  441

Query  1412  AQPGRALHLFSSFIRGRRLPNTT  1480
             AQP RALHLFSSFIRGRRLPNTT
Sbjct  442   AQPSRALHLFSSFIRGRRLPNTT  464



>ref|XP_011074776.1| PREDICTED: serine carboxypeptidase-like 42 [Sesamum indicum]
Length=475

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/447 (77%), Positives = 381/447 (85%), Gaps = 3/447 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PE+DLVV LPGQP V FRQF+GYVDVD K GRSLFYYFVEA +D   + PLTLWLNGGPG
Sbjct  30    PEKDLVVRLPGQPVVKFRQFAGYVDVDVKNGRSLFYYFVEAVEDPDHK-PLTLWLNGGPG  88

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPFFP GDGRGL INSKSWNKASNLLFVESP+GVGWSYSNTSSDYTCG
Sbjct  89    CSSIGGGAFTELGPFFPKGDGRGLRINSKSWNKASNLLFVESPSGVGWSYSNTSSDYTCG  148

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DM IFM +WY+KFP F  R LFLTGESYAGHYIPQLA  ++DHN+H    KF I
Sbjct  149   DASTAIDMHIFMMEWYKKFPTFRTRDLFLTGESYAGHYIPQLAVALLDHNEHSTDLKFKI  208

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+LDRDVPA  EF WSHG+ISDEN+ AI N+CDFDDY+F  PHN S SCN 
Sbjct  209   KGVAIGNPLLRLDRDVPATYEFFWSHGMISDENFLAIMNDCDFDDYAFASPHNVSQSCND  268

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI+  N  V DYIN YDVI+DVCYPSIVEQELRL K  TK+S+GIDVCM  ER FYFNLP
Sbjct  269   AISQANEIVGDYINNYDVILDVCYPSIVEQELRLRKMATKISVGIDVCMSYERRFYFNLP  328

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRTNLPY W  C+  S+L Y++TDG+ +++PLLK+++Q+ IP+WI+SGDQDS
Sbjct  329   EVQKALHANRTNLPYRWTMCS--SVLNYSETDGNIDMLPLLKRIVQNHIPVWIFSGDQDS  386

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA D+   ITVPY AWFHKGQVGGW TEYGNLLTFATVRGAAHMVPY
Sbjct  387   VVPLLGSRTLVRELAHDLNFKITVPYGAWFHKGQVGGWATEYGNLLTFATVRGAAHMVPY  446

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPI  1492
             AQP RALHLFSSF+RGRRLPNTT  PI
Sbjct  447   AQPSRALHLFSSFVRGRRLPNTTHPPI  473



>ref|XP_010315077.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Solanum 
lycopersicum]
Length=478

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/448 (75%), Positives = 383/448 (85%), Gaps = 3/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLV  LPGQP+V FRQ++GYVDVDEKAGRSLFYYFVEAEKD H  LPLTLWLNGGPG
Sbjct  26    PIEDLVENLPGQPKVGFRQYAGYVDVDEKAGRSLFYYFVEAEKDAHN-LPLTLWLNGGPG  84

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPFFP GDG GL  N+KSWNK SNLLF+ESP GVGWSYSNTSSDYT G
Sbjct  85    CSSIGGGAFTELGPFFPRGDGHGLRRNTKSWNKVSNLLFIESPVGVGWSYSNTSSDYTSG  144

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA+DML FM KWYEKF E   RPLFLTGESYAGHYIPQLA+ ++D+NK  K  KFN+
Sbjct  145   DESTAKDMLNFMLKWYEKFSELKSRPLFLTGESYAGHYIPQLANGILDYNKQSKDFKFNL  204

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+LDRDVPA+ E+ WSHG+ISDE +  I+  CDFDDY F  PHN S +CN 
Sbjct  205   KGVAIGNPLLRLDRDVPAMYEYYWSHGMISDELFLIIKENCDFDDYEFPLPHNVSITCNQ  264

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI++  + V+DY+NVYDVI+DVCYPSIV+QELRLHK VTKMSMG+DVCM SER FYFNLP
Sbjct  265   AIDEAYKLVTDYVNVYDVILDVCYPSIVQQELRLHKQVTKMSMGVDVCMTSERYFYFNLP  324

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRTNLPY+W+ C+D   L Y+Q+DGD +++P LK ++QH +PLWI+SGDQDS
Sbjct  325   EVQKALHANRTNLPYEWRMCSD--RLNYSQSDGDIDMLPSLKNIIQHDVPLWIFSGDQDS  382

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPLVGSRT+VRELA D+K   TVPY AWFHKGQVGGWQ EYG  LTFATVRGAAHMVPY
Sbjct  383   VVPLVGSRTLVRELARDLKFKTTVPYGAWFHKGQVGGWQIEYGEKLTFATVRGAAHMVPY  442

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP RALHLF++F+ G+RLPNTT IPI+
Sbjct  443   AQPSRALHLFTTFVHGKRLPNTTRIPIN  470



>ref|XP_004230572.1| PREDICTED: serine carboxypeptidase-like 42 isoform X2 [Solanum 
lycopersicum]
Length=477

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/448 (75%), Positives = 383/448 (85%), Gaps = 4/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLV  LPGQP+V FRQ++GYVDVDEKAGRSLFYYFVEAEKD H  LPLTLWLNGGPG
Sbjct  26    PIEDLVENLPGQPKVGFRQYAGYVDVDEKAGRSLFYYFVEAEKDAHN-LPLTLWLNGGPG  84

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPFFP GDG GL  N+KSWNK SNLLF+ESP GVGWSYSNTSSDYT G
Sbjct  85    CSSIGGGAFTELGPFFPRGDGHGLRRNTKSWNKVSNLLFIESPVGVGWSYSNTSSDYTSG  144

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA+DML FM KWYEKF E   RPLFLTGESYAGHYIPQLA+ ++D+NK  K  KFN+
Sbjct  145   DESTAKDMLNFMLKWYEKFSELKSRPLFLTGESYAGHYIPQLANGILDYNKQSKDFKFNL  204

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+LDRDVPA+ E+ WSHG+ISDE +  I+  CDFDDY F  PHN S +CN 
Sbjct  205   KGVAIGNPLLRLDRDVPAMYEYYWSHGMISDELFLIIKENCDFDDYEFPLPHNVSITCNQ  264

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI++  + V+DY+NVYDVI+DVCYPSIV+QELRLHK VTKMSMG+DVCM SER FYFNLP
Sbjct  265   AIDEAYKLVTDYVNVYDVILDVCYPSIVQQELRLHKQVTKMSMGVDVCMTSERYFYFNLP  324

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRTNLPY+W+ C++   L Y+Q+DGD +++P LK ++QH +PLWI+SGDQDS
Sbjct  325   EVQKALHANRTNLPYEWRMCSE---LNYSQSDGDIDMLPSLKNIIQHDVPLWIFSGDQDS  381

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPLVGSRT+VRELA D+K   TVPY AWFHKGQVGGWQ EYG  LTFATVRGAAHMVPY
Sbjct  382   VVPLVGSRTLVRELARDLKFKTTVPYGAWFHKGQVGGWQIEYGEKLTFATVRGAAHMVPY  441

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP RALHLF++F+ G+RLPNTT IPI+
Sbjct  442   AQPSRALHLFTTFVHGKRLPNTTRIPIN  469



>ref|XP_011101717.1| PREDICTED: serine carboxypeptidase-like 42 [Sesamum indicum]
Length=469

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/448 (75%), Positives = 378/448 (84%), Gaps = 3/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLV  LPGQP V FRQ++GYVDVD K GRSLFYYFVEA +D  R+ PLTLWLNGGPG
Sbjct  24    PEEDLVTKLPGQPVVKFRQYAGYVDVDVKNGRSLFYYFVEAAEDPDRK-PLTLWLNGGPG  82

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P GDGRGL INSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG
Sbjct  83    CSSVGGGAFTELGPFYPRGDGRGLRINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  142

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DM IF+ +WY+KFP F  R LFLTGESYAGHYIPQLA  ++DHN+H    KF I
Sbjct  143   DASTAMDMHIFLMEWYKKFPTFKTRDLFLTGESYAGHYIPQLAVALLDHNEHSTEFKFKI  202

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+LDRDVPA  EF WSHG+ISDE    I N+CDFDDY+F  PHN S  CN 
Sbjct  203   KGVAIGNPLLRLDRDVPATYEFFWSHGMISDEIGLTIMNDCDFDDYTFGSPHNVSLPCNH  262

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI+  N  V DYIN YDVI+DVCYPSIVEQELRL K  TK+S+G+DVCM SER FYFNLP
Sbjct  263   AISKANEIVGDYINNYDVILDVCYPSIVEQELRLRKMATKISVGVDVCMSSERHFYFNLP  322

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRTNLPY W  C++  +L YN+TDG+ N++PLLK+++Q +IP+WI+SGDQDS
Sbjct  323   EVQKALHANRTNLPYSWSMCSE--VLNYNETDGNINILPLLKRIVQKRIPVWIFSGDQDS  380

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA D++  ITVPY AWFHKGQVGGW TEYGN+LTFATVRGAAHMVPY
Sbjct  381   VVPLLGSRTLVRELAHDLQFKITVPYGAWFHKGQVGGWATEYGNMLTFATVRGAAHMVPY  440

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP RALHLFSSF+RGRRLPN T   ID
Sbjct  441   AQPSRALHLFSSFVRGRRLPNNTRPSID  468



>gb|EYU17411.1| hypothetical protein MIMGU_mgv1a005783mg [Erythranthe guttata]
Length=471

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/448 (75%), Positives = 381/448 (85%), Gaps = 3/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLVV LPGQP V FRQ++GYVDVD K GRSLFYYFVEA+ +   + PLTLWLNGGPG
Sbjct  26    PEEDLVVKLPGQPFVKFRQYAGYVDVDVKKGRSLFYYFVEADNNPDHK-PLTLWLNGGPG  84

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPFFP+GDGR L +NSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG
Sbjct  85    CSSIGGGAFTELGPFFPNGDGRSLRVNSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  144

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DM +F+ +WY+KFP F  R LFLTGESYAGHYIPQLA  ++DHN+H    KFNI
Sbjct  145   DASTAMDMHVFLMEWYKKFPTFKTRDLFLTGESYAGHYIPQLAIALLDHNQHSPKFKFNI  204

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+LDRDVPA  EF WSHG+ISDE   AI N+CDFDDYSF  PHN S+SCN 
Sbjct  205   KGVAIGNPLLRLDRDVPATYEFFWSHGMISDETGLAIMNDCDFDDYSFASPHNVSESCNQ  264

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI+  N+ V DYIN YDVI+DVCYPSIVEQELRL K  TK+S+G+DVCM  ER FYFNLP
Sbjct  265   AISVANQIVGDYINNYDVILDVCYPSIVEQELRLKKMATKISVGVDVCMSYERRFYFNLP  324

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRT LPY W  C+   +L YN+TDG+ +++PLLK+++Q++IP+WI+SGDQDS
Sbjct  325   EVQKALHANRTKLPYSWSMCS--GVLNYNETDGNLDMLPLLKRIIQNRIPVWIFSGDQDS  382

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA +M+  ITVPY AWFHKGQVGGW TEYGNLLTFATVRGAAHMVPY
Sbjct  383   VVPLLGSRTLVRELAHEMQFKITVPYGAWFHKGQVGGWATEYGNLLTFATVRGAAHMVPY  442

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP RALHLFSSF+RGRRLPN T   ID
Sbjct  443   AQPSRALHLFSSFVRGRRLPNNTRPAID  470



>ref|XP_010679983.1| PREDICTED: serine carboxypeptidase-like 42 [Beta vulgaris subsp. 
vulgaris]
Length=477

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/443 (75%), Positives = 374/443 (84%), Gaps = 3/443 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLVV LPGQP+V F+QF+GY+DVD KAGRSLFYYFVEA+ D H + PLTLWLNGGPG
Sbjct  32    PMEDLVVNLPGQPKVGFKQFAGYIDVDVKAGRSLFYYFVEAKNDPHSK-PLTLWLNGGPG  90

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPFFPSGDGRGL  NS SWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  91    CSSMGGGAFTELGPFFPSGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTSSDYNTG  150

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D ++A+DML F+  W+EKFPEF  R LFLTGESYAGHYIPQLA  ++DHN H +  K  +
Sbjct  151   DAASAKDMLTFLVNWFEKFPEFKSRDLFLTGESYAGHYIPQLAVAVLDHNAHSRASKMKL  210

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLLKLDRDVPA  E+ WSHG+ISDE   +I N+CDF+DY+F  PHNESDSCN 
Sbjct  211   KGVAIGNPLLKLDRDVPATYEYFWSHGMISDEIGLSIMNQCDFEDYTFASPHNESDSCNN  270

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI+  N  V DYIN YDVI+DVCYPSIVEQELRL K  TKMS+G+DVCM  ER FYFNLP
Sbjct  271   AISQANSIVGDYINNYDVILDVCYPSIVEQELRLKKMATKMSLGVDVCMTYERRFYFNLP  330

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRTNLPY+W  C+  S+L Y+  DG  +++PLLKK+L H IP+W++SGDQDS
Sbjct  331   EVQKALHANRTNLPYEWSMCS--SILNYSDNDGSLDMLPLLKKILSHHIPIWVFSGDQDS  388

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA D+K   TVPY AWFHKGQVGGW TEYGNLLTFATVRGAAHMVPY
Sbjct  389   VVPLLGSRTLVRELAHDLKFKATVPYGAWFHKGQVGGWATEYGNLLTFATVRGAAHMVPY  448

Query  1412  AQPGRALHLFSSFIRGRRLPNTT  1480
              QP RALHLFSSFIRGRRLP+TT
Sbjct  449   TQPSRALHLFSSFIRGRRLPSTT  471



>ref|XP_004237734.1| PREDICTED: serine carboxypeptidase-like 42 [Solanum lycopersicum]
Length=472

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/448 (75%), Positives = 379/448 (85%), Gaps = 3/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PE+DLV  LPGQP+V FRQ++GYVDVD KAGRSLFYYFVEAE     + PLTLWLNGGPG
Sbjct  27    PEKDLVKALPGQPKVGFRQYAGYVDVDVKAGRSLFYYFVEAEVKPDEK-PLTLWLNGGPG  85

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPFFP+GDGRGL  NSKSWNKASNLLFVESPAGVGWSYSNTSSDYT G
Sbjct  86    CSSIGGGAFTELGPFFPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYTTG  145

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D  TA DM +FM +W +KFP F  R L+LTGESYAGHYIPQLA+ ++DHN+H K +KFNI
Sbjct  146   DAKTAMDMHMFMMEWVKKFPAFKSRELYLTGESYAGHYIPQLAAALLDHNEHSKEYKFNI  205

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+LDRDVPA  E+ WSHG+ISDE    I N+CDFDDY+F  PHN S +CN 
Sbjct  206   KGVAIGNPLLRLDRDVPATYEYFWSHGMISDEVGLTIMNQCDFDDYTFGSPHNVSQACNN  265

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI++ N  V +YIN YDVI+DVCYPSIVEQELRL K  TK+S+G+DVCM  ER FYFNLP
Sbjct  266   AISEANTIVGEYINNYDVILDVCYPSIVEQELRLKKMATKISVGVDVCMSYERRFYFNLP  325

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRTNLPY W  C++  +LKY+ TDG+ N++PLLK++++  IP+WI+SGDQDS
Sbjct  326   EVQKALHANRTNLPYTWSMCSN--VLKYSDTDGNINILPLLKRIIEKHIPVWIFSGDQDS  383

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA DM   ITVPY AWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY
Sbjct  384   VVPLLGSRTLVRELAHDMGFKITVPYGAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  443

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP RALHLFSSFIRGRRLPN T   ID
Sbjct  444   AQPARALHLFSSFIRGRRLPNNTRPSID  471



>ref|XP_009600050.1| PREDICTED: serine carboxypeptidase-like 42 [Nicotiana tomentosiformis]
Length=472

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/448 (75%), Positives = 378/448 (84%), Gaps = 3/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLV  LPGQP+VSFRQ++GYVDVD KAGRSLFYYFVEAE +   + PLTLWLNGGPG
Sbjct  27    PEEDLVKALPGQPKVSFRQYAGYVDVDVKAGRSLFYYFVEAEVNPDHK-PLTLWLNGGPG  85

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPFFP+GDGRGL  NSKSWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  86    CSSIGGGAFTELGPFFPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYITG  145

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D  TA DM IFM +W +KFPEF  R L+LTGESYAGHYIPQLA  ++DHN+H K +KFNI
Sbjct  146   DAKTAMDMHIFMMEWLKKFPEFRSRELYLTGESYAGHYIPQLAVALLDHNEHSKEYKFNI  205

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLLKLDRDVPA  E+ WSHG+ISDE   AI N+CDF+DY+F  PHN S  CN 
Sbjct  206   KGVAIGNPLLKLDRDVPATYEYFWSHGMISDEVGLAIMNQCDFEDYTFGSPHNVSHECNN  265

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI++ N  +S+YIN YDVI+DVCYPSIVEQELRL K  TKMS+G+DVCM  ER FYFNLP
Sbjct  266   AISEANHIISEYINNYDVILDVCYPSIVEQELRLRKMATKMSVGVDVCMSYERRFYFNLP  325

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRTNL Y W  C+   +L Y+  DG+ N++PLLK+++Q+ IP+WI+SGDQDS
Sbjct  326   EVQKALHANRTNLAYSWSMCS--GILNYSDVDGNINILPLLKRIIQNHIPVWIFSGDQDS  383

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA DM   ITVPY AWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY
Sbjct  384   VVPLLGSRTLVRELAHDMGFKITVPYGAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  443

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP RALHLFSSFIRGR+LPN T   ID
Sbjct  444   AQPSRALHLFSSFIRGRKLPNNTRPSID  471



>ref|XP_006356286.1| PREDICTED: serine carboxypeptidase-like 42-like [Solanum tuberosum]
Length=472

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/448 (75%), Positives = 380/448 (85%), Gaps = 3/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLV  LPGQP+V FRQ++GYV+VD KAGRSLFYYFVEAE     + PL LWLNGGPG
Sbjct  27    PEEDLVKALPGQPKVGFRQYAGYVEVDVKAGRSLFYYFVEAEVKPDEK-PLALWLNGGPG  85

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPFFP+GDGRGL  NSKSWNKASNLLFVESPAGVGWSYSNTSSDYT G
Sbjct  86    CSSIGGGAFTELGPFFPTGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTSSDYTTG  145

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D  TA DM +FM +W +KFP F  R L+LTGESYAGHYIPQLA+ ++DHN+H K +KFNI
Sbjct  146   DAKTAMDMHMFMMEWVKKFPAFKSRELYLTGESYAGHYIPQLAAALLDHNEHSKEYKFNI  205

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+LDRDVPA  E+ WSHG+ISDE    I N+CDFDDY+F  PHN S +CN 
Sbjct  206   KGVAIGNPLLRLDRDVPATYEYFWSHGMISDEVGLTIMNQCDFDDYTFGSPHNVSQACNN  265

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI++ N  VS+YIN YDVI+DVCYPSIVEQELRL K  TK+S+G+DVCM  ER FYFNLP
Sbjct  266   AISEANTIVSEYINNYDVILDVCYPSIVEQELRLKKMATKISVGVDVCMTYERRFYFNLP  325

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRTNLPY W  C++  +LKY+ TDG+ N++PLLK+++++ IP+WI+SGDQDS
Sbjct  326   EVQKALHANRTNLPYTWSMCSN--ILKYSDTDGNINILPLLKRIIENHIPVWIFSGDQDS  383

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA DM   ITVPY AWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY
Sbjct  384   VVPLLGSRTLVRELAHDMGFKITVPYGAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  443

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP RALHLFSSFIRGRRLPN T   ID
Sbjct  444   AQPARALHLFSSFIRGRRLPNNTRPSID  471



>ref|XP_009798650.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009798651.1| PREDICTED: serine carboxypeptidase-like 42 isoform X2 [Nicotiana 
sylvestris]
Length=472

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/473 (73%), Positives = 385/473 (81%), Gaps = 7/473 (1%)
 Frame = +2

Query  77    MGRLVICFVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLF  256
             MG L  C     L+      G  GYPEEDLV  LPGQP+VSFRQ++GYVDVD KAGRSLF
Sbjct  6     MGTLWFC----GLVIVSLVIGGKGYPEEDLVKALPGQPKVSFRQYAGYVDVDVKAGRSLF  61

Query  257   YYFVEAEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKAS  436
             YYFVEAE +   + PLTLWLNGGPGCSSIGGGAFTELGPFFP+GDGRGL  NSKSWNKAS
Sbjct  62    YYFVEAEVNPDHK-PLTLWLNGGPGCSSIGGGAFTELGPFFPTGDGRGLRRNSKSWNKAS  120

Query  437   NLLFVESPAGVGWSYSNTSSDYTCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYA  616
             NLLFVESPAGVGWSYSNTSSDY  GD  TA DM IFM +W +KFP F  R L+LTGESYA
Sbjct  121   NLLFVESPAGVGWSYSNTSSDYNTGDAKTAMDMHIFMMEWLKKFPAFRSRELYLTGESYA  180

Query  617   GHYIPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYN  796
             GHYIPQLA  ++DHN+H K +KFN+KGVA+GNPLLKLDRDVPA  E+ WSHG+ISDE   
Sbjct  181   GHYIPQLAVALLDHNEHSKEYKFNVKGVAIGNPLLKLDRDVPATYEYFWSHGMISDEAGL  240

Query  797   AIRNECDFDDYSFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLH  976
             AI N+CDF+DY+F  PHN S  CN AI++ N  +S+YIN YDVI+DVCYPSIVEQELRL 
Sbjct  241   AIMNQCDFEDYTFGSPHNVSHECNNAISEANDIISEYINNYDVILDVCYPSIVEQELRLR  300

Query  977   KAVTKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDA  1156
             K  TKMS+G+DVCM  ER FYFNLPEVQKA HANRTNL Y W  C+   +L Y+  DG+ 
Sbjct  301   KMATKMSVGVDVCMSYERRFYFNLPEVQKAFHANRTNLAYSWSMCS--GILNYSDVDGNI  358

Query  1157  NVVPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQV  1336
             N++PLLK+++Q+ IP+WI+SGDQDSVVPL+GSRT+VRELA DM   ITVPY AWFHKGQV
Sbjct  359   NILPLLKRIIQNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKITVPYGAWFHKGQV  418

Query  1337  GGWQTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             GGWQTEYGNLLTFATVRGAAHMVPYAQP RALHLFSSFIRGRRLPN T   ID
Sbjct  419   GGWQTEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFIRGRRLPNNTRPSID  471



>ref|XP_002278193.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Vitis 
vinifera]
 emb|CBI19968.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/448 (74%), Positives = 375/448 (84%), Gaps = 3/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLVV LPGQPEV FRQF+GYVDVD KAGRSLFYYFVEAE D   +  LTLWLNGGPG
Sbjct  22    PEEDLVVRLPGQPEVGFRQFAGYVDVDVKAGRSLFYYFVEAEDDPDTK-ALTLWLNGGPG  80

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPFFPSGDGRGL  NSKSWNKASNLLFVESPAGVGWSYSNT+SDYTCG
Sbjct  81    CSSMGGGAFTELGPFFPSGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTTSDYTCG  140

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DM +FM KW EKFP F  R LFLTGESYAGHYIPQLA  ++D+N H  G KFN+
Sbjct  141   DASTARDMRVFMMKWLEKFPAFKSRALFLTGESYAGHYIPQLAVALLDYNSHSTGFKFNL  200

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+LDRD  A  EF WSHG+ISDE    I  ECDFDDY +  PHN S SCN 
Sbjct  201   KGVAIGNPLLRLDRDSAATYEFFWSHGMISDEIGLTITKECDFDDYVYASPHNVSFSCNQ  260

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             A+++ N  V +YIN YDVI+DVCYP+IVEQELRL +  TKMS+GIDVCM  ER+FYFNLP
Sbjct  261   ALSEANSIVGEYINNYDVILDVCYPAIVEQELRLRRMATKMSVGIDVCMTYERSFYFNLP  320

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRT L Y W  C+   +L Y++TDG+ +++PLLK+++Q+ IP+W++SGDQDS
Sbjct  321   EVQKALHANRTGLNYRWTMCS--GVLNYSETDGNIDILPLLKRIVQNSIPVWVFSGDQDS  378

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT++RELA +MK  ITVP+ AWFHKGQVGGW TEYGNLLTFATVRGAAHMVPY
Sbjct  379   VVPLLGSRTLIRELAQEMKFKITVPFGAWFHKGQVGGWATEYGNLLTFATVRGAAHMVPY  438

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP RALHLFSSF+RGRRLPNTT   ID
Sbjct  439   AQPSRALHLFSSFVRGRRLPNTTRPSID  466



>gb|KDP43043.1| hypothetical protein JCGZ_25229 [Jatropha curcas]
Length=491

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/448 (74%), Positives = 377/448 (84%), Gaps = 3/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P +DLVV LPGQP+V+FRQFSGYVDVD K GRSLFYYFVEA+KD  ++ PLTLWLNGGPG
Sbjct  46    PIKDLVVNLPGQPKVAFRQFSGYVDVDVKNGRSLFYYFVEADKDPDKK-PLTLWLNGGPG  104

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P GDGRGL  NS SWN+ASNLLFVESPAGVGWSYSNTS+DYT G
Sbjct  105   CSSIGGGAFTELGPFYPKGDGRGLRRNSMSWNRASNLLFVESPAGVGWSYSNTSTDYTTG  164

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D  TA+DM +F+ KWYEKFPEF  R LFLTGESYAGHYIPQLA +++DHN H KG KFNI
Sbjct  165   DAKTAKDMHMFLLKWYEKFPEFKSRELFLTGESYAGHYIPQLAEVLLDHNSHSKGFKFNI  224

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+LDRD+PA  EF WSHG+ISDE    + NEC FDDY F  PHN ++SCN 
Sbjct  225   KGVAIGNPLLRLDRDIPATYEFFWSHGMISDEIGLKVMNECQFDDYIFANPHNVTESCNE  284

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI      V +Y+N YDVI+DVCYPSIV+QELRL K  TK+S+G+DVCM  ER FYFNLP
Sbjct  285   AIEQAYNIVGEYVNNYDVILDVCYPSIVQQELRLRKLATKLSVGVDVCMTYERAFYFNLP  344

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
              VQKALHANRTNLPY W  C+  S+L Y+ TDG+ +++P+LKK++Q+ IP+W++SGDQDS
Sbjct  345   AVQKALHANRTNLPYRWTMCS--SVLDYSDTDGNEDILPILKKIIQNDIPVWVFSGDQDS  402

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA D+   ITVPY AWFHKGQVGGW TEYGNLLTFATVRGAAHMVPY
Sbjct  403   VVPLLGSRTLVRELAHDLNFKITVPYGAWFHKGQVGGWATEYGNLLTFATVRGAAHMVPY  462

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP RALHLFSSF+RGRRLPN T I ID
Sbjct  463   AQPSRALHLFSSFVRGRRLPNRTHISID  490



>ref|XP_002526159.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF36235.1| serine carboxypeptidase, putative [Ricinus communis]
Length=476

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/475 (71%), Positives = 388/475 (82%), Gaps = 5/475 (1%)
 Frame = +2

Query  71    LIMGRLVICFVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRS  250
             L  G  +I  +C    F  G   V GYP EDLVV LPGQP+V FRQ++GY+DVD   GRS
Sbjct  6     LSSGGALIVLLCFG--FLVGYEVVEGYPVEDLVVNLPGQPKVGFRQYAGYIDVDVNNGRS  63

Query  251   LFYYFVEAEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNK  430
             L+YYFVEA+KD   + PL LWLNGGPGCSSIGGGAFTELGPFFP G+GRGL INS SWN+
Sbjct  64    LYYYFVEADKDPDNK-PLALWLNGGPGCSSIGGGAFTELGPFFPKGNGRGLRINSMSWNR  122

Query  431   ASNLLFVESPAGVGWSYSNTSSDYTCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGES  610
             ASNLLFVESPAGVGWSYSNT+SDYT GD  TA+DM IF+ KWYEKFPE   R LFLTGES
Sbjct  123   ASNLLFVESPAGVGWSYSNTTSDYTTGDAKTAKDMHIFLLKWYEKFPELKSRELFLTGES  182

Query  611   YAGHYIPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDEN  790
             YAGHYIPQLA +++DHN H  G KFNIKGVA+GNPLLKLDRDVPA  EF WSHG+ISDE 
Sbjct  183   YAGHYIPQLAEVLLDHNAHSTGFKFNIKGVAIGNPLLKLDRDVPATYEFFWSHGMISDEI  242

Query  791   YNAIRNECDFDDYSFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELR  970
                I NEC+FDDY+F  PHN S+SCN AI+  N  V +YIN YDVI+DVCYPSIV+QEL 
Sbjct  243   GLKIMNECEFDDYTFASPHNVSNSCNDAISQANSIVGEYINNYDVILDVCYPSIVQQELL  302

Query  971   LHKAVTKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDG  1150
             L K VTK+S+G+DVCM  ER+FYFNLPEVQKALHANRT+LPY W  C+   +L Y+ TDG
Sbjct  303   LKKVVTKISVGVDVCMTMERSFYFNLPEVQKALHANRTSLPYRWSMCS--GVLNYSDTDG  360

Query  1151  DANVVPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKG  1330
             + +++P++KK++Q+ IP+W++SGDQDSVVPL+GSRT+VRELA D+K  ITVPY AWFHKG
Sbjct  361   NMDILPIIKKIIQNHIPVWVFSGDQDSVVPLLGSRTLVRELADDLKFKITVPYGAWFHKG  420

Query  1331  QVGGWQTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             QVGGW TEYG+LLTF TVRGAAHMVPYAQP RALHLFSSF+RGRRLP+T   PID
Sbjct  421   QVGGWATEYGDLLTFVTVRGAAHMVPYAQPSRALHLFSSFVRGRRLPSTARTPID  475



>ref|XP_003544740.2| PREDICTED: serine carboxypeptidase-like 42-like isoformX1 [Glycine 
max]
Length=487

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/490 (70%), Positives = 396/490 (81%), Gaps = 11/490 (2%)
 Frame = +2

Query  44    GWCSTTYVRLIMGR-----LVICFVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQ  208
             GW S+  V ++MGR     ++I   C S  F G  G V GYP EDLVV LPGQP+V F+Q
Sbjct  4     GWLSSEGV-VVMGRCWLVGVIIVVGCAS--FLGTVGVVEGYPAEDLVVKLPGQPKVGFKQ  60

Query  209   FSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSG  388
             F+GYVDVD K GRSLFYYFVEAE+D H++ PLTLWLNGGPGCSSIGGGAFTELGPF+P G
Sbjct  61    FAGYVDVDAKHGRSLFYYFVEAEQDPHKK-PLTLWLNGGPGCSSIGGGAFTELGPFYPKG  119

Query  389   DGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCGDISTAEDMLIFMKKWYEKF  568
             DGRGL  NS SWNKASNLLFVESPAGVGWSYSNT+SDY  GD STA DM +FM KWYEKF
Sbjct  120   DGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNSGDASTANDMYLFMLKWYEKF  179

Query  569   PEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAV  748
             P ++ R LFLTGESYAGHYIPQL ++++DHN    G KFNIKGVA+GNPLL+LDRD PA+
Sbjct  180   PSYITRELFLTGESYAGHYIPQLTNVLLDHNARSTGSKFNIKGVAIGNPLLRLDRDAPAI  239

Query  749   TEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNAAINDQNRAvsdyinvydvi  928
              E+ WSHG+ISDE   AI N+CDFDDY +  PHN S  CN AI + N  V DYIN YDVI
Sbjct  240   YEYFWSHGMISDEIGLAIMNDCDFDDYVYASPHNVSQLCNNAIYEANLIVGDYINNYDVI  299

Query  929   vdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKT  1108
             +DVCY SI+EQELRL +  TK+S+ +DVCM  ER FYFNLPEVQKALHANRTNLPY W  
Sbjct  300   LDVCYTSIMEQELRLKRMATKISVSVDVCMTLERRFYFNLPEVQKALHANRTNLPYSWSM  359

Query  1109  CADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMK  1288
             C+   +L Y  TDG+ N++P+LK+++Q+ IP+W++SGDQDSVVPL+GSRT++RELA +++
Sbjct  360   CS--HVLNYRDTDGNINILPILKRIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAHELQ  417

Query  1289  MGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRL  1468
               ITVPY AWFHKGQVGGW TEYGNLLTFATVRGAAHMVPYAQP RALHLFSSF+RGRRL
Sbjct  418   FKITVPYGAWFHKGQVGGWVTEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRL  477

Query  1469  PNTTSIPIDQ  1498
             PNTT   ID+
Sbjct  478   PNTTRPSIDE  487



>ref|XP_007019397.1| Serine carboxypeptidase-like 42 isoform 1 [Theobroma cacao]
 gb|EOY16622.1| Serine carboxypeptidase-like 42 isoform 1 [Theobroma cacao]
Length=473

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/449 (73%), Positives = 374/449 (83%), Gaps = 3/449 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLVV LPGQP+V F Q++GYVDVD KAGRSLFYYFVEA+KD  ++ PLTLWLNGGPG
Sbjct  28    PAEDLVVNLPGQPQVGFMQYAGYVDVDVKAGRSLFYYFVEADKDPDKK-PLTLWLNGGPG  86

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P+GDGRGL  NS SWN+ASNLLFVESPAGVGWSYSNTSSDY CG
Sbjct  87    CSSIGGGAFTELGPFYPTGDGRGLRRNSMSWNRASNLLFVESPAGVGWSYSNTSSDYICG  146

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA+DM IFM  WYEKFPEF  R LFLTGESYAGHYIPQLA +++DHN H  G KFNI
Sbjct  147   DASTAKDMHIFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLDHNAHSTGFKFNI  206

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+LDRDVPA  EF WSHG+ISDE    I NECDFDDY F  PHN S SC+ 
Sbjct  207   KGVAIGNPLLRLDRDVPATYEFFWSHGMISDETGLTIMNECDFDDYVFENPHNVSQSCSQ  266

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI + N  V DYIN YDV++DVCYPSIVEQELRL K  TK+S+G+DVCM  ER FY NLP
Sbjct  267   AIAEANGIVGDYINSYDVLLDVCYPSIVEQELRLRKMATKISLGVDVCMTYERRFYLNLP  326

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQ ALHANRT LPY W  C+    +KY+ TDG+ +++P+LKK++Q+ IP+W++SGDQDS
Sbjct  327   EVQMALHANRTKLPYPWSMCS--GQIKYSDTDGNIDILPILKKIIQNGIPVWVFSGDQDS  384

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA D+   ITVPY AWFHK QVGGW TEYGNLLTFATVRGAAHMVPY
Sbjct  385   VVPLLGSRTLVRELAHDLNFKITVPYGAWFHKHQVGGWVTEYGNLLTFATVRGAAHMVPY  444

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPIDQ  1498
             AQP RALHLFSSF+RGRRLPN T   +++
Sbjct  445   AQPSRALHLFSSFVRGRRLPNNTRPSVNE  473



>ref|XP_010244030.1| PREDICTED: serine carboxypeptidase-like 42 isoform X2 [Nelumbo 
nucifera]
Length=469

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/476 (70%), Positives = 391/476 (82%), Gaps = 9/476 (2%)
 Frame = +2

Query  65    VRLIMGRLVICFVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAG  244
             + LI  +LV+  + L++L C   G     P E LV  LPGQP+V FRQF+GY+DVDEKAG
Sbjct  1     MNLIYCQLVL--LGLAVLICVVDGY----PVEHLVSKLPGQPKVDFRQFAGYIDVDEKAG  54

Query  245   RSLFYYFVEAEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSW  424
             RSLFYYFVEAE +  ++ PLTLWLNGGPGCSS+GGGAFTELGPFFP GDGRGL  N+KSW
Sbjct  55    RSLFYYFVEAEGEPEKK-PLTLWLNGGPGCSSVGGGAFTELGPFFPRGDGRGLRRNTKSW  113

Query  425   NKASNLLFVESPAGVGWSYSNTSSDYTCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTG  604
             NKASNLLFVESPAGVGWSYSNT+SDYTCGD S+A DM +F+ KW++K+PE+  R LFLTG
Sbjct  114   NKASNLLFVESPAGVGWSYSNTTSDYTCGDASSARDMHMFLMKWFQKYPEYKSRDLFLTG  173

Query  605   ESYAGHYIPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISD  784
             ESYAGHYIPQLA++++D+N+H    KFNIKGVA+GNPLLKLDRD+PA  EF WSHG+ISD
Sbjct  174   ESYAGHYIPQLANVLLDYNEHSTDFKFNIKGVAIGNPLLKLDRDIPATYEFFWSHGMISD  233

Query  785   ENYNAIRNECDFDDYSFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQE  964
             E    I NEC+FDDY F   HN S SCN AI   N+ V DYIN YDVI+DVCYPSIVEQE
Sbjct  234   EIGLTIMNECNFDDYVFSNSHNVSQSCNQAIAGANQVVGDYINNYDVILDVCYPSIVEQE  293

Query  965   LRLHKAVTKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQT  1144
             LRL K  TK+S+G+DVCM  ER FYFNLP VQ+ALHANRTNLPY W  C++  +L YN+T
Sbjct  294   LRLRKLATKISIGVDVCMSYERRFYFNLPRVQQALHANRTNLPYGWSMCSN--ILNYNET  351

Query  1145  DGDANVVPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFH  1324
             DG+ +++PLLK++++H IP+W++SGDQDSVVPL+GSRT+VRELA D+   +TVPY AWFH
Sbjct  352   DGNISILPLLKRIIKHHIPVWVFSGDQDSVVPLLGSRTLVRELAHDLNFEVTVPYGAWFH  411

Query  1325  KGQVGGWQTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNTTSIPI  1492
             KGQVGGW TEYGNLLTFATVRGAAHMVPYAQP RALHLFSSF+ GRRLPNTT   I
Sbjct  412   KGQVGGWATEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNTTRPSI  467



>ref|XP_004290564.1| PREDICTED: serine carboxypeptidase-like 42-like [Fragaria vesca 
subsp. vesca]
Length=467

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/449 (73%), Positives = 373/449 (83%), Gaps = 3/449 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLVV LPGQP+V F+Q++GYVDVD K GRSLFYYFVEAE    ++ PL+LWLNGGPG
Sbjct  22    PAEDLVVKLPGQPQVGFKQYAGYVDVDVKNGRSLFYYFVEAENQADKK-PLSLWLNGGPG  80

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P+GDGRGL  N  SWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  81    CSSIGGGAFTELGPFYPTGDGRGLRRNPSSWNRASNLLFVESPAGVGWSYSNTSSDYNSG  140

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DM  F+ KWYEKFP +  R LFLTGESYAGHYIPQLA  ++DHNKH  G KFN+
Sbjct  141   DASTARDMHTFLLKWYEKFPAYKSRALFLTGESYAGHYIPQLAVAILDHNKHSTGFKFNL  200

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+LDRDVPA  EF WSHG+ISDE    I N+CDFDDY F  PHN S +CN 
Sbjct  201   KGVAIGNPLLRLDRDVPATYEFFWSHGMISDEIGLTIMNDCDFDDYEFAIPHNVSVACNN  260

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI   N  V DYIN YDVI+DVCYPSIVEQELRL K  TK+S+G+DVCM  ER FYFNLP
Sbjct  261   AIATANSIVGDYINNYDVILDVCYPSIVEQELRLRKTATKISVGVDVCMTYERRFYFNLP  320

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRTNLPY W  C++  +L Y+ TDG+ N++PLL +++++ IPLW++SGD+DS
Sbjct  321   EVQKALHANRTNLPYSWSMCSN--VLNYSDTDGNLNMLPLLARIVKNHIPLWVFSGDEDS  378

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT++RELA D+K  ITVPY AWFHKGQVGGW TEYGNLLTFATVRGAAHMVPY
Sbjct  379   VVPLLGSRTLIRELAHDLKFKITVPYGAWFHKGQVGGWATEYGNLLTFATVRGAAHMVPY  438

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPIDQ  1498
             AQP RALHLFSSF+R RRLPNTT  PID+
Sbjct  439   AQPSRALHLFSSFVRNRRLPNTTRPPIDE  467



>ref|XP_002268397.1| PREDICTED: serine carboxypeptidase-like 42 [Vitis vinifera]
 emb|CBI20040.3| unnamed protein product [Vitis vinifera]
Length=474

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/468 (72%), Positives = 384/468 (82%), Gaps = 4/468 (1%)
 Frame = +2

Query  95    CFVCLSLLFCgggggvygy-PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVE  271
              FV + LL C   G      PEEDLVV LPGQP+V FRQF GYVDVDEKAGRS+FYYFVE
Sbjct  10    AFVGVVLLLCDVCGAANNGWPEEDLVVRLPGQPKVGFRQFGGYVDVDEKAGRSMFYYFVE  69

Query  272   AEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFV  451
             AE+D   + PLTLWLNGGPGCSS+GGGAFT LGPFFP G  RG+  NSKSWNK SNLLFV
Sbjct  70    AEEDPQNK-PLTLWLNGGPGCSSVGGGAFTALGPFFPKGHSRGVRRNSKSWNKVSNLLFV  128

Query  452   ESPAGVGWSYSNTSSDYTCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIP  631
             ESPAGVGWSYSNTS+DY CGD STA DML FM KW++KFP +  RPLFLTGESYAGHYIP
Sbjct  129   ESPAGVGWSYSNTSADYNCGDASTASDMLTFMLKWFKKFPGYKLRPLFLTGESYAGHYIP  188

Query  632   QLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNE  811
             QLA++++D+NK  K  KFNIKGVA+GNPLL+LDRDVPAV EF WSHG+ISDE   AI N+
Sbjct  189   QLANVLLDYNKKSKDFKFNIKGVAIGNPLLQLDRDVPAVYEFFWSHGMISDEVGLAIMND  248

Query  812   CDFDDYSFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTK  991
             C+F+DY+F   HN S  C+ A+ND    V  YIN YDVI+DVCYPSIV+QELRL K VTK
Sbjct  249   CNFEDYTFSGTHNVSTECSTALNDAYSIVGSYINPYDVILDVCYPSIVQQELRLRKVVTK  308

Query  992   MSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPL  1171
             +S+G+DVCM +ERTFYFNLPEVQKALHANRTNLPY W TC++  +L YN+ D + +++PL
Sbjct  309   ISIGVDVCMTAERTFYFNLPEVQKALHANRTNLPYHWTTCSN--ILFYNEGDSNLDMLPL  366

Query  1172  LKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQT  1351
             LK++LQ KIP+WI+SGDQDSVVPL+GSRT+VRELA D+    TVPY AWFHKGQVGGWQT
Sbjct  367   LKRILQDKIPVWIFSGDQDSVVPLMGSRTLVRELAKDLNFQHTVPYGAWFHKGQVGGWQT  426

Query  1352  EYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             EYGNLLTFATVRGAAHMV Y+QP RALHLF++FI GRRLPN T   ID
Sbjct  427   EYGNLLTFATVRGAAHMVSYSQPSRALHLFATFIHGRRLPNNTRPSID  474



>ref|XP_010244029.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Nelumbo 
nucifera]
Length=505

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/447 (73%), Positives = 377/447 (84%), Gaps = 3/447 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P E LV  LPGQP+V FRQF+GY+DVDEKAGRSLFYYFVEAE +  ++ PLTLWLNGGPG
Sbjct  60    PVEHLVSKLPGQPKVDFRQFAGYIDVDEKAGRSLFYYFVEAEGEPEKK-PLTLWLNGGPG  118

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPFFP GDGRGL  N+KSWNKASNLLFVESPAGVGWSYSNT+SDYTCG
Sbjct  119   CSSVGGGAFTELGPFFPRGDGRGLRRNTKSWNKASNLLFVESPAGVGWSYSNTTSDYTCG  178

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D S+A DM +F+ KW++K+PE+  R LFLTGESYAGHYIPQLA++++D+N+H    KFNI
Sbjct  179   DASSARDMHMFLMKWFQKYPEYKSRDLFLTGESYAGHYIPQLANVLLDYNEHSTDFKFNI  238

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLLKLDRD+PA  EF WSHG+ISDE    I NEC+FDDY F   HN S SCN 
Sbjct  239   KGVAIGNPLLKLDRDIPATYEFFWSHGMISDEIGLTIMNECNFDDYVFSNSHNVSQSCNQ  298

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI   N+ V DYIN YDVI+DVCYPSIVEQELRL K  TK+S+G+DVCM  ER FYFNLP
Sbjct  299   AIAGANQVVGDYINNYDVILDVCYPSIVEQELRLRKLATKISIGVDVCMSYERRFYFNLP  358

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
              VQ+ALHANRTNLPY W  C++  +L YN+TDG+ +++PLLK++++H IP+W++SGDQDS
Sbjct  359   RVQQALHANRTNLPYGWSMCSN--ILNYNETDGNISILPLLKRIIKHHIPVWVFSGDQDS  416

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA D+   +TVPY AWFHKGQVGGW TEYGNLLTFATVRGAAHMVPY
Sbjct  417   VVPLLGSRTLVRELAHDLNFEVTVPYGAWFHKGQVGGWATEYGNLLTFATVRGAAHMVPY  476

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPI  1492
             AQP RALHLFSSF+ GRRLPNTT   I
Sbjct  477   AQPSRALHLFSSFVHGRRLPNTTRPSI  503



>gb|KHN05260.1| Serine carboxypeptidase-like 42 [Glycine soja]
Length=474

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/479 (70%), Positives = 389/479 (81%), Gaps = 10/479 (2%)
 Frame = +2

Query  77    MGR-----LVICFVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKA  241
             MGR     ++I   C S  F G  G V GYP EDLVV LPGQP+V F+QF+GYVDVD K 
Sbjct  1     MGRCWLVGVIIVVGCAS--FLGTVGVVEGYPAEDLVVKLPGQPKVGFKQFAGYVDVDAKH  58

Query  242   GRSLFYYFVEAEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKS  421
             GRSLFYYFVEAE+D H++ PLTLWLNGGPGCSSIGGGAFTELGPF+P GDGRGL  NS S
Sbjct  59    GRSLFYYFVEAEQDPHKK-PLTLWLNGGPGCSSIGGGAFTELGPFYPKGDGRGLRRNSMS  117

Query  422   WNKASNLLFVESPAGVGWSYSNTSSDYTCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLT  601
             WNKASNLLFVESPAGVGWSYSNT+SDY  GD STA DM +FM KWYEKFP ++ R LFLT
Sbjct  118   WNKASNLLFVESPAGVGWSYSNTTSDYNSGDASTANDMYLFMLKWYEKFPSYITRELFLT  177

Query  602   GESYAGHYIPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIIS  781
             GESYAGHYIPQL ++++DHN    G KFNIKGVA+GNPLL+LDRD PA+ E+ WSHG+IS
Sbjct  178   GESYAGHYIPQLTNVLLDHNARSTGSKFNIKGVAIGNPLLRLDRDAPAIYEYFWSHGMIS  237

Query  782   DENYNAIRNECDFDDYSFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQ  961
             DE   AI N+CDFDDY +  PHN S  CN AI + N  V DYIN YDVI+DVCY SI+EQ
Sbjct  238   DEIGLAIMNDCDFDDYVYASPHNVSQLCNNAIYEANLIVGDYINNYDVILDVCYTSIMEQ  297

Query  962   ELRLHKAVTKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQ  1141
             ELRL +  TK+S+ +DVC+  ER FYFNLPEVQKALHANRTNLPY W  C+   +L Y  
Sbjct  298   ELRLKRMATKISVSVDVCITLERRFYFNLPEVQKALHANRTNLPYSWSMCS--HVLNYRD  355

Query  1142  TDGDANVVPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWF  1321
             TDG+ N++P+LK+++Q+ IP+W++SGDQDSVVPL+GSRT++RELA +++  ITVPY AWF
Sbjct  356   TDGNINILPILKRIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAHELQFKITVPYGAWF  415

Query  1322  HKGQVGGWQTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNTTSIPIDQ  1498
             HKGQVGGW TEYGNLLTFATVRGAAHMVPYAQP RALHLFSSF+RGRRLPNTT   ID+
Sbjct  416   HKGQVGGWVTEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRLPNTTRPSIDE  474



>ref|XP_008786550.1| PREDICTED: serine carboxypeptidase-like 42 [Phoenix dactylifera]
Length=475

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/451 (71%), Positives = 375/451 (83%), Gaps = 3/451 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLVVGLP QP+V FRQ++GYVDVDEKAGRSLFYYF EA+ +  ++ PLTLWLNGGPG
Sbjct  26    PEEDLVVGLPRQPKVGFRQYAGYVDVDEKAGRSLFYYFAEADGNADKK-PLTLWLNGGPG  84

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPFFP GDGRGL  N  SWNKASNLLFVESPAGVGWSYSN +SDYTCG
Sbjct  85    CSSIGGGAFTELGPFFPRGDGRGLRRNKMSWNKASNLLFVESPAGVGWSYSNRTSDYTCG  144

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D S A D+ +F+ +WY+KFPEF  R LFLTGESYAGHYIPQLA+++++HNKH  G KF I
Sbjct  145   DESAANDLHVFLLRWYDKFPEFKSRDLFLTGESYAGHYIPQLANVLLNHNKHSTGFKFKI  204

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLLKLDRD PA  EF WSHG+ISDE    I NECDF+DY+F+ PHN S+SCN 
Sbjct  205   KGVAIGNPLLKLDRDAPATYEFFWSHGMISDEIGLVIMNECDFEDYTFVSPHNMSESCND  264

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             A+   N  V +YIN YDV++DVCYP+IVEQELRL K  T++SMG+DVCM  ER FYFNLP
Sbjct  265   ALAKANDVVGEYINNYDVLIDVCYPAIVEQELRLRKYATRISMGVDVCMTYERHFYFNLP  324

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQ ALHANRT LPY W  C+D  +L Y+ TD + N++PLLK++++H+IP+WI+SGDQDS
Sbjct  325   EVQHALHANRTKLPYSWSMCSD--VLNYSGTDPNINILPLLKRIIKHQIPVWIFSGDQDS  382

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVP +GSRT+VRELA D+K G+T+PY AWF+KGQ GGW TEYGNLLTFATVRGAAHMVPY
Sbjct  383   VVPFLGSRTLVRELAHDLKFGVTLPYGAWFYKGQAGGWSTEYGNLLTFATVRGAAHMVPY  442

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPIDQQQ  1504
             AQP RAL LF SF+ G+RLPNTT  PID   
Sbjct  443   AQPARALRLFRSFVNGQRLPNTTYPPIDDDN  473



>ref|XP_003527966.2| PREDICTED: serine carboxypeptidase-like 42-like isoform X1 [Glycine 
max]
Length=473

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/448 (73%), Positives = 375/448 (84%), Gaps = 3/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P+EDL+V LPGQP+V F+Q++GYVD+D K GRSLFYYFVEAE +V  + PLTLWLNGGPG
Sbjct  28    PDEDLIVSLPGQPKVEFKQYAGYVDIDVKHGRSLFYYFVEAE-NVPDKKPLTLWLNGGPG  86

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P GDGRGL  NS SWNKASNLLFVESPAGVGWSYSNT+SDY  G
Sbjct  87    CSSIGGGAFTELGPFYPKGDGRGLRTNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNSG  146

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DML+F+ KWY+KFP +  R LFLTGESYAGHYIPQLA++++D+N H    KFNI
Sbjct  147   DSSTATDMLLFLLKWYQKFPSYRSRELFLTGESYAGHYIPQLANVLLDYNVHSTSFKFNI  206

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLLKLDRD  A  E+ WSHG+ISDE   AI N+CDFDDY F   HN S SCN 
Sbjct  207   KGVAIGNPLLKLDRDAQATYEYFWSHGMISDEIGLAITNDCDFDDYVFASAHNMSKSCNE  266

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AIN+ N  V DYIN YDVI DVCYPSIVEQELRL K  TK+S+G+DVCM  ER+FYFNLP
Sbjct  267   AINEANEIVGDYINNYDVIFDVCYPSIVEQELRLKKIATKISIGVDVCMTYERSFYFNLP  326

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRTNLPY W  C+   +L Y+ TD + +++P+LKK++Q+ IP+W++SGDQDS
Sbjct  327   EVQKALHANRTNLPYQWSMCS--GVLNYSDTDPNIDILPILKKIVQNHIPVWVFSGDQDS  384

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT++RELA D+K  ITVPY AWFHKGQVGGW TEYGNLLTFATVRGAAHMVPY
Sbjct  385   VVPLLGSRTLIRELAHDLKFKITVPYGAWFHKGQVGGWVTEYGNLLTFATVRGAAHMVPY  444

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP RALHLFSSF+ GRRLPNTTS  ID
Sbjct  445   AQPSRALHLFSSFVHGRRLPNTTSPSID  472



>ref|XP_008237677.1| PREDICTED: serine carboxypeptidase-like 42 [Prunus mume]
Length=471

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/443 (73%), Positives = 373/443 (84%), Gaps = 3/443 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLVV LPGQP V F+Q++GYVDVD KAGRSLFYYFVEA+K+  ++ PLTLWLNGGPG
Sbjct  28    PAEDLVVRLPGQPNVGFKQYAGYVDVDVKAGRSLFYYFVEADKEPDKK-PLTLWLNGGPG  86

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P+GDGRGL  N  SWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  87    CSSIGGGAFTELGPFYPTGDGRGLRRNLMSWNRASNLLFVESPAGVGWSYSNTSSDYNSG  146

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DM  F+ KWYEKFP F  R LFLTGESYAGHYIPQLA  ++DHN+H  G KFN+
Sbjct  147   DASTARDMHTFLLKWYEKFPAFRSRELFLTGESYAGHYIPQLAIAILDHNEHSTGFKFNL  206

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KG+A+GNPLL+LDRD+PA  E+ WSHG+ISDE    I NECDFDDY+F  PHN +  C  
Sbjct  207   KGIAIGNPLLRLDRDIPATYEYFWSHGMISDEIGLIIMNECDFDDYAFANPHNVTVKCTT  266

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI++ N+ V DYIN YDVI+DVCYPSIV+QELRL K  TKMS+G+DVCM SER FYFNLP
Sbjct  267   AISEANQIVGDYINNYDVILDVCYPSIVQQELRLRKMATKMSLGVDVCMSSERRFYFNLP  326

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRTNLPY W  C++  +L Y+ TDG+ N++PLL +++ ++IP+W++SGDQDS
Sbjct  327   EVQKALHANRTNLPYSWSMCSN--VLNYSDTDGNINILPLLARIVHNRIPVWVFSGDQDS  384

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT++RELA D+K  ITVPY  WFHKGQ GGW TEYG+LLTFATVRGAAHMVPY
Sbjct  385   VVPLLGSRTLIRELAHDLKFQITVPYGVWFHKGQAGGWATEYGDLLTFATVRGAAHMVPY  444

Query  1412  AQPGRALHLFSSFIRGRRLPNTT  1480
             AQP RALHLFSSFIRGRRLPNTT
Sbjct  445   AQPSRALHLFSSFIRGRRLPNTT  467



>ref|XP_009767156.1| PREDICTED: serine carboxypeptidase-like 42 isoform X2 [Nicotiana 
sylvestris]
Length=445

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/447 (71%), Positives = 359/447 (80%), Gaps = 33/447 (7%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLV  LPGQP+V FRQ++GYVDVDEKAGRSLFYYFVEAEKD  + LPLTLWLNGGPG
Sbjct  31    PIEDLVENLPGQPKVGFRQYAGYVDVDEKAGRSLFYYFVEAEKDADK-LPLTLWLNGGPG  89

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPFFP GDGRGL  N+KSWNKASNLLF+ESPAGVGWSYSNTSSDYTCG
Sbjct  90    CSSIGGGAFTELGPFFPRGDGRGLRRNTKSWNKASNLLFIESPAGVGWSYSNTSSDYTCG  149

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D  TA+DML FM +WYEKF E   +PLFLTGESYAGHYIPQLA++++D+NK  K  KFN+
Sbjct  150   DDPTAKDMLTFMLRWYEKFSELKSKPLFLTGESYAGHYIPQLANVILDYNKQSKDFKFNL  209

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+LDRDVPAV E+ WSHG+ISDE Y  I+  C+FDDY F  PHNE  SCN 
Sbjct  210   KGVAIGNPLLRLDRDVPAVYEYYWSHGMISDELYLRIKEHCNFDDYEFPVPHNEPISCNQ  269

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI++  +                              VTKMS+G+DVCM SER FYFNLP
Sbjct  270   AIDEAYK------------------------------VTKMSVGVDVCMTSERYFYFNLP  299

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRTNLPY+W  C+D  +L Y+Q+DGD +++P LK ++QH +PLWI+SGDQDS
Sbjct  300   EVQKALHANRTNLPYEWTMCSD--VLNYSQSDGDTDMLPSLKNIIQHDVPLWIFSGDQDS  357

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA D+KM  TV Y AWFHKGQVGGWQ EYG+ LTFATVRGAAHMVPY
Sbjct  358   VVPLIGSRTLVRELANDLKMKTTVAYGAWFHKGQVGGWQIEYGDKLTFATVRGAAHMVPY  417

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPI  1492
             AQP RALHLFSSF+ GRRLPNTT IPI
Sbjct  418   AQPSRALHLFSSFVHGRRLPNTTRIPI  444



>gb|KHF97371.1| Serine carboxypeptidase-like 42 [Gossypium arboreum]
Length=483

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/449 (73%), Positives = 369/449 (82%), Gaps = 3/449 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLVV LPGQP V F+Q++GYVDVD KAGRSLFYYFVEA+K+  ++ PLTLWLNGGPG
Sbjct  38    PAEDLVVKLPGQPPVGFKQYAGYVDVDVKAGRSLFYYFVEADKNPEKQ-PLTLWLNGGPG  96

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P GDGR L INS SWNKASNLLFVESP GVGWSYSNTSSDY  G
Sbjct  97    CSSVGGGAFTELGPFYPRGDGRSLRINSMSWNKASNLLFVESPVGVGWSYSNTSSDYIRG  156

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA+DM IFM KWYEKFPEF  R LFLTGESYAGHYIPQLA +++DHN   KG KFNI
Sbjct  157   DASTAKDMYIFMMKWYEKFPEFKSRELFLTGESYAGHYIPQLAEVLLDHNARSKGFKFNI  216

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+LDRDVPA  EF WSHG+ISDE    I NECDFDDY F  PHN S  C  
Sbjct  217   KGVAIGNPLLRLDRDVPATYEFFWSHGMISDEVGLTIMNECDFDDYVFESPHNVSHPCYQ  276

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI + NR V  Y+N YDV++D+CYPS+VEQELRL K  TK+S+GIDVCM  ER FY NLP
Sbjct  277   AIVEANRIVGHYVNNYDVLLDICYPSLVEQELRLRKMATKISIGIDVCMSFERRFYLNLP  336

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQ ALHANRT LPYDW  C+    L Y+ +DG+ N++P+LKK++ + IP+WI+SGDQDS
Sbjct  337   EVQMALHANRTKLPYDWSMCS--GRLSYSDSDGNINILPILKKIILNGIPVWIFSGDQDS  394

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA D+K  ITVPY AWFHK QVGGW TEYGNLLTFATVRGAAHMVPY
Sbjct  395   VVPLLGSRTLVRELAHDLKFKITVPYRAWFHKQQVGGWVTEYGNLLTFATVRGAAHMVPY  454

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPIDQ  1498
             +QP RALHLFSSF+ GRRLPN T  PI +
Sbjct  455   SQPSRALHLFSSFVHGRRLPNNTHPPIHE  483



>ref|XP_004490638.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X2 [Cicer 
arietinum]
Length=476

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/471 (70%), Positives = 384/471 (82%), Gaps = 3/471 (1%)
 Frame = +2

Query  86    LVICFVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYF  265
             ++I   CL         GV GYP EDLVV LPGQP+V F Q+ GYVD+D K GRSLFYYF
Sbjct  9     VLIAVACLCNFLETSVWGVEGYPIEDLVVRLPGQPKVKFSQYGGYVDIDVKHGRSLFYYF  68

Query  266   VEAEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLL  445
             VEA+   H++ PLTLWLNGGPGCSSIGGGAFTELGPF+P+GDGRGL  NS SWN+ASNLL
Sbjct  69    VEADHHPHKK-PLTLWLNGGPGCSSIGGGAFTELGPFYPTGDGRGLRKNSMSWNRASNLL  127

Query  446   FVESPAGVGWSYSNTSSDYTCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHY  625
             FVESPAGVGWSYSNTSSDY  GD STA+DM++F+ KWYEKFP +  R LFLTGESYAGHY
Sbjct  128   FVESPAGVGWSYSNTSSDYNSGDASTADDMVLFLLKWYEKFPSYKSRDLFLTGESYAGHY  187

Query  626   IPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIR  805
             IPQLA+ ++D+N H  G KFN KGVA+GNPLL LDRD  A  ++ WSHG+ISDE   AI 
Sbjct  188   IPQLANAILDYNAHSTGFKFNTKGVAIGNPLLNLDRDSQATYDYFWSHGMISDEIGLAIT  247

Query  806   NECDFDDYSFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAV  985
             N+CDFDDY+F  PHN S SCN A+ND N+ V DYIN YDVI+DVCYPSIVEQELRL K  
Sbjct  248   NDCDFDDYTFASPHNISKSCNDAMNDANKVVGDYINNYDVILDVCYPSIVEQELRLKKMA  307

Query  986   TKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVV  1165
             TK+S+G+DVCM  ER FYFNLPEVQKALHANRTNLPY W  C+   +L Y+ TD + N++
Sbjct  308   TKISIGVDVCMSYERRFYFNLPEVQKALHANRTNLPYPWSMCS--GVLNYSDTDPNINML  365

Query  1166  PLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGW  1345
             P+LK+++Q+ IP+W++SGDQDSVVPL+GSRT++RELA D+K  ITVPY AWFHKGQVGGW
Sbjct  366   PILKRIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAHDLKFKITVPYGAWFHKGQVGGW  425

Query  1346  QTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNTTSIPIDQ  1498
              TEYGNLLTFATVRGAAHMVPYAQP RALHLFSSF+ GRRLPNTT   ID+
Sbjct  426   VTEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVNGRRLPNTTRPSIDE  476



>ref|XP_002300939.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEE80212.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=480

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/448 (72%), Positives = 373/448 (83%), Gaps = 3/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P +DLV+ LPGQP+V FRQ++GYVDVD K GRSLFYYFVEA+KD  ++ PL LWLNGGPG
Sbjct  35    PSKDLVLNLPGQPKVGFRQYAGYVDVDVKNGRSLFYYFVEADKDPDQK-PLALWLNGGPG  93

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPFFP GDGRGL  NS SWN+ASNLLFVESPAGVGWSYSNT+SDYT G
Sbjct  94    CSSIGGGAFTELGPFFPKGDGRGLRRNSMSWNRASNLLFVESPAGVGWSYSNTTSDYTTG  153

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D  TA+DM +F+ KWYEKFP+F  R LFLTGESYAGHYIPQLA +++DHN      KFNI
Sbjct  154   DAKTAKDMHMFLLKWYEKFPDFKSRELFLTGESYAGHYIPQLAEVLLDHNAQSTNFKFNI  213

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+LDRDVPA  EF WSHG+ISDE    I NEC F+DY++  PHN +DSCN 
Sbjct  214   KGVAIGNPLLRLDRDVPATYEFFWSHGMISDEIGLKIMNECAFNDYTYASPHNVTDSCND  273

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI+  N  + DYIN YDVI+DVCYPSIV QELRL K  TK+S+G+DVCM  ER FYFNLP
Sbjct  274   AISQANSIIGDYINNYDVILDVCYPSIVNQELRLRKMATKISVGVDVCMTYERRFYFNLP  333

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRT LPY W  C+D  +L Y+ TDG+ +++P+LKK++Q+ IP+W++SGDQDS
Sbjct  334   EVQKALHANRTKLPYPWSMCSD--VLNYSDTDGNIDILPILKKIIQNHIPVWVFSGDQDS  391

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+V+ELA D+   ITVPY  WFHKGQVGGW TEYGNLLTFATVR AAHMVPY
Sbjct  392   VVPLLGSRTLVKELAQDLNFKITVPYGTWFHKGQVGGWATEYGNLLTFATVRSAAHMVPY  451

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP RALHLFSSF+RGRRLPNTT + +D
Sbjct  452   AQPSRALHLFSSFVRGRRLPNTTDVRMD  479



>ref|XP_004148827.1| PREDICTED: serine carboxypeptidase-like 42-like [Cucumis sativus]
Length=480

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/448 (73%), Positives = 368/448 (82%), Gaps = 3/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P +DLV  LPGQP V FRQF+GYVDVD  AGRSLFYYF EA++D H  LPLTLWLNGGPG
Sbjct  35    PAQDLVDRLPGQPTVGFRQFAGYVDVDVNAGRSLFYYFAEAQQDPHL-LPLTLWLNGGPG  93

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P GDGRGL  NS SWNKASNLLFVESPAGVGWSYSN +SDYTCG
Sbjct  94    CSSVGGGAFTELGPFYPKGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNRTSDYTCG  153

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DML FM KWY+KFP F DR  FLTGESYAGHYIPQLA  ++D+N H K  KFNI
Sbjct  154   DDSTARDMLTFMLKWYDKFPAFKDRSFFLTGESYAGHYIPQLADAILDYNIHSKAFKFNI  213

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL LDRD  A  EF WSHG+ISDE + AI  +C+FDDY    PHN + SCN 
Sbjct  214   KGVAIGNPLLNLDRDAQATYEFFWSHGMISDEVWFAITRDCNFDDYVLTNPHNVTKSCNE  273

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI D N  V +YIN YDV++DVCYPSIVEQELRL K  TK+SMG+DVCM  ER FYFNLP
Sbjct  274   AIADANGIVGEYINNYDVLLDVCYPSIVEQELRLKKLATKISMGVDVCMTYERRFYFNLP  333

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRTNLPY+W  C+D   L YN  D + N++PLL++++++ IPLWIYSGD+DS
Sbjct  334   EVQKALHANRTNLPYEWSMCSD--TLDYNYDDTNINMLPLLQRIVRNHIPLWIYSGDEDS  391

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA D+K+ +TVPY AWFHKGQVGGW  EYGN LTFATVRGA+HMVP+
Sbjct  392   VVPLLGSRTLVRELAHDLKLKVTVPYGAWFHKGQVGGWAIEYGNTLTFATVRGASHMVPF  451

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP RALHLFSSF+RGRRLPN+T   ID
Sbjct  452   AQPSRALHLFSSFVRGRRLPNSTRPSID  479



>ref|XP_010930631.1| PREDICTED: serine carboxypeptidase-like 42 [Elaeis guineensis]
Length=476

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/448 (72%), Positives = 372/448 (83%), Gaps = 3/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLVVGLPGQP+V FRQ++GYVDVD K G+SLFYYF EA+ +  ++ PLTLWLNGGPG
Sbjct  27    PEEDLVVGLPGQPKVEFRQYAGYVDVDTKTGKSLFYYFAEADSNASKK-PLTLWLNGGPG  85

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P GDGRGL  N KSWNKASNLLFVESP GVGWSYSN SSDYTCG
Sbjct  86    CSSIGGGAFTELGPFYPRGDGRGLRRNKKSWNKASNLLFVESPVGVGWSYSNRSSDYTCG  145

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DM +F+ +WY+KFPEF  R LFLTGESYAGHYIPQLA+++++HNKH  G KF I
Sbjct  146   DESTANDMHVFLLRWYDKFPEFKSRDLFLTGESYAGHYIPQLANVLLNHNKHSTGFKFKI  205

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLLKLDRD  A  EF WSHG+ISDE    I N+CDF+DY F+ PHN S+SCN 
Sbjct  206   KGVAIGNPLLKLDRDAAATYEFFWSHGMISDEIGLTIMNQCDFEDYVFLSPHNVSESCND  265

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI   N  V DYIN YDVI+DVCYP+IVEQELRL K  TK+S+G+DVCM  ER FYFNLP
Sbjct  266   AIEKANEIVGDYINNYDVIIDVCYPAIVEQELRLRKYATKISVGVDVCMTYERHFYFNLP  325

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQ ALHANRT LPY W  C+   +L Y+ TD + +++PLLK++++H IP+WI+SGDQDS
Sbjct  326   EVQHALHANRTKLPYSWSMCS--GVLNYSDTDPNIDILPLLKRIIKHHIPVWIFSGDQDS  383

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVP +GSRT+VRELA D+K G+TVPYSAWF+KGQVGGW TEYGNLLTFATVRGAAHMVP+
Sbjct  384   VVPFLGSRTLVRELAHDLKFGVTVPYSAWFYKGQVGGWATEYGNLLTFATVRGAAHMVPF  443

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP RAL LF SF+ G+RLPNTT   ID
Sbjct  444   AQPARALRLFRSFVNGQRLPNTTYPSID  471



>ref|XP_003522555.2| PREDICTED: serine carboxypeptidase-like 42-like isoform X1 [Glycine 
max]
 gb|KHN44256.1| Serine carboxypeptidase-like 42 [Glycine soja]
Length=473

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/448 (72%), Positives = 374/448 (83%), Gaps = 3/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P+EDL+V LPGQP+V F+Q++GYVD+D K GRSLFYYFVEAE    ++ PLTLWLNGGPG
Sbjct  28    PDEDLIVSLPGQPKVGFKQYAGYVDIDVKHGRSLFYYFVEAENGPDKK-PLTLWLNGGPG  86

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P GDGRGL  NS SWN+ASNLLFVESPAGVGWSYSN +SDY  G
Sbjct  87    CSSIGGGAFTELGPFYPKGDGRGLRRNSMSWNRASNLLFVESPAGVGWSYSNKTSDYNSG  146

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DML+F++KWYEKFP +  R LFLTGESYAGHYIPQLA++++D+N H  G KFNI
Sbjct  147   DSSTATDMLLFLRKWYEKFPSYRSRELFLTGESYAGHYIPQLANVLLDYNAHSTGFKFNI  206

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLLKLDRD  A  E+ WSHG+ISDE   AI N+CDFDDY F   HN S SCN 
Sbjct  207   KGVAIGNPLLKLDRDAQATYEYFWSHGMISDEIGLAITNDCDFDDYVFASTHNVSKSCNE  266

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AIN+ N  V DYIN YDVI+DVCYPSIVEQELRL K  TK+S+G+DVCM  ER+FYFNLP
Sbjct  267   AINEANEIVGDYINNYDVILDVCYPSIVEQELRLKKMATKISIGVDVCMTYERSFYFNLP  326

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRTNLPY W  C+   +L Y+ TD + +++P+LKK++Q+ IP+W++SGDQDS
Sbjct  327   EVQKALHANRTNLPYQWSMCS--GVLNYSDTDPNIDILPVLKKIVQNHIPVWVFSGDQDS  384

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT++RELA D+K  ITVPY AWFHKGQVGGW TEYGNLLTFATVRGAAHMVPY
Sbjct  385   VVPLLGSRTLIRELAHDLKFKITVPYGAWFHKGQVGGWVTEYGNLLTFATVRGAAHMVPY  444

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP RALHLFSSF+  +RLPNTT   ID
Sbjct  445   AQPSRALHLFSSFVLRKRLPNTTHPSID  472



>ref|XP_010062160.1| PREDICTED: serine carboxypeptidase-like 42 [Eucalyptus grandis]
 gb|KCW69227.1| hypothetical protein EUGRSUZ_F02740 [Eucalyptus grandis]
Length=472

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/474 (69%), Positives = 381/474 (80%), Gaps = 3/474 (1%)
 Frame = +2

Query  74    IMGRLVICFVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSL  253
             + GR   C+V + L        V GYP +DLVV LPGQP+V FRQF+GYVDVD K GRSL
Sbjct  1     MTGREWACWVLIVLGGVWSVVVVEGYPAQDLVVNLPGQPKVGFRQFAGYVDVDVKHGRSL  60

Query  254   FYYFVEAEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKA  433
             FYYFVEA+KD   + PL LWLNGGPGCSSIGGGAFTELGPF+P GDGRGL  NS SWN+A
Sbjct  61    FYYFVEADKDPESK-PLALWLNGGPGCSSIGGGAFTELGPFYPRGDGRGLRRNSMSWNRA  119

Query  434   SNLLFVESPAGVGWSYSNTSSDYTCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESY  613
             SNLLFVESPAGVGWSYSNT+SDY CGD S+A+D+  F  KW+EKFP +  R LFLTGESY
Sbjct  120   SNLLFVESPAGVGWSYSNTTSDYNCGDESSAKDLHTFFLKWFEKFPTYKSRDLFLTGESY  179

Query  614   AGHYIPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENY  793
             AGHYIPQLA  ++DHN H  G KFN+KG+A+GNPLLKLDRD PA  EF WSHG+ISDE  
Sbjct  180   AGHYIPQLAVALLDHNAHSTGFKFNLKGIAIGNPLLKLDRDAPATYEFFWSHGMISDELG  239

Query  794   NAIRNECDFDDYSFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRL  973
               I NECDFDDY F  PHN + +CN A++  N  V DYIN YDVI+D+CYPSIVEQELRL
Sbjct  240   LTIMNECDFDDYLFASPHNVTQTCNDALSKANIIVGDYINNYDVILDMCYPSIVEQELRL  299

Query  974   HKAVTKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGD  1153
              K  TK+S+G+DVCM  ER FY NLPEVQKALHANRTNLPY W  C+   ++ Y+ TDG+
Sbjct  300   RKTATKLSVGVDVCMTYERRFYLNLPEVQKALHANRTNLPYPWSMCS--GVVNYSDTDGN  357

Query  1154  ANVVPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQ  1333
              +++PLLK+++Q+ IP+W++SGDQDSVVPL+GSRT++RELA ++   +TVPY AWFHKGQ
Sbjct  358   IDMLPLLKRIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAHNLNFKVTVPYGAWFHKGQ  417

Query  1334  VGGWQTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             VGGW TEYGNLLTFATVRGAAHMVPYAQP RALHLFSSF+RGRRLPNTT   ID
Sbjct  418   VGGWATEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRLPNTTRPSID  471



>ref|XP_009360732.1| PREDICTED: serine carboxypeptidase-like 42 [Pyrus x bretschneideri]
Length=473

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/449 (72%), Positives = 368/449 (82%), Gaps = 3/449 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLVV LPGQP V F+Q++GYVDVD KAGRSLFYYFVEA++   ++ PLTLWLNGGPG
Sbjct  28    PAEDLVVSLPGQPSVGFKQYAGYVDVDVKAGRSLFYYFVEADEQPDKK-PLTLWLNGGPG  86

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P+GDGRGL  N  SWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  87    CSSVGGGAFTELGPFYPTGDGRGLRRNPMSWNRASNLLFVESPAGVGWSYSNTSSDYDSG  146

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DM  F+ +WYEKFP F  R LFLTGESYAGHYIPQLA  ++DHNK   G KFN+
Sbjct  147   DASTARDMHTFLMEWYEKFPTFRSRELFLTGESYAGHYIPQLAIAILDHNKQSTGFKFNL  206

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVALGNPLL+LDRD PA  E+ WSHG+ISDE    I NECDFDDY    PHN S  CN 
Sbjct  207   KGVALGNPLLRLDRDAPATYEYFWSHGMISDETGLTIMNECDFDDYVLGNPHNVSHPCNK  266

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI+  N+ V +YIN YDVI+DVCYPSIVEQELRL K  TK+S+G+DVCM  ER FY NLP
Sbjct  267   AISQANQMVGEYINNYDVILDVCYPSIVEQELRLRKMATKISVGVDVCMTFERRFYLNLP  326

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQK LHANRTNLPY W  C+   +L Y+ TDG  N++PLL +++Q++IP+W++SGDQDS
Sbjct  327   EVQKVLHANRTNLPYPWSMCS--RVLNYSDTDGSINILPLLTRIVQNRIPVWVFSGDQDS  384

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA D+K  ITVPY AWFHKGQVGGW TEYGNLLTFATVRGAAHMVPY
Sbjct  385   VVPLLGSRTLVRELAHDLKFPITVPYGAWFHKGQVGGWATEYGNLLTFATVRGAAHMVPY  444

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPIDQ  1498
             AQP RALHLFS+F+RGRRLPNT    ID+
Sbjct  445   AQPSRALHLFSAFVRGRRLPNTAHPSIDE  473



>ref|XP_008373913.1| PREDICTED: serine carboxypeptidase-like 42 [Malus domestica]
Length=473

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/449 (72%), Positives = 370/449 (82%), Gaps = 3/449 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLVV LPGQP V F+Q++GYVDVD KAGRSLFYYFVEA+K   ++  LTLWLNGGPG
Sbjct  28    PAEDLVVSLPGQPSVGFKQYAGYVDVDVKAGRSLFYYFVEADKQPDKK-SLTLWLNGGPG  86

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P+GDGRG+  N  SWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  87    CSSIGGGAFTELGPFYPTGDGRGVRSNKMSWNRASNLLFVESPAGVGWSYSNTSSDYNSG  146

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA+DM  F+ KWYEKFP F  R LFLTGESYAGHYIPQLA  ++DHNK   G KFN+
Sbjct  147   DASTAKDMHTFLLKWYEKFPTFRSRELFLTGESYAGHYIPQLAIAILDHNKESTGFKFNL  206

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+LDRD  A  E+ WSHG+ISDE    I NECDFDDY +  PHN S  CN 
Sbjct  207   KGVAIGNPLLRLDRDAAATYEYFWSHGMISDEIGLTIMNECDFDDYVYANPHNVSLECNK  266

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI+  N+ V DYIN YDVI+DVCYPSIVEQELRL K  TK+S+G+DVCM  ER+FY NLP
Sbjct  267   AISKANQIVGDYINNYDVILDVCYPSIVEQELRLRKMATKISVGVDVCMTYERSFYLNLP  326

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRTNLPY W  C+   +L Y+ TD + N++PLL +++Q+ IP+W++SGDQDS
Sbjct  327   EVQKALHANRTNLPYTWSMCS--GVLNYSDTDENINILPLLTRIVQNHIPVWVFSGDQDS  384

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT++RELA D+K  ITVPY AWFHKGQVGGW TEYGNLLTFATVRGAAHMVPY
Sbjct  385   VVPLLGSRTLIRELAXDLKFPITVPYGAWFHKGQVGGWATEYGNLLTFATVRGAAHMVPY  444

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPIDQ  1498
             AQP RALHLFSSF+ GRRLPNTT  PID+
Sbjct  445   AQPSRALHLFSSFVHGRRLPNTTRPPIDE  473



>ref|XP_010530237.1| PREDICTED: serine carboxypeptidase-like 42 [Tarenaya hassleriana]
Length=474

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/448 (71%), Positives = 377/448 (84%), Gaps = 3/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLVV LPGQP+V FRQF+GYVDVD K+GRSLFYYFVEAEK    + PL+LWLNGGPG
Sbjct  29    PEEDLVVKLPGQPDVQFRQFAGYVDVDLKSGRSLFYYFVEAEKKPDEK-PLSLWLNGGPG  87

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P+GDGRGL  NS SWNKASNLLFVESPAGVGWSYSN +SDYT G
Sbjct  88    CSSIGGGAFTELGPFYPTGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNKTSDYTTG  147

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D +TA+DML+F+ +W++KFPEF  R LFLTGESYAGHYIPQLA +++++N    G KFN+
Sbjct  148   DATTAKDMLVFLLRWFKKFPEFKSRDLFLTGESYAGHYIPQLAEVILNYNARSTGFKFNV  207

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KG+A+GNPLLKLDRDVPA+ EF WSHG+ISDE    I   CDF+DY+F  PHNES SCN 
Sbjct  208   KGIAIGNPLLKLDRDVPAIYEFFWSHGMISDELGLTIMTRCDFEDYTFASPHNESKSCND  267

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             A+++    VSD++N YDV++DVCYPSIVEQELRL K  TKMS+G+DVCM  ER FYFNLP
Sbjct  268   ALSEVESIVSDHVNYYDVLLDVCYPSIVEQELRLKKMATKMSLGVDVCMTYERRFYFNLP  327

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQ ALHANRT LPY W  C+ +  L Y+ TDG+ N++P+LK++LQ+KI +WI+SGDQDS
Sbjct  328   EVQAALHANRTRLPYPWSMCSRH--LNYSDTDGNLNMLPILKRILQNKIRVWIFSGDQDS  385

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA ++   ITVPY AWFH+GQVGGW TEYGN+LTFATVRGAAHMVPY
Sbjct  386   VVPLLGSRTLVRELAHELGFKITVPYGAWFHRGQVGGWATEYGNILTFATVRGAAHMVPY  445

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP RALHLFS+F+ GRRLPNTT   +D
Sbjct  446   AQPSRALHLFSNFVSGRRLPNTTRHSVD  473



>ref|XP_009414969.1| PREDICTED: serine carboxypeptidase-like 42 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009414970.1| PREDICTED: serine carboxypeptidase-like 42 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009414971.1| PREDICTED: serine carboxypeptidase-like 42 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009414972.1| PREDICTED: serine carboxypeptidase-like 42 [Musa acuminata subsp. 
malaccensis]
Length=470

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/448 (72%), Positives = 378/448 (84%), Gaps = 3/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLVV LPGQP+V FRQ++G+VDVD KAGRSLFYY  EA+ D H++ PLTLWLNGGPG
Sbjct  26    PEEDLVVRLPGQPKVGFRQYAGHVDVDVKAGRSLFYYLAEADGDAHKK-PLTLWLNGGPG  84

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P GDGRGL IN  SWNK SNLLFVESPAGVGWSYSNT+SDY   
Sbjct  85    CSSVGGGAFTELGPFYPRGDGRGLRINKMSWNKVSNLLFVESPAGVGWSYSNTTSDYNRD  144

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DM IF+ +WY+KFPEF  R LFLTGESYAGHYIPQLA+++++HN+H  G KF I
Sbjct  145   DESTANDMYIFLLRWYDKFPEFRSRDLFLTGESYAGHYIPQLANVLLNHNQHSVGFKFKI  204

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLLKLDRD+PA  EF WSHG+ISDE    I NECDF+DY+F   HN S SCN 
Sbjct  205   KGVAIGNPLLKLDRDIPATYEFFWSHGMISDEIGLTIINECDFEDYTFSSAHNVSKSCND  264

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI + N  V DYIN YDVI+DVCYPS+VEQELRL K VTK+S+G+DVCM  ER FYFNLP
Sbjct  265   AILEANAVVGDYINSYDVILDVCYPSLVEQELRLRKYVTKLSVGVDVCMSYERRFYFNLP  324

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQ +LHANRT LPY W  C++  +L Y+ TDG+ N++PLLK++++H+IP+W++SGDQDS
Sbjct  325   EVQHSLHANRTKLPYPWSMCSN--VLNYSYTDGNINILPLLKRIVKHQIPVWVFSGDQDS  382

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA D+K GITVPYS WF+KGQVGGW TEYGNLLTFATVRGA+HMVP+
Sbjct  383   VVPLLGSRTLVRELAHDLKFGITVPYSNWFYKGQVGGWVTEYGNLLTFATVRGASHMVPF  442

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQPGRAL LF+SF+ G+RLPN+T  PID
Sbjct  443   AQPGRALRLFASFVHGQRLPNSTYPPID  470



>ref|XP_008461495.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Cucumis 
melo]
Length=472

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/448 (72%), Positives = 370/448 (83%), Gaps = 3/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLV+ LPGQP VSF+Q++GYVD+D K GRSLFYYFVEAE+   ++ PLTLWLNGGPG
Sbjct  27    PSEDLVLRLPGQPPVSFKQYAGYVDIDVKNGRSLFYYFVEAEEHPEKK-PLTLWLNGGPG  85

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+PSGDGRGL  N  SWNKASNLLFVESPAGVGWSYSNTSSDY CG
Sbjct  86    CSSIGGGAFTELGPFYPSGDGRGLRKNPMSWNKASNLLFVESPAGVGWSYSNTSSDYNCG  145

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DM IF   WYEKFP F    L+LTGESYAGHYIPQLA  ++DHN    G KFNI
Sbjct  146   DASTARDMHIFFMNWYEKFPSFKSSALYLTGESYAGHYIPQLAIALLDHNAKSSGFKFNI  205

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLLKLDRDVPA  E+ WSHG+ISDE    I +ECDF+DY+F  PHNES SCN 
Sbjct  206   KGVAIGNPLLKLDRDVPATYEYFWSHGMISDEIGITIMSECDFEDYTFASPHNESHSCNE  265

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI+  N+ V +YIN YDVI+DVCYPSIVEQELRL K  +K+S+G+DVCM  ER FYFNLP
Sbjct  266   AISMANQVVGNYINNYDVILDVCYPSIVEQELRLRKMASKISLGVDVCMTMERKFYFNLP  325

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRT LPY W  C+   ++ Y+ TDG+ N++PLLK++++ +IP+WI+SGDQDS
Sbjct  326   EVQKALHANRTKLPYRWSMCS--PVINYSDTDGNINILPLLKRIIELRIPVWIFSGDQDS  383

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA D+K  ITVPY  WFHKGQVGGW  EYGNLLTFATVRGAAHMVPY
Sbjct  384   VVPLLGSRTLVRELAHDLKFKITVPYGTWFHKGQVGGWVIEYGNLLTFATVRGAAHMVPY  443

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP RALHLFSSF+ GRRLPN+T   I+
Sbjct  444   AQPSRALHLFSSFVGGRRLPNSTRPSIE  471



>ref|XP_011027377.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
42 [Populus euphratica]
Length=480

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/448 (71%), Positives = 371/448 (83%), Gaps = 3/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P +DLV+ LPGQP+  FRQ++GYVDVD K GRSLFYYFVEA+KD  ++ PL LWLNGGPG
Sbjct  35    PAKDLVLNLPGQPKAGFRQYAGYVDVDVKNGRSLFYYFVEADKDPDQK-PLALWLNGGPG  93

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTE+ PFFPS DGRGL  NS SWN+ASNLLFVESPAGVGWSYSNT+SDYT G
Sbjct  94    CSSIGGGAFTEVXPFFPSRDGRGLRRNSMSWNRASNLLFVESPAGVGWSYSNTTSDYTTG  153

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D  TAEDM +F+ KWYEKFP+F  R LFLTGESYAGHYIPQLA +++DHN      KFNI
Sbjct  154   DAKTAEDMHMFLLKWYEKFPDFKSRELFLTGESYAGHYIPQLAEVLLDHNAQSTDFKFNI  213

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+LDRDVPA  EF WSHG+ISDE    I NEC FDDY++  PHN +DSCN 
Sbjct  214   KGVAIGNPLLRLDRDVPATYEFFWSHGMISDEIGLKIMNECAFDDYTYASPHNVTDSCND  273

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI+  N  + DYIN YDVI+DVCYPSIV QELRL K  T++S+G+DVCM  ER FYFNLP
Sbjct  274   AISQANSIIGDYINNYDVILDVCYPSIVNQELRLRKMATRISVGVDVCMTYERRFYFNLP  333

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRT LPY W  C+D  +L Y+  DG+ +++P+LKK++Q+ IP+W++SGDQDS
Sbjct  334   EVQKALHANRTKLPYPWSMCSD--VLNYSDIDGNIDILPILKKIIQNHIPVWVFSGDQDS  391

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+V+ELA D+   ITVPY  WFHKGQVGGW TEYGNLLTFATVR AAHMVPY
Sbjct  392   VVPLLGSRTLVKELAQDLNFKITVPYGTWFHKGQVGGWATEYGNLLTFATVRAAAHMVPY  451

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP RALHLFSSF+RGRRLPNTT +P+D
Sbjct  452   AQPSRALHLFSSFVRGRRLPNTTHVPMD  479



>ref|XP_003615811.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES98769.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=470

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/448 (72%), Positives = 370/448 (83%), Gaps = 3/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLVV LPGQP+V F Q++GYVD+D K GRSLFYYFVEA+     + PLTLWLNGGPG
Sbjct  25    PIEDLVVSLPGQPKVEFSQYAGYVDIDVKHGRSLFYYFVEADHKPQNK-PLTLWLNGGPG  83

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPFFP+GDGRGL  NS SWN+ASNLLF+ESPAGVGWSYSNT+SDY  G
Sbjct  84    CSSIGGGAFTELGPFFPAGDGRGLRTNSMSWNRASNLLFIESPAGVGWSYSNTTSDYNIG  143

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DML F  KW+EKFP +  R LFLTGESYAGHYIPQLA+ ++D+N H  G+KFN+
Sbjct  144   DASTANDMLSFFLKWFEKFPTYKSRALFLTGESYAGHYIPQLANAILDYNAHSTGYKFNL  203

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL LDRD  A  ++ WSHG+ISDE   AI  +CDFDDY+F  PHN S SCN 
Sbjct  204   KGVAIGNPLLNLDRDAQATYDYFWSHGMISDEIGLAITKDCDFDDYTFASPHNVSASCNT  263

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AIND N  V DYIN YDVI+DVCYPSIVEQELRL K  TK+S+G+DVCM  ER FYFNLP
Sbjct  264   AINDANEVVGDYINNYDVILDVCYPSIVEQELRLKKMATKISVGVDVCMSYERKFYFNLP  323

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRTNLPY W  C+   +L Y+ TD + N++P+LK+++Q+ IP+WI+SGDQDS
Sbjct  324   EVQKALHANRTNLPYSWSMCS--GVLNYSDTDPNINMLPILKRIVQNHIPVWIFSGDQDS  381

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT++RELA D+K  +TVPY AWFHKGQVGGW TEYGNLLTFATVRGAAHMVPY
Sbjct  382   VVPLLGSRTLIRELADDLKFKVTVPYGAWFHKGQVGGWATEYGNLLTFATVRGAAHMVPY  441

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP RALHLFS+F+ GRRLPNTT   I+
Sbjct  442   AQPSRALHLFSNFVNGRRLPNTTRPSIE  469



>ref|XP_006472927.1| PREDICTED: serine carboxypeptidase-like 42-like [Citrus sinensis]
Length=478

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/447 (72%), Positives = 369/447 (83%), Gaps = 3/447 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLVV LPGQP+V+FRQ++GYVDVD K GRSLFYYFVEAE + H + PLTLWLNGGPG
Sbjct  33    PAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEK-PLTLWLNGGPG  91

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P GDGR L  NS SWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  92    CSSVGGGAFTELGPFYPRGDGRALRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCG  151

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DM +FM  WYEKFPEF  R LFLTGESYAGHYIPQLA +++DHN H KG KFNI
Sbjct  152   DASTARDMHVFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLDHNAHSKGFKFNI  211

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+LD+DVPA+ EF WSHG+ISDE    I ++CDFDDY     HN ++SC  
Sbjct  212   KGVAIGNPLLRLDQDVPAIYEFFWSHGMISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIE  271

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI + N+ V DYIN YDVI+DVCYP+IVEQELRL K  TKMS+G+DVCM  ER FY NLP
Sbjct  272   AITEANKIVGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLP  331

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRTNLPY W  C+   +L Y+ TD + N++P+LK+++Q+ IP+W++SGDQDS
Sbjct  332   EVQKALHANRTNLPYGWSMCS--GVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDS  389

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT++RELA D+   +TVPY AWFHK QVGGW TEYGNLLTF TVRGAAHMVPY
Sbjct  390   VVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQVGGWGTEYGNLLTFVTVRGAAHMVPY  449

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPI  1492
             AQP RALHLFSSF+ GRRLPN T   I
Sbjct  450   AQPSRALHLFSSFVHGRRLPNNTRPAI  476



>ref|XP_009406489.1| PREDICTED: serine carboxypeptidase-like 42 [Musa acuminata subsp. 
malaccensis]
Length=470

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/443 (72%), Positives = 369/443 (83%), Gaps = 3/443 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLVV LPGQP+V FRQ++GYVDVDEKAGR+LFYYF EA+ D H + PLTLWLNGGPG
Sbjct  26    PEEDLVVRLPGQPKVGFRQYAGYVDVDEKAGRTLFYYFAEADGDAHAK-PLTLWLNGGPG  84

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPFFP GDGRGL +N  SWNK SNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  85    CSSVGGGAFTELGPFFPRGDGRGLRLNKMSWNKVSNLLFVESPAGVGWSYSNTTSDYNCG  144

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DM  F+ +WY+KFPEF  + LFLTGESYAGHYIPQLA++++DHN+H  G KFNI
Sbjct  145   DESTANDMYKFLLRWYDKFPEFRLKNLFLTGESYAGHYIPQLANVLLDHNQHSTGFKFNI  204

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLLKLDRD PA  EF WSHG+ISDE    I N+CDF+DY+F  PHN S +CN 
Sbjct  205   KGVAIGNPLLKLDRDAPATYEFFWSHGMISDEIGLTIMNQCDFEDYTFSNPHNVSKACND  264

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI   N  V DYIN YDVI+DVCYPSIVEQELRL K VTKMS+G+DVCM  ER FYFNLP
Sbjct  265   AIEKANIIVGDYINEYDVILDVCYPSIVEQELRLRKYVTKMSVGVDVCMSVERYFYFNLP  324

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             +VQ ALHANRT LPY W  C+   LL Y+ TD D +++PLLKK+++H  P+W++SGDQDS
Sbjct  325   QVQLALHANRTKLPYSWGMCS--GLLNYSSTDVDIDILPLLKKIIRHGTPVWVFSGDQDS  382

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA D+   +TVPY  WF+KGQVGGW TEYGNLLTFATVRGA+HMVPY
Sbjct  383   VVPLLGSRTLVRELAHDLNFRVTVPYGVWFYKGQVGGWVTEYGNLLTFATVRGASHMVPY  442

Query  1412  AQPGRALHLFSSFIRGRRLPNTT  1480
             AQP RAL LF+SFI G+RLPN+T
Sbjct  443   AQPARALRLFTSFIHGQRLPNST  465



>gb|KGN44500.1| hypothetical protein Csa_7G319000 [Cucumis sativus]
Length=472

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/443 (72%), Positives = 369/443 (83%), Gaps = 3/443 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLV+ LPGQP VSF+Q++GYVD+D K GRSLFYYFVEAE+   ++ PLTLWLNGGPG
Sbjct  27    PSEDLVLRLPGQPPVSFKQYAGYVDIDLKNGRSLFYYFVEAEEQPEKK-PLTLWLNGGPG  85

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+PSGDGRGL  N  SWNKASNLLFVESPAGVGWSYSNTSSDY CG
Sbjct  86    CSSIGGGAFTELGPFYPSGDGRGLRKNPMSWNKASNLLFVESPAGVGWSYSNTSSDYNCG  145

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DM +F   WYEKFP F  R L+LTGESYAGHYIPQLA  ++DHN    G KFNI
Sbjct  146   DASTARDMHMFFMNWYEKFPSFKSRALYLTGESYAGHYIPQLAIALLDHNAKSSGFKFNI  205

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLLKLDRDVPA  E+ WSHG+ISDE    I +ECDF+DY+F  PHNES SCN 
Sbjct  206   KGVAIGNPLLKLDRDVPATYEYFWSHGMISDEIGITIMSECDFEDYTFASPHNESHSCNE  265

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI+  N+ V +YIN YDVI+DVCYPSIVEQELRL K  +K+S+G+DVCM  ER FYFNL 
Sbjct  266   AISIANQVVGNYINNYDVILDVCYPSIVEQELRLRKMASKISLGVDVCMTMERKFYFNLQ  325

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQ+ALHANRT LPY W  C+  S++ Y+ TDG+ N++PL++++++ +IP+W++SGDQDS
Sbjct  326   EVQEALHANRTKLPYRWSMCS--SMINYSDTDGNINILPLIRRIIEFQIPVWVFSGDQDS  383

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA D+K  ITVPY  WFHKGQVGGW  EYGNLLTFATVRGAAHMVPY
Sbjct  384   VVPLLGSRTLVRELAHDLKFKITVPYGTWFHKGQVGGWVIEYGNLLTFATVRGAAHMVPY  443

Query  1412  AQPGRALHLFSSFIRGRRLPNTT  1480
             AQP RALHLFSSF+ GRRLPN+T
Sbjct  444   AQPSRALHLFSSFVGGRRLPNST  466



>ref|XP_009377699.1| PREDICTED: serine carboxypeptidase-like 42 [Pyrus x bretschneideri]
Length=473

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/449 (72%), Positives = 368/449 (82%), Gaps = 3/449 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLVV LPGQP V F+Q++GYVDVD KAGRSLFYYFVEA+K   ++  LTLWLNGGPG
Sbjct  28    PAEDLVVSLPGQPSVGFKQYAGYVDVDVKAGRSLFYYFVEADKQPDKK-SLTLWLNGGPG  86

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P+GDGRGL  N  SWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  87    CSSIGGGAFTELGPFYPTGDGRGLRRNKMSWNRASNLLFVESPAGVGWSYSNTSSDYNSG  146

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA+DM  F+ KWYEKFP F  R LFLTGESYAGHYIPQLA  ++DHNK   G KFN+
Sbjct  147   DASTAKDMHTFLLKWYEKFPTFRSRELFLTGESYAGHYIPQLAIAILDHNKQSTGFKFNL  206

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+LD D  A  E+ WSHG+ISDE    I NECDFDDY F  PHN S  CN 
Sbjct  207   KGVAIGNPLLRLDLDAAATYEYFWSHGMISDEIGLTIMNECDFDDYVFANPHNVSLECNK  266

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI+  N+ V DYIN YDVI+DVCYPSIVEQELRL K  TK+S+G+DVCM  ER+FYFNLP
Sbjct  267   AISKANQIVGDYINNYDVILDVCYPSIVEQELRLRKKATKISVGVDVCMTYERSFYFNLP  326

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRTNLPY W  C+   +L Y+ TD + N++PLL +++Q+ IP+W++SGDQDS
Sbjct  327   EVQKALHANRTNLPYTWSMCS--GVLNYSDTDENINILPLLTRIVQNHIPVWVFSGDQDS  384

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVP +GSRT++RELA D+K  ITVPY AWFHKGQV GW TEYGNLLTFATVRGAAHMVPY
Sbjct  385   VVPFLGSRTLIRELAHDLKFPITVPYGAWFHKGQVAGWATEYGNLLTFATVRGAAHMVPY  444

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPIDQ  1498
             AQP RALHLFSSF+ G+RLPNTT  PID+
Sbjct  445   AQPSRALHLFSSFVLGQRLPNTTRPPIDK  473



>ref|XP_008373914.1| PREDICTED: serine carboxypeptidase-like 42 [Malus domestica]
Length=474

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/443 (72%), Positives = 364/443 (82%), Gaps = 3/443 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLVV LPGQP V F+Q++G VDVD KAGRSLFYYFVEA+K   ++ PLTLWLNGGPG
Sbjct  29    PAEDLVVSLPGQPSVGFKQYAGSVDVDVKAGRSLFYYFVEADKQPDKK-PLTLWLNGGPG  87

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P+GDGRGL  N  SWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  88    CSSIGGGAFTELGPFYPTGDGRGLRRNKMSWNRASNLLFVESPAGVGWSYSNTSSDYNSG  147

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DM  F+ KWYEKFP F  R LFLTGESYAGHYIPQLA  ++DHNK   G KFN+
Sbjct  148   DASTARDMHAFLLKWYEKFPTFRSRELFLTGESYAGHYIPQLAIAILDHNKQSTGFKFNL  207

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+LDRD PA  E+ WSHG+ISDE    I NECDFDDY F   HN S  CN 
Sbjct  208   KGVAIGNPLLRLDRDAPASYEYFWSHGMISDEIGLTIMNECDFDDYVFANTHNLSLECNK  267

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI+  N+ V  YI+ YDVI+DVCYPSIVEQELRL K  TK+S+G+DVCM  ER+FY NLP
Sbjct  268   AISQANQIVGYYIDNYDVILDVCYPSIVEQELRLRKMATKISVGVDVCMTYERSFYLNLP  327

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRTNLPY W  C+   +L Y+ TD + N++PLL +++Q+ IP+W++SGDQDS
Sbjct  328   EVQKALHANRTNLPYTWSMCS--XVLNYSNTDENINILPLLTRIVQNHIPVWVFSGDQDS  385

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT++RELA D+K  ITVPY AWFHKGQVGGW TEYGNLLTFATVRGAAHMVPY
Sbjct  386   VVPLLGSRTLIRELAXDLKFPITVPYGAWFHKGQVGGWATEYGNLLTFATVRGAAHMVPY  445

Query  1412  AQPGRALHLFSSFIRGRRLPNTT  1480
             AQP RALHLFSSF+ GRRLPNTT
Sbjct  446   AQPSRALHLFSSFVHGRRLPNTT  468



>ref|XP_010519388.1| PREDICTED: serine carboxypeptidase-like 42 [Tarenaya hassleriana]
Length=471

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/448 (71%), Positives = 376/448 (84%), Gaps = 3/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLVV LPGQP+V FRQF+GYVDVD K+GRSLFYYFVEAEK+   + PLTLWLNGGPG
Sbjct  26    PEEDLVVKLPGQPDVEFRQFAGYVDVDFKSGRSLFYYFVEAEKNPLDK-PLTLWLNGGPG  84

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P+GDGRGL +N  SWNKASNLLFVESPAGVGWSYSN +SDY  G
Sbjct  85    CSSIGGGAFTELGPFYPTGDGRGLRVNPMSWNKASNLLFVESPAGVGWSYSNRTSDYNTG  144

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA+DML+F+ +W++KFPEF  R LFLTGESYAGHYIPQLA +++++N    G KFN+
Sbjct  145   DASTAKDMLVFLLRWFKKFPEFKSRDLFLTGESYAGHYIPQLADVILNYNARSSGFKFNV  204

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KG+A+GNPLLKLDRDVPA  EF WSHG+ISDE    I  +C+F+DY+F  PHNES +C+ 
Sbjct  205   KGIAIGNPLLKLDRDVPATYEFFWSHGMISDELGLTITAQCNFEDYTFSSPHNESKACDD  264

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             A+ +    VS+Y+N YDVI+DVCYPSIVEQELRL K  TKMS+G+DVCM  ER FYFNLP
Sbjct  265   ALGEVGSIVSEYVNYYDVILDVCYPSIVEQELRLKKMATKMSLGVDVCMTYERQFYFNLP  324

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRT LPY W  C+  S L Y+ TDG+ +++P+LK+++Q+KI +WI+SGDQDS
Sbjct  325   EVQKALHANRTLLPYQWSMCS--SQLNYSDTDGNLDMLPILKRIVQNKIYVWIFSGDQDS  382

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA ++    TVPY AWFHKGQVGGW TEYGNLLTFATVRGAAHMVPY
Sbjct  383   VVPLLGSRTLVRELAQELDFKNTVPYGAWFHKGQVGGWVTEYGNLLTFATVRGAAHMVPY  442

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP RALHLFSSF+ G+RLPNTT   ID
Sbjct  443   AQPSRALHLFSSFVSGQRLPNTTRPSID  470



>ref|XP_004979109.1| PREDICTED: serine carboxypeptidase-like 42-like [Setaria italica]
Length=473

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/448 (71%), Positives = 372/448 (83%), Gaps = 3/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLV  LPGQP V+FRQF+GYVDVD KAGRSLFYYF EA++D   + PLTLWLNGGPG
Sbjct  29    PAEDLVARLPGQPPVTFRQFAGYVDVDVKAGRSLFYYFAEAQEDAAAK-PLTLWLNGGPG  87

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P GDGRGL +N KSWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  88    CSSIGGGAFTELGPFYPRGDGRGLRLNKKSWNKASNLLFVESPAGVGWSYSNTSSDYNTG  147

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D+ TA+DM  F+  WY+KFPE+  R LFLTGESYAGHYIPQL  +++ HN+  KG KFNI
Sbjct  148   DVRTADDMYRFLLGWYKKFPEYRSRALFLTGESYAGHYIPQLTDVLLTHNEKSKGFKFNI  207

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLLKLDRDVPA  E+ WSHG+ISDE + AI + CDF+DY+F  PHNES SCN 
Sbjct  208   KGVAIGNPLLKLDRDVPATYEYFWSHGMISDEIFLAISHSCDFEDYTFNDPHNESKSCND  267

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI++ N  V  Y+N YDVI+DVCYPSIV QELRL K  TK+S+G+DVCM  ER FYFNLP
Sbjct  268   AISEANTIVGQYVNNYDVILDVCYPSIVMQELRLRKYATKISVGVDVCMTYERFFYFNLP  327

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQ+ALHANRT+L Y W  C+D  +L Y+ TDG+ N++P+L+++++HKIPLW++SGDQDS
Sbjct  328   EVQQALHANRTHLKYQWGMCSD--VLNYSNTDGNINILPILQRIVEHKIPLWVFSGDQDS  385

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA  M + +TVPYS WF KGQVGGW TEYGN LTFATVRGA+HMVP+
Sbjct  386   VVPLLGSRTLVRELAHTMGLPVTVPYSTWFRKGQVGGWVTEYGNFLTFATVRGASHMVPF  445

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP RAL LF S I G+RLPNTT+ PID
Sbjct  446   AQPDRALGLFRSIILGQRLPNTTNPPID  473



>ref|XP_007137531.1| hypothetical protein PHAVU_009G134900g [Phaseolus vulgaris]
 gb|ESW09525.1| hypothetical protein PHAVU_009G134900g [Phaseolus vulgaris]
Length=472

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/448 (71%), Positives = 370/448 (83%), Gaps = 3/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDL+  LPGQP V F+QF+GYVDVD K GRSLFYYFVEA+ D H + PLTLWLNGGPG
Sbjct  28    PAEDLIERLPGQPNVGFKQFAGYVDVDVKHGRSLFYYFVEADNDHHNK-PLTLWLNGGPG  86

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P GDGRGL  NS SWN+ASNLLF+ESPAGVGWSYSNT+SDY+ G
Sbjct  87    CSSIGGGAFTELGPFYPKGDGRGLRRNSMSWNRASNLLFLESPAGVGWSYSNTTSDYSSG  146

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA D L+F+ KWYEKFP +  R LFLTGESYAGHYIPQLA++++DHN H  G KFNI
Sbjct  147   DASTANDTLLFLLKWYEKFPSYRSRELFLTGESYAGHYIPQLANVLLDHNAHSNGFKFNI  206

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLLKLDRD  A  E+ WSHG+ISDE   AI N+CDFDDY F   HN S SCN 
Sbjct  207   KGVAIGNPLLKLDRDAQATYEYFWSHGLISDEIGLAIANDCDFDDYVFANTHNVSKSCNH  266

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AIN+ N  V +YIN YDVI+DVCYPSIVEQELRL K  TK+S+G+DVCM  E  FY NLP
Sbjct  267   AINEANEIVGEYINNYDVILDVCYPSIVEQELRLKKMATKISIGVDVCMNYENGFYLNLP  326

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRTNLPY+W  C+   +L Y+ TD + +++P+LK+++Q+ IP+W++SGDQDS
Sbjct  327   EVQKALHANRTNLPYEWSMCS--GVLNYSDTDPNIDILPVLKRIVQNHIPVWVFSGDQDS  384

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT++RELA ++K  ITVPY AWFH+GQVGGW TEYGNLLTFATVRGAAHMVP+
Sbjct  385   VVPLLGSRTLIRELAHELKFKITVPYGAWFHQGQVGGWVTEYGNLLTFATVRGAAHMVPF  444

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP RAL LFSSF+RG RLPNTT   ID
Sbjct  445   AQPSRALRLFSSFVRGMRLPNTTRPSID  472



>ref|XP_006434388.1| hypothetical protein CICLE_v10000998mg [Citrus clementina]
 gb|ESR47628.1| hypothetical protein CICLE_v10000998mg [Citrus clementina]
Length=479

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/447 (71%), Positives = 366/447 (82%), Gaps = 3/447 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLVV LPGQP+V+FRQ++GYVDVD K GRSLFYYFVEAE + H + PLTLWLNGGPG
Sbjct  34    PAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEK-PLTLWLNGGPG  92

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P GDGRGL  NS SWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  93    CSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCG  152

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DM +FM  WYEKFPEF  R LFLTGESYAGHYIPQLA +++ HN H KG KFNI
Sbjct  153   DASTARDMHVFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLHHNAHSKGFKFNI  212

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+LD+DV A  EF WSHG+ISDE    I ++CDFDDY     HN ++SC  
Sbjct  213   KGVAIGNPLLRLDQDVSATYEFFWSHGMISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIE  272

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI + N+ V DYIN YDVI+DVCYP+IVEQELRL K  TKMS+G+DVCM  ER FY NLP
Sbjct  273   AITEANKIVGDYINNYDVILDVCYPAIVEQELRLRKMATKMSVGVDVCMTYERFFYLNLP  332

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRTNLPY W  C+   +L Y+  D + N++P+LK+++Q+ IP+W++SGDQDS
Sbjct  333   EVQKALHANRTNLPYGWSMCS--RVLNYSDADSNINILPVLKRIIQNGIPVWVFSGDQDS  390

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT++RELA D+   +TVPY AWFHK QVGGW TEYGN+LTF TVRGAAHMVPY
Sbjct  391   VVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQVGGWATEYGNILTFVTVRGAAHMVPY  450

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPI  1492
             AQP RALHLFSSF+ GRRLPN T   I
Sbjct  451   AQPSRALHLFSSFVHGRRLPNNTRPAI  477



>ref|XP_002449388.1| hypothetical protein SORBIDRAFT_05g009120 [Sorghum bicolor]
 gb|EES08376.1| hypothetical protein SORBIDRAFT_05g009120 [Sorghum bicolor]
Length=476

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/448 (70%), Positives = 371/448 (83%), Gaps = 3/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLV  LPGQP V+FRQF+GYVDVD KAGRSLFYYF EA++D   + PLTLWLNGGPG
Sbjct  32    PAEDLVTRLPGQPPVTFRQFAGYVDVDVKAGRSLFYYFAEAQQDAAAK-PLTLWLNGGPG  90

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P GDGRGL +N KSWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  91    CSSIGGGAFTELGPFYPRGDGRGLRLNKKSWNKASNLLFVESPAGVGWSYSNTSSDYNTG  150

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D+ TA DM  F+  WY KFPE+  R LFLTGESYAGHYIPQL  +++ HN+  KG KFNI
Sbjct  151   DVQTANDMYQFLLGWYVKFPEYRSRALFLTGESYAGHYIPQLTDVLLTHNEKSKGFKFNI  210

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLLKLDRDVPA  E+ WSHG+ISDE + AI + CDF+DY+F  PHNES SCN 
Sbjct  211   KGVAIGNPLLKLDRDVPATYEYFWSHGMISDEIFLAISHSCDFEDYTFNDPHNESKSCND  270

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI + N  V DY+N YDVI+DVCYPSIV QELRL +  TK+S+G+DVCM  ER FYFNLP
Sbjct  271   AIAEANSIVGDYVNNYDVILDVCYPSIVMQELRLRQYATKISIGVDVCMSYERYFYFNLP  330

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQ+ALHANRT+L Y+W  C+D  +L Y+ TDG+ N++P L+++++HKIPLW++SGDQDS
Sbjct  331   EVQQALHANRTHLKYNWSMCSD--ILNYSNTDGNINILPTLQRIVEHKIPLWVFSGDQDS  388

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA +M + +TVPYS WF +GQVGGW T+YGN LTFATVRGA+HMVP+
Sbjct  389   VVPLLGSRTLVRELAHNMGLQVTVPYSTWFRRGQVGGWVTQYGNFLTFATVRGASHMVPF  448

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP RAL LF S + G+RLPNTTS PI+
Sbjct  449   AQPDRALRLFQSIVLGQRLPNTTSPPIE  476



>ref|XP_003577714.1| PREDICTED: serine carboxypeptidase-like 42 [Brachypodium distachyon]
Length=472

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/448 (71%), Positives = 370/448 (83%), Gaps = 3/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLV  LPGQP V FRQFSGYVDVDEKAGRSLFYYF EA++    + PLTLWLNGGPG
Sbjct  28    PEEDLVRRLPGQPVVGFRQFSGYVDVDEKAGRSLFYYFTEAQEGAAGK-PLTLWLNGGPG  86

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P GDGRGL +N KSWNK SNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  87    CSSVGGGAFTELGPFYPRGDGRGLRLNKKSWNKVSNLLFVESPAGVGWSYSNTSSDYKTG  146

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D  TA+DM  F+  WY+KFPE+  R LFL+GESYAGHYIPQLA +++ HN+  KG KFNI
Sbjct  147   DTRTADDMYRFLLGWYKKFPEYRSRSLFLSGESYAGHYIPQLADVLLTHNEKSKGFKFNI  206

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             +GVA+GNPLLKLDRDVPA  E+ WSHG+ISDE + AI   CDF+DY+F  PHNES SCN 
Sbjct  207   QGVAIGNPLLKLDRDVPATFEYFWSHGMISDEIFLAINKGCDFEDYTFTNPHNESKSCND  266

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI + N  V +Y+N YDVI+DVCYPSIV QELRL K VTK+S+G+DVCM  ER FYFNLP
Sbjct  267   AIAEANGIVGNYVNNYDVILDVCYPSIVMQELRLRKYVTKISVGVDVCMTYERFFYFNLP  326

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQ ALHANRT+LPY W  C+D  +L Y+  DG+ N++PLL+++++ KIP+W++SGDQDS
Sbjct  327   EVQHALHANRTHLPYGWSMCSD--VLDYSGKDGNINILPLLQRIVEQKIPVWVFSGDQDS  384

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA  M   +TVPYS WFHKGQVGGW TEYGN+LTFATVRGA+HMVP+
Sbjct  385   VVPLLGSRTLVRELAHTMGFHVTVPYSTWFHKGQVGGWVTEYGNMLTFATVRGASHMVPF  444

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP R+L LF SF+ G+RLPNTT  PID
Sbjct  445   AQPDRSLGLFRSFVLGQRLPNTTHPPID  472



>ref|XP_004490637.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X1 [Cicer 
arietinum]
Length=509

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/504 (66%), Positives = 385/504 (76%), Gaps = 36/504 (7%)
 Frame = +2

Query  86    LVICFVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYF  265
             ++I   CL         GV GYP EDLVV LPGQP+V F Q+ GYVD+D K GRSLFYYF
Sbjct  9     VLIAVACLCNFLETSVWGVEGYPIEDLVVRLPGQPKVKFSQYGGYVDIDVKHGRSLFYYF  68

Query  266   VEAEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLL  445
             VEA+   H++ PLTLWLNGGPGCSSIGGGAFTELGPF+P+GDGRGL  NS SWN+ASNLL
Sbjct  69    VEADHHPHKK-PLTLWLNGGPGCSSIGGGAFTELGPFYPTGDGRGLRKNSMSWNRASNLL  127

Query  446   FVESPAGVGWSYSNTSSDYTCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHY  625
             FVESPAGVGWSYSNTSSDY  GD STA+DM++F+ KWYEKFP +  R LFLTGESYAGHY
Sbjct  128   FVESPAGVGWSYSNTSSDYNSGDASTADDMVLFLLKWYEKFPSYKSRDLFLTGESYAGHY  187

Query  626   IPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIR  805
             IPQLA+ ++D+N H  G KFN KGVA+GNPLL LDRD  A  ++ WSHG+ISDE   AI 
Sbjct  188   IPQLANAILDYNAHSTGFKFNTKGVAIGNPLLNLDRDSQATYDYFWSHGMISDEIGLAIT  247

Query  806   NECDFDDYSFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAV  985
             N+CDFDDY+F  PHN S SCN A+ND N+ V DYIN YDVI+DVCYPSIVEQELRL K V
Sbjct  248   NDCDFDDYTFASPHNISKSCNDAMNDANKVVGDYINNYDVILDVCYPSIVEQELRLKKMV  307

Query  986   ---------------------------------TKMSMGIDVCMGSERTFYFNLPEVQKA  1066
                                              TK+S+G+DVCM  ER FYFNLPEVQKA
Sbjct  308   LFASFISSVLVMIFLTFDEFINLINSVISLMQATKISIGVDVCMSYERRFYFNLPEVQKA  367

Query  1067  LHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSVVPLV  1246
             LHANRTNLPY W  C+   +L Y+ TD + N++P+LK+++Q+ IP+W++SGDQDSVVPL+
Sbjct  368   LHANRTNLPYPWSMCS--GVLNYSDTDPNINMLPILKRIVQNHIPVWVFSGDQDSVVPLL  425

Query  1247  GSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYAQPGR  1426
             GSRT++RELA D+K  ITVPY AWFHKGQVGGW TEYGNLLTFATVRGAAHMVPYAQP R
Sbjct  426   GSRTLIRELAHDLKFKITVPYGAWFHKGQVGGWVTEYGNLLTFATVRGAAHMVPYAQPSR  485

Query  1427  ALHLFSSFIRGRRLPNTTSIPIDQ  1498
             ALHLFSSF+ GRRLPNTT   ID+
Sbjct  486   ALHLFSSFVNGRRLPNTTRPSIDE  509



>emb|CDP12019.1| unnamed protein product [Coffea canephora]
Length=470

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/466 (70%), Positives = 376/466 (81%), Gaps = 5/466 (1%)
 Frame = +2

Query  104   CLSLL--FCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAE  277
             C+SLL    G   G  G+P ED V  LPGQP+V F+Q++GY+DVD KAGRSLFYYFVEAE
Sbjct  7     CISLLVILAGLMVGGNGFPAEDFVEALPGQPKVGFKQYAGYIDVDVKAGRSLFYYFVEAE  66

Query  278   KDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVES  457
             KD  ++ PL LWLNGGPGCSSIGGGAFTE GPFFP GDGR L  N  SWN+ASNLLFVES
Sbjct  67    KDPDQK-PLALWLNGGPGCSSIGGGAFTEFGPFFPRGDGRALRRNKMSWNRASNLLFVES  125

Query  458   PAGVGWSYSNTSSDYTCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQL  637
             PAGVGWSYSNTSSDY  GD +TA DM IFM +W++KFP F  R LFLTGESYAGHYIPQL
Sbjct  126   PAGVGWSYSNTSSDYNTGDANTARDMHIFMMEWFKKFPSFRSRALFLTGESYAGHYIPQL  185

Query  638   ASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECD  817
             A  ++DHN   K  KFNIKGVA+GNPLLKLDRDVPA  E+ WSHG+ISDE   AI N CD
Sbjct  186   AVALLDHNADSKDFKFNIKGVAIGNPLLKLDRDVPATYEYFWSHGMISDEVGLAIMNNCD  245

Query  818   FDDYSFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMS  997
             F+DY++  PHN +++CN+AI+  N+ V DYIN YDVI+DVCYPSIVEQELRL K  TK+S
Sbjct  246   FEDYTYPNPHNVTEACNSAISQANQIVGDYINNYDVILDVCYPSIVEQELRLKKLATKIS  305

Query  998   MGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLK  1177
             +G+DVCM  ER FYFNLPEVQKALHANRTNLP+ W  C D   L Y Q DG+ +++PLLK
Sbjct  306   LGVDVCMTYERRFYFNLPEVQKALHANRTNLPHVWSMCNDD--LNYTQADGNLDMLPLLK  363

Query  1178  KLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEY  1357
             ++LQ  IP+W++SGDQDSVVPL+GSRT+VRELA D+ +  TVPY AWFHK QVGGW TEY
Sbjct  364   QILQSGIPVWVFSGDQDSVVPLLGSRTLVRELAHDLHLQTTVPYGAWFHKRQVGGWVTEY  423

Query  1358  GNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             GNLLTFATVRGAAHMVP+AQP RALHLFSSF+RG RLPNTT   +D
Sbjct  424   GNLLTFATVRGAAHMVPFAQPSRALHLFSSFVRGWRLPNTTQTRMD  469



>gb|AFW60600.1| serine carboxypeptidase F13S12.6 [Zea mays]
Length=471

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/448 (70%), Positives = 370/448 (83%), Gaps = 3/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLV  LPGQP V+FRQF+GYVDVD KAGRSLFYYF EA +D   + PLTLWLNGGPG
Sbjct  27    PAEDLVARLPGQPPVTFRQFAGYVDVDAKAGRSLFYYFAEAREDAAAK-PLTLWLNGGPG  85

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P GDGRGL +N KSWN+ASNLLFVESPAGVGWSYSNTSSDY+ G
Sbjct  86    CSSVGGGAFTELGPFYPRGDGRGLRLNKKSWNRASNLLFVESPAGVGWSYSNTSSDYSTG  145

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D+ TA DM  F+  WY KFPE+  R LFLTGESYAGHYIPQLA ++I HN+  KG KFNI
Sbjct  146   DVRTAHDMYQFLLGWYAKFPEYRSRALFLTGESYAGHYIPQLADVLITHNEKSKGFKFNI  205

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLLKLDRDVPA  E+ WSHG+ISDE + AI + CDF+DY+F  PHNES SCN 
Sbjct  206   KGVAIGNPLLKLDRDVPATYEYFWSHGMISDEIFLAISHSCDFEDYTFNDPHNESKSCND  265

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI + N  V DY+N YDVI+DVCYPSIV QELRL +  TK+S+G+DVCM  ER FYFNLP
Sbjct  266   AIAEANSVVGDYVNNYDVILDVCYPSIVMQELRLREYATKISIGVDVCMSYERFFYFNLP  325

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQ+ALHANRT+L + W  C+D  +L Y+ TDG+ N++P L+++++HKIPLW++SGDQDS
Sbjct  326   EVQQALHANRTHLKHHWSMCSD--ILNYSNTDGNINILPTLQRIVEHKIPLWVFSGDQDS  383

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+G+RT+VRELA  M + +TVPYS WFHKGQVGGW TEYGN LTFATVRGA+HMVP+
Sbjct  384   VVPLLGTRTLVRELAHAMGLHVTVPYSTWFHKGQVGGWVTEYGNFLTFATVRGASHMVPF  443

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP RAL LF S + G+RLPNTT+  ID
Sbjct  444   AQPDRALGLFRSIVLGQRLPNTTNPHID  471



>ref|XP_004977164.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X1 [Setaria 
italica]
Length=476

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/444 (71%), Positives = 366/444 (82%), Gaps = 2/444 (0%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PE DLV GLPGQP V+FRQF+GYVDVDE+AGRSLFYY  EA+       PLTLWLNGGPG
Sbjct  31    PESDLVRGLPGQPPVAFRQFAGYVDVDERAGRSLFYYLAEADGAAAASKPLTLWLNGGPG  90

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P GDGRGL IN KSWNK SNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  91    CSSVGGGAFTELGPFYPRGDGRGLRINDKSWNKVSNLLFVESPAGVGWSYSNTSSDYKTG  150

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D  TA DM IF+ KWYEKFPE+  R LFLTGESYAGHYIPQL +++I HNK  KG KFNI
Sbjct  151   DARTASDMHIFLLKWYEKFPEYKSRDLFLTGESYAGHYIPQLTNVLISHNKESKGFKFNI  210

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLLKLDRD+ ++ E+ WSHG+ISDE   AI N CDF+DY+F  PHNES SCN 
Sbjct  211   KGVAIGNPLLKLDRDIASIYEYFWSHGMISDEVGLAITNACDFEDYTFSSPHNESQSCND  270

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI + N+ V DY+N YDV++DVCYPSIV QELRL K VTK+SMG+D+CM  ER FYFNLP
Sbjct  271   AIAEANKVVGDYVNNYDVLLDVCYPSIVMQELRLRKYVTKISMGVDICMSYERFFYFNLP  330

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQ+ALHANRT LPY W  C+  ++L Y+ TDG+ N++PLL+++++H IP+W++SGDQDS
Sbjct  331   EVQQALHANRTRLPYKWSMCS--AVLNYSDTDGNINILPLLQRIIEHNIPVWVFSGDQDS  388

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA DM + +TVPY AWFH  QV GW TEYG LLTFATVRGAAHMVP+
Sbjct  389   VVPLLGSRTLVRELAHDMGLDVTVPYRAWFHNDQVAGWVTEYGKLLTFATVRGAAHMVPF  448

Query  1412  AQPGRALHLFSSFIRGRRLPNTTS  1483
             AQP RAL LF  F+ G+RLPNTT+
Sbjct  449   AQPDRALGLFRWFVDGQRLPNTTN  472



>ref|NP_001151858.1| serine carboxypeptidase F13S12.6 precursor [Zea mays]
 gb|ACG44640.1| serine carboxypeptidase F13S12.6 precursor [Zea mays]
Length=471

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/448 (70%), Positives = 370/448 (83%), Gaps = 3/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLV  LPGQP V+FRQF+GYVDVD KAGRSLFYYF EA +D   + PLTLWLNGGPG
Sbjct  27    PAEDLVARLPGQPPVTFRQFAGYVDVDAKAGRSLFYYFAEAREDAAAK-PLTLWLNGGPG  85

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P GDGRGL +N KSWN+ASNLLFVESPAGVGWSYSNTSSDY+ G
Sbjct  86    CSSVGGGAFTELGPFYPRGDGRGLRLNKKSWNRASNLLFVESPAGVGWSYSNTSSDYSTG  145

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D+ TA DM  F+  WY KFPE+  R LFLTGESYAGHYIPQLA ++I HN+  KG KFNI
Sbjct  146   DVWTAHDMYQFLLGWYAKFPEYRSRALFLTGESYAGHYIPQLADVLITHNEKSKGFKFNI  205

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLLKLDRDVPA  E+ WSHG+ISDE + AI + CDF+DY+F  PHNES SCN 
Sbjct  206   KGVAIGNPLLKLDRDVPATYEYFWSHGMISDEIFLAISHSCDFEDYTFNDPHNESKSCND  265

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI + N  V DY+N YDVI+DVCYPSIV QELRL +  TK+S+G+DVCM  ER FYFNLP
Sbjct  266   AIAEANSVVGDYVNNYDVILDVCYPSIVMQELRLREYATKISIGVDVCMSYERFFYFNLP  325

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQ+ALHANRT+L + W  C+D  +L Y+ TDG+ N++P L+++++HKIPLW++SGDQDS
Sbjct  326   EVQQALHANRTHLKHHWSMCSD--ILNYSNTDGNINILPTLQRIVEHKIPLWVFSGDQDS  383

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+G+RT+VRELA  M + +TVPYS WFHKGQVGGW TEYGN LTFATVRGA+HMVP+
Sbjct  384   VVPLLGTRTLVRELAHAMGLHVTVPYSTWFHKGQVGGWVTEYGNFLTFATVRGASHMVPF  443

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP RAL LF S + G+RLPNTT+  ID
Sbjct  444   AQPDRALGLFRSIVLGQRLPNTTNPHID  471



>ref|XP_002865546.1| hypothetical protein ARALYDRAFT_494806 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41805.1| hypothetical protein ARALYDRAFT_494806 [Arabidopsis lyrata subsp. 
lyrata]
Length=473

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/448 (70%), Positives = 366/448 (82%), Gaps = 3/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLVV LPGQP V FRQ++GYVDVD KAGRSLFYY+VEA K    + PLTLWLNGGPG
Sbjct  28    PEEDLVVRLPGQPTVGFRQYAGYVDVDVKAGRSLFYYYVEAVKQPDTK-PLTLWLNGGPG  86

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P+GDGRGL +NS SWNKASNLLFVESPAGVGWSYSN S+DY  G
Sbjct  87    CSSIGGGAFTELGPFYPTGDGRGLRVNSLSWNKASNLLFVESPAGVGWSYSNRSTDYNTG  146

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D +TA DML+F+ +W++KFP+   R LFLTGESYAGHYIPQLA  ++ +N H  G KFNI
Sbjct  147   DKTTARDMLVFLLRWFDKFPKSKSRDLFLTGESYAGHYIPQLADAILSYNAHSSGFKFNI  206

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLLKLDRD PA  EF WSHG+ISDE    I ++CDFDDY+F  PHN S +CN 
Sbjct  207   KGVAIGNPLLKLDRDSPATYEFFWSHGMISDELKLTITSQCDFDDYTFASPHNVSTACND  266

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI++    +S+Y+N YDV++DVCYPSIV+QELRL K  TK+S+G+DVCM  ER FYFNLP
Sbjct  267   AISETGNIISEYVNNYDVLLDVCYPSIVQQELRLKKMATKLSLGVDVCMTYERRFYFNLP  326

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRT+LPY+W  C+    L Y+ TDG+ +++P+LK+++Q+K P+WI+SGDQDS
Sbjct  327   EVQKALHANRTHLPYEWSMCS--GQLNYSDTDGNIDMLPILKRIIQNKTPVWIFSGDQDS  384

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVP VGSRT+VRELA D+    TVPY AWFHK QVGGW  EYG LLTFATVRGAAHMVPY
Sbjct  385   VVPFVGSRTLVRELANDLNFETTVPYGAWFHKSQVGGWAIEYGKLLTFATVRGAAHMVPY  444

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP RALHLFSSF+ GRRLPN T    D
Sbjct  445   AQPSRALHLFSSFVSGRRLPNNTHSSTD  472



>ref|XP_009377698.1| PREDICTED: serine carboxypeptidase-like 42 [Pyrus x bretschneideri]
Length=474

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/471 (70%), Positives = 371/471 (79%), Gaps = 6/471 (1%)
 Frame = +2

Query  77    MGRLVICFVCLSLLFCg---ggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGR  247
             MGR     V   L+ C      G V GYP EDLVV LPGQP V F+Q++GYVDVD KAGR
Sbjct  1     MGRCWFSGVLTVLMGCEWLLLLGAVEGYPAEDLVVSLPGQPSVGFKQYAGYVDVDVKAGR  60

Query  248   SLFYYFVEAEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWN  427
             SLFYYF EA+K   ++ PLTLWLNGGPGCSSIGGGAFTELGPF+P+GDGRGL  N  SWN
Sbjct  61    SLFYYFAEADKQPDKK-PLTLWLNGGPGCSSIGGGAFTELGPFYPTGDGRGLRTNKMSWN  119

Query  428   KASNLLFVESPAGVGWSYSNTSSDYTCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGE  607
             +ASNLLFVESPAGVGWSYSNTSSDY  GD STA DM  F+ KWYEKFP F  R LFLTGE
Sbjct  120   RASNLLFVESPAGVGWSYSNTSSDYNSGDASTARDMHTFLLKWYEKFPTFRSRELFLTGE  179

Query  608   SYAGHYIPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDE  787
             SYAGHYIPQLA  ++DHNK   G KFN+KGVA+GNPLL+LDRD  A  E+ WSHG+ISDE
Sbjct  180   SYAGHYIPQLAVAILDHNKQSTGFKFNLKGVAIGNPLLRLDRDALATYEYFWSHGMISDE  239

Query  788   NYNAIRNECDFDDYSFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQEL  967
                 I NECDFDDY     HN S  CN AI+  N+ V DYIN YDVI+DVCYPSIVEQEL
Sbjct  240   IGLTITNECDFDDYVSANTHNLSLECNEAISQANQIVGDYINNYDVILDVCYPSIVEQEL  299

Query  968   RLHKAVTKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTD  1147
             +L K  TK+S+G+DVCM  ER FY NLPEVQKALHANRTNL Y W  C+   +L Y+ TD
Sbjct  300   KLRKMATKISVGVDVCMTYERRFYLNLPEVQKALHANRTNLAYTWSMCS--GVLNYSDTD  357

Query  1148  GDANVVPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHK  1327
              + N++PLL +++Q+ IP+W++SGDQDSVVP +GSRT++RELA D+K  ITVPY AWFHK
Sbjct  358   ENINILPLLTRIVQNHIPVWVFSGDQDSVVPFLGSRTLIRELAHDLKFPITVPYGAWFHK  417

Query  1328  GQVGGWQTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNTT  1480
             GQVGGW TEYGNLLTFATVRGAAHMVPYAQP RALHLFSSF+ GRRLPNTT
Sbjct  418   GQVGGWATEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNTT  468



>ref|NP_199039.1| serine carboxypeptidase-like 42 [Arabidopsis thaliana]
 sp|Q9FH05.1|SCP42_ARATH RecName: Full=Serine carboxypeptidase-like 42; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK32772.1|AF361604_1 AT5g42240/K5J14_4 [Arabidopsis thaliana]
 dbj|BAB10197.1| serine carboxypeptidase II-like [Arabidopsis thaliana]
 gb|AAN28838.1| At5g42240/K5J14_4 [Arabidopsis thaliana]
 gb|AED94786.1| serine carboxypeptidase-like 42 [Arabidopsis thaliana]
Length=473

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/449 (69%), Positives = 364/449 (81%), Gaps = 3/449 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLVV LPGQP V F+Q++GYVDVD KAGRSLFYY+VEA K    + PLTLWLNGGPG
Sbjct  28    PEEDLVVRLPGQPTVGFKQYAGYVDVDVKAGRSLFYYYVEAVKQPDSK-PLTLWLNGGPG  86

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P+GDGRGL +NS SWNKAS+LLFVESPAGVGWSYSN SSDY  G
Sbjct  87    CSSIGGGAFTELGPFYPTGDGRGLRVNSMSWNKASHLLFVESPAGVGWSYSNKSSDYNTG  146

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DML+F+ +W+EKFP+   R LFLTGESYAGHYIPQLA  ++ +N H  G KFNI
Sbjct  147   DKSTANDMLVFLLRWFEKFPKLKSRDLFLTGESYAGHYIPQLADAILSYNSHSSGFKFNI  206

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLLKLDRD PA  EF WSHG+ISDE    I ++CDFDDY+F  PHN S +CN 
Sbjct  207   KGVAIGNPLLKLDRDSPATYEFFWSHGMISDELKLTITSQCDFDDYTFASPHNVSTACNE  266

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI++    +++Y+N YDV++DVCYPSIV+QELRL K  TKMSMG+DVCM  ER FYFNLP
Sbjct  267   AISETENIITEYVNNYDVLLDVCYPSIVQQELRLKKMATKMSMGVDVCMTYERRFYFNLP  326

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRT+LPY W  C+   +L Y+  DG+ +++P+LK+++ +K P+WI+SGDQDS
Sbjct  327   EVQKALHANRTHLPYSWSMCS--GVLNYSDIDGNIDMLPILKRIILNKTPIWIFSGDQDS  384

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVP  GSRT+VRELA D+    TVPY AWFHK QVGGW  EYG LLTFATVRGAAHMVPY
Sbjct  385   VVPFGGSRTLVRELAQDLNFKTTVPYGAWFHKSQVGGWAIEYGKLLTFATVRGAAHMVPY  444

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPIDQ  1498
             AQP RALHLFSSF+ GRRLPN T    D+
Sbjct  445   AQPSRALHLFSSFVSGRRLPNNTHSSTDE  473



>ref|XP_006663298.1| PREDICTED: serine carboxypeptidase-like 42-like [Oryza brachyantha]
Length=486

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/460 (68%), Positives = 369/460 (80%), Gaps = 15/460 (3%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLV  LPGQP V FRQF+GYVDVDEKAGRSLFYYF EA +D   + PLTLWLNGG  
Sbjct  30    PEEDLVTRLPGQPIVGFRQFAGYVDVDEKAGRSLFYYFAEAAEDAAGK-PLTLWLNGGRL  88

Query  332   c------------ssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGW  475
                          SS+GGGAFTELGPF+P GDGRGL +N KSWNK SNLLFVESPAGVGW
Sbjct  89    PPPATGSSPGPGCSSVGGGAFTELGPFYPRGDGRGLRLNKKSWNKVSNLLFVESPAGVGW  148

Query  476   SYSNTSSDYTCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMID  655
             SYSNTSSDY  GD  TA DM  F+  WY+KFPE+  R L L+GESYAGHYIPQL  +++ 
Sbjct  149   SYSNTSSDYNTGDQRTANDMYKFLLGWYKKFPEYSSRGLLLSGESYAGHYIPQLTDVLLK  208

Query  656   HNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSF  835
             HN+  KG KFNIKGVA+GNPLLKLDRDVPA  E+ WSHG+ISDE + AI N CDF+DY+F
Sbjct  209   HNEKSKGFKFNIKGVAIGNPLLKLDRDVPATYEYFWSHGMISDEIFLAISNRCDFEDYTF  268

Query  836   IYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVC  1015
               PHNES SCN AI + N  V DY+N YDVI+DVCYPS+V QELRL K VTK+S+G+DVC
Sbjct  269   SNPHNESKSCNDAIAEANSIVGDYVNNYDVILDVCYPSLVMQELRLRKYVTKISVGVDVC  328

Query  1016  MGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHK  1195
             M  ER FYFNLP+VQ+ALHANRT+LPY W  C+D  +L Y+  DG+ N++PLL+++++HK
Sbjct  329   MTYERYFYFNLPDVQRALHANRTHLPYGWSMCSD--VLNYSNKDGNINILPLLQRIVEHK  386

Query  1196  IPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTF  1375
             IP+WI+SGDQDSVVPL+GSRT+VRELA  M + +TVPYS+WF +GQVGGW TEYGN+LTF
Sbjct  387   IPVWIFSGDQDSVVPLLGSRTLVRELAHTMGLQVTVPYSSWFRRGQVGGWVTEYGNMLTF  446

Query  1376  ATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             ATVRGA+HMVP+AQP RAL LF SF  GRRLPNTT++PI+
Sbjct  447   ATVRGASHMVPFAQPDRALGLFQSFALGRRLPNTTNVPIN  486



>ref|NP_001067496.1| Os11g0213600 [Oryza sativa Japonica Group]
 gb|ABA92134.1| Serine carboxypeptidase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27859.1| Os11g0213600 [Oryza sativa Japonica Group]
Length=465

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/448 (71%), Positives = 369/448 (82%), Gaps = 3/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLV  LPGQP V FRQF+GYVDVDEKAGRSLFYYF EA +    + PLTLWLNGGPG
Sbjct  21    PEEDLVARLPGQPVVGFRQFAGYVDVDEKAGRSLFYYFAEAAEGAAAK-PLTLWLNGGPG  79

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P GDGRGL +N KSWNK SNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  80    CSSVGGGAFTELGPFYPRGDGRGLRLNKKSWNKVSNLLFVESPAGVGWSYSNTSSDYNTG  139

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D  TA DM  F+  WY+KFPE+  R L L+GESYAGHYIPQL  +++ HN+   G KFNI
Sbjct  140   DAQTANDMYKFLLGWYKKFPEYRSRGLLLSGESYAGHYIPQLTDVLLTHNEKSNGFKFNI  199

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLLKLDRDVPA  E+ WSHG+ISDE + +I + CDF+DY+F  PHNES SCN 
Sbjct  200   KGVAIGNPLLKLDRDVPATYEYFWSHGMISDEIFLSISHSCDFEDYTFSNPHNESKSCND  259

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI + N  V DY+N YDVI+DVCYPSIV QELRL K VTKMS+G+DVCM  ER FYFNLP
Sbjct  260   AIAEANSIVGDYVNNYDVILDVCYPSIVMQELRLRKYVTKMSVGVDVCMTYERYFYFNLP  319

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQ+ALHANRT+LPY W  C+D  +L Y+  DG+ N++PLL+++++HKIP+W++SGDQDS
Sbjct  320   EVQQALHANRTHLPYGWSMCSD--VLNYSNKDGNINILPLLQRIVEHKIPVWVFSGDQDS  377

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA DM + +TVPYS+WF +GQVGGW TEYGN+LTFATVRGA+HMVP+
Sbjct  378   VVPLLGSRTLVRELAHDMGLHVTVPYSSWFRRGQVGGWVTEYGNILTFATVRGASHMVPF  437

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP RAL LF SF  GRRLPNTT  PI+
Sbjct  438   AQPDRALGLFQSFALGRRLPNTTHPPIN  465



>ref|XP_006280410.1| hypothetical protein CARUB_v10026343mg [Capsella rubella]
 gb|EOA13308.1| hypothetical protein CARUB_v10026343mg [Capsella rubella]
Length=471

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/449 (69%), Positives = 367/449 (82%), Gaps = 3/449 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEED VV LPGQP+V FRQ++GYVDVD KAGRSLFYY+VEA K    + PLTLWLNGGPG
Sbjct  26    PEEDFVVRLPGQPKVGFRQYAGYVDVDVKAGRSLFYYYVEAVKQPDTK-PLTLWLNGGPG  84

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P+GDGRGL +NS SWNKASNLLFVESPAGVGWSYSN S+DY  G
Sbjct  85    CSSIGGGAFTELGPFYPTGDGRGLRVNSMSWNKASNLLFVESPAGVGWSYSNRSTDYNTG  144

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D +TA DM++F+ +W++KFP+   R LFLTGESYAGHYIPQLA  ++ +N    G KFNI
Sbjct  145   DKTTASDMVMFLLRWFDKFPKLKSRDLFLTGESYAGHYIPQLADAILSYNSRSSGFKFNI  204

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+LD+D PA  EF WSHG+ISDE    I ++CDFDDY+F  PHN S +CN 
Sbjct  205   KGVAIGNPLLRLDKDSPATYEFFWSHGMISDELKLIITSQCDFDDYTFASPHNVSTACNK  264

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI++    +++Y+N YDV++DVCYPSIV+QEL+L K  TKMS+G+DVCM  ER FYFNLP
Sbjct  265   AISETETIITEYVNNYDVLLDVCYPSIVQQELKLKKMATKMSLGVDVCMSYERRFYFNLP  324

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQ ALHANRT+LPYDW  C+  SLL Y+ TDG+ +++P+LK+++ +KIP+WI+SGDQDS
Sbjct  325   EVQIALHANRTHLPYDWSMCS--SLLNYSDTDGNIDMLPILKRIIHNKIPVWIFSGDQDS  382

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVP +GSRT+VRELA D+    TVPY AWFHK QVGGW  EYG LLTFATVRGAAHMVPY
Sbjct  383   VVPFLGSRTLVRELAQDLNFKTTVPYGAWFHKKQVGGWAIEYGKLLTFATVRGAAHMVPY  442

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPIDQ  1498
             AQP RALHLFSSF+ GRRLPN T    D+
Sbjct  443   AQPSRALHLFSSFVNGRRLPNQTHSSTDE  471



>gb|KHN23425.1| Serine carboxypeptidase-like 42 [Glycine soja]
Length=457

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/451 (68%), Positives = 356/451 (79%), Gaps = 25/451 (6%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P+EDL+V LPGQP+V F+Q++GYVD+D K GRSLFYYFVEAE +V  + PLTLWLNGGPG
Sbjct  28    PDEDLIVSLPGQPKVEFKQYAGYVDIDVKHGRSLFYYFVEAE-NVPDKKPLTLWLNGGPG  86

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P GDGRGL  NS SWNKASNLLFVESPAGVGWSYSNT+SDY  G
Sbjct  87    CSSIGGGAFTELGPFYPKGDGRGLRTNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNSG  146

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DML+F+ KWY+KFP +  R LFLTGESYAGHYIPQLA++++D+N H    KFNI
Sbjct  147   DSSTATDMLLFLLKWYQKFPSYRSRELFLTGESYAGHYIPQLANVLLDYNVHSTSFKFNI  206

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLLKLDRD  A  E+ WSHG+ISDE   AI N+CDFDDY F   HN S SCN 
Sbjct  207   KGVAIGNPLLKLDRDAQATYEYFWSHGMISDEIGLAITNDCDFDDYVFASAHNMSKSCNE  266

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAV---TKMSMGIDVCMGSERTFYF  1042
             AIN+ N                    IV   +  +  +   TK+S+G+DVCM  ER+FYF
Sbjct  267   AINEANE-------------------IVGDYINNYDVILDATKISIGVDVCMTYERSFYF  307

Query  1043  NLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGD  1222
             NLPEVQKALHANRTNLPY W  C+   +L Y+ TD + +++P+LKK++Q+ IP+W++SGD
Sbjct  308   NLPEVQKALHANRTNLPYQWSMCS--GVLNYSDTDPNIDILPILKKIVQNHIPVWVFSGD  365

Query  1223  QDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHM  1402
             QDSVVPL+GSRT++RELA D+K  ITVPY AWFHKGQVGGW TEYGNLLTFATVRGAAHM
Sbjct  366   QDSVVPLLGSRTLIRELAHDLKFKITVPYGAWFHKGQVGGWVTEYGNLLTFATVRGAAHM  425

Query  1403  VPYAQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             VPYAQP RALHLFSSF+ GRRLPNTTS  ID
Sbjct  426   VPYAQPSRALHLFSSFVHGRRLPNTTSPSID  456



>ref|XP_010442147.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
 ref|XP_010442148.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
 ref|XP_010442149.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
Length=465

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/466 (67%), Positives = 371/466 (80%), Gaps = 3/466 (1%)
 Frame = +2

Query  101   VCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEK  280
             V + LL         GYPEEDLVV LPGQP V+F+Q++GYVDVD KAGRSLFYY+VEA K
Sbjct  3     VAIVLLLLSVQWFAQGYPEEDLVVRLPGQPTVAFKQYAGYVDVDVKAGRSLFYYYVEAVK  62

Query  281   DVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESP  460
                 + PLTLWLNGGPGCSSIGGGAFTELGPF+P+GDGRGL +NS SWNKASNLLFVESP
Sbjct  63    QPDTK-PLTLWLNGGPGCSSIGGGAFTELGPFYPTGDGRGLRVNSMSWNKASNLLFVESP  121

Query  461   AGVGWSYSNTSSDYTCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLA  640
             AGVGWSYSN SSDY  GD STA DML+F+ +W +KFP+   R LFLTGESYAGHYIPQLA
Sbjct  122   AGVGWSYSNRSSDYNAGDRSTASDMLVFLLRWLDKFPKLKSRDLFLTGESYAGHYIPQLA  181

Query  641   SLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDF  820
               ++ +N    G KFNIKG+A+GNPLLKLDRD PA+ EF WSHG+ISDE    I ++CDF
Sbjct  182   DAILSYNSRSSGFKFNIKGIAIGNPLLKLDRDSPAMYEFFWSHGMISDELKLTITSQCDF  241

Query  821   DDYSFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSM  1000
             +DY+F  PHN S +CN A+ +    +++Y+N YDV++DVCYPSIV+QELRL K  TKMS+
Sbjct  242   EDYTFASPHNVSTACNEALGETENIITEYVNNYDVLLDVCYPSIVQQELRLKKMATKMSL  301

Query  1001  GIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKK  1180
             G+DVCM  ER FYFNLPEVQ ALHANRT+LPY+W  C+  S+L Y+  DG+ +++P+LK+
Sbjct  302   GVDVCMTYERRFYFNLPEVQIALHANRTHLPYEWSMCS--SVLNYSGIDGNIDMLPVLKR  359

Query  1181  LLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYG  1360
             ++ +KIP+WI+SGDQDSVVP +GSRT+VRELA D+    TVPY AWFHK QVGGW  EYG
Sbjct  360   IILNKIPVWIFSGDQDSVVPFLGSRTLVRELAQDLNFATTVPYGAWFHKRQVGGWAIEYG  419

Query  1361  NLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNTTSIPIDQ  1498
              LLTFATVRGAAHMVPYAQP RALH FSSF+ GRRLPN T    D+
Sbjct  420   KLLTFATVRGAAHMVPYAQPSRALHFFSSFVSGRRLPNQTHSSTDE  465



>emb|CDY48945.1| BnaA08g04690D [Brassica napus]
Length=477

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/448 (69%), Positives = 368/448 (82%), Gaps = 4/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLV  LPGQPEV+FRQF+GYVDVD KAGRSLFYYFVEAEK  H + PLTLWLNGGPG
Sbjct  31    PEEDLVTKLPGQPEVAFRQFAGYVDVDIKAGRSLFYYFVEAEKQQHTK-PLTLWLNGGPG  89

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P+GDGRGL  NSKSWNKASNLLFV+SPAGVGWSYSNT+SDYT G
Sbjct  90    CSSIGGGAFTELGPFYPAGDGRGLRRNSKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTG  149

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGH-KFN  688
             D STA+DML+F+ +W EKFPEF  R LFL GESYAGHYIPQLA +++++N       KF 
Sbjct  150   DESTAKDMLVFLLRWLEKFPEFRTRNLFLAGESYAGHYIPQLADVILEYNSRPSNRFKFK  209

Query  689   IKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCN  868
             +KG+A+GNPLLKLDRDVPA  EF WSHG+ISDE    I N+C+FDDY+F   HN S  C 
Sbjct  210   LKGIAIGNPLLKLDRDVPATYEFFWSHGMISDELGLTIMNQCNFDDYTFSSSHNISKPCE  269

Query  869   AAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNL  1048
             AA+++    ++ Y+N YDV++D+CYP++VEQELRL K  TK+S+G+DVCM  E   Y +L
Sbjct  270   AAMSEAGTIITQYVNYYDVLLDICYPTLVEQELRLKKMGTKISVGVDVCMSYEEQLYLSL  329

Query  1049  PEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQD  1228
             PEVQ+ALHANRTNLPY W  C+   LL Y+ TDG+ N++P+LK++L  KIP+W++SGD+D
Sbjct  330   PEVQQALHANRTNLPYSWSMCS--GLLNYSDTDGNMNILPILKRILTRKIPIWVFSGDED  387

Query  1229  SVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVP  1408
             SV+PL+GSRT+V+ELA D+    TVPY AWFHKGQVGGW  EYG++LTFATVRGAAHMVP
Sbjct  388   SVIPLLGSRTLVKELAEDLNFNTTVPYGAWFHKGQVGGWVIEYGDILTFATVRGAAHMVP  447

Query  1409  YAQPGRALHLFSSFIRGRRLPNTTSIPI  1492
             YAQP RALHLFSSF+ GRRLPN +  P+
Sbjct  448   YAQPSRALHLFSSFVLGRRLPNKSPPPL  475



>ref|XP_009107652.1| PREDICTED: serine carboxypeptidase-like 44 isoform X3 [Brassica 
rapa]
Length=454

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/448 (69%), Positives = 368/448 (82%), Gaps = 4/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLV  LPGQPEV+FRQF+GYVDVD KAGRSLFYYFVEAEK  H + PLTLWLNGGPG
Sbjct  8     PEEDLVTKLPGQPEVAFRQFAGYVDVDIKAGRSLFYYFVEAEKQQHTK-PLTLWLNGGPG  66

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P+GDGRGL  NSKSWNKASNLLFV+SPAGVGWSYSNT+SDYT G
Sbjct  67    CSSIGGGAFTELGPFYPAGDGRGLRRNSKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTG  126

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGH-KFN  688
             D STA+DML+F+ +W EKFPEF  R LFL GESYAGHYIPQLA +++++N       KF 
Sbjct  127   DESTAKDMLVFLLRWLEKFPEFRTRNLFLAGESYAGHYIPQLADVILEYNSRPSNRFKFK  186

Query  689   IKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCN  868
             +KG+A+GNPLLKLDRDVPA  EF WSHG+ISDE    I N+C+FDDY+F   HN S  C 
Sbjct  187   LKGIAIGNPLLKLDRDVPATYEFFWSHGMISDELGLTIMNQCNFDDYTFSSSHNISKPCE  246

Query  869   AAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNL  1048
             AA+++    ++ Y+N YDV++D+CYP++VEQELRL K  TK+S+G+DVCM  E   Y +L
Sbjct  247   AAMSEAGTIITQYVNYYDVLLDICYPTLVEQELRLKKMGTKISVGVDVCMSYEEQLYLSL  306

Query  1049  PEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQD  1228
             PEVQ+ALHANRTNLPY W  C+   LL Y+ TDG+ N++P+LK++L  KIP+W++SGD+D
Sbjct  307   PEVQQALHANRTNLPYSWSMCS--GLLNYSDTDGNMNILPILKRILTRKIPIWVFSGDED  364

Query  1229  SVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVP  1408
             SV+PL+GSRT+V+ELA D+    TVPY AWFHKGQVGGW  EYG++LTFATVRGAAHMVP
Sbjct  365   SVIPLLGSRTLVKELAEDLNFHTTVPYGAWFHKGQVGGWVIEYGDILTFATVRGAAHMVP  424

Query  1409  YAQPGRALHLFSSFIRGRRLPNTTSIPI  1492
             YAQP RALHLFSSF+ GRRLPN +  P+
Sbjct  425   YAQPSRALHLFSSFVLGRRLPNKSPPPL  452



>ref|XP_009107650.1| PREDICTED: serine carboxypeptidase-like 44 isoform X2 [Brassica 
rapa]
 ref|XP_009107651.1| PREDICTED: serine carboxypeptidase-like 44 isoform X2 [Brassica 
rapa]
Length=464

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/448 (69%), Positives = 368/448 (82%), Gaps = 4/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLV  LPGQPEV+FRQF+GYVDVD KAGRSLFYYFVEAEK  H + PLTLWLNGGPG
Sbjct  18    PEEDLVTKLPGQPEVAFRQFAGYVDVDIKAGRSLFYYFVEAEKQQHTK-PLTLWLNGGPG  76

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P+GDGRGL  NSKSWNKASNLLFV+SPAGVGWSYSNT+SDYT G
Sbjct  77    CSSIGGGAFTELGPFYPAGDGRGLRRNSKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTG  136

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGH-KFN  688
             D STA+DML+F+ +W EKFPEF  R LFL GESYAGHYIPQLA +++++N       KF 
Sbjct  137   DESTAKDMLVFLLRWLEKFPEFRTRNLFLAGESYAGHYIPQLADVILEYNSRPSNRFKFK  196

Query  689   IKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCN  868
             +KG+A+GNPLLKLDRDVPA  EF WSHG+ISDE    I N+C+FDDY+F   HN S  C 
Sbjct  197   LKGIAIGNPLLKLDRDVPATYEFFWSHGMISDELGLTIMNQCNFDDYTFSSSHNISKPCE  256

Query  869   AAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNL  1048
             AA+++    ++ Y+N YDV++D+CYP++VEQELRL K  TK+S+G+DVCM  E   Y +L
Sbjct  257   AAMSEAGTIITQYVNYYDVLLDICYPTLVEQELRLKKMGTKISVGVDVCMSYEEQLYLSL  316

Query  1049  PEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQD  1228
             PEVQ+ALHANRTNLPY W  C+   LL Y+ TDG+ N++P+LK++L  KIP+W++SGD+D
Sbjct  317   PEVQQALHANRTNLPYSWSMCS--GLLNYSDTDGNMNILPILKRILTRKIPIWVFSGDED  374

Query  1229  SVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVP  1408
             SV+PL+GSRT+V+ELA D+    TVPY AWFHKGQVGGW  EYG++LTFATVRGAAHMVP
Sbjct  375   SVIPLLGSRTLVKELAEDLNFHTTVPYGAWFHKGQVGGWVIEYGDILTFATVRGAAHMVP  434

Query  1409  YAQPGRALHLFSSFIRGRRLPNTTSIPI  1492
             YAQP RALHLFSSF+ GRRLPN +  P+
Sbjct  435   YAQPSRALHLFSSFVLGRRLPNKSPPPL  462



>ref|XP_009107648.1| PREDICTED: serine carboxypeptidase-like 44 isoform X1 [Brassica 
rapa]
 ref|XP_009107649.1| PREDICTED: serine carboxypeptidase-like 44 isoform X1 [Brassica 
rapa]
Length=477

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/448 (69%), Positives = 368/448 (82%), Gaps = 4/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLV  LPGQPEV+FRQF+GYVDVD KAGRSLFYYFVEAEK  H + PLTLWLNGGPG
Sbjct  31    PEEDLVTKLPGQPEVAFRQFAGYVDVDIKAGRSLFYYFVEAEKQQHTK-PLTLWLNGGPG  89

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P+GDGRGL  NSKSWNKASNLLFV+SPAGVGWSYSNT+SDYT G
Sbjct  90    CSSIGGGAFTELGPFYPAGDGRGLRRNSKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTG  149

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGH-KFN  688
             D STA+DML+F+ +W EKFPEF  R LFL GESYAGHYIPQLA +++++N       KF 
Sbjct  150   DESTAKDMLVFLLRWLEKFPEFRTRNLFLAGESYAGHYIPQLADVILEYNSRPSNRFKFK  209

Query  689   IKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCN  868
             +KG+A+GNPLLKLDRDVPA  EF WSHG+ISDE    I N+C+FDDY+F   HN S  C 
Sbjct  210   LKGIAIGNPLLKLDRDVPATYEFFWSHGMISDELGLTIMNQCNFDDYTFSSSHNISKPCE  269

Query  869   AAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNL  1048
             AA+++    ++ Y+N YDV++D+CYP++VEQELRL K  TK+S+G+DVCM  E   Y +L
Sbjct  270   AAMSEAGTIITQYVNYYDVLLDICYPTLVEQELRLKKMGTKISVGVDVCMSYEEQLYLSL  329

Query  1049  PEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQD  1228
             PEVQ+ALHANRTNLPY W  C+   LL Y+ TDG+ N++P+LK++L  KIP+W++SGD+D
Sbjct  330   PEVQQALHANRTNLPYSWSMCS--GLLNYSDTDGNMNILPILKRILTRKIPIWVFSGDED  387

Query  1229  SVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVP  1408
             SV+PL+GSRT+V+ELA D+    TVPY AWFHKGQVGGW  EYG++LTFATVRGAAHMVP
Sbjct  388   SVIPLLGSRTLVKELAEDLNFHTTVPYGAWFHKGQVGGWVIEYGDILTFATVRGAAHMVP  447

Query  1409  YAQPGRALHLFSSFIRGRRLPNTTSIPI  1492
             YAQP RALHLFSSF+ GRRLPN +  P+
Sbjct  448   YAQPSRALHLFSSFVLGRRLPNKSPPPL  475



>ref|NP_001183841.1| hypothetical protein precursor [Zea mays]
 gb|ACR38507.1| unknown [Zea mays]
 tpg|DAA38901.1| TPA: hypothetical protein ZEAMMB73_424549 [Zea mays]
Length=473

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/449 (70%), Positives = 366/449 (82%), Gaps = 5/449 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLV  LPGQP V+FRQF+GYVDVD KAGRSLFYYF EA+++   + PLTLWLNGGPG
Sbjct  27    PAEDLVTRLPGQPPVTFRQFAGYVDVDVKAGRSLFYYFAEAQENAAAK-PLTLWLNGGPG  85

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P GDGRGL +N KSWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  86    CSSIGGGAFTELGPFYPRGDGRGLRLNKKSWNKASNLLFVESPAGVGWSYSNTSSDYITG  145

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D  TA DML F+  WY KFPE+  R LFLTGESYAGHYIPQ+A +++ HN+  KG KFNI
Sbjct  146   DARTANDMLRFLLGWYAKFPEYRSRALFLTGESYAGHYIPQIADVLVTHNERSKGLKFNI  205

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSF--IYPHNESDSC  865
             KGVA+GNPLLKLDRDVPA  E+ WSHG+ISDE + AI + CDF+DY+F    PHNES  C
Sbjct  206   KGVAIGNPLLKLDRDVPATYEYFWSHGMISDETFLAISHSCDFEDYTFNNDSPHNESKPC  265

Query  866   NAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFN  1045
             N AI + N  V DY+N YDVI+DVCYPSIV QELRL +  TK+S+G+DVCM  ER FYFN
Sbjct  266   NDAIAEANAVVGDYVNNYDVILDVCYPSIVMQELRLRQFATKISVGVDVCMSYERFFYFN  325

Query  1046  LPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQ  1225
             LPEVQ+ALHANRT+L Y W  C+D+  L Y+ TDG+ +++P L+++++ KIPLW++SGDQ
Sbjct  326   LPEVQQALHANRTHLKYQWSMCSDF--LNYSNTDGNIDMLPTLQRIVERKIPLWVFSGDQ  383

Query  1226  DSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMV  1405
             DSVVPL+GSR++VRELA  M + +TVPYS WF KGQVGGW TEYGN LTFATVRGA+HMV
Sbjct  384   DSVVPLLGSRSLVRELAHTMGLHVTVPYSTWFRKGQVGGWVTEYGNFLTFATVRGASHMV  443

Query  1406  PYAQPGRALHLFSSFIRGRRLPNTTSIPI  1492
             P+AQP RAL LF S + GRRLPN TS PI
Sbjct  444   PFAQPDRALGLFRSIVLGRRLPNATSPPI  472



>ref|XP_009107653.1| PREDICTED: serine carboxypeptidase-like 44 isoform X4 [Brassica 
rapa]
Length=449

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/447 (68%), Positives = 367/447 (82%), Gaps = 4/447 (1%)
 Frame = +2

Query  155   EEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgc  334
             EEDLV  LPGQPEV+FRQF+GYVDVD KAGRSLFYYFVEAEK  H + PLTLWLNGGPGC
Sbjct  4     EEDLVTKLPGQPEVAFRQFAGYVDVDIKAGRSLFYYFVEAEKQQHTK-PLTLWLNGGPGC  62

Query  335   ssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCGD  514
             SSIGGGAFTELGPF+P+GDGRGL  NSKSWNKASNLLFV+SPAGVGWSYSNT+SDYT GD
Sbjct  63    SSIGGGAFTELGPFYPAGDGRGLRRNSKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTGD  122

Query  515   ISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGH-KFNI  691
              STA+DML+F+ +W EKFPEF  R LFL GESYAGHYIPQLA +++++N       KF +
Sbjct  123   ESTAKDMLVFLLRWLEKFPEFRTRNLFLAGESYAGHYIPQLADVILEYNSRPSNRFKFKL  182

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KG+A+GNPLLKLDRDVPA  EF WSHG+ISDE    I N+C+FDDY+F   HN S  C A
Sbjct  183   KGIAIGNPLLKLDRDVPATYEFFWSHGMISDELGLTIMNQCNFDDYTFSSSHNISKPCEA  242

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             A+++    ++ Y+N YDV++D+CYP++VEQELRL K  TK+S+G+DVCM  E   Y +LP
Sbjct  243   AMSEAGTIITQYVNYYDVLLDICYPTLVEQELRLKKMGTKISVGVDVCMSYEEQLYLSLP  302

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQ+ALHANRTNLPY W  C+   LL Y+ TDG+ N++P+LK++L  KIP+W++SGD+DS
Sbjct  303   EVQQALHANRTNLPYSWSMCS--GLLNYSDTDGNMNILPILKRILTRKIPIWVFSGDEDS  360

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             V+PL+GSRT+V+ELA D+    TVPY AWFHKGQVGGW  EYG++LTFATVRGAAHMVPY
Sbjct  361   VIPLLGSRTLVKELAEDLNFHTTVPYGAWFHKGQVGGWVIEYGDILTFATVRGAAHMVPY  420

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPI  1492
             AQP RALHLFSSF+ GRRLPN +  P+
Sbjct  421   AQPSRALHLFSSFVLGRRLPNKSPPPL  447



>ref|XP_009377728.1| PREDICTED: serine carboxypeptidase-like 42 [Pyrus x bretschneideri]
Length=491

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/463 (70%), Positives = 368/463 (79%), Gaps = 3/463 (1%)
 Frame = +2

Query  92    ICFVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVE  271
             I  V L  ++    G V GYP EDLVV LPGQP V F+Q++GYVDVD KAGRSLFYYFVE
Sbjct  26    ILTVLLGCVWLVLLGAVEGYPAEDLVVSLPGQPSVGFKQYAGYVDVDVKAGRSLFYYFVE  85

Query  272   AEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFV  451
             A+K   R+ PLTLWLNGGPGCSSIGGGAFTELGPF+P+GDGRGL  N  SWN+ASNLLFV
Sbjct  86    ADKQPDRK-PLTLWLNGGPGCSSIGGGAFTELGPFYPTGDGRGLRRNKMSWNRASNLLFV  144

Query  452   ESPAGVGWSYSNTSSDYTCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIP  631
             ESPAGVGWSYSNTSSDY  GD STA DM  F+ KWYEKFP F  R LFLTGESYAGHYIP
Sbjct  145   ESPAGVGWSYSNTSSDYNSGDASTARDMHTFLLKWYEKFPTFRSRELFLTGESYAGHYIP  204

Query  632   QLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNE  811
             QLA  ++DHNK   G KFN+KGVA+GNPLL+LD D  A  E+ WSHG+ISDE    I NE
Sbjct  205   QLAIAILDHNKQSTGFKFNLKGVAIGNPLLRLDHDARATYEYFWSHGMISDEIGLTIMNE  264

Query  812   CDFDDYSFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTK  991
             CDFD Y     HN S  CN A++   + V DYIN YDVI+DVCYPSIVEQELRL K  TK
Sbjct  265   CDFDYYFSANTHNLSLECNKAVSQAKQIVGDYINDYDVILDVCYPSIVEQELRLRKMATK  324

Query  992   MSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPL  1171
             +S+G+DVCM  ER FY NLPEVQ+ALHANRTNLPY W  C+   +L Y+ TD + N++PL
Sbjct  325   ISVGVDVCMTYERRFYLNLPEVQEALHANRTNLPYTWSMCS--GILNYSDTDWNINILPL  382

Query  1172  LKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQT  1351
             L +++Q+ IP+W++SGDQDSVVPL+GSRT++RELA D+K  ITVPY AWFHKGQVGGW T
Sbjct  383   LTRIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAHDLKFPITVPYGAWFHKGQVGGWAT  442

Query  1352  EYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNTT  1480
             EYGNLLTFATVRGAAHMVPYAQP RAL LFSSF+ GRRLPNTT
Sbjct  443   EYGNLLTFATVRGAAHMVPYAQPSRALRLFSSFVHGRRLPNTT  485



>gb|EEE51848.1| hypothetical protein OsJ_33355 [Oryza sativa Japonica Group]
Length=474

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/457 (68%), Positives = 365/457 (80%), Gaps = 12/457 (3%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLV  LPGQP V FRQF+GYVDVDEKAGRSLFYYF EA +    + PLTLWLNG   
Sbjct  21    PEEDLVARLPGQPVVGFRQFAGYVDVDEKAGRSLFYYFAEAAEGAAAK-PLTLWLNGDGI  79

Query  332   c---------ssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYS  484
                       SS+GGGAFTELGPF+P GDGRGL +N KSWNK SNLLFVESPAGVGWSYS
Sbjct  80    GVVIVNGPGCSSVGGGAFTELGPFYPRGDGRGLRLNKKSWNKVSNLLFVESPAGVGWSYS  139

Query  485   NTSSDYTCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNK  664
             NTSSDY  GD  TA DM  F+  WY+KFPE+  R L L+GESYAGHYIPQL  +++ HN+
Sbjct  140   NTSSDYNTGDAQTANDMYKFLLGWYKKFPEYRSRGLLLSGESYAGHYIPQLTDVLLTHNE  199

Query  665   HFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYP  844
                G KFNIKGVA+GNPLLKLDRDVPA  E+ WSHG+ISDE + +I + CDF+DY+F  P
Sbjct  200   KSNGFKFNIKGVAIGNPLLKLDRDVPATYEYFWSHGMISDEIFLSISHSCDFEDYTFSNP  259

Query  845   HNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGS  1024
             HNES SCN AI + N  V DY+N YDVI+DVCYPSIV QELRL K VTKMS+G+DVCM  
Sbjct  260   HNESKSCNDAIAEANSIVGDYVNNYDVILDVCYPSIVMQELRLRKYVTKMSVGVDVCMTY  319

Query  1025  ERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPL  1204
             ER FYFNLPEVQ+ALHANRT+LPY W  C+D  +L Y+  DG+ N++PLL+++++HKIP+
Sbjct  320   ERYFYFNLPEVQQALHANRTHLPYGWSMCSD--VLNYSNKDGNINILPLLQRIVEHKIPV  377

Query  1205  WIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATV  1384
             W++SGDQDSVVPL+GSRT+VRELA DM + +TVPYS+WF +GQVGGW TEYGN+LTFATV
Sbjct  378   WVFSGDQDSVVPLLGSRTLVRELAHDMGLHVTVPYSSWFRRGQVGGWVTEYGNILTFATV  437

Query  1385  RGAAHMVPYAQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             RGA+HMVP+AQP RAL LF SF  GRRLPNTT  PI+
Sbjct  438   RGASHMVPFAQPDRALGLFQSFALGRRLPNTTHPPIN  474



>ref|XP_010482006.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
Length=473

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/466 (67%), Positives = 370/466 (79%), Gaps = 3/466 (1%)
 Frame = +2

Query  101   VCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEK  280
             V + LL         GYP+EDLVV LPGQP V F+Q++GYVDVD KAGRSLFYY+VEA K
Sbjct  11    VAIVLLLLSVQWFAQGYPDEDLVVRLPGQPTVGFKQYAGYVDVDVKAGRSLFYYYVEAVK  70

Query  281   DVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESP  460
                 + PLTLWLNGGPGCSSIGGGAFTELGPF+P+GDGRGL +NS SWNKASNLLFVESP
Sbjct  71    QPDTK-PLTLWLNGGPGCSSIGGGAFTELGPFYPTGDGRGLRVNSMSWNKASNLLFVESP  129

Query  461   AGVGWSYSNTSSDYTCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLA  640
             AGVGWSYSN SSDY  GD STA DML+F+ +W +KFP+   R LFLTGESYAGHYIPQLA
Sbjct  130   AGVGWSYSNRSSDYNAGDRSTASDMLVFLLRWLDKFPKLKSRDLFLTGESYAGHYIPQLA  189

Query  641   SLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDF  820
               ++ +N    G KFNIKG+A+GNPLLKLDRD PA+ EF WSHG+ISDE    I ++CDF
Sbjct  190   DAILSYNLRSSGFKFNIKGIAVGNPLLKLDRDSPAMYEFFWSHGMISDELKLTITSQCDF  249

Query  821   DDYSFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSM  1000
             +DY+F  PHN S +CN A+ +    +++Y+N YDV++DVCYPSIV+QELRL K  TKMS+
Sbjct  250   EDYTFASPHNVSTACNEALGETESIITEYVNNYDVLLDVCYPSIVQQELRLKKMATKMSL  309

Query  1001  GIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKK  1180
             G+DVCM  ER FYFNLPEVQ ALHANRT+LPY+W  C+  S+L Y+  DG+ +++P+LK+
Sbjct  310   GVDVCMTYERRFYFNLPEVQIALHANRTHLPYEWSMCS--SVLNYSGIDGNIDMLPVLKR  367

Query  1181  LLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYG  1360
             ++Q+KIP+WI+SGDQDSVVP +GSRT VRELA D     TVPY AWFHK QVGGW  EYG
Sbjct  368   IIQNKIPVWIFSGDQDSVVPFLGSRTPVRELAQDFNFETTVPYGAWFHKRQVGGWAIEYG  427

Query  1361  NLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNTTSIPIDQ  1498
              LLTFATVRGAAHMVPYAQP RALHLFSSF+ GRRLPN T    D+
Sbjct  428   KLLTFATVRGAAHMVPYAQPSRALHLFSSFMSGRRLPNQTHSSTDE  473



>gb|ACM17527.1| putative serine carboxy peptidase [Oryza australiensis]
Length=466

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/448 (70%), Positives = 365/448 (81%), Gaps = 8/448 (2%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLV  LPGQP V FRQF+GYVDVDEKAGRSLFYYF EA +    + PLTLWLNGGPG
Sbjct  27    PEEDLVARLPGQPVVGFRQFAGYVDVDEKAGRSLFYYFAEAAEGAAAK-PLTLWLNGGPG  85

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P GDGRGL +N KSWNK SNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  86    CSSVGGGAFTELGPFYPRGDGRGLRLNKKSWNKVSNLLFVESPAGVGWSYSNTSSDYNTG  145

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D  TA DM  F+  WY+KFPE+  R L L+GESYAGHYIPQL  +++ HN+   G KFNI
Sbjct  146   DARTANDMYKFVLGWYKKFPEYRSRGLLLSGESYAGHYIPQLTDVLLTHNEKSNGFKFNI  205

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLLKLDRDVPA  E+ WSHG+ISDE + AI + CDF+DY+F  PHNES SCN 
Sbjct  206   KGVAIGNPLLKLDRDVPATYEYFWSHGMISDEIFLAISHSCDFEDYTFSNPHNESKSCND  265

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI D N  V DY+N YDVI+DVCYPSIV QELRL K VTKMS+G+DVCM  ER FYFNLP
Sbjct  266   AIADANSIVGDYVNNYDVILDVCYPSIVMQELRLRKYVTKMSVGVDVCMTYERYFYFNLP  325

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQ+ALHANRT+LPY W  C+D        TDG+ N++PLL+++++HKIP+W++SGDQDS
Sbjct  326   EVQQALHANRTHLPYGWSMCSD-------NTDGNINILPLLQRIVEHKIPVWVFSGDQDS  378

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA +M + +TVPYS+WF +GQVGGW TEYGN+LTFATVRGA+HMVP+
Sbjct  379   VVPLLGSRTLVRELAHNMGLHVTVPYSSWFCRGQVGGWVTEYGNILTFATVRGASHMVPF  438

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP RAL LF SF  GRRLPNTT   I+
Sbjct  439   AQPDRALGLFQSFALGRRLPNTTHPSIN  466



>emb|CDX80725.1| BnaC08g05590D [Brassica napus]
Length=476

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/447 (68%), Positives = 368/447 (82%), Gaps = 4/447 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLV  LPGQPEV+FRQF+GYVDVD KAGRSLFYYFVEAEK  H + PLTLWLNGGPG
Sbjct  32    PEEDLVTKLPGQPEVAFRQFAGYVDVDIKAGRSLFYYFVEAEKQPHTK-PLTLWLNGGPG  90

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P+GDGRGL  NSKSWNKASNLLFV+SPAGVGWSYSNT+SDYT G
Sbjct  91    CSSIGGGAFTELGPFYPAGDGRGLRRNSKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTG  150

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA+DML+F+ +W EKFPEF  R LFL GESYAGHYIPQLA +++++N     ++F +
Sbjct  151   DESTAKDMLVFLLRWLEKFPEFRTRNLFLAGESYAGHYIPQLADVILEYNSR-HSNRFKL  209

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KG+A+GNPLLKLDRDVPA  EF WSHG+ISDE    I N+C+F+DY+F   HN S  C  
Sbjct  210   KGIAVGNPLLKLDRDVPATYEFFWSHGMISDELGLTIMNQCNFEDYTFSSSHNISKPCED  269

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             A+++    ++ Y+N YDV++D+CYP++VEQELRL K  TK+S+G+DVCM  E   Y +LP
Sbjct  270   AMSEAGTIITQYVNYYDVLLDICYPTLVEQELRLKKMGTKISVGVDVCMSYEEQLYLSLP  329

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQ+ALHANRTNLPY W  C+   LL Y+ TDG+ N++P+LK++L  KIP+W++SGD+DS
Sbjct  330   EVQQALHANRTNLPYSWSMCS--GLLNYSDTDGNMNILPILKRILTRKIPIWVFSGDEDS  387

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             V+PL+GSRT+V+ELA D+    TVPY AWFHKGQVGGW  EYG++LTFATVRGAAHMVPY
Sbjct  388   VIPLLGSRTLVKELAEDLNFNTTVPYGAWFHKGQVGGWVIEYGDILTFATVRGAAHMVPY  447

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPI  1492
             AQP RALHLFSSF+ GRRLPN +  P+
Sbjct  448   AQPSRALHLFSSFVLGRRLPNKSPPPL  474



>ref|XP_010479023.1| PREDICTED: serine carboxypeptidase-like 44 [Camelina sativa]
Length=479

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/444 (68%), Positives = 367/444 (83%), Gaps = 4/444 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P+EDLV  LPGQPEV+FRQF+GYVD+D KAGRSLFYYFVEAEK  H + PLTLWLNGGPG
Sbjct  33    PKEDLVTKLPGQPEVAFRQFAGYVDIDVKAGRSLFYYFVEAEKQPHTK-PLTLWLNGGPG  91

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P+G+GRGL  N KSWNKASNLLFV+SPAGVGWSYSNT+SDYT G
Sbjct  92    CSSIGGGAFTELGPFYPTGNGRGLRRNPKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTG  151

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGH-KFN  688
             D +TA+DML+FM +W EKFP+F  R LFL GESYAGHYIPQLA +++++N       KF 
Sbjct  152   DETTAKDMLVFMLRWLEKFPQFKTRNLFLAGESYAGHYIPQLADVILEYNTRPSSRFKFK  211

Query  689   IKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCN  868
             +KG+A+GNPLLKLDRDVPA+ EF WSHG+ISDE    I N+CDF+DYSF   HN S  C 
Sbjct  212   LKGIAIGNPLLKLDRDVPAIYEFFWSHGMISDELGLTIMNQCDFEDYSFSSTHNISKPCE  271

Query  869   AAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNL  1048
             AA+++    ++ Y+N YD+++D+CYPS+VEQELRL K  TKMS G+DVCM  E   Y  L
Sbjct  272   AAMSEAGTIITQYVNYYDILLDICYPSLVEQELRLKKMGTKMSFGVDVCMSYEEQLYLTL  331

Query  1049  PEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQD  1228
             PEVQKALHANRT LPY+W  C+  SLL YN  DG+ N++P+LK++++ K+P+W++SGD+D
Sbjct  332   PEVQKALHANRTQLPYEWSMCS--SLLNYNYNDGNTNILPILKRIVKSKVPVWVFSGDED  389

Query  1229  SVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVP  1408
             SV+PL+GSRT+VRELA D+ +  TVPY+AWFHKGQVGGW  EYGNLLTFATVRGAAHMVP
Sbjct  390   SVIPLLGSRTLVRELADDLYLNTTVPYAAWFHKGQVGGWVIEYGNLLTFATVRGAAHMVP  449

Query  1409  YAQPGRALHLFSSFIRGRRLPNTT  1480
             YAQP RALHLF+SF+ GRRLP+ +
Sbjct  450   YAQPSRALHLFTSFVLGRRLPHKS  473



>gb|KFK24266.1| hypothetical protein AALP_AAs40498U001000 [Arabis alpina]
Length=480

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/447 (68%), Positives = 364/447 (81%), Gaps = 4/447 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLV  LP QP+V+FRQF+GYVDVD KAGRSLFYYFVEAE   H + PLTLWLNGGPG
Sbjct  33    PEEDLVTKLPRQPKVAFRQFAGYVDVDVKAGRSLFYYFVEAENQPHSK-PLTLWLNGGPG  91

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P+GDGRGL  NSKSWNKASNLLFVESPAGVGWSYSNTSSDY   
Sbjct  92    CSSIGGGAFTELGPFYPTGDGRGLRKNSKSWNKASNLLFVESPAGVGWSYSNTSSDYNTD  151

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHN-KHFKGHKFN  688
             D +TA+DML+FM +W++KFPEF  R LFL+GESYAGHY+PQLA +++ +N +     KFN
Sbjct  152   DATTAKDMLVFMLRWFKKFPEFKTRQLFLSGESYAGHYVPQLADIILQYNARRSNEFKFN  211

Query  689   IKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCN  868
             +KG+A+GNPLLKLDRDVPA  EF WSHG+ISDE    I N+CDF+DYSF   HN S SC 
Sbjct  212   LKGIAIGNPLLKLDRDVPATYEFFWSHGMISDELGLTIMNQCDFEDYSFSSSHNISKSCE  271

Query  869   AAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNL  1048
             AA+++    ++ ++N YDV++DVCYPS+ EQELRL K  TKMS+G+DVC+  E   Y  L
Sbjct  272   AAMSEAGTIITRFVNYYDVLLDVCYPSLFEQELRLKKMGTKMSVGVDVCISYEEQLYLTL  331

Query  1049  PEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQD  1228
             PEVQKALHANRT L Y W  C+   LL YN TDG+ N++P+LK++++ KIP+W++SGD+D
Sbjct  332   PEVQKALHANRTQLTYPWSMCS--GLLNYNNTDGNTNILPILKRIVKSKIPVWVFSGDED  389

Query  1229  SVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVP  1408
             SV+PL+GSRT++RELA D+    TVPY AWFHKGQVGGW  EYGNLLTFATVRGAAHMVP
Sbjct  390   SVIPLLGSRTLIRELADDLNFNTTVPYGAWFHKGQVGGWAIEYGNLLTFATVRGAAHMVP  449

Query  1409  YAQPGRALHLFSSFIRGRRLPNTTSIP  1489
             YAQP RALHLF+SF+ GRRLPN T  P
Sbjct  450   YAQPSRALHLFTSFVLGRRLPNKTPPP  476



>ref|XP_002863806.1| hypothetical protein ARALYDRAFT_331179 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40065.1| hypothetical protein ARALYDRAFT_331179 [Arabidopsis lyrata subsp. 
lyrata]
Length=472

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/445 (67%), Positives = 361/445 (81%), Gaps = 3/445 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PE D VV LPGQP V+FRQ++GYVD+D+  GRSLFYYFVEAEK    + PLTLWLNGGPG
Sbjct  27    PEADFVVKLPGQPMVTFRQYAGYVDIDKVVGRSLFYYFVEAEKRPDTK-PLTLWLNGGPG  85

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P+GDGRGL INS SWNKASNLLFV+SPAGVGWSYSN SSDY  G
Sbjct  86    CSSVGGGAFTELGPFYPTGDGRGLRINSMSWNKASNLLFVDSPAGVGWSYSNRSSDYNAG  145

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D S A DML+F+ +W++KFPE   R LFLTGESYAGHYIPQLA  ++ +N H  G KFNI
Sbjct  146   DESAASDMLVFLLRWFDKFPELKSRDLFLTGESYAGHYIPQLADAILSYNSHSSGFKFNI  205

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KG+A+GNPLLKLDRD+PAV EF WSHG+ISD     IR++CDF  Y++ YPHN SD+CN 
Sbjct  206   KGIAIGNPLLKLDRDIPAVYEFFWSHGMISDIVGRTIRSQCDFSHYTYAYPHNASDACND  265

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             A  +    +++Y+N +DV++D+CYPSIV QELRL +  TKMSMG+DVCM  ER FYFNLP
Sbjct  266   ATTEAGIVITEYVNNFDVLLDICYPSIVLQELRLKQMATKMSMGVDVCMTYERQFYFNLP  325

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQ ALHANRT+LPY+W  C++  LL Y+  D + N++P LK+++Q+KIP+WI+SGDQDS
Sbjct  326   EVQMALHANRTHLPYEWSLCSN--LLNYSGIDINTNMLPTLKRIIQNKIPVWIFSGDQDS  383

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVP +G+RT+V+ELA D+    TVPY  WFHK QVGGW  EYGNLLTFATVRGAAH+V Y
Sbjct  384   VVPFLGTRTVVQELADDLNFKTTVPYGVWFHKRQVGGWAIEYGNLLTFATVRGAAHVVAY  443

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSI  1486
              QP RALHLFS+F+RG+RLPN T I
Sbjct  444   KQPSRALHLFSAFVRGQRLPNKTDI  468



>ref|XP_006307408.1| hypothetical protein CARUB_v10009034mg [Capsella rubella]
 gb|EOA40306.1| hypothetical protein CARUB_v10009034mg [Capsella rubella]
Length=473

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/466 (65%), Positives = 372/466 (80%), Gaps = 14/466 (3%)
 Frame = +2

Query  86    LVICFVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYF  265
             L++   CL+  F          PEEDLV  LPGQPEV+FRQ++GYVD+D KAGRSLFYYF
Sbjct  15    LIMALQCLAEGF----------PEEDLVTKLPGQPEVAFRQYAGYVDIDVKAGRSLFYYF  64

Query  266   VEAEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLL  445
             VEAEK+ H + PLTLWLNGGPGCSSIGGGAFTELGPF+P+G+G GL  N KSWNKASNLL
Sbjct  65    VEAEKEPHTK-PLTLWLNGGPGCSSIGGGAFTELGPFYPTGNGLGLRRNPKSWNKASNLL  123

Query  446   FVESPAGVGWSYSNTSSDYTCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHY  625
             FV+SPAGVGWSYSNT+SDY  GD  TA+DML+FM +W EKFP+F  R LFL GESYAGHY
Sbjct  124   FVDSPAGVGWSYSNTTSDYNTGDEKTAKDMLMFMLRWLEKFPQFKTRNLFLAGESYAGHY  183

Query  626   IPQLASLMIDHN-KHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAI  802
             +PQLA +++++N +     KFN+KG+A+GNPLLKLDRDVPA+ EF WSHG+ISDE    I
Sbjct  184   VPQLADVILEYNTRQSNRFKFNLKGIAIGNPLLKLDRDVPAIFEFFWSHGMISDELGATI  243

Query  803   RNECDFDDYSFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKA  982
             +N+CDF+DYSF   HN S  C  A+N+    ++ YIN YD+++D+CYPS+VEQELRL K 
Sbjct  244   KNQCDFEDYSFSRTHNISKPCETAMNEAGTIITQYINYYDILLDICYPSLVEQELRLKKM  303

Query  983   VTKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANV  1162
              TKMS G+DVCM  E   Y  LPEVQKALHANRT LPY+W  C+  SL+ YN  DG  N+
Sbjct  304   GTKMSNGVDVCMSYEEQIYLTLPEVQKALHANRTQLPYEWSICS--SLVNYNYNDGSTNI  361

Query  1163  VPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGG  1342
             +P+LK++++ K+P+W++SGD+DSV+PL+GSRT+V+ELA+D+    TVPY AWFHKGQVGG
Sbjct  362   LPILKRIVKSKVPVWVFSGDEDSVIPLLGSRTLVKELASDLNFNTTVPYGAWFHKGQVGG  421

Query  1343  WQTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNTT  1480
             W  EYGNLLTFATVRGAAHMVPYAQP RALHLF+SF+ GRRLP+ +
Sbjct  422   WVIEYGNLLTFATVRGAAHMVPYAQPSRALHLFTSFVLGRRLPHKS  467



>ref|XP_006858474.1| hypothetical protein AMTR_s00071p00113850 [Amborella trichopoda]
 gb|ERN19941.1| hypothetical protein AMTR_s00071p00113850 [Amborella trichopoda]
Length=474

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/462 (68%), Positives = 368/462 (80%), Gaps = 4/462 (1%)
 Frame = +2

Query  113   LLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHR  292
             +L C    G YG P EDLV  LPGQP+V F+Q++GYV+VDEKAGRSLFYYF EA+ D  +
Sbjct  16    ILLCLFVDGGYGGPVEDLVHRLPGQPKVDFKQYAGYVNVDEKAGRSLFYYFAEADGDADK  75

Query  293   RLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVG  472
             + PLTLWLNGGPGCSSIGGGAFTELGPFFP GDGRGLI N KSWN+ SNLLFVESPAGVG
Sbjct  76    K-PLTLWLNGGPGCSSIGGGAFTELGPFFPRGDGRGLIRNKKSWNRVSNLLFVESPAGVG  134

Query  473   WSYSNTSSDYTCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMI  652
             WSYSNT++DYTCGD STA+DML F+  W  KFPE+  R LFLTGESYAGHYIPQLA  ++
Sbjct  135   WSYSNTTADYTCGDASTAKDMLRFLLGWIHKFPEYKTRDLFLTGESYAGHYIPQLADALL  194

Query  653   DHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYS  832
             DHN H    KFNIKG+A+GNPLLKLD D  A  ++ WSHG+ISDE  +AI ++C+FDDY 
Sbjct  195   DHNSHSTKFKFNIKGIAIGNPLLKLDVDAAASYQYFWSHGLISDETGSAILDQCNFDDYV  254

Query  833   F-IYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGID  1009
                 PHN S +C+ A+   NR V +Y+N YDVI+DVCYPSIV+QELRL K  TK+S+G+D
Sbjct  255   LGNSPHNVSMACDDAMEKANREVGNYVNAYDVILDVCYPSIVQQELRLRKWATKISVGVD  314

Query  1010  VCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQ  1189
             VCM  ER FY NLPEVQ ALHANRT LPY W  C+D   L Y+  DG  N++P+LKK++Q
Sbjct  315   VCMTYERRFYLNLPEVQYALHANRTKLPYSWSMCSDQ--LNYSNIDGSINMIPVLKKIIQ  372

Query  1190  HKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLL  1369
             HK+P+W++SGDQDSVVPL+GSRT+VREL+ DM   ITVPY AWF+KGQVGGW  EYGN+L
Sbjct  373   HKVPIWVFSGDQDSVVPLMGSRTLVRELSDDMNFEITVPYGAWFYKGQVGGWAAEYGNML  432

Query  1370  TFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             TFATVRGAAHMVPYAQP RAL LF +F+ G+RLPN T   I+
Sbjct  433   TFATVRGAAHMVPYAQPARALKLFHTFVSGQRLPNITHPSIE  474



>ref|NP_175046.1| serine carboxypeptidase-like 44 [Arabidopsis thaliana]
 sp|Q9MAR8.1|SCP44_ARATH RecName: Full=Serine carboxypeptidase-like 44; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF63101.1|AC006423_2 Putative serine carboxypeptidases [Arabidopsis thaliana]
 gb|AEE31996.1| serine carboxypeptidase-like 44 [Arabidopsis thaliana]
Length=479

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/444 (68%), Positives = 363/444 (82%), Gaps = 4/444 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P +DLV  LPGQPEV+FRQF+GYVD+D KAGRSLFYYFVEAEK  H + PLTLWLNGGPG
Sbjct  33    PVQDLVTKLPGQPEVAFRQFAGYVDIDVKAGRSLFYYFVEAEKQPHSK-PLTLWLNGGPG  91

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P+GD RGL  N KSWNKASNLLFV+SPAGVGWSYSNT+SDYT G
Sbjct  92    CSSIGGGAFTELGPFYPTGDARGLRRNPKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTG  151

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGH-KFN  688
             D STA+DML+FM +W EKFP+F  R LFL GESYAGHY+PQLA +++++N       KFN
Sbjct  152   DESTAKDMLVFMLRWLEKFPQFKTRNLFLAGESYAGHYVPQLADVILEYNAQRSNRFKFN  211

Query  689   IKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCN  868
             +KG+A+GNPLLKLDRDVPA+ EF WSHG+ISDE    I N+CDF+DY+F   HN S  C 
Sbjct  212   LKGIAIGNPLLKLDRDVPAIYEFFWSHGMISDELGLTIMNQCDFEDYTFTDSHNISKLCE  271

Query  869   AAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNL  1048
             AA+N     ++ Y+N YD+++DVCYPS+ EQELRL K  T+MS G+DVCM  E   Y NL
Sbjct  272   AAVNQAGTIITQYVNYYDILLDVCYPSLFEQELRLKKMGTRMSFGVDVCMSFEEQLYLNL  331

Query  1049  PEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQD  1228
             PEVQKALHANRT LPY+W  C+  SLL Y  TDG+AN++P+LK++++ K+P+W++SGD+D
Sbjct  332   PEVQKALHANRTKLPYEWSMCS--SLLNYKYTDGNANMLPILKRIVKSKVPVWVFSGDED  389

Query  1229  SVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVP  1408
             SV+PL+GSRT+V+ELA D+    TVPY AWF KGQVGGW  EYGNLLTFATVRGAAHMVP
Sbjct  390   SVIPLLGSRTLVKELADDLNFNTTVPYGAWFDKGQVGGWVVEYGNLLTFATVRGAAHMVP  449

Query  1409  YAQPGRALHLFSSFIRGRRLPNTT  1480
             Y+QP RALHLF+SF+ GR+LP+ +
Sbjct  450   YSQPSRALHLFTSFVLGRKLPHKS  473



>ref|XP_002891272.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67531.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=479

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/444 (68%), Positives = 362/444 (82%), Gaps = 4/444 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLV  LPGQPEV+FRQF+GYVD+D KAGRSLFYYFVEAEK  H + PLTLWLNGGPG
Sbjct  33    PIEDLVTKLPGQPEVAFRQFAGYVDIDVKAGRSLFYYFVEAEKQPHSK-PLTLWLNGGPG  91

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P G+GRGL  N KSWNKASNLLFV+SPAGVGWSYSNT+SDYT G
Sbjct  92    CSSIGGGAFTELGPFYPIGNGRGLRRNPKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTG  151

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGH-KFN  688
             D STA+DML+FM +W EKFP+F  R LFL GESYAGHYIPQLA +++++N+      KFN
Sbjct  152   DESTAKDMLVFMLRWLEKFPQFKTRNLFLAGESYAGHYIPQLADVILEYNQQRTNRFKFN  211

Query  689   IKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCN  868
             +KG+A+GNPLLKLDRD+PA+ EF WSHG+ISDE    I N+CDF+DYSF   HN S SC 
Sbjct  212   LKGIAIGNPLLKLDRDIPAMYEFFWSHGMISDELGLTIMNQCDFEDYSFTGSHNISKSCE  271

Query  869   AAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNL  1048
             A ++     ++ Y+N YD+++D+CYPS+ EQELRL K  TKMS G+DVCM  E   Y  L
Sbjct  272   AVVSQAGTIITQYVNYYDILLDICYPSLFEQELRLKKMGTKMSFGVDVCMSYEEQLYLTL  331

Query  1049  PEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQD  1228
             PEVQKALHANRT LPY W  C+  SLLKYN TDG+ N++P+LK++++ K+ +W++SGDQD
Sbjct  332   PEVQKALHANRTQLPYQWSMCS--SLLKYNYTDGNTNMLPILKRIVKSKVHVWVFSGDQD  389

Query  1229  SVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVP  1408
             SV+PL+GSRT+V+ELA D+    TVPY AWF KGQVGGW  EYGNL+TFATVRGAAHMVP
Sbjct  390   SVIPLLGSRTLVKELADDLNFNTTVPYGAWFDKGQVGGWVIEYGNLVTFATVRGAAHMVP  449

Query  1409  YAQPGRALHLFSSFIRGRRLPNTT  1480
             Y+QP RALHLF+SF+ GRRLP+ +
Sbjct  450   YSQPSRALHLFTSFVLGRRLPHKS  473



>ref|XP_004502581.1| PREDICTED: serine carboxypeptidase-like 42-like [Cicer arietinum]
Length=468

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/448 (67%), Positives = 363/448 (81%), Gaps = 4/448 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLV  LPGQP+V F Q++GYVD+D K G+SLFYYFVEA  + H++ PLTLWLNGGPG
Sbjct  25    PSEDLVERLPGQPKVKFSQYAGYVDIDVKNGKSLFYYFVEAHHNPHKK-PLTLWLNGGPG  83

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+PSG+GRGL  NSKSWN+ SNLLFVESPAGVGWSYSNT+SDY  G
Sbjct  84    CSSIGGGAFTELGPFYPSGNGRGLRKNSKSWNRVSNLLFVESPAGVGWSYSNTTSDYNAG  143

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DML+FM KWYEKFP +  R LFLTGESYAGHYIPQLA+ ++DH +   G KFN+
Sbjct  144   DASTANDMLLFMLKWYEKFPTYRSRELFLTGESYAGHYIPQLATALLDHTRS-TGFKFNL  202

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KG+A+GNPLL  DRD  ++ E+ WSHG+ISDE + AI+N+C FDDY++  PHNES +CN 
Sbjct  203   KGIAIGNPLLNFDRDAYSIYEYFWSHGMISDEVFLAIQNDCHFDDYTYAPPHNESKACND  262

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             A+ D    VS Y++ YDV++DVCYP+I EQELRL K +TK S+ +DVCM  E   Y NLP
Sbjct  263   ALGDAYNIVSSYVDNYDVLLDVCYPAIAEQELRLKKTLTKRSLSVDVCMDYELFSYLNLP  322

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRT LPY W  C++  +L Y+ TD D N++P+LK+++++ IP+WIYSGD DS
Sbjct  323   EVQKALHANRTILPYPWSECSN--ILNYSSTDPDINILPILKRIIENHIPVWIYSGDADS  380

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+ RELA D+K GIT  Y  WFHKGQVGGW TEYGNLLTFATVRGA HMVP+
Sbjct  381   VVPLLGSRTLTRELAHDLKFGITDSYRVWFHKGQVGGWVTEYGNLLTFATVRGAGHMVPF  440

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP R+LHLFSSF++G+RLPNTT   ID
Sbjct  441   AQPSRSLHLFSSFVQGKRLPNTTKPSID  468



>ref|XP_010493597.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
 ref|XP_010493598.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
 ref|XP_010493599.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
Length=462

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/442 (69%), Positives = 359/442 (81%), Gaps = 7/442 (2%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLVV LPGQP V F+Q++GYVDVD KAGRSLFYY+VEA K    + PLTLWLNGGPG
Sbjct  24    PEEDLVVRLPGQPTVGFKQYAGYVDVDVKAGRSLFYYYVEAVKQPDTK-PLTLWLNGGPG  82

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P+GDGRGL +NS SWNKASNLLFVESPAGVGWSYSN +SDY  G
Sbjct  83    CSSIGGGAFTELGPFYPTGDGRGLRVNSMSWNKASNLLFVESPAGVGWSYSNRTSDYNAG  142

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DML+F+ +W +KFP    R LFLTGESYAGHYIPQLA  ++ +N    G KFNI
Sbjct  143   DRSTASDMLVFLLRWLDKFPNLKSRDLFLTGESYAGHYIPQLADAILSYNSRSSGFKFNI  202

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KG+A+GNPLLKL+RD PA+ EF WSHG+ISDE    I ++CDF+DY+F  PHN S +CN 
Sbjct  203   KGIAIGNPLLKLERDSPAMYEFFWSHGMISDELKLTITSQCDFEDYTFASPHNVSTACNE  262

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI +    +++Y+N YDV++DVCYPSIV+QELRL K  TKMS+G+DVCM  ER FYFNLP
Sbjct  263   AIGETESIITEYVNNYDVLLDVCYPSIVQQELRLKKIATKMSLGVDVCMTYERRFYFNLP  322

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQ ALHANRT+LPY+W  C+  S+L Y+  DG+ +++P+LK++LQ+KIP+WI+SGDQDS
Sbjct  323   EVQIALHANRTHLPYEWSMCS--SVLNYSGIDGNIDMLPVLKRILQNKIPVWIFSGDQDS  380

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVP +GSRT+VRELA D+    TVPY AWFHK QVGGW  EYG LLTFATVRGAAHMVPY
Sbjct  381   VVPFLGSRTLVRELAQDLNFETTVPYGAWFHKRQVGGWAIEYGKLLTFATVRGAAHMVPY  440

Query  1412  AQPGRALHLFSSFIRGRRLPNT  1477
             AQP RALHLFSSF +    PNT
Sbjct  441   AQPSRALHLFSSFAQ----PNT  458



>ref|XP_006393769.1| hypothetical protein EUTSA_v10011445mg [Eutrema salsugineum]
 gb|ESQ31055.1| hypothetical protein EUTSA_v10011445mg [Eutrema salsugineum]
Length=479

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/476 (65%), Positives = 375/476 (79%), Gaps = 6/476 (1%)
 Frame = +2

Query  68    RLIMGRLVICFVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGR  247
             R ++G L++  V  S  +        GYPEEDLV  LPGQP+V+FRQF+GYVDVD +AGR
Sbjct  7     RFLVGALMVMVVQCS--WGYNRNLAEGYPEEDLVTKLPGQPKVAFRQFAGYVDVDVRAGR  64

Query  248   SLFYYFVEAEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWN  427
             SLFYYFVEAEK  H + PLTLWLNGGPGCSSIGGGAFTELGPF+P+GDGRGL  N KSWN
Sbjct  65    SLFYYFVEAEKQPHTK-PLTLWLNGGPGCSSIGGGAFTELGPFYPTGDGRGLRRNPKSWN  123

Query  428   KASNLLFVESPAGVGWSYSNTSSDYTCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGE  607
             KASNLLFV+SPAGVGWSYSNT+SDYT GD STA+DML+FM +W EKFP F  + LFL GE
Sbjct  124   KASNLLFVDSPAGVGWSYSNTTSDYTTGDESTAKDMLVFMLRWLEKFPAFKTQNLFLAGE  183

Query  608   SYAGHYIPQLASLMIDHN-KHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISD  784
             SYAGHYIPQLA +++D+N +     KF +KG+A+GNPLLKLDRDVPAV EF WSHG+ISD
Sbjct  184   SYAGHYIPQLADVILDYNARRSNRFKFKLKGIAIGNPLLKLDRDVPAVYEFFWSHGMISD  243

Query  785   ENYNAIRNECDFDDYSFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQE  964
             E    I ++CDF+DY+F   HN S  C  A++     ++ Y+N YDV++DVCYP++ EQE
Sbjct  244   ELGLTIMDQCDFEDYTFSSSHNISKPCEDAVSKAGTIITQYVNYYDVLLDVCYPTLFEQE  303

Query  965   LRLHKAVTKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQT  1144
             LRL K  TKMS+G+DVCM  E   Y  LPEVQKALHANRT+LPY W  C+   LL Y+ T
Sbjct  304   LRLKKMGTKMSVGVDVCMSYEEQLYLTLPEVQKALHANRTHLPYSWSMCS--GLLNYDDT  361

Query  1145  DGDANVVPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFH  1324
             DG+ N++P++K++++ KIP+W++SGD+DSV+PL+GSRT+VR LA ++    TVPY AWFH
Sbjct  362   DGNRNILPIIKRIVKSKIPVWVFSGDEDSVIPLLGSRTLVRGLAEELNFNTTVPYGAWFH  421

Query  1325  KGQVGGWQTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNTTSIPI  1492
             KGQVGGW  EYGNLLTFATVRGAAHMV YAQP RALHLF+SF+ GRRLPN +  P+
Sbjct  422   KGQVGGWVIEYGNLLTFATVRGAAHMVSYAQPSRALHLFTSFVLGRRLPNKSPPPL  477



>ref|XP_007019399.1| Serine carboxypeptidase-like 42 isoform 3, partial [Theobroma 
cacao]
 gb|EOY16624.1| Serine carboxypeptidase-like 42 isoform 3, partial [Theobroma 
cacao]
Length=439

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/415 (73%), Positives = 345/415 (83%), Gaps = 3/415 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLVV LPGQP+V F Q++GYVDVD KAGRSLFYYFVEA+KD  ++ PLTLWLNGGPG
Sbjct  28    PAEDLVVNLPGQPQVGFMQYAGYVDVDVKAGRSLFYYFVEADKDPDKK-PLTLWLNGGPG  86

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P+GDGRGL  NS SWN+ASNLLFVESPAGVGWSYSNTSSDY CG
Sbjct  87    CSSIGGGAFTELGPFYPTGDGRGLRRNSMSWNRASNLLFVESPAGVGWSYSNTSSDYICG  146

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA+DM IFM  WYEKFPEF  R LFLTGESYAGHYIPQLA +++DHN H  G KFNI
Sbjct  147   DASTAKDMHIFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLDHNAHSTGFKFNI  206

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+LDRDVPA  EF WSHG+ISDE    I NECDFDDY F  PHN S SC+ 
Sbjct  207   KGVAIGNPLLRLDRDVPATYEFFWSHGMISDETGLTIMNECDFDDYVFENPHNVSQSCSQ  266

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI + N  V DYIN YDV++DVCYPSIVEQELRL K  TK+S+G+DVCM  ER FY NLP
Sbjct  267   AIAEANGIVGDYINSYDVLLDVCYPSIVEQELRLRKMATKISLGVDVCMTYERRFYLNLP  326

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQ ALHANRT LPY W  C+    +KY+ TDG+ +++P+LKK++Q+ IP+W++SGDQDS
Sbjct  327   EVQMALHANRTKLPYPWSMCS--GQIKYSDTDGNIDILPILKKIIQNGIPVWVFSGDQDS  384

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAA  1396
             VVPL+GSRT+VRELA D+   ITVPY AWFHK QVGGW TEYGNLLTFATVRGAA
Sbjct  385   VVPLLGSRTLVRELAHDLNFKITVPYGAWFHKHQVGGWVTEYGNLLTFATVRGAA  439



>ref|NP_199038.1| serine carboxypeptidase-like 41 [Arabidopsis thaliana]
 sp|Q9FH06.1|SCP41_ARATH RecName: Full=Serine carboxypeptidase-like 41; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB10196.1| serine carboxypeptidase-II like [Arabidopsis thaliana]
 gb|AAO22761.1| putative serine carboxypeptidase-II [Arabidopsis thaliana]
 gb|AAO42380.1| putative serine carboxypeptidase-II [Arabidopsis thaliana]
 gb|AED94783.1| serine carboxypeptidase-like 41 [Arabidopsis thaliana]
Length=469

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/447 (66%), Positives = 352/447 (79%), Gaps = 3/447 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PE DLVV LPGQP+V FRQ++GYVD+D  AGRSLFYYFVEAEK    + PLTLWLNGGPG
Sbjct  24    PETDLVVRLPGQPKVVFRQYAGYVDLDLNAGRSLFYYFVEAEKHPDTK-PLTLWLNGGPG  82

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P+G GRGL INS SWNKASNLLFV+SPAGVGWSYSN SSDY  G
Sbjct  83    CSSVGGGAFTELGPFYPTGYGRGLRINSMSWNKASNLLFVDSPAGVGWSYSNRSSDYNAG  142

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D S A DML+F+ +W++KFPE     LFLTGESYAGHYIPQLA  ++ +N    G KFNI
Sbjct  143   DKSAASDMLVFLLRWFDKFPELKSHDLFLTGESYAGHYIPQLADAILSYNSRSSGFKFNI  202

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KG+A+GNPLLKLDRD+PAV EF WSHG+IS+     I+ +CDF  Y++ YPHN SD+CN 
Sbjct  203   KGIAIGNPLLKLDRDIPAVYEFFWSHGMISEVVGRTIKIQCDFSHYTYAYPHNVSDACND  262

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI +     ++Y+N +DV+ D+CYPSI  QELRL +  TKMSMG+DVCM  ER FY N+P
Sbjct  263   AIREAGDITTEYVNTFDVLPDLCYPSIALQELRLKQMATKMSMGVDVCMNYERQFYLNIP  322

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQ ALHANRTNLPY W  C++  LL Y+  D + N++P LK+++Q+KIP+ I+SGDQDS
Sbjct  323   EVQMALHANRTNLPYSWSLCSN--LLNYSAIDVNTNMLPTLKRIIQNKIPVRIFSGDQDS  380

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVP +G+RTIV ELA D+    TVPY  WFHK QVGGW  EYGNLLTFATVRGAAH V Y
Sbjct  381   VVPFLGTRTIVGELANDLNFKTTVPYGVWFHKRQVGGWAIEYGNLLTFATVRGAAHAVAY  440

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPI  1492
              QP RALHLFS+F+RG+RLPN T I +
Sbjct  441   TQPSRALHLFSTFLRGQRLPNKTDIAM  467



>ref|XP_003602149.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES72400.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=465

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/449 (68%), Positives = 356/449 (79%), Gaps = 7/449 (2%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLVV LPGQP+V F Q++GYVD+D K GRSLFYYFVEA+   H++ PLTLWLNGGPG
Sbjct  24    PIEDLVVKLPGQPKVKFSQYAGYVDIDIKHGRSLFYYFVEADHLPHKK-PLTLWLNGGPG  82

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+PSGDGRGL  NSKSWN  SN+LFVESPAGVGWSYSNT+SDY  G
Sbjct  83    CSSIGGGAFTELGPFYPSGDGRGLRKNSKSWNTVSNILFVESPAGVGWSYSNTTSDYNIG  142

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DML+FM KWYEKFP +  R LFLTGESYAGHYIPQLA+ ++D+N H    KFNI
Sbjct  143   DASTANDMLLFMLKWYEKFPSYKSRKLFLTGESYAGHYIPQLANAILDYNAHSSSFKFNI  202

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLLKLDRD  A  E++WSHG+ISDE   AIRN+C+FD        N S SC  
Sbjct  203   KGVAIGNPLLKLDRDRQATYEYLWSHGMISDEIVLAIRNDCNFDASY----DNLSKSCKE  258

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AIN   + VS Y++ YDVI+DVCYP+I EQE+RL K  TK+S+ +DVC+  E   Y NLP
Sbjct  259   AINVTRKIVSQYVDNYDVILDVCYPAIAEQEIRLKKMATKISLSVDVCIDYESFNYLNLP  318

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRTNLPY W  C+D  +L Y+ TD D +++P+LK+++Q+ IP+W+YSGDQDS
Sbjct  319   EVQKALHANRTNLPYPWGMCSD--VLNYSNTDPDVDMLPILKRIVQNHIPIWVYSGDQDS  376

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT++RELA DMK  IT  Y  WFHKGQ GGW TEY NLLTFATVRGA HMVPY
Sbjct  377   VVPLLGSRTLIRELAHDMKFKITDSYRVWFHKGQAGGWVTEYENLLTFATVRGAGHMVPY  436

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPIDQ  1498
              QP RALHLFSSF+ G+RLPNTT   I +
Sbjct  437   GQPSRALHLFSSFVHGKRLPNTTKPSIGE  465



>ref|XP_002865553.1| hypothetical protein ARALYDRAFT_494807 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41812.1| hypothetical protein ARALYDRAFT_494807 [Arabidopsis lyrata subsp. 
lyrata]
Length=473

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/447 (65%), Positives = 353/447 (79%), Gaps = 3/447 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PE DLVV LPGQ +V+FRQ++GYVD+D  AGRSLFYYFVEAE+    + PLTLWLNGGPG
Sbjct  28    PEADLVVRLPGQLKVAFRQYAGYVDLDMNAGRSLFYYFVEAEEHPDTK-PLTLWLNGGPG  86

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS  GGAFTELGPF+P+GDG GL +NS SWNKASNLLFVESP GVGWSYSN SSDY  G
Sbjct  87    CSSGCGGAFTELGPFYPTGDGGGLRVNSMSWNKASNLLFVESPVGVGWSYSNRSSDYNTG  146

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DML+F+  W++KFPEF  R  FLTGE+YAGHYIPQLA  ++ +N    G KFNI
Sbjct  147   DKSTASDMLVFLLGWFDKFPEFKSRDFFLTGENYAGHYIPQLADAILSYNSRSSGFKFNI  206

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KG+A+GNP LKLDRDV A  EF WSHG+ISDE  + I ++CDF DY++IYPHN S +CN 
Sbjct  207   KGIAIGNPFLKLDRDVRAAFEFFWSHGMISDEVGHTIMSQCDFLDYTYIYPHNLSVACND  266

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI +   ++++Y+N YD ++D+CYPSIV +ELRL +  TKMSMG+DVCM  ER  YFNLP
Sbjct  267   AIREAGNSITEYVNNYDFLLDICYPSIVLKELRLKQMATKMSMGVDVCMTYERQLYFNLP  326

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQ ALHANRT+LPY W  C++  LL Y+  D + N++P LK+++Q+KIP+WI+SGDQDS
Sbjct  327   EVQMALHANRTHLPYSWSMCSN--LLNYSGIDANINMLPTLKRVIQNKIPVWIFSGDQDS  384

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVP +G+RT+VRELA D+    TVPY  WFHK QVGGW  EYGN+LTFATVRGAAH V  
Sbjct  385   VVPFLGTRTVVRELANDLNFKTTVPYGVWFHKRQVGGWAIEYGNILTFATVRGAAHAVAN  444

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPI  1492
              QP +ALHLFS+F+RG RLPN T I +
Sbjct  445   TQPSQALHLFSTFLRGHRLPNKTDIAM  471



>ref|XP_006279617.1| hypothetical protein CARUB_v10026338mg [Capsella rubella]
 gb|EOA12515.1| hypothetical protein CARUB_v10026338mg [Capsella rubella]
Length=472

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/441 (66%), Positives = 351/441 (80%), Gaps = 3/441 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PE DLVV LPGQP+V+FRQ++GYV+VD   GRSLFYY+VEAE     + PLTLWLNGGPG
Sbjct  27    PEADLVVRLPGQPKVTFRQYAGYVEVDLSVGRSLFYYYVEAETHPDTK-PLTLWLNGGPG  85

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGG FTELGPF+P+GDGRGL IN+ SWNKASNLLFVESPAGVGWSYSN +SDY  G
Sbjct  86    CSSVGGGGFTELGPFYPTGDGRGLRINTMSWNKASNLLFVESPAGVGWSYSNRTSDYNAG  145

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D S   DML+F+ +W++KFP      LFLTGESYAGHYIPQLA  ++ +N    G +FNI
Sbjct  146   DESATSDMLLFLLRWFDKFPALKSHDLFLTGESYAGHYIPQLADAILSYNSRSSGFRFNI  205

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KG+A+GNPLLKLDRDVPAV EF WSHG+I+DE    I N+CDF DY+F  PHN S+ C+ 
Sbjct  206   KGIAIGNPLLKLDRDVPAVFEFFWSHGMIADEERLTIMNQCDFKDYTFASPHNVSNICHD  265

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI      +++YIN YDV++D CYPSIV+QELRL K  TKMSMG+DVCM  ER  YFNLP
Sbjct  266   AIRTAGNVITEYINNYDVLLDFCYPSIVQQELRLKKMATKMSMGVDVCMTYERRLYFNLP  325

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQ ALHANRT+LPY+W  C+  + L Y+  DG+ +++P+LK+++Q+K P+WI+SGDQDS
Sbjct  326   EVQIALHANRTHLPYEWSMCS--TQLNYSGIDGNMDMLPVLKRIIQNKTPVWIFSGDQDS  383

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             V+P  GSR+++RELA D+   ITVPY  WFHK QVGGW  EYGNLLTFATVRGAAHMVPY
Sbjct  384   VIPFTGSRSLIRELAQDLNFEITVPYRIWFHKRQVGGWAIEYGNLLTFATVRGAAHMVPY  443

Query  1412  AQPGRALHLFSSFIRGRRLPN  1474
             AQP RAL LFSSF+ G RLPN
Sbjct  444   AQPARALQLFSSFVSGGRLPN  464



>ref|XP_007019398.1| Serine carboxypeptidase-like 42 isoform 2 [Theobroma cacao]
 gb|EOY16623.1| Serine carboxypeptidase-like 42 isoform 2 [Theobroma cacao]
Length=433

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/451 (65%), Positives = 341/451 (76%), Gaps = 47/451 (10%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLVV LPGQP+V F Q++GYVDVD KAGRSLFYYFVEA+KD  ++ PLTLWLNGGPG
Sbjct  28    PAEDLVVNLPGQPQVGFMQYAGYVDVDVKAGRSLFYYFVEADKDPDKK-PLTLWLNGGPG  86

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P+GDGRGL  NS SWN+ASNLLFVESPAGVGWSYSNTSSDY CG
Sbjct  87    CSSIGGGAFTELGPFYPTGDGRGLRRNSMSWNRASNLLFVESPAGVGWSYSNTSSDYICG  146

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA+DM IFM  WYEKFPEF  R LFLTGESYAGHYIPQLA +++DHN H  G KFNI
Sbjct  147   DASTAKDMHIFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLDHNAHSTGFKFNI  206

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISD--ENYNAIRNECDFDDYSFIYPHNESDSC  865
             KGVA+GNPLL+LDRDVPA      ++GI+ D   +Y+ + + C                 
Sbjct  207   KGVAIGNPLLRLDRDVPATQAIAEANGIVGDYINSYDVLLDVC-----------------  249

Query  866   NAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFN  1045
                                      YPSIVEQELRL K  TK+S+G+DVCM  ER FY N
Sbjct  250   -------------------------YPSIVEQELRLRKMATKISLGVDVCMTYERRFYLN  284

Query  1046  LPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQ  1225
             LPEVQ ALHANRT LPY W  C+    +KY+ TDG+ +++P+LKK++Q+ IP+W++SGDQ
Sbjct  285   LPEVQMALHANRTKLPYPWSMCS--GQIKYSDTDGNIDILPILKKIIQNGIPVWVFSGDQ  342

Query  1226  DSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMV  1405
             DSVVPL+GSRT+VRELA D+   ITVPY AWFHK QVGGW TEYGNLLTFATVRGAAHMV
Sbjct  343   DSVVPLLGSRTLVRELAHDLNFKITVPYGAWFHKHQVGGWVTEYGNLLTFATVRGAAHMV  402

Query  1406  PYAQPGRALHLFSSFIRGRRLPNTTSIPIDQ  1498
             PYAQP RALHLFSSF+RGRRLPN T   +++
Sbjct  403   PYAQPSRALHLFSSFVRGRRLPNNTRPSVNE  433



>ref|XP_006596272.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X2 [Glycine 
max]
Length=456

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/490 (65%), Positives = 371/490 (76%), Gaps = 42/490 (9%)
 Frame = +2

Query  44    GWCSTTYVRLIMGR-----LVICFVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQ  208
             GW S+  V ++MGR     ++I   C S  F G  G V GYP EDLVV LPGQP+V F+Q
Sbjct  4     GWLSSEGV-VVMGRCWLVGVIIVVGCAS--FLGTVGVVEGYPAEDLVVKLPGQPKVGFKQ  60

Query  209   FSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSG  388
             F+GYVDVD K GRSLFYYFVEAE+D H++ PLTLWLNGGPGCSSIGGGAFTELGPF+P G
Sbjct  61    FAGYVDVDAKHGRSLFYYFVEAEQDPHKK-PLTLWLNGGPGCSSIGGGAFTELGPFYPKG  119

Query  389   DGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCGDISTAEDMLIFMKKWYEKF  568
             DGRGL  NS SWNKASNLLFVESPAGVGWSYSNT+SDY  GD ST               
Sbjct  120   DGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNSGDAST---------------  164

Query  569   PEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAV  748
                             GHYIPQL ++++DHN    G KFNIKGVA+GNPLL+LDRD PA+
Sbjct  165   ----------------GHYIPQLTNVLLDHNARSTGSKFNIKGVAIGNPLLRLDRDAPAI  208

Query  749   TEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNAAINDQNRAvsdyinvydvi  928
              E+ WSHG+ISDE   AI N+CDFDDY +  PHN S  CN AI + N  V DYIN YDVI
Sbjct  209   YEYFWSHGMISDEIGLAIMNDCDFDDYVYASPHNVSQLCNNAIYEANLIVGDYINNYDVI  268

Query  929   vdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKT  1108
             +DVCY SI+EQELRL +  TK+S+ +DVCM  ER FYFNLPEVQKALHANRTNLPY W  
Sbjct  269   LDVCYTSIMEQELRLKRMATKISVSVDVCMTLERRFYFNLPEVQKALHANRTNLPYSWSM  328

Query  1109  CADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMK  1288
             C+   +L Y  TDG+ N++P+LK+++Q+ IP+W++SGDQDSVVPL+GSRT++RELA +++
Sbjct  329   CS--HVLNYRDTDGNINILPILKRIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAHELQ  386

Query  1289  MGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRL  1468
               ITVPY AWFHKGQVGGW TEYGNLLTFATVRGAAHMVPYAQP RALHLFSSF+RGRRL
Sbjct  387   FKITVPYGAWFHKGQVGGWVTEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRL  446

Query  1469  PNTTSIPIDQ  1498
             PNTT   ID+
Sbjct  447   PNTTRPSIDE  456



>ref|XP_009136205.1| PREDICTED: serine carboxypeptidase-like 42 [Brassica rapa]
Length=466

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/449 (65%), Positives = 355/449 (79%), Gaps = 9/449 (2%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLVV LPGQP+V FRQ++GYV+VD K GRSLFYYFVEA+K    + PLTLWLNGGPG
Sbjct  27    PEEDLVVRLPGQPKVEFRQYAGYVNVDSKNGRSLFYYFVEADKQPDTK-PLTLWLNGGPG  85

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P+GDGRGL INS SWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  86    CSSVGGGAFTELGPFYPTGDGRGLRINSMSWNKASNLLFVESPAGVGWSYSNTSSDYNTG  145

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D +TA DM++F+ +W+ KFPE   R  FLTGESYAGHYIPQLA  ++ +N H +G+KFN+
Sbjct  146   DETTASDMVVFLLRWFNKFPELKSRDFFLTGESYAGHYIPQLADAILSYNIHSRGYKFNV  205

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KG+A+GNPLL+L  D  A  +F WSHG+ISDE    I   CDF +      HN S  CN 
Sbjct  206   KGIAIGNPLLELGMDTSATYDFFWSHGMISDETRGTITTHCDFSNL-----HNMSKVCND  260

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             A+ + +  +++Y+N YDV++DVCYPSIV+QELRL +  TK+SMG+DVCM  ER FYFNLP
Sbjct  261   ALKEAD-TINEYVNNYDVLLDVCYPSIVQQELRLKQMATKISMGVDVCMTYERKFYFNLP  319

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQ+ALHANRT LPY W  C+  SL+ Y  TD   +++P+LK+++Q+K P+WI+SGDQD+
Sbjct  320   EVQQALHANRTRLPYQWSMCS--SLVNYRDTDASISMLPILKRIIQNKTPVWIFSGDQDA  377

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA  +    T+PY  WFHK QVGGW TEYG LLTFATVRGAAHMVPY
Sbjct  378   VVPLLGSRTLVRELAHHLNFKTTLPYRPWFHKDQVGGWVTEYGKLLTFATVRGAAHMVPY  437

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPIDQ  1498
             AQP RALH+FSSF+ GRRLPN T    D+
Sbjct  438   AQPSRALHMFSSFVHGRRLPNNTHYSPDE  466



>ref|XP_008461496.1| PREDICTED: serine carboxypeptidase-like 42 isoform X2 [Cucumis 
melo]
Length=441

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/448 (68%), Positives = 349/448 (78%), Gaps = 34/448 (8%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLV+ LPGQP VSF+Q++GYVD+D K GRSLFYYFVEAE+   ++ PLTLWLNGGPG
Sbjct  27    PSEDLVLRLPGQPPVSFKQYAGYVDIDVKNGRSLFYYFVEAEEHPEKK-PLTLWLNGGPG  85

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+PSGDGRGL  N  SWNKASNLLFVESPAGVGWSYSNTSSDY CG
Sbjct  86    CSSIGGGAFTELGPFYPSGDGRGLRKNPMSWNKASNLLFVESPAGVGWSYSNTSSDYNCG  145

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D ST                               GHYIPQLA  ++DHN    G KFNI
Sbjct  146   DAST-------------------------------GHYIPQLAIALLDHNAKSSGFKFNI  174

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLLKLDRDVPA  E+ WSHG+ISDE    I +ECDF+DY+F  PHNES SCN 
Sbjct  175   KGVAIGNPLLKLDRDVPATYEYFWSHGMISDEIGITIMSECDFEDYTFASPHNESHSCNE  234

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI+  N+ V +YIN YDVI+DVCYPSIVEQELRL K  +K+S+G+DVCM  ER FYFNLP
Sbjct  235   AISMANQVVGNYINNYDVILDVCYPSIVEQELRLRKMASKISLGVDVCMTMERKFYFNLP  294

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRT LPY W  C+   ++ Y+ TDG+ N++PLLK++++ +IP+WI+SGDQDS
Sbjct  295   EVQKALHANRTKLPYRWSMCS--PVINYSDTDGNINILPLLKRIIELRIPVWIFSGDQDS  352

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA D+K  ITVPY  WFHKGQVGGW  EYGNLLTFATVRGAAHMVPY
Sbjct  353   VVPLLGSRTLVRELAHDLKFKITVPYGTWFHKGQVGGWVIEYGNLLTFATVRGAAHMVPY  412

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP RALHLFSSF+ GRRLPN+T   I+
Sbjct  413   AQPSRALHLFSSFVGGRRLPNSTRPSIE  440



>ref|XP_004515138.1| PREDICTED: serine carboxypeptidase-like 42-like [Cicer arietinum]
Length=470

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/449 (66%), Positives = 354/449 (79%), Gaps = 7/449 (2%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLVV LPGQP+V F Q++GYVD+D K G+SLFYYFVEA+   H++ PLTLWLNGGPG
Sbjct  29    PMEDLVVRLPGQPKVKFSQYAGYVDIDVKHGKSLFYYFVEADHHPHKK-PLTLWLNGGPG  87

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+PSGDGRGL  NSKSWN+ SNLLFVESPAGVGWSYSNT+SDY   
Sbjct  88    CSSIGGGAFTELGPFYPSGDGRGLRRNSKSWNRVSNLLFVESPAGVGWSYSNTTSDYDSD  147

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DM++FM KWYEKFP ++ R LFLTGESYAGHYIPQL + ++D+N H  G KFNI
Sbjct  148   DASTANDMVLFMLKWYEKFPSYVSRGLFLTGESYAGHYIPQLTTALLDYNTHSTGFKFNI  207

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+L+RD  A  E+ WSHG+ISDE   +I N+C+FD  S     N S SC  
Sbjct  208   KGVAIGNPLLELNRDTQATYEYFWSHGMISDEIGISIMNDCNFDTTS----ANLSKSCQN  263

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             A+ D    V  YI+ YDVI+DVCYPSI EQEL+L K  +K+S+ +D+CM SE  FY NL 
Sbjct  264   AMVDAQDIVGSYIDEYDVILDVCYPSIAEQELKLKKMASKISLSVDICMDSEIYFYLNLQ  323

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQK LHANRT L Y W  C+D  +L Y  TD D +++P+LK+++Q+ IP+ IYSGDQDS
Sbjct  324   EVQKCLHANRTKLSYPWSMCSD--VLNYKNTDHDISMLPVLKRIVQNHIPILIYSGDQDS  381

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSR++VR+LA D+K  IT PY  WFHKGQ GGW TEYGNLLTFATVRGA HMVPY
Sbjct  382   VVPLIGSRSLVRQLARDLKFNITDPYRVWFHKGQAGGWVTEYGNLLTFATVRGAGHMVPY  441

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPIDQ  1498
             AQP RALHLFSSF+ G+RLPNTT + + +
Sbjct  442   AQPSRALHLFSSFVGGKRLPNTTRLSVGE  470



>ref|XP_010110480.1| Serine carboxypeptidase-like 42 [Morus notabilis]
 gb|EXC26581.1| Serine carboxypeptidase-like 42 [Morus notabilis]
Length=442

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/470 (66%), Positives = 353/470 (75%), Gaps = 37/470 (8%)
 Frame = +2

Query  86    LVICFVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYF  265
             +V+ FV L L+       V  YP EDLVV LPGQP+VSF Q++GYVDVD  AGRSLFYYF
Sbjct  9     VVVGFVWLILV---NVNNVGAYPVEDLVVKLPGQPKVSFSQYAGYVDVDFNAGRSLFYYF  65

Query  266   VEAEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLL  445
             VEA+ + H++ PLTLWLNGGPGCSS+GGGAFTELGPF+P+GDGRGL  NS SWN+ASNLL
Sbjct  66    VEADNEPHKK-PLTLWLNGGPGCSSVGGGAFTELGPFYPTGDGRGLHRNSMSWNRASNLL  124

Query  446   FVESPAGVGWSYSNTSSDYTCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHY  625
             FVESPAGVGWSYSNT+SDY  GD + A DM  FM KW EKFP +  R LFLTGESYAGHY
Sbjct  125   FVESPAGVGWSYSNTTSDYNSGDAAAANDMREFMLKWLEKFPTYKSRDLFLTGESYAGHY  184

Query  626   IPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIR  805
             IPQLA  ++D+N+H  G KFN+KGVA+GNPLL+LDRD+PA  EF WSHG+ISDE    I 
Sbjct  185   IPQLAIALLDYNEHSTGFKFNLKGVAIGNPLLRLDRDIPASYEFFWSHGMISDELGLTIM  244

Query  806   NECDFDDYSFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAV  985
             NECDFDDYS   PHN ++SC  A  + N+ V DYI+ YDVI+DVCYPSIVEQELRL K  
Sbjct  245   NECDFDDYSLETPHNVTESCTNATTEANQIVGDYIDQYDVILDVCYPSIVEQELRLRKLA  304

Query  986   TKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVV  1165
             TK+S+G+DVCM  ER FYFNLPEVQ ALHANRT LPY W  C+                 
Sbjct  305   TKISLGVDVCMSYERRFYFNLPEVQHALHANRTKLPYPWSMCS-----------------  347

Query  1166  PLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGW  1345
                              GDQDSVVPL+GSRT++RELA ++K  ITVPY AWFHKGQVGGW
Sbjct  348   ----------------RGDQDSVVPLLGSRTLIRELAHELKFKITVPYGAWFHKGQVGGW  391

Query  1346  QTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNTTSIPID  1495
              TEYGNLLTFATVRGA+HMVP+AQP RALHLFSSF+ GRRLPN T   ID
Sbjct  392   ATEYGNLLTFATVRGASHMVPFAQPSRALHLFSSFVHGRRLPNNTRPSID  441



>ref|XP_010468548.1| PREDICTED: serine carboxypeptidase-like 43 [Camelina sativa]
Length=462

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/448 (66%), Positives = 355/448 (79%), Gaps = 9/448 (2%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PE+DLVV LPGQP+V FRQF+GY++VD + GRSLFYY+VEA K+   + PLTLWLNGGPG
Sbjct  23    PEDDLVVRLPGQPKVGFRQFAGYINVDSENGRSLFYYYVEAVKEPDTK-PLTLWLNGGPG  81

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P+GDGRGL INS SWNKASNLLFVESPAGVGWSYSN SSDY  G
Sbjct  82    CSSVGGGAFTELGPFYPTGDGRGLRINSMSWNKASNLLFVESPAGVGWSYSNRSSDYNTG  141

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DML+F+ +W+++FPE   R LFLTGESYAGHYIPQLA +++ +N    G KFNI
Sbjct  142   DKSTANDMLMFLLRWFKRFPELKSRNLFLTGESYAGHYIPQLADVILTYNSRSSGFKFNI  201

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KG+A+GNPLLKL RD PA  EF WSHG+ISDE    I ++CDF       P N S  C  
Sbjct  202   KGIAIGNPLLKLHRDYPAAYEFFWSHGMISDEVRLTIMSQCDFAS-----PQNMSKVCTD  256

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI +  R V++Y+N Y V++D+CYPSIV+QELRL K  TKM+MG+DVCM  ER+FYFNLP
Sbjct  257   AIIEA-RIVTEYVNYYHVLLDLCYPSIVQQELRLKKMATKMNMGVDVCMTYERSFYFNLP  315

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRT LPY+W  C++  LL Y+    + +++P+LKK++Q + P+WI+SGDQDS
Sbjct  316   EVQKALHANRTRLPYEWTMCSN--LLNYSGIYWNIDMLPILKKIVQSQTPVWIFSGDQDS  373

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             V+PL  SRT+VRELA D+    TVPY AWFHK Q+GGW TEYG+LLTF TVRGAAHMVPY
Sbjct  374   VIPLQSSRTLVRELAQDLNFKTTVPYGAWFHKEQIGGWFTEYGSLLTFVTVRGAAHMVPY  433

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             AQP RAL +FSSF+ GR+LPN   + ID
Sbjct  434   AQPSRALLMFSSFVSGRKLPNKPHLSID  461



>gb|AAD28662.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
Length=468

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/441 (66%), Positives = 352/441 (80%), Gaps = 9/441 (2%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLV  LPGQP V FRQF+GYVDVD + GRSLFYY+VEA K+   + PLTLWLNGGPG
Sbjct  27    PEEDLVARLPGQPNVGFRQFAGYVDVDSENGRSLFYYYVEAVKEPDTK-PLTLWLNGGPG  85

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P+GDGRGL +NS SWNKASNLLFVESPAGVGWSYSN SSDY  G
Sbjct  86    CSSVGGGAFTELGPFYPTGDGRGLRLNSMSWNKASNLLFVESPAGVGWSYSNRSSDYNTG  145

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D ST  DML+F+ +W+ KFPE   R LFLTGESYAGHYIPQLA +++ +N    G KFN+
Sbjct  146   DKSTVNDMLVFLLRWFNKFPELKSRDLFLTGESYAGHYIPQLADVILSYNSRSSGFKFNV  205

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KG+A+GNPLLKLDRD  A  E+ WSHG+ISDE    I N+CDF +     P N S++C  
Sbjct  206   KGIAIGNPLLKLDRDFAAAYEYFWSHGMISDEVRLTIMNQCDFAN-----PKNMSNACIY  260

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI + +  +++YIN Y +++DVCYPSIV+QELRL K VTK+SM +DVC+  ER+FYFNLP
Sbjct  261   AIVESS-VLTEYINSYHILLDVCYPSIVQQELRLKKMVTKISMVVDVCITYERSFYFNLP  319

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             +VQ ALHANRT LPY+W  C++   L Y+  DG  +++P LK+++Q++ P+WI+SGDQDS
Sbjct  320   KVQNALHANRTRLPYEWTMCSNR--LNYSGIDGYIDMLPSLKRIIQNQTPVWIFSGDQDS  377

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             V+PL  SRT+VRELA D+    T+PY AWFHK QVGGW TEYGNLLTFATVRGAAHMVPY
Sbjct  378   VIPLQSSRTLVRELAEDLNFKTTIPYGAWFHKEQVGGWVTEYGNLLTFATVRGAAHMVPY  437

Query  1412  AQPGRALHLFSSFIRGRRLPN  1474
             A+P RALH+FSSF+ GRRLPN
Sbjct  438   AEPSRALHMFSSFMNGRRLPN  458



>ref|XP_010664883.1| PREDICTED: serine carboxypeptidase-like 42 isoform X2 [Vitis 
vinifera]
Length=400

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/381 (73%), Positives = 317/381 (83%), Gaps = 2/381 (1%)
 Frame = +2

Query  353   AFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCGDISTAED  532
             AFTELGPFFPSGDGRGL  NSKSWNKASNLLFVESPAGVGWSYSNT+SDYTCGD STA D
Sbjct  21    AFTELGPFFPSGDGRGLRRNSKSWNKASNLLFVESPAGVGWSYSNTTSDYTCGDASTARD  80

Query  533   MLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKGVALGN  712
             M +FM KW EKFP F  R LFLTGESYAGHYIPQLA  ++D+N H  G KFN+KGVA+GN
Sbjct  81    MRVFMMKWLEKFPAFKSRALFLTGESYAGHYIPQLAVALLDYNSHSTGFKFNLKGVAIGN  140

Query  713   PLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNAAINDQNR  892
             PLL+LDRD  A  EF WSHG+ISDE    I  ECDFDDY +  PHN S SCN A+++ N 
Sbjct  141   PLLRLDRDSAATYEFFWSHGMISDEIGLTITKECDFDDYVYASPHNVSFSCNQALSEANS  200

Query  893   AvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPEVQKALH  1072
              V +YIN YDVI+DVCYP+IVEQELRL +  TKMS+GIDVCM  ER+FYFNLPEVQKALH
Sbjct  201   IVGEYINNYDVILDVCYPAIVEQELRLRRMATKMSVGIDVCMTYERSFYFNLPEVQKALH  260

Query  1073  ANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSVVPLVGS  1252
             ANRT L Y W  C+   +L Y++TDG+ +++PLLK+++Q+ IP+W++SGDQDSVVPL+GS
Sbjct  261   ANRTGLNYRWTMCS--GVLNYSETDGNIDILPLLKRIVQNSIPVWVFSGDQDSVVPLLGS  318

Query  1253  RTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYAQPGRAL  1432
             RT++RELA +MK  ITVP+ AWFHKGQVGGW TEYGNLLTFATVRGAAHMVPYAQP RAL
Sbjct  319   RTLIRELAQEMKFKITVPFGAWFHKGQVGGWATEYGNLLTFATVRGAAHMVPYAQPSRAL  378

Query  1433  HLFSSFIRGRRLPNTTSIPID  1495
             HLFSSF+RGRRLPNTT   ID
Sbjct  379   HLFSSFVRGRRLPNTTRPSID  399



>ref|XP_009112251.1| PREDICTED: serine carboxypeptidase-like 42 [Brassica rapa]
Length=469

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/449 (65%), Positives = 351/449 (78%), Gaps = 9/449 (2%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLVV LPGQP+V FRQ++GYVDVD +  RSLFYYFVEA+     + PLTLWLN GPG
Sbjct  30    PEEDLVVRLPGQPKVLFRQYAGYVDVDSETCRSLFYYFVEADTQPETK-PLTLWLNRGPG  88

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P+GD RGL INS SWNKASNLLFV+SPAGVGWSYSNTSSDY  G
Sbjct  89    CSSVGGGAFTELGPFYPTGDDRGLRINSMSWNKASNLLFVDSPAGVGWSYSNTSSDYNAG  148

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D +TA DML+F+ +W+ KFPE   R LFLTGESYAGHYIPQLA  +  +N+   G K N+
Sbjct  149   DETTASDMLVFLLRWFNKFPELKARHLFLTGESYAGHYIPQLADAIHSYNRQSSGFKINV  208

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KG+A+GNPLLKLD D  A  +F+WSHGIISDE  +AI  +CDF         N S  C  
Sbjct  209   KGIAIGNPLLKLDTDTSASYDFIWSHGIISDERRHAIIRQCDFTSLP-----NTSKECIE  263

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             A+ + + A + Y+NVYDV++DVC+PSI+EQELRL K  T+MSMG+DVCM  ER  YFNLP
Sbjct  264   ALTEVSLA-NIYVNVYDVLLDVCFPSIIEQELRLKKMATQMSMGVDVCMKHERQLYFNLP  322

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
              VQ ALHANRT LPY W  C+  +L+ Y+  DG+ N++P+LK+++Q+K  +WI+SGDQDS
Sbjct  323   AVQHALHANRTRLPYQWSMCS--TLVNYSGMDGNINMLPILKRIIQNKTSVWIFSGDQDS  380

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA D+    T+PY  WFHK QVGGW TEYG +LTFATVRGAAHMVPY
Sbjct  381   VVPLLGSRTLVRELAHDLNFSTTLPYGPWFHKNQVGGWVTEYGKILTFATVRGAAHMVPY  440

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPIDQ  1498
             AQP RALH+FSSF+RGRRLPN+T    D+
Sbjct  441   AQPSRALHIFSSFVRGRRLPNSTHYSPDE  469



>gb|KGN47484.1| hypothetical protein Csa_6G338160 [Cucumis sativus]
Length=806

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/417 (70%), Positives = 332/417 (80%), Gaps = 9/417 (2%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P +DLV  LPGQP V FRQF+GYVDVD  AGRSLFYYF EA++D H  LPLTLWLNG  G
Sbjct  35    PAQDLVDRLPGQPTVGFRQFAGYVDVDVNAGRSLFYYFAEAQQDPHL-LPLTLWLNGVGG  93

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
                    AFTELGPF+P GDGRGL  NS SWNKASNLLFVESPAGVGWSYSN +SDYTCG
Sbjct  94    G------AFTELGPFYPKGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNRTSDYTCG  147

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DML FM KWY+KFP F DR  FLTGESYAGHYIPQLA  ++D+N H K  KFNI
Sbjct  148   DDSTARDMLTFMLKWYDKFPAFKDRSFFLTGESYAGHYIPQLADAILDYNIHSKAFKFNI  207

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL LDRD  A  EF WSHG+ISDE + AI  +C+FDDY    PHN + SCN 
Sbjct  208   KGVAIGNPLLNLDRDAQATYEFFWSHGMISDEVWFAITRDCNFDDYVLTNPHNVTKSCNE  267

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI D N  V +YIN YDV++DVCYPSIVEQELRL K  TK+SMG+DVCM  ER FYFNLP
Sbjct  268   AIADANGIVGEYINNYDVLLDVCYPSIVEQELRLKKLATKISMGVDVCMTYERRFYFNLP  327

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRTNLPY+W  C+D   L YN  D + N++PLL++++++ IPLWIYSGD+DS
Sbjct  328   EVQKALHANRTNLPYEWSMCSD--TLDYNYDDTNINMLPLLQRIVRNHIPLWIYSGDEDS  385

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHM  1402
             VVPL+GSRT+VRELA D+K+ +TVPY AWFHKGQVGGW  EYGN LTFATVRGA+HM
Sbjct  386   VVPLLGSRTLVRELAHDLKLKVTVPYGAWFHKGQVGGWAIEYGNTLTFATVRGASHM  442



>ref|XP_006299245.1| hypothetical protein CARUB_v10015394mg [Capsella rubella]
 gb|EOA32143.1| hypothetical protein CARUB_v10015394mg [Capsella rubella]
Length=459

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/441 (65%), Positives = 355/441 (80%), Gaps = 9/441 (2%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PE+DLV  LPGQP+V FRQF+GYV+VD + GRSLFYY+VEA K+   + PLTLWLNGGPG
Sbjct  18    PEDDLVARLPGQPKVGFRQFAGYVNVDSENGRSLFYYYVEAVKEPETK-PLTLWLNGGPG  76

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P+GDGRGL +NS SWNKASNLLFVESPAGVGWSYSN SSDY  G
Sbjct  77    CSSVGGGAFTELGPFYPTGDGRGLRVNSMSWNKASNLLFVESPAGVGWSYSNRSSDYNTG  136

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DML+F+ +W+++FPE   R LFL GESYAGHYIPQLA +++ +N    G KFNI
Sbjct  137   DKSTANDMLVFLLRWFKRFPELKSRELFLMGESYAGHYIPQLAEVILAYNSRSSGFKFNI  196

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KG+A+GNPLLKLDRDV A  EF WS G+ISDE    I ++CDF +     P N S++C  
Sbjct  197   KGIAIGNPLLKLDRDVAAAYEFFWSRGMISDEVRLTIMSQCDFSN-----PKNMSNACID  251

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI + +  +++YIN Y V++D+CYPSIV+QELRL K  TKMSMG+DVC+  ER+ YFNLP
Sbjct  252   AIVESS-VLTEYINSYHVLLDICYPSIVQQELRLKKMATKMSMGVDVCITYERSLYFNLP  310

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQ+AL+ANRT LPY+W  C++   L Y+  DG  +++P+LK+++Q++ P+WI+SGDQDS
Sbjct  311   EVQRALNANRTRLPYEWTMCSNR--LNYSGIDGYIDMLPILKRIIQNQTPVWIFSGDQDS  368

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             V+PL  SRT+VRELA D+    TVPY+AWF+K QVGGW TEYGN+LTFATVRGAAHMV Y
Sbjct  369   VIPLQSSRTLVRELAHDLNFKTTVPYAAWFYKEQVGGWVTEYGNILTFATVRGAAHMVSY  428

Query  1412  AQPGRALHLFSSFIRGRRLPN  1474
             AQP R LH+FSSF+RG+RLPN
Sbjct  429   AQPSRGLHMFSSFVRGQRLPN  449



>ref|XP_009123167.1| PREDICTED: serine carboxypeptidase-like 42 [Brassica rapa]
Length=469

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/449 (64%), Positives = 352/449 (78%), Gaps = 9/449 (2%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEE+LVV LPGQP+V FRQ++GYV+VD K GRSLFYYFVEA      + PLTLWLNGGPG
Sbjct  30    PEEELVVRLPGQPKVLFRQYAGYVEVDSKTGRSLFYYFVEAATQPETK-PLTLWLNGGPG  88

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P+GDGRGL IN  SWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  89    CSSVGGGAFTELGPFYPTGDGRGLRINPMSWNKASNLLFVESPAGVGWSYSNTSSDYNTG  148

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D +TA+DML+F+ +W+ KFPE   R  FLTGESYAGHYIPQLA  ++ +N+   G K N+
Sbjct  149   DETTAKDMLVFLMRWFSKFPELKARDFFLTGESYAGHYIPQLADAILSYNRQSSGFKINV  208

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KG+A+GNPLLKL+ D  AV E++WSHGIISDE    I ++CDF++       N S++C  
Sbjct  209   KGIAIGNPLLKLNTDTSAVYEYLWSHGIISDELRLEIISQCDFNNIP-----NVSNACIK  263

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             A  +    VS +I+V DV+ D+CYPSIV+QELRL K  T MS+G+DVCM  ER FYFNLP
Sbjct  264   AATEAG-VVSQFIDVDDVLRDLCYPSIVQQELRLKKMATHMSIGVDVCMTYERKFYFNLP  322

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQ ALHANRT LPY+W  C+  +L+ Y+  D + +++PLLK+++Q+K P+WI+SGDQDS
Sbjct  323   EVQHALHANRTRLPYEWSMCS--TLVNYHGIDSNISMLPLLKRIIQNKTPVWIFSGDQDS  380

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             +VP +G+RT +RELA D+    T+PY  WFHK QVGGW TEYG LLTFATVRGAAHMVPY
Sbjct  381   IVPFLGTRTNIRELAHDLNFSTTLPYGHWFHKDQVGGWVTEYGKLLTFATVRGAAHMVPY  440

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPIDQ  1498
             AQP RALH+FS F+RGRRLPN T  P D+
Sbjct  441   AQPARALHMFSCFVRGRRLPNNTHYPHDE  469



>ref|XP_004173353.1| PREDICTED: serine carboxypeptidase-like 42-like, partial [Cucumis 
sativus]
Length=393

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/382 (72%), Positives = 312/382 (82%), Gaps = 2/382 (1%)
 Frame = +2

Query  353   AFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCGDISTAED  532
             AFTELGPF+P GDGRGL  NS SWNKASNLLFVESPAGVGWSYSN +SDYTCGD STA D
Sbjct  14    AFTELGPFYPKGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNRTSDYTCGDDSTARD  73

Query  533   MLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKGVALGN  712
             ML FM KWY+KFP F DR  FLTGESYAGHYIPQLA  ++D+N H K  KFNIKGVA+GN
Sbjct  74    MLTFMLKWYDKFPAFKDRSFFLTGESYAGHYIPQLADAILDYNIHSKAFKFNIKGVAIGN  133

Query  713   PLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNAAINDQNR  892
             PLL LDRD  A  EF WSHG+ISDE + AI  +C+FDDY    PHN + SCN AI D N 
Sbjct  134   PLLNLDRDAQATYEFFWSHGMISDEVWFAITRDCNFDDYVLTNPHNVTKSCNEAIADANG  193

Query  893   AvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPEVQKALH  1072
              V +YIN YDV++DVCYPSIVEQELRL K  TK+SMG+DVCM  ER FYFNLPEVQKALH
Sbjct  194   IVGEYINNYDVLLDVCYPSIVEQELRLKKLATKISMGVDVCMTYERRFYFNLPEVQKALH  253

Query  1073  ANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSVVPLVGS  1252
             ANRTNLPY+W  C+D   L YN  D + N++PLL++++++ IPLWIYSGD+DSVVPL+GS
Sbjct  254   ANRTNLPYEWSMCSD--TLDYNYDDTNINMLPLLQRIVRNHIPLWIYSGDEDSVVPLLGS  311

Query  1253  RTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYAQPGRAL  1432
             RT+VRELA D+K+ +TVPY AWFHKGQVGGW  EYGN LTFATVRGA+HMVP+AQP RAL
Sbjct  312   RTLVRELAHDLKLKVTVPYGAWFHKGQVGGWAIEYGNTLTFATVRGASHMVPFAQPSRAL  371

Query  1433  HLFSSFIRGRRLPNTTSIPIDQ  1498
             HLFSSF+RGRRLPN+T   ID 
Sbjct  372   HLFSSFVRGRRLPNSTRPSIDD  393



>ref|XP_006578942.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X2 [Glycine 
max]
Length=454

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/381 (72%), Positives = 316/381 (83%), Gaps = 2/381 (1%)
 Frame = +2

Query  353   AFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCGDISTAED  532
             AFTELGPF+P GDGRGL  NS SWN+ASNLLFVESPAGVGWSYSN +SDY  GD STA D
Sbjct  75    AFTELGPFYPKGDGRGLRRNSMSWNRASNLLFVESPAGVGWSYSNKTSDYNSGDSSTATD  134

Query  533   MLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKGVALGN  712
             ML+F++KWYEKFP +  R LFLTGESYAGHYIPQLA++++D+N H  G KFNIKGVA+GN
Sbjct  135   MLLFLRKWYEKFPSYRSRELFLTGESYAGHYIPQLANVLLDYNAHSTGFKFNIKGVAIGN  194

Query  713   PLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNAAINDQNR  892
             PLLKLDRD  A  E+ WSHG+ISDE   AI N+CDFDDY F   HN S SCN AIN+ N 
Sbjct  195   PLLKLDRDAQATYEYFWSHGMISDEIGLAITNDCDFDDYVFASTHNVSKSCNEAINEANE  254

Query  893   AvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPEVQKALH  1072
              V DYIN YDVI+DVCYPSIVEQELRL K  TK+S+G+DVCM  ER+FYFNLPEVQKALH
Sbjct  255   IVGDYINNYDVILDVCYPSIVEQELRLKKMATKISIGVDVCMTYERSFYFNLPEVQKALH  314

Query  1073  ANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSVVPLVGS  1252
             ANRTNLPY W  C+   +L Y+ TD + +++P+LKK++Q+ IP+W++SGDQDSVVPL+GS
Sbjct  315   ANRTNLPYQWSMCS--GVLNYSDTDPNIDILPVLKKIVQNHIPVWVFSGDQDSVVPLLGS  372

Query  1253  RTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYAQPGRAL  1432
             RT++RELA D+K  ITVPY AWFHKGQVGGW TEYGNLLTFATVRGAAHMVPYAQP RAL
Sbjct  373   RTLIRELAHDLKFKITVPYGAWFHKGQVGGWVTEYGNLLTFATVRGAAHMVPYAQPSRAL  432

Query  1433  HLFSSFIRGRRLPNTTSIPID  1495
             HLFSSF+  +RLPNTT   ID
Sbjct  433   HLFSSFVLRKRLPNTTHPSID  453



>emb|CDY23340.1| BnaA08g12060D [Brassica napus]
Length=469

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/449 (64%), Positives = 348/449 (78%), Gaps = 9/449 (2%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEE+LVV LPGQP+V FRQ++GYV+VD K GRSLFYYFVEA      + PLTLWLNGGPG
Sbjct  30    PEEELVVRLPGQPKVLFRQYAGYVEVDSKTGRSLFYYFVEAATQPETK-PLTLWLNGGPG  88

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P+GDGRGL IN  SWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  89    CSSVGGGAFTELGPFYPTGDGRGLRINPMSWNKASNLLFVESPAGVGWSYSNTSSDYNTG  148

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D +TA+DML+F+ +W+ KFPE   R  FLTGESYA HYIPQLA  ++ +N+   G K N+
Sbjct  149   DETTAKDMLVFLIRWFSKFPELKARDFFLTGESYARHYIPQLADAILSYNRESSGFKINV  208

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KG+A+GNPLLKL+ D  AV E++WSHGIISDE    I  +CDF++       N S++C  
Sbjct  209   KGIAIGNPLLKLNTDTSAVYEYLWSHGIISDELRQEIIRQCDFNNIP-----NLSNACIK  263

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             A  +    VS +I+V DV+ D+CYPSIV+QELRL K  T MS+G+DVCM  ER FYFNLP
Sbjct  264   AATEAG-VVSQFIDVDDVLRDLCYPSIVQQELRLKKMATHMSIGMDVCMTYERKFYFNLP  322

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQ ALHANRT LPY+W  C+  +L+ Y   D + +++PLLK+++Q+K P+WI+SGDQDS
Sbjct  323   EVQHALHANRTRLPYEWSMCS--TLVNYRGIDSNISMLPLLKRIIQNKTPVWIFSGDQDS  380

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             +VP +G+RT +RELA D+    T+PY  WFHK QVGGW TEYG LLTFATVRGAAH VPY
Sbjct  381   IVPFLGTRTNIRELAHDLNFSTTLPYGHWFHKDQVGGWVTEYGKLLTFATVRGAAHRVPY  440

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPIDQ  1498
             AQP RALH+FS F+RGRRLPN T  P D+
Sbjct  441   AQPARALHMFSCFVRGRRLPNNTHYPHDE  469



>gb|KEH35413.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=477

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/455 (65%), Positives = 352/455 (77%), Gaps = 9/455 (2%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P ED +V LPGQP+V F+Q++GY+D+D + GRSLFYYFVEA+ D H++ PLTLWLNGGPG
Sbjct  29    PIEDFIVKLPGQPKVEFKQYAGYIDIDVRHGRSLFYYFVEADHDPHKK-PLTLWLNGGPG  87

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYT-C  508
             CSSIGGGAFTELGPF+P+GDGRGL  N KSWN+ASNLLFVESPAGVGWSYSNT+SDY   
Sbjct  88    CSSIGGGAFTELGPFYPTGDGRGLRRNKKSWNRASNLLFVESPAGVGWSYSNTTSDYNNY  147

Query  509   GDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFK-GHKF  685
              D STA D L+FM KWYEKFP +  R LFLTGESYAGH+IPQLA+ ++D+N H   G KF
Sbjct  148   DDTSTANDTLLFMLKWYEKFPSYRSRGLFLTGESYAGHFIPQLANTILDYNAHHSTGFKF  207

Query  686   NIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSC  865
             NIKGVA+GNPLL+  RD  A  E+ WSHG+ISDE    I N+C+FD        N S SC
Sbjct  208   NIKGVAIGNPLLQFSRDTQATYEYYWSHGMISDEIGLTIMNDCNFDASY----DNLSKSC  263

Query  866   NAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFN  1045
               A+ D    VSDYI+ YDVI+DVCYPSI EQELRL +  TK+S+ +D+CM SE  FY N
Sbjct  264   KDAMVDAQDIVSDYIDNYDVILDVCYPSIAEQELRLKRMATKISLTVDICMDSEIYFYLN  323

Query  1046  LPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQ  1225
             LPEVQKALHANRTNLPY W  C+   +L YN  D D N++P+LK+++Q+ IP+W+YSGDQ
Sbjct  324   LPEVQKALHANRTNLPYPWSMCS--GVLNYNDADHDINILPVLKRIVQNHIPVWVYSGDQ  381

Query  1226  DSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMV  1405
             DS+VPL+GSR  +RELA D+   IT  Y  WFH+ QVGGW TEYGNLLTFATVRGA H+V
Sbjct  382   DSIVPLLGSRRHIRELAHDLNFNITDSYRVWFHRDQVGGWVTEYGNLLTFATVRGAGHIV  441

Query  1406  PYAQPGRALHLFSSFIRGRRLPNTTSIPIDQQQYY  1510
             PYAQP +ALHLFSSF+RGRRLP TT   I  +  Y
Sbjct  442   PYAQPSKALHLFSSFVRGRRLPKTTRPKIIDEITY  476



>ref|XP_004977165.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X2 [Setaria 
italica]
Length=445

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/444 (66%), Positives = 341/444 (77%), Gaps = 33/444 (7%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PE DLV GLPGQP V+FRQF+GYVDVDE+AGRSLFYY  EA+       PLTLWLNGGPG
Sbjct  31    PESDLVRGLPGQPPVAFRQFAGYVDVDERAGRSLFYYLAEADGAAAASKPLTLWLNGGPG  90

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P GDGRGL IN KSWNK SNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  91    CSSVGGGAFTELGPFYPRGDGRGLRINDKSWNKVSNLLFVESPAGVGWSYSNTSSDYKTG  150

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D  T                               GHYIPQL +++I HNK  KG KFNI
Sbjct  151   DART-------------------------------GHYIPQLTNVLISHNKESKGFKFNI  179

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLLKLDRD+ ++ E+ WSHG+ISDE   AI N CDF+DY+F  PHNES SCN 
Sbjct  180   KGVAIGNPLLKLDRDIASIYEYFWSHGMISDEVGLAITNACDFEDYTFSSPHNESQSCND  239

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI + N+ V DY+N YDV++DVCYPSIV QELRL K VTK+SMG+D+CM  ER FYFNLP
Sbjct  240   AIAEANKVVGDYVNNYDVLLDVCYPSIVMQELRLRKYVTKISMGVDICMSYERFFYFNLP  299

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQ+ALHANRT LPY W  C+  ++L Y+ TDG+ N++PLL+++++H IP+W++SGDQDS
Sbjct  300   EVQQALHANRTRLPYKWSMCS--AVLNYSDTDGNINILPLLQRIIEHNIPVWVFSGDQDS  357

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA DM + +TVPY AWFH  QV GW TEYG LLTFATVRGAAHMVP+
Sbjct  358   VVPLLGSRTLVRELAHDMGLDVTVPYRAWFHNDQVAGWVTEYGKLLTFATVRGAAHMVPF  417

Query  1412  AQPGRALHLFSSFIRGRRLPNTTS  1483
             AQP RAL LF  F+ G+RLPNTT+
Sbjct  418   AQPDRALGLFRWFVDGQRLPNTTN  441



>emb|CDY66139.1| BnaAnng21620D [Brassica napus]
Length=486

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/453 (62%), Positives = 332/453 (73%), Gaps = 19/453 (4%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLV  LPGQP+V FRQ++GYVDVD + GRSLFYYFVEA+     + PLTLWLNG   
Sbjct  30    PEEDLVARLPGQPKVLFRQYAGYVDVDFETGRSLFYYFVEADTHPETK-PLTLWLNGILI  88

Query  332   c--------ssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSN  487
                      SS+GGGAFTELGPF+P+GDGRGL INS SWNKASNLLFVESPAGVGWSYSN
Sbjct  89    KLYLAGPGCSSVGGGAFTELGPFYPTGDGRGLRINSMSWNKASNLLFVESPAGVGWSYSN  148

Query  488   TSSDYTCGDISTAE--DMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHN  661
             TSSDY  GD +T E  D +     W+ KFPE   R  FLTGESYAGHYIPQLA  +  +N
Sbjct  149   TSSDYNTGDETTGEIQDPIFNSFVWFSKFPELKARHFFLTGESYAGHYIPQLADAIHSYN  208

Query  662   KHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIY  841
             +   G K N+KG+A+GNPLLKLD D  A  EF+WSHG+ISDE+ +AI  +CDF       
Sbjct  209   RQSSGFKINVKGIAIGNPLLKLDTDTSAAYEFLWSHGLISDEHKHAIIRQCDFTSLP---  265

Query  842   PHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMG  1021
               N S +C  A+ + +           ++     PSI+EQELRL K  T++SMG+DVCM 
Sbjct  266   --NISKACIEALTEVSFVTKYVNVYDVLLDLCF-PSIIEQELRLKKMATQISMGVDVCMM  322

Query  1022  SERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIP  1201
              ER FYFNLPEVQ ALHANRT+LPY W  C+  +L+ Y+  DG+ N++P+LK+++Q+K  
Sbjct  323   HERQFYFNLPEVQHALHANRTHLPYQWSMCS--TLVNYSGIDGNINMLPILKRIIQNKTS  380

Query  1202  LWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFAT  1381
             +WI+SGDQDSVVPL+GSRT+VRELA D+    T+PY  WFHK QVGGW TEYG LLTFAT
Sbjct  381   VWIFSGDQDSVVPLLGSRTLVRELAHDLNFSTTLPYGPWFHKDQVGGWVTEYGKLLTFAT  440

Query  1382  VRGAAHMVPYAQPGRALHLFSSFIRGRRLPNTT  1480
             VRGAAHMVPYAQP RALHLFSSF+RGRRLPN T
Sbjct  441   VRGAAHMVPYAQPSRALHLFSSFVRGRRLPNNT  473



>emb|CAN74668.1| hypothetical protein VITISV_005686 [Vitis vinifera]
Length=480

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/454 (64%), Positives = 331/454 (73%), Gaps = 50/454 (11%)
 Frame = +2

Query  95    CFVCLSLLFCgggggvygy-PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVE  271
              FV + LL C   G      PEEDLVV LPGQP+V FRQF GYVDVDEKAGRSLFYYFVE
Sbjct  10    AFVGVVLLLCDVCGAANNGWPEEDLVVRLPGQPKVGFRQFGGYVDVDEKAGRSLFYYFVE  69

Query  272   AEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFV  451
             AE+D   + PLTLWLN                                      SNLLFV
Sbjct  70    AEEDPQNK-PLTLWLN------------------------------------GVSNLLFV  92

Query  452   ESPAGVGWSYSNTSSDYTCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIP  631
             ESPAGVGWSYSNTSSDY CGD STA DML FM KW++KFP +  RPLFLTGESYAGHYIP
Sbjct  93    ESPAGVGWSYSNTSSDYNCGDASTASDMLTFMLKWFKKFPGYKLRPLFLTGESYAGHYIP  152

Query  632   QLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNE  811
             QLA++++D+NK  K  KFNIKGVA+GNPLL+L RDVPAV EF WSHG+ISDE   AI N+
Sbjct  153   QLANVLLDYNKKSKDFKFNIKGVAIGNPLLQLARDVPAVYEFFWSHGMISDEVGLAIMND  212

Query  812   CDFD----------DYSFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQ  961
             C+F+          DY++   HN S  CN A+ND    V  YIN YDVI+DVCYPSIV+Q
Sbjct  213   CNFEDYTYSATHNVDYTYSATHNVSTECNTALNDAYSIVGSYINPYDVILDVCYPSIVQQ  272

Query  962   ELRLHKAVTKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQ  1141
             ELRL K VTK+S+G+DVCM +ERTFYFNLPEVQKALHANRTNLPY W TC++  +L YN+
Sbjct  273   ELRLRKVVTKISIGVDVCMTAERTFYFNLPEVQKALHANRTNLPYRWTTCSN--ILFYNE  330

Query  1142  TDGDANVVPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWF  1321
              D + +++PLLK++LQ KIP+WI+SGDQDSVVPL+GSRT+VRELA D+    TVPY AWF
Sbjct  331   GDSNLDMLPLLKRILQDKIPVWIFSGDQDSVVPLMGSRTLVRELAKDLNFQHTVPYGAWF  390

Query  1322  HKGQVGGWQTEYGNLLTFATVRGAAHMVPYAQPG  1423
             HKGQVGGWQTEYGNLLTFATVRGAAHMV  A  G
Sbjct  391   HKGQVGGWQTEYGNLLTFATVRGAAHMVTVASTG  424



>gb|KDO83614.1| hypothetical protein CISIN_1g0117641mg, partial [Citrus sinensis]
 gb|KDO83615.1| hypothetical protein CISIN_1g0117641mg, partial [Citrus sinensis]
Length=423

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/394 (71%), Positives = 325/394 (82%), Gaps = 3/394 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLVV LPGQP+V+FRQ++GYVDVD K GRSLFYYFVEAE + H + PLTLWLNGGPG
Sbjct  33    PAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEK-PLTLWLNGGPG  91

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P GDGRGL  NS SWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  92    CSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCG  151

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DM +FM  WYEKFPEF  R LFLTGESYAGHYIPQLA +++DHN H KG KFNI
Sbjct  152   DASTARDMHVFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLDHNAHSKGFKFNI  211

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+LD+DVPA+ EF WSHG+ISDE    I ++CDFDDY     HN ++SC  
Sbjct  212   KGVAIGNPLLRLDQDVPAIYEFFWSHGMISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIE  271

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI + N+ V DYIN YDVI+DVCYP+IVEQELRL K  TKMS+G+DVCM  ER FY NLP
Sbjct  272   AITEANKIVGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLP  331

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRTNLPY W  C+   +L Y+ TD + N++P+LK+++Q+ IP+W++SGDQDS
Sbjct  332   EVQKALHANRTNLPYGWSMCS--GVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDS  389

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQ  1333
             VVPL+GSRT++RELA D+   +TVPY AWFHK Q
Sbjct  390   VVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQ  423



>gb|ABK25236.1| unknown [Picea sitchensis]
Length=469

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/442 (62%), Positives = 347/442 (79%), Gaps = 4/442 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDL+  LPGQP+V+F+Q++GY+ VDE AGR+LFYYF EAE D   + P+ LWLNGGPG
Sbjct  29    PAEDLIDRLPGQPKVNFKQYAGYITVDEHAGRALFYYFAEAEDDSDSK-PVALWLNGGPG  87

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P  DG GL  N +SWNK SNLLFVESPAGVGWSYSNT+SDYTCG
Sbjct  88    CSSVGGGAFTELGPFYPRDDGHGLRKNLQSWNKVSNLLFVESPAGVGWSYSNTTSDYTCG  147

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA +ML+F+ KW+++FPE+  R LFLTGESYAGHYIPQLA+ ++++NK  K +KFN+
Sbjct  148   DESTARNMLVFLSKWFKRFPEYASRDLFLTGESYAGHYIPQLANKLLNYNKVAKRYKFNL  207

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDD-YSFIYPHNESDSCN  868
             KG+++GNPLL L+ D  A  EF+WSHG+ISDE+  AI   C FD     +   + S  C+
Sbjct  208   KGISIGNPLLSLNVDTAASYEFLWSHGLISDESNIAILKSCKFDKRIKNVDVIDISKECD  267

Query  869   AAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNL  1048
               +    + + DY+N YDVI+DVC PS++EQELRL K V+ MS+G+DVCM SER FYFNL
Sbjct  268   DILKQVEQEIGDYVNEYDVILDVCPPSLIEQELRLRKKVSHMSLGVDVCMTSERQFYFNL  327

Query  1049  PEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQD  1228
             P VQKALHANRTNLPYDW  C++  +L Y+  D   +++P+LK ++Q  I +WI+SGDQD
Sbjct  328   PNVQKALHANRTNLPYDWSMCSN--VLNYSGYDEGIDILPVLKDIIQQGIRVWIFSGDQD  385

Query  1229  SVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVP  1408
             SVVPL+GSRT VR LA D+KM + VPY AW+H+GQV GW T YG+LLTFATVRGA+HMVP
Sbjct  386   SVVPLMGSRTNVRNLANDLKMSVKVPYRAWYHEGQVAGWTTVYGDLLTFATVRGASHMVP  445

Query  1409  YAQPGRALHLFSSFIRGRRLPN  1474
             Y+QP RALHLF +F+ G+ LP+
Sbjct  446   YSQPARALHLFRTFLSGKDLPD  467



>gb|EAY80352.1| hypothetical protein OsI_35523 [Oryza sativa Indica Group]
Length=529

 Score =   531 bits (1369),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 264/381 (69%), Positives = 313/381 (82%), Gaps = 2/381 (1%)
 Frame = +2

Query  353   AFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCGDISTAED  532
             AFTELGPF+P GDGRGL +N KSWNK SNLLFVESPAGVGWSYSNTSSDY  GD  TA D
Sbjct  151   AFTELGPFYPRGDGRGLRLNKKSWNKVSNLLFVESPAGVGWSYSNTSSDYNTGDARTAND  210

Query  533   MLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKGVALGN  712
             M  F+  WY+KFPE+  R L L+GESYAGHYIPQL  +++ HN+   G KFNIKGVA+GN
Sbjct  211   MYKFLLGWYKKFPEYRSRGLLLSGESYAGHYIPQLTDVLLTHNEKSNGFKFNIKGVAIGN  270

Query  713   PLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNAAINDQNR  892
             PLLKLDRDVPA  E+ WSHG+ISDE + +I + CDF+DY+F  PHNES SCN AI + N 
Sbjct  271   PLLKLDRDVPATYEYFWSHGMISDEIFLSISHSCDFEDYTFSNPHNESKSCNDAIAEANS  330

Query  893   AvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPEVQKALH  1072
              V DY+N YDVI+DVCYPSIV QELRL K VTKMS+G+DVCM  ER FYFNLPEVQ+ALH
Sbjct  331   IVGDYVNNYDVILDVCYPSIVMQELRLRKYVTKMSIGVDVCMTYERYFYFNLPEVQQALH  390

Query  1073  ANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSVVPLVGS  1252
             ANRT+LPY W  C+D  +L Y+  DG+ N++PLL+++++HKIP+W++SGDQDSVVPL+GS
Sbjct  391   ANRTHLPYGWSMCSD--VLNYSNKDGNINILPLLQRIVEHKIPVWVFSGDQDSVVPLLGS  448

Query  1253  RTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYAQPGRAL  1432
             RT+VRELA DM + +TVPYS+WF +GQVGGW TEYGN+LTFATVRGA+HMVP+AQP RAL
Sbjct  449   RTLVRELAHDMGLHVTVPYSSWFRRGQVGGWVTEYGNILTFATVRGASHMVPFAQPDRAL  508

Query  1433  HLFSSFIRGRRLPNTTSIPID  1495
              LF SF  GRRLPNTT  PI+
Sbjct  509   GLFQSFALGRRLPNTTHPPIN  529


 Score = 80.9 bits (198),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +2

Query  152  PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLN  319
            PEEDLV  LPGQP V FRQF+GYVDVDEKAGRSLFYYF EA +    + PLTLWLN
Sbjct  21   PEEDLVARLPGQPVVGFRQFAGYVDVDEKAGRSLFYYFAEAAEGAAAK-PLTLWLN  75



>gb|EMT33269.1| Serine carboxypeptidase-like 42 [Aegilops tauschii]
Length=487

 Score =   530 bits (1364),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 298/499 (60%), Positives = 348/499 (70%), Gaps = 53/499 (11%)
 Frame = +2

Query  86    LVICFVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYF  265
             L +  VCL    C  G      PEEDLV  LPGQP V                 +L +Y 
Sbjct  10    LAVAMVCLVASSCVLGF-----PEEDLVGRLPGQPVVG----------------ALLHY-  47

Query  266   VEAEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLL  445
              +A+KD+         +   PGCSS+GGGAFTELGPF+P GDGRGL +N KSWNK SNLL
Sbjct  48    -DADKDLSTATTYGSVIANCPGCSSVGGGAFTELGPFYPRGDGRGLRLNKKSWNKVSNLL  106

Query  446   FVESPAGVGWSYSNTSSDYTCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHY  625
             FVESPAGVGWSYSNTSSDY  GD  TA DM  F+  WY+KFPE+    L L+GESYAGHY
Sbjct  107   FVESPAGVGWSYSNTSSDYNTGDARTANDMYKFLLGWYKKFPEYRSSSLLLSGESYAGHY  166

Query  626   IPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIR  805
             IPQL  +++ HN+  KG KFNIKGVA+GNPLLKLDRDVPA  E+ WSHG+ISDE + AI 
Sbjct  167   IPQLTDVLLTHNEKSKGFKFNIKGVAIGNPLLKLDRDVPATYEYFWSHGMISDEIFLAIN  226

Query  806   NECDFDDYSFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAV  985
               CDF+DY+F  PHNES SCN AI + N  V  Y+N YDVI+DVCYPSIV QELRL K V
Sbjct  227   KGCDFEDYTFGSPHNESKSCNDAIAEANSIVGQYVNNYDVILDVCYPSIVMQELRLRKYV  286

Query  986   TKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADY---------------  1120
             TK+S+G+DVCM  ER FYFNLPEVQ ALHANRT+LPY W  C+D                
Sbjct  287   TKISLGVDVCMSYERYFYFNLPEVQHALHANRTHLPYGWGMCSDNKYVKREESVRVNELL  346

Query  1121  ---------------SLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSVVPLVGSR  1255
                            S+L Y   DG+ N++PLL+++++HKIPLWI+SGDQDSVVPL+GSR
Sbjct  347   IFATQTHMDHLKSCPSVLNYTDKDGNINILPLLRRIVEHKIPLWIFSGDQDSVVPLLGSR  406

Query  1256  TIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYAQPGRALH  1435
             T+VRELA DM + +TVPYS WF KGQVGGW TEYGNLLTFATVRGA+HMVP+AQP RAL 
Sbjct  407   TLVRELAHDMGLPVTVPYSTWFRKGQVGGWTTEYGNLLTFATVRGASHMVPFAQPDRALG  466

Query  1436  LFSSFIRGRRLPNTTSIPI  1492
             LF SF+ G+RLPNTT  PI
Sbjct  467   LFRSFVLGQRLPNTTYPPI  485



>emb|CDX93108.1| BnaA03g38300D [Brassica napus]
Length=449

 Score =   528 bits (1359),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 281/449 (63%), Positives = 340/449 (76%), Gaps = 26/449 (6%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLVV LPGQP V FRQ++GYV+VD K GRSLFYYFVEA+K  + + PLTLWLNGGPG
Sbjct  27    PEEDLVVRLPGQPNVGFRQYAGYVNVDSKNGRSLFYYFVEADKQPNTK-PLTLWLNGGPG  85

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P+GDGRGL INS SWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  86    CSSVGGGAFTELGPFYPTGDGRGLRINSMSWNKASNLLFVESPAGVGWSYSNTSSDYNTG  145

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D +TA DM++F+ +W+ KFPE   R  FLTGESYAGHYIPQLA  ++ +N H  G+KFN+
Sbjct  146   DETTASDMVVFLLRWFNKFPELKSRDFFLTGESYAGHYIPQLADAILSYNIHSTGYKFNV  205

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KG+A+GNPLL+L  D  A  +F WSHG+ISDE    I   CDF +      HN S  CN 
Sbjct  206   KGIAIGNPLLELGMDTSATYDFFWSHGMISDETRGTITTHCDFSNL-----HNMSKVCND  260

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             A+ + +  +++Y+N YDV++DVCYPSIV+QELRL +  TK+SMG                
Sbjct  261   ALKEAD-TINEYVNNYDVLLDVCYPSIVQQELRLKQMATKISMG----------------  303

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
              VQ+ALHANRT LPY W  C+  SL+ Y  TD   +++P+LK+++Q+K P+WI+SGDQD+
Sbjct  304   -VQQALHANRTRLPYQWSMCS--SLVNYRDTDASISMLPILKRIIQNKTPVWIFSGDQDA  360

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA  +    T+PY  WFHK QVGGW TEYG LLTFATVRGAAHMVPY
Sbjct  361   VVPLLGSRTLVRELAHHLNFTTTLPYRPWFHKDQVGGWVTEYGKLLTFATVRGAAHMVPY  420

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPIDQ  1498
             AQP RALH+FSSF+ GRRLPN T    D+
Sbjct  421   AQPSRALHMFSSFVHGRRLPNNTHYSPDE  449



>emb|CDY70042.1| BnaCnng66490D [Brassica napus]
Length=449

 Score =   527 bits (1358),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 281/449 (63%), Positives = 340/449 (76%), Gaps = 26/449 (6%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLVV LPGQP+V FRQ++GYV+VD K GRSLFYYFVEA+K    + PLTLWLNGGPG
Sbjct  27    PEEDLVVRLPGQPKVGFRQYAGYVNVDSKNGRSLFYYFVEADKQPDTK-PLTLWLNGGPG  85

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P+GDGRGL INS SWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  86    CSSVGGGAFTELGPFYPTGDGRGLRINSMSWNKASNLLFVESPAGVGWSYSNTSSDYNTG  145

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D +TA DM++F+ +W++KFPE   R  FLTGESYAGHYIPQLA  ++ +N H  G+KFN+
Sbjct  146   DETTASDMVVFLLRWFDKFPELKSRDFFLTGESYAGHYIPQLADAILSYNIHSTGYKFNV  205

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KG+A+GNPLL+L RD  A  EF WSHG+ISDE    I   CDF +      HN S  C+ 
Sbjct  206   KGIAIGNPLLELGRDTSATYEFFWSHGMISDETRGTITTHCDFSNL-----HNLSQVCSD  260

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             A+ + +  ++ Y+N YDV++DVCYPSIV+QEL+L +  TK+SMG                
Sbjct  261   ALKEAD-TINGYVNNYDVLLDVCYPSIVQQELKLKQMATKISMG----------------  303

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
              VQ+ALHANRT LPY W  C+  SL+ Y  TD   N++P+LK+++Q+K P+WI+SGDQD+
Sbjct  304   -VQQALHANRTRLPYQWSMCS--SLVNYRDTDASINMLPILKRIIQNKTPVWIFSGDQDA  360

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA  +    T+PY  WFHK QVGGW TEYG LLTFATVRGAAHMVPY
Sbjct  361   VVPLLGSRTLVRELAHHLNFKTTLPYRPWFHKNQVGGWVTEYGKLLTFATVRGAAHMVPY  420

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPIDQ  1498
             AQP RALH+FSSF+ GRRL N T    D+
Sbjct  421   AQPSRALHMFSSFVHGRRLHNNTHYSPDE  449



>ref|XP_006434389.1| hypothetical protein CICLE_v10000998mg [Citrus clementina]
 gb|ESR47629.1| hypothetical protein CICLE_v10000998mg [Citrus clementina]
Length=424

 Score =   521 bits (1343),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 275/394 (70%), Positives = 321/394 (81%), Gaps = 3/394 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLVV LPGQP+V+FRQ++GYVDVD K GRSLFYYFVEAE + H + PLTLWLNGGPG
Sbjct  34    PAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEK-PLTLWLNGGPG  92

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P GDGRGL  NS SWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  93    CSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCG  152

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DM +FM  WYEKFPEF  R LFLTGESYAGHYIPQLA +++ HN H KG KFNI
Sbjct  153   DASTARDMHVFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLHHNAHSKGFKFNI  212

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+LD+DV A  EF WSHG+ISDE    I ++CDFDDY     HN ++SC  
Sbjct  213   KGVAIGNPLLRLDQDVSATYEFFWSHGMISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIE  272

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI + N+ V DYIN YDVI+DVCYP+IVEQELRL K  TKMS+G+DVCM  ER FY NLP
Sbjct  273   AITEANKIVGDYINNYDVILDVCYPAIVEQELRLRKMATKMSVGVDVCMTYERFFYLNLP  332

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRTNLPY W  C+   +L Y+  D + N++P+LK+++Q+ IP+W++SGDQDS
Sbjct  333   EVQKALHANRTNLPYGWSMCS--RVLNYSDADSNINILPVLKRIIQNGIPVWVFSGDQDS  390

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQ  1333
             VVPL+GSRT++RELA D+   +TVPY AWFHK Q
Sbjct  391   VVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQ  424



>gb|EMS56738.1| Serine carboxypeptidase-like 42 [Triticum urartu]
Length=433

 Score =   513 bits (1322),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 265/410 (65%), Positives = 308/410 (75%), Gaps = 30/410 (7%)
 Frame = +2

Query  353   AFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCGDISTAED  532
             AFTELGPF+P GDGRGL +N KSWNK SNLLFVESPAGVGWSYSNTSSDY  GD  TA D
Sbjct  22    AFTELGPFYPRGDGRGLRLNKKSWNKVSNLLFVESPAGVGWSYSNTSSDYNTGDARTAND  81

Query  533   MLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKGVALGN  712
             M  F+  WY+KFPE+    L L+GESYAGHYIPQL  +++ HN+  KG KFNIKGVA+GN
Sbjct  82    MYKFLLGWYKKFPEYRSSSLLLSGESYAGHYIPQLTDVLLTHNEKSKGFKFNIKGVAIGN  141

Query  713   PLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNAAINDQNR  892
             PLLKLDRDVPA  E+ WSHG+ISDE + AI   CDF+DY+F  PHNES SCN AI + N 
Sbjct  142   PLLKLDRDVPATYEYFWSHGMISDEIFLAINKGCDFEDYTFGSPHNESKSCNDAIAEANA  201

Query  893   AvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPEVQKALH  1072
              V  Y+N YDVI+DVCYPSIV QELRL K VTK+S+G+DVCM  ER FYFNLPEVQ ALH
Sbjct  202   VVGQYVNNYDVILDVCYPSIVMQELRLRKYVTKISLGVDVCMSYERYFYFNLPEVQHALH  261

Query  1073  ANRTNLPYDWKTCADY------------------------------SLLKYNQTDGDANV  1162
             ANRT+LPY W  C+D                               S+L Y   DG+ N+
Sbjct  262   ANRTHLPYGWGMCSDNKYVKREESVRVNELLIFATQTHMDHLKSCPSVLNYTDKDGNINI  321

Query  1163  VPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGG  1342
             +PLL+++++H IP+WI+SGDQDSVVPL+GSRT+VRELA DM + +TVPYS WF KGQVGG
Sbjct  322   LPLLQRIVEHNIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGLPVTVPYSTWFRKGQVGG  381

Query  1343  WQTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNTTSIPI  1492
             W TEYGNLLTFATVRGA+HMVP+AQP RAL LF SF+ G+RLPNTT  PI
Sbjct  382   WTTEYGNLLTFATVRGASHMVPFAQPDRALGLFRSFVLGQRLPNTTYPPI  431



>ref|XP_009107654.1| PREDICTED: serine carboxypeptidase-like 44 isoform X5 [Brassica 
rapa]
Length=396

 Score =   512 bits (1318),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 250/381 (66%), Positives = 308/381 (81%), Gaps = 3/381 (1%)
 Frame = +2

Query  353   AFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCGDISTAED  532
             AFTELGPF+P+GDGRGL  NSKSWNKASNLLFV+SPAGVGWSYSNT+SDYT GD STA+D
Sbjct  16    AFTELGPFYPAGDGRGLRRNSKSWNKASNLLFVDSPAGVGWSYSNTTSDYTTGDESTAKD  75

Query  533   MLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGH-KFNIKGVALG  709
             ML+F+ +W EKFPEF  R LFL GESYAGHYIPQLA +++++N       KF +KG+A+G
Sbjct  76    MLVFLLRWLEKFPEFRTRNLFLAGESYAGHYIPQLADVILEYNSRPSNRFKFKLKGIAIG  135

Query  710   NPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNAAINDQN  889
             NPLLKLDRDVPA  EF WSHG+ISDE    I N+C+FDDY+F   HN S  C AA+++  
Sbjct  136   NPLLKLDRDVPATYEFFWSHGMISDELGLTIMNQCNFDDYTFSSSHNISKPCEAAMSEAG  195

Query  890   RAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPEVQKAL  1069
               ++ Y+N YDV++D+CYP++VEQELRL K  TK+S+G+DVCM  E   Y +LPEVQ+AL
Sbjct  196   TIITQYVNYYDVLLDICYPTLVEQELRLKKMGTKISVGVDVCMSYEEQLYLSLPEVQQAL  255

Query  1070  HANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSVVPLVG  1249
             HANRTNLPY W  C+   LL Y+ TDG+ N++P+LK++L  KIP+W++SGD+DSV+PL+G
Sbjct  256   HANRTNLPYSWSMCS--GLLNYSDTDGNMNILPILKRILTRKIPIWVFSGDEDSVIPLLG  313

Query  1250  SRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYAQPGRA  1429
             SRT+V+ELA D+    TVPY AWFHKGQVGGW  EYG++LTFATVRGAAHMVPYAQP RA
Sbjct  314   SRTLVKELAEDLNFHTTVPYGAWFHKGQVGGWVIEYGDILTFATVRGAAHMVPYAQPSRA  373

Query  1430  LHLFSSFIRGRRLPNTTSIPI  1492
             LHLFSSF+ GRRLPN +  P+
Sbjct  374   LHLFSSFVLGRRLPNKSPPPL  394



>ref|NP_178937.2| serine carboxypeptidase-like 43 [Arabidopsis thaliana]
 sp|Q84W27.1|SCP43_ARATH RecName: Full=Serine carboxypeptidase-like 43; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAO42304.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AEC06202.1| serine carboxypeptidase-like 43 [Arabidopsis thaliana]
Length=442

 Score =   506 bits (1303),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 273/441 (62%), Positives = 329/441 (75%), Gaps = 35/441 (8%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLV  LPGQP V FRQF+GYVDVD + GRSLFYY+VEA K+   + PLTLWLNGGPG
Sbjct  27    PEEDLVARLPGQPNVGFRQFAGYVDVDSENGRSLFYYYVEAVKEPDTK-PLTLWLNGGPG  85

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P+GDGRGL +NS SWNKASNLLFVESPAGVGWSYSN SSDY  G
Sbjct  86    CSSVGGGAFTELGPFYPTGDGRGLRLNSMSWNKASNLLFVESPAGVGWSYSNRSSDYNTG  145

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D ST  DML+F+ +W+ KFPE   R LFLTGESYAGHYIPQLA +++ +N    G KFN+
Sbjct  146   DKSTVNDMLVFLLRWFNKFPELKSRDLFLTGESYAGHYIPQLADVILSYNSRSSGFKFNV  205

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KG+A+GNPLLKLDRD  A  E+ WSHG+ISDE    I N+CDF +     P N S++C  
Sbjct  206   KGIAIGNPLLKLDRDFAAAYEYFWSHGMISDEVRLTIMNQCDFAN-----PKNMSNACIY  260

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI + +  +++YIN Y +++DVCYPSIV+QELRL K                        
Sbjct  261   AIVESS-VLTEYINSYHILLDVCYPSIVQQELRLKK------------------------  295

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
                 ALHANRT LPY+W  C++   L Y+  DG  +++P LK+++Q++ P+WI+SGDQDS
Sbjct  296   --MNALHANRTRLPYEWTMCSNR--LNYSGIDGYIDMLPSLKRIIQNQTPVWIFSGDQDS  351

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             V+PL  SRT+VRELA D+    T+PY AWFHK QVGGW TEYGNLLTFATVRGAAHMVPY
Sbjct  352   VIPLQSSRTLVRELAEDLNFKTTIPYGAWFHKEQVGGWVTEYGNLLTFATVRGAAHMVPY  411

Query  1412  AQPGRALHLFSSFIRGRRLPN  1474
             A+P RALH+FSSF+ GRRLPN
Sbjct  412   AEPSRALHMFSSFMNGRRLPN  432



>gb|KDO83613.1| hypothetical protein CISIN_1g0117641mg, partial [Citrus sinensis]
Length=394

 Score =   503 bits (1295),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 256/394 (65%), Positives = 300/394 (76%), Gaps = 32/394 (8%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLVV LPGQP+V+FRQ++GYVDVD K GRSLFYYFVEAE + H + PLTLWLNGGPG
Sbjct  33    PAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEK-PLTLWLNGGPG  91

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P GDGRGL  NS SWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  92    CSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCG  151

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DM +FM  WYEKFPEF  R LFLTGESYAGHYIPQLA +++DHN H KG KFNI
Sbjct  152   DASTARDMHVFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLDHNAHSKGFKFNI  211

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+LD+DVPA+ EF WSHG+ISDE    I ++CDFDDY     HN ++SC  
Sbjct  212   KGVAIGNPLLRLDQDVPAIYEFFWSHGMISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIE  271

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI + N                             K  TKMS+G+DVCM  ER FY NLP
Sbjct  272   AITEAN-----------------------------KIATKMSVGVDVCMTLERFFYLNLP  302

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRTNLPY W  C+   +L Y+ TD + N++P+LK+++Q+ IP+W++SGDQDS
Sbjct  303   EVQKALHANRTNLPYGWSMCS--GVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDS  360

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQ  1333
             VVPL+GSRT++RELA D+   +TVPY AWFHK Q
Sbjct  361   VVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQ  394



>ref|NP_001031351.1| serine carboxypeptidase-like 43 [Arabidopsis thaliana]
 gb|AEC06203.1| serine carboxypeptidase-like 43 [Arabidopsis thaliana]
Length=443

 Score =   501 bits (1291),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 273/442 (62%), Positives = 329/442 (74%), Gaps = 36/442 (8%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLV  LPGQP V FRQF+GYVDVD + GRSLFYY+VEA K+   + PLTLWLNGGPG
Sbjct  27    PEEDLVARLPGQPNVGFRQFAGYVDVDSENGRSLFYYYVEAVKEPDTK-PLTLWLNGGPG  85

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P+GDGRGL +NS SWNKASNLLFVESPAGVGWSYSN SSDY  G
Sbjct  86    CSSVGGGAFTELGPFYPTGDGRGLRLNSMSWNKASNLLFVESPAGVGWSYSNRSSDYNTG  145

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D ST  DML+F+ +W+ KFPE   R LFLTGESYAGHYIPQLA +++ +N    G KFN+
Sbjct  146   DKSTVNDMLVFLLRWFNKFPELKSRDLFLTGESYAGHYIPQLADVILSYNSRSSGFKFNV  205

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KG+A+GNPLLKLDRD  A  E+ WSHG+ISDE    I N+CDF +     P N S++C  
Sbjct  206   KGIAIGNPLLKLDRDFAAAYEYFWSHGMISDEVRLTIMNQCDFAN-----PKNMSNACIY  260

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI + +  +++YIN Y +++DVCYPSIV+QELRL K                        
Sbjct  261   AIVESS-VLTEYINSYHILLDVCYPSIVQQELRLKK------------------------  295

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
                 ALHANRT LPY+W  C++   L Y+  DG  +++P LK+++Q++ P+WI+SGDQDS
Sbjct  296   --MNALHANRTRLPYEWTMCSNR--LNYSGIDGYIDMLPSLKRIIQNQTPVWIFSGDQDS  351

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQ-VGGWQTEYGNLLTFATVRGAAHMVP  1408
             V+PL  SRT+VRELA D+    T+PY AWFHK Q VGGW TEYGNLLTFATVRGAAHMVP
Sbjct  352   VIPLQSSRTLVRELAEDLNFKTTIPYGAWFHKEQVVGGWVTEYGNLLTFATVRGAAHMVP  411

Query  1409  YAQPGRALHLFSSFIRGRRLPN  1474
             YA+P RALH+FSSF+ GRRLPN
Sbjct  412   YAEPSRALHMFSSFMNGRRLPN  433



>ref|XP_010463193.1| PREDICTED: serine carboxypeptidase-like 44 [Camelina sativa]
Length=422

 Score =   498 bits (1283),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 270/443 (61%), Positives = 325/443 (73%), Gaps = 59/443 (13%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLV  LPGQPEV+FRQF+GYVD+D KAGRSLFYYFVEAEK  H + PLTLWLNGGPG
Sbjct  33    PEEDLVTKLPGQPEVAFRQFAGYVDIDVKAGRSLFYYFVEAEKQPHTK-PLTLWLNGGPG  91

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P+G+GRGL  N KSWNKASNLLFV+SPAGVGWSYSNT+SDYT  
Sbjct  92    CSSIGGGAFTELGPFYPTGNGRGLRRNPKSWNKASNLLFVDSPAGVGWSYSNTTSDYT--  149

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
                T ++  +F++                                               
Sbjct  150   ---TGDETTVFIQ-----------------------------------------------  159

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
                 +GNPLLKLDRDVPA+ EF WSHG+ISDE    I N+CDF+DYSF   HN S SC A
Sbjct  160   ----IGNPLLKLDRDVPAIYEFFWSHGMISDELGLTIMNQCDFEDYSFSSTHNISKSCEA  215

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             A+N+    ++ Y+N YD+++D+CYPS+VEQELRL K  TKMS G+DVCM  E   Y  LP
Sbjct  216   AMNEAGTIITQYVNYYDILLDICYPSLVEQELRLKKMGTKMSFGVDVCMSYEEQLYLILP  275

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQKALHANRT LPY+W  C+  SLL YN  DG+ N++P+LK++++ K+P+W++SGD+DS
Sbjct  276   EVQKALHANRTQLPYEWSMCS--SLLNYNYNDGNTNILPILKRIVKSKVPVWVFSGDEDS  333

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             V+PL+GSRT+VRELA D+ +  TVPY+AWFHKGQVGGW  EYGNLLTFATVRGAAHMVPY
Sbjct  334   VIPLLGSRTLVRELADDLYLNTTVPYAAWFHKGQVGGWVIEYGNLLTFATVRGAAHMVPY  393

Query  1412  AQPGRALHLFSSFIRGRRLPNTT  1480
             AQP RALHLF+SF+ GRRLP+ +
Sbjct  394   AQPSRALHLFTSFVLGRRLPHKS  416



>ref|XP_002885858.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62117.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=451

 Score =   496 bits (1277),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 271/441 (61%), Positives = 329/441 (75%), Gaps = 35/441 (8%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEED+VV LPGQP+V FRQF+GYVDVD + GRSLFYY+VEA K+   + PLTLWLNGGPG
Sbjct  36    PEEDMVVRLPGQPKVGFRQFAGYVDVDSENGRSLFYYYVEAVKEPDTK-PLTLWLNGGPG  94

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGG FT+LGPF+P+GDGRGL +NS SWNKASNLLFVESPA VGWSYSN SS+Y  G
Sbjct  95    CSSVGGGDFTKLGPFYPTGDGRGLRLNSMSWNKASNLLFVESPAVVGWSYSNRSSNYNTG  154

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DML+F+ +W+ KF E   R LFLTGESYAGHYIPQLA +++ +N    G KFN+
Sbjct  155   DKSTANDMLVFLLRWFNKFQELKSRDLFLTGESYAGHYIPQLADVILSYNSRSNGFKFNV  214

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KG+A+GNPLLKLDRDV A  E+ WSHG+ISDE    I N+CDF +     P N S++C  
Sbjct  215   KGIAIGNPLLKLDRDVAAAYEYFWSHGMISDEVRLTIMNQCDFAN-----PKNMSNACIH  269

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI D +  +++YIN Y V++DVCYPSIV+QELRL K                        
Sbjct  270   AIVDSS-VLTEYINSYHVLLDVCYPSIVQQELRLKK------------------------  304

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
                 ALHANRT LPY+W  C++   L Y+  DG  +++P+LK+++Q++ P+WI+SGDQDS
Sbjct  305   --MNALHANRTRLPYEWTMCSN--RLNYSGIDGYIDMLPILKRIIQNQTPVWIFSGDQDS  360

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             V+PL  SRT VRELA D+    TVPY AWFHK QVGGW TEYGNLLTFATVRGAAHMV Y
Sbjct  361   VIPLQSSRTRVRELAQDLNFKTTVPYGAWFHKEQVGGWVTEYGNLLTFATVRGAAHMVAY  420

Query  1412  AQPGRALHLFSSFIRGRRLPN  1474
             A+P RALH+FS+F+ GRRLPN
Sbjct  421   AEPSRALHMFSTFVTGRRLPN  441



>emb|CDX81435.1| BnaC09g08460D [Brassica napus]
Length=413

 Score =   483 bits (1244),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 258/448 (58%), Positives = 312/448 (70%), Gaps = 46/448 (10%)
 Frame = +2

Query  155   EEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgc  334
             EEDLVV LPGQP+V FRQ++ YVDVD + GRSLFYYFVEA+     + PLTLWLNGGPGC
Sbjct  12    EEDLVVRLPGQPKVLFRQYAVYVDVDSETGRSLFYYFVEADSQPETK-PLTLWLNGGPGC  70

Query  335   ssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCGD  514
             SS+GGGAFTELGPF+P+GDG GL INS SWNKASNLLFV+SPAGVG             D
Sbjct  71    SSVGGGAFTELGPFYPTGDGHGLRINSMSWNKASNLLFVDSPAGVG-------------D  117

Query  515   ISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIK  694
              +TA DML+F+ +W+ KFP    R LFLTGESYAGHYIPQLA  +  +N+   G K N+K
Sbjct  118   ETTASDMLVFLLRWFNKFPALKARHLFLTGESYAGHYIPQLADAIHSYNRQSSGFKINVK  177

Query  695   GVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNAA  874
             G+A+GNPLLKLD D  A  +F+W HGIISDE  +AI  +CDF         N S  C  A
Sbjct  178   GIAIGNPLLKLDTDTSASYDFLWYHGIISDERRHAIIRQCDFTSLP-----NISKECIEA  232

Query  875   INDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPE  1054
             + + + A                         ++  V  MSMG+DVCM  ER  YFNLP 
Sbjct  233   LTEVSLA------------------------NMYVNVYDMSMGVDVCMKHERQLYFNLPA  268

Query  1055  VQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSV  1234
             VQ ALH NRT+LPY W  C+  +L+ Y+  DG+ N++P+LK+++Q+K  +WI SGDQDSV
Sbjct  269   VQHALHVNRTSLPYQWSMCS--TLVNYSGIDGNINMLPILKRIIQNKTYVWISSGDQDSV  326

Query  1235  VPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYA  1414
             VPL+GSRT+VRELA D+    T+PY  WFHK QVGGW TEYG +LTFATVRGAAHMVPYA
Sbjct  327   VPLLGSRTLVRELAHDLNFSTTLPYGPWFHKNQVGGWVTEYGKILTFATVRGAAHMVPYA  386

Query  1415  QPGRALHLFSSFIRGRRLPNTTSIPIDQ  1498
              P RALH+FSSF+RGRRLPN+T    D+
Sbjct  387   -PSRALHIFSSFVRGRRLPNSTHYSPDE  413



>emb|CDY51660.1| BnaC03g66990D [Brassica napus]
Length=441

 Score =   483 bits (1243),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 271/451 (60%), Positives = 329/451 (73%), Gaps = 31/451 (7%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEE+LVV LPGQP+V FRQ++GYV+VD K GRSLFYYFVEA      + PLTLWLNGGPG
Sbjct  20    PEEELVVRLPGQPKVLFRQYAGYVEVDSKTGRSLFYYFVEAATQPETK-PLTLWLNGGPG  78

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P+GDGRGL INS SWNKASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  79    CSSVGGGAFTELGPFYPTGDGRGLRINSMSWNKASNLLFVESPAGVGWSYSNTSSDYNTG  138

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D +TA+DML+F+ +W+ KFPE   R  FLTGESYAGHYIPQLA  ++ +N+   G K N+
Sbjct  139   DETTAKDMLVFLMRWFSKFPELKSRDFFLTGESYAGHYIPQLADAILSYNRQSSGFKINV  198

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KG+A+GNPLLKL+ D  AV E++WSHGIISDE    I   CDF++       N S++C  
Sbjct  199   KGIAIGNPLLKLNTDTSAVYEYLWSHGIISDELRLEIIRRCDFNNIP-----NVSNACIK  253

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSER--TFYFN  1045
             A  +    VS +I+VYDV+ D+CYPSIV+QE RL K  T MS+G  V   S R  T +F 
Sbjct  254   ATTEAG-VVSQFIDVYDVLRDLCYPSIVQQEPRLKKMATHMSIG-KVLFQSPRGPTRFFC  311

Query  1046  LPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQ  1225
             L                    C  +SL+ Y+  D +  ++PLLK+++Q+K P+WI+SGDQ
Sbjct  312   L-------------------LC--HSLVNYHGIDSNITMLPLLKRIIQNKTPVWIFSGDQ  350

Query  1226  DSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMV  1405
             DS+VP +G+RT +RELA D+    T+PY  WFHK QVGGW TEYG LLTFATVRGAAHMV
Sbjct  351   DSIVPFLGTRTNIRELAHDLNFSTTLPYGHWFHKDQVGGWVTEYGKLLTFATVRGAAHMV  410

Query  1406  PYAQPGRALHLFSSFIRGRRLPNTTSIPIDQ  1498
             PYAQP RALH+FS F+RGRRLPN T  P D+
Sbjct  411   PYAQPARALHMFSFFVRGRRLPNNTHYPHDE  441



>ref|XP_004139740.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At3g09040, mitochondrial-like [Cucumis sativus]
Length=1441

 Score =   508 bits (1307),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 279/447 (62%), Positives = 327/447 (73%), Gaps = 57/447 (13%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLV+ LPGQP VSF+Q++GYVD+D K GRSLFYYFVEAE+   ++ PLTLWLNGGPG
Sbjct  1050  PSEDLVLRLPGQPPVSFKQYAGYVDIDLKNGRSLFYYFVEAEEQPEKK-PLTLWLNGGPG  1108

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+PSGDGRGL  N  SWNKASNLLFVESPAGVGWSYSNTSSDY CG
Sbjct  1109  CSSIGGGAFTELGPFYPSGDGRGLRKNPMSWNKASNLLFVESPAGVGWSYSNTSSDYNCG  1168

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D ST                               GHYIPQLA  ++DHN    G KFNI
Sbjct  1169  DAST-------------------------------GHYIPQLAIALLDHNAKSSGFKFNI  1197

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+ N  + +                        I +ECDF+DY+F  PHNES SCN 
Sbjct  1198  KGVAVRNNEIGI-----------------------TIMSECDFEDYTFASPHNESHSCNE  1234

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI+  N+ V +YIN YDVI+DVCYPSIVEQELRL K  +K+S+G+DVCM  ER FYFNL 
Sbjct  1235  AISIANQVVGNYINNYDVILDVCYPSIVEQELRLRKMASKISLGVDVCMTMERKFYFNLQ  1294

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             EVQ+ALHANRT LPY W  C+  S++ Y+ TDG+ N++PL++++++ +IP+W++SGDQDS
Sbjct  1295  EVQEALHANRTKLPYRWSMCS--SMINYSDTDGNINILPLIRRIIEFQIPVWVFSGDQDS  1352

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             VVPL+GSRT+VRELA D+K  ITVPY  WFHKGQVGGW  EYGNLLTFATVRGAAHMVPY
Sbjct  1353  VVPLLGSRTLVRELAHDLKFKITVPYGTWFHKGQVGGWVIEYGNLLTFATVRGAAHMVPY  1412

Query  1412  AQPGRALHLFSSFIRGRRLPNTTSIPI  1492
             AQP RALHLFSSF+ GRRLPN+T   I
Sbjct  1413  AQPSRALHLFSSFVGGRRLPNSTRPSI  1439



>emb|CDY37202.1| BnaA09g08230D [Brassica napus]
Length=456

 Score =   477 bits (1228),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 270/452 (60%), Positives = 326/452 (72%), Gaps = 28/452 (6%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PEEDLVV LPGQP+V FRQ++GYVDVD +  RSLFYYFVEA+     + PLTLWLN GPG
Sbjct  30    PEEDLVVRLPGQPKVLFRQYAGYVDVDSETCRSLFYYFVEADTQPETK-PLTLWLNRGPG  88

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P+GD RGL INS SWNKASNLLFV+SPAGVGWSYSNTSSDY  G
Sbjct  89    CSSVGGGAFTELGPFYPTGDDRGLRINSMSWNKASNLLFVDSPAGVGWSYSNTSSDYNTG  148

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D +TA DML+F+ +W+ KFPE   R LFLTGESYAGHYIPQLA  +  +N+   G K N+
Sbjct  149   DETTASDMLVFLLRWFNKFPELKARHLFLTGESYAGHYIPQLADAIHSYNRQSSGFKINV  208

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KG+A+GNPLLKLD D  A  +F+WSHGIISDE  +AI  +CDF         N S  C  
Sbjct  209   KGIAIGNPLLKLDTDTSASYDFIWSHGIISDERRHAIIRQCDFTSLP-----NISKECIE  263

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             A+ + + A + Y+NVYDV++DVC+PSI+EQELRL K  T+MSMG+DV       F F  P
Sbjct  264   ALTEVSLA-NIYVNVYDVLLDVCFPSIIEQELRLKKMATQMSMGVDV-------FIFQSP  315

Query  1052  E--VQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLL-KKLLQHKIPLWIYSGD  1222
                 + +   + + LP           + Y Q  G         K+++Q+K  +WI+SGD
Sbjct  316   SGATRSSREPHSSTLP-----------MVYVQHPGKLQWHGREHKRIIQNKTSVWIFSGD  364

Query  1223  QDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHM  1402
             QDSVVPL+GSRT+VRELA D+    T+PY  WFHK QVGGW TEYG +LTFATVRGAAHM
Sbjct  365   QDSVVPLLGSRTLVRELAHDLNFSTTLPYGPWFHKNQVGGWVTEYGKILTFATVRGAAHM  424

Query  1403  VPYAQPGRALHLFSSFIRGRRLPNTTSIPIDQ  1498
             VPYAQP RALH+FSSF+RGRRLPN+T    D+
Sbjct  425   VPYAQPSRALHIFSSFVRGRRLPNSTHYSPDE  456



>ref|XP_002967656.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ31003.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=464

 Score =   473 bits (1217),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 253/442 (57%), Positives = 317/442 (72%), Gaps = 6/442 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PE +LV  LPGQP VSF+Q++GYV VD+ AGR+LFYYF EAE     + PLTLWLNGGPG
Sbjct  23    PESELVSRLPGQPHVSFKQYAGYVTVDKNAGRALFYYFAEAETRASSQ-PLTLWLNGGPG  81

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDY-TC  508
             CSSIGGGAFTELGPF+P+  G+GL++N ++WNK SN+LF+E+PAGVGWSYSN SSDY   
Sbjct  82    CSSIGGGAFTELGPFYPNASGQGLLVNRRAWNKVSNMLFLEAPAGVGWSYSNKSSDYEQV  141

Query  509   GDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFN  688
              D  TA D L F+  W +KFPE+  R  ++TGESYAGHY+PQLA L+I H++    + F 
Sbjct  142   TDRITAVDTLNFLLGWMDKFPEYQTRDFYITGESYAGHYVPQLAELIIKHSQVPGNYAFR  201

Query  689   IKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSF-IYPHNESDSC  865
             +KGVA+GNPLL L  D  A+ E+ WSHG+ISDE + A+ N C F+DY   +  HN S++C
Sbjct  202   LKGVAIGNPLLNLAVDTSAMYEYFWSHGLISDETFQALSNSCKFEDYELGLADHNVSNAC  261

Query  866   NAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFN  1045
             N  I   N  V  +IN YDVI+DVC PSI  QE+RL + + + S G+D+C+  ER  YFN
Sbjct  262   NDGILQSNTEVGRFINNYDVILDVCLPSIFLQEVRLKQQMAQKSYGVDICIDKERDVYFN  321

Query  1046  LPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQ  1225
             LPEVQ+ LHAN T LPY W  C     + Y   DG  N+VPLL  +L+  + +WI+SGDQ
Sbjct  322   LPEVQRELHANTTGLPYSWSMCT--GPVDYAMQDGSTNMVPLLGDILKAGLRVWIFSGDQ  379

Query  1226  DSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMV  1405
             DSVVPL G+R+++  LA  + M  T PY+AW+  GQV GW   YGN LT+AT+RGAAHMV
Sbjct  380   DSVVPLTGTRSLIGGLAKSLGMQTTQPYTAWYQGGQVAGWTQSYGN-LTYATIRGAAHMV  438

Query  1406  PYAQPGRALHLFSSFIRGRRLP  1471
             PYAQP RAL LF SFIRG  LP
Sbjct  439   PYAQPERALLLFRSFIRGNALP  460



>ref|XP_010239229.1| PREDICTED: serine carboxypeptidase-like 42 [Brachypodium distachyon]
Length=380

 Score =   469 bits (1208),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 243/376 (65%), Positives = 290/376 (77%), Gaps = 3/376 (1%)
 Frame = +2

Query  371   PFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCGDISTAEDMLIFMK  550
             P    G   GL +        S+LLFVES AGVGWSYSNTSSDY  GD  TA+DM  F+ 
Sbjct  7     PHVACGGDAGLRLGHHGDGAVSSLLFVESLAGVGWSYSNTSSDYKTGDTRTADDMYRFLL  66

Query  551   KWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLD  730
              WY+KFPE+  R LFL+GESYAGHYIPQLA +++ HNK  KG KFNIKGVA+GNPLLKLD
Sbjct  67    GWYKKFPEYRSRSLFLSGESYAGHYIPQLADVLLTHNKKSKGFKFNIKGVAIGNPLLKLD  126

Query  731   RDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNAAINDQNRAvsdyi  910
             RDVPA  E+ WSHG+ISDE + AI   CDF+DY+F  PHNES SCN AI + N  V +Y+
Sbjct  127   RDVPATFEYFWSHGMISDEIFLAINKGCDFEDYTFNNPHNESKSCNDAIAEANGIVGNYV  186

Query  911   nvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNL  1090
             N YDVI+DVCYPSIV QELRL K VTK+S+G+DVCM  ER FYFNLPEVQ ALHANRT+L
Sbjct  187   NNYDVILDVCYPSIVMQELRLRKYVTKISVGVDVCMTYERFFYFNLPEVQHALHANRTHL  246

Query  1091  PYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRE  1270
             PY W  C+D  +L Y+  DG+ N++PLL+++++ KIP+W++S DQDSVVPL+GSRT+VRE
Sbjct  247   PYGWSMCSD--VLDYSGKDGNINILPLLQRIVEQKIPVWVFSDDQDSVVPLLGSRTLVRE  304

Query  1271  LAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSF  1450
             LA  M    TVPYS WFHKGQVGGW T YGN+LTFATVRGA+HMVP+AQP RAL LF SF
Sbjct  305   LAHTMGFHCTVPYSTWFHKGQVGGWVTVYGNMLTFATVRGASHMVPFAQPDRALGLFRSF  364

Query  1451  IRGRR-LPNTTSIPID  1495
             + G+  +PNTT  PI+
Sbjct  365   VLGQTIIPNTTHPPIN  380



>gb|KDO83622.1| hypothetical protein CISIN_1g0117641mg [Citrus sinensis]
Length=396

 Score =   468 bits (1205),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 250/357 (70%), Positives = 292/357 (82%), Gaps = 3/357 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLVV LPGQP+V+FRQ++GYVDVD K GRSLFYYFVEAE + H + PLTLWLNGGPG
Sbjct  33    PAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEK-PLTLWLNGGPG  91

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P GDGRGL  NS SWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  92    CSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCG  151

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DM +FM  WYEKFPEF  R LFLTGESYAGHYIPQLA +++DHN H KG KFNI
Sbjct  152   DASTARDMHVFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLDHNAHSKGFKFNI  211

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+LD+DVPA+ EF WSHG+ISDE    I ++CDFDDY     HN ++SC  
Sbjct  212   KGVAIGNPLLRLDQDVPAIYEFFWSHGMISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIE  271

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI + N+ V DYIN YDVI+DVCYP+IVEQELRL K  TKMS+G+DVCM  ER FY NLP
Sbjct  272   AITEANKIVGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLP  331

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGD  1222
             EVQKALHANRTNLPY W  C+   +L Y+ TD + N++P+LK+++Q+ IP+W++  D
Sbjct  332   EVQKALHANRTNLPYGWSMCS--GVLNYSDTDSNINILPVLKRIIQNGIPVWVFRYD  386



>ref|XP_002964377.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ34710.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=464

 Score =   470 bits (1210),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 252/442 (57%), Positives = 316/442 (71%), Gaps = 6/442 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PE +LV  LPGQP VSF+Q++GYV VD+ AGR+LFYYF EAE     + PLTLWLNGGPG
Sbjct  23    PESELVSRLPGQPHVSFKQYAGYVTVDKNAGRALFYYFAEAETRASSQ-PLTLWLNGGPG  81

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDY-TC  508
             CSSIGGGAFTELGPF+P+  G+GL++N ++WNK SN+LF+E+PAGVGWSYSN SSDY   
Sbjct  82    CSSIGGGAFTELGPFYPNASGQGLLVNRQAWNKVSNMLFLEAPAGVGWSYSNKSSDYEQV  141

Query  509   GDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFN  688
              D  TA D L F+  W +KFPE+  R  ++TGESYAGHY+PQLA L+I H++    + F 
Sbjct  142   TDRITAVDTLNFLLGWMDKFPEYQTRDFYITGESYAGHYVPQLAELIIKHSQVPGNYAFR  201

Query  689   IKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSF-IYPHNESDSC  865
             +KGVA+GNPLL L  D  A+ E+ WSHG+ISDE + A+ N C F+DY   +  HN S++C
Sbjct  202   LKGVAIGNPLLNLAVDTSAMYEYFWSHGLISDETFQALSNSCKFEDYELGLADHNVSNAC  261

Query  866   NAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFN  1045
             N  I   N  V  +IN YDVI+DVC PSI  QE+RL + + + S G+D+C+  ER  YFN
Sbjct  262   NDGILQSNTEVGRFINNYDVILDVCLPSIFLQEVRLKQQMAQKSYGVDICIDKERDVYFN  321

Query  1046  LPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQ  1225
             LPEVQ+ LHAN T L Y W  C     + Y   DG  N+VPLL  +L+  + +WI+SGDQ
Sbjct  322   LPEVQRELHANTTGLSYSWSMCT--GPVDYAMQDGSTNMVPLLGDILKAGLRVWIFSGDQ  379

Query  1226  DSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMV  1405
             DSVVPL G+R+++  LA  + M  T PY+AW+  GQV GW   YGN LT+AT+RGAAHMV
Sbjct  380   DSVVPLTGTRSLIGGLAKSLGMQTTQPYTAWYQGGQVAGWTQSYGN-LTYATIRGAAHMV  438

Query  1406  PYAQPGRALHLFSSFIRGRRLP  1471
             PYAQP RAL LF SFIRG  LP
Sbjct  439   PYAQPERALLLFRSFIRGNALP  460



>gb|AFW60601.1| hypothetical protein ZEAMMB73_172356 [Zea mays]
Length=382

 Score =   462 bits (1190),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 245/354 (69%), Positives = 290/354 (82%), Gaps = 3/354 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLV  LPGQP V+FRQF+GYVDVD KAGRSLFYYF EA +D   + PLTLWLNGGPG
Sbjct  27    PAEDLVARLPGQPPVTFRQFAGYVDVDAKAGRSLFYYFAEAREDAAAK-PLTLWLNGGPG  85

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P GDGRGL +N KSWN+ASNLLFVESPAGVGWSYSNTSSDY+ G
Sbjct  86    CSSVGGGAFTELGPFYPRGDGRGLRLNKKSWNRASNLLFVESPAGVGWSYSNTSSDYSTG  145

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D+ TA DM  F+  WY KFPE+  R LFLTGESYAGHYIPQLA ++I HN+  KG KFNI
Sbjct  146   DVRTAHDMYQFLLGWYAKFPEYRSRALFLTGESYAGHYIPQLADVLITHNEKSKGFKFNI  205

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLLKLDRDVPA  E+ WSHG+ISDE + AI + CDF+DY+F  PHNES SCN 
Sbjct  206   KGVAIGNPLLKLDRDVPATYEYFWSHGMISDEIFLAISHSCDFEDYTFNDPHNESKSCND  265

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI + N  V DY+N YDVI+DVCYPSIV QELRL +  TK+S+G+DVCM  ER FYFNLP
Sbjct  266   AIAEANSVVGDYVNNYDVILDVCYPSIVMQELRLREYATKISIGVDVCMSYERFFYFNLP  325

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIY  1213
             EVQ+ALHANRT+L + W  C+D  +L Y+ TDG+ N++P L+++++HKIPLW++
Sbjct  326   EVQQALHANRTHLKHHWSMCSD--ILNYSNTDGNINILPTLQRIVEHKIPLWVF  377



>ref|XP_002974500.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ24722.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=471

 Score =   460 bits (1183),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 248/442 (56%), Positives = 316/442 (71%), Gaps = 6/442 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PE DLV  LPGQP V F+Q++GYV VD  AGR+LFYYFVEA      R PL LWLNGGPG
Sbjct  29    PEHDLVTNLPGQPAVPFKQYAGYVTVDSHAGRALFYYFVEAHSHASSR-PLALWLNGGPG  87

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTC-  508
             CSSIGGGAFTELGPF+P+G GRGL+ NS SWNKA+N+LF+ESPAGVGWSYSN S DY+  
Sbjct  88    CSSIGGGAFTELGPFYPNGTGRGLVKNSNSWNKAANILFLESPAGVGWSYSNRSEDYSIY  147

Query  509   GDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFN  688
              D  TA+D + FM +W++ FPE+  R  ++TGESYAGHY+PQLA+ ++D+NK      FN
Sbjct  148   NDAKTAKDSVTFMLRWFDAFPEYKSREFYITGESYAGHYVPQLAAALLDYNKAAGHSVFN  207

Query  689   IKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNE-SDSC  865
             +KGVA+GNP L L  D  +  +F+WSHG+ISD+ Y  +   C + DY     +N  S  C
Sbjct  208   VKGVAIGNPALNLAIDTASTYDFLWSHGLISDKTYEGLGRSCYWSDYDHGSGNNNVSAEC  267

Query  866   NAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFN  1045
             N  I++    + D++N YD+I+DVC PSIVEQE RL K +   S+G+DVCM  ER +YFN
Sbjct  268   NQFISNSALEMGDHVNPYDIILDVCVPSIVEQEFRLKKRMGHRSIGVDVCMSYERYYYFN  327

Query  1046  LPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQ  1225
             LPEVQKALHAN T LPY W  C     ++Y+  D   ++VP+L+ LL++ + +W++SGD+
Sbjct  328   LPEVQKALHANTTGLPYPWTNCD--GPVQYDINDMRLDIVPVLRDLLKNGLRVWVFSGDE  385

Query  1226  DSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMV  1405
             D+VVP +G+R  V  LA ++K+  T  Y AWF + QVGGW   +GN LTFATVRGAAHMV
Sbjct  386   DAVVPFLGTRVNVNSLAQELKLRTTASYKAWFLRTQVGGWAESFGN-LTFATVRGAAHMV  444

Query  1406  PYAQPGRALHLFSSFIRGRRLP  1471
             P AQP RAL LF  FI G+ LP
Sbjct  445   PLAQPARALLLFQKFISGQPLP  466



>ref|XP_002990798.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ08071.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=467

 Score =   456 bits (1174),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 245/442 (55%), Positives = 316/442 (71%), Gaps = 6/442 (1%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PE DLV  LPGQP V F+Q++GYV VD  AGR+LFYYFVEA      + PL LWLNGGPG
Sbjct  25    PEHDLVTNLPGQPAVPFKQYAGYVTVDSHAGRALFYYFVEAHSHASSK-PLALWLNGGPG  83

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTC-  508
             CSSIGGGAFTELGPF+P+G GRGL+ NS SWNKA+N+LF+ESPAGVGWSYSN S DY+  
Sbjct  84    CSSIGGGAFTELGPFYPNGTGRGLVKNSNSWNKAANILFLESPAGVGWSYSNRSEDYSIY  143

Query  509   GDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFN  688
              D  TA+D + F+ +W++ FPE+  R  ++TGESYAGHY+PQLA+ ++D+NK      FN
Sbjct  144   NDAKTAKDSVTFLLRWFDAFPEYKSREFYITGESYAGHYVPQLAAALLDYNKAAGHSVFN  203

Query  689   IKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNE-SDSC  865
             +KG+A+GNP L L  D  +  +F+WSHG+ISD+ Y  +   C + DY     +N  S  C
Sbjct  204   VKGIAIGNPALNLAIDTASTYDFLWSHGLISDKTYEGLGRSCYWSDYDHGSGNNNVSAEC  263

Query  866   NAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFN  1045
             N  I++    + D++N YD+I+DVC PSIVEQE RL K +   S+G+DVCM  ER +YFN
Sbjct  264   NQFISNSALEMGDHVNPYDIILDVCVPSIVEQEFRLKKRMGHRSIGVDVCMSYERYYYFN  323

Query  1046  LPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQ  1225
             LPEVQKALHAN T LPY W  C     ++Y+  D   ++VP+L+ LL++ + +W++SGD+
Sbjct  324   LPEVQKALHANTTGLPYPWTNCD--GPVQYDINDMRLDIVPVLRDLLKNGLRVWVFSGDE  381

Query  1226  DSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMV  1405
             D+VVP +G+R  V  LA ++K+  T  Y AWF + QVGGW   +GN LTFATVRGAAHMV
Sbjct  382   DAVVPFLGTRVNVNSLAQELKLRTTASYKAWFLRTQVGGWAESFGN-LTFATVRGAAHMV  440

Query  1406  PYAQPGRALHLFSSFIRGRRLP  1471
             P AQP RAL LF  FI G+ LP
Sbjct  441   PLAQPARALLLFQKFISGQPLP  462



>ref|XP_010315079.1| PREDICTED: serine carboxypeptidase-like 42 isoform X4 [Solanum 
lycopersicum]
Length=345

 Score =   452 bits (1162),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 245/321 (76%), Positives = 275/321 (86%), Gaps = 1/321 (0%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLV  LPGQP+V FRQ++GYVDVDEKAGRSLFYYFVEAEKD H  LPLTLWLNGGPG
Sbjct  26    PIEDLVENLPGQPKVGFRQYAGYVDVDEKAGRSLFYYFVEAEKDAHN-LPLTLWLNGGPG  84

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPFFP GDG GL  N+KSWNK SNLLF+ESP GVGWSYSNTSSDYT G
Sbjct  85    CSSIGGGAFTELGPFFPRGDGHGLRRNTKSWNKVSNLLFIESPVGVGWSYSNTSSDYTSG  144

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA+DML FM KWYEKF E   RPLFLTGESYAGHYIPQLA+ ++D+NK  K  KFN+
Sbjct  145   DESTAKDMLNFMLKWYEKFSELKSRPLFLTGESYAGHYIPQLANGILDYNKQSKDFKFNL  204

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+LDRDVPA+ E+ WSHG+ISDE +  I+  CDFDDY F  PHN S +CN 
Sbjct  205   KGVAIGNPLLRLDRDVPAMYEYYWSHGMISDELFLIIKENCDFDDYEFPLPHNVSITCNQ  264

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI++  + V+DY+NVYDVI+DVCYPSIV+QELRLHK VTKMSMG+DVCM SER FYFNLP
Sbjct  265   AIDEAYKLVTDYVNVYDVILDVCYPSIVQQELRLHKQVTKMSMGVDVCMTSERYFYFNLP  324

Query  1052  EVQKALHANRTNLPYDWKTCA  1114
             EVQKALHANRTNLPY+W+ C+
Sbjct  325   EVQKALHANRTNLPYEWRMCS  345



>ref|XP_010315078.1| PREDICTED: serine carboxypeptidase-like 42 isoform X3 [Solanum 
lycopersicum]
Length=346

 Score =   451 bits (1161),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 245/321 (76%), Positives = 274/321 (85%), Gaps = 1/321 (0%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLV  LPGQP+V FRQ++GYVDVDEKAGRSLFYYFVEAEKD H  LPLTLWLNGGPG
Sbjct  26    PIEDLVENLPGQPKVGFRQYAGYVDVDEKAGRSLFYYFVEAEKDAHN-LPLTLWLNGGPG  84

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPFFP GDG GL  N+KSWNK SNLLF+ESP GVGWSYSNTSSDYT G
Sbjct  85    CSSIGGGAFTELGPFFPRGDGHGLRRNTKSWNKVSNLLFIESPVGVGWSYSNTSSDYTSG  144

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA+DML FM KWYEKF E   RPLFLTGESYAGHYIPQLA+ ++D+NK  K  KFN+
Sbjct  145   DESTAKDMLNFMLKWYEKFSELKSRPLFLTGESYAGHYIPQLANGILDYNKQSKDFKFNL  204

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+LDRDVPA+ E+ WSHG+ISDE +  I+  CDFDDY F  PHN S +CN 
Sbjct  205   KGVAIGNPLLRLDRDVPAMYEYYWSHGMISDELFLIIKENCDFDDYEFPLPHNVSITCNQ  264

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI++  + V+DY+NVYDVI+DVCYPSIV+QELRLHK VTKMSMG+DVCM SER FYFNLP
Sbjct  265   AIDEAYKLVTDYVNVYDVILDVCYPSIVQQELRLHKQVTKMSMGVDVCMTSERYFYFNLP  324

Query  1052  EVQKALHANRTNLPYDWKTCA  1114
             EVQKALHANRTNLPY+W+ C 
Sbjct  325   EVQKALHANRTNLPYEWRMCT  345



>ref|XP_002971138.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ27736.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=475

 Score =   449 bits (1156),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 234/456 (51%), Positives = 307/456 (67%), Gaps = 16/456 (4%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P  DLV  LPGQP V FRQ++GYV VD  AGR+LFYYFVE E    +  PLTLWLNG   
Sbjct  23    PLSDLVTNLPGQPRVRFRQYAGYVTVDPSAGRALFYYFVEVEGGAPQSKPLTLWLNGEFL  82

Query  332   cssiggg----------AFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSY  481
               +              AFTELGPF+P+  G GL+ N +SWNK SNLLF++SPAGVGWSY
Sbjct  83    SGTKKKKGPGCSSIGCGAFTELGPFYPNASGTGLLRNPQSWNKVSNLLFLDSPAGVGWSY  142

Query  482   SNTSSDY-TCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDH  658
             SNTSSDY    D  TA+D L+F+  W+ KFPEF    L++TGESYAGHY+PQLAS+++ H
Sbjct  143   SNTSSDYDNVTDEKTAQDTLLFLLGWFRKFPEFRSSDLYITGESYAGHYVPQLASVILGH  202

Query  659   NKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSF-  835
             N+  +  +  +KG+A+GNPLL L  D  A+ E+ WSHG+ISD+ + A++  C+F+DY   
Sbjct  203   NERNRQEELRLKGIAIGNPLLNLGIDTAAMYEYFWSHGLISDDTFAAVKGACNFEDYELG  262

Query  836   -IYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDV  1012
                 HN S+ C+  +   +  V D+IN YDVI+DVC PS+  QELRL + +T+ S G+DV
Sbjct  263   AEKQHNVSNQCDVIMGKSDDEVGDFINNYDVILDVCLPSLFLQELRLKQHITQKSYGVDV  322

Query  1013  CMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQH  1192
             C+  ER  Y N   VQ+ALHAN T L Y W  C     ++Y   DG  ++VPLL+ +++ 
Sbjct  323   CIDDERDLYLNDYRVQQALHANVTGLNYKWTMCD--GPVQYYLQDGSIDIVPLLQNIVKT  380

Query  1193  KIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLT  1372
              + +W++SGDQDSVVPL G+RTI+  L   + +  TVPY+AW+  GQV GW   YGN LT
Sbjct  381   GLRVWVFSGDQDSVVPLTGTRTIINGLGKSLNLPATVPYTAWYLGGQVAGWTQVYGN-LT  439

Query  1373  FATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNTT  1480
             +AT+RGAAHMVPYAQP RAL LF +F+ G+ LP  +
Sbjct  440   YATIRGAAHMVPYAQPARALLLFQTFLSGQTLPKNS  475



>ref|XP_002961948.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ37208.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=480

 Score =   448 bits (1153),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 234/461 (51%), Positives = 307/461 (67%), Gaps = 21/461 (5%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P  DLV  LPGQP V FRQ++GYV VD  AGR+LFYYFVE E    +  PLTLWLNG   
Sbjct  23    PLSDLVTNLPGQPRVRFRQYAGYVTVDPSAGRALFYYFVEVEGGAPQSKPLTLWLNGVVS  82

Query  332   cssigggA---------------FTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAG  466
              +     A               FTELGPF+P+  G GL+ N +SWNK SNLLF++SPAG
Sbjct  83    LTQSSCLAPKKKGPGCSSIGCGAFTELGPFYPNASGTGLLRNPQSWNKVSNLLFLDSPAG  142

Query  467   VGWSYSNTSSDY-TCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLAS  643
             VGWSYSNTSSDY    D  TA+D L+F+  W+ KFPEF    L++TGESYAGHY+PQLAS
Sbjct  143   VGWSYSNTSSDYDNVTDEKTAQDTLLFLLGWFRKFPEFRSSDLYITGESYAGHYVPQLAS  202

Query  644   LMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFD  823
             +++ HN+  +  +  +KG+A+GNPLL L  D  A+ E+ WSHG+ISD+ + A++  C+F+
Sbjct  203   VILGHNERNRQEELRLKGIAIGNPLLNLGIDTAAMYEYFWSHGLISDDTFAAVKGACNFE  262

Query  824   DYSF--IYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMS  997
             DY       HN S+ C+  +   +  V D+IN YDVI+DVC PS+  QELRL + +T+ S
Sbjct  263   DYELGAEKQHNVSNQCDVIMGKSDDEVGDFINNYDVILDVCLPSLFLQELRLKQHITQKS  322

Query  998   MGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLK  1177
              G+DVC+  ER  Y N   VQ+ALHAN T L Y W  C     ++Y   DG  ++VPLL+
Sbjct  323   YGVDVCIDDERDLYLNDYRVQQALHANVTGLNYKWTMCD--GPVQYYLQDGSIDIVPLLQ  380

Query  1178  KLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEY  1357
              +++  + +W++SGDQDSVVPL G+RTI+  L   + +  TVPY+AW+  GQV GW   Y
Sbjct  381   SIVKTGLRVWVFSGDQDSVVPLTGTRTIINGLGKSLNLPATVPYTAWYLGGQVAGWTQVY  440

Query  1358  GNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNTT  1480
             GN LT+AT+RGAAHMVPYAQP RAL LF +F+ G+ LP  +
Sbjct  441   GN-LTYATIRGAAHMVPYAQPARALLLFQTFLSGQTLPKNS  480



>gb|EMS54298.1| Serine carboxypeptidase-like 42 [Triticum urartu]
Length=402

 Score =   442 bits (1136),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 248/424 (58%), Positives = 300/424 (71%), Gaps = 51/424 (12%)
 Frame = +2

Query  224   DVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGL  403
             D+  +AGRSLFYYF EA+     + PLTLWLNGGPGCSS+GGGAFTELGPF+P GD    
Sbjct  30    DLVGRAGRSLFYYFAEAQDHAAGK-PLTLWLNGGPGCSSVGGGAFTELGPFYPRGD----  84

Query  404   IINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCGDISTAEDMLIFMKKWYEKFPEFLD  583
                       SNLLFVESPAGVGWSYSNTSSDY  GD  TA DM  F+  WY+KFPE+  
Sbjct  85    ---------VSNLLFVESPAGVGWSYSNTSSDYNTGDTRTANDMYKFLLGWYKKFPEYRS  135

Query  584   RPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMW  763
               LFL+GESYAGH+IPQL  +++ HN+  KG KFNIKGVA                    
Sbjct  136   TSLFLSGESYAGHHIPQLTDVLLTHNEKSKGFKFNIKGVA--------------------  175

Query  764   SHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcy  943
                            +CDF+DY+   PHNES SCN AI++    V +Y++ YDVI DVCY
Sbjct  176   ---------------DCDFEDYTSGNPHNESKSCNDAIDEAIAMVGEYVDDYDVIRDVCY  220

Query  944   PSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYS  1123
             PSIV QELRL K VTK+S+G+DVCM  E  FYFNLPEVQ ALHANRT+LPY W  C+D  
Sbjct  221   PSIVMQELRLRKYVTKISLGVDVCMSYEGNFYFNLPEVQHALHANRTHLPYSWSMCSD--  278

Query  1124  LLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITV  1303
             +L +   D   N++PLL+++++ KIP+W++SGDQDSVVPL+ +RT+VRELA  M + +TV
Sbjct  279   VLNFTGKDVYTNILPLLQRIVEQKIPVWVFSGDQDSVVPLLRTRTLVRELAHAMGLPVTV  338

Query  1304  PYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNTTS  1483
             PYS+WF KGQVGGW TEYGN+LTFATVRGA+HMVP++QP RAL LF SF+ G+RLPNTT 
Sbjct  339   PYSSWFRKGQVGGWATEYGNMLTFATVRGASHMVPFSQPDRALGLFRSFVLGQRLPNTTH  398

Query  1484  IPID  1495
              PID
Sbjct  399   RPID  402



>gb|EMT31513.1| Serine carboxypeptidase-like 42 [Aegilops tauschii]
Length=433

 Score =   442 bits (1136),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 261/470 (56%), Positives = 316/470 (67%), Gaps = 46/470 (10%)
 Frame = +2

Query  86    LVICFVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYF  265
             L +  VC +   C  G      PEEDLV  LPGQP V FRQF+GYVDVD+KAGRSLFYYF
Sbjct  10    LAVAMVCWAASSCMLGF-----PEEDLVGRLPGQPIVGFRQFAGYVDVDDKAGRSLFYYF  64

Query  266   VEAEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLL  445
              EA+     + PLTLWLNGGPGCSS+GGGAFTELGPF+P GD              SNLL
Sbjct  65    AEAQDHAAGK-PLTLWLNGGPGCSSVGGGAFTELGPFYPRGD-------------VSNLL  110

Query  446   FVESPAGVGWSYSNTSSDYTCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHY  625
             FVESPAGVG SYSNTSSDY  GD  TA DM  F+  WY+KFPE+  R LFL+GESYAGH+
Sbjct  111   FVESPAGVGRSYSNTSSDYNTGDTRTANDMYKFLLGWYKKFPEYRSRSLFLSGESYAGHH  170

Query  626   IPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIR  805
             IPQL  +++ HN+  KG KFNIKGVA+GNPLL+LDR +    E+ WSHG+ISDE + AI+
Sbjct  171   IPQLTDVLLTHNEKSKGFKFNIKGVAIGNPLLELDRYIRVTYEYFWSHGMISDEIFLAIK  230

Query  806   NECDFDDYSFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAV  985
              +CDF+DY+   PHNES SCN AI++    V +Y++ YDVI DVCYPSIV QELRL K  
Sbjct  231   KDCDFEDYTSGNPHNESKSCNDAIDEAKAMVGEYVDGYDVIRDVCYPSIVMQELRLRKYA  290

Query  986   TKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVV  1165
             TK+S+G+DVCM  E +FYFNLPEVQ ALHANRT+LPY W  C+  + +         +V 
Sbjct  291   TKISLGVDVCMSYEGSFYFNLPEVQHALHANRTHLPYGWSKCSGVTKISLG-----VDVC  345

Query  1166  PLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGW  1345
                ++     +P   ++        L  +RT              +PY  W     VGGW
Sbjct  346   MSYERYFYFNLPEVQHA--------LHANRT-------------HLPY-GWSMCSGVGGW  383

Query  1346  QTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNTTSIPID  1495
              T+YGN+LTFATVRGA+HMVP++QP RAL LF SF+ G+RLPNTT  PID
Sbjct  384   ATQYGNMLTFATVRGASHMVPFSQPDRALGLFRSFVLGQRLPNTTHRPID  433



>gb|KDO83623.1| hypothetical protein CISIN_1g0117641mg [Citrus sinensis]
 gb|KDO83624.1| hypothetical protein CISIN_1g0117641mg [Citrus sinensis]
Length=353

 Score =   437 bits (1125),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 237/321 (74%), Positives = 266/321 (83%), Gaps = 1/321 (0%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLVV LPGQP+V+FRQ++GYVDVD K GRSLFYYFVEAE + H + PLTLWLNGGPG
Sbjct  33    PAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEK-PLTLWLNGGPG  91

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P GDGRGL  NS SWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  92    CSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCG  151

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DM +FM  WYEKFPEF  R LFLTGESYAGHYIPQLA +++DHN H KG KFNI
Sbjct  152   DASTARDMHVFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLDHNAHSKGFKFNI  211

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLL+LD+DVPA+ EF WSHG+ISDE    I ++CDFDDY     HN ++SC  
Sbjct  212   KGVAIGNPLLRLDQDVPAIYEFFWSHGMISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIE  271

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI + N+ V DYIN YDVI+DVCYP+IVEQELRL K  TKMS+G+DVCM  ER FY NLP
Sbjct  272   AITEANKIVGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLP  331

Query  1052  EVQKALHANRTNLPYDWKTCA  1114
             EVQKALHANRTNLPY W  C+
Sbjct  332   EVQKALHANRTNLPYGWSMCS  352



>ref|XP_006581614.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X2 [Glycine 
max]
Length=414

 Score =   437 bits (1125),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 221/312 (71%), Positives = 256/312 (82%), Gaps = 2/312 (1%)
 Frame = +2

Query  560   EKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDV  739
             +KFP +  R LFLTGESYAGHYIPQLA++++D+N H    KFNIKGVA+GNPLLKLDRD 
Sbjct  104   QKFPSYRSRELFLTGESYAGHYIPQLANVLLDYNVHSTSFKFNIKGVAIGNPLLKLDRDA  163

Query  740   PAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNAAINDQNRAvsdyinvy  919
              A  E+ WSHG+ISDE   AI N+CDFDDY F   HN S SCN AIN+ N  V DYIN Y
Sbjct  164   QATYEYFWSHGMISDEIGLAITNDCDFDDYVFASAHNMSKSCNEAINEANEIVGDYINNY  223

Query  920   dvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYD  1099
             DVI DVCYPSIVEQELRL K  TK+S+G+DVCM  ER+FYFNLPEVQKALHANRTNLPY 
Sbjct  224   DVIFDVCYPSIVEQELRLKKIATKISIGVDVCMTYERSFYFNLPEVQKALHANRTNLPYQ  283

Query  1100  WKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAA  1279
             W  C+   +L Y+ TD + +++P+LKK++Q+ IP+W++SGDQDSVVPL+GSRT++RELA 
Sbjct  284   WSMCS--GVLNYSDTDPNIDILPILKKIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAH  341

Query  1280  DMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRG  1459
             D+K  ITVPY AWFHKGQVGGW TEYGNLLTFATVRGAAHMVPYAQP RALHLFSSF+ G
Sbjct  342   DLKFKITVPYGAWFHKGQVGGWVTEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVHG  401

Query  1460  RRLPNTTSIPID  1495
             RRLPNTTS  ID
Sbjct  402   RRLPNTTSPSID  413



>ref|XP_007201403.1| hypothetical protein PRUPE_ppa008027mg [Prunus persica]
 gb|EMJ02602.1| hypothetical protein PRUPE_ppa008027mg [Prunus persica]
Length=348

 Score =   432 bits (1110),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 232/320 (73%), Positives = 264/320 (83%), Gaps = 1/320 (0%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLVV LPGQP V F+Q++GYVDVD KAGRSLFYYFVEA+++  ++ PLTLWLNGGPG
Sbjct  28    PAEDLVVRLPGQPNVGFKQYAGYVDVDVKAGRSLFYYFVEADREPDKK-PLTLWLNGGPG  86

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSSIGGGAFTELGPF+P+GDGRGL  N  SWN+ASNLLFVESPAGVGWSYSNTSSDY  G
Sbjct  87    CSSIGGGAFTELGPFYPTGDGRGLRRNLMSWNRASNLLFVESPAGVGWSYSNTSSDYNSG  146

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D STA DM  F+ KWYEKFP F  R LFLTGESYAGHYIPQLA  ++DHN+H  G KFN+
Sbjct  147   DASTARDMHTFLLKWYEKFPAFRSRELFLTGESYAGHYIPQLAIAILDHNEHSTGFKFNL  206

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KG+A+GNPLL+LDRD+PA  E+ WSHG+ISDE    I NECDFDDY F  PHN +  CN 
Sbjct  207   KGIAIGNPLLRLDRDIPATYEYFWSHGMISDEIGLTIMNECDFDDYVFANPHNVTVKCNT  266

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             A++  N+ + DYIN YDVI+DVCYPSIV+QELRL K  TK+S+G+DVCM SER FYFNLP
Sbjct  267   AVSQVNQIIGDYINNYDVILDVCYPSIVQQELRLRKMATKISLGVDVCMSSERHFYFNLP  326

Query  1052  EVQKALHANRTNLPYDWKTC  1111
             EVQKALHANRTNLPY W  C
Sbjct  327   EVQKALHANRTNLPYSWSMC  346



>ref|XP_002972012.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ26929.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=465

 Score =   434 bits (1115),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 232/443 (52%), Positives = 312/443 (70%), Gaps = 7/443 (2%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P  DLV  LPGQPEVSF+Q++GYV +D+++G++LFYYFVEAE+D   + PL+LWLNGGPG
Sbjct  25    PASDLVKDLPGQPEVSFKQYAGYVTIDQRSGKALFYYFVEAEEDPTSK-PLSLWLNGGPG  83

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDY-TC  508
             CSS+GGGAFTELGPF+P     GL+ NSK+WNKASN+LFV+SP GVGWSYSNTSSDY T 
Sbjct  84    CSSLGGGAFTELGPFYPDSKSDGLVRNSKAWNKASNVLFVDSPIGVGWSYSNTSSDYQTY  143

Query  509   GDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNK-HFKGHKF  685
              D  T+ D++ F+  W+ KFPE+  R  ++TGESYAGHY+PQLA  +++HN    K H+F
Sbjct  144   NDEKTSRDLVKFLHGWFIKFPEYRHREFYITGESYAGHYVPQLAVRLLNHNMLAKKSHQF  203

Query  686   NIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYP-HNESDS  862
             N+KG+A+GNP L    D  A  ++ WSHG+ISD+ Y  I + C++ DY +  P HN S  
Sbjct  204   NLKGIAIGNPALNSAIDDEATYDYYWSHGLISDKTYQGIVHNCNWHDYDYSGPNHNVSVE  263

Query  863   CNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYF  1042
             C   I+  +  V   ++ YDV++D C P  V QE RL K  ++ S+G+D+C+  ERT YF
Sbjct  264   CVKYISQTSSEVGQNVDPYDVLLDACLPEAVHQEFRLRKMKSQRSIGVDICITRERTRYF  323

Query  1043  NLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGD  1222
               PEVQ+ALHAN T LPY+W  C     L Y+  + + ++V +L+ LL   + ++IYSGD
Sbjct  324   RRPEVQRALHANTTGLPYEWSNCE--GPLYYDNGNLNIDMVTVLENLLVQGLRIFIYSGD  381

Query  1223  QDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHM  1402
              DSVVP +G+RTI+  +   +++   VPYSAW+ + QV GW    GN LTFATV+GA HM
Sbjct  382   ADSVVPFLGTRTIIDSIVNRLRLKTLVPYSAWYSQSQVAGWTQVTGN-LTFATVKGAGHM  440

Query  1403  VPYAQPGRALHLFSSFIRGRRLP  1471
             VPYAQP RAL +F +F+  + LP
Sbjct  441   VPYAQPTRALVMFQAFVNNKNLP  463



>ref|XP_002972549.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ26635.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=465

 Score =   431 bits (1109),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 232/443 (52%), Positives = 312/443 (70%), Gaps = 7/443 (2%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P  DLV  LPGQP+VSF+Q++GYV +D+++G++LFYYFVEAE+D   + PL+LWLNGGPG
Sbjct  25    PASDLVKDLPGQPDVSFKQYAGYVTIDQRSGKALFYYFVEAEEDPTSK-PLSLWLNGGPG  83

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDY-TC  508
             CSS+GGGAFTELGPF+P     GL+ NSK+WNKASN+LFV+SP GVGWSYSNTSSDY T 
Sbjct  84    CSSLGGGAFTELGPFYPDSKSDGLVRNSKAWNKASNVLFVDSPIGVGWSYSNTSSDYQTY  143

Query  509   GDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNK-HFKGHKF  685
              D  T+ D++ F+  W+ KFPE+  R  ++TGESYAGHY+PQLA  +++HNK   K H+F
Sbjct  144   NDEKTSRDLVKFLHGWFIKFPEYRHREFYITGESYAGHYVPQLAVRLLNHNKLAKKSHQF  203

Query  686   NIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFI-YPHNESDS  862
             N+KG+A+GNP L    D  A  ++ WSHG+ISD+ Y  I + C++ DY +    HN S  
Sbjct  204   NLKGLAIGNPALNSAIDDEATYDYYWSHGLISDKTYQGIVHNCNWHDYDYSGLNHNVSVE  263

Query  863   CNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYF  1042
             C   I+  N  V   ++ YDV++D C P  V QE RL K  ++ S+G+D+C+  ERT YF
Sbjct  264   CVKYISQTNTEVGQNVDPYDVLLDACLPEAVHQEFRLRKMKSQRSIGVDICITRERTRYF  323

Query  1043  NLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGD  1222
               PEVQ+ALHAN T LPY+W  C     L Y+  + + ++V +L+ LL   + ++IYSGD
Sbjct  324   RRPEVQRALHANTTGLPYEWSNCE--GPLFYDNGNLNIDMVTVLENLLVQGLRIFIYSGD  381

Query  1223  QDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHM  1402
              DSVVP +G+RTI+  +   +++   VPYSAW+ + QV GW    GN LTFATV+GA HM
Sbjct  382   ADSVVPFLGTRTIIDSIVNRLRLKTLVPYSAWYSQSQVAGWTQVTGN-LTFATVKGAGHM  440

Query  1403  VPYAQPGRALHLFSSFIRGRRLP  1471
             VPYAQP RAL +F +F+  + LP
Sbjct  441   VPYAQPMRALVMFQAFVNNKNLP  463



>ref|XP_008677381.1| PREDICTED: serine carboxypeptidase F13S12.6 isoform X1 [Zea mays]
Length=490

 Score =   431 bits (1107),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 233/331 (70%), Positives = 268/331 (81%), Gaps = 1/331 (0%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P EDLV  LPGQP V+FRQF+GYVDVD KAGRSLFYYF EA +D   + PLTLWLNGGPG
Sbjct  27    PAEDLVARLPGQPPVTFRQFAGYVDVDAKAGRSLFYYFAEAREDAAAK-PLTLWLNGGPG  85

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+GGGAFTELGPF+P GDGRGL +N KSWN+ASNLLFVESPAGVGWSYSNTSSDY+ G
Sbjct  86    CSSVGGGAFTELGPFYPRGDGRGLRLNKKSWNRASNLLFVESPAGVGWSYSNTSSDYSTG  145

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D+ TA DM  F+  WY KFPE+  R LFLTGESYAGHYIPQLA ++I HN+  KG KFNI
Sbjct  146   DVRTAHDMYQFLLGWYAKFPEYRSRALFLTGESYAGHYIPQLADVLITHNEKSKGFKFNI  205

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
             KGVA+GNPLLKLDRDVPA  E+ WSHG+ISDE + AI + CDF+DY+F  PHNES SCN 
Sbjct  206   KGVAIGNPLLKLDRDVPATYEYFWSHGMISDEIFLAISHSCDFEDYTFNDPHNESKSCND  265

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
             AI + N  V DY+N YDVI+DVCYPSIV QELRL +  TK+S+G+DVCM  ER FYFNLP
Sbjct  266   AIAEANSVVGDYVNNYDVILDVCYPSIVMQELRLREYATKISIGVDVCMSYERFFYFNLP  325

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQT  1144
             EVQ+ALHANRT+L + W  C+++ L    QT
Sbjct  326   EVQQALHANRTHLKHHWSMCSEFWLSSQCQT  356



>gb|ACR37620.1| unknown [Zea mays]
Length=321

 Score =   419 bits (1078),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 212/322 (66%), Positives = 257/322 (80%), Gaps = 4/322 (1%)
 Frame = +2

Query  533   MLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKGVALGN  712
             ML F+  WY KFPE+  R LFLTGESYAGHYIPQ+A +++ HN+  KG KFNIKGVA+GN
Sbjct  1     MLRFLLGWYAKFPEYRSRALFLTGESYAGHYIPQIADVLVTHNERSKGLKFNIKGVAIGN  60

Query  713   PLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSF--IYPHNESDSCNAAINDQ  886
             PLLKLDRDVPA  E+ WSHG+ISDE + AI + CDF+DY+F    PHNES  CN AI + 
Sbjct  61    PLLKLDRDVPATYEYFWSHGMISDETFLAISHSCDFEDYTFNNDSPHNESKPCNDAIAEA  120

Query  887   NRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPEVQKA  1066
             N  V DY+N YDVI+DVCYPSIV QELRL +  TK+S+G+DVCM  ER FYFNLPEVQ+A
Sbjct  121   NAVVGDYVNNYDVILDVCYPSIVMQELRLRQFATKISVGVDVCMSYERFFYFNLPEVQQA  180

Query  1067  LHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSVVPLV  1246
             LHANRT+L Y W  C+D+  L Y+ TDG+ +++P L+++++ KIPLW++SGDQDSVVPL+
Sbjct  181   LHANRTHLKYQWSMCSDF--LNYSNTDGNIDMLPTLQRIVERKIPLWVFSGDQDSVVPLL  238

Query  1247  GSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYAQPGR  1426
             GSR++VRELA  M + +TVPYS WF KGQVGGW TEYGN LTFATVRGA+HMVP+AQP R
Sbjct  239   GSRSLVRELAHTMGLHVTVPYSTWFRKGQVGGWVTEYGNFLTFATVRGASHMVPFAQPDR  298

Query  1427  ALHLFSSFIRGRRLPNTTSIPI  1492
             AL LF S + GRRLPN TS PI
Sbjct  299   ALGLFRSIVLGRRLPNATSPPI  320



>dbj|BAJ87921.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=303

 Score =   417 bits (1072),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 210/304 (69%), Positives = 249/304 (82%), Gaps = 2/304 (1%)
 Frame = +2

Query  584   RPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMW  763
             R LFL+GESYAGHYIPQL  +++ HN+  KG KFNIKGVA+GNPLLKLDRDVPA  E+ W
Sbjct  1     RSLFLSGESYAGHYIPQLTDVLLTHNEKSKGFKFNIKGVAIGNPLLKLDRDVPATYEYFW  60

Query  764   SHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcy  943
             SHG+ISDE + AI   CDF+DY+F  PHNES SCN AI + N  V +Y+N YDVI+DVCY
Sbjct  61    SHGMISDEIFLAINKGCDFEDYTFGNPHNESKSCNDAIGEANAIVGEYVNNYDVILDVCY  120

Query  944   PSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYS  1123
             PSIV QELRL K VTK+S+G+DVCM  ER FYFNLPEVQ ALHANRT+LPY W  C+D  
Sbjct  121   PSIVMQELRLRKYVTKISLGVDVCMSYERYFYFNLPEVQHALHANRTHLPYGWSMCSD--  178

Query  1124  LLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITV  1303
             +L Y   DG+ N++PLL+++++HKIP+WI+SGDQDSVVPL+GSRT+VRELA DM + +TV
Sbjct  179   VLNYTDKDGNINILPLLQRIVEHKIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGLPVTV  238

Query  1304  PYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNTTS  1483
             PY  WF KGQVGGW TEYGNLLTFATVRGA+HMVP+AQP RAL LF SF+ G+RLPNTT 
Sbjct  239   PYRTWFRKGQVGGWATEYGNLLTFATVRGASHMVPFAQPDRALGLFRSFVLGQRLPNTTY  298

Query  1484  IPID  1495
              PID
Sbjct  299   PPID  302



>gb|KDO83617.1| hypothetical protein CISIN_1g0117641mg, partial [Citrus sinensis]
 gb|KDO83618.1| hypothetical protein CISIN_1g0117641mg, partial [Citrus sinensis]
Length=304

 Score =   417 bits (1072),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 209/305 (69%), Positives = 248/305 (81%), Gaps = 2/305 (1%)
 Frame = +2

Query  419   SWNKASNLLFVESPAGVGWSYSNTSSDYTCGDISTAEDMLIFMKKWYEKFPEFLDRPLFL  598
             SWNKASNLLFVESPAGVGWSYSNT+SDY CGD STA DM +FM  WYEKFPEF  R LFL
Sbjct  2     SWNKASNLLFVESPAGVGWSYSNTTSDYNCGDASTARDMHVFMMNWYEKFPEFKSRELFL  61

Query  599   TGESYAGHYIPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGII  778
             TGESYAGHYIPQLA +++DHN H KG KFNIKGVA+GNPLL+LD+DVPA+ EF WSHG+I
Sbjct  62    TGESYAGHYIPQLADVLLDHNAHSKGFKFNIKGVAIGNPLLRLDQDVPAIYEFFWSHGMI  121

Query  779   SDENYNAIRNECDFDDYSFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVE  958
             SDE    I ++CDFDDY     HN ++SC  AI + N+ V DYIN YDVI+DVCYP+IVE
Sbjct  122   SDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTIVE  181

Query  959   QELRLHKAVTKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYN  1138
             QELRL K  TKMS+G+DVCM  ER FY NLPEVQKALHANRTNLPY W  C+   +L Y+
Sbjct  182   QELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCS--GVLNYS  239

Query  1139  QTDGDANVVPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAW  1318
              TD + N++P+LK+++Q+ IP+W++SGDQDSVVPL+GSRT++RELA D+   +TVPY AW
Sbjct  240   DTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAW  299

Query  1319  FHKGQ  1333
             FHK Q
Sbjct  300   FHKQQ  304



>ref|XP_006830556.1| hypothetical protein AMTR_s00117p00106310 [Amborella trichopoda]
 gb|ERM97972.1| hypothetical protein AMTR_s00117p00106310 [Amborella trichopoda]
Length=486

 Score =   422 bits (1084),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 242/475 (51%), Positives = 311/475 (65%), Gaps = 24/475 (5%)
 Frame = +2

Query  122   CgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLP  301
             C     V   P E L+  LPGQP+VSFRQ+SGY++VDE AG +LFYYFVEA+ +   + P
Sbjct  15    CFSCKWVSTAPTEHLISSLPGQPQVSFRQYSGYINVDESAGTNLFYYFVEAQSNASSQ-P  73

Query  302   LTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSY  481
             L LWLNGGPGCSSIGGGAFTELGPF+P+G G GL IN  SWNK +N+LF+ESPAGVGWSY
Sbjct  74    LALWLNGGPGCSSIGGGAFTELGPFYPNGKGDGLRINPYSWNKVANVLFLESPAGVGWSY  133

Query  482   SNTSSDYTCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHN  661
             S   + Y   D   A + L+F+ +W+++FPE+ +RPLFLTGESYAGHYIPQLA LM  HN
Sbjct  134   SRIPAGYRYNDARVANESLVFLLRWFQRFPEYSERPLFLTGESYAGHYIPQLALLMARHN  193

Query  662   KHFK----GHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFD-D  826
                        FN+ G+ +GNPLL    D  A   F+WSHG+ISD  Y  + + CDF   
Sbjct  194   GRMSRGAAAFGFNLHGILVGNPLLNYGVDTSATYSFLWSHGLISDNTYKGVASTCDFRYG  253

Query  827   YSFIYPHNESDS-------CNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAV  985
             Y+   P + S S       C   +      V  +IN+YDV +DVC P IV Q L LHK +
Sbjct  254   YTGQNPDDASKSQGKKAHACPNFLVSARAEVGAFINMYDVTLDVCAPPIVHQALLLHKLM  313

Query  986   TKM-------SMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQT  1144
               +       S  +DVC+  E T Y N P VQ+ALHAN T+LPY W+ C+D  ++ Y   
Sbjct  314   GHLVETSKEGSDEVDVCIDHELTRYLNHPTVQRALHANLTSLPYAWEACSD--IVDYKYE  371

Query  1145  DGDANVVPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFH  1324
             D   +++PLLK L++ ++ +WI+SGDQDSVVPL G+R+ +  LA  +++   +PYSAW+ 
Sbjct  372   DQLEDMLPLLKDLVKSRVRIWIFSGDQDSVVPLTGTRSQLTTLAHHLRLKTMIPYSAWYA  431

Query  1325  KGQVGGWQTEYGNL--LTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNTTS  1483
              GQVGGW   Y     L +ATVRGAAHMVPYAQP RAL LFSSF+  + LP+ +S
Sbjct  432   NGQVGGWVEAYEESLGLVYATVRGAAHMVPYAQPERALILFSSFLHAQPLPSRSS  486



>ref|XP_007161488.1| hypothetical protein PHAVU_001G0732000g, partial [Phaseolus vulgaris]
 gb|ESW33482.1| hypothetical protein PHAVU_001G0732000g, partial [Phaseolus vulgaris]
Length=291

 Score =   407 bits (1045),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 204/292 (70%), Positives = 242/292 (83%), Gaps = 2/292 (1%)
 Frame = +2

Query  620   HYIPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNA  799
             HY+PQL ++++DHN    G KFNIKGVA+GNPLL+LDRD PA  E+ WSHG+ISDE   A
Sbjct  1     HYVPQLTNVLLDHNAGSTGFKFNIKGVAIGNPLLRLDRDTPATYEYFWSHGMISDEIGLA  60

Query  800   IRNECDFDDYSFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHK  979
             I N+CDFDDYS+  PHN S SCN AI + N  V DYIN YDVI+DVCYPSIVEQELRL +
Sbjct  61    IMNDCDFDDYSYASPHNVSHSCNNAIYEANLIVGDYINNYDVILDVCYPSIVEQELRLKR  120

Query  980   AVTKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDAN  1159
               TK+S+G+DVCM  ER FYFNLPEVQKALHANRTNLPY W  C+   +L Y+ TDG+ N
Sbjct  121   MATKISVGVDVCMSLERRFYFNLPEVQKALHANRTNLPYSWSMCS--HVLNYSDTDGNIN  178

Query  1160  VVPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVG  1339
             ++P+LK+++Q+ IP+W++SGDQDSVVPL+GSRT++RELA +++  ITVPY AWFHKGQVG
Sbjct  179   ILPILKRIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAHELQFKITVPYGAWFHKGQVG  238

Query  1340  GWQTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNTTSIPID  1495
             GW TEYGNLLTFATVRGAAHMVPYAQP RALHLFSSF+RGRRLPNTT   ID
Sbjct  239   GWVTEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRLPNTTRPSID  290



>ref|XP_004167283.1| PREDICTED: serine carboxypeptidase-like 42-like [Cucumis sativus]
Length=377

 Score =   403 bits (1036),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 201/294 (68%), Positives = 240/294 (82%), Gaps = 2/294 (1%)
 Frame = +2

Query  611   YAGHYIPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDEN  790
             Y GHYIPQLA  ++DHN    G KFNIKGVA+GNPLLKLDRDVPA  E+ WSHG+ISDE 
Sbjct  84    YTGHYIPQLAIALLDHNAKSSGFKFNIKGVAIGNPLLKLDRDVPATYEYFWSHGMISDEI  143

Query  791   YNAIRNECDFDDYSFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELR  970
                I +ECDF+DY+F  PHNES SCN AI+  N+ V +YIN YDVI+DVCYPSIVEQELR
Sbjct  144   GITIMSECDFEDYTFASPHNESHSCNEAISIANQVVGNYINNYDVILDVCYPSIVEQELR  203

Query  971   LHKAVTKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDG  1150
             L K  +K+S+G+DVCM  ER FYFNL EVQ+ALHANRT LPY W  C+  S++ Y+ TDG
Sbjct  204   LRKMASKISLGVDVCMTMERKFYFNLQEVQEALHANRTKLPYRWSMCS--SMINYSDTDG  261

Query  1151  DANVVPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKG  1330
             + N++PL++++++ +IP+W++SGDQDSVVPL+GSRT+VRELA D+K  ITVPY  WFHKG
Sbjct  262   NINILPLIRRIIEFQIPVWVFSGDQDSVVPLLGSRTLVRELAHDLKFKITVPYGTWFHKG  321

Query  1331  QVGGWQTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNTTSIPI  1492
             QVGGW  EYGNLLTFATVRGAAHMVPYAQP RALHLFSSF+ GRRLPN+T   I
Sbjct  322   QVGGWVIEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVGGRRLPNSTRPSI  375



>ref|XP_007021534.1| Serine carboxypeptidase 44 [Theobroma cacao]
 gb|EOY13059.1| Serine carboxypeptidase 44 [Theobroma cacao]
Length=472

 Score =   393 bits (1009),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 211/445 (47%), Positives = 280/445 (63%), Gaps = 12/445 (3%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P  DL+  LPGQP V+FRQFS Y+D+DEKAGRSLFYYFVEAEKD    L LT+WL  G  
Sbjct  30    PMNDLIEKLPGQPNVTFRQFSDYIDIDEKAGRSLFYYFVEAEKD-PMNLSLTIWL-TGGP  87

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
                  G  F  +GPF  + +  GL  N  SW K +NLLF++SP G GWSYSNTSSDY  G
Sbjct  88    GCGSVGDGFLSVGPFITTANAHGLQRNPYSWIKVTNLLFIDSPIGAGWSYSNTSSDYEVG  147

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D ST +D+L F+ +W+EK+P F  R L+L G SYAGH+IP   + ++D+NK     KFNI
Sbjct  148   DDSTNKDLLTFILQWFEKYPNFKSRDLYLGGSSYAGHFIPNFVNTLLDYNKQSTSFKFNI  207

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNEC---DFDDYSFIYPHNESDS  862
             KG+ALGNPLL+   D  AV +F WS G+I+   +  I  EC   D D+YS       S+S
Sbjct  208   KGLALGNPLLRNKLDTLAVYDFFWSRGMININLHQQILKECNGIDEDNYS-NNATKWSES  266

Query  863   CNAAINDQNRAvsdyinvydvivdv----cyPSIVE-QELRLHKAVTKMSMGIDVCMGSE  1027
             C  A++    A     ++             P   + ++L L K VTK+S  +D+C+   
Sbjct  267   CQQAMDKAEMAAFIVSSINVAKARRFDVLRDPCDEKWEDLVLGKEVTKVSYEVDMCIPFR  326

Query  1028  RTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLW  1207
               FYFN+PEVQKA H N+TNL Y WK C + S LKY+  D D +++P LKK+LQ  IP+ 
Sbjct  327   ADFYFNIPEVQKAFHGNQTNLGYQWKGCFEKSGLKYSDVDKDIDMIPALKKILQQSIPIT  386

Query  1208  IYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVR  1387
             I+SGDQD++VP VG+   V +LA DMK+ +T    AW H+ + GGW   YGNLLT+ TV+
Sbjct  387   IFSGDQDAIVPTVGTLNHVNKLAKDMKLNLTKD-EAWNHENKGGGWMYSYGNLLTYMTVK  445

Query  1388  GAAHMVPYAQPGRALHLFSSFIRGR  1462
             GA H V +++P  AL +F++ +  R
Sbjct  446   GANHHVTFSKPSEALFIFTNIVLNR  470



>ref|XP_007021532.1| Serine carboxypeptidase 44 [Theobroma cacao]
 gb|EOY13057.1| Serine carboxypeptidase 44 [Theobroma cacao]
Length=464

 Score =   390 bits (1003),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 212/445 (48%), Positives = 279/445 (63%), Gaps = 12/445 (3%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P  DL+  LPGQP V+F+QFSGY+DVD KAGRSLFYYFVEAE D  +R PLT+WL  G  
Sbjct  22    PMNDLIEKLPGQPNVTFKQFSGYIDVDGKAGRSLFYYFVEAENDPMKR-PLTIWL-TGGP  79

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
                  G  F  +GPF  + +  GL  N  SW K SNLLF++SP G GWSYSNTSSDY  G
Sbjct  80    GCGSVGDGFLSVGPFITTANAHGLQRNLYSWIKVSNLLFIDSPIGAGWSYSNTSSDYEVG  139

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D ST +D+L  + +W+EK+P F  R L+L G SYAGH+IP  A+ ++D+NK     KFNI
Sbjct  140   DDSTNKDLLTLILQWFEKYPNFKSRDLYLGGSSYAGHFIPNFANALLDYNKQSNNFKFNI  199

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNEC---DFDDYSFIYPHNESDS  862
             KG+ALGNPLL+   D  A+ +F WS G+I+   +  I  EC   D D+YS       S+S
Sbjct  200   KGLALGNPLLRNKLDTLALYDFFWSRGMININLHQQILKECNGIDEDNYS-NNATKWSES  258

Query  863   CNAAINDQNRAvsdyinvydvivd---vcyPSIVE--QELRLHKAVTKMSMGIDVCMGSE  1027
             C  A+N    A     ++         V   S  E  ++L L K VTK+S  +D+C+   
Sbjct  259   CQQAMNKAESAAFVVSSINVAKASRFDVLRASCDENWEDLVLGKEVTKVSYDVDMCIPFR  318

Query  1028  RTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLW  1207
               FYFN+PEVQKA H NRTNL Y WK C + S LK++  D D +++P LKK+LQ  IP+ 
Sbjct  319   VDFYFNIPEVQKAFHGNRTNLGYQWKGCFEKSGLKFSDVDKDIDMLPALKKILQQSIPIT  378

Query  1208  IYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVR  1387
             I+SGDQD++VP VG+   V +LA DM + +T    AW H  + GGW   YG+LLT  TV+
Sbjct  379   IFSGDQDAIVPTVGTLNHVNKLAKDMNLNLTKD-EAWNHGNKGGGWMYSYGDLLTLMTVK  437

Query  1388  GAAHMVPYAQPGRALHLFSSFIRGR  1462
             GA H V +++P  AL +F++ +  R
Sbjct  438   GANHHVTFSKPSEALFIFTNAVINR  462



>ref|XP_007021681.1| Serine carboxypeptidase 44 [Theobroma cacao]
 gb|EOY13206.1| Serine carboxypeptidase 44 [Theobroma cacao]
Length=464

 Score =   388 bits (997),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 214/445 (48%), Positives = 278/445 (62%), Gaps = 12/445 (3%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P  DL+  LPGQP V+FRQFSGY+DVDE AGRSLFYYFVEAE D   R PLT+WL  G  
Sbjct  22    PMNDLIEKLPGQPNVTFRQFSGYIDVDENAGRSLFYYFVEAENDPMNR-PLTIWL-TGGP  79

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
                  G  F  +GPF  + +  GL  N  SW KASNLLF++SP G GWSYSNTSSD+  G
Sbjct  80    GCGSVGDGFLSVGPFITTANAHGLQRNLYSWIKASNLLFIDSPIGEGWSYSNTSSDHEVG  139

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D ST +D+L F+ +W EK+P F  R L+L G SYAGH+IP LA+ ++D+NK     KFNI
Sbjct  140   DESTNKDLLTFILQWSEKYPNFKSRDLYLGGSSYAGHFIPNLANALLDYNKQSNNFKFNI  199

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNEC---DFDDYSFIYPHNESDS  862
             KG+ALGNPLL+   D  A+ +F WS G+I+   +  I  EC   D D+YS       S  
Sbjct  200   KGLALGNPLLRNKLDTLAIYDFFWSRGMININLHQQILKECNGIDEDNYS-NNATKWSKL  258

Query  863   CNAAINDQNRAvsdyinvydvivd---vcyPSIVE--QELRLHKAVTKMSMGIDVCMGSE  1027
             C  A++    A     ++         V   S  E  ++L L K VTK+S  +D+C+   
Sbjct  259   CQEAMDKAELAAFVLSSINAAKTSHFDVLRASCNEKWEDLVLGKEVTKVSYEVDMCILFR  318

Query  1028  RTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLW  1207
               FYFN+PEVQKA H NRTNL Y WK C + S LKY+  D D +++P LKK+LQ  IP+ 
Sbjct  319   ADFYFNIPEVQKAFHGNRTNLGYQWKGCFEKSGLKYSDADKDIDMLPALKKILQQSIPIT  378

Query  1208  IYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVR  1387
             I+SGDQD++VP VG+   V +LA DM + +T    AW H+ + GGW   Y NLLT  TV+
Sbjct  379   IFSGDQDAIVPTVGTLNHVNKLAKDMNLNLTKD-EAWNHENKGGGWMYSYDNLLTLMTVK  437

Query  1388  GAAHMVPYAQPGRALHLFSSFIRGR  1462
             GA H V +++P  AL +F++ +  R
Sbjct  438   GANHHVTFSKPFEALFIFTNIVINR  462



>ref|XP_010271868.1| PREDICTED: serine carboxypeptidase-like 45 isoform X4 [Nelumbo 
nucifera]
Length=503

 Score =   384 bits (985),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 215/443 (49%), Positives = 299/443 (67%), Gaps = 15/443 (3%)
 Frame = +2

Query  155   EEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgc  334
             E D ++ LPGQPEV+F+Q+SGY+ VDE+  R+LFYYFVEAE +   + PL LW+NGGPGC
Sbjct  69    EADRIIKLPGQPEVNFQQYSGYITVDEEQQRALFYYFVEAETNPASK-PLVLWVNGGPGC  127

Query  335   ssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYS-NTSSDYTCG  511
             SSIG GAF+E GPF PSG  + L+ N  SWNK +N+L++E+PAGVG+SYS NTS  Y   
Sbjct  128   SSIGTGAFSEHGPFRPSG--KNLVRNEYSWNKEANMLYLETPAGVGFSYSTNTSYYYGVN  185

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D  TA D L+FM++W +KFPE  ++ LF+TGESYAGHY+PQLA LMI  N       FN+
Sbjct  186   DEMTARDNLVFMQRWLDKFPEHKNKDLFITGESYAGHYVPQLAQLMIQFNDQ---KLFNL  242

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCN  868
             KG+ALGNPLL+   D  +  EF+WSHG+ISD  Y    ++C++  + S  Y  + S  C 
Sbjct  243   KGIALGNPLLEFTTDFNSRAEFLWSHGLISDSTYGFFTSDCNYSRFLSKYYRGSVSSVCL  302

Query  869   AAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVT--KMSMGIDVCMGSERTFYF  1042
               ++  NR +S +I+ YDV + VC  SI+ Q     KA+T  K+    DVC+  E   Y 
Sbjct  303   RVVSLVNREISRFIDEYDVTLSVCVSSILSQS----KALTPQKVVESTDVCVEDETYNYL  358

Query  1043  NLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGD  1222
             N  +VQK+LHA+   +   W  C +Y ++KY+  + + + +P+L  L +  I + +YSGD
Sbjct  359   NRDDVQKSLHAHLVGVS-GWIACTNYRVIKYDMLNLEVSTIPVLSSLSRSGIKILVYSGD  417

Query  1223  QDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHM  1402
             QDS++PL G+RT+V  LA ++ +  TVPY  WF   QVGGW   YG++LTFAT+RG +H 
Sbjct  418   QDSIIPLTGTRTLVHRLANELGLNTTVPYRVWFEGKQVGGWTQVYGDILTFATIRGGSHE  477

Query  1403  VPYAQPGRALHLFSSFIRGRRLP  1471
              P++QP R+L LF+SF++G+ LP
Sbjct  478   APFSQPQRSLVLFNSFLKGKPLP  500



>ref|XP_002862434.1| hypothetical protein ARALYDRAFT_497456 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38692.1| hypothetical protein ARALYDRAFT_497456 [Arabidopsis lyrata subsp. 
lyrata]
Length=452

 Score =   345 bits (886),  Expect(3) = 1e-122, Method: Compositional matrix adjust.
 Identities = 170/275 (62%), Positives = 214/275 (78%), Gaps = 2/275 (1%)
 Frame = +2

Query  668   FKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPH  847
              KG +FNIKG+A+GNP LKLDRDV A  EF WSHG+ISDE  + I ++CDF DY++IYPH
Sbjct  178   LKGVQFNIKGIAIGNPFLKLDRDVRAAFEFFWSHGMISDEVGHTIMSQCDFLDYTYIYPH  237

Query  848   NESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSE  1027
             N S +CN AI +   ++++Y+N YD ++D+CYPSIV +ELRL +  TKMSMG+DVCM  E
Sbjct  238   NLSVACNDAIREAGNSITEYVNNYDFLLDICYPSIVLKELRLKQMATKMSMGVDVCMTYE  297

Query  1028  RTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLW  1207
             R  YFNLPEVQ ALHANRT+LPY W  C++  LL Y+  D + N++P LK+++Q+KIP+W
Sbjct  298   RQLYFNLPEVQMALHANRTHLPYSWSMCSN--LLNYSGIDANINMLPTLKRVIQNKIPVW  355

Query  1208  IYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVR  1387
             I+SGDQDSVVP +G+RT+VRELA D+    TVPY  WFHK QVGGW  +YGN+LTFATVR
Sbjct  356   IFSGDQDSVVPFLGTRTVVRELANDLNFKTTVPYGVWFHKRQVGGWAIDYGNILTFATVR  415

Query  1388  GAAHMVPYAQPGRALHLFSSFIRGRRLPNTTSIPI  1492
             GAAH V   QP RALHLFS+F+RG RLPN T I +
Sbjct  416   GAAHAVANTQPSRALHLFSTFLRGHRLPNKTDIAM  450


 Score =   107 bits (267),  Expect(3) = 1e-122, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 71/84 (85%), Gaps = 1/84 (1%)
 Frame = +2

Query  152  PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
            PE DLVV LPGQ +V+FRQ++GYVD+D  AGRSLFYYFVEAE+    + PLTLWLNGGPG
Sbjct  28   PEADLVVRLPGQLKVAFRQYAGYVDLDMNAGRSLFYYFVEAEEHPDTK-PLTLWLNGGPG  86

Query  332  cssigggAFTELGPFFPSGDGRGL  403
            CSS  GGAFTELGPF+P+GDG GL
Sbjct  87   CSSGCGGAFTELGPFYPTGDGGGL  110


 Score = 38.5 bits (88),  Expect(3) = 1e-122, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 35/65 (54%), Gaps = 0/65 (0%)
 Frame = +3

Query  423  GTKHRTFCLLSLRPE*DGHTRTQVVITLVGISALRRICLYS*KNGMKNSQNFLTDLCFSP  602
            G +HRT CL S R E DG T T+ +IT    S L  IC  S  +G  +SQ+      FS 
Sbjct  109  GLRHRTCCLWSDRLELDGLTPTEALITTPVTSLLPAICSCSCWDGSTSSQSSSLATSFSL  168

Query  603  VKAMQ  617
            VK MQ
Sbjct  169  VKTMQ  173



>ref|XP_010271867.1| PREDICTED: serine carboxypeptidase-like 45 isoform X3 [Nelumbo 
nucifera]
Length=504

 Score =   383 bits (983),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 215/444 (48%), Positives = 299/444 (67%), Gaps = 16/444 (4%)
 Frame = +2

Query  155   EEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgc  334
             E D ++ LPGQPEV+F+Q+SGY+ VDE+  R+LFYYFVEAE +   + PL LW+NGGPGC
Sbjct  69    EADRIIKLPGQPEVNFQQYSGYITVDEEQQRALFYYFVEAETNPASK-PLVLWVNGGPGC  127

Query  335   ssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYS-NTSSDYTCG  511
             SSIG GAF+E GPF PSG  + L+ N  SWNK +N+L++E+PAGVG+SYS NTS  Y   
Sbjct  128   SSIGTGAFSEHGPFRPSG--KNLVRNEYSWNKEANMLYLETPAGVGFSYSTNTSYYYGVN  185

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D  TA D L+FM++W +KFPE  ++ LF+TGESYAGHY+PQLA LMI  N       FN+
Sbjct  186   DEMTARDNLVFMQRWLDKFPEHKNKDLFITGESYAGHYVPQLAQLMIQFNDQ---KLFNL  242

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCN  868
             KG+ALGNPLL+   D  +  EF+WSHG+ISD  Y    ++C++  + S  Y  + S  C 
Sbjct  243   KGIALGNPLLEFTTDFNSRAEFLWSHGLISDSTYGFFTSDCNYSRFLSKYYRGSVSSVCL  302

Query  869   AAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVT---KMSMGIDVCMGSERTFY  1039
               ++  NR +S +I+ YDV + VC  SI+ Q     KA+T   K+    DVC+  E   Y
Sbjct  303   RVVSLVNREISRFIDEYDVTLSVCVSSILSQS----KALTPQQKVVESTDVCVEDETYNY  358

Query  1040  FNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSG  1219
              N  +VQK+LHA+   +   W  C +Y ++KY+  + + + +P+L  L +  I + +YSG
Sbjct  359   LNRDDVQKSLHAHLVGVS-GWIACTNYRVIKYDMLNLEVSTIPVLSSLSRSGIKILVYSG  417

Query  1220  DQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAH  1399
             DQDS++PL G+RT+V  LA ++ +  TVPY  WF   QVGGW   YG++LTFAT+RG +H
Sbjct  418   DQDSIIPLTGTRTLVHRLANELGLNTTVPYRVWFEGKQVGGWTQVYGDILTFATIRGGSH  477

Query  1400  MVPYAQPGRALHLFSSFIRGRRLP  1471
               P++QP R+L LF+SF++G+ LP
Sbjct  478   EAPFSQPQRSLVLFNSFLKGKPLP  501



>ref|XP_009778790.1| PREDICTED: serine carboxypeptidase-like 45 [Nicotiana sylvestris]
Length=457

 Score =   380 bits (976),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 220/455 (48%), Positives = 298/455 (65%), Gaps = 10/455 (2%)
 Frame = +2

Query  113   LLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHR  292
              L C   G    +P  D ++ LPGQP+V F+QFSGYV VD+K  RSLFYYFVEAE +   
Sbjct  8     FLLCAFVGIRNAFPHPDKIILLPGQPQVGFQQFSGYVTVDDKKQRSLFYYFVEAETNPAS  67

Query  293   RLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVG  472
             + PL LWLNGGPGCSS+G GAF+E GPF P  +G+ L+ N  SWNK +N+L++ESP GVG
Sbjct  68    K-PLVLWLNGGPGCSSLGVGAFSENGPFRP--NGQVLVKNEYSWNKEANMLYLESPIGVG  124

Query  473   WSYS-NTSSDYTCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLM  649
             +SYS NTS+  T  D +TA D ++F+++W+ KFP++ +  LFLTGESYAGHY+PQLA LM
Sbjct  125   FSYSTNTSAYETVNDETTARDNVVFLQRWFNKFPQYRNNNLFLTGESYAGHYVPQLAKLM  184

Query  650   IDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY  829
             I+ N+  K   FN+KGVALGNP+L+   D  +  E+ WSHG+ISD  Y    + C++  Y
Sbjct  185   IELNQ--KKKLFNLKGVALGNPVLEFATDFNSRAEYFWSHGLISDSTYKMFTSFCNYSRY  242

Query  830   -SFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGI  1006
              S  Y  N S  C+  ++   R  S +++ YDV +DVC  S++ Q   +       +  I
Sbjct  243   VSEYYRENVSPMCSRVMSLVTRETSKFVDKYDVTLDVCLSSVLSQSKIISPQENADTEKI  302

Query  1007  DVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLL  1186
             DVC+  +   Y N  +V++ALHA    +   W  C++  +L Y   D +   + ++  L+
Sbjct  303   DVCIDDKTVNYLNRQDVRRALHAKLVGV-RRWDVCSN--VLDYQLLDIEIPTIYIVGLLV  359

Query  1187  QHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNL  1366
             + +IP+ IYSGDQDSVVPL GSRT+V +LA  M +  TVPY  WF   QVGGW   Y N+
Sbjct  360   KERIPVLIYSGDQDSVVPLTGSRTVVHQLAKRMGLNTTVPYRVWFAGQQVGGWTIVYDNI  419

Query  1367  LTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLP  1471
             L+FATVRGAAH VP++QP R+L LF SF+ GR LP
Sbjct  420   LSFATVRGAAHEVPFSQPERSLVLFKSFLEGRALP  454



>ref|XP_008222371.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Prunus 
mume]
Length=464

 Score =   380 bits (976),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 215/444 (48%), Positives = 296/444 (67%), Gaps = 16/444 (4%)
 Frame = +2

Query  155   EEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgc  334
             E D++  LPGQP+V F+Q+SGYV VDEK  R+LFYYF EAE D   + PL LWLNGGPGC
Sbjct  33    ELDIIALLPGQPQVGFQQYSGYVTVDEKKQRALFYYFAEAEIDPASK-PLVLWLNGGPGC  91

Query  335   ssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDY-TCG  511
             SS+G GAF+E GPF PSG+   L+ N  SWN+ +N+L++E+P GVG+SYS  +S Y    
Sbjct  92    SSLGVGAFSENGPFRPSGEV--LVRNEHSWNREANMLYLETPIGVGFSYSTDTSSYEAVN  149

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D  TA D L+F++KW EKFP++ +R LF+TGESYAGHY+PQLA LM+     +K ++FN+
Sbjct  150   DHITARDNLLFLQKWLEKFPQYKNRSLFITGESYAGHYVPQLAELML----QYKDYQFNL  205

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCN  868
             KG+ALGNP+L+   D  +  EF WSHG+ISD  Y    + C++  Y S  Y  + S  C+
Sbjct  206   KGIALGNPVLEYTTDFNSRAEFFWSHGLISDSTYKMFTSVCNYSRYVSEYYRGSVSPICS  265

Query  869   AAINDQNRAvsdyinvydvivdvcyPSIVEQ-ELRLHKAVTKMSMGIDVCMGSERTFYFN  1045
               ++  +R  S +++ YDV +DVC  S+  Q ++ L + VT+    IDVC+  E   Y N
Sbjct  266   RVMSQVSRETSKFVDKYDVTLDVCISSVFSQSKVLLPQQVTE---AIDVCVEDEIVNYLN  322

Query  1046  LPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQ  1225
              P+VQKALHA    +   W  C++  +L Y   D +   + ++ KL++  IP+ +YSGDQ
Sbjct  323   RPDVQKALHARLVGV-RQWAVCSN--ILDYQLLDVEIPTITIVGKLIKAGIPVLVYSGDQ  379

Query  1226  DSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMV  1405
             DSV+PL GSRT+V  LA  + +  TVPY  WF   QVGGW   YGN+L+FAT+RGA+H  
Sbjct  380   DSVIPLTGSRTLVHRLAEQLGLNTTVPYRVWFEGQQVGGWTQAYGNMLSFATIRGASHEA  439

Query  1406  PYAQPGRALHLFSSFIRGRRLPNT  1477
             P++QP R+L LF SF+ G+ LP  
Sbjct  440   PFSQPERSLVLFKSFLEGQPLPEV  463



>ref|XP_009415855.1| PREDICTED: serine carboxypeptidase-like 45 [Musa acuminata subsp. 
malaccensis]
Length=467

 Score =   380 bits (976),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 217/443 (49%), Positives = 297/443 (67%), Gaps = 12/443 (3%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             D +  LPGQP+V+F+QFSGY+ VDE   R+LFYYFVEAE D   + PL LWLNGGPGCSS
Sbjct  32    DRITKLPGQPQVTFQQFSGYITVDELQKRALFYYFVEAEMDPSSK-PLVLWLNGGPGCSS  90

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYT-CGDI  517
             +G GAF+E GPF PSG  + L+ N  SWNK +N+L++E+PAGVG+SYS  SS Y    D 
Sbjct  91    LGVGAFSENGPFRPSG--QVLVRNEYSWNKEANMLYLEAPAGVGFSYSGDSSFYDGVNDK  148

Query  518   STAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKG  697
              TA D L+F+++W+ KFP + +R L++TGESYAGHY+PQLA LM++ NK  K   FN+KG
Sbjct  149   KTAWDNLVFLQRWFNKFPGYKNRDLYITGESYAGHYVPQLAQLMVEFNK--KAKIFNLKG  206

Query  698   VALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCNAA  874
             +A+GNP+L+   D  +  EF WSHG+ISD  Y    + C++  Y S  Y  + S  C   
Sbjct  207   IAMGNPVLEFATDFNSRAEFFWSHGLISDSTYRIFTSACNYSRYVSEYYRGSLSPVCARV  266

Query  875   INDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPE  1054
             ++   R  S +++ YDV +DVC  S++ Q L L     ++   IDVC+  E   Y N  +
Sbjct  267   MSQVTRETSRFVDKYDVTLDVCISSVLSQSLVLSPQ--QVPENIDVCIEDETVNYLNRKD  324

Query  1055  VQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSV  1234
             VQ ALHA  T +   W  C+  S+L+Y   + +   + L+  LL+ +IP+ +YSGDQDSV
Sbjct  325   VQDALHARLTGVT-KWTVCS--SVLQYELLNLEIPTITLVGSLLKARIPVLVYSGDQDSV  381

Query  1235  VPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYA  1414
             +PL GSRT+V++LA +M +  TVPY  WF   QVGGW   YG++L+FAT+RGA+H  P++
Sbjct  382   IPLTGSRTLVQKLANEMGLKTTVPYRVWFEGKQVGGWTQVYGDILSFATIRGASHEAPFS  441

Query  1415  QPGRALHLFSSFIRGRRLPNTTS  1483
             QP R+L LF SF++GR LP T S
Sbjct  442   QPERSLVLFRSFLQGRPLPETFS  464



>gb|ABK25202.1| unknown [Picea sitchensis]
Length=462

 Score =   379 bits (974),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 221/445 (50%), Positives = 299/445 (67%), Gaps = 12/445 (3%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             PE DLV  LPGQP V+F+Q++GYV VDEK+GR+LFYYFVEAE D + + PL +WLNGGPG
Sbjct  21    PESDLVDRLPGQPAVTFKQYAGYVTVDEKSGRALFYYFVEAETDSNLK-PLVVWLNGGPG  79

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYT-C  508
             CSS G GA +E GPF P G G+ L  N  SWNK +N+L++E+PAGVG+SYSN ++ Y   
Sbjct  80    CSSFGVGALSENGPFHPRG-GK-LFGNEYSWNKEANMLYLETPAGVGFSYSNDTTYYLGA  137

Query  509   GDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFN  688
              D  TAED L F+  W++KFPE+  R L+LTGESYAGHYIPQ A L+++ N+  K   FN
Sbjct  138   NDAKTAEDNLQFLHGWFDKFPEYKTRDLYLTGESYAGHYIPQWAELIVEANR--KEKIFN  195

Query  689   IKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSC  865
             +KG+A+GNPLL    D  A  E++WSHG+ISD  YN ++  C++  Y    Y    S +C
Sbjct  196   LKGIAIGNPLLDFFTDFNARAEYLWSHGLISDPTYNNMKTGCNYTRYVDEYYRGTVSSTC  255

Query  866   NAAINDQNRAvsdyinvydvivdvcyPSIVEQE---LRLHKAVTKMSMGIDVCMGSERTF  1036
                 +  +  +S YI+ YDV +D+C  S+  Q+   L +    T++++  DVC+ +E T 
Sbjct  256   EDVYSTVSMELSQYIDRYDVTLDICLSSVGTQKSKMLGVKTIGTRLAVQPDVCVENEATA  315

Query  1037  YFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYS  1216
             Y N+ +VQKA HA        W +C+D  +L Y+  + +   VPLL KL    I + IYS
Sbjct  316   YLNMVDVQKAFHARLVGNVKRWDSCSD--VLTYDHHNLEIPTVPLLGKLAMTGIRVLIYS  373

Query  1217  GDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAA  1396
             GDQDSV+PL G+RT+V  LAA +K+  TVPYS WF   QV GW   YGN+L+FATVRGA+
Sbjct  374   GDQDSVIPLTGTRTLVNNLAASLKLNSTVPYSVWFQGKQVAGWVQVYGNILSFATVRGAS  433

Query  1397  HMVPYAQPGRALHLFSSFIRGRRLP  1471
             H VP++QP R+L LF +F++G+  P
Sbjct  434   HEVPFSQPERSLVLFKAFLQGQTPP  458



>ref|XP_007021444.1| Serine carboxypeptidase 44 isoform 2 [Theobroma cacao]
 gb|EOY12969.1| Serine carboxypeptidase 44 isoform 2 [Theobroma cacao]
Length=465

 Score =   379 bits (974),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 207/443 (47%), Positives = 274/443 (62%), Gaps = 13/443 (3%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P  DL+  LPGQP V+FRQFSGY+D+D KAGRSLFYYFVEAEKD    LPLT+WL  G  
Sbjct  22    PMNDLIEKLPGQPNVTFRQFSGYIDIDGKAGRSLFYYFVEAEKD-PMNLPLTIWL-TGGP  79

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
                  G  F  +GPF  + +  GL  N  SW K +NLLF++SP G GWSYSNTS DY  G
Sbjct  80    GCGSVGDGFLSVGPFITTANAHGLQRNPYSWIKVTNLLFIDSPIGAGWSYSNTSRDYEVG  139

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKH-FKGHKFN  688
             D ST +D+L F+ +W+EK P F  R L+L G SYAGH+IP  A+ ++D+N +     KFN
Sbjct  140   DDSTNKDLLTFILQWFEKHPNFKSRDLYLGGSSYAGHFIPNFANSLLDYNNNQSNSSKFN  199

Query  689   IKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNEC---DFDDYSFIYPHNESD  859
             IKG+ALGNPLL+   D  AV +F WS G+I+   +  I  EC   D D+YS       S+
Sbjct  200   IKGLALGNPLLRNKLDTLAVYDFFWSRGMININLHQQILKECNGIDEDNYS-NNATKWSE  258

Query  860   SCNAAINDQNRAvsdyinvydvivdv----cyPSIVE-QELRLHKAVTKMSMGIDVCMGS  1024
              C  A++    A     +              P   + ++L L K VTK+S  +D+C+  
Sbjct  259   PCQQAMDKAEMAAFIVSSTNVAKARRFDVLRDPCDEKWEDLVLGKEVTKVSFEVDMCIPF  318

Query  1025  ERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPL  1204
                FYFN+PEVQKA H NRTNL Y WK C + S LKY+  D D +++P LKK+LQ  IP+
Sbjct  319   RADFYFNIPEVQKAFHGNRTNLGYQWKGCFEKSGLKYSDADKDIDMLPALKKILQQSIPI  378

Query  1205  WIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATV  1384
              I+SGDQD++VP +G+   V +LA DM + +T    AW H+ + GGW   Y NLL F TV
Sbjct  379   TIFSGDQDAIVPTIGTLNHVNKLAKDMNLNLTKD-EAWNHENKGGGWMYSYDNLLNFMTV  437

Query  1385  RGAAHMVPYAQPGRALHLFSSFI  1453
             +GA H V +++P  AL +F++ +
Sbjct  438   KGANHHVTFSKPSEALFIFTNIV  460



>ref|XP_007021443.1| Serine carboxypeptidase 44 isoform 1 [Theobroma cacao]
 gb|EOY12968.1| Serine carboxypeptidase 44 isoform 1 [Theobroma cacao]
Length=476

 Score =   380 bits (975),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 207/443 (47%), Positives = 274/443 (62%), Gaps = 13/443 (3%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P  DL+  LPGQP V+FRQFSGY+D+D KAGRSLFYYFVEAEKD    LPLT+WL  G  
Sbjct  33    PMNDLIEKLPGQPNVTFRQFSGYIDIDGKAGRSLFYYFVEAEKD-PMNLPLTIWL-TGGP  90

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
                  G  F  +GPF  + +  GL  N  SW K +NLLF++SP G GWSYSNTS DY  G
Sbjct  91    GCGSVGDGFLSVGPFITTANAHGLQRNPYSWIKVTNLLFIDSPIGAGWSYSNTSRDYEVG  150

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKH-FKGHKFN  688
             D ST +D+L F+ +W+EK P F  R L+L G SYAGH+IP  A+ ++D+N +     KFN
Sbjct  151   DDSTNKDLLTFILQWFEKHPNFKSRDLYLGGSSYAGHFIPNFANSLLDYNNNQSNSSKFN  210

Query  689   IKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNEC---DFDDYSFIYPHNESD  859
             IKG+ALGNPLL+   D  AV +F WS G+I+   +  I  EC   D D+YS       S+
Sbjct  211   IKGLALGNPLLRNKLDTLAVYDFFWSRGMININLHQQILKECNGIDEDNYS-NNATKWSE  269

Query  860   SCNAAINDQNRAvsdyinvydvivdv----cyPSIVE-QELRLHKAVTKMSMGIDVCMGS  1024
              C  A++    A     +              P   + ++L L K VTK+S  +D+C+  
Sbjct  270   PCQQAMDKAEMAAFIVSSTNVAKARRFDVLRDPCDEKWEDLVLGKEVTKVSFEVDMCIPF  329

Query  1025  ERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPL  1204
                FYFN+PEVQKA H NRTNL Y WK C + S LKY+  D D +++P LKK+LQ  IP+
Sbjct  330   RADFYFNIPEVQKAFHGNRTNLGYQWKGCFEKSGLKYSDADKDIDMLPALKKILQQSIPI  389

Query  1205  WIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATV  1384
              I+SGDQD++VP +G+   V +LA DM + +T    AW H+ + GGW   Y NLL F TV
Sbjct  390   TIFSGDQDAIVPTIGTLNHVNKLAKDMNLNLTKD-EAWNHENKGGGWMYSYDNLLNFMTV  448

Query  1385  RGAAHMVPYAQPGRALHLFSSFI  1453
             +GA H V +++P  AL +F++ +
Sbjct  449   KGANHHVTFSKPSEALFIFTNIV  471



>ref|XP_010413849.1| PREDICTED: serine carboxypeptidase-like 46 [Camelina sativa]
Length=465

 Score =   379 bits (974),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 211/439 (48%), Positives = 290/439 (66%), Gaps = 10/439 (2%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             D +  LPGQP V F+Q+SGYV VDEK  R+LFYY  EAE     + PL LWLNGGPGCSS
Sbjct  32    DRITRLPGQPRVGFQQYSGYVTVDEKQQRALFYYLAEAETKPISK-PLVLWLNGGPGCSS  90

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYT-CGDI  517
             +G GAF+E GPF P G    L+ N  SWN+ +N+L++E+P GVG+SY+  SS Y    D 
Sbjct  91    LGVGAFSENGPFRPKGSV--LVKNQHSWNQEANMLYLETPVGVGFSYATESSSYEGVNDK  148

Query  518   STAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKG  697
              TA+D L+F++KW+ KFP++L+R LF+TGESYAGHY+PQLA LMI +NK  K + FN+KG
Sbjct  149   ITAKDNLVFLQKWFLKFPQYLNRSLFITGESYAGHYVPQLAQLMIQYNK--KHNLFNLKG  206

Query  698   VALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCNAA  874
             +A+GNP+++   D  +  E+ WSHG+ISD  Y    + C++  Y S  Y    S  C   
Sbjct  207   IAIGNPVMEFSTDFNSRAEYFWSHGLISDPTYKMFTSYCNYSRYVSEYYRGTVSSMCTKV  266

Query  875   INDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPE  1054
             ++  +   S +++ YDV +DVC PS++ Q  R++    +M   +DVC+  E   Y N  +
Sbjct  267   MSQVSIETSRFVDKYDVTLDVCIPSVLSQSKRVNPQPQQMGEAVDVCVEDETVNYLNRRD  326

Query  1055  VQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSV  1234
             VQKALHA R      W  C++  +L Y   D +   + ++ +L++  +P+ +YSGDQDSV
Sbjct  327   VQKALHA-RLVGTRKWSVCSN--VLDYEVLDVEVPTINIVGRLVKAGVPVLVYSGDQDSV  383

Query  1235  VPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYA  1414
             +PL GSRT+V+ LA ++ +  TVPY  WF   QVGGW   YGN+L FATVRGAAH VP++
Sbjct  384   IPLTGSRTLVKRLADELGLRTTVPYRVWFAGQQVGGWTQVYGNILAFATVRGAAHEVPFS  443

Query  1415  QPGRALHLFSSFIRGRRLP  1471
             QP RAL LF +F+ GR LP
Sbjct  444   QPARALVLFKAFLGGRPLP  462



>ref|XP_004501743.1| PREDICTED: serine carboxypeptidase-like 45-like [Cicer arietinum]
Length=470

 Score =   379 bits (974),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 213/440 (48%), Positives = 296/440 (67%), Gaps = 11/440 (3%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             D +VGLPGQP ++F+QFSGYV VD+K  +SLFYYFVE+E D   + PL LWLNGGPGCSS
Sbjct  36    DRIVGLPGQPHITFQQFSGYVSVDDKKNKSLFYYFVESEIDPPSK-PLVLWLNGGPGCSS  94

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYT--CGD  514
             +G GAF+E GPF P+G+   LI N  SWNK +N+L++E+P GVG+SY+  SS YT    D
Sbjct  95    LGVGAFSENGPFRPNGEF--LIKNEHSWNKEANMLYLETPIGVGFSYAKGSSSYTTTVND  152

Query  515   ISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIK  694
               TA D L+F+++W+ KFP++ +R LFLTGESYAGHY+PQLA LMI+ NK  +   FN+K
Sbjct  153   EETARDNLVFLQRWFNKFPQYRNRDLFLTGESYAGHYVPQLAKLMIEMNK--RNKIFNLK  210

Query  695   GVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNE-SDSCNA  871
             G+ALGNP+L+   D  +  EF WSHG+ISD  YN     C++  Y   Y  +  S  C+ 
Sbjct  211   GIALGNPVLEYATDFNSRAEFFWSHGLISDSTYNMFTTVCNYSRYVSEYNRDSVSPLCSK  270

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
              +   ++  S +++ YDV +DVC  S++ Q   ++    + +  IDVC+  + T Y N  
Sbjct  271   VMGLVSKETSKFVDKYDVTLDVCISSVLSQSKVINPQPQQANERIDVCVDDKVTNYLNRR  330

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             +VQ+ALHA    +   W  C++  +L Y+  + +   +P++  L++  + + IYSGDQDS
Sbjct  331   DVQEALHAKLVGV-RKWDVCSN--ILDYDVLNLEVPTLPIVGSLIKSGVRVLIYSGDQDS  387

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             V+PL GSRT+V++LA  + +  TV Y  WF   QVGGW   YGN+L+FATVRGAAH VP+
Sbjct  388   VIPLTGSRTLVQKLARQLGLNTTVSYRVWFESQQVGGWTQVYGNMLSFATVRGAAHEVPF  447

Query  1412  AQPGRALHLFSSFIRGRRLP  1471
             +QP R+L LF SF+ GR LP
Sbjct  448   SQPERSLVLFKSFLEGRPLP  467



>ref|XP_008222370.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Prunus 
mume]
Length=465

 Score =   379 bits (974),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 212/443 (48%), Positives = 294/443 (66%), Gaps = 13/443 (3%)
 Frame = +2

Query  155   EEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgc  334
             E D++  LPGQP+V F+Q+SGYV VDEK  R+LFYYF EAE D   + PL LWLNGGPGC
Sbjct  33    ELDIIALLPGQPQVGFQQYSGYVTVDEKKQRALFYYFAEAEIDPASK-PLVLWLNGGPGC  91

Query  335   ssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDY-TCG  511
             SS+G GAF+E GPF PSG+   L+ N  SWN+ +N+L++E+P GVG+SYS  +S Y    
Sbjct  92    SSLGVGAFSENGPFRPSGEV--LVRNEHSWNREANMLYLETPIGVGFSYSTDTSSYEAVN  149

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D  TA D L+F++KW EKFP++ +R LF+TGESYAGHY+PQLA LM+     +K ++FN+
Sbjct  150   DHITARDNLLFLQKWLEKFPQYKNRSLFITGESYAGHYVPQLAELML----QYKDYQFNL  205

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCN  868
             KG+ALGNP+L+   D  +  EF WSHG+ISD  Y    + C++  Y S  Y  + S  C+
Sbjct  206   KGIALGNPVLEYTTDFNSRAEFFWSHGLISDSTYKMFTSVCNYSRYVSEYYRGSVSPICS  265

Query  869   AAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNL  1048
               ++  +R  S +++ YDV +DVC  S+  Q  ++     +++  IDVC+  E   Y N 
Sbjct  266   RVMSQVSRETSKFVDKYDVTLDVCISSVFSQS-KVLLPQQQVTEAIDVCVEDEIVNYLNR  324

Query  1049  PEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQD  1228
             P+VQKALHA    +   W  C++  +L Y   D +   + ++ KL++  IP+ +YSGDQD
Sbjct  325   PDVQKALHARLVGV-RQWAVCSN--ILDYQLLDVEIPTITIVGKLIKAGIPVLVYSGDQD  381

Query  1229  SVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVP  1408
             SV+PL GSRT+V  LA  + +  TVPY  WF   QVGGW   YGN+L+FAT+RGA+H  P
Sbjct  382   SVIPLTGSRTLVHRLAEQLGLNTTVPYRVWFEGQQVGGWTQAYGNMLSFATIRGASHEAP  441

Query  1409  YAQPGRALHLFSSFIRGRRLPNT  1477
             ++QP R+L LF SF+ G+ LP  
Sbjct  442   FSQPERSLVLFKSFLEGQPLPEV  464



>ref|XP_009599118.1| PREDICTED: serine carboxypeptidase-like 45 [Nicotiana tomentosiformis]
Length=457

 Score =   379 bits (972),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 219/455 (48%), Positives = 301/455 (66%), Gaps = 10/455 (2%)
 Frame = +2

Query  113   LLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHR  292
              L C   G   G+P+ D ++ LPGQP+V F+QFSGYV VD+K  R+LFYYFVEAE +   
Sbjct  8     FLLCAFVGIANGFPQPDKIILLPGQPQVGFQQFSGYVTVDDKKQRALFYYFVEAEINPAS  67

Query  293   RLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVG  472
             + PL LWLNGGPGCSS+G GAF+E GPF P  +G+ L+ N  SWNK +N+L++ESP GVG
Sbjct  68    K-PLVLWLNGGPGCSSLGVGAFSENGPFRP--NGQVLVKNEYSWNKEANMLYLESPIGVG  124

Query  473   WSYS-NTSSDYTCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLM  649
             +SYS NTSS  T  D++TA D ++F+++W+ KFP++ +  LFLTGESYAGHY+PQLA LM
Sbjct  125   FSYSTNTSSYETVNDVTTARDNVVFLQRWFNKFPQYRNSNLFLTGESYAGHYVPQLAKLM  184

Query  650   IDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY  829
             I+ N+  K   FN+KGVALGNP+L+   D  +  E+ WSHG+ISD  Y    + C++  Y
Sbjct  185   IELNQMKK--LFNLKGVALGNPVLEFATDFNSRAEYFWSHGLISDSTYRMFTSFCNYSRY  242

Query  830   -SFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGI  1006
              S  Y  N S  C+  ++  +R  S +++ YDV +DVC  S+  Q   +       +  I
Sbjct  243   VSEYYRDNVSPMCSRVMSLVSRETSKFVDKYDVTLDVCLSSVFSQSKIICPQENADAEKI  302

Query  1007  DVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLL  1186
             DVC+  +   Y N  +V++ALHA    +   W  C++  +L Y   D +   + ++  L+
Sbjct  303   DVCIDDKTVNYLNREDVRRALHAKLVGV-RRWDVCSN--ILDYQLLDIEIPTISIVGLLV  359

Query  1187  QHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNL  1366
             + +IP+ IYSGDQDSVVPL GSRT++ +LA  M +  TVPY  WF   QVGGW   Y N+
Sbjct  360   KERIPVLIYSGDQDSVVPLTGSRTVIHQLAKRMGLNTTVPYRVWFAGQQVGGWTVVYDNI  419

Query  1367  LTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLP  1471
             L+FATVRGA+H VP++QP R+L LF SF+ GR LP
Sbjct  420   LSFATVRGASHEVPFSQPERSLVLFKSFLEGRALP  454



>ref|XP_010469459.1| PREDICTED: serine carboxypeptidase-like 46 [Camelina sativa]
Length=466

 Score =   379 bits (972),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 209/439 (48%), Positives = 291/439 (66%), Gaps = 10/439 (2%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             D +  LPGQP V F+Q+SGYV++DEK  R+LFYY  EAE     + PL LWLNGGPGCSS
Sbjct  33    DRITRLPGQPRVGFQQYSGYVNIDEKKQRALFYYLAEAETKPISK-PLVLWLNGGPGCSS  91

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYT-CGDI  517
             +G GAF+E GPF P G    L+ N  SWN+ +N+L++E+P GVG+SY+  SS Y    D 
Sbjct  92    VGVGAFSENGPFRPKGSV--LVKNQHSWNQEANMLYLETPVGVGFSYATESSSYEGVNDK  149

Query  518   STAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKG  697
              TA+D L+F++KW+ KFP++L+R LF+TGESYAGHY+PQLA LMI +NK  K + FN+KG
Sbjct  150   ITAKDNLVFLQKWFLKFPQYLNRSLFITGESYAGHYVPQLAQLMIQYNK--KHNLFNLKG  207

Query  698   VALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCNAA  874
             +A+GNP+++   D  +  E+ WSHG+ISD  Y    + C++  Y S  Y    S  C   
Sbjct  208   IAIGNPVMEFSTDFNSRAEYFWSHGLISDPTYKMFTSYCNYSRYVSEYYRGTVSSMCTKV  267

Query  875   INDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPE  1054
             ++  +   S +++ YDV +DVC PS++ Q  R++    ++   +DVC+  E   Y N  +
Sbjct  268   MSQVSIETSRFVDKYDVTLDVCIPSVLSQSKRVNPQPQQVGEAVDVCVEDETVNYLNRRD  327

Query  1055  VQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSV  1234
             VQKALHA R     +W  C++  +L Y   D +   + ++  L++  +P+ +YSGDQDSV
Sbjct  328   VQKALHA-RLVGTRNWAVCSN--VLDYEVLDVEVPTINIVGSLVKAGVPVLVYSGDQDSV  384

Query  1235  VPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYA  1414
             +PL GSRT+V+ LA ++ +  TVPY  WF   QVGGW   YGN+L FATVRGAAH VP++
Sbjct  385   IPLTGSRTLVKRLAEELGLRTTVPYRVWFAGQQVGGWTQVYGNILAFATVRGAAHEVPFS  444

Query  1415  QPGRALHLFSSFIRGRRLP  1471
             QP RAL LF +F+ GR LP
Sbjct  445   QPARALVLFKAFMGGRPLP  463



>ref|XP_010929656.1| PREDICTED: serine carboxypeptidase-like 45 [Elaeis guineensis]
Length=463

 Score =   378 bits (970),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 215/457 (47%), Positives = 297/457 (65%), Gaps = 12/457 (3%)
 Frame = +2

Query  113   LLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHR  292
             L  C           +D +  LPGQP+VSF+QFSGY+ VD++  R+LFYYF EAE D + 
Sbjct  16    LQLCSSRELESNLSLQDKITKLPGQPQVSFQQFSGYITVDDRKQRALFYYFAEAELDPYT  75

Query  293   RLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVG  472
             + PL LWLNGGPGCSS+G GAF+E GPF PSG  + L+ N  SWNK +N+L++E+PAGVG
Sbjct  76    K-PLVLWLNGGPGCSSVGVGAFSENGPFRPSG--QVLVRNEFSWNKEANMLYLETPAGVG  132

Query  473   WSYSNTSSDYT-CGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLM  649
             +SY+  SS Y    D  TA D L+F+ +W+ KFP++ DR L++TGESYAGHY+PQLA LM
Sbjct  133   FSYATDSSYYDGVDDKMTARDNLVFLLRWFTKFPQYKDRDLYITGESYAGHYVPQLAELM  192

Query  650   IDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY  829
             +  NK  K + FN+KG+ALGNP+L+   D  +  EF WSHG+ISD  Y      C++  Y
Sbjct  193   VLFNK--KKNVFNLKGIALGNPVLEFSTDFNSRAEFFWSHGLISDSTYRIFTYACNYSRY  250

Query  830   -SFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGI  1006
              S  Y  + S  C   +    R  S +++ YDV +DVC  S++ Q   L     ++   I
Sbjct  251   VSEYYRGSLSPVCARVMGQVTRETSRFVDKYDVTLDVCISSVLSQSKVLSPQ--QVPEHI  308

Query  1007  DVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLL  1186
             DVC+  E   Y N  +VQ A+HA  T +P  W  C+  S+L+Y   + +   + ++  L+
Sbjct  309   DVCVEDETVNYLNRKDVQDAMHARLTGVP-KWSVCS--SVLEYELLNLEIPTISVVGSLV  365

Query  1187  QHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNL  1366
             +  IP+ +YSGDQDSV+PL GSRT+V+ LA ++K+  TVPY  WF   QVGGW   YG++
Sbjct  366   RSGIPVLVYSGDQDSVIPLTGSRTLVQRLAKELKLKTTVPYRVWFEDKQVGGWTQVYGDI  425

Query  1367  LTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNT  1477
             LTFAT+RGA+H  P++QP R+L LF +F++GR LP T
Sbjct  426   LTFATIRGASHEAPFSQPERSLVLFRAFLQGRPLPET  462



>ref|XP_009378815.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=462

 Score =   377 bits (968),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 212/441 (48%), Positives = 291/441 (66%), Gaps = 14/441 (3%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             D + GLPGQP V F+Q+SGYV VD K  R+LFYYF EAE D   + PL LWLNGGPGCSS
Sbjct  33    DRITGLPGQPPVGFQQYSGYVTVDAKKQRALFYYFAEAEIDPASK-PLVLWLNGGPGCSS  91

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDY-TCGDI  517
             +G GAF+E GPF P G+   L+ N  SWN+ +N+L++E+P GVG+SYS  +S Y    D 
Sbjct  92    LGVGAFSENGPFRPKGEV--LVRNEHSWNREANMLYLETPIGVGFSYSTDTSSYEAVADH  149

Query  518   STAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKG  697
              TA D L+F++KW+EKFP++ +R L++TGESYAGH++PQLA LM+     FK H FN+KG
Sbjct  150   ITARDNLLFLQKWFEKFPQYRNRSLYITGESYAGHFVPQLAELML----QFKEHHFNLKG  205

Query  698   VALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCNAA  874
             +ALGNP+L+   D  +  EF WSHG+ISD  Y    + C++  + S  Y  + S  C+  
Sbjct  206   IALGNPVLEYATDFNSRAEFFWSHGLISDSTYKMFSSVCNYSRFVSEYYRGSVSPICSRV  265

Query  875   INDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPE  1054
             ++  +R  S +++ YDV +DVC  S+  Q   L     +++  IDVC+  E   Y N P+
Sbjct  266   MSQVSRETSKFVDKYDVTLDVCISSVFSQSKALLP--QQVADSIDVCVEDEVVNYLNRPD  323

Query  1055  VQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSV  1234
             VQKALHA    +   W  C++  +L Y   D +   + ++ KL++  IP+ +YSGDQDSV
Sbjct  324   VQKALHARLVGV-RQWAVCSN--ILDYQVLDVEIPTITIVGKLIKAGIPVLVYSGDQDSV  380

Query  1235  VPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYA  1414
             +PL GSRT+V  LA  +++  TVPY  WF   QVGGW   YGN+L+FATVRGA+H  P++
Sbjct  381   IPLTGSRTLVHGLAEQLRLNTTVPYRVWFEGQQVGGWTQVYGNILSFATVRGASHEAPFS  440

Query  1415  QPGRALHLFSSFIRGRRLPNT  1477
             QP R+L LF SF++GR LP  
Sbjct  441   QPERSLVLFKSFLKGRPLPEV  461



>ref|XP_007223032.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
 gb|EMJ24231.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
Length=464

 Score =   377 bits (967),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 215/444 (48%), Positives = 293/444 (66%), Gaps = 16/444 (4%)
 Frame = +2

Query  155   EEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgc  334
             E D +  LPGQP+V F+Q+SGYV VDEK  R+LFYYF EAE D   + PL LWLNGGPGC
Sbjct  33    ELDRIALLPGQPQVGFQQYSGYVTVDEKKQRALFYYFAEAEIDPASK-PLVLWLNGGPGC  91

Query  335   ssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDY-TCG  511
             SS+G GAF+E GPF PSG+   L+ N  SWN+ +N+L++E+P GVG+SYS  +S Y    
Sbjct  92    SSLGVGAFSENGPFRPSGEV--LVRNEHSWNREANMLYLETPIGVGFSYSTDTSSYEAVN  149

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D  TA D L+F++ W EKFP++ +R LF+TGESYAGHY+PQLA LM+     +K ++FN+
Sbjct  150   DHITARDNLLFLQNWLEKFPQYKNRSLFITGESYAGHYVPQLAELML----QYKEYQFNL  205

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCN  868
             KG+ALGNP+L+   D  +  EF WSHG+ISD  Y    + C++  Y S  Y  + S  C+
Sbjct  206   KGIALGNPVLEYTTDFNSRAEFFWSHGLISDSTYKMFTSVCNYSRYVSEYYRGSVSPICS  265

Query  869   AAINDQNRAvsdyinvydvivdvcyPSIVEQ-ELRLHKAVTKMSMGIDVCMGSERTFYFN  1045
               ++  +R  S +++ YDV +DVC  S+  Q ++ L + VT+    IDVC+  E   Y N
Sbjct  266   RVMSQVSRETSKFVDKYDVTLDVCISSVFSQSKVLLPQQVTE---AIDVCVEDEIVNYLN  322

Query  1046  LPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQ  1225
              P+VQKALHA    +   W  C++  +L Y   D +     ++ KL++  IP+ +YSGDQ
Sbjct  323   RPDVQKALHARLVGV-RQWAVCSN--ILDYQLLDVEIPTTTIVGKLIKAGIPVLVYSGDQ  379

Query  1226  DSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMV  1405
             DSV+PL GSRT+V  LA  + +  TVPY  WF   QVGGW   YGN+L+FAT+RGA+H  
Sbjct  380   DSVIPLTGSRTLVHRLAEQLGLNTTVPYRVWFEGQQVGGWTQAYGNILSFATIRGASHEA  439

Query  1406  PYAQPGRALHLFSSFIRGRRLPNT  1477
             P++QP R+L LF SF+ GR LP  
Sbjct  440   PFSQPERSLVLFKSFLEGRPLPEV  463



>gb|KDO83181.1| hypothetical protein CISIN_1g012396mg [Citrus sinensis]
Length=464

 Score =   377 bits (967),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 217/466 (47%), Positives = 299/466 (64%), Gaps = 17/466 (4%)
 Frame = +2

Query  89    VICFVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFV  268
             ++ F  + +  C            D +  LPGQP+V F+Q+SGYV VDEK  R+LFYYF 
Sbjct  8     LVAFAGILIHICLRIQVEAYASLLDRITALPGQPQVGFQQYSGYVTVDEKKQRALFYYFA  67

Query  269   EAEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLF  448
             EAE D   + PL LWLNGGPGCSS+G GAF+E GPF P  +G+ L+ N  SWN+ +N+LF
Sbjct  68    EAETDPASK-PLVLWLNGGPGCSSLGVGAFSENGPFRP--NGQVLVRNEYSWNREANMLF  124

Query  449   VESPAGVGWSYSNTSSDYT-CGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHY  625
             +E+P GVG+SYS  +S Y   GD  TA D L+F+K W+ KFP++ +R LF+TGESYAGHY
Sbjct  125   LETPIGVGFSYSKDASSYQGVGDKITARDNLVFLKNWFLKFPQYRNRSLFITGESYAGHY  184

Query  626   IPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIR  805
             IPQLA LM++ NK  K   FN+KG+ALGNP+L+   D  +  EF WSHG+ISD  Y    
Sbjct  185   IPQLADLMLEFNK--KEELFNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDATYTMFT  242

Query  806   NECDFDDY-SFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKA  982
             + C++  Y S  Y  + S  C+  ++  +R  S +++ YDV +DVC  S++ Q     K 
Sbjct  243   SFCNYSRYVSEYYRGSVSPICSRVMSLVSRETSRFVDKYDVTLDVCISSVLSQS----KV  298

Query  983   VTKMSMG---IDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGD  1153
             +T   +G   +DVC+  E   Y N  +VQKALHA    +   W  C++  +L Y   D +
Sbjct  299   LTPKQVGETTVDVCVEDETVNYLNRKDVQKALHARLVGV-RSWAVCSN--ILDYELLDLE  355

Query  1154  ANVVPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQ  1333
                + ++ KL++  IP+ +YSGDQDSV+PL GSR +V  LA ++K+G TVPY  WF   Q
Sbjct  356   IPTITIVGKLVKAGIPVMVYSGDQDSVIPLTGSRKLVNGLAKELKLGTTVPYRVWFEGQQ  415

Query  1334  VGGWQTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLP  1471
             VGGW   YGN+L+FAT+RGA+H  P++QP R+L LF +F+  R LP
Sbjct  416   VGGWTQVYGNILSFATIRGASHEAPFSQPERSLVLFKAFLDSRPLP  461



>ref|XP_007038110.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
 gb|EOY22611.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
Length=463

 Score =   376 bits (966),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 218/466 (47%), Positives = 302/466 (65%), Gaps = 14/466 (3%)
 Frame = +2

Query  86    LVICFVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYF  265
             ++I    L L F         +P  D +V LPGQP V F+QFSGYV VDEK  + LFYYF
Sbjct  9     MLIAVAMLQLCFSMEVESSLAHP--DKIVRLPGQPRVGFQQFSGYVTVDEKKHKVLFYYF  66

Query  266   VEAEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLL  445
             VEAE D   + PL LWLNGGPGCSS+G GAF+E GPF P+G+   L+ N  SWN+ +N+L
Sbjct  67    VEAEIDPASK-PLVLWLNGGPGCSSVGVGAFSENGPFRPNGEV--LVRNDYSWNREANML  123

Query  446   FVESPAGVGWSYSNTSSDYTC-GDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGH  622
             ++E+P GVG+SYS  SS Y    D +TA D L+F+++WY KFP +  R LF+TGESYAGH
Sbjct  124   YLETPIGVGFSYSTNSSSYVAVDDETTARDNLVFLQRWYHKFPNYRQRDLFITGESYAGH  183

Query  623   YIPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAI  802
             YIPQLA LM++ NK  K + FN+KG+ALGNP+L+   D  +  E+ WSHG+ISD  Y   
Sbjct  184   YIPQLAKLMVELNK--KQNLFNLKGIALGNPVLEFAIDFNSRAEYFWSHGLISDSTYRMF  241

Query  803   RNECDFDDY-SFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHK  979
              + C++  Y S  Y  + S SC+  ++  +R  S +++ YDV +DVC  S++ Q + L+ 
Sbjct  242   TSVCNYSRYVSEYYRDSVSPSCSRVMSQVSRETSKFVDKYDVTLDVCISSVLSQSMVLNP  301

Query  980   AVTKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDAN  1159
                ++S  +DVC+  +   Y N  +VQKALHA    +   W  C++  +L Y   + +  
Sbjct  302   --QQVSERVDVCVEDKIVNYLNRKDVQKALHALLVGV-RRWAVCSN--ILDYQLLNLEIP  356

Query  1160  VVPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVG  1339
              + ++  L++  IP+ +YSGDQDSV+PL GSRT+VR LA ++ +  TVPY  WF   QVG
Sbjct  357   TISIVGSLIKAGIPVLVYSGDQDSVIPLTGSRTLVRGLAKELGLETTVPYRVWFEGKQVG  416

Query  1340  GWQTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNT  1477
             GW   YGN+L FAT+RGA+H  P++QP R+L LF SF+ G+ LP  
Sbjct  417   GWTQVYGNILAFATIRGASHEAPFSQPERSLMLFKSFLEGKPLPEV  462



>ref|XP_004235841.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Solanum 
lycopersicum]
Length=455

 Score =   376 bits (965),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 214/444 (48%), Positives = 293/444 (66%), Gaps = 12/444 (3%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P  D +  LPGQP+V F+QFSGYV VD+K  RSLFYYFVEAE D   + PL LWLNGGPG
Sbjct  21    PHPDKITKLPGQPQVGFQQFSGYVTVDDKKQRSLFYYFVEAETDPASK-PLVLWLNGGPG  79

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDY-TC  508
             CSS+G GAF+E GPF P G+G  L+IN  SWNK +N+L++ESP GVG+SYS+ +S Y T 
Sbjct  80    CSSLGVGAFSENGPFRPRGEG--LVINEHSWNKEANMLYLESPIGVGFSYSSDTSSYETV  137

Query  509   GDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFN  688
              D  TA D ++F+ +W+ KFP++    LFLTGESYAGHY+PQLA LM+  NK  K   FN
Sbjct  138   NDEITARDNVVFLLRWFHKFPQYRKSNLFLTGESYAGHYVPQLAKLMMAFNK--KQQLFN  195

Query  689   IKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSC  865
             +KG+ALGNP+L+   D  +  E+ WSHG+ISD  Y    + C++  Y S  Y    S  C
Sbjct  196   LKGIALGNPVLEFATDFNSRAEYFWSHGLISDPTYRMFSSACNYSRYVSEYYRDTVSPIC  255

Query  866   NAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFN  1045
             +  ++  +R  S +++ YDV +DVC  S++ Q   +  +  + S  +DVC+  E   Y N
Sbjct  256   SRVMSLVSRETSKFVDKYDVTLDVCISSVLSQSKII--SPQENSEKLDVCVEDEVVNYLN  313

Query  1046  LPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQ  1225
               +V++ALHA    + + W  C+  S+L Y   D +   + ++  L++ +IP+ IYSGDQ
Sbjct  314   RKDVKRALHAELVGV-HRWSVCS--SILDYQLLDIEIPTISIIGTLIKERIPVLIYSGDQ  370

Query  1226  DSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMV  1405
             DSVVPL+GSR  V++LA  M++  TVPY  WF   QVGGW   Y N+L+FAT+RGA+H  
Sbjct  371   DSVVPLIGSRATVQQLARQMQLNTTVPYRVWFAGQQVGGWTHVYDNILSFATIRGASHEA  430

Query  1406  PYAQPGRALHLFSSFIRGRRLPNT  1477
             P++QP R+L LF SF+ G+ LP  
Sbjct  431   PFSQPERSLVLFKSFLEGKPLPEV  454



>ref|XP_006483005.1| PREDICTED: serine carboxypeptidase-like 45-like [Citrus sinensis]
Length=464

 Score =   376 bits (966),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 217/466 (47%), Positives = 299/466 (64%), Gaps = 17/466 (4%)
 Frame = +2

Query  89    VICFVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFV  268
             ++ F  + +  C            D +  LPGQP+V F+Q+SGYV VDEK  R+LFYYF 
Sbjct  8     LVAFAGILIHICLRIQVEAYASLLDRITALPGQPQVGFQQYSGYVTVDEKKQRALFYYFA  67

Query  269   EAEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLF  448
             EAE D   + PL LWLNGGPGCSS+G GAF+E GPF P  +G+ L+ N  SWN+ +N+LF
Sbjct  68    EAETDPASK-PLVLWLNGGPGCSSLGVGAFSENGPFRP--NGQVLVRNEYSWNREANMLF  124

Query  449   VESPAGVGWSYSNTSSDYT-CGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHY  625
             +E+P GVG+SYS  +S Y   GD  TA D L+F+K W+ KFP++ +R LF+TGESYAGHY
Sbjct  125   LETPIGVGFSYSKDASSYQGVGDKITARDNLVFLKNWFLKFPQYRNRSLFITGESYAGHY  184

Query  626   IPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIR  805
             IPQLA LM++ NK  K   FN+KG+ALGNP+L+   D  +  EF WSHG+ISD  Y    
Sbjct  185   IPQLADLMLEFNK--KEELFNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDATYTMFT  242

Query  806   NECDFDDY-SFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKA  982
             + C++  Y S  Y  + S  C+  ++  +R  S +++ YDV +DVC  S++ Q     K 
Sbjct  243   SFCNYSRYVSEYYRGSVSPICSRVMSLVSRETSRFVDKYDVTLDVCISSVLSQS----KV  298

Query  983   VTKMSMG---IDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGD  1153
             +T   +G   +DVC+  E   Y N  +VQKALHA    +   W  C++  +L Y   D +
Sbjct  299   LTPKQVGETTVDVCVEDETVNYLNRKDVQKALHARLVGV-RSWAVCSN--ILDYELLDLE  355

Query  1154  ANVVPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQ  1333
                + ++ KL++  IP+ +YSGDQDSV+PL GSR +V  LA ++K+G TVPY  WF   Q
Sbjct  356   IPTITVVGKLVKAGIPVMVYSGDQDSVIPLTGSRKLVNGLAKELKLGTTVPYRVWFEGQQ  415

Query  1334  VGGWQTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLP  1471
             VGGW   YGN+L+FAT+RGA+H  P++QP R+L LF +F+  R LP
Sbjct  416   VGGWTQVYGNILSFATIRGASHEAPFSQPERSLVLFKAFLDSRPLP  461



>ref|XP_002318164.2| hypothetical protein POPTR_0012s10730g [Populus trichocarpa]
 gb|EEE96384.2| hypothetical protein POPTR_0012s10730g [Populus trichocarpa]
Length=463

 Score =   376 bits (965),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 218/475 (46%), Positives = 304/475 (64%), Gaps = 19/475 (4%)
 Frame = +2

Query  53    STTYVRLIMGRLVICFVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVD  232
             S T+  + M  LV+         C   G     P  D + GLPGQP V F+QFSGYV VD
Sbjct  3     SQTWKAMTMAALVV-------QLCTSMGVDSSSPHPDKIAGLPGQPHVGFQQFSGYVTVD  55

Query  233   EKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIIN  412
                 R+LFYYFVEAE D   + PL LWLNGGPGCSS+G GAF+E GPF P  +GR LI N
Sbjct  56    GNKHRALFYYFVEAEIDPASK-PLVLWLNGGPGCSSLGVGAFSENGPFRP--NGRVLIRN  112

Query  413   SKSWNKASNLLFVESPAGVGWSYSNTSSDYTC-GDISTAEDMLIFMKKWYEKFPEFLDRP  589
               SWN+ +N+L++E+P GVG+SYS  +S Y    D +TA D L+F++ W+ KFP++ ++ 
Sbjct  113   EHSWNREANMLYLETPVGVGFSYSTDNSSYVAVDDEATARDNLVFLQGWFHKFPQYRNKD  172

Query  590   LFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSH  769
             LF+TGESYAGHYIPQLA LM++ NK  K    N+KG+ALGNP+L+   D+ +  E+ WSH
Sbjct  173   LFITGESYAGHYIPQLAKLMVEINK--KERLVNLKGIALGNPVLEFATDLNSRAEYFWSH  230

Query  770   GIISDENYNAIRNECDFDDY-SFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyP  946
             G+ISD  Y    + C++  Y S  Y  + S  C+  +   +   S +++ YDV +DVC P
Sbjct  231   GLISDSTYKMFTSACNYSRYVSEYYRDSVSSVCSLVMKQVSTETSRFVDKYDVTLDVCIP  290

Query  947   SIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSL  1126
             S++ Q   +  +  ++S  IDVC+  E   Y N  +V+KALHA    +   W+ C++  +
Sbjct  291   SVLSQSKVI--SPKQVSERIDVCIEDETVNYLNREDVRKALHARLIGV-RRWEVCSN--I  345

Query  1127  LKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVP  1306
             L Y   + +   + ++  L++  IP+ IYSGDQDSV+PL GSRT+V  LA ++ +  TVP
Sbjct  346   LDYEVLNIEIPTINIVGSLIKAGIPVLIYSGDQDSVIPLTGSRTLVHRLAKELGLNTTVP  405

Query  1307  YSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLP  1471
             Y AWF   QVGGW   YGN+L+FAT+RGA+H  P++QP R+L LF SF++G+ LP
Sbjct  406   YRAWFAGKQVGGWTQVYGNILSFATIRGASHEAPFSQPERSLMLFKSFLQGKHLP  460



>ref|XP_007223033.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
 gb|EMJ24232.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
Length=465

 Score =   376 bits (965),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 212/443 (48%), Positives = 291/443 (66%), Gaps = 13/443 (3%)
 Frame = +2

Query  155   EEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgc  334
             E D +  LPGQP+V F+Q+SGYV VDEK  R+LFYYF EAE D   + PL LWLNGGPGC
Sbjct  33    ELDRIALLPGQPQVGFQQYSGYVTVDEKKQRALFYYFAEAEIDPASK-PLVLWLNGGPGC  91

Query  335   ssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDY-TCG  511
             SS+G GAF+E GPF PSG+   L+ N  SWN+ +N+L++E+P GVG+SYS  +S Y    
Sbjct  92    SSLGVGAFSENGPFRPSGEV--LVRNEHSWNREANMLYLETPIGVGFSYSTDTSSYEAVN  149

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D  TA D L+F++ W EKFP++ +R LF+TGESYAGHY+PQLA LM+     +K ++FN+
Sbjct  150   DHITARDNLLFLQNWLEKFPQYKNRSLFITGESYAGHYVPQLAELML----QYKEYQFNL  205

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCN  868
             KG+ALGNP+L+   D  +  EF WSHG+ISD  Y    + C++  Y S  Y  + S  C+
Sbjct  206   KGIALGNPVLEYTTDFNSRAEFFWSHGLISDSTYKMFTSVCNYSRYVSEYYRGSVSPICS  265

Query  869   AAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNL  1048
               ++  +R  S +++ YDV +DVC  S+  Q  ++     +++  IDVC+  E   Y N 
Sbjct  266   RVMSQVSRETSKFVDKYDVTLDVCISSVFSQS-KVLLPQQQVTEAIDVCVEDEIVNYLNR  324

Query  1049  PEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQD  1228
             P+VQKALHA    +   W  C++  +L Y   D +     ++ KL++  IP+ +YSGDQD
Sbjct  325   PDVQKALHARLVGV-RQWAVCSN--ILDYQLLDVEIPTTTIVGKLIKAGIPVLVYSGDQD  381

Query  1229  SVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVP  1408
             SV+PL GSRT+V  LA  + +  TVPY  WF   QVGGW   YGN+L+FAT+RGA+H  P
Sbjct  382   SVIPLTGSRTLVHRLAEQLGLNTTVPYRVWFEGQQVGGWTQAYGNILSFATIRGASHEAP  441

Query  1409  YAQPGRALHLFSSFIRGRRLPNT  1477
             ++QP R+L LF SF+ GR LP  
Sbjct  442   FSQPERSLVLFKSFLEGRPLPEV  464



>ref|XP_007021448.1| Serine carboxypeptidase 44 [Theobroma cacao]
 gb|EOY12973.1| Serine carboxypeptidase 44 [Theobroma cacao]
Length=465

 Score =   376 bits (965),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 206/443 (47%), Positives = 273/443 (62%), Gaps = 13/443 (3%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P  DL+  LPGQP V+FRQFSGY+D+D KAGRSLFYYFVEAEKD    LPLT+WL  G  
Sbjct  22    PMNDLIEKLPGQPNVTFRQFSGYIDIDGKAGRSLFYYFVEAEKDP-MNLPLTIWL-TGGP  79

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
                  G  F  +GPF  + +  GL  N  SW K +NLLF++SP G GWSYSNTS DY  G
Sbjct  80    GCGSVGDGFLSVGPFITTANAHGLQRNPYSWIKVTNLLFIDSPIGAGWSYSNTSRDYEVG  139

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKH-FKGHKFN  688
             D ST +D+L F+ +W+EK P F  R L+L G SYAGH+IP  A+ ++D+N +     KFN
Sbjct  140   DDSTNKDLLTFILQWFEKHPNFKSRDLYLGGSSYAGHFIPNFANSLLDYNNNQSNSSKFN  199

Query  689   IKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNEC---DFDDYSFIYPHNESD  859
             IKG+ALGNPLL+   D  AV +F WS G+I+   +  I  EC   D D+YS       S+
Sbjct  200   IKGLALGNPLLRNKLDTLAVYDFFWSRGMININLHQQILKECNGIDEDNYS-NNATKWSE  258

Query  860   SCNAAINDQNRAvsdyinvydvivdv----cyPSIVE-QELRLHKAVTKMSMGIDVCMGS  1024
              C  A++    A     +              P   + ++L L K VTK+S  +D+C+  
Sbjct  259   PCQQAMDKAEMAAFIVSSTNVAKARRFDVLRDPCDEKWEDLVLGKEVTKVSFEVDMCIPF  318

Query  1025  ERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPL  1204
                FYFN+PEVQKA H NRTNL Y WK C + S LKY+  D D +++P LKK+LQ  IP+
Sbjct  319   RADFYFNIPEVQKAFHGNRTNLGYQWKGCFEKSGLKYSDADKDIDMLPALKKILQQSIPI  378

Query  1205  WIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATV  1384
              I+SGDQD++VP  G+   + +LA DM + +T    AW H+ + GGW   Y NLL F TV
Sbjct  379   TIFSGDQDAIVPNFGTLNHMNKLAKDMNLNLTKD-EAWNHENKGGGWMYSYDNLLNFMTV  437

Query  1385  RGAAHMVPYAQPGRALHLFSSFI  1453
             +GA H V +++P  AL +F++ +
Sbjct  438   KGANHHVTFSKPSEALFIFTNIV  460



>ref|XP_010509871.1| PREDICTED: serine carboxypeptidase-like 46 [Camelina sativa]
Length=465

 Score =   376 bits (965),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 209/440 (48%), Positives = 289/440 (66%), Gaps = 10/440 (2%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             D +  LPGQP+V F+Q+SGYV VDEK  R+LFYY  EAE     + PL LWLNGGPGCSS
Sbjct  32    DRITRLPGQPQVGFQQYSGYVTVDEKKQRALFYYLAEAETKPISK-PLVLWLNGGPGCSS  90

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYT-CGDI  517
             +G GAF+E GPF P G    L+ N  SWN+ +N+L++E+P GVG+SY+  SS Y    D 
Sbjct  91    VGVGAFSENGPFRPKGSV--LVKNQHSWNQEANMLYLETPVGVGFSYATESSSYEGVNDK  148

Query  518   STAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKG  697
              TA+D L+F++KW+ KFP++L+R LF+TGESYAGHY+PQLA LMI +NK    + FN+KG
Sbjct  149   ITAKDNLVFLQKWFLKFPQYLNRSLFITGESYAGHYVPQLAQLMIQYNKQH--NLFNLKG  206

Query  698   VALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCNAA  874
             +A+GNP+++   D  +  E+ WSHG+ISD  Y    + C++  Y S  Y    S  C   
Sbjct  207   IAIGNPVMEFSTDFNSRAEYFWSHGLISDPTYKMFTSYCNYSRYVSEYYRGTVSSMCTKV  266

Query  875   INDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPE  1054
             ++  +   S +++ YDV +DVC PS++ Q  R++    +M   +DVC+  E   Y N  +
Sbjct  267   MSQVSIETSRFVDKYDVTLDVCIPSVLSQSKRVNPQPQEMGETVDVCVEDETVNYLNRRD  326

Query  1055  VQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSV  1234
             VQKALHA R      W  C++  +L Y   D +   + ++  L++  +P+ +YSGDQDSV
Sbjct  327   VQKALHA-RLVGTRKWSVCSN--VLDYEVLDVEVPTINIVGTLVKAGVPVLVYSGDQDSV  383

Query  1235  VPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYA  1414
             +PL GSRT+V+ LA ++ +  TVPY  WF   QVGGW   YGN+L FATVRGAAH VP++
Sbjct  384   IPLTGSRTLVKRLAEELGLRTTVPYRVWFAGQQVGGWTQVYGNILAFATVRGAAHEVPFS  443

Query  1415  QPGRALHLFSSFIRGRRLPN  1474
             QP RAL LF +F+ G  LP+
Sbjct  444   QPARALVLFKAFLGGLPLPD  463



>ref|XP_010249188.1| PREDICTED: serine carboxypeptidase-like 45 [Nelumbo nucifera]
Length=494

 Score =   377 bits (967),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 219/460 (48%), Positives = 295/460 (64%), Gaps = 14/460 (3%)
 Frame = +2

Query  104   CLSLLF--CgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAE  277
              L+ LF  C            D ++ LPGQP+V F+QFSGYV VDEK  R+LFYYFVEAE
Sbjct  42    ALTTLFQLCLFLEISASLSPSDKIIALPGQPQVGFQQFSGYVTVDEKKERALFYYFVEAE  101

Query  278   KDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVES  457
              D   + PL LWLNGGPGCSS+G GAF+E GPF PSG+   L+ N  SWN  +N+L++E+
Sbjct  102   IDPSSK-PLVLWLNGGPGCSSLGVGAFSENGPFRPSGEV--LVRNEYSWNSEANMLYLET  158

Query  458   PAGVGWSYSNTSSDYTC-GDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQ  634
             P GVG+SYS  +S Y    D  TA D L+F+++W+ KFP++  R LF+TGESYAGHYIPQ
Sbjct  159   PVGVGFSYSTDTSSYVAVDDKITARDNLVFLQRWFLKFPQYKHRDLFITGESYAGHYIPQ  218

Query  635   LASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNEC  814
             LA LMI  NK  K   FN+KG+ALGNP+L+   D  +  EF WSHG+ISD  Y    + C
Sbjct  219   LADLMIQFNK--KEKLFNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDSTYRLFTSAC  276

Query  815   DFDDY-SFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTK  991
             ++  Y S  Y  + S  C+  +N  ++  S +++ YDV +DVC  S++ Q   L     +
Sbjct  277   NYSRYVSEYYRGSVSSVCSKVMNQVSKETSRFVDKYDVTLDVCISSVLSQSKVLSPQ--Q  334

Query  992   MSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPL  1171
             ++  IDVC+  E   Y N  +VQKALHA    +   W  C++  +L Y   + +   + +
Sbjct  335   VTERIDVCVEDETVNYLNRRDVQKALHARLVGV-RRWAVCSN--ILNYELLNLEIPTISI  391

Query  1172  LKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQT  1351
             +  L++  IP+ +YSGDQDSV+PL GSRT+V  LA D+ +  TVPY  WF   QVGGW  
Sbjct  392   VGSLVKAGIPVLVYSGDQDSVIPLTGSRTLVHGLAKDLGLNTTVPYRVWFAGQQVGGWTQ  451

Query  1352  EYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLP  1471
              YGN+L+FAT+RGA+H  P++QP R+L LF SF+ GR LP
Sbjct  452   VYGNVLSFATIRGASHEAPFSQPERSLVLFKSFLEGRPLP  491



>ref|XP_009143848.1| PREDICTED: serine carboxypeptidase-like 46 [Brassica rapa]
 emb|CDY17183.1| BnaA05g10050D [Brassica napus]
Length=462

 Score =   375 bits (963),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 213/460 (46%), Positives = 293/460 (64%), Gaps = 16/460 (3%)
 Frame = +2

Query  104   CLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKD  283
             CL LL              D +  LPGQP+V F+Q+SGYV +DEK  R+LFYY  EAE  
Sbjct  12    CLILLQALTLVSSTVMSRADRITSLPGQPKVVFQQYSGYVSIDEKKQRALFYYLAEAETK  71

Query  284   VHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPA  463
                + PL LWLNGGPGCSS+G GAF+E GPF P G    L+ N  SWN  +N+L++E+P 
Sbjct  72    PISK-PLVLWLNGGPGCSSLGVGAFSENGPFRPKGSV--LVRNQHSWNHEANMLYLETPV  128

Query  464   GVGWSYSNTSSDYT-CGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLA  640
             GVG+SY+  SS Y    D  TA+D L+F++KW+++FP++L+R LF+TGESYAGHY+PQLA
Sbjct  129   GVGFSYATESSSYEGVNDKITAKDNLVFLQKWFKRFPQYLNRSLFITGESYAGHYVPQLA  188

Query  641   SLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDF  820
              LMI +NK  K H FN+KG+ALGNP+L+   D  +  E+ WSHG+ISD  Y    + C++
Sbjct  189   QLMIQYNK--KHHLFNLKGIALGNPVLEFSTDFNSRAEYFWSHGLISDPTYKMFTSYCNY  246

Query  821   DDYSFIYPHNESDS-CNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMS  997
               +   Y   E  S C+  ++  +   S +++ YDV +D+C PS++ Q     K V+   
Sbjct  247   SRFVSEYYRGEVSSMCSKVMSQVSTETSRFVDKYDVTLDLCIPSVLSQS----KVVSPQQ  302

Query  998   MG--IDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPL  1171
             +G  +DVC+  E   Y N  +VQKALHA R      W  C++  +L Y   D +   + +
Sbjct  303   VGETVDVCVEDETVNYLNRRDVQKALHA-RLVGTRKWAVCSN--VLDYELLDVEVPTINV  359

Query  1172  LKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQT  1351
             +  L++  +P+ +YSGDQDSV+PL GSRT+V+ LA  + +  TVPY  WF   QVGGW  
Sbjct  360   VGSLIKAGVPVLVYSGDQDSVIPLTGSRTLVKRLAQQLGLSTTVPYRVWFAGQQVGGWTQ  419

Query  1352  EYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLP  1471
              YGN+L FATVRGAAH VP++QP R+L LF +F+ G  LP
Sbjct  420   VYGNVLAFATVRGAAHEVPFSQPERSLVLFKAFLGGNPLP  459



>ref|XP_002268172.1| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
 emb|CBI35664.3| unnamed protein product [Vitis vinifera]
Length=463

 Score =   375 bits (962),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 216/456 (47%), Positives = 294/456 (64%), Gaps = 12/456 (3%)
 Frame = +2

Query  113   LLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHR  292
             LL C            D ++ LPGQP+V F+Q+SGYV VDEK  R+LFYYF EAE D   
Sbjct  16    LLLCFSREVESSLSLSDKILELPGQPQVGFQQYSGYVAVDEKQQRALFYYFAEAETDPAI  75

Query  293   RLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVG  472
             + PL LWLNGGPGCSS+G GAF+E GPF PSG+   L+ N  SWN+ +N+L++E+P GVG
Sbjct  76    K-PLVLWLNGGPGCSSLGVGAFSENGPFRPSGEL--LVRNEYSWNREANMLYLETPIGVG  132

Query  473   WSYSNTSSDYTC-GDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLM  649
             +SYS  SS Y    D  TA D L+F++KW  KFP++ +R LF+TGESYAGHY+PQLA LM
Sbjct  133   FSYSTDSSSYAAVNDKITARDNLVFLQKWLLKFPQYKNRDLFITGESYAGHYVPQLAELM  192

Query  650   IDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY  829
             +  NK  K   FN+KG+ALGNP+L+   D+ +  EF WSHG+ISD  Y    + C++  Y
Sbjct  193   LQFNK--KEKLFNLKGIALGNPVLEFATDLNSRAEFFWSHGLISDSTYKMFTSFCNYSRY  250

Query  830   -SFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGI  1006
              S  Y  + S  C+  ++   R  S +++ YDV +DVC  S++ Q   L     +++  I
Sbjct  251   VSEYYRGSVSSICSRVMSQVGRETSRFVDKYDVTLDVCISSVLSQSKVLSP--QQVTETI  308

Query  1007  DVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLL  1186
             DVC+  E   Y N  +VQKALHA    +   W  C++  +L Y   D +   + ++ KL+
Sbjct  309   DVCVEDETESYLNRRDVQKALHARLVGVN-KWSVCSN--ILDYELLDLEIPTISIVGKLI  365

Query  1187  QHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNL  1366
             +  IP+ +YSGDQDSV+PL GSRT+V  LA ++ +  TVPY  WF   QVGGW   YGN+
Sbjct  366   KAGIPVLVYSGDQDSVIPLTGSRTLVHGLAEELGLNTTVPYRVWFEGKQVGGWTQVYGNI  425

Query  1367  LTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPN  1474
             L+FAT+RGA+H  P++QP R+L LF +F+ GR LP 
Sbjct  426   LSFATIRGASHEAPFSQPERSLVLFRAFLGGRPLPQ  461



>ref|XP_006844530.1| hypothetical protein AMTR_s00016p00162700 [Amborella trichopoda]
 gb|ERN06205.1| hypothetical protein AMTR_s00016p00162700 [Amborella trichopoda]
Length=460

 Score =   375 bits (962),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 220/444 (50%), Positives = 293/444 (66%), Gaps = 15/444 (3%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             D +  LPGQP ++F+QF+GY+ VDE   R+LFYYF EAE D   + PL +WLNGGPGCSS
Sbjct  29    DKITSLPGQPTINFQQFAGYITVDEAKPRALFYYFAEAETDPVLK-PLVIWLNGGPGCSS  87

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYT-CGDI  517
             +G GAF+E GPF PSG+   L+ N  SWN+ +N+L++E+PAGVG+SYS   S Y    D 
Sbjct  88    LGVGAFSENGPFRPSGNV--LVKNHYSWNREANMLYIETPAGVGFSYSTDISFYEGVDDE  145

Query  518   STAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHK-FNIK  694
              TA D L+F+K+W+ KFPE+  R LF+TGESYAGHYIPQLA LMI+ NK   G K FN+K
Sbjct  146   KTARDNLVFLKRWFIKFPEYRTRDLFITGESYAGHYIPQLAELMIEANK---GEKLFNLK  202

Query  695   GVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCNA  871
             G+ALGNPLL    D  +  EF WSHG+ISD  Y    + C++  Y S  Y  N S  C+ 
Sbjct  203   GIALGNPLLDFSTDFNSRAEFFWSHGLISDPAYRIFTSSCNYSRYVSEYYRENVSPICSR  262

Query  872   AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLP  1051
              ++  +R  S +++ YDV +DVC  SI+ Q   L     ++S  IDVC+  E   Y N  
Sbjct  263   VMSLVSRETSKFVDKYDVTLDVCISSILMQSKALRP--MQVSEPIDVCVEDETVNYLNRK  320

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             +VQ+ALHA R +    W  C   S + YN+ + +   + LL  +++  IP+ +YSGDQDS
Sbjct  321   DVQRALHA-RLSGDETWSVC---SSMNYNRLNLEIPTISLLGLVVKSGIPVLVYSGDQDS  376

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             V+PL GSRT+V  LAA + +  TVPY  WF   QVGGW   YGN+L+FAT+RGA+H  P+
Sbjct  377   VIPLTGSRTLVHGLAAKLHLNTTVPYRVWFEGEQVGGWTQVYGNILSFATIRGASHEAPF  436

Query  1412  AQPGRALHLFSSFIRGRRLPNTTS  1483
             +QP R+L LF +F++GR LP T S
Sbjct  437   SQPQRSLGLFRAFLQGRPLPETFS  460



>emb|CBI32794.3| unnamed protein product [Vitis vinifera]
Length=453

 Score =   374 bits (961),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 218/447 (49%), Positives = 297/447 (66%), Gaps = 15/447 (3%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P  D +V LPGQP+V F+QF+GY+ VDEK  R LFYYFVEAE D   + PL LWLNGGPG
Sbjct  19    PSADKIVSLPGQPQVGFQQFAGYITVDEKQQRHLFYYFVEAETDPASK-PLVLWLNGGPG  77

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYT-C  508
             CSSIG GAF E GPF PSG+   L+ N  SWNK +N+L++ESPAGVG+SYS  +S Y   
Sbjct  78    CSSIGAGAFCEHGPFKPSGEI--LVNNDYSWNKVANMLYLESPAGVGFSYSANTSFYAFV  135

Query  509   GDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFN  688
              D  TA D L F+++W+ KFPE+ +R LFLTGESYAGHY+PQLA L++         KFN
Sbjct  136   NDEMTARDNLKFLQRWFLKFPEYKNRDLFLTGESYAGHYVPQLAQLIVQSKV-----KFN  190

Query  689   IKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSF-IYPHNESDSC  865
             +KGVA+GNPLL+ + D  +  E+MWSHG+ISD  Y A    C++      I   + S +C
Sbjct  191   LKGVAIGNPLLEFNTDFNSRAEYMWSHGLISDITYEAFTVICNYSQVRREIVMGSLSPAC  250

Query  866   NAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFN  1045
             +  I+  +R +  +I+ YDV +DVC PS+V Q  RL++   + +  IDVC+  E   Y N
Sbjct  251   SGVISQVSRELGKHIDSYDVTLDVCLPSVVSQSERLNQP--RGTEKIDVCVEDETIKYLN  308

Query  1046  LPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQ  1225
               +VQKALHA+   +   W  C++  +LKY   + +   + ++  +L+  I + +YSGDQ
Sbjct  309   RKDVQKALHAHLKGVS-RWSICSE--VLKYEYRNLEIPTIHVVGAVLKSGIRVLVYSGDQ  365

Query  1226  DSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMV  1405
             DSVVPL G+RT+V  LA D+ +  TVPY  WF   QVGGW   YG+ L+FAT+RGA+H  
Sbjct  366   DSVVPLTGTRTLVNGLAKDLGLNTTVPYRNWFQGRQVGGWTQVYGDKLSFATIRGASHEA  425

Query  1406  PYAQPGRALHLFSSFIRGRRLPNTTSI  1486
             P++QP R+L LF++F++G+ LP  T +
Sbjct  426   PFSQPERSLVLFNTFLQGKPLPEATVV  452



>gb|KHN31265.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=457

 Score =   374 bits (961),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 213/440 (48%), Positives = 291/440 (66%), Gaps = 10/440 (2%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             D +  LPGQP V F+QFSGYV VD+K  +SLFYYF EAE D   + PL LWLNGGPGCSS
Sbjct  24    DTIAALPGQPHVGFQQFSGYVTVDDKKQKSLFYYFAEAETDPASK-PLVLWLNGGPGCSS  82

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDY-TCGDI  517
             +G GAF+E GPF P+G+   LI N  SWNK +N+L++E+P GVG+SY+  SS Y T  D 
Sbjct  83    LGVGAFSENGPFRPNGEF--LIKNYYSWNKEANMLYLETPVGVGFSYAKGSSSYMTVNDE  140

Query  518   STAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKG  697
             +TA D LIF+ +W+ KFP++  R LFLTGESYAGHY+PQLA L+I+ N   K   FN+KG
Sbjct  141   ATARDNLIFLLRWFNKFPQYRSRDLFLTGESYAGHYVPQLAKLIIEMNT--KNKIFNLKG  198

Query  698   VALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCNAA  874
             +ALGNP+L+   D  +  EF WSHG+ISD  YN     C++  Y S  Y  + S  C+  
Sbjct  199   IALGNPVLEYATDFNSRAEFFWSHGLISDSTYNMFTTVCNYSRYVSEYYRDSVSPLCSKV  258

Query  875   INDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPE  1054
             +   +R  S +++ YDV +DVC  S++ Q   +     + +  IDVC+  + T Y N  +
Sbjct  259   MGQVSRETSKFVDKYDVTLDVCISSVLSQSKVICPQSQEANESIDVCVDDKVTNYLNRRD  318

Query  1055  VQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSV  1234
             VQ+ALHA    +   W  C++  +L Y+  + +   +P++  L++  + + IYSGDQDSV
Sbjct  319   VQEALHAKLVGI-RKWDVCSN--ILDYDMLNLEVPTLPVVGSLIKAGVKVLIYSGDQDSV  375

Query  1235  VPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYA  1414
             +PL GSRT+V++LA  + +  TVPY  WF   QVGGW   YGN+L+FATVRGA+H  P++
Sbjct  376   IPLTGSRTLVQKLARQLGLNSTVPYRVWFEGQQVGGWTQVYGNILSFATVRGASHEAPFS  435

Query  1415  QPGRALHLFSSFIRGRRLPN  1474
             QP R+L LF SF+ GR LP+
Sbjct  436   QPERSLVLFKSFLEGRPLPD  455



>gb|ABR16719.1| unknown [Picea sitchensis]
Length=460

 Score =   374 bits (961),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 214/466 (46%), Positives = 304/466 (65%), Gaps = 14/466 (3%)
 Frame = +2

Query  92    ICFVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVE  271
             +CF+ L ++       V   PE  +V  LPGQP V+F+Q++GY+ V+EK+ R+LFYYFVE
Sbjct  1     MCFLQLLIILAFLFIKVLSAPEGHVVNRLPGQPAVTFKQYAGYITVNEKSDRALFYYFVE  60

Query  272   AEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFV  451
             AE +   + PL +WLNGGPGCSS G GA +E GPF+P      LI NS SWNK +N+L++
Sbjct  61    AETEPDLK-PLVVWLNGGPGCSSFGVGALSENGPFYPKAGK--LIRNSCSWNKEANMLYL  117

Query  452   ESPAGVGWSYSNTSSDYT-CGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYI  628
             ESPAGVG+SYSN  S Y    D  TA D L+F+  W+ KFPE+  R L+LTGESYAGHYI
Sbjct  118   ESPAGVGFSYSNDPSYYMGANDSKTAVDNLLFLHGWFNKFPEYKTRELYLTGESYAGHYI  177

Query  629   PQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRN  808
             PQLA L+++ N+  K   FN+KG+++GNPLL    D+ A  EF+WSHG++SD  YN ++ 
Sbjct  178   PQLAELIVEENR--KKKSFNLKGISIGNPLLDFITDLNARAEFLWSHGLVSDPTYNMMKT  235

Query  809   ECDFD---DYSFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHK  979
              C++    D +F      S +C       +  +S +I+ YDV ++ C  S++ Q+ ++  
Sbjct  236   GCNYSRLLDEAF--RGGVSSTCEHIYLTVSMEISKFIDKYDVTLESCLSSLLMQKSKMMI  293

Query  980   AVTKM-SMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDA  1156
              VT+  ++  DVC+  E T Y N+ +VQKA HA        W+ C+D  +L+Y+  + + 
Sbjct  294   GVTRTATVKPDVCVQDEATSYLNMADVQKAFHARLVGNVKTWEACSD--VLEYDDLNWEI  351

Query  1157  NVVPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQV  1336
               +PLL KL++  I + IYSGDQDS++PL G+RT+V  LAA +++  TVPY  WF   QV
Sbjct  352   PTIPLLGKLVKAGIRVLIYSGDQDSIIPLTGTRTLVNNLAASLQLNTTVPYRVWFQGKQV  411

Query  1337  GGWQTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPN  1474
              GW   YGN L+FATVRGA H VP++QP R+L LF +F++G+  P+
Sbjct  412   AGWVQVYGNTLSFATVRGAGHEVPFSQPERSLVLFKAFLQGQPPPS  457



>ref|XP_009359890.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=463

 Score =   374 bits (961),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 211/441 (48%), Positives = 289/441 (66%), Gaps = 13/441 (3%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             D + GLPGQP V F+Q+SGYV VDEK  +++FYY  EAE D   + PL LWLNGGPGCSS
Sbjct  33    DRITGLPGQPPVGFQQYSGYVTVDEKRQKAMFYYLAEAEIDPASK-PLVLWLNGGPGCSS  91

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYT-CGDI  517
             +G GAF+E GPF P G+   L+ N  SWN  +N+L++E+P GVG+SYS  +S Y    D 
Sbjct  92    LGVGAFSENGPFRPKGEV--LVRNEHSWNTEANMLYLETPIGVGFSYSTDTSSYEGVTDR  149

Query  518   STAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKG  697
              TA D L+F++KW EKFP++ +R L++TGESYAGHY+PQLA LM+   K ++   FN+KG
Sbjct  150   ITARDNLLFLQKWLEKFPQYRNRSLYITGESYAGHYVPQLAELMLQFKKEYQ---FNLKG  206

Query  698   VALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCNAA  874
             +ALGNP+L+   D  +  EF WSHG+ISD  YN   + C++  Y S  Y  + S  C   
Sbjct  207   IALGNPVLEFATDFNSRAEFFWSHGLISDATYNMFTSVCNYSRYVSEYYRGSLSPICAMV  266

Query  875   INDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPE  1054
             ++  +R  S +++ YDV +DVC  S+V Q   L     +++  IDVC+  E   Y N P+
Sbjct  267   MSQVSRETSKFVDKYDVTLDVCISSVVSQSKALLPQ--EVADTIDVCVDDEIVNYLNRPD  324

Query  1055  VQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSV  1234
             VQKALHA    +   W  C+  ++L Y Q D +   + ++ KL++  IP+ +YSGDQDSV
Sbjct  325   VQKALHARLVGV-RQWAVCS--TILDYQQLDVEIPTITIVGKLIKAGIPVLVYSGDQDSV  381

Query  1235  VPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYA  1414
             +PL GSR +V  LA  +++  TVPY  WF   QVGGW   YGN+L+FAT+RGA+H  P++
Sbjct  382   IPLTGSRKLVNGLAEQLRLSTTVPYRVWFGGQQVGGWTQVYGNMLSFATIRGASHEAPFS  441

Query  1415  QPGRALHLFSSFIRGRRLPNT  1477
             QP R+L LF SF+ GR LP  
Sbjct  442   QPERSLVLFKSFLEGRPLPEV  462



>ref|XP_008791046.1| PREDICTED: serine carboxypeptidase-like 45 [Phoenix dactylifera]
 ref|XP_008791047.1| PREDICTED: serine carboxypeptidase-like 45 [Phoenix dactylifera]
Length=463

 Score =   374 bits (961),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 214/457 (47%), Positives = 295/457 (65%), Gaps = 12/457 (3%)
 Frame = +2

Query  113   LLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHR  292
             L  C           +D +  LPGQP+VSF+QFSGY+ VD++  R+LFYYF EAE D   
Sbjct  16    LQLCSSKELETNLSLQDKITKLPGQPQVSFQQFSGYITVDDRKQRALFYYFAEAELDPST  75

Query  293   RLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVG  472
             + PL LWLNGGPGCSS+G GAF+E GPF PSG  + L+ N  SWNK +N+L++E+PAGVG
Sbjct  76    K-PLVLWLNGGPGCSSVGVGAFSENGPFRPSG--QLLVRNEYSWNKEANMLYLETPAGVG  132

Query  473   WSYSNTSSDYT-CGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLM  649
             +SY+  SS Y    D  TA D L+F+ +W+ KFP++ DR L++TGESYAGHY+PQLA LM
Sbjct  133   FSYATDSSYYEGVNDKMTARDNLVFLLRWFTKFPQYKDRDLYITGESYAGHYVPQLAELM  192

Query  650   IDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY  829
             +  NK  K + FN+KG+ALGNP+L+   D  +  EF WSHG+ISD  Y    + C++  Y
Sbjct  193   VLFNK--KNNVFNLKGIALGNPVLEFATDFNSRAEFFWSHGLISDSTYRIFTSACNYSRY  250

Query  830   -SFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGI  1006
              S  Y  + S  C   +    R  S +++ YDV +DVC  S++ Q   L     +++  I
Sbjct  251   VSEYYRGSLSPVCARVMGQVTRETSRFVDKYDVTLDVCISSVLSQSKVLSPQ--QVAERI  308

Query  1007  DVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLL  1186
             DVC+  E   Y N  +VQ ALHA  T +P  W  C+  S+L+Y   + +   + ++  L+
Sbjct  309   DVCVEDETVNYLNRKDVQDALHARLTGVP-KWTVCS--SVLEYELLNLENPTISVVGSLV  365

Query  1187  QHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNL  1366
                IP+ +YSGDQDSV+PL GSRT+V+ LA ++K+  TVPY  WF   QVGGW   YG++
Sbjct  366   SSGIPVLVYSGDQDSVIPLTGSRTLVQRLANELKLKTTVPYRVWFEGKQVGGWTQVYGDI  425

Query  1367  LTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNT  1477
             L FAT+RGA+H  P++QP R+L LF +F++ R LP T
Sbjct  426   LAFATIRGASHEAPFSQPERSLVLFRAFLQRRPLPET  462



>ref|XP_006578724.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=469

 Score =   374 bits (961),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 213/440 (48%), Positives = 291/440 (66%), Gaps = 10/440 (2%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             D +  LPGQP V F+QFSGYV VD+K  +SLFYYF EAE D   + PL LWLNGGPGCSS
Sbjct  36    DTIAALPGQPHVGFQQFSGYVTVDDKKQKSLFYYFAEAETDPASK-PLVLWLNGGPGCSS  94

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDY-TCGDI  517
             +G GAF+E GPF P+G+   LI N  SWNK +N+L++E+P GVG+SY+  SS Y T  D 
Sbjct  95    LGVGAFSENGPFRPNGEF--LIKNYYSWNKEANMLYLETPVGVGFSYAKGSSSYMTVNDE  152

Query  518   STAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKG  697
             +TA D LIF+ +W+ KFP++  R LFLTGESYAGHY+PQLA L+I+ N   K   FN+KG
Sbjct  153   ATARDNLIFLLRWFNKFPQYRSRDLFLTGESYAGHYVPQLAKLIIEMNT--KNKIFNLKG  210

Query  698   VALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCNAA  874
             +ALGNP+L+   D  +  EF WSHG+ISD  YN     C++  Y S  Y  + S  C+  
Sbjct  211   IALGNPVLEYATDFNSRAEFFWSHGLISDSTYNMFTTVCNYSRYVSEYYRDSVSPLCSKV  270

Query  875   INDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPE  1054
             +   +R  S +++ YDV +DVC  S++ Q   +     + +  IDVC+  + T Y N  +
Sbjct  271   MGQVSRETSKFVDKYDVTLDVCISSVLSQSKVICPQSQEANESIDVCVDDKVTNYLNRRD  330

Query  1055  VQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSV  1234
             VQ+ALHA    +   W  C++  +L Y+  + +   +P++  L++  + + IYSGDQDSV
Sbjct  331   VQEALHAKLVGI-RKWDVCSN--ILDYDMLNLEVPTLPVVGSLIKAGVKVLIYSGDQDSV  387

Query  1235  VPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYA  1414
             +PL GSRT+V++LA  + +  TVPY  WF   QVGGW   YGN+L+FATVRGA+H  P++
Sbjct  388   IPLTGSRTLVQKLARQLGLNSTVPYRVWFEGQQVGGWTQVYGNILSFATVRGASHEAPFS  447

Query  1415  QPGRALHLFSSFIRGRRLPN  1474
             QP R+L LF SF+ GR LP+
Sbjct  448   QPERSLVLFKSFLEGRPLPD  467



>ref|XP_010653629.1| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
Length=461

 Score =   374 bits (960),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 218/447 (49%), Positives = 297/447 (66%), Gaps = 15/447 (3%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P  D +V LPGQP+V F+QF+GY+ VDEK  R LFYYFVEAE D   + PL LWLNGGPG
Sbjct  27    PSADKIVSLPGQPQVGFQQFAGYITVDEKQQRHLFYYFVEAETDPASK-PLVLWLNGGPG  85

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYT-C  508
             CSSIG GAF E GPF PSG+   L+ N  SWNK +N+L++ESPAGVG+SYS  +S Y   
Sbjct  86    CSSIGAGAFCEHGPFKPSGEI--LVNNDYSWNKVANMLYLESPAGVGFSYSANTSFYAFV  143

Query  509   GDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFN  688
              D  TA D L F+++W+ KFPE+ +R LFLTGESYAGHY+PQLA L++         KFN
Sbjct  144   NDEMTARDNLKFLQRWFLKFPEYKNRDLFLTGESYAGHYVPQLAQLIVQSKV-----KFN  198

Query  689   IKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSF-IYPHNESDSC  865
             +KGVA+GNPLL+ + D  +  E+MWSHG+ISD  Y A    C++      I   + S +C
Sbjct  199   LKGVAIGNPLLEFNTDFNSRAEYMWSHGLISDITYEAFTVICNYSQVRREIVMGSLSPAC  258

Query  866   NAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFN  1045
             +  I+  +R +  +I+ YDV +DVC PS+V Q  RL++   + +  IDVC+  E   Y N
Sbjct  259   SGVISQVSRELGKHIDSYDVTLDVCLPSVVSQSERLNQP--RGTEKIDVCVEDETIKYLN  316

Query  1046  LPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQ  1225
               +VQKALHA+   +   W  C++  +LKY   + +   + ++  +L+  I + +YSGDQ
Sbjct  317   RKDVQKALHAHLKGVS-RWSICSE--VLKYEYRNLEIPTIHVVGAVLKSGIRVLVYSGDQ  373

Query  1226  DSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMV  1405
             DSVVPL G+RT+V  LA D+ +  TVPY  WF   QVGGW   YG+ L+FAT+RGA+H  
Sbjct  374   DSVVPLTGTRTLVNGLAKDLGLNTTVPYRNWFQGRQVGGWTQVYGDKLSFATIRGASHEA  433

Query  1406  PYAQPGRALHLFSSFIRGRRLPNTTSI  1486
             P++QP R+L LF++F++G+ LP  T +
Sbjct  434   PFSQPERSLVLFNTFLQGKPLPEATVV  460



>emb|CDO98312.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   374 bits (959),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 210/444 (47%), Positives = 294/444 (66%), Gaps = 12/444 (3%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P  D++  LPGQP+V F+QFSGYV VD+K G++LFYYFVEAE D   + PL LWLNGGPG
Sbjct  20    PHPDMITQLPGQPQVGFQQFSGYVTVDDKKGKALFYYFVEAEIDCASK-PLVLWLNGGPG  78

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDY-TC  508
             CSS+G GAF+E GPF P  +G+GL+ N  SWN+ +N+L++E+P GVG+S+++ SS Y   
Sbjct  79    CSSLGVGAFSENGPFRP--NGQGLVRNEHSWNREANVLYLETPVGVGFSFADDSSSYDAV  136

Query  509   GDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFN  688
              D  TA D L+F+++W+ +FP++ DR LF+TGESYAGHY+PQLA LMI  NK  K   FN
Sbjct  137   SDAITARDNLVFLQRWFLQFPQYRDRNLFITGESYAGHYVPQLAELMIQFNK--KEKLFN  194

Query  689   IKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSC  865
             +KG+ALGNP+L+   D+ +  E+ WSHG+ISD  Y    + C++  Y S  Y    S  C
Sbjct  195   LKGIALGNPVLEYATDLNSRAEYFWSHGLISDSTYKLFTSFCNYSRYVSEYYRDAVSPIC  254

Query  866   NAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFN  1045
             +  ++  +R  S +++ YDV +DVC  S++ Q   +  +  + +  IDVC+  E   Y N
Sbjct  255   SKVMSQVSRETSRFVDKYDVTLDVCISSVLSQSRII--SPQQNAERIDVCIEDETVNYLN  312

Query  1046  LPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQ  1225
               +VQKALHA    +   W  C+D  +L Y   D +   + ++  L++  I + +YSGDQ
Sbjct  313   RQDVQKALHARLVGV-RRWLVCSD--ILDYQLLDIEIPTISIVGSLIKEGITVLVYSGDQ  369

Query  1226  DSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMV  1405
             DSV+PL GSR++V  LA  +++  T PY  WF   QVGGW   YGNLL+FAT+RGA+H  
Sbjct  370   DSVIPLTGSRSLVHGLAKQLRLNATTPYRVWFAGQQVGGWTQVYGNLLSFATIRGASHEA  429

Query  1406  PYAQPGRALHLFSSFIRGRRLPNT  1477
             P++QP R+L LF SF+ GR LP  
Sbjct  430   PFSQPERSLVLFKSFLEGRPLPEV  453



>ref|XP_010549305.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Tarenaya 
hassleriana]
Length=466

 Score =   374 bits (960),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 213/441 (48%), Positives = 290/441 (66%), Gaps = 16/441 (4%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             D V  LPGQP V F+Q+SGYV VD+K  R+LFYYF EAE D   + PL LWLNGGPGCSS
Sbjct  35    DRVAQLPGQPRVGFQQYSGYVTVDDKKQRALFYYFAEAEADPASK-PLVLWLNGGPGCSS  93

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYT-CGDI  517
             +G GAF+E GPF P G    L+ N  SWNK +N+L++E+P GVG+SYS  SS Y    D 
Sbjct  94    LGVGAFSENGPFRPKGPI--LVKNEHSWNKEANMLYLETPVGVGFSYSTDSSSYEGVNDK  151

Query  518   STAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKG  697
              TA D L+F+++W+ KFP++L+R LF+TGESYAGHY+PQLA LMI +NK  K   FN++G
Sbjct  152   ITARDNLVFLQRWFLKFPQYLNRSLFITGESYAGHYVPQLAQLMIQYNKKHK--LFNLRG  209

Query  698   VALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCNAA  874
             +ALGNP+L+   D  +  EF WSHG+ISD  Y    + C++  Y S  Y    S  C+  
Sbjct  210   IALGNPVLEFATDFNSRAEFFWSHGLISDSTYKMFTSYCNYSRYVSEYYRGTVSAMCSKV  269

Query  875   INDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMG--IDVCMGSERTFYFNL  1048
             ++  +   S +++ YDV +DVC PS++ Q     K V+   +G  +DVC+  E   Y N 
Sbjct  270   MSQVSVETSRFVDKYDVTLDVCIPSVLSQS----KVVSPQQVGETVDVCVEDETVSYLNR  325

Query  1049  PEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQD  1228
              +VQ++LHA    +   W  C++  +L Y   D +   + ++  L++  IP+ +YSGDQD
Sbjct  326   RDVQRSLHARLVGV-RKWAVCSN--VLDYELLDVEIPTITVVGNLVKAGIPVLVYSGDQD  382

Query  1229  SVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVP  1408
             SV+PL GSRT+V  LA ++++  TVPY  WF   QVGGW   YGN+L+FATVRGA+H VP
Sbjct  383   SVIPLTGSRTLVNRLAEELRLRTTVPYRVWFAGQQVGGWTQVYGNILSFATVRGASHEVP  442

Query  1409  YAQPGRALHLFSSFIRGRRLP  1471
             ++QP R+L LF +FI G  LP
Sbjct  443   FSQPQRSLVLFKAFINGHPLP  463



>ref|XP_008390188.1| PREDICTED: serine carboxypeptidase-like 45 [Malus domestica]
Length=462

 Score =   374 bits (959),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 210/441 (48%), Positives = 290/441 (66%), Gaps = 14/441 (3%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             D + GLPGQP V F+ +SGYV VD K  R+LFYYF EAE D   + PL LWLNGGPGCSS
Sbjct  33    DRITGLPGQPPVGFQHYSGYVTVDAKKQRALFYYFAEAEIDPASK-PLVLWLNGGPGCSS  91

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDY-TCGDI  517
             +G GAF+E GPF P G+   L+ N  SWN+ +N+L++E+P GVG+SYS  +S Y    D 
Sbjct  92    LGVGAFSENGPFRPKGEV--LVRNEHSWNREANMLYLETPIGVGFSYSTDTSSYEAVTDH  149

Query  518   STAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKG  697
              TA D L+F++KW+EKFP++ +R L++TGESYAGHY+PQLA LM+     FK H FN+KG
Sbjct  150   ITARDNLLFLQKWFEKFPQYRNRSLYITGESYAGHYVPQLAELML----QFKEHHFNLKG  205

Query  698   VALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCNAA  874
             +ALGNP+L+   D  +  EF WSHG+ISD  Y    + C++  + S  Y  + S  C+  
Sbjct  206   IALGNPVLEYATDFNSRAEFFWSHGLISDSTYKMFSSVCNYSRFVSEYYRGSVSPICSRV  265

Query  875   INDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPE  1054
             ++  +R  S +++ YDV +DVC  S+  Q   L     +++  IDVC+  E   Y N P+
Sbjct  266   MSQVSRETSKFVDKYDVTLDVCISSVFSQSKALLPQ--QVADSIDVCVEDEVVNYLNRPD  323

Query  1055  VQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSV  1234
             VQKALHA    + + W  C++  +L Y   D +   + ++ KL++  IP+ +YSGDQDSV
Sbjct  324   VQKALHARLVGVRH-WAVCSN--ILGYQVLDVEIPTITIVGKLIKAGIPVLVYSGDQDSV  380

Query  1235  VPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYA  1414
             +PL GSRT++  LA  +++  TVPY  WF   QVGGW   YGN+L+FAT+RGA+H  P++
Sbjct  381   IPLTGSRTLIHGLAEQLRLNTTVPYRVWFEGQQVGGWTQVYGNMLSFATIRGASHEAPFS  440

Query  1415  QPGRALHLFSSFIRGRRLPNT  1477
             QP R+L LF SF+ GR LP  
Sbjct  441   QPERSLVLFKSFLEGRPLPEV  461



>ref|XP_002512656.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF50108.1| serine carboxypeptidase, putative [Ricinus communis]
Length=458

 Score =   373 bits (958),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 216/463 (47%), Positives = 299/463 (65%), Gaps = 12/463 (3%)
 Frame = +2

Query  89    VICFVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFV  268
             ++ F  + L  C   G        D +V LPGQP++ F Q+SGYV VDEK  R+LFYYF 
Sbjct  3     IMAFAVVLLQICFLMGVNSNPSLFDKIVKLPGQPQIGFHQYSGYVTVDEKKQRALFYYFA  62

Query  269   EAEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLF  448
             EAE D   + PL LWLNGGPGCSS+G GAF+E GPF PSG  + L+ N  SWN+ +N+L+
Sbjct  63    EAETDPASK-PLVLWLNGGPGCSSLGVGAFSENGPFRPSG--QVLVKNQYSWNREANMLY  119

Query  449   VESPAGVGWSYSNTSSDY-TCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHY  625
             +ESP GVG+SYS  +S Y    D +TA D L+F++KW+ KFP++ +R LF+TGESYAGHY
Sbjct  120   LESPIGVGFSYSVDTSFYEAVNDKTTARDNLVFLQKWFVKFPQYRNRSLFITGESYAGHY  179

Query  626   IPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIR  805
             +PQLA LM++ NK  K   FN+KGVALGNP+L+   D  +  EF WSHG+ISD  Y    
Sbjct  180   VPQLAQLMLEFNK--KQKLFNLKGVALGNPVLEFATDFNSRAEFFWSHGLISDTTYKLFT  237

Query  806   NECDFDDY-SFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKA  982
             + C++  Y S  Y  + S  C+  +   +R  S +++ YDV +DVC  S++ Q   L   
Sbjct  238   SVCNYSRYVSEYYRGSVSPLCSRVMGQVSRETSKFVDKYDVTLDVCISSVLSQSKILSPH  297

Query  983   VTKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANV  1162
             V  ++  +DVC+  E   Y N  +VQ ALHA    + + W  C+  S+L Y   D +   
Sbjct  298   V--IADNVDVCVEDETVNYLNRLDVQMALHARLVGV-HQWTVCS--SILDYELLDLEIPT  352

Query  1163  VPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGG  1342
             + ++ KL++  +P+ +YSGDQDSV+PL GSRT+V  LA ++ +  TVPY  WF   QVGG
Sbjct  353   ISIVGKLIEAGVPVLVYSGDQDSVIPLTGSRTLVHGLAEELGLKTTVPYRVWFEGQQVGG  412

Query  1343  WQTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLP  1471
             W   YGN+L+FAT+RGA+H  P++QP R+L LF +F+ G+ LP
Sbjct  413   WTQVYGNILSFATIRGASHEAPFSQPERSLVLFKAFLEGQPLP  455



>emb|CDY19500.1| BnaC04g10990D [Brassica napus]
Length=463

 Score =   373 bits (958),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 213/460 (46%), Positives = 294/460 (64%), Gaps = 16/460 (3%)
 Frame = +2

Query  104   CLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKD  283
              L LL              D +  LPGQP+V F+Q+SGYV +DEK  R+LFYY  EAE  
Sbjct  13    ALILLHALSLVSSTVMSRADRITSLPGQPKVGFQQYSGYVSIDEKKQRALFYYLAEAEAK  72

Query  284   VHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPA  463
                + PL LWLNGGPGCSS+G GAF+E GPF P G    L+ N  SWN  +N+L++E+P 
Sbjct  73    PISK-PLVLWLNGGPGCSSLGVGAFSENGPFRPKGSV--LVRNQHSWNHEANMLYLETPV  129

Query  464   GVGWSYSNTSSDYT-CGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLA  640
             GVG+SY+  SS Y    D  TA+D L+F++KW+++FP++L+R LF+TGESYAGHY+PQLA
Sbjct  130   GVGFSYATESSSYEGVNDKITAKDNLVFLQKWFKRFPQYLNRSLFITGESYAGHYVPQLA  189

Query  641   SLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDF  820
              LMI +NK  K H FN+KG+ALGNP+L+   D  +  E+ WSHG+ISD  Y    + C++
Sbjct  190   QLMIQYNK--KHHLFNLKGIALGNPVLEFSTDFNSRAEYFWSHGLISDPTYRMFTSYCNY  247

Query  821   DDY-SFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMS  997
               + S  Y  + S  C+  ++  +   S +++ YDV +DVC PS++ Q     K V+   
Sbjct  248   SRFVSEYYRGDVSSMCSKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQS----KVVSPQQ  303

Query  998   MG--IDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPL  1171
             +G  +DVC+  E   Y N  +VQKALHA R      W  C++  +L Y   D +   + +
Sbjct  304   VGETVDVCVEDETVNYLNRRDVQKALHA-RLVGTRKWAVCSN--VLDYELLDVEVPTINI  360

Query  1172  LKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQT  1351
             +  L++  +P+ +YSGDQDSV+PL GSRT+V++LA  + +  TVPY  WF   QVGGW  
Sbjct  361   VGSLIKAGVPVLVYSGDQDSVIPLTGSRTLVKQLAQQLGLSTTVPYRVWFAGQQVGGWTQ  420

Query  1352  EYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLP  1471
              YGN+L FATVRGAAH VP++QP R+L LF +F+ G  LP
Sbjct  421   VYGNVLAFATVRGAAHEVPFSQPERSLVLFKAFLGGNPLP  460



>ref|XP_006294161.1| hypothetical protein CARUB_v10023154mg [Capsella rubella]
 gb|EOA27059.1| hypothetical protein CARUB_v10023154mg [Capsella rubella]
Length=465

 Score =   373 bits (957),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 207/440 (47%), Positives = 290/440 (66%), Gaps = 10/440 (2%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             D +  LPGQP V F+Q+SGYV++D+K  R+LFYY  EAE     + PL LWLNGGPGCSS
Sbjct  32    DRITRLPGQPRVGFQQYSGYVNIDDKKQRALFYYLAEAETKPISK-PLVLWLNGGPGCSS  90

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYT-CGDI  517
             +G GAF+E GPF P G    L+ N  SWN+ +N+L++E+P GVG+SY+  SS Y    D 
Sbjct  91    LGVGAFSENGPFRPKGSI--LVKNQHSWNQEANMLYLETPVGVGFSYATESSSYEGVNDK  148

Query  518   STAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKG  697
              TA+D L+F++KW+ KFP++L+R LF+TGESYAGHY+PQLA LMI +NK  K + FN+KG
Sbjct  149   ITAKDNLVFLQKWFLKFPQYLNRSLFITGESYAGHYVPQLAQLMIQYNK--KHNLFNLKG  206

Query  698   VALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCNAA  874
             +A+GNP+++   D  +  E+ WSHG+ISD  Y    + C++  Y S  Y    S  C   
Sbjct  207   IAIGNPVMEFSTDFNSRAEYFWSHGLISDLTYKMFTSYCNYSRYVSEYYRGTVSSMCTKV  266

Query  875   INDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPE  1054
             ++  +   S +++ YDV +DVC PS++ Q   ++    +M   +DVC+  E   Y N  +
Sbjct  267   MSQVSIETSRFVDKYDVTLDVCIPSVLSQSKVVNPQPQQMGETVDVCVEDETVNYLNRRD  326

Query  1055  VQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSV  1234
             VQKALHA R      W  C++  +L Y   D +   + ++  L++ ++P+ +YSGDQDSV
Sbjct  327   VQKALHA-RLVGTRKWAVCSN--VLDYEVLDVEVPTINIVGSLVKARVPVLVYSGDQDSV  383

Query  1235  VPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYA  1414
             +PL GSRT+V+ LA ++ +  T PY  WF   QVGGW   YGN+L FATVRGAAH VP++
Sbjct  384   IPLTGSRTLVKRLAEELGLRTTGPYRVWFAGQQVGGWTQVYGNILAFATVRGAAHEVPFS  443

Query  1415  QPGRALHLFSSFIRGRRLPN  1474
             QP RAL LF +F+ GR LP+
Sbjct  444   QPARALVLFKAFLGGRPLPD  463



>ref|XP_006341487.1| PREDICTED: serine carboxypeptidase-like 45-like [Solanum tuberosum]
Length=463

 Score =   373 bits (957),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 215/466 (46%), Positives = 300/466 (64%), Gaps = 20/466 (4%)
 Frame = +2

Query  86    LVICFVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYF  265
             L + +VC+ ++           P  D ++ LPGQP+V F+QFSGYV VD+K  RSLFYYF
Sbjct  15    LFLLYVCVGIV--------SALPHPDKIIKLPGQPQVGFQQFSGYVTVDDKKQRSLFYYF  66

Query  266   VEAEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLL  445
             VEAE D   + PL LWLNGGPGCSS+G GAF+E GPF P G+G  L+ N  SWNK +N+L
Sbjct  67    VEAETDPASK-PLVLWLNGGPGCSSLGVGAFSENGPFRPRGEG--LVKNEHSWNKEANML  123

Query  446   FVESPAGVGWSYSNTSSDY-TCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGH  622
             ++ESP GVG+SYS+ +S Y T  D  TA D ++F+ +W+ KFP++    LFLTGESYAGH
Sbjct  124   YLESPIGVGFSYSSDTSSYETVNDEVTARDNVVFLLRWFHKFPQYSKSNLFLTGESYAGH  183

Query  623   YIPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAI  802
             Y+PQLA LM+  NK  K   FN+KG+ALGNP+L+   D  +  E+ WSHG+ISD  Y   
Sbjct  184   YVPQLAKLMMAFNK--KQQLFNLKGIALGNPVLEFATDFNSRAEYFWSHGLISDPTYRMF  241

Query  803   RNECDFDDY-SFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHK  979
              + C++  Y S  Y    S  C+  ++  +R  S +++ YDV +DVC  S++ Q   +  
Sbjct  242   SSACNYSRYVSEYYRDTVSPICSRVMSLVSRETSKFVDKYDVTLDVCISSVLSQSKII--  299

Query  980   AVTKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDAN  1159
             +  + +  +DVC+  E   Y N  +V++ALHA    +   W  C+  S+L Y   D +  
Sbjct  300   SPQENAEKLDVCVEDEVVNYLNRKDVRRALHAELVGV-RRWSVCS--SILDYQLLDIEIP  356

Query  1160  VVPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVG  1339
              + ++  L++ +IP+ IYSGDQDSVVPL+GSR  V++LA  M++  TVPY  WF   QVG
Sbjct  357   TISIIGTLIKERIPVLIYSGDQDSVVPLIGSRATVQQLARQMQLNTTVPYRVWFAGQQVG  416

Query  1340  GWQTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNT  1477
             GW   Y N+L+FAT+RGA+H  P++QP R+L LF SF+ G+ LP  
Sbjct  417   GWTHVYDNILSFATIRGASHEAPFSQPERSLVLFKSFLEGKPLPEV  462



>gb|KDO83625.1| hypothetical protein CISIN_1g0117641mg [Citrus sinensis]
Length=330

 Score =   368 bits (944),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 206/281 (73%), Positives = 232/281 (83%), Gaps = 1/281 (0%)
 Frame = +2

Query  152  PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
            P EDLVV LPGQP+V+FRQ++GYVDVD K GRSLFYYFVEAE + H + PLTLWLNGGPG
Sbjct  33   PAEDLVVSLPGQPKVAFRQYAGYVDVDVKNGRSLFYYFVEAEVEPHEK-PLTLWLNGGPG  91

Query  332  cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
            CSS+GGGAFTELGPF+P GDGRGL  NS SWNKASNLLFVESPAGVGWSYSNT+SDY CG
Sbjct  92   CSSVGGGAFTELGPFYPRGDGRGLRRNSMSWNKASNLLFVESPAGVGWSYSNTTSDYNCG  151

Query  512  DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
            D STA DM +FM  WYEKFPEF  R LFLTGESYAGHYIPQLA +++DHN H KG KFNI
Sbjct  152  DASTARDMHVFMMNWYEKFPEFKSRELFLTGESYAGHYIPQLADVLLDHNAHSKGFKFNI  211

Query  692  KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDSCNA  871
            KGVA+GNPLL+LD+DVPA+ EF WSHG+ISDE    I ++CDFDDY     HN ++SC  
Sbjct  212  KGVAIGNPLLRLDQDVPAIYEFFWSHGMISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIE  271

Query  872  AINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKM  994
            AI + N+ V DYIN YDVI+DVCYP+IVEQELRL K V  M
Sbjct  272  AITEANKIVGDYINNYDVILDVCYPTIVEQELRLRKMVYIM  312



>ref|XP_006438864.1| hypothetical protein CICLE_v10031451mg [Citrus clementina]
 gb|ESR52104.1| hypothetical protein CICLE_v10031451mg [Citrus clementina]
Length=464

 Score =   373 bits (957),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 214/442 (48%), Positives = 292/442 (66%), Gaps = 17/442 (4%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             D +  LPGQP+V F+Q+SGYV VDEK  R+LFYYF EAE D   + PL LWLNGGPGCSS
Sbjct  32    DRITALPGQPQVGFQQYSGYVTVDEKKQRALFYYFAEAETDPASK-PLVLWLNGGPGCSS  90

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYT-CGDI  517
             +G GAF+E GPF P  +G+ L+ N  SWN+ +N+LF+E+P GVG+SYS  +S Y   GD 
Sbjct  91    LGVGAFSENGPFRP--NGQVLVRNEYSWNREANMLFLETPIGVGFSYSKDASSYQGVGDK  148

Query  518   STAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKG  697
              TA D L+F+K W+ KFP++ +R LF+TGESYAGHYIPQLA LM++ NK  K   FN+KG
Sbjct  149   ITARDNLVFLKNWFLKFPQYRNRSLFITGESYAGHYIPQLADLMLEFNK--KEELFNLKG  206

Query  698   VALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCNAA  874
             +ALGNP+L+   D  +  EF WSHG+ISD  Y    + C++  Y S  Y  + S  C+  
Sbjct  207   IALGNPVLEFATDFNSRAEFFWSHGLISDATYTMFTSFCNYSRYVSEYYRGSVSPICSRV  266

Query  875   INDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMG---IDVCMGSERTFYFN  1045
             ++  +R  S +++ YDV +DVC  S++ Q     K +T   +G   +DVC+  E   Y N
Sbjct  267   MSLVSRETSRFVDKYDVTLDVCISSVLSQS----KVLTPKQVGETTVDVCVEDETVNYLN  322

Query  1046  LPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQ  1225
               +VQKALHA    +   W  C++  +L Y   D +   + ++ KL++  IP+ +YSGDQ
Sbjct  323   RKDVQKALHARLVGV-RGWAVCSN--ILDYELLDLEIPTITVVGKLVKAGIPVMVYSGDQ  379

Query  1226  DSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMV  1405
             DSV+PL GSR +V  LA ++K+  TVPY  WF   QVGGW   YGN+L+FAT+RGA+H  
Sbjct  380   DSVIPLTGSRKLVNGLAKELKLETTVPYRVWFEGQQVGGWTQVYGNILSFATIRGASHEA  439

Query  1406  PYAQPGRALHLFSSFIRGRRLP  1471
             P++QP R+L LF +F+  R LP
Sbjct  440   PFSQPERSLVLFEAFLDSRPLP  461



>ref|XP_010239839.1| PREDICTED: serine carboxypeptidase-like 45 [Brachypodium distachyon]
Length=465

 Score =   372 bits (956),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 216/466 (46%), Positives = 294/466 (63%), Gaps = 11/466 (2%)
 Frame = +2

Query  89    VICFVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFV  268
             +   VC + +     G +     ED + GLPGQP VSF Q+SGYV VD    RSLFYYF 
Sbjct  6     IAAAVCAATVLLITNGFLSMASAEDEIRGLPGQPPVSFAQYSGYVAVDAARKRSLFYYFA  65

Query  269   EAEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLF  448
             EAE D   + PL LWLNGGPGCSS+G GAF+E GPF PSG+   L+ N  SWNK +N+L+
Sbjct  66    EAELDPATK-PLVLWLNGGPGCSSVGVGAFSENGPFRPSGNA--LVRNEYSWNKEANMLY  122

Query  449   VESPAGVGWSYSNTSSDYT-CGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHY  625
             +ESPAGVG+SYS   S Y   GD  TA D L F++ W+ KFP +  R L++TGESYAGHY
Sbjct  123   LESPAGVGFSYSTDPSFYGGVGDSMTARDNLKFLQGWFAKFPRYKGRDLYITGESYAGHY  182

Query  626   IPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIR  805
             +PQLA  +++ NK  K   FN+KG+ALGNP+L+   D  +  EF WSHG+ISD  YN   
Sbjct  183   VPQLAQRIVEFNK--KEKLFNLKGIALGNPVLEFSTDFNSRAEFFWSHGLISDSTYNIFS  240

Query  806   NECDFDDYSFIYPHNE-SDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLH-K  979
               C++  Y   Y H   S  C+  ++   R  S +++ YDV +DVC  S++ Q   L  +
Sbjct  241   RVCNYSRYVSEYYHGSISPVCDRVMSQVTRETSRFVDKYDVTLDVCISSVLAQSKTLTPQ  300

Query  980   AVTKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDAN  1159
             +  ++S  +DVC+  E   Y N  +VQ+A+HA    +P  W  C+  S+L+Y Q D    
Sbjct  301   STQQLSRELDVCVEDETMNYLNRKDVQQAMHARLNGVP-KWTVCS--SVLEYKQLDLQIP  357

Query  1160  VVPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVG  1339
              +  +  L++  IP+ +YSGDQDSV+PL GSRT+V  LA  +++  TVPY  WF   QVG
Sbjct  358   TINTVGMLVKSGIPVLVYSGDQDSVIPLTGSRTLVHRLAKRLRLNATVPYRVWFEGKQVG  417

Query  1340  GWQTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNT  1477
             GW   +G+ L+FAT+RGA+H  P++QP R+L LF +F+ GR LP +
Sbjct  418   GWTQVFGDALSFATIRGASHEAPFSQPERSLVLFRAFLAGRPLPES  463



>ref|XP_010549304.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Tarenaya 
hassleriana]
Length=467

 Score =   372 bits (956),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 210/439 (48%), Positives = 289/439 (66%), Gaps = 11/439 (3%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             D V  LPGQP V F+Q+SGYV VD+K  R+LFYYF EAE D   + PL LWLNGGPGCSS
Sbjct  35    DRVAQLPGQPRVGFQQYSGYVTVDDKKQRALFYYFAEAEADPASK-PLVLWLNGGPGCSS  93

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYT-CGDI  517
             +G GAF+E GPF P G    L+ N  SWNK +N+L++E+P GVG+SYS  SS Y    D 
Sbjct  94    LGVGAFSENGPFRPKGPI--LVKNEHSWNKEANMLYLETPVGVGFSYSTDSSSYEGVNDK  151

Query  518   STAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKG  697
              TA D L+F+++W+ KFP++L+R LF+TGESYAGHY+PQLA LMI +NK  K   FN++G
Sbjct  152   ITARDNLVFLQRWFLKFPQYLNRSLFITGESYAGHYVPQLAQLMIQYNKKHK--LFNLRG  209

Query  698   VALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCNAA  874
             +ALGNP+L+   D  +  EF WSHG+ISD  Y    + C++  Y S  Y    S  C+  
Sbjct  210   IALGNPVLEFATDFNSRAEFFWSHGLISDSTYKMFTSYCNYSRYVSEYYRGTVSAMCSKV  269

Query  875   INDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPE  1054
             ++  +   S +++ YDV +DVC PS++ Q  ++     ++   +DVC+  E   Y N  +
Sbjct  270   MSQVSVETSRFVDKYDVTLDVCIPSVLSQS-KVVSPQQQVGETVDVCVEDETVSYLNRRD  328

Query  1055  VQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSV  1234
             VQ++LHA    +   W  C++  +L Y   D +   + ++  L++  IP+ +YSGDQDSV
Sbjct  329   VQRSLHARLVGV-RKWAVCSN--VLDYELLDVEIPTITVVGNLVKAGIPVLVYSGDQDSV  385

Query  1235  VPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYA  1414
             +PL GSRT+V  LA ++++  TVPY  WF   QVGGW   YGN+L+FATVRGA+H VP++
Sbjct  386   IPLTGSRTLVNRLAEELRLRTTVPYRVWFAGQQVGGWTQVYGNILSFATVRGASHEVPFS  445

Query  1415  QPGRALHLFSSFIRGRRLP  1471
             QP R+L LF +FI G  LP
Sbjct  446   QPQRSLVLFKAFINGHPLP  464



>ref|NP_850212.1| serine carboxypeptidase-like 46 [Arabidopsis thaliana]
 sp|Q8VY01.1|SCP46_ARATH RecName: Full=Serine carboxypeptidase-like 46; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL67013.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AEC08849.1| serine carboxypeptidase-like 46 [Arabidopsis thaliana]
Length=465

 Score =   372 bits (956),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 209/439 (48%), Positives = 286/439 (65%), Gaps = 10/439 (2%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             D +  LPGQP V F+Q+SGYV +DEK  R+LFYY  EAE     + PL LWLNGGPGCSS
Sbjct  32    DRITRLPGQPRVGFQQYSGYVTIDEKKQRALFYYLAEAETKPISK-PLVLWLNGGPGCSS  90

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYT-CGDI  517
             +G GAF+E GPF P G    L+ N  SWN+ +N+L++E+P GVG+SY+N SS Y    D 
Sbjct  91    LGVGAFSENGPFRPKGSI--LVRNQHSWNQEANMLYLETPVGVGFSYANESSSYEGVNDK  148

Query  518   STAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKG  697
              TA+D L+F++KW+ KFP++L+R LF+TGESYAGHY+PQLA LMI +NK  K + FN+KG
Sbjct  149   ITAKDNLVFLQKWFLKFPQYLNRSLFITGESYAGHYVPQLAQLMIQYNK--KHNLFNLKG  206

Query  698   VALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDS-CNAA  874
             +A+GNP+++   D  +  E+ WSHG+ISD  Y    + C++  +   Y      S C   
Sbjct  207   IAIGNPVMEFATDFNSRAEYFWSHGLISDPTYKLFTSSCNYSRFLSEYHRGSVSSMCTKV  266

Query  875   INDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPE  1054
             ++      S +I+ YDV +DVC PS++ Q   +     ++   +DVC+  E   Y N  +
Sbjct  267   LSQVGIETSRFIDKYDVTLDVCIPSVLSQSKVVSPQPQQVGETVDVCLEDETVNYLNRRD  326

Query  1055  VQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSV  1234
             VQKALHA R      W  C+D  +L Y   D +   + ++  L++  +P+++YSGDQDSV
Sbjct  327   VQKALHA-RLVGTRKWTVCSD--VLDYEVLDVEVPTINIVGSLVKAGVPVFVYSGDQDSV  383

Query  1235  VPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYA  1414
             +PL GSRT+V+ LA ++ +  TVPY  WF   QVGGW   YGN L FATVRGAAH VP++
Sbjct  384   IPLTGSRTLVKRLAEELGLRTTVPYRVWFAGQQVGGWTQVYGNTLAFATVRGAAHEVPFS  443

Query  1415  QPGRALHLFSSFIRGRRLP  1471
             QP RAL LF +F+ GR LP
Sbjct  444   QPARALVLFKAFLGGRPLP  462



>ref|XP_011036160.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Populus 
euphratica]
Length=462

 Score =   372 bits (955),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 215/459 (47%), Positives = 296/459 (64%), Gaps = 16/459 (3%)
 Frame = +2

Query  107   LSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDV  286
             L LL C   G      + D +  LPGQP V F+Q+SGYV VD+K  ++LFYYF EAE D 
Sbjct  13    LGLLVCFIIGVECSLSQLDRITQLPGQPPVWFQQYSGYVTVDDKNQKALFYYFAEAEIDC  72

Query  287   HRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAG  466
               + PL LWLNGGPGCSS+G GAF+E GPF PSG+G  L+ N  SWN+ +N+L++E+P G
Sbjct  73    ASK-PLVLWLNGGPGCSSLGVGAFSENGPFRPSGEG--LVKNQYSWNREANMLYLETPIG  129

Query  467   VGWSYS-NTSSDYTCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLAS  643
             VG+SYS NTSS     D  TA D L+F+++W+ KFP++  R LF+TGESYAGHY+PQLA 
Sbjct  130   VGFSYSTNTSSYEGVDDKITARDNLVFLQRWFVKFPQYKSRSLFITGESYAGHYVPQLAE  189

Query  644   LMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFD  823
             LM+  NK  K   FN+KG+ALGNP+L+   D  +  EF+WSHG+ISD  Y      C++ 
Sbjct  190   LMLQFNK--KEKLFNLKGIALGNPVLEYSTDFNSRAEFLWSHGLISDTTYKMFTTVCNYS  247

Query  824   DY-SFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSM  1000
              Y S  Y  + S  C+  +N   R  S +++ YDV +DVC  S++ Q     K +T   +
Sbjct  248   RYVSEYYRGSVSPQCSRVMNQVTRETSRFVDKYDVTLDVCISSVLSQS----KVLTPQQV  303

Query  1001  G--IDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLL  1174
             G  +DVC+  E   Y N P+VQ ALHA    +   W  C++  +L Y   D +   + ++
Sbjct  304   GDNVDVCVEDETVNYLNRPDVQMALHARLVGV-RRWAVCSN--ILDYELLDLEIPTITIV  360

Query  1175  KKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTE  1354
              +L++  IP+ +YSGDQDSV+PL GSR +V  L+ ++ +  TVPY  WF   QVGGW   
Sbjct  361   GRLIKAGIPVLVYSGDQDSVIPLTGSRILVHRLSEELGLKTTVPYRVWFEGQQVGGWTQV  420

Query  1355  YGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLP  1471
             YGN+L+FAT+RGA+H  P++QP R+L LF +F+ G+ LP
Sbjct  421   YGNILSFATIRGASHEAPFSQPERSLVLFKAFLGGQPLP  459



>ref|XP_006430527.1| hypothetical protein CICLE_v10011695mg [Citrus clementina]
 gb|ESR43767.1| hypothetical protein CICLE_v10011695mg [Citrus clementina]
Length=455

 Score =   371 bits (953),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 211/460 (46%), Positives = 293/460 (64%), Gaps = 15/460 (3%)
 Frame = +2

Query  98    FVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAE  277
              + +S LFC         P+ D ++ LPGQP+ SF+Q++GY+ +DEK  R+LFYYFVEA 
Sbjct  7     IIIVSALFCTTILTAKSVPQADKIISLPGQPQASFQQYAGYITIDEKQQRALFYYFVEAA  66

Query  278   KDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVES  457
              +   + PL LWLNGGPGCSSIG GAF E GPF PSGD   L+ N  SWNK +N+L++ES
Sbjct  67    TEAASK-PLVLWLNGGPGCSSIGAGAFCEHGPFKPSGDT--LLRNEYSWNKEANMLYLES  123

Query  458   PAGVGWSYSNTSSDY-TCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQ  634
             PAGVG+SYS   S Y +  D   A D L F++ WYEKF E+ +R  F+TGESYAGHY+PQ
Sbjct  124   PAGVGFSYSANKSFYGSINDAIAARDNLAFLEGWYEKFTEYKNREFFITGESYAGHYVPQ  183

Query  635   LASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNEC  814
             LA L+I  N      KFN+KG+A+GNPLL+ + D  +  EF+WSHG+ISD  Y+     C
Sbjct  184   LAQLIIQSN-----MKFNLKGIAIGNPLLEFNTDFNSRAEFLWSHGLISDSTYDIFTRVC  238

Query  815   DFDDYSFIYPHNE-SDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTK  991
             ++      Y     +  C+  I+  +R +S +++ YDV +DVC PS++ Q   L +   K
Sbjct  239   NYSQIRRQYASGSLTAVCSQVISQVSREISRFVDTYDVTLDVCLPSVLLQSKMLSQLQDK  298

Query  992   MSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPL  1171
                 IDVC+  E T Y N  +VQKALHA    +   W  C++  +LKY+  + +   + +
Sbjct  299   EE--IDVCVEDETTKYLNRKDVQKALHAQLIGVT-SWTVCSE--VLKYDMQNLEIPTIHV  353

Query  1172  LKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQT  1351
             L KL +  I + +YSGDQDSV+PL G+RT+V  LA ++ +  TVPY  W    Q  GW  
Sbjct  354   LGKLAKSGIRVLVYSGDQDSVLPLTGTRTLVNGLAKEIGLNTTVPYRTWVEGRQAAGWTQ  413

Query  1352  EYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLP  1471
              YG++L+FAT+RGA+H  P +QP R+L LF++F+ G+ LP
Sbjct  414   VYGDILSFATIRGASHEAPLSQPRRSLALFNAFLGGKPLP  453



>ref|XP_006482059.1| PREDICTED: serine carboxypeptidase-like 45-like [Citrus sinensis]
Length=455

 Score =   371 bits (953),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 211/457 (46%), Positives = 292/457 (64%), Gaps = 15/457 (3%)
 Frame = +2

Query  107   LSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDV  286
             +S LFC         P+ D ++ LPGQP+ SF+Q++GY+ +DEK  R+LFYYFVEA  + 
Sbjct  10    VSALFCTTILTAKSVPQADKIISLPGQPQASFQQYAGYITIDEKQQRALFYYFVEAATEA  69

Query  287   HRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAG  466
               + PL LWLNGGPGCSSIG GAF E GPF PSGD   L+ N  SWNK +N+L++ESPAG
Sbjct  70    ASK-PLVLWLNGGPGCSSIGAGAFCEHGPFKPSGDT--LLRNEYSWNKEANMLYLESPAG  126

Query  467   VGWSYSNTSSDY-TCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLAS  643
             VG+SYS   S Y +  D   A D L F++ WYEKFPE+ +R  F+TGESYAGHY+PQLA 
Sbjct  127   VGFSYSANKSFYGSVNDAIAARDNLAFLEGWYEKFPEYKNREFFITGESYAGHYVPQLAQ  186

Query  644   LMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFD  823
             L+I  N      K N+KG+A+GNPLL+ + D  +  EF+WSHG+ISD  Y+     C++ 
Sbjct  187   LIIQSN-----MKLNLKGIAIGNPLLEFNTDFNSRAEFLWSHGLISDSTYDIFTRVCNYS  241

Query  824   DYSFIYPHNE-SDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSM  1000
                  Y     +  C+  I+  +R +S +++ YDV +DVC PS++ Q   L +   K   
Sbjct  242   QIRRQYASGSLTAVCSQVISQVSREISRFVDTYDVTLDVCLPSVLLQSKMLSQLQDKEE-  300

Query  1001  GIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKK  1180
              IDVC+  E T Y N  +VQKALHA    +   W  C++  +LKY+  + +   + +L K
Sbjct  301   -IDVCVEDETTKYLNRKDVQKALHAQLIGVT-SWTVCSE--VLKYDMQNLEIPTIHVLGK  356

Query  1181  LLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYG  1360
             L +  I + +YSGDQDSV+PL G+RT+V  LA ++ +  TVPY  W    Q  GW   YG
Sbjct  357   LAKSGIRVLVYSGDQDSVLPLTGTRTLVNGLAKEIGLNTTVPYRTWVEGRQAAGWTQVYG  416

Query  1361  NLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLP  1471
             ++L+FAT+RGA+H  P +QP R+L LF++F+ G+ LP
Sbjct  417   DILSFATIRGASHEAPLSQPRRSLALFNAFLGGKPLP  453



>ref|XP_002307963.1| hypothetical protein POPTR_0006s03490g [Populus trichocarpa]
 gb|EEE91486.1| hypothetical protein POPTR_0006s03490g [Populus trichocarpa]
Length=459

 Score =   371 bits (953),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 206/466 (44%), Positives = 291/466 (62%), Gaps = 17/466 (4%)
 Frame = +2

Query  86    LVICFVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYF  265
             +VI  +C +L+F   G       E   +V LPGQP VSF+Q++GY+ +DE+  R+LFYYF
Sbjct  8     IVIAAICATLIFLTTGSIS----EAGKIVALPGQPTVSFQQYAGYITIDEQQKRALFYYF  63

Query  266   VEAEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLL  445
              EAE D   + PL LWLNGGPGCSSIG GAF E GPF PSG+   L+ N  SWNK +N+L
Sbjct  64    AEAEIDPATK-PLVLWLNGGPGCSSIGAGAFCEHGPFKPSGEI--LLKNDYSWNKEANML  120

Query  446   FVESPAGVGWSYSNTSSDYT-CGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGH  622
             ++ESPAGVG+SYS   S YT   D  TA+D L+F+++W+++FPE+  R  F+TGESYAGH
Sbjct  121   YLESPAGVGFSYSANDSFYTYVTDGITAQDNLVFLERWFDEFPEYKGRDFFITGESYAGH  180

Query  623   YIPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAI  802
             Y+PQLA+L++         KFN+KG+A+GNPLL+ + D  +  EF+WSHG+ISD  Y   
Sbjct  181   YVPQLATLIVQSKA-----KFNLKGIAIGNPLLEFNTDFNSRAEFLWSHGLISDNTYEIF  235

Query  803   RNECDFDDYSFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKA  982
                C++      Y         +A+N Q             +      S +E + ++ K 
Sbjct  236   TTVCNYSQIRRQYQSGSLSLPCSAVNSQVSREVSKYVDAYDVTLDVCLSSIESQSQVLKQ  295

Query  983   VTKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANV  1162
             + + +  IDVC+  E   Y N  +V +ALHA    +   W  C+D  ++KY   + + + 
Sbjct  296   M-EYTGTIDVCVEDETIKYLNRKDVLEALHAQLVGVD-QWTVCSD--VVKYEMENLEIST  351

Query  1163  VPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGG  1342
             VPLL KLL+  I + +YSGDQDSV+PL G+RT+V  LA ++ +  TVPY  WF   QV G
Sbjct  352   VPLLAKLLKSGIRVHVYSGDQDSVIPLTGTRTVVNGLAKELGLNTTVPYRTWFQGKQVAG  411

Query  1343  WQTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNTT  1480
             W   YGN+L+FAT+RGA+H  P++QP R+  LF++F+ G++LP  T
Sbjct  412   WTQVYGNILSFATIRGASHEAPFSQPERSFVLFNAFLEGKQLPPPT  457



>ref|XP_009759845.1| PREDICTED: serine carboxypeptidase-like 45 [Nicotiana sylvestris]
Length=463

 Score =   371 bits (953),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 217/457 (47%), Positives = 296/457 (65%), Gaps = 16/457 (4%)
 Frame = +2

Query  113   LLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHR  292
              LFC   G V   P  D ++ LPGQP+V F+QFSGYV VD+K  +SLFYYFVEAE +   
Sbjct  16    FLFCVSLGIVAALPHPDKIIQLPGQPQVGFQQFSGYVTVDDKKQKSLFYYFVEAETNPAS  75

Query  293   RLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVG  472
             + PL LWLNGGPGCSS+G GAF+E GPF P G  + L+ N  SWNK +N+L++ESP GVG
Sbjct  76    K-PLVLWLNGGPGCSSVGVGAFSENGPFRPRG--QVLVRNEYSWNKEANMLYLESPIGVG  132

Query  473   WSYSNTSSDY-TCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLM  649
             +SYSN +S Y T  D  TA D L+F+ +W++KFP++    LFLTGESYAGHY+PQLA LM
Sbjct  133   FSYSNNTSSYETVNDEVTARDNLVFLLRWFQKFPQYRKSNLFLTGESYAGHYVPQLAKLM  192

Query  650   IDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY  829
             +  NK  K   FN+KGVALGNP+L+   D  +  E+ WSHG+ISD  Y    + C++  Y
Sbjct  193   MVFNK--KQQIFNLKGVALGNPVLEFATDFNSRAEYFWSHGLISDPTYRMFSSACNYSRY  250

Query  830   -SFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQE--LRLHKAVTKMSM  1000
              S  Y  + S  C+  ++  +R  S +++ Y V +DVC  S++ Q   +   + V K+  
Sbjct  251   VSEYYRGSVSPICSRVMSLVSRETSKFVDKYGVTLDVCISSVLSQSKIISPQENVEKL--  308

Query  1001  GIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKK  1180
               DVC+  E   Y N  +V++ALHA    +   W  C++  +L Y   D +   + ++  
Sbjct  309   --DVCVEDEIINYLNRKDVRRALHAELVGV-RRWAVCSN--ILDYQLLDIEIPTISIIGM  363

Query  1181  LLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYG  1360
             L++ +IP+ IYSGDQDSV+PL+GSR  V +LA  M++  TVPY  WF   QVGGW   Y 
Sbjct  364   LVKERIPVLIYSGDQDSVIPLIGSRATVHQLARRMQLNTTVPYRVWFAGQQVGGWTHVYD  423

Query  1361  NLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLP  1471
             N+L+FAT+RGA+H  P++QP R+L LF SF+ GR LP
Sbjct  424   NILSFATIRGASHEAPFSQPERSLVLFRSFLEGRPLP  460



>ref|XP_006415698.1| hypothetical protein EUTSA_v10007573mg [Eutrema salsugineum]
 gb|ESQ34051.1| hypothetical protein EUTSA_v10007573mg [Eutrema salsugineum]
Length=463

 Score =   371 bits (953),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 211/444 (48%), Positives = 293/444 (66%), Gaps = 16/444 (4%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P  D V  LPGQP V F+Q+SGYV VD++  R+LFYYF EAE D   + PL LWLNGGPG
Sbjct  29    PHSDRVTRLPGQPRVGFQQYSGYVTVDDRKQRALFYYFAEAEIDPTSK-PLVLWLNGGPG  87

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYT-C  508
             CSS+G GAF+E GPF P G    L+ N  SWN+ +N+L++E+P GVG+SYS  SS Y   
Sbjct  88    CSSLGVGAFSENGPFRPKGPV--LVKNQHSWNQEANMLYLETPVGVGFSYSTQSSSYEGV  145

Query  509   GDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFN  688
              D  TA+D L+F+++W+ KFP +L+R LF+TGESYAGHY+PQLA LMI++NK  K H FN
Sbjct  146   TDKITAKDNLVFLQRWFLKFPHYLNRSLFITGESYAGHYVPQLAQLMIEYNK--KHHLFN  203

Query  689   IKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSC  865
             ++G+A+GNP+L+   D  +  E+ WSHG+ISD  Y    + C++  Y S  Y  + S  C
Sbjct  204   LRGIAIGNPVLEFATDFNSRAEYFWSHGLISDPTYKMFTSYCNYSRYVSEYYRGSMSSMC  263

Query  866   NAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMG--IDVCMGSERTFY  1039
             +  ++  +   S +++ YDV +DVC PS++ Q     K V+   +G  +DVC+  E   Y
Sbjct  264   SKVMSQVSTETSRFVDKYDVTLDVCIPSVLSQS----KVVSPNQVGESVDVCVEDETVKY  319

Query  1040  FNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSG  1219
              N  +VQ+ALHA    +  +W  C++  +L Y   D +   + ++  L+Q  +P+ +YSG
Sbjct  320   LNRRDVQEALHARLIGV-REWTVCSN--VLDYQLLDVEIPTINIVGSLVQAGVPVLVYSG  376

Query  1220  DQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAH  1399
             DQDSV+PL GSRT+V  LA  + +  +VPY  WF   QVGGW   YGN+L+FATVRGAAH
Sbjct  377   DQDSVIPLTGSRTLVSRLAKRLGLRTSVPYRVWFAGQQVGGWTQVYGNVLSFATVRGAAH  436

Query  1400  MVPYAQPGRALHLFSSFIRGRRLP  1471
              VP++QP R+L LF +F+ G  LP
Sbjct  437   EVPFSQPERSLVLFKAFLDGHPLP  460



>gb|KEH35690.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=448

 Score =   370 bits (951),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 214/441 (49%), Positives = 293/441 (66%), Gaps = 12/441 (3%)
 Frame = +2

Query  161   DLVVGLPGQPE-VSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcs  337
             D +V LPGQP+ ++F+QFSGYV VD K  +SLFYYF E+E D   + PL LWLNGGPGCS
Sbjct  13    DKIVTLPGQPQNIAFQQFSGYVTVDNKKHKSLFYYFAESETDPSSK-PLVLWLNGGPGCS  71

Query  338   sigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYT--CG  511
             S+G GAF+E GPF P+GD   LI N  SWNK +N+L++E+PAGVG+SY   SS YT    
Sbjct  72    SLGVGAFSENGPFRPNGDF--LIKNEHSWNKEANMLYLETPAGVGFSYVKGSSAYTTTVN  129

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D  TA D L+F+++W+ KFP++ +R LFLTGESYAGHY+PQLA LMI+ NK  K   FN+
Sbjct  130   DDETARDNLVFLERWFNKFPQYRNRDLFLTGESYAGHYVPQLAKLMIEMNKRNK--IFNL  187

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNE-SDSCN  868
             KG+ALGNP+L+   D  +  EF WSHG+ISD  YN     C++  Y   Y  +  S  C+
Sbjct  188   KGIALGNPVLEYATDFNSRAEFFWSHGLISDATYNMFTRVCNYSRYVSEYNRDSVSPLCS  247

Query  869   AAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNL  1048
               +   ++  S +++ YDV +DVC  S++ Q   +     + +  IDVC+  + T Y N 
Sbjct  248   KVMGLVSKETSRFVDKYDVTLDVCISSVLSQSKVISPQPQQANEMIDVCVDDKVTNYLNR  307

Query  1049  PEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQD  1228
              +VQ+ALHA    +   W  C++  +L Y+  + +   +P++  L++  + + IYSGDQD
Sbjct  308   RDVQEALHAKLVGV-RKWDVCSN--VLDYDVLNLEVPTLPVVGSLIKAGVKVLIYSGDQD  364

Query  1229  SVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVP  1408
             SV+PL GSRT+V++LA  + +  TVPY  WF   QVGGW   YGN+L+FATVRGAAH  P
Sbjct  365   SVIPLTGSRTLVQKLARQLGLNTTVPYRVWFEGQQVGGWTQVYGNVLSFATVRGAAHEAP  424

Query  1409  YAQPGRALHLFSSFIRGRRLP  1471
             ++QP R+L LF SF+ GR LP
Sbjct  425   FSQPERSLVLFKSFLEGRPLP  445



>ref|XP_011073181.1| PREDICTED: serine carboxypeptidase-like 45 [Sesamum indicum]
Length=458

 Score =   371 bits (952),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 215/443 (49%), Positives = 291/443 (66%), Gaps = 12/443 (3%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P  D +  LPGQP V F+ FSGYV VDEK  ++LFYYFVEAE D   + PL LWLNGGPG
Sbjct  24    PHPDKITQLPGQPPVEFQHFSGYVTVDEKKEKALFYYFVEAEIDPLSK-PLVLWLNGGPG  82

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDY-TC  508
             CSSIG GAF+E GPF P  +G+ L+ N  SWN+ +N+L++++P GVG+SYS  +S Y T 
Sbjct  83    CSSIGVGAFSENGPFRP--NGQVLLRNEYSWNREANMLYLDTPIGVGFSYSTGASSYVTV  140

Query  509   GDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFN  688
              D  TA+D L+F+++W+ KFP++ +  LF+TGESYAGHY+PQLA L+I+ NK  K    N
Sbjct  141   NDEMTAKDNLVFLQRWFLKFPQYRNSSLFITGESYAGHYVPQLAKLVIELNK--KRKMIN  198

Query  689   IKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNE-SDSC  865
             +KG+ALGNPLL+   D  +  E+ WSHG+ISD  YN   + C++  Y   Y  +  S  C
Sbjct  199   LKGIALGNPLLEFTTDYNSRAEYFWSHGLISDSTYNLFTSVCNYSRYVREYYRDSLSVLC  258

Query  866   NAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFN  1045
             +  ++  NR  S ++N YDV +DVC PS++ Q   +  A  + S  IDVC+  E   Y N
Sbjct  259   SRVMSLVNRESSRFVNKYDVTLDVCIPSVLSQSKII--APQRNSERIDVCVEDETVSYLN  316

Query  1046  LPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQ  1225
               +VQKALHA    +   W  C++  +L Y+  D +   + ++  L++  IP+ IYSGDQ
Sbjct  317   RRDVQKALHARLVGV-RRWDVCSN--ILDYDMLDLEIPTISIIGSLIKEGIPVLIYSGDQ  373

Query  1226  DSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMV  1405
             DSV+PL GSRT+V  LA  + +  TVPY  WF   QVGGW   YGNLL+FAT+RGA+H  
Sbjct  374   DSVIPLTGSRTLVHRLAKQLGLNTTVPYRVWFEGQQVGGWTQVYGNLLSFATIRGASHEA  433

Query  1406  PYAQPGRALHLFSSFIRGRRLPN  1474
             P++QP R+  LF SF+ GR LP 
Sbjct  434   PFSQPERSFVLFKSFLDGRPLPQ  456



>ref|XP_006304410.1| hypothetical protein CARUB_v10010972mg [Capsella rubella]
 gb|EOA37308.1| hypothetical protein CARUB_v10010972mg [Capsella rubella]
Length=459

 Score =   371 bits (952),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 211/441 (48%), Positives = 291/441 (66%), Gaps = 16/441 (4%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             D V  LPGQP V F+Q+SGYV VD+K  R+LFYYF EAE D   + PL LWLNGGPGCSS
Sbjct  28    DRVTRLPGQPRVGFQQYSGYVTVDDKKQRALFYYFAEAETDPTSK-PLVLWLNGGPGCSS  86

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYT-CGDI  517
             +G GAF+E GPF P G    L+ N  SWN+ +N+L++E+P GVG+SYS  SS Y    D 
Sbjct  87    LGVGAFSENGPFRPKGPV--LVKNQHSWNQEANMLYLETPVGVGFSYSTQSSSYEGVNDK  144

Query  518   STAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKG  697
              TA D L+F+++W+ KFP +L+R LF+TGESYAGHY+PQLA LMI +NK  K H FN++G
Sbjct  145   ITARDNLVFLQRWFLKFPHYLNRSLFITGESYAGHYVPQLAQLMIQYNK--KHHLFNLRG  202

Query  698   VALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCNAA  874
             +A+GNP+L+ + D  +  E+ WSHG+ISD  Y    + C++  Y S  Y  + S  C+  
Sbjct  203   IAIGNPVLEFETDFNSRAEYFWSHGLISDSTYKMFTSYCNYSRYVSEYYRGSMSSICSKV  262

Query  875   INDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMG--IDVCMGSERTFYFNL  1048
             ++  +   S +++ YDV +DVC PS++ Q     K V+   +G  +DVC+  E   Y N 
Sbjct  263   MSQVSTETSRFVDKYDVTLDVCIPSVLSQS----KVVSPNQVGESVDVCVEDETVKYLNR  318

Query  1049  PEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQD  1228
              +VQ+ALHA    +  +W  C++  +L Y   D +   + ++  L++  +P+ +YSGDQD
Sbjct  319   RDVQEALHARLIGV-REWTVCSN--VLDYQLLDVEIPTINIVGSLVRAGVPVLVYSGDQD  375

Query  1229  SVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVP  1408
             SV+PL GSRT+V  LA  + +  TVPY  WF   QVGGW   YGN+L+FATVRGAAH VP
Sbjct  376   SVIPLTGSRTLVSRLAKQLGLRTTVPYRVWFAGQQVGGWTQVYGNVLSFATVRGAAHEVP  435

Query  1409  YAQPGRALHLFSSFIRGRRLP  1471
             ++QP R+L LF +F+ G  LP
Sbjct  436   FSQPERSLVLFKAFLDGHPLP  456



>ref|XP_010044871.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
 gb|KCW86989.1| hypothetical protein EUGRSUZ_B03549 [Eucalyptus grandis]
Length=473

 Score =   371 bits (952),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 211/439 (48%), Positives = 288/439 (66%), Gaps = 12/439 (3%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             D +  LPGQP V FRQ+SGYV VDEK  R+LFYYF EAE D   + PL LWLNGGPGCSS
Sbjct  42    DSIPRLPGQPPVGFRQYSGYVTVDEKQQRALFYYFAEAELDPASK-PLVLWLNGGPGCSS  100

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDY-TCGDI  517
             +G GAF+E GPF PSGD   L+ N  SWN+ +N+L++E+P GVG+SYS  +S Y    D 
Sbjct  101   LGVGAFSENGPFRPSGDA--LVRNEYSWNREANMLYLEAPIGVGFSYSTDTSSYEAVNDK  158

Query  518   STAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKG  697
              TA D L+F++ W+ KFP++ +  LF+TGESYAGHY+PQLA LM+  N+  K   FN+KG
Sbjct  159   ITARDNLVFLQGWFVKFPQYKNSNLFITGESYAGHYVPQLAELMLQINR--KEKMFNLKG  216

Query  698   VALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNE-SDSCNAA  874
             +ALGNP+L+   D  +  EF WSHG+ISD  Y    + C++  Y   Y     S  C+  
Sbjct  217   IALGNPVLEFATDFNSRAEFFWSHGLISDTTYKMFTSICNYSRYVREYAEGSVSPICSRV  276

Query  875   INDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPE  1054
             ++  N+  S +++ YDV +DVC  S++ Q  RL     +++  IDVC+  E   Y N  +
Sbjct  277   MSQVNKETSKFVDNYDVTLDVCIASVMSQSRRLSP--QQVTDTIDVCVEDETVNYLNRQD  334

Query  1055  VQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSV  1234
             VQKALHA    +   W  C+D  +L Y+ T+ +   + +L KL++  IP+ +YSGDQDSV
Sbjct  335   VQKALHARLVGV-RKWAVCSD--VLDYDLTNLEIPTITILGKLIKAGIPVLVYSGDQDSV  391

Query  1235  VPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYA  1414
             +PL GSR +V  LA  + +  T+PY  WF   QVGGW   YGN+L+FAT+RGA+H  P++
Sbjct  392   IPLTGSRRLVHGLAEKLGLNTTIPYRVWFQGQQVGGWTQVYGNVLSFATIRGASHEAPFS  451

Query  1415  QPGRALHLFSSFIRGRRLP  1471
             QP R+L LF SF++G+ LP
Sbjct  452   QPQRSLVLFKSFLQGQPLP  470



>ref|XP_002511104.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF51706.1| serine carboxypeptidase, putative [Ricinus communis]
Length=460

 Score =   370 bits (951),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 213/439 (49%), Positives = 291/439 (66%), Gaps = 12/439 (3%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             D +V LPGQP V F+QFSGYV VD+K  R+LFYYFVEAE D   + PL LWLNGGPGCSS
Sbjct  29    DKIVRLPGQPHVGFQQFSGYVSVDDKKHRALFYYFVEAEIDPASK-PLVLWLNGGPGCSS  87

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDY-TCGDI  517
             +G GAF+E GPF P G  + L+ N  SWNK +N+L++E+P GVG+SY+  SS Y    D 
Sbjct  88    LGVGAFSENGPFRPKG--KVLVRNEYSWNKEANMLYLETPVGVGFSYATDSSSYLAVDDE  145

Query  518   STAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKG  697
             +TA D L+F+K WY +FP++  R LF+TGESYAGHYIPQLA LM++ NK  K   F++KG
Sbjct  146   ATARDNLVFLKHWYNRFPQYRHRDLFITGESYAGHYIPQLAKLMVEINK--KEKLFHLKG  203

Query  698   VALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCNAA  874
             +ALGNP+L+   D  +  E++WSHG+ISD  +      C++  Y S  Y  + S  C+  
Sbjct  204   IALGNPVLEFATDFNSRAEYLWSHGLISDSTFKMFTAACNYSRYVSEYYRDSLSTICSRV  263

Query  875   INDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPE  1054
             ++  N   S +++ YDV +DVC  SI+ Q   L     ++S  IDVC+  E   Y N  +
Sbjct  264   MSRVNTETSRFVDKYDVTLDVCISSILSQSKVLRP--QQVSERIDVCVDDETMNYLNRKD  321

Query  1055  VQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSV  1234
             VQKALHA    +   W+ C++  +L Y   + +   + ++  L++  IP+ +YSGDQDSV
Sbjct  322   VQKALHARLVGVG-RWEVCSN--ILDYELLNLEIPTISVVGSLVKAGIPVLVYSGDQDSV  378

Query  1235  VPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYA  1414
             +PL GSRT+V  LA ++ +  TVPY  WF + QVGGW   Y ++L+FAT+RGAAH VPY+
Sbjct  379   IPLTGSRTLVHGLAKELGLNTTVPYRVWFAEKQVGGWTQVYSDILSFATIRGAAHEVPYS  438

Query  1415  QPGRALHLFSSFIRGRRLP  1471
             QP R+L LF SF+ G+ LP
Sbjct  439   QPERSLVLFKSFLEGKHLP  457



>ref|XP_011036159.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Populus 
euphratica]
Length=463

 Score =   370 bits (951),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 212/457 (46%), Positives = 295/457 (65%), Gaps = 11/457 (2%)
 Frame = +2

Query  107   LSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDV  286
             L LL C   G      + D +  LPGQP V F+Q+SGYV VD+K  ++LFYYF EAE D 
Sbjct  13    LGLLVCFIIGVECSLSQLDRITQLPGQPPVWFQQYSGYVTVDDKNQKALFYYFAEAEIDC  72

Query  287   HRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAG  466
               + PL LWLNGGPGCSS+G GAF+E GPF PSG+G  L+ N  SWN+ +N+L++E+P G
Sbjct  73    ASK-PLVLWLNGGPGCSSLGVGAFSENGPFRPSGEG--LVKNQYSWNREANMLYLETPIG  129

Query  467   VGWSYS-NTSSDYTCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLAS  643
             VG+SYS NTSS     D  TA D L+F+++W+ KFP++  R LF+TGESYAGHY+PQLA 
Sbjct  130   VGFSYSTNTSSYEGVDDKITARDNLVFLQRWFVKFPQYKSRSLFITGESYAGHYVPQLAE  189

Query  644   LMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFD  823
             LM+  NK  K   FN+KG+ALGNP+L+   D  +  EF+WSHG+ISD  Y      C++ 
Sbjct  190   LMLQFNK--KEKLFNLKGIALGNPVLEYSTDFNSRAEFLWSHGLISDTTYKMFTTVCNYS  247

Query  824   DY-SFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSM  1000
              Y S  Y  + S  C+  +N   R  S +++ YDV +DVC  S++ Q  ++     ++  
Sbjct  248   RYVSEYYRGSVSPQCSRVMNQVTRETSRFVDKYDVTLDVCISSVLSQS-KVLTPQQQVGD  306

Query  1001  GIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKK  1180
              +DVC+  E   Y N P+VQ ALHA    +   W  C++  +L Y   D +   + ++ +
Sbjct  307   NVDVCVEDETVNYLNRPDVQMALHARLVGV-RRWAVCSN--ILDYELLDLEIPTITIVGR  363

Query  1181  LLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYG  1360
             L++  IP+ +YSGDQDSV+PL GSR +V  L+ ++ +  TVPY  WF   QVGGW   YG
Sbjct  364   LIKAGIPVLVYSGDQDSVIPLTGSRILVHRLSEELGLKTTVPYRVWFEGQQVGGWTQVYG  423

Query  1361  NLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLP  1471
             N+L+FAT+RGA+H  P++QP R+L LF +F+ G+ LP
Sbjct  424   NILSFATIRGASHEAPFSQPERSLVLFKAFLGGQPLP  460



>gb|AAB80670.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
Length=458

 Score =   370 bits (949),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 210/439 (48%), Positives = 286/439 (65%), Gaps = 17/439 (4%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             D +  LPGQP V F+Q+SGYV +DEK  R+LFYY  EAE     + PL LWLNGGPGCSS
Sbjct  32    DRITRLPGQPRVGFQQYSGYVTIDEKKQRALFYYLAEAETKPISK-PLVLWLNGGPGCSS  90

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYT-CGDI  517
             +G GAF+E GPF P G    L+ N  SWN+ +N+L++E+P GVG+SY+N SS Y    D 
Sbjct  91    LGVGAFSENGPFRPKGSI--LVRNQHSWNQEANMLYLETPVGVGFSYANESSSYEGVNDK  148

Query  518   STAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKG  697
              TA+D L+F++KW+ KFP++L+R LF+TGESYAGHY+PQLA LMI +NK  K + FN+KG
Sbjct  149   ITAKDNLVFLQKWFLKFPQYLNRSLFITGESYAGHYVPQLAQLMIQYNK--KHNLFNLKG  206

Query  698   VALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNESDS-CNAA  874
             +A+GNP+++   D  +  E+ WSHG+ISD  Y    + C++  +   Y      S C   
Sbjct  207   IAIGNPVMEFATDFNSRAEYFWSHGLISDPTYKLFTSSCNYSRFLSEYHRGSVSSMCTKV  266

Query  875   INDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPE  1054
             ++      S +I+ YDV +DVC PS++ Q  ++ + V       DVC+  E   Y N  +
Sbjct  267   LSQVGIETSRFIDKYDVTLDVCIPSVLSQSKQVGETV-------DVCLEDETVNYLNRRD  319

Query  1055  VQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSV  1234
             VQKALHA R      W  C+D  +L Y   D +   + ++  L++  +P+++YSGDQDSV
Sbjct  320   VQKALHA-RLVGTRKWTVCSD--VLDYEVLDVEVPTINIVGSLVKAGVPVFVYSGDQDSV  376

Query  1235  VPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYA  1414
             +PL GSRT+V+ LA ++ +  TVPY  WF   QVGGW   YGN L FATVRGAAH VP++
Sbjct  377   IPLTGSRTLVKRLAEELGLRTTVPYRVWFAGQQVGGWTQVYGNTLAFATVRGAAHEVPFS  436

Query  1415  QPGRALHLFSSFIRGRRLP  1471
             QP RAL LF +F+ GR LP
Sbjct  437   QPARALVLFKAFLGGRPLP  455



>ref|XP_009380118.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=467

 Score =   370 bits (949),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 214/464 (46%), Positives = 301/464 (65%), Gaps = 12/464 (3%)
 Frame = +2

Query  92    ICFVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVE  271
             +  V   +  C            + +V LPGQP+VSF+QFSGYV VDE+  R+LFYYF E
Sbjct  9     VVMVAALVQICSSRELESNLSHPNRIVKLPGQPQVSFQQFSGYVTVDERKHRALFYYFAE  68

Query  272   AEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFV  451
             AE D   + PL LWLNGGPGCSS+G GAF+E GPF P G+   L+ N  SWNK +N+L++
Sbjct  69    AEMDPSSK-PLVLWLNGGPGCSSVGVGAFSENGPFRPKGEV--LVRNEYSWNKEANMLYL  125

Query  452   ESPAGVGWSYSNTSSDYT-CGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYI  628
             E+PAGVG+S+S+ SSDY    D  TA D L+F+++W+ KFP +  R L++TGESYAGHY+
Sbjct  126   ETPAGVGFSFSSDSSDYEGVNDRITARDNLVFLQRWFTKFPRYKGRDLYITGESYAGHYV  185

Query  629   PQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRN  808
             PQLA LM+D NK  K   FN+KG+ALGNP+L+   D  +  EF WSHG+ISD  Y    +
Sbjct  186   PQLAQLMVDFNK--KEKVFNLKGIALGNPVLEFSTDFNSRAEFFWSHGLISDTTYRIFTS  243

Query  809   ECDFDDY-SFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAV  985
              C++  Y S  Y  + S  C   ++   R  S +++ YDV +DVC  S++ Q + L    
Sbjct  244   ACNYSRYVSEYYRGSLSSICQRVMSQVTRETSRFVDKYDVTLDVCISSVLSQSMVLSPQ-  302

Query  986   TKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVV  1165
              +++  +DVC+  E   Y N  +VQ ALHAN   +   W  C+  S+++Y   + +   +
Sbjct  303   -QVTERVDVCVEDETVSYLNRKDVQAALHANLVGVT-KWTVCS--SVIEYELLNLEVPTI  358

Query  1166  PLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGW  1345
              ++  L++  IP+ +YSGDQDSV+PL GSRT+V+ LA ++ +  T+PY AWF   QVGGW
Sbjct  359   SIVGSLVKSGIPVLVYSGDQDSVIPLTGSRTLVQRLANELGLKTTIPYRAWFEGEQVGGW  418

Query  1346  QTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNT  1477
                YG++L+FATVRGA+H  P++QP R+L LF +F++GR LP T
Sbjct  419   TQVYGDVLSFATVRGASHEAPFSQPERSLVLFRAFLQGRPLPET  462



>ref|XP_009615672.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Nicotiana 
tomentosiformis]
Length=463

 Score =   369 bits (948),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 218/459 (47%), Positives = 293/459 (64%), Gaps = 16/459 (3%)
 Frame = +2

Query  113   LLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHR  292
              LFC   G V   P  D ++ LPGQP+V F+QFSGYV VD+K  RSLFYYFVEAE +   
Sbjct  16    FLFCVSLGIVSALPHPDKIIQLPGQPQVGFQQFSGYVTVDDKKQRSLFYYFVEAETNPAS  75

Query  293   RLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVG  472
             + PL LWLNGGPGCSS+G GAF+E GPF P G  + L+ N  SWNK +N+L++ESP GVG
Sbjct  76    K-PLVLWLNGGPGCSSVGVGAFSENGPFRPRG--QVLVRNEHSWNKEANMLYLESPIGVG  132

Query  473   WSYSNTSSDY-TCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLM  649
             +SYSN +S Y T  D  TA D L+F+ +W+ KFP +    LFLTGESYAGHY+PQLA LM
Sbjct  133   FSYSNDTSSYETVNDEITARDNLVFLLRWFHKFPLYRKSNLFLTGESYAGHYVPQLAKLM  192

Query  650   IDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY  829
             +  NK  K   FN+KGVALGNP+L+   D  +  E+ WSHG+ISD  Y    + C++  Y
Sbjct  193   MAFNK--KQQIFNLKGVALGNPVLEFATDFNSRAEYFWSHGLISDPTYRMFSSACNYSRY  250

Query  830   -SFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQE--LRLHKAVTKMSM  1000
              S  Y  + S  C+  ++  +R  S +++ Y V +DVC  S++ Q   +   + V K+  
Sbjct  251   VSEYYRGSVSPICSRVMSLVSRETSKFVDKYGVTLDVCISSVLSQSKIISPQENVEKL--  308

Query  1001  GIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKK  1180
               DVC+  E   Y N  +V++ALHA    +   W  C+  S+L Y   D +   + ++  
Sbjct  309   --DVCVEDEIVNYLNRKDVRRALHAELVGV-RRWAVCS--SILDYQLLDIEIPTISIIGM  363

Query  1181  LLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYG  1360
             L++ +IP+ IYSGDQDSV+PL+GSR  V +LA  M++  TVPY  WF   QVGGW   Y 
Sbjct  364   LVKERIPVLIYSGDQDSVIPLIGSRATVHQLARRMRLNTTVPYRVWFAGQQVGGWTHVYD  423

Query  1361  NLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNT  1477
             N+L+FAT+RGA+H  P++QP R+L LF SF+  R LP  
Sbjct  424   NILSFATIRGASHEAPFSQPERSLVLFKSFLEDRPLPEV  462



>ref|XP_004241645.1| PREDICTED: serine carboxypeptidase-like 45 [Solanum lycopersicum]
Length=457

 Score =   369 bits (947),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 214/441 (49%), Positives = 291/441 (66%), Gaps = 16/441 (4%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             D ++ LPGQP+V F+QFSGYV VD+K  R+LFYYFVEAE D   + PL LWLNGGPGCSS
Sbjct  26    DKIILLPGQPQVGFQQFSGYVTVDDKKQRALFYYFVEAETDPASK-PLVLWLNGGPGCSS  84

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYS-NTSSDYTCGDI  517
             +G GAF+E GPF P G  + L+ N  SWNK +N+L++ESP GVG+SYS NTSS  T  D 
Sbjct  85    VGVGAFSENGPFRPRG--QVLVKNEHSWNKEANMLYLESPVGVGFSYSTNTSSYETVNDE  142

Query  518   STAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKG  697
              TA D ++F+++W+ KFP++ +  LFLTGESYAGHY+PQLA LMI+ N   K   FN+KG
Sbjct  143   ITARDNVVFLQRWFNKFPQYRENNLFLTGESYAGHYVPQLAKLMIELNN--KKKLFNLKG  200

Query  698   VALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCNAA  874
             VALGNP+L+   D  +  E+ WSHG+ISD  Y    + C++  Y S  Y    S  C+  
Sbjct  201   VALGNPVLEFATDFNSRAEYFWSHGLISDSTYRMFTSVCNYSRYVSEYYRDGVSPMCSRV  260

Query  875   INDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMG--IDVCMGSERTFYFNL  1048
             ++  +R  S +++ YDV +DVC  S++ Q       ++    G  IDVC+  E   Y N 
Sbjct  261   MSLVSRETSKFVDKYDVTLDVCMSSVLSQS----NIISPQENGEKIDVCIDDETVNYLNR  316

Query  1049  PEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQD  1228
              +V+ ALHA    + + W  C+  ++L Y   D +   + ++  L++ +IP+ IYSGDQD
Sbjct  317   QDVRTALHARLVGV-HSWDVCS--TILDYQLLDIEIPTISIVGLLVKERIPVLIYSGDQD  373

Query  1229  SVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVP  1408
             SVVPL GSR++V +LA  M +  TVPY  WF   QVGGW   Y N+L+FAT+RGAAH  P
Sbjct  374   SVVPLTGSRSVVHQLANQMGLNTTVPYRVWFSGQQVGGWTQVYDNILSFATIRGAAHEAP  433

Query  1409  YAQPGRALHLFSSFIRGRRLP  1471
             ++QP R+L LF SF++G+ LP
Sbjct  434   FSQPERSLVLFRSFLQGKALP  454



>ref|XP_003528093.2| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=470

 Score =   369 bits (947),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 211/440 (48%), Positives = 292/440 (66%), Gaps = 10/440 (2%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             D +  LPGQP VSF+QFSGYV VD+K  +SLFYYF EAE D   + PL LWLNGGPGCSS
Sbjct  37    DTIALLPGQPHVSFQQFSGYVTVDDKKHKSLFYYFAEAETDPSSK-PLVLWLNGGPGCSS  95

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDY-TCGDI  517
             +G GAF+E GPF P+ +   LI N  SWNK +N+L++E+P GVG+SY+  SS Y T  D 
Sbjct  96    LGVGAFSENGPFRPNEEF--LIKNDYSWNKEANMLYLETPVGVGFSYAKGSSSYMTVNDE  153

Query  518   STAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKG  697
             +TA D L+F+ +W+ KFP++  R LFLTGESYAGHY+PQLA LM++ N   K   FN+KG
Sbjct  154   ATARDNLVFLLRWFNKFPQYKSRDLFLTGESYAGHYVPQLAKLMVEMNT--KNKIFNLKG  211

Query  698   VALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCNAA  874
             +ALGNP+L+   D  +  EF WSHG+ISD  YN     C++  Y S  Y  + S  C+  
Sbjct  212   IALGNPVLEYATDFNSRAEFFWSHGLISDSTYNMFTRVCNYSRYVSEYYRDSVSPLCSKV  271

Query  875   INDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPE  1054
             ++  +R  S +++ YDV +DVC  S++ Q   +     + +  IDVC+  + T Y N  +
Sbjct  272   MSQVSRETSKFVDKYDVTLDVCISSVLSQSKVICPQSQEANESIDVCVDDKVTNYLNRRD  331

Query  1055  VQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSV  1234
             VQ+ALHA    +   W+ C++  +L Y+  + +   + ++  L++  + + IYSGDQDSV
Sbjct  332   VQEALHAKLVGV-RKWEVCSN--ILDYDMLNLEVPTLLVVGSLIKAGVKVLIYSGDQDSV  388

Query  1235  VPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYA  1414
             +PL GSRT+V++LA  + +  TVPY  WF   QVGGW   YGN+L+FATVRGA+H  P++
Sbjct  389   IPLTGSRTLVQKLARKLGLNSTVPYRVWFEGQQVGGWTQGYGNILSFATVRGASHEAPFS  448

Query  1415  QPGRALHLFSSFIRGRRLPN  1474
             QP R+L LF SF+ GR LP+
Sbjct  449   QPERSLVLFKSFLEGRPLPD  468



>ref|XP_002297872.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEE82677.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=454

 Score =   369 bits (946),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 214/459 (47%), Positives = 296/459 (64%), Gaps = 16/459 (3%)
 Frame = +2

Query  107   LSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDV  286
             L LL C   G      + D +  LPGQP V F+Q+SGYV VD+K  ++LFYYF EAE D 
Sbjct  5     LGLLVCFIIGVECSLSQLDRITQLPGQPPVWFQQYSGYVTVDDKNQKALFYYFAEAEIDC  64

Query  287   HRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAG  466
               + PL LWLNGGPGCSS+G GAF+E GPF PSG+G  L+ N  SWN+ +N+L++E+P G
Sbjct  65    ASK-PLVLWLNGGPGCSSLGVGAFSENGPFRPSGEG--LVKNQYSWNREANMLYLETPIG  121

Query  467   VGWSYS-NTSSDYTCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLAS  643
             VG+SYS NTSS     D  TA D L+F+++W+ KFP++  R LF+TGESYAGHY+PQLA 
Sbjct  122   VGFSYSTNTSSYEGVDDKITARDNLVFLQRWFVKFPQYRSRSLFITGESYAGHYVPQLAE  181

Query  644   LMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFD  823
             LM+  NK  K   FN+KG+ALGNP+L+   D  +  EF WSHG+ISD  Y    + C++ 
Sbjct  182   LMLQFNK--KEKLFNLKGIALGNPVLEYSTDFNSRAEFFWSHGLISDTTYKMFTSVCNYS  239

Query  824   DY-SFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSM  1000
              Y S  Y  + S  C+  ++   R  S +++ YDV +DVC  S++ Q     K +T   +
Sbjct  240   RYVSEYYRGSVSPLCSRVMSQVTRETSRFVDKYDVTLDVCISSVLSQS----KVLTPQQV  295

Query  1001  G--IDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLL  1174
             G  +DVC+  E   Y N P+VQ ALHA    +   W  C++  +L Y   D +   + ++
Sbjct  296   GDNVDVCVEDETVNYLNRPDVQMALHARLVGV-RRWAVCSN--ILDYELLDLEIPTITIV  352

Query  1175  KKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTE  1354
              +L++  IP+ +YSGDQDSV+PL GSR +V  L+ ++ +  TVPY  WF   QVGGW   
Sbjct  353   GRLIKAGIPVLVYSGDQDSVIPLTGSRILVHRLSEELGLKTTVPYRVWFEGQQVGGWTQV  412

Query  1355  YGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLP  1471
             YGN+L+FAT+RGA+H  P++QP R+L LF +F+ G+ LP
Sbjct  413   YGNILSFATIRGASHEAPFSQPERSLVLFKAFLGGQPLP  451



>ref|XP_009380117.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=489

 Score =   370 bits (949),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 214/464 (46%), Positives = 301/464 (65%), Gaps = 12/464 (3%)
 Frame = +2

Query  92    ICFVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVE  271
             +  V   +  C            + +V LPGQP+VSF+QFSGYV VDE+  R+LFYYF E
Sbjct  31    VVMVAALVQICSSRELESNLSHPNRIVKLPGQPQVSFQQFSGYVTVDERKHRALFYYFAE  90

Query  272   AEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFV  451
             AE D   + PL LWLNGGPGCSS+G GAF+E GPF P G+   L+ N  SWNK +N+L++
Sbjct  91    AEMDPSSK-PLVLWLNGGPGCSSVGVGAFSENGPFRPKGEV--LVRNEYSWNKEANMLYL  147

Query  452   ESPAGVGWSYSNTSSDYT-CGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYI  628
             E+PAGVG+S+S+ SSDY    D  TA D L+F+++W+ KFP +  R L++TGESYAGHY+
Sbjct  148   ETPAGVGFSFSSDSSDYEGVNDRITARDNLVFLQRWFTKFPRYKGRDLYITGESYAGHYV  207

Query  629   PQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRN  808
             PQLA LM+D NK  K   FN+KG+ALGNP+L+   D  +  EF WSHG+ISD  Y    +
Sbjct  208   PQLAQLMVDFNK--KEKVFNLKGIALGNPVLEFSTDFNSRAEFFWSHGLISDTTYRIFTS  265

Query  809   ECDFDDY-SFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAV  985
              C++  Y S  Y  + S  C   ++   R  S +++ YDV +DVC  S++ Q + L    
Sbjct  266   ACNYSRYVSEYYRGSLSSICQRVMSQVTRETSRFVDKYDVTLDVCISSVLSQSMVLSPQ-  324

Query  986   TKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVV  1165
              +++  +DVC+  E   Y N  +VQ ALHAN   +   W  C+  S+++Y   + +   +
Sbjct  325   -QVTERVDVCVEDETVSYLNRKDVQAALHANLVGVT-KWTVCS--SVIEYELLNLEVPTI  380

Query  1166  PLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGW  1345
              ++  L++  IP+ +YSGDQDSV+PL GSRT+V+ LA ++ +  T+PY AWF   QVGGW
Sbjct  381   SIVGSLVKSGIPVLVYSGDQDSVIPLTGSRTLVQRLANELGLKTTIPYRAWFEGEQVGGW  440

Query  1346  QTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNT  1477
                YG++L+FATVRGA+H  P++QP R+L LF +F++GR LP T
Sbjct  441   TQVYGDVLSFATVRGASHEAPFSQPERSLVLFRAFLQGRPLPET  484



>gb|KDP23272.1| hypothetical protein JCGZ_23105 [Jatropha curcas]
Length=463

 Score =   369 bits (946),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 219/475 (46%), Positives = 301/475 (63%), Gaps = 33/475 (7%)
 Frame = +2

Query  71    LIMGRLVICF----VCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEK  238
             L M  L +CF    VC   LF             D +  LPGQP+V F+Q+SGYV VD K
Sbjct  11    LAMVLLQLCFFMKVVCHPFLF-------------DRITQLPGQPQVGFQQYSGYVIVDNK  57

Query  239   AGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSK  418
               R+LFYYF EAE D   + PL LWLNGGPGCSS+G GAF+E GPF PSG+   L+ N  
Sbjct  58    EQRALFYYFAEAETDPASK-PLVLWLNGGPGCSSLGVGAFSENGPFRPSGEV--LVKNQH  114

Query  419   SWNKASNLLFVESPAGVGWSYSNTSSDY-TCGDISTAEDMLIFMKKWYEKFPEFLDRPLF  595
             SWN+ +N+L++E+P GVG+SYS  +S Y T  D  TA D L+F++KW+ KFP++ +R LF
Sbjct  115   SWNREANMLYLETPIGVGFSYSTDTSSYETVNDKITARDNLVFLQKWFIKFPQYRNRSLF  174

Query  596   LTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGI  775
             ++GESYAGHY+PQLA LM++ NK  K   FN+KG+ALGNP+L    D  +  EF WSHG+
Sbjct  175   ISGESYAGHYVPQLAELMLEFNKKHK--LFNLKGIALGNPVLDFATDFNSRAEFFWSHGL  232

Query  776   ISDENYNAIRNECDFDDY-SFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSI  952
             ISD  Y    + C++  Y +  Y  + S  C+  +   +R  S +++ YDV +DVC  S+
Sbjct  233   ISDTTYKMFTSVCNYSRYVNEYYRGSVSPICSRVMGQVSRETSRFVDKYDVTLDVCISSV  292

Query  953   VEQELRLHKAVTKMSMG--IDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSL  1126
             + Q      A++   +G  IDVC+  E   Y N  +VQKALHA    +   W  C++  +
Sbjct  293   LAQS----NALSPKQVGDNIDVCVEDETVNYLNRQDVQKALHARLVGV-RRWTVCSN--I  345

Query  1127  LKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVP  1306
             L Y   D +   + ++ +L++  IP+ +YSGDQDSV+PL GSRT+VR LA  + +  +VP
Sbjct  346   LDYELLDLEIPTIAIVGRLIRAGIPVLVYSGDQDSVIPLTGSRTLVRGLAEKLGLKTSVP  405

Query  1307  YSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLP  1471
             Y  WF   QVGGW   YGN+L+FAT+RGA+H  P++QP R+L LF +F+ GR LP
Sbjct  406   YRVWFGGQQVGGWTQVYGNILSFATIRGASHEAPFSQPERSLVLFKAFLEGRPLP  460



>ref|XP_007159978.1| hypothetical protein PHAVU_002G282700g [Phaseolus vulgaris]
 gb|ESW31972.1| hypothetical protein PHAVU_002G282700g [Phaseolus vulgaris]
Length=468

 Score =   369 bits (946),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 212/464 (46%), Positives = 297/464 (64%), Gaps = 10/464 (2%)
 Frame = +2

Query  86    LVICFVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYF  265
             + +  V L L FC     +      D +V LPGQP   F+QFSGYV VD+   ++LFYYF
Sbjct  10    MAMTVVLLQLSFCLEIFCLSN--HADRIVRLPGQPNTGFQQFSGYVTVDDLKHKALFYYF  67

Query  266   VEAEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLL  445
             VE+E     + PL LWLNGGPGCSS+G GAF+E GPF P+G+   LI N  SWN+ +N+L
Sbjct  68    VESETHPASK-PLVLWLNGGPGCSSLGVGAFSENGPFRPNGEV--LIKNEYSWNRETNML  124

Query  446   FVESPAGVGWSYSNTSSDY-TCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGH  622
             ++E+P GVG+SY+   S Y T  D +TA D L+F+++W+ KFP+F +R LFL GESYAGH
Sbjct  125   YLETPVGVGFSYAKGGSSYETVNDETTARDNLVFLQRWFNKFPQFRNRDLFLAGESYAGH  184

Query  623   YIPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAI  802
             Y+PQLA LMI+ NK  K   FN+KG+ALGNP+L+   D+ +  EF WSHG+ISD  Y   
Sbjct  185   YVPQLAKLMIEINK--KEKLFNLKGIALGNPVLEYATDLNSRAEFFWSHGLISDSTYKLF  242

Query  803   RNECDFDDY-SFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHK  979
                C++  Y S  Y  + S  C+  +    R  S +++ YDV +DVC  S++ Q   +  
Sbjct  243   TTGCNYSRYVSEYYRDSISPVCSKVLRHVARETSRFVDKYDVTLDVCISSVLSQSKAICP  302

Query  980   AVTKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDAN  1159
                K++  IDVC+  + T Y N  +VQ+ALHA    +   W  C++ S+L Y+  + +  
Sbjct  303   QGQKINESIDVCVDDKVTNYLNRKDVQEALHAKLVGV-RKWDVCSNNSILDYDMLNLEKP  361

Query  1160  VVPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVG  1339
              +P++  L++  + + IYSGDQDSV+PL GSRT+V++LA  + +  TVPY  WF   QVG
Sbjct  362   TLPVVGSLIKAGVRVLIYSGDQDSVIPLTGSRTLVQKLARQLGLNTTVPYRVWFEGQQVG  421

Query  1340  GWQTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLP  1471
             GW   YG++L+FATVRGA+H  P++QP R+  LF SF+  R LP
Sbjct  422   GWTQVYGSILSFATVRGASHEAPFSQPERSFVLFKSFLEDRPLP  465



>ref|XP_009337518.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=468

 Score =   369 bits (946),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 207/437 (47%), Positives = 289/437 (66%), Gaps = 12/437 (3%)
 Frame = +2

Query  167   VVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcssig  346
             +  LPGQP V F+ FSGY+ VD+   +SLFYYF EAE     + PL LWLNGGPGCSS+G
Sbjct  39    ITSLPGQPPVRFQHFSGYITVDDHNHKSLFYYFAEAEITPASK-PLVLWLNGGPGCSSLG  97

Query  347   ggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDY-TCGDIST  523
              GAF+E GPF P  DG  L+ N  SWN+ +N+L++E+P GVG+SY+ +SS Y    D +T
Sbjct  98    VGAFSENGPFRP--DGEVLVRNEYSWNREANMLYLETPVGVGFSYAKSSSSYIAVDDEAT  155

Query  524   AEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKGVA  703
             A D L+F+++W+ KFP++  R LFLTGESYAGHYIPQLA LMI+ N+  K   FN+KG+A
Sbjct  156   ARDNLVFLQRWFNKFPQYKHRDLFLTGESYAGHYIPQLAKLMIEINR--KEKSFNLKGIA  213

Query  704   LGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCNAAIN  880
             LGNP+L+   D  +  EF WSHG+ISD  YN   + C++  Y S  Y  + S  C+  ++
Sbjct  214   LGNPVLEFATDFNSRAEFFWSHGLISDSTYNMFTSVCNYSRYVSEYYRDSMSPVCSRVMS  273

Query  881   DQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPEVQ  1060
               ++  S +++ YDV +DVC  S++ Q   +  +  +M+  IDVC+  +   Y N  +VQ
Sbjct  274   QVSKETSKFVDKYDVTLDVCISSVLSQSKVI--SPNQMTERIDVCVEDKTVNYLNRKDVQ  331

Query  1061  KALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSVVP  1240
             KALHA    +   W  C++  +L Y   + +   + L+  L++  IP+ +YSGDQDSV+P
Sbjct  332   KALHARLVGV-RRWDVCSN--ILDYQVLNLEIPTISLVGSLVKQGIPVLVYSGDQDSVIP  388

Query  1241  LVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYAQP  1420
             L GSR++V  LA ++ +  TVPY  WF   QVGGW   YGN+L+FAT+RGA+H  P++QP
Sbjct  389   LTGSRSLVYRLATELGLNTTVPYRVWFEGKQVGGWTQVYGNILSFATIRGASHEAPFSQP  448

Query  1421  GRALHLFSSFIRGRRLP  1471
             GR+L LF SF+ GR LP
Sbjct  449   GRSLRLFKSFLEGRPLP  465



>ref|XP_009334311.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=459

 Score =   368 bits (945),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 206/437 (47%), Positives = 289/437 (66%), Gaps = 12/437 (3%)
 Frame = +2

Query  167   VVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcssig  346
             +  LPGQP V F+ FSGY+ VD+   ++LFYYF EAE     + PL LWLNGGPGCSS+G
Sbjct  30    ITSLPGQPPVGFQHFSGYITVDDHNHKALFYYFAEAEITPASK-PLVLWLNGGPGCSSLG  88

Query  347   ggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDY-TCGDIST  523
              GAF+E GPF P  DG  L+ N  SWN+ +N+L++E+P GVG+SY+ +SS Y    D +T
Sbjct  89    VGAFSENGPFRP--DGEVLVRNEYSWNREANMLYLETPVGVGFSYAKSSSSYIAVDDEAT  146

Query  524   AEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKGVA  703
             A D L+F+++W+ KFP++  R LFLTGESYAGHYIPQLA LMI+ N+  K   FN+KG+A
Sbjct  147   ARDNLVFLQRWFNKFPQYKQRDLFLTGESYAGHYIPQLAKLMIEINR--KEKSFNLKGIA  204

Query  704   LGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCNAAIN  880
             LGNP+L+   D  +  EF WSHG+ISD  YN   + C++  Y S  Y  + S  C+  ++
Sbjct  205   LGNPVLEFATDFNSRAEFFWSHGLISDSTYNMFTSVCNYSRYVSEYYRDSMSPVCSRVMS  264

Query  881   DQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPEVQ  1060
               ++  S +++ YDV +DVC  S++ Q   +  +  +M+  IDVC+  +   Y N  +VQ
Sbjct  265   QVSKETSKFVDKYDVTIDVCISSVLSQSKVI--SPNQMTERIDVCVEDKTVNYLNRKDVQ  322

Query  1061  KALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSVVP  1240
             KALHA    +   W  C++  +L Y   + +   + L+  L++  IP+ +YSGDQDSV+P
Sbjct  323   KALHARLVGV-RRWDVCSN--ILDYQVLNLEIPTISLVGSLVKQGIPVLVYSGDQDSVIP  379

Query  1241  LVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYAQP  1420
             L GSR++V  LA ++ +  TVPY  WF   QVGGW   YGN+L+FAT+RGA+H  P++QP
Sbjct  380   LTGSRSLVYRLATELGLNTTVPYRVWFEGKQVGGWTQVYGNILSFATIRGASHEAPFSQP  439

Query  1421  GRALHLFSSFIRGRRLP  1471
             GR+L LF SF+ GR LP
Sbjct  440   GRSLRLFKSFLEGRPLP  456



>ref|XP_011020860.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=463

 Score =   368 bits (945),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 212/457 (46%), Positives = 294/457 (64%), Gaps = 11/457 (2%)
 Frame = +2

Query  107   LSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDV  286
             L+LL C   G    + + D +  LPGQP V F+Q+SGYV VDEK  ++LFYYF EAE D 
Sbjct  13    LALLICFFIGVESSFSQFDRITQLPGQPPVWFQQYSGYVTVDEKKQKALFYYFAEAELDC  72

Query  287   HRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAG  466
               + PL LWLNGGPGCSS+G GAF+E GPF PSG  + L+ N  SWN+ +N+L++E+P G
Sbjct  73    ASK-PLVLWLNGGPGCSSLGVGAFSENGPFRPSG--QVLVKNQYSWNREANMLYLETPIG  129

Query  467   VGWSYSNTSSDYT-CGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLAS  643
             VG+SYS  +S Y    D  TA D L+F++KW+  FP + +R LF+TGESYAGHY+PQLA 
Sbjct  130   VGFSYSANASSYEGVNDKITARDNLVFLQKWFVNFPHYRNRSLFITGESYAGHYVPQLAD  189

Query  644   LMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFD  823
             LM+  N+  K   FN+KG+A+GNP+L+   D  +  EF WSHG+ISD  Y      C++ 
Sbjct  190   LMLQFNR--KEKLFNLKGIAMGNPVLEYSTDFNSRAEFFWSHGLISDTTYKMFTTVCNYS  247

Query  824   DY-SFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSM  1000
              Y S  Y  + S  C+  +N   R  S +++ YDV +DVC  S + Q  ++     ++  
Sbjct  248   RYVSEYYRGSVSPQCSRVMNQVTRETSRFVDKYDVTLDVCISSALSQS-KILSPQQQLGD  306

Query  1001  GIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKK  1180
              IDVC+  E   Y N P+VQKALHA    +   W  C++  +L Y   D +   + ++ +
Sbjct  307   NIDVCVEDETVNYLNRPDVQKALHARLVGV-RRWAVCSN--ILDYELLDLEIPTISIVGR  363

Query  1181  LLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYG  1360
             L++  IP+ +YSGDQDSV+PL GSRT+V  LA ++ +  TVPY  WF   QVGGW   YG
Sbjct  364   LIKAGIPVLVYSGDQDSVIPLTGSRTLVHGLAEELGLQTTVPYRVWFGGQQVGGWTQVYG  423

Query  1361  NLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLP  1471
             N+L+FAT+RGA+H  P++QP R+L LF +F+ G+ LP
Sbjct  424   NILSFATIRGASHEAPFSQPERSLVLFKAFLGGQPLP  460



>ref|XP_004492026.1| PREDICTED: serine carboxypeptidase-like 45-like [Cicer arietinum]
Length=462

 Score =   368 bits (944),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 216/470 (46%), Positives = 300/470 (64%), Gaps = 16/470 (3%)
 Frame = +2

Query  77    MGRLVIC--FVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRS  250
             M  L+ C   +C+++                 ++ LPGQP V F  FSGYV+VD+K  ++
Sbjct  1     MSSLLCCSTAMCVAIFLLQLRSFGVSLSHPYRIIHLPGQPNVEFNHFSGYVNVDDKNNKA  60

Query  251   LFYYFVEAEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNK  430
             LF+YFVEA++D   + PL LWLNGGPGCSSIG GAF+E GPF P G+G  L+ N  SWN 
Sbjct  61    LFFYFVEAQQDSVSK-PLVLWLNGGPGCSSIGVGAFSENGPFRPKGEG--LVRNQFSWNT  117

Query  431   ASNLLFVESPAGVGWSYSNTSSDYT-CGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGE  607
              +N+L++ESP GVG+SYS  +S Y    D  TA D LIF++ W+ +FP++ +R LF+ GE
Sbjct  118   EANMLYLESPIGVGFSYSTDTSSYGGVNDKITARDNLIFLQNWFVQFPQYRNRSLFIVGE  177

Query  608   SYAGHYIPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDE  787
             SYAGHY+PQLA LM+  NK  K   FN+KG+ALGNP+L+   D  +  EF WSHG+ISD 
Sbjct  178   SYAGHYVPQLAELMLQFNK--KEKLFNLKGIALGNPVLEFSADFNSRAEFFWSHGLISDL  235

Query  788   NYNAIRNECDFDDYSFIYPHNE-SDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQE  964
              Y    + C++  Y   Y +   S  C++ ++  +   S +++ YDV +DVC  S+  Q 
Sbjct  236   TYKMFTSVCNYSRYVREYYNGAVSPVCSSVMSQVSTETSRFVDKYDVTLDVCISSVFSQT  295

Query  965   LRLH-KAVTKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQ  1141
               L+ K VT+    IDVC+  E   Y N  +VQ ALHA    +   W  C++  +L Y+ 
Sbjct  296   KILNPKQVTET---IDVCVEDETVNYLNRKDVQSALHARLVGVQ-RWTPCSN--VLDYDL  349

Query  1142  TDGDANVVPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWF  1321
              D +   + ++ KL++  IP+ +YSGDQDSV+PL GSRT+V +LA +++M  TVPY  WF
Sbjct  350   HDLEIPTITVVGKLVKAGIPVLVYSGDQDSVIPLTGSRTLVHQLAKELRMNTTVPYRVWF  409

Query  1322  HKGQVGGWQTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLP  1471
              K QVGGW   YGN+L+FATVRGA+H  P++QP R+L LF SF+ GR LP
Sbjct  410   QKQQVGGWTQVYGNILSFATVRGASHEAPFSQPERSLVLFKSFLEGRPLP  459



>ref|XP_008777393.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Phoenix 
dactylifera]
Length=463

 Score =   368 bits (944),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 213/464 (46%), Positives = 296/464 (64%), Gaps = 12/464 (3%)
 Frame = +2

Query  92    ICFVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVE  271
             I    + L  C     V     +D +  LPGQP+V F+QFSGY+ VD++  R+LFYYF E
Sbjct  9     IVMAAILLQPCSSKELVSNLSLQDKISKLPGQPQVDFQQFSGYITVDDRKQRALFYYFTE  68

Query  272   AEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFV  451
             AE D   + PL LWLNGGPGCSS+G GAF+E GPF PS   + L+ N  SWNK +N+L++
Sbjct  69    AELDPSAK-PLVLWLNGGPGCSSVGVGAFSENGPFRPSE--QVLVRNEYSWNKEANMLYL  125

Query  452   ESPAGVGWSYSNTSSDYT-CGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYI  628
             E+PAGVG+SY+N +S Y    D  TA D L+F+ +W+ KFP++  R L++TGESYAGHY+
Sbjct  126   ETPAGVGFSYANDTSCYEGVDDKMTARDNLVFLLRWFSKFPQYKVRDLYITGESYAGHYV  185

Query  629   PQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRN  808
             PQLA LM+  NK  K + FN+KG ALGNP+L+   D  +  EF WSHG+ISD  Y     
Sbjct  186   PQLAELMVKFNK--KKNIFNLKGAALGNPVLEFSTDFNSRAEFFWSHGLISDSTYRIFTL  243

Query  809   ECDFDDY-SFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAV  985
              C++  Y S  Y  + S  C   +    +  S +++ YDV +DVC  S++ Q   L    
Sbjct  244   ACNYSRYVSEYYRGSLSAVCARVMGQVTQETSRFVDKYDVTLDVCISSVLSQSKVLSP--  301

Query  986   TKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVV  1165
              +++  IDVC+  E   Y N  +VQ ALHA    +P  W  C+  S+L+Y   + +   +
Sbjct  302   QQVTENIDVCVEDETVNYLNRKDVQDALHARLAGVP-KWSVCS--SVLEYELLNLEIPTI  358

Query  1166  PLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGW  1345
              ++  L++  IP+ +YSGDQDSV+PL GSRT+V+ LA ++K+  TVPY  WF   QVGGW
Sbjct  359   SVVGSLVRSGIPVLVYSGDQDSVIPLTGSRTLVQRLAKELKLKTTVPYRVWFAGKQVGGW  418

Query  1346  QTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNT  1477
                YG++LTFAT+RGA+H  P++QP R+L LF +F++GR LP T
Sbjct  419   TQVYGDILTFATIRGASHEAPFSQPERSLVLFRAFLQGRPLPET  462



>ref|XP_002881286.1| hypothetical protein ARALYDRAFT_482299 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57545.1| hypothetical protein ARALYDRAFT_482299 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score =   367 bits (943),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 206/439 (47%), Positives = 288/439 (66%), Gaps = 10/439 (2%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             D +  LPGQP V F+Q+SGYV +D+K  R+LFYY  EAE     + PL LWLNGGPGCSS
Sbjct  23    DRITRLPGQPRVGFQQYSGYVTIDDKKQRALFYYLAEAETKPISK-PLVLWLNGGPGCSS  81

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYT-CGDI  517
             +G GAF+E GPF P G    L+ N  SWN+ +N+L++E+P GVG+SY+  SS Y    D 
Sbjct  82    LGVGAFSENGPFRPKGSV--LVRNLHSWNQEANMLYLETPVGVGFSYATESSSYEGVNDK  139

Query  518   STAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKG  697
              TA+D L+F++KW+ KFP++L+R LF+TGESYAGHY+PQLA LMI +NK  K + FN+KG
Sbjct  140   ITAKDNLVFLQKWFLKFPQYLNRSLFITGESYAGHYVPQLAQLMIQYNK--KHNLFNLKG  197

Query  698   VALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCNAA  874
             +A+GNP+++   D  +  E+ WSHG+ISD  Y    + C++  Y S  Y  + S  C   
Sbjct  198   IAIGNPVMEFATDFNSRGEYFWSHGLISDPTYKMFTSYCNYSRYVSEYYRGSVSSMCTKV  257

Query  875   INDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPE  1054
             ++  +   S +++ YDV +DVC PS++ Q   ++    ++   +DVC+  E   Y N  +
Sbjct  258   MSQVSIETSRFVDKYDVTLDVCIPSVLSQSKVVNPQPQQVGETVDVCVEDETVNYLNRRD  317

Query  1055  VQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSV  1234
             VQ+ALHA R      W  C++  +L Y   D +   + ++  L++  +P+ +YSGDQDSV
Sbjct  318   VQRALHA-RLVGTRKWAVCSN--VLDYEVLDVEVPTINIVGSLVKAGVPVLVYSGDQDSV  374

Query  1235  VPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYA  1414
             +PL GSRT+V+ LA ++ +  TVPY  WF   QVGGW   YGN L FATVRGAAH VP++
Sbjct  375   IPLTGSRTLVKRLAEELGLRTTVPYRVWFAGQQVGGWTQVYGNTLAFATVRGAAHEVPFS  434

Query  1415  QPGRALHLFSSFIRGRRLP  1471
             QP RAL LF +F+ GR LP
Sbjct  435   QPARALVLFKAFLGGRPLP  453



>ref|XP_004310134.1| PREDICTED: serine carboxypeptidase-like 45-like [Fragaria vesca 
subsp. vesca]
Length=458

 Score =   367 bits (943),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 208/440 (47%), Positives = 292/440 (66%), Gaps = 13/440 (3%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             D +  LPGQP+V F+ +SGYV VDEK  R+LFYYF EAE +   + PL LWLNGGPGCSS
Sbjct  28    DRITRLPGQPQVGFQHYSGYVTVDEKKQRALFYYFAEAEVEPASK-PLVLWLNGGPGCSS  86

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDY-TCGDI  517
             +G GAF+E GPF PSG+   L+ N  SWN+ +N+L++E+P GVG+SYS  ++ Y +  D 
Sbjct  87    LGVGAFSENGPFRPSGEV--LVRNEYSWNREANMLYLETPIGVGFSYSTDTASYESVNDR  144

Query  518   STAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKG  697
              TA D L+F++KW +KFP++ +R LF+TGESYAGHY+PQLA LM+  +K +    FN+KG
Sbjct  145   ITARDNLMFLQKWLDKFPQYRNRSLFITGESYAGHYVPQLAELMLQFSKEYH---FNLKG  201

Query  698   VALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCNAA  874
             +ALGNP+L+   D  + +EF WSHG+ISD  Y    + C++  Y S  Y  + S  C+  
Sbjct  202   IALGNPVLEYATDFNSRSEFFWSHGLISDSTYKMFTSVCNYSRYVSEYYRGSVSPICSKV  261

Query  875   INDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPE  1054
             ++  +R  S +++ YDV +DVC  S+  Q   L  +  +++  IDVC+  E   Y N  +
Sbjct  262   MSQVSRETSKFVDKYDVTLDVCISSVFSQSKVL--SPQQVTESIDVCVEDETVNYLNRLD  319

Query  1055  VQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSV  1234
             VQKALHA    +   W  C++  +L Y   D +   + ++ KL++  I + +YSGDQDSV
Sbjct  320   VQKALHARLVGV-RKWAVCSN--VLDYELLDLEIPTISIVGKLIKAGISVLVYSGDQDSV  376

Query  1235  VPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYA  1414
             +PL GSRT+V  LA ++K+  TVPY  WF   QVGGW   YGN+L+FAT+RGA+H  P++
Sbjct  377   IPLTGSRTLVHGLAEELKLNTTVPYRVWFEGQQVGGWTQVYGNMLSFATIRGASHEAPFS  436

Query  1415  QPGRALHLFSSFIRGRRLPN  1474
             QP R+L LF SF+ GR LP 
Sbjct  437   QPERSLVLFKSFLEGRPLPE  456



>ref|XP_002280796.2| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
 emb|CAN81275.1| hypothetical protein VITISV_021177 [Vitis vinifera]
 emb|CBI15743.3| unnamed protein product [Vitis vinifera]
Length=462

 Score =   368 bits (944),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 209/461 (45%), Positives = 294/461 (64%), Gaps = 11/461 (2%)
 Frame = +2

Query  92    ICFVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVE  271
             I  V +    C            D ++ LPGQP+V F+QFSGYV +D+K  R+LFYYFVE
Sbjct  9     IPMVSVVFQLCFLLKAHPSLSHPDKIIQLPGQPQVGFQQFSGYVSLDDKKQRALFYYFVE  68

Query  272   AEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFV  451
             AE D   + PL LWLNGGPGCSS+G GAF+E GPF P+G+   L+ N  SWN+ +N+L++
Sbjct  69    AESDPASK-PLVLWLNGGPGCSSLGVGAFSENGPFRPNGEF--LLRNEYSWNREANMLYL  125

Query  452   ESPAGVGWSYSNTSSDYTCGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIP  631
             E+P GVG+SYS+ +   T  D  TA D L F+++W+ KFP++  R LF+TGESYAGHY+P
Sbjct  126   ETPVGVGFSYSSDTPYVTVDDKITARDNLAFLQRWFLKFPQYKHRDLFITGESYAGHYVP  185

Query  632   QLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNE  811
             QLA LMI  NK  K   FN+KG+ALGNP+L+   D+ +  E+ WSHG+ISD  Y    + 
Sbjct  186   QLAELMIRFNK--KEKLFNLKGIALGNPVLEFATDLNSRAEYFWSHGLISDSTYRLFTSA  243

Query  812   CDFDDY-SFIYPHNESDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVT  988
             C++  Y S  Y  + S  C+  +   +R  S +++ YDV +DVC  S++ Q   +  +  
Sbjct  244   CNYSRYVSEYYRDSVSSVCSRVMAQVSRETSKFVDKYDVTLDVCLSSVLSQSKVI--SPQ  301

Query  989   KMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVP  1168
             +++  IDVC+  +   Y N  +VQKALHA    +   W  C+D  +L Y   + +   + 
Sbjct  302   QVAETIDVCIDDKTVNYLNRKDVQKALHARLVGI-RSWTVCSD--ILDYELLNLEIPTIS  358

Query  1169  LLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQ  1348
             ++  L++  IP+ +YSGDQDSV+PL GSRT+V  LA ++ +  TVPY  WF   QVGGW 
Sbjct  359   IVGSLIKAGIPVLVYSGDQDSVIPLTGSRTLVHNLAKELGLNTTVPYRVWFEGKQVGGWT  418

Query  1349  TEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLP  1471
               YGN+L+FAT+RGA+H  P++QP R+L LF SF+  R LP
Sbjct  419   RVYGNILSFATIRGASHEAPFSQPERSLVLFKSFLEARPLP  459



>ref|XP_007139316.1| hypothetical protein PHAVU_008G019100g [Phaseolus vulgaris]
 gb|ESW11310.1| hypothetical protein PHAVU_008G019100g [Phaseolus vulgaris]
Length=461

 Score =   367 bits (943),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 207/438 (47%), Positives = 287/438 (66%), Gaps = 12/438 (3%)
 Frame = +2

Query  167   VVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcssig  346
             +  LPGQP+V F+QFSGYV VD++  ++LF+YF EAEKD   + PL LWLNGGPGCSS+G
Sbjct  32    ITHLPGQPQVEFQQFSGYVTVDDRNQQALFFYFAEAEKDAASK-PLVLWLNGGPGCSSLG  90

Query  347   ggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYT-CGDIST  523
              GAF+E GPF P G+   L+ N  SWN+ +N+L++E+P GVG+SYS  +S Y    D  T
Sbjct  91    VGAFSENGPFRPKGEA--LVRNQFSWNREANMLYLETPIGVGFSYSTDTSSYEGVNDEIT  148

Query  524   AEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKGVA  703
             A D L+F+K W+ KFPE+ +R LF+ GESYAGHY+PQLA LM+  NK  K   FN+KG+A
Sbjct  149   ARDNLVFLKNWFIKFPEYRNRSLFIVGESYAGHYVPQLAELMLQFNK--KEKLFNLKGIA  206

Query  704   LGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNE-SDSCNAAIN  880
             LGNP+L+   D  +  EF WSHG+ISD  Y    + C++  Y   Y +   S  C++ ++
Sbjct  207   LGNPVLEFATDFNSRAEFFWSHGLISDTTYKVFTSVCNYSRYVREYYNGAVSPVCSSVMS  266

Query  881   DQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPEVQ  1060
               +   S +++ YDV +DVC  S+  Q   L+    +++  IDVC+  E   Y N  +VQ
Sbjct  267   QVSTETSRFVDKYDVTLDVCLSSVFSQTKVLNPQ--QVTETIDVCVEDETVNYLNRKDVQ  324

Query  1061  KALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSVVP  1240
              ALHA    +   W  C++  +L Y   D +   + ++ KL+Q  IP+ +YSGDQDSV+P
Sbjct  325   SALHARLVGVQ-RWSACSN--VLDYELRDLEIPTITVVGKLVQEGIPVLVYSGDQDSVIP  381

Query  1241  LVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYAQP  1420
             L GSRT+V +LA  + +  TVPY  WF K QVGGW   YG++L+FAT+RGA+H  P++QP
Sbjct  382   LTGSRTLVHKLAKKLGLKTTVPYRVWFEKQQVGGWTQVYGDILSFATIRGASHEAPFSQP  441

Query  1421  GRALHLFSSFIRGRRLPN  1474
              RAL LF SF+ GR +P 
Sbjct  442   ERALVLFKSFLEGRPMPQ  459



>ref|XP_010250555.1| PREDICTED: serine carboxypeptidase-like 45 [Nelumbo nucifera]
Length=498

 Score =   368 bits (945),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 209/441 (47%), Positives = 291/441 (66%), Gaps = 12/441 (3%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             D +  LPGQP+VSF+QFSGYV VD+K  R LFYYF EAE D   + PL LWLNGGPGCSS
Sbjct  67    DRITELPGQPQVSFQQFSGYVTVDDKRRRDLFYYFAEAEIDPASK-PLVLWLNGGPGCSS  125

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTC-GDI  517
             +G GAF+E GPF PSG+   L+ N  SWN+ +N+L++E+P GVG+SYS  +S Y    D 
Sbjct  126   LGVGAFSENGPFRPSGEV--LVRNEYSWNREANMLYLETPVGVGFSYSTDTSSYVAVDDK  183

Query  518   STAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKG  697
              TA D L+F+++W+ KFP++  + LF+TGESYAGHY+PQLA L+I  NK  K   FN+KG
Sbjct  184   ITARDNLVFLQRWFLKFPQYKHKDLFITGESYAGHYVPQLAELIIQFNK--KEKLFNLKG  241

Query  698   VALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCNAA  874
             +ALGNP+L+   D  +  EF WSHG+ISD  Y    + C++  Y    Y  + S  C+  
Sbjct  242   IALGNPVLEFATDFNSRAEFFWSHGLISDSTYKLFTSACNYSRYVGEYYRGSISSVCSRV  301

Query  875   INDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPE  1054
             ++  ++  S +++ YDV +DVC  S++ Q   L+    +++  IDVC+  E   Y N  +
Sbjct  302   MSRVSKETSRFVDKYDVTLDVCISSVLSQSKVLNPQ--QVTERIDVCVEDETVNYLNRRD  359

Query  1055  VQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSV  1234
             VQKALHA    +   W  C++  +L Y   + +   + ++  L++  IP+ +YSGDQDSV
Sbjct  360   VQKALHARLVGV-RRWAVCSN--ILDYELLNLEIPTISIVGSLVKAGIPVLVYSGDQDSV  416

Query  1235  VPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYA  1414
             +PL GSRT+V ELA ++ +  TVPY  WF   QVGGW  +YGN+L+FAT+RGA+H  P++
Sbjct  417   IPLTGSRTLVHELAMELGLNTTVPYRVWFAGQQVGGWTQDYGNILSFATIRGASHEAPFS  476

Query  1415  QPGRALHLFSSFIRGRRLPNT  1477
             QP R+L LF SF+ GR LP  
Sbjct  477   QPERSLVLFKSFLEGRPLPEV  497



>emb|CDX90124.1| BnaA08g18600D [Brassica napus]
Length=460

 Score =   367 bits (941),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 207/440 (47%), Positives = 289/440 (66%), Gaps = 15/440 (3%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             DLV  LPGQP V F+Q+SGYV +DEK  R+LFYYF EAE +   + PL LWLNGGPGCSS
Sbjct  30    DLVTRLPGQPRVGFQQYSGYVTLDEKKQRALFYYFAEAETNPTSK-PLVLWLNGGPGCSS  88

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCGDIS  520
             +G GAF+E GPF P G    L+ N  SWN+ +N+L++E+P GVG+SYS   S  +  D  
Sbjct  89    LGVGAFSENGPFRPKGSV--LVKNQHSWNQEANMLYLETPVGVGFSYSTQRSYESVDDKI  146

Query  521   TAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKGV  700
             TA D L+F+++W+ KFP +L+R LF+TGESYAGHY+PQLA LMI +NK  K H FN++G+
Sbjct  147   TARDNLVFLERWFLKFPHYLNRSLFITGESYAGHYVPQLADLMIQYNK--KHHLFNLRGI  204

Query  701   ALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCNAAI  877
             A+GNP+L+   D  +  E+ WSHG+ISD  +    + C++  Y S  Y  + S  C+  +
Sbjct  205   AIGNPVLEFSTDFNSRAEYFWSHGLISDSTFKLFTSYCNYSRYVSEYYRGSMSSICSKVM  264

Query  878   NDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMG--IDVCMGSERTFYFNLP  1051
             +  N   S +++ YDV +DVC  S++ Q     K V+   +G  +DVC+  E   Y N  
Sbjct  265   SQVNTETSRFVDKYDVTLDVCISSVLSQS----KVVSPNQVGESVDVCVEDETVNYLNRR  320

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             +VQ+ALHA    +  +W  C++  +L Y   D +   + ++  L++  +P+ +YSGDQDS
Sbjct  321   DVQEALHARLVGV-REWTVCSN--VLDYQMLDVEKPTINIVGSLVEAGVPVLVYSGDQDS  377

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             V+PL GSRT+V  LA  + +  +VPY  WF   QVGGW   YGN+L+FATVRGAAH VP+
Sbjct  378   VIPLTGSRTLVSRLAKRLGLRTSVPYRVWFAGQQVGGWTQVYGNVLSFATVRGAAHEVPF  437

Query  1412  AQPGRALHLFSSFIRGRRLP  1471
             +QP R+L LF +F+ G  LP
Sbjct  438   SQPERSLVLFKAFLDGHPLP  457



>ref|XP_010678341.1| PREDICTED: serine carboxypeptidase-like 45 [Beta vulgaris subsp. 
vulgaris]
Length=476

 Score =   367 bits (943),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 210/441 (48%), Positives = 285/441 (65%), Gaps = 12/441 (3%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             D +  LPGQP+VSF+QF+GYV VD K  +SLFYYFVEA+ D   + PL LWLNGGPGCSS
Sbjct  41    DKITILPGQPKVSFKQFAGYVTVDHKKHKSLFYYFVEAQVDPSSK-PLVLWLNGGPGCSS  99

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDY-TCGDI  517
             +G GAF+E GPF P G+   L+ N  SWN  +N+L++E+P GVG+SYS  ++ Y    D 
Sbjct  100   LGVGAFSENGPFRPKGNI--LVKNEHSWNTEANMLYLETPVGVGFSYSIDTTGYDAVSDA  157

Query  518   STAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKG  697
              TA D L+F+++W+ KFP++  R LF+TGESYAGHYIPQLA LM+  NK  K   FN+KG
Sbjct  158   VTARDNLVFLRRWFNKFPQYKHRDLFITGESYAGHYIPQLADLMVAFNK--KEKLFNLKG  215

Query  698   VALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCNAA  874
             +ALGNP+L+   D  +  E+ WSHG+ISD  Y    + C++  Y S  Y    S  C+  
Sbjct  216   IALGNPVLEFANDFNSRAEYFWSHGLISDSTYKIFTSACNYSRYVSEYYRGYVSPICSKV  275

Query  875   INDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMG--IDVCMGSERTFYFNL  1048
             +    R  S +++ YDV +DVC  S++ Q   +       + G  +DVC+  E   Y N 
Sbjct  276   MRQVGRETSKFVDKYDVTLDVCISSVLSQSKIISPQEQTEAGGESVDVCIEDETVSYLNR  335

Query  1049  PEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQD  1228
              +VQKALHA   N+   W+ C++  +L Y   D +   + ++  L++  +P+ +YSGDQD
Sbjct  336   QDVQKALHARLVNV-RRWEVCSN--ILDYELLDVEIPTITIVGSLVKSGVPVLVYSGDQD  392

Query  1229  SVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVP  1408
             SV+PL GSRT+V  LA ++ +  T PY  WF   QVGGW   YGN+L+FATVRGAAH VP
Sbjct  393   SVIPLTGSRTLVHRLAMELGLNATTPYRVWFAGEQVGGWTEVYGNILSFATVRGAAHEVP  452

Query  1409  YAQPGRALHLFSSFIRGRRLP  1471
             Y+QP R+L LF SF+  R LP
Sbjct  453   YSQPARSLVLFKSFLESRPLP  473



>ref|XP_007021438.1| Serine carboxypeptidase 44 [Theobroma cacao]
 gb|EOY12963.1| Serine carboxypeptidase 44 [Theobroma cacao]
Length=516

 Score =   369 bits (946),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 203/427 (48%), Positives = 263/427 (62%), Gaps = 13/427 (3%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P  DL+  LPGQP V+FRQFSGY+D+D KAGRSLFYYFVEAEKD    LPLT+WL  G  
Sbjct  32    PMNDLIEKLPGQPNVTFRQFSGYIDIDAKAGRSLFYYFVEAEKD-PMNLPLTIWL-TGGP  89

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
                  G  F  +GPF  + +  GL  N  SW K +NLLF++SP G GWSYSNTS DY  G
Sbjct  90    GCGSVGDGFLSVGPFITTANAHGLQRNPYSWIKVTNLLFIDSPIGAGWSYSNTSRDYEVG  149

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKH-FKGHKFN  688
             D ST +D+L F+ +W+EK P F  R L+L G SYAGH+IP  A+ ++D+N +     KFN
Sbjct  150   DDSTNKDLLTFILQWFEKHPNFKSRDLYLGGSSYAGHFIPNFANSLLDYNNNQSNSSKFN  209

Query  689   IKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNEC---DFDDYSFIYPHNESD  859
             IKG+ALGNPLL+   D  AV +F WS G+I+   +  I  EC   D D+YS       S+
Sbjct  210   IKGLALGNPLLRNKLDTLAVYDFFWSRGMININLHQQILKECNGIDEDNYSN-NATKWSE  268

Query  860   SCNAAINDQNRAvsdyinvydvivdv----cyPSIVE-QELRLHKAVTKMSMGIDVCMGS  1024
              C  A++    A     +              P   + ++L L K VTK+S  +D+C+  
Sbjct  269   PCQQAMDKAEMAAFIVSSTNVAKARRFDVLRDPCDEKWEDLVLGKEVTKVSFEVDMCIPF  328

Query  1025  ERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPL  1204
                FYFN+PEVQKA H NRTNL Y WK C + S LKY+  D D +++P LKK+LQ  IP+
Sbjct  329   RADFYFNIPEVQKAFHGNRTNLGYQWKGCFEKSGLKYSDADKDIDMLPALKKILQQSIPI  388

Query  1205  WIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATV  1384
              I+SGDQD++VP +G+   V +LA DM + +T    AW H+ + GGW   Y NLL F TV
Sbjct  389   TIFSGDQDAIVPTIGTLNHVNKLAKDMNLNLTKD-EAWNHENKGGGWMYSYDNLLNFMTV  447

Query  1385  RGAAHMV  1405
             +GA H V
Sbjct  448   KGANHHV  454



>gb|KHN09723.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=457

 Score =   366 bits (940),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 211/440 (48%), Positives = 290/440 (66%), Gaps = 10/440 (2%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             D +  LPGQP VSF+QFSGYV VD+K  +SLFYYF EAE D   + PL LWLNGGPGCSS
Sbjct  24    DTIALLPGQPHVSFQQFSGYVTVDDKKHKSLFYYFAEAETDPSSK-PLVLWLNGGPGCSS  82

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDY-TCGDI  517
             +G GAF+E GPF P+ +   LI N  SWNK +N+L++E+P GVG+SY+  SS Y T  D 
Sbjct  83    LGVGAFSENGPFRPNEEF--LIKNDYSWNKEANMLYLETPVGVGFSYAKGSSSYMTVNDE  140

Query  518   STAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKG  697
             +TA D L+F+ +W+ KFP++  R LFLTGESYAGHY+PQLA LM++ N   K   FN+KG
Sbjct  141   ATARDNLVFLLRWFNKFPQYKSRDLFLTGESYAGHYVPQLAKLMVEMNT--KNKIFNLKG  198

Query  698   VALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCNAA  874
             +ALGNP+L+   D  +  EF WSHG+ISD  YN     C +  Y S  Y    S  C+  
Sbjct  199   IALGNPVLEYATDFNSRAEFFWSHGLISDSTYNMFTKVCYYSRYVSEYYRDLVSPLCSKV  258

Query  875   INDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPE  1054
             ++  +R  S +++ YDV +DVC  S++ Q   +     + +  IDVC+  + T Y N  +
Sbjct  259   MSQVSRETSKFVDKYDVTLDVCISSVLSQSKVICPQSQEANESIDVCVDDKVTNYLNRRD  318

Query  1055  VQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSV  1234
             VQ+ALHA    +   W+ C++  +L Y+  + +   + ++  L++  + + IYSGDQDSV
Sbjct  319   VQEALHAKLVGV-RKWEVCSN--ILDYDMLNLEVPTLLVVGSLIKAGVKVLIYSGDQDSV  375

Query  1235  VPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYA  1414
             +PL GSRT+V++LA  + +  TVPY  WF   QVGGW   YGN+L+FATVRGA+H  P++
Sbjct  376   IPLTGSRTLVQKLARKLGLNSTVPYRVWFEGQQVGGWTQGYGNILSFATVRGASHEAPFS  435

Query  1415  QPGRALHLFSSFIRGRRLPN  1474
             QP R+L LF SF+ GR LP+
Sbjct  436   QPERSLVLFKSFLEGRPLPD  455



>ref|XP_007137891.1| hypothetical protein PHAVU_009G164600g [Phaseolus vulgaris]
 gb|ESW09885.1| hypothetical protein PHAVU_009G164600g [Phaseolus vulgaris]
Length=467

 Score =   367 bits (941),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 211/439 (48%), Positives = 288/439 (66%), Gaps = 10/439 (2%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             D +  LPGQP V F+QFSGYV VD+K  +SLFYYF E+E D   + PL LWLNGGPGCSS
Sbjct  34    DRIDELPGQPYVGFQQFSGYVTVDDKKHKSLFYYFAESETDPASK-PLVLWLNGGPGCSS  92

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDY-TCGDI  517
             +G GAF+E GPF P+G+   LI N  SWNK +N+L++E+P GVG+SY+  SS Y T  D 
Sbjct  93    LGVGAFSENGPFRPNGEF--LIKNEYSWNKEANMLYLETPVGVGFSYAKGSSSYMTVNDE  150

Query  518   STAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKG  697
             +TA D L+F+ +W+ KFP++  R LFLTGESYAGHY+PQLA LMI  N   K   FN+KG
Sbjct  151   ATARDNLVFLLRWFNKFPQYRSRDLFLTGESYAGHYVPQLAKLMIKMNT--KKKIFNLKG  208

Query  698   VALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCNAA  874
             +ALGNP+L+   D  +  EF WSHG+ISD  YN     C++  Y S  Y  + S  C+  
Sbjct  209   IALGNPVLEYATDFNSRAEFFWSHGLISDSTYNMFTTVCNYSRYVSEYYRDSISPLCSKV  268

Query  875   INDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPE  1054
             +   +R  S +++ YDV +DVC  S++ Q   +     + S  IDVC+  + T Y N  +
Sbjct  269   MGQVSRETSKFVDKYDVTLDVCISSVLSQSNVISPKTQEASESIDVCVDDKVTNYLNRRD  328

Query  1055  VQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSV  1234
             VQ+ALHA    +   W  C++  +L Y+  + +   +P++  L++  + + IYSGDQDSV
Sbjct  329   VQEALHAKLVGV-RKWDVCSN--VLNYDMLNLEVPTLPVVGSLIKAGVRVLIYSGDQDSV  385

Query  1235  VPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYA  1414
             +PL GSRT+V++L   + +  TVPY  WF   QVGGW   +GN L+FATVRGA+H VP++
Sbjct  386   IPLTGSRTLVQKLGRQLGLNTTVPYRVWFEGQQVGGWTQVHGNTLSFATVRGASHEVPFS  445

Query  1415  QPGRALHLFSSFIRGRRLP  1471
             QP R+L LF SF++G  LP
Sbjct  446   QPRRSLVLFKSFLKGISLP  464



>ref|XP_003531913.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X1 [Glycine 
max]
Length=461

 Score =   367 bits (941),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 208/443 (47%), Positives = 287/443 (65%), Gaps = 12/443 (3%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P    +  LPGQP V F QFSGYV VD+K  R+LF+YF EAEKD   + PL LWLNGGPG
Sbjct  27    PSHHRITRLPGQPHVQFHQFSGYVTVDDKNQRALFFYFAEAEKDALSK-PLVLWLNGGPG  85

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYT-C  508
             CSS+G GAF+E GPF P   G+GL+ N  SWN+ +N+L++E+P GVG+SYS  +S Y   
Sbjct  86    CSSLGVGAFSENGPFRP--KGKGLVRNQFSWNREANMLYLETPIGVGFSYSTDTSSYEGV  143

Query  509   GDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFN  688
              D  TA D L+F++ W+ KFPE+ +R LF+ GESYAGHY+PQLA LM+  NK  K   FN
Sbjct  144   NDKITARDNLVFLQSWFIKFPEYRNRSLFIVGESYAGHYVPQLAELMLQFNK--KEKLFN  201

Query  689   IKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNE-SDSC  865
             +KG+ALGNP+L+   D  +  EF WSHG+ISD  Y    + C++  Y   Y +   S  C
Sbjct  202   LKGIALGNPVLEFATDFNSRAEFFWSHGLISDTTYKMFTSVCNYSTYVREYYNGAVSPIC  261

Query  866   NAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFN  1045
             ++ ++      S +++ YDV +DVC  S+  Q   L+    +++  IDVC+  E   Y N
Sbjct  262   SSVMSQVTTETSRFVDKYDVTLDVCLSSVFSQTKVLNPQ--QVTETIDVCVEDETVNYLN  319

Query  1046  LPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQ  1225
               +VQ A+HA+   +   W  C++  +L Y   D +   + ++ KL++  IP+ +YSGDQ
Sbjct  320   RKDVQSAMHAHLVGVQ-RWSACSN--VLDYELRDLEIPTITVVGKLVKEGIPVLVYSGDQ  376

Query  1226  DSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMV  1405
             DSV+PL GSRT+V +LA ++ +  TVPY  WF K QVGGW   YGN+L+FAT+RGA+H  
Sbjct  377   DSVIPLTGSRTLVHKLAKELGLNTTVPYRVWFEKQQVGGWTQVYGNILSFATIRGASHEA  436

Query  1406  PYAQPGRALHLFSSFIRGRRLPN  1474
             P++QP R+L LF SF+ G  LP 
Sbjct  437   PFSQPERSLVLFKSFLEGGPLPQ  459



>emb|CDY11750.1| BnaC03g58280D [Brassica napus]
Length=461

 Score =   366 bits (940),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 208/441 (47%), Positives = 290/441 (66%), Gaps = 16/441 (4%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             DLV  LPGQP+V F+Q+SGYV VDEK   +LFYYF EAE +   + PL LWLNGGPGCSS
Sbjct  30    DLVTRLPGQPQVGFKQYSGYVTVDEKKHSALFYYFAEAETEPTSK-PLVLWLNGGPGCSS  88

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDY-TCGDI  517
             +G GAF+E GPF P G    L+ N  SWN+ +N+L++E+P GVG+SYS  SS Y +  D 
Sbjct  89    LGVGAFSENGPFRPKGSV--LVKNQHSWNQEANMLYLETPVGVGFSYSTQSSSYESVNDK  146

Query  518   STAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKG  697
              TA D L+F+++W+ KFP +L+R LF+TGESYAGHY+PQLA LMI +NK  K H FN++G
Sbjct  147   ITARDNLVFLERWFLKFPHYLNRSLFITGESYAGHYVPQLADLMIQYNK--KHHLFNLRG  204

Query  698   VALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCNAA  874
             +A+GNP+L+   D  +  E+ WSHG+ISD  +    + C++  Y S  Y  + S  C+  
Sbjct  205   IAIGNPVLEFSTDFNSRAEYFWSHGLISDSTFKLFTSYCNYSRYVSEYYRGSMSSICSKV  264

Query  875   INDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMG--IDVCMGSERTFYFNL  1048
             ++  N   S +++ YDV +DVC  S++ Q     K V+   +G  +DVC+  E   Y N 
Sbjct  265   MSQVNTETSRFVDKYDVTLDVCISSVLSQS----KVVSPNQVGESVDVCVEDETVNYLNR  320

Query  1049  PEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQD  1228
              +VQ+AL A    +  +W  C++  +L Y   D +   + ++  L++  +P+ +YSGDQD
Sbjct  321   RDVQEALQARLVGV-REWTVCSN--VLDYQMLDVEKPTINIVGSLVEAGVPVLVYSGDQD  377

Query  1229  SVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVP  1408
             SV+PL GSRT+V  LA  + +  +VPY  WF   QVGGW   YGN+L+FATVRGAAH VP
Sbjct  378   SVIPLTGSRTLVSRLAKRLGLRTSVPYRVWFAGQQVGGWTQVYGNVLSFATVRGAAHEVP  437

Query  1409  YAQPGRALHLFSSFIRGRRLP  1471
             ++QP R+L LF +F+ G  LP
Sbjct  438   FSQPERSLVLFKAFLDGHPLP  458



>ref|XP_011040748.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Populus 
euphratica]
Length=459

 Score =   366 bits (940),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 216/467 (46%), Positives = 299/467 (64%), Gaps = 19/467 (4%)
 Frame = +2

Query  86    LVICFVCLSLLFCgggggvygyPEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYF  265
             +VI  +C +L+F   G       E   +V LPGQP VSF+Q++GY+ +DE+  R+LFYYF
Sbjct  8     IVIAAICATLIFLTTGSIS----EAGKIVALPGQPRVSFQQYAGYITIDEQQKRALFYYF  63

Query  266   VEAEKDVHRRLPLTLWLNggpgcssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLL  445
              EAE D   + PL LWLNGGPGCSSIG GAF E GPF PS +   L+ N  SWNK +N+L
Sbjct  64    AEAEIDPATK-PLVLWLNGGPGCSSIGAGAFCEHGPFKPSAEI--LLKNDYSWNKEANML  120

Query  446   FVESPAGVGWSYSNTSSDYT-CGDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGH  622
             ++ESPAGVG+SYS   S YT   D  TA+D L+F+++W+++FPE+  R  F+TGESYAGH
Sbjct  121   YLESPAGVGFSYSANDSFYTYVTDEITAQDNLVFLERWFDEFPEYKGRDFFITGESYAGH  180

Query  623   YIPQLASLMIDHNKHFKGHKFNIKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAI  802
             Y+PQLA+L++         KFN+KG+A+GNPLL+ + D  +  EF WSHG+ISD+ Y   
Sbjct  181   YVPQLATLIVQSQT-----KFNLKGIAIGNPLLEFNTDFNSRAEFFWSHGLISDDTYEIF  235

Query  803   RNECDFDDYSFIYPHNE-SDSCNAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHK  979
                C++      Y     S  C+A  +  +R VS Y++ YDV +DVC  SI  Q   L +
Sbjct  236   TTVCNYSQIRRQYQSGSLSLPCSAVNSRVSREVSKYVDAYDVTLDVCLSSIESQSQVLKQ  295

Query  980   AVTKMSMGIDVCMGSERTFYFNLPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDAN  1159
                + +  IDVC+  E   Y N  +V +ALHA    +   W  C+D  ++KY   + + +
Sbjct  296   --MEYTGTIDVCVEDETIKYLNRKDVLEALHAQLVGVD-QWTVCSD--VIKYEMENLEIS  350

Query  1160  VVPLLKKLLQHKIPLWIYSGDQDSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVG  1339
              VPLL KLL+  I + +YSGDQDSV+PL G+RTIV  LA ++ +  TVPY  WF   QV 
Sbjct  351   TVPLLAKLLKSGIRVHVYSGDQDSVIPLTGTRTIVNGLAKELGLNTTVPYRTWFQGKQVA  410

Query  1340  GWQTEYGNLLTFATVRGAAHMVPYAQPGRALHLFSSFIRGRRLPNTT  1480
             GW   YGN+L+FAT+R A+H  P++QP R+  LF++F+ G++LP  T
Sbjct  411   GWTQVYGNILSFATIRAASHEAPFSQPERSFVLFNAFLEGKQLPPPT  457



>ref|XP_003551804.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=461

 Score =   366 bits (940),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 209/443 (47%), Positives = 288/443 (65%), Gaps = 12/443 (3%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P    +  LPGQP V F QFSGYV VD+K  R+LF+YF EAEKD   + PL LWLNGGPG
Sbjct  27    PSHHRITRLPGQPHVQFHQFSGYVTVDDKNQRALFFYFAEAEKDALSK-PLVLWLNGGPG  85

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYT-C  508
             CSS+G GAF+E GPF P G+G  L+ N  SWNK +N+L++E+P GVG+SYS  +S Y   
Sbjct  86    CSSLGVGAFSENGPFRPKGEG--LVRNQFSWNKEANMLYLETPIGVGFSYSTDTSSYEGV  143

Query  509   GDISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFN  688
              D  TA D L+F++ W+ KFPE+ +R LF+ GESYAGHY+PQLA LM+  N+  K   FN
Sbjct  144   NDKITAGDNLVFLQNWFMKFPEYRNRSLFIVGESYAGHYVPQLAELMLRFNR--KEKLFN  201

Query  689   IKGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNE-SDSC  865
             +KG+ALGNP+L+   D  +  EF WSHG+ISD  Y    + C++  Y   Y +   S  C
Sbjct  202   LKGIALGNPVLEFATDFNSRAEFFWSHGLISDTTYKMFTSVCNYSTYVREYYNGAVSPIC  261

Query  866   NAAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFN  1045
             ++ ++  +   S +++ YDV +DVC  S+  Q   L+    +++  IDVC+  E   Y N
Sbjct  262   SSVMSQVSTETSRFVDKYDVTLDVCLSSVFSQTKVLNPQ--QVTETIDVCVEDETVNYLN  319

Query  1046  LPEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQ  1225
               +VQ ALHA+   +   W  C++  +L Y   D +   + ++ KL++  IP+ +YSGDQ
Sbjct  320   RKDVQSALHAHLVGVQ-RWSACSN--VLDYELRDLEIPTITVVGKLVKEGIPVLVYSGDQ  376

Query  1226  DSVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMV  1405
             DSV+PL GSRT+V +LA ++ +  TVPY  WF K QVGGW   YGN+L+FAT+RGA+H  
Sbjct  377   DSVIPLTGSRTLVHKLAKELGLNTTVPYRVWFEKQQVGGWTQVYGNILSFATIRGASHEA  436

Query  1406  PYAQPGRALHLFSSFIRGRRLPN  1474
             P++QP R+L LF SF+ G  LP 
Sbjct  437   PFSQPERSLVLFKSFLEGGPLPQ  459



>ref|XP_009109757.1| PREDICTED: serine carboxypeptidase-like 45 [Brassica rapa]
Length=460

 Score =   366 bits (940),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 206/440 (47%), Positives = 289/440 (66%), Gaps = 15/440 (3%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             DL+  LPGQP V F+Q+SGYV +DEK  R+LFYYF EAE +   + PL LWLNGGPGCSS
Sbjct  30    DLITRLPGQPRVGFQQYSGYVTLDEKKQRALFYYFAEAETNPTSK-PLVLWLNGGPGCSS  88

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCGDIS  520
             +G GAF+E GPF P G    L+ N  SWN+ +N+L++E+P GVG+SYS   S  +  D  
Sbjct  89    LGVGAFSENGPFRPKGSV--LVKNQHSWNQEANMLYLETPVGVGFSYSTQRSYESVDDKI  146

Query  521   TAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKGV  700
             TA D L+F+++W+ KFP +L+R LF+TGESYAGHY+PQLA LMI +NK  K H FN++G+
Sbjct  147   TARDNLVFLERWFLKFPHYLNRSLFITGESYAGHYVPQLADLMIQYNK--KHHLFNLRGI  204

Query  701   ALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCNAAI  877
             A+GNP+L+   D  +  E+ WSHG+ISD  +    + C++  Y S  Y  + S  C+  +
Sbjct  205   AIGNPVLEFSTDFNSRAEYFWSHGLISDSTFKLFTSYCNYSRYVSEYYRGSMSSICSKVM  264

Query  878   NDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMG--IDVCMGSERTFYFNLP  1051
             +  N   S +++ YDV +DVC  S++ Q     K V+   +G  +DVC+  E   Y N  
Sbjct  265   SQVNTETSRFVDKYDVTLDVCISSVLSQS----KVVSPNQVGESVDVCVEDETVNYLNRR  320

Query  1052  EVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDS  1231
             +VQ+ALHA    +  +W  C++  +L Y   D +   + ++  L++  +P+ +YSGDQDS
Sbjct  321   DVQEALHARLVGV-REWTVCSN--VLDYQMLDVEKPTINIVGSLVEAGVPVLVYSGDQDS  377

Query  1232  VVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPY  1411
             V+PL GSRT+V  LA  + +  +VPY  WF   QVGGW   YGN+L+FATVRGAAH VP+
Sbjct  378   VIPLTGSRTLVSRLAKRLGLRTSVPYRVWFAGQQVGGWTQVYGNVLSFATVRGAAHEVPF  437

Query  1412  AQPGRALHLFSSFIRGRRLP  1471
             +QP R+L LF +F+ G  LP
Sbjct  438   SQPERSLVLFKAFLDGHPLP  457



>ref|XP_010460580.1| PREDICTED: serine carboxypeptidase-like 45 [Camelina sativa]
Length=491

 Score =   367 bits (943),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 209/441 (47%), Positives = 291/441 (66%), Gaps = 16/441 (4%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             D V  LPGQP+V F+Q+SGYV VD+K  R+LFYYF EAE D   + PL LWLNGGPGCSS
Sbjct  60    DRVTSLPGQPQVGFQQYSGYVTVDDKKQRALFYYFAEAETDPTSK-PLVLWLNGGPGCSS  118

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYT-CGDI  517
             +G GAF+E GPF P G    L+ N  SWN+ +N+L++E+P GVG+SYS  SS Y    D 
Sbjct  119   LGVGAFSENGPFRPKGPI--LVKNYHSWNQEANMLYLETPVGVGFSYSTQSSSYEGVNDK  176

Query  518   STAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKG  697
              TA D L+F+++W+ KFP +L+R LF+TGESYAGHY+PQLA LMI +NK  K H FN++G
Sbjct  177   ITARDNLVFLQRWFLKFPHYLNRSLFITGESYAGHYVPQLAQLMIQYNK--KHHLFNLRG  234

Query  698   VALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCNAA  874
             +A+GNP+L+   D  +  E+ WSHG+ISD  Y    + C++  Y S  Y  + S  C+  
Sbjct  235   IAIGNPVLEFATDFNSRAEYFWSHGLISDSTYKMFTSYCNYSRYVSEYYRGSMSSICSKV  294

Query  875   INDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMG--IDVCMGSERTFYFNL  1048
             ++  +   S +++ YDV +DVC PS++ Q     K V+   +G  +DVC+  E   Y N 
Sbjct  295   MSQVSTETSRFVDKYDVTLDVCIPSVLSQS----KVVSPNQVGESVDVCVEDETVNYLNR  350

Query  1049  PEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQD  1228
              +VQ+ALHA    +  +W  C++  +L Y   D +   + ++  L++  +P+ +YSGDQD
Sbjct  351   RDVQEALHARLIGV-REWTVCSN--VLDYQLLDVEKPTINIVGSLVRAGVPVLVYSGDQD  407

Query  1229  SVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVP  1408
             SV+PL GSRT+V  LA  + +  +VPY  WF   QVGGW   YGN+L+FATVRGA+H VP
Sbjct  408   SVIPLTGSRTLVSRLAKQLGLRTSVPYRVWFAGQQVGGWTQVYGNVLSFATVRGASHEVP  467

Query  1409  YAQPGRALHLFSSFIRGRRLP  1471
             ++QP R+L LF +F+ G  LP
Sbjct  468   FSQPERSLVLFKAFLNGHPLP  488



>gb|KHN13827.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=454

 Score =   366 bits (939),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 207/442 (47%), Positives = 286/442 (65%), Gaps = 17/442 (4%)
 Frame = +2

Query  152   PEEDLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpg  331
             P    +  LPGQP V F QFSGYV VD+K  R+LF+YF EAEKD   + PL LWLNGGPG
Sbjct  27    PSHHRITRLPGQPHVQFHQFSGYVTVDDKNQRALFFYFAEAEKDALSK-PLVLWLNGGPG  85

Query  332   cssigggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDYTCG  511
             CSS+G GAF+E GPF P G+G  L+ N  SWNK +N+L++E+P GVG+SYS  +S Y  G
Sbjct  86    CSSLGVGAFSENGPFRPKGEG--LVRNQFSWNKEANMLYLETPIGVGFSYSTDTSSYEAG  143

Query  512   DISTAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNI  691
             D       L+F++ W+ KFPE+ +R LF+ GESYAGHY+PQLA LM+  N+  K   FN+
Sbjct  144   D------NLVFLQNWFMKFPEYRNRSLFIVGESYAGHYVPQLAELMLRFNR--KEKLFNL  195

Query  692   KGVALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDYSFIYPHNE-SDSCN  868
             KG+ALGNP+L+   D  +  EF WSHG+ISD  Y    + C++  Y   Y +   S +C+
Sbjct  196   KGIALGNPVLEFATDFNSRAEFFWSHGLISDTTYKMFTSVCNYSTYVREYYNGAVSPTCS  255

Query  869   AAINDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNL  1048
             + ++  +   S ++  YDV +DVC  S+  Q   L+    +++  IDVC+  E   Y N 
Sbjct  256   SVMSQVSTETSRFVEKYDVTLDVCLSSVFSQTKVLNPQ--QVTETIDVCVEDETVNYLNR  313

Query  1049  PEVQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQD  1228
              +VQ ALHA+   +   W  C++  +L Y   D +   + ++ KL++  IP+ +YSGDQD
Sbjct  314   KDVQSALHAHLVGVQ-RWSACSN--VLDYELRDLETPTITVVGKLVKEGIPVLVYSGDQD  370

Query  1229  SVVPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVP  1408
             SV+PL GSRT+V +LA ++ +  TVPY  WF K QVGGW   YGN+L+FAT+RGA+H  P
Sbjct  371   SVIPLTGSRTLVHKLAKELGLNTTVPYRVWFEKQQVGGWTQVYGNILSFATIRGASHEAP  430

Query  1409  YAQPGRALHLFSSFIRGRRLPN  1474
             ++QP R+L LF SF+ G  LP 
Sbjct  431   FSQPERSLVLFKSFLEGGPLPQ  452



>ref|XP_006584695.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X2 [Glycine 
max]
Length=468

 Score =   366 bits (940),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 205/439 (47%), Positives = 287/439 (65%), Gaps = 8/439 (2%)
 Frame = +2

Query  161   DLVVGLPGQPEVSFRQFSGYVDVDEKAGRSLFYYFVEAEKDVHRRLPLTLWLNggpgcss  340
             D +V LPGQP + F+QFSGYV VD+   ++LFYYFVE+E D   + PL LWLNGGPGCSS
Sbjct  33    DRIVRLPGQPNIGFQQFSGYVTVDDMKHKALFYYFVESETDPASK-PLVLWLNGGPGCSS  91

Query  341   igggAFTELGPFFPSGDGRGLIINSKSWNKASNLLFVESPAGVGWSYSNTSSDY-TCGDI  517
             +G GAF+E GPF P+G+   LI N  SWN+ +N+L++E+P GVG+SY+   S Y T  D 
Sbjct  92    LGVGAFSENGPFRPNGEV--LIKNEYSWNRETNMLYLETPVGVGFSYAKGGSSYDTVNDE  149

Query  518   STAEDMLIFMKKWYEKFPEFLDRPLFLTGESYAGHYIPQLASLMIDHNKHFKGHKFNIKG  697
             +TA D L+F+++W+ KFP +    LFL GESYAGHY+PQLA LMI+ NK  K   FN+KG
Sbjct  150   TTARDNLVFLQRWFNKFPHYRHTDLFLAGESYAGHYVPQLAKLMIEINK--KEKMFNLKG  207

Query  698   VALGNPLLKLDRDVPAVTEFMWSHGIISDENYNAIRNECDFDDY-SFIYPHNESDSCNAA  874
             +ALGNP+L+   D  +  EF WSHG+ISD  Y      C++  Y S  Y  + S  C+  
Sbjct  208   IALGNPVLEYATDFNSRAEFFWSHGLISDSTYKLFTTGCNYSRYVSEYYRDSISPLCSKV  267

Query  875   INDQNRAvsdyinvydvivdvcyPSIVEQELRLHKAVTKMSMGIDVCMGSERTFYFNLPE  1054
             +   +R  S +++ YDV +DVC  S++ Q   +     + +  IDVC+  + T Y N  +
Sbjct  268   MKQVSRETSKFVDKYDVTLDVCISSVLSQSKAICPQSQQTNESIDVCVDDKVTNYLNRKD  327

Query  1055  VQKALHANRTNLPYDWKTCADYSLLKYNQTDGDANVVPLLKKLLQHKIPLWIYSGDQDSV  1234
             VQ+ALHA    +   W  C+  S+L Y+  + +   +P++  L++  + + IYSGDQDSV
Sbjct  328   VQEALHAKLVGVQ-KWNVCSTNSILDYDMLNLEVPTLPIVGSLIKAGVRVLIYSGDQDSV  386

Query  1235  VPLVGSRTIVRELAADMKMGITVPYSAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYA  1414
             +PL GSRT+V++LA  +++  T+ Y  WF   QVGGW   YGN+L+FATVRGA+H  P++
Sbjct  387   IPLTGSRTLVQKLARQLRLNTTIHYRVWFEGQQVGGWTQVYGNILSFATVRGASHEAPFS  446

Query  1415  QPGRALHLFSSFIRGRRLP  1471
             QP R+L LF SF+  R LP
Sbjct  447   QPERSLVLFKSFLEDRPLP  465



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4980019072482