BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79951_g1_i1 len=3150 path=[1:0-3055 3057:3056-3102 3057:3103-3149]

Length=3150
                                                                      Score     E

ref|XP_004253038.1|  PREDICTED: ankyrin repeat-containing protein...    893   0.0      
ref|XP_009758452.1|  PREDICTED: ankyrin repeat-containing protein...    892   0.0      
ref|XP_006342435.1|  PREDICTED: ankyrin repeat-containing protein...    892   0.0      
ref|XP_009593299.1|  PREDICTED: ankyrin repeat-containing protein...    888   0.0      
ref|XP_004251987.1|  PREDICTED: ankyrin repeat-containing protein...    879   0.0      
ref|XP_011074001.1|  PREDICTED: ankyrin repeat-containing protein...    875   0.0      
ref|XP_009624816.1|  PREDICTED: ankyrin repeat-containing protein...    875   0.0      
ref|XP_006353117.1|  PREDICTED: ankyrin repeat-containing protein...    875   0.0      
ref|XP_009800727.1|  PREDICTED: ankyrin repeat-containing protein...    874   0.0      
ref|XP_009624817.1|  PREDICTED: ankyrin repeat-containing protein...    868   0.0      
ref|XP_009800728.1|  PREDICTED: ankyrin repeat-containing protein...    867   0.0      
ref|XP_006351067.1|  PREDICTED: ankyrin repeat-containing protein...    850   0.0      
gb|EYU36659.1|  hypothetical protein MIMGU_mgv1a003600mg                844   0.0      
ref|XP_004244774.1|  PREDICTED: ankyrin repeat-containing protein...    840   0.0      
ref|XP_002279889.3|  PREDICTED: ankyrin repeat-containing protein...    840   0.0      Vitis vinifera
ref|XP_006493139.1|  PREDICTED: ankyrin repeat-containing protein...    832   0.0      
ref|XP_006442042.1|  hypothetical protein CICLE_v10019293mg             831   0.0      
gb|KDO51600.1|  hypothetical protein CISIN_1g006802mg                   830   0.0      
ref|XP_009781472.1|  PREDICTED: ankyrin repeat-containing protein...    822   0.0      
ref|XP_007139079.1|  hypothetical protein PHAVU_009G263200g             819   0.0      
ref|XP_010101339.1|  Ankyrin repeat-containing protein                  816   0.0      
emb|CDP19161.1|  unnamed protein product                                813   0.0      
ref|XP_008243064.1|  PREDICTED: ankyrin repeat-containing protein...    815   0.0      
ref|XP_009601846.1|  PREDICTED: ankyrin repeat-containing protein...    812   0.0      
ref|XP_009343658.1|  PREDICTED: ankyrin repeat-containing protein...    812   0.0      
ref|XP_009366249.1|  PREDICTED: ankyrin repeat-containing protein...    812   0.0      
gb|KHG02212.1|  Ankyrin-1                                               811   0.0      
ref|XP_003554805.1|  PREDICTED: ankyrin repeat-containing protein...    806   0.0      
ref|XP_008362856.1|  PREDICTED: ankyrin repeat-containing protein...    805   0.0      
ref|XP_003521843.1|  PREDICTED: ankyrin repeat-containing protein...    804   0.0      
gb|KHN11342.1|  Ankyrin repeat-containing protein                       801   0.0      
ref|XP_008367732.1|  PREDICTED: ankyrin repeat-containing protein...    801   0.0      
ref|XP_010277792.1|  PREDICTED: ankyrin repeat-containing protein...    793   0.0      
gb|KEH24678.1|  ankyrin repeat protein                                  786   0.0      
ref|XP_004494898.1|  PREDICTED: ankyrin repeat-containing protein...    784   0.0      
ref|XP_004287177.1|  PREDICTED: ankyrin repeat-containing protein...    785   0.0      
ref|XP_008449420.1|  PREDICTED: ankyrin repeat-containing protein...    781   0.0      
gb|KDP29560.1|  hypothetical protein JCGZ_19273                         780   0.0      
ref|XP_007026501.1|  Ankyrin repeat family protein isoform 1            779   0.0      
ref|XP_004140228.1|  PREDICTED: ankyrin repeat-containing protein...    776   0.0      
ref|XP_004494896.1|  PREDICTED: ankyrin repeat-containing protein...    775   0.0      
ref|XP_010251404.1|  PREDICTED: ankyrin repeat-containing protein...    775   0.0      
ref|XP_010069205.1|  PREDICTED: ankyrin repeat-containing protein...    773   0.0      
emb|CBI24749.3|  unnamed protein product                                771   0.0      
ref|XP_002323928.2|  hypothetical protein POPTR_0017s03960g             772   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010069206.1|  PREDICTED: ankyrin repeat-containing protein...    766   0.0      
gb|KDO51601.1|  hypothetical protein CISIN_1g006802mg                   763   0.0      
ref|XP_006410311.1|  hypothetical protein EUTSA_v10016361mg             765   0.0      
ref|NP_180741.1|  ankyrin repeats-containing protein                    762   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_011011388.1|  PREDICTED: ankyrin repeat-containing protein...    757   0.0      
ref|XP_010414079.1|  PREDICTED: ankyrin repeat-containing protein...    758   0.0      
ref|XP_010510146.1|  PREDICTED: ankyrin repeat-containing protein...    757   0.0      
ref|XP_002529101.1|  ankyrin repeat-containing protein, putative        754   0.0      Ricinus communis
ref|XP_010672502.1|  PREDICTED: ankyrin repeat-containing protein...    753   0.0      
ref|XP_006293806.1|  hypothetical protein CARUB_v10022790mg             753   0.0      
ref|XP_009141191.1|  PREDICTED: ankyrin repeat-containing protein...    752   0.0      
gb|KFK31178.1|  hypothetical protein AALP_AA6G079100                    752   0.0      
ref|XP_008337174.1|  PREDICTED: ankyrin repeat-containing protein...    756   0.0      
emb|CDY19113.1|  BnaA04g18530D                                          749   0.0      
ref|XP_009144041.1|  PREDICTED: LOW QUALITY PROTEIN: ankyrin repe...    744   0.0      
ref|XP_010469665.1|  PREDICTED: ankyrin repeat-containing protein...    745   0.0      
ref|XP_010522247.1|  PREDICTED: ankyrin repeat-containing protein...    743   0.0      
gb|EPS61029.1|  hypothetical protein M569_13769                         738   0.0      
ref|XP_007203633.1|  hypothetical protein PRUPE_ppa003989mg             736   0.0      
emb|CDY58363.1|  BnaCnng33120D                                          736   0.0      
ref|XP_002309714.2|  hypothetical protein POPTR_0007s00400g             737   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011005262.1|  PREDICTED: ankyrin repeat-containing protein...    733   0.0      
ref|XP_006307001.1|  hypothetical protein CARUB_v10008579mg             732   0.0      
ref|XP_010457656.1|  PREDICTED: ankyrin repeat-containing protein...    728   0.0      
ref|NP_172055.1|  ankyrin repeats-containing protein                    726   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010485156.1|  PREDICTED: ankyrin repeat-containing protein...    724   0.0      
ref|XP_010475269.1|  PREDICTED: ankyrin repeat-containing protein...    723   0.0      
ref|XP_009111045.1|  PREDICTED: ankyrin repeat-containing protein...    714   0.0      
emb|CDY15549.1|  BnaA08g28330D                                          707   0.0      
emb|CDY42071.1|  BnaA05g11150D                                          707   0.0      
emb|CAN68139.1|  hypothetical protein VITISV_035656                     706   0.0      Vitis vinifera
gb|EPS61725.1|  hypothetical protein M569_13069                         699   0.0      
ref|XP_010557050.1|  PREDICTED: ankyrin repeat-containing protein...    700   0.0      
ref|XP_010908526.1|  PREDICTED: ankyrin repeat-containing protein...    687   0.0      
ref|XP_008788257.1|  PREDICTED: ankyrin repeat-containing protein...    683   0.0      
emb|CDY34515.1|  BnaC04g12840D                                          684   0.0      
ref|XP_009781473.1|  PREDICTED: ankyrin repeat-containing protein...    676   0.0      
ref|XP_009383357.1|  PREDICTED: ankyrin repeat-containing protein...    678   0.0      
gb|KFK42900.1|  hypothetical protein AALP_AA1G053200                    690   0.0      
ref|XP_008807257.1|  PREDICTED: ankyrin repeat-containing protein...    673   0.0      
ref|XP_010927921.1|  PREDICTED: ankyrin repeat-containing protein...    664   0.0      
gb|KFK42901.1|  hypothetical protein AALP_AA1G053200                    678   0.0      
ref|XP_009384270.1|  PREDICTED: ankyrin repeat-containing protein...    662   0.0      
ref|XP_009410730.1|  PREDICTED: ankyrin repeat-containing protein...    662   0.0      
ref|XP_004957374.1|  PREDICTED: ankyrin repeat-containing protein...    654   0.0      
ref|XP_002460533.1|  hypothetical protein SORBIDRAFT_02g030070          652   0.0      Sorghum bicolor [broomcorn]
ref|XP_008670326.1|  PREDICTED: ankyrin repeat-containing protein...    649   0.0      
ref|XP_008651626.1|  PREDICTED: uncharacterized protein LOC100381...    647   0.0      
gb|KHN16372.1|  Ankyrin repeat-containing protein                       643   0.0      
ref|XP_004974098.1|  PREDICTED: ankyrin repeat-containing protein...    645   0.0      
ref|XP_006660851.1|  PREDICTED: ankyrin repeat-containing protein...    645   0.0      
ref|XP_002445764.1|  hypothetical protein SORBIDRAFT_07g025390          643   0.0      Sorghum bicolor [broomcorn]
ref|XP_003578456.1|  PREDICTED: ankyrin repeat-containing protein...    638   0.0      
ref|XP_008679639.1|  PREDICTED: protein binding protein isoform X1      636   0.0      
ref|XP_010930296.1|  PREDICTED: ankyrin repeat-containing protein...    636   0.0      
gb|EAZ07847.1|  hypothetical protein OsI_30106                          634   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001062394.1|  Os08g0542700                                       634   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EMT16664.1|  hypothetical protein F775_21555                         634   0.0      
ref|NP_001063687.1|  Os09g0518500                                       632   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EAZ09775.1|  hypothetical protein OsI_32062                          632   0.0      Oryza sativa Indica Group [Indian rice]
dbj|BAK00823.1|  predicted protein                                      631   0.0      
ref|NP_001151505.1|  protein binding protein                            630   0.0      Zea mays [maize]
ref|XP_006659650.1|  PREDICTED: ankyrin repeat-containing protein...    628   0.0      
gb|KDO51603.1|  hypothetical protein CISIN_1g006802mg                   620   0.0      
ref|XP_003574859.1|  PREDICTED: ankyrin repeat-containing protein...    624   0.0      
gb|EMT05138.1|  hypothetical protein F775_28341                         625   0.0      
dbj|BAD08980.1|  ankyrin-like protein                                   604   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CDX86566.1|  BnaC08g01370D                                          584   0.0      
ref|XP_006854391.1|  hypothetical protein AMTR_s00039p00181370          577   0.0      
gb|KDO51602.1|  hypothetical protein CISIN_1g006802mg                   577   0.0      
tpg|DAA39352.1|  TPA: hypothetical protein ZEAMMB73_862375              576   0.0      
ref|XP_007026502.1|  Ankyrin repeat family protein isoform 2            559   0.0      
ref|XP_009412600.1|  PREDICTED: ankyrin repeat-containing protein...    550   1e-180   
ref|XP_004487042.1|  PREDICTED: ankyrin repeat-containing protein...    546   3e-179   
ref|XP_006424729.1|  hypothetical protein CICLE_v10028165mg             541   2e-177   
ref|XP_008794360.1|  PREDICTED: ankyrin repeat-containing protein...    541   4e-177   
ref|XP_010937738.1|  PREDICTED: ankyrin repeat-containing protein...    540   6e-177   
ref|XP_010112932.1|  Ankyrin repeat-containing protein                  539   1e-176   
ref|XP_009406960.1|  PREDICTED: ankyrin repeat-containing protein...    533   1e-174   
ref|XP_008448352.1|  PREDICTED: ankyrin repeat-containing protein...    533   4e-174   
emb|CDP08980.1|  unnamed protein product                                532   5e-174   
ref|XP_006850626.1|  hypothetical protein AMTR_s00034p00179220          531   2e-173   
ref|XP_004148223.1|  PREDICTED: ankyrin repeat-containing protein...    528   4e-172   
ref|XP_003597310.1|  Ankyrin repeat-containing protein                  527   4e-172   
ref|XP_010685856.1|  PREDICTED: ankyrin repeat-containing protein...    527   7e-172   
ref|XP_008810497.1|  PREDICTED: ankyrin repeat-containing protein...    526   8e-172   
ref|XP_002284522.2|  PREDICTED: ankyrin repeat-containing protein...    525   5e-171   Vitis vinifera
ref|XP_004294623.1|  PREDICTED: ankyrin repeat-containing protein...    524   1e-170   
ref|XP_007150267.1|  hypothetical protein PHAVU_005G139900g             523   2e-170   
ref|XP_010253368.1|  PREDICTED: ankyrin repeat-containing protein...    523   3e-170   
gb|KHN30214.1|  Ankyrin repeat-containing protein                       521   8e-170   
ref|XP_010920742.1|  PREDICTED: ankyrin repeat-containing protein...    521   1e-169   
ref|XP_006595004.1|  PREDICTED: ankyrin repeat-containing protein...    521   1e-169   
ref|XP_010653499.1|  PREDICTED: ankyrin repeat-containing protein...    520   5e-169   
ref|XP_006597296.1|  PREDICTED: ankyrin repeat-containing protein...    519   9e-169   
ref|XP_011022863.1|  PREDICTED: ankyrin repeat-containing protein...    518   2e-168   
ref|XP_004505914.1|  PREDICTED: ankyrin repeat-containing protein...    517   6e-168   
ref|XP_004505916.1|  PREDICTED: ankyrin repeat-containing protein...    516   1e-167   
ref|XP_010260012.1|  PREDICTED: ankyrin repeat-containing protein...    513   2e-166   
ref|XP_009354547.1|  PREDICTED: ankyrin repeat-containing protein...    513   2e-166   
ref|XP_007016551.1|  Ankyrin repeat family protein isoform 1            512   5e-166   
ref|XP_010043606.1|  PREDICTED: ankyrin repeat-containing protein...    511   1e-165   
dbj|BAK03736.1|  predicted protein                                      511   1e-165   
ref|XP_011089841.1|  PREDICTED: ankyrin repeat-containing protein...    510   2e-165   
ref|XP_006350741.1|  PREDICTED: ankyrin repeat-containing protein...    509   4e-165   
emb|CAN80966.1|  hypothetical protein VITISV_005610                     509   4e-165   Vitis vinifera
ref|XP_007132130.1|  hypothetical protein PHAVU_011G069200g             509   4e-165   
ref|XP_007205036.1|  hypothetical protein PRUPE_ppa004158mg             508   6e-165   
ref|XP_003539755.1|  PREDICTED: ankyrin repeat-containing protein...    509   8e-165   
ref|XP_004302802.1|  PREDICTED: ankyrin repeat-containing protein...    508   8e-165   
ref|XP_003539100.1|  PREDICTED: ankyrin repeat-containing protein...    508   1e-164   
ref|XP_008222732.1|  PREDICTED: ankyrin repeat-containing protein...    508   1e-164   
ref|XP_008385187.1|  PREDICTED: ankyrin repeat-containing protein...    508   1e-164   
ref|XP_004246736.1|  PREDICTED: ankyrin repeat-containing protein...    506   4e-164   
gb|KHN22008.1|  Ankyrin repeat-containing protein                       507   5e-164   
gb|KHN33422.1|  Ankyrin repeat-containing protein                       507   5e-164   
ref|XP_004241254.1|  PREDICTED: ankyrin repeat-containing protein...    506   5e-164   
ref|XP_006380398.1|  hypothetical protein POPTR_0007s04760g             506   6e-164   
ref|XP_004984777.1|  PREDICTED: ankyrin repeat-containing protein...    506   1e-163   
ref|XP_009776901.1|  PREDICTED: ankyrin repeat-containing protein...    504   4e-163   
ref|XP_009607373.1|  PREDICTED: ankyrin repeat-containing protein...    503   6e-163   
gb|KHG23432.1|  Ankyrin-2                                               503   2e-162   
ref|XP_009416260.1|  PREDICTED: ankyrin repeat-containing protein...    502   2e-162   
ref|XP_009599077.1|  PREDICTED: ankyrin repeat-containing protein...    501   7e-162   
ref|XP_009796770.1|  PREDICTED: ankyrin repeat-containing protein...    501   8e-162   
ref|XP_009358305.1|  PREDICTED: ankyrin repeat-containing protein...    501   8e-162   
gb|KHN05690.1|  Ankyrin repeat-containing protein                       501   1e-161   
gb|KDP35568.1|  hypothetical protein JCGZ_09006                         499   2e-161   
ref|XP_010542612.1|  PREDICTED: ankyrin repeat-containing protein...    499   2e-161   
ref|XP_006417764.1|  hypothetical protein EUTSA_v10009425mg             499   5e-161   
ref|XP_008355149.1|  PREDICTED: ankyrin repeat-containing protein...    498   1e-160   
ref|XP_011077490.1|  PREDICTED: LOW QUALITY PROTEIN: ankyrin repe...    516   4e-160   
ref|XP_010457974.1|  PREDICTED: ankyrin repeat-containing protein...    496   5e-160   
gb|ACJ85550.1|  unknown                                                 495   1e-159   Medicago truncatula
ref|XP_003606581.1|  Ankyrin repeat-containing protein                  495   1e-159   
ref|XP_006400885.1|  hypothetical protein EUTSA_v10016051mg             494   2e-159   
gb|ACR34761.1|  unknown                                                 495   3e-159   Zea mays [maize]
ref|XP_006345675.1|  PREDICTED: ankyrin repeat-containing protein...    494   4e-159   
ref|XP_010475540.1|  PREDICTED: ankyrin repeat-containing protein...    493   8e-159   
ref|XP_010455898.1|  PREDICTED: ankyrin repeat-containing protein...    492   2e-158   
ref|XP_006306426.1|  hypothetical protein CARUB_v10012363mg             491   4e-158   
ref|XP_010487878.1|  PREDICTED: ankyrin repeat-containing protein...    492   5e-158   
ref|XP_010542613.1|  PREDICTED: ankyrin repeat-containing protein...    490   9e-158   
gb|EYU38487.1|  hypothetical protein MIMGU_mgv1a004270mg                490   1e-157   
gb|KDP44171.1|  hypothetical protein JCGZ_05638                         490   1e-157   
ref|NP_172250.1|  ankyrin repeats-containing protein                    489   2e-157   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010321907.1|  PREDICTED: ankyrin repeat-containing protein...    489   2e-157   
ref|XP_008387720.1|  PREDICTED: ankyrin repeat-containing protein...    489   3e-157   
gb|KHG07452.1|  hypothetical protein F383_11113                         489   5e-157   
ref|XP_002525011.1|  ankyrin repeat-containing protein, putative        488   6e-157   Ricinus communis
gb|KHG07451.1|  hypothetical protein F383_11113                         487   6e-157   
ref|XP_010457973.1|  PREDICTED: ankyrin repeat-containing protein...    488   7e-157   
ref|XP_010487870.1|  PREDICTED: ankyrin repeat-containing protein...    490   1e-156   
ref|XP_010457972.1|  PREDICTED: ankyrin repeat-containing protein...    488   1e-156   
gb|KHG02476.1|  Ankyrin-2                                               486   3e-156   
ref|XP_006366327.1|  PREDICTED: ankyrin repeat-containing protein...    486   3e-156   
ref|XP_006428986.1|  hypothetical protein CICLE_v10011445mg             486   3e-156   
ref|XP_011031106.1|  PREDICTED: ankyrin repeat-containing protein...    486   3e-156   
ref|XP_009341692.1|  PREDICTED: ankyrin repeat-containing protein...    486   4e-156   
gb|EAY89499.1|  hypothetical protein OsI_11032                          486   4e-156   Oryza sativa Indica Group [Indian rice]
ref|NP_001049741.1|  Os03g0281100                                       486   6e-156   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010485246.1|  PREDICTED: ankyrin repeat-containing protein...    486   6e-156   
ref|XP_009377124.1|  PREDICTED: ankyrin repeat-containing protein...    485   1e-155   
gb|KDO49826.1|  hypothetical protein CISIN_1g009331mg                   484   1e-155   
ref|XP_009131955.1|  PREDICTED: ankyrin repeat-containing protein...    484   2e-155   
ref|XP_002468068.1|  hypothetical protein SORBIDRAFT_01g039030          484   3e-155   Sorghum bicolor [broomcorn]
emb|CDX71059.1|  BnaC03g11430D                                          484   3e-155   
ref|XP_002306278.2|  hypothetical protein POPTR_0005s07030g             483   3e-155   Populus trichocarpa [western balsam poplar]
ref|XP_010443799.1|  PREDICTED: ankyrin repeat-containing protein...    484   4e-155   
ref|NP_200815.1|  ankyrin repeat-containing protein                     483   5e-155   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003520633.1|  PREDICTED: ankyrin repeat-containing protein...    482   7e-155   
ref|XP_006282166.1|  hypothetical protein CARUB_v10028425mg             483   8e-155   
ref|XP_007208006.1|  hypothetical protein PRUPE_ppa003717mg             483   1e-154   
ref|XP_008241703.1|  PREDICTED: ankyrin repeat-containing protein...    482   2e-154   
ref|XP_011089403.1|  PREDICTED: ankyrin repeat-containing protein...    482   2e-154   
ref|XP_011089404.1|  PREDICTED: ankyrin repeat-containing protein...    481   3e-154   
ref|XP_007027137.1|  Ankyrin repeat family protein isoform 2            480   4e-154   
tpg|DAA48337.1|  TPA: hypothetical protein ZEAMMB73_216697              476   4e-154   
gb|KHN09446.1|  Ankyrin repeat-containing protein                       480   4e-154   
ref|XP_009148027.1|  PREDICTED: ankyrin repeat-containing protein...    482   7e-154   
ref|XP_007027136.1|  Ankyrin repeat family protein isoform 1            481   7e-154   
ref|XP_011019262.1|  PREDICTED: ankyrin repeat-containing protein...    479   9e-154   
gb|EYU36245.1|  hypothetical protein MIMGU_mgv1a019161mg                479   1e-153   
emb|CDX95126.1|  BnaC05g05450D                                          478   3e-153   
ref|XP_010228779.1|  PREDICTED: ankyrin repeat-containing protein...    478   3e-153   
emb|CDX88738.1|  BnaA03g09110D                                          478   4e-153   
ref|XP_002308487.2|  hypothetical protein POPTR_0006s23110g             477   6e-153   Populus trichocarpa [western balsam poplar]
gb|KDO49827.1|  hypothetical protein CISIN_1g009331mg                   476   1e-152   
ref|XP_009762672.1|  PREDICTED: ankyrin repeat-containing protein...    475   4e-152   
ref|XP_004493908.1|  PREDICTED: ankyrin repeat-containing protein...    474   1e-151   
ref|XP_009598255.1|  PREDICTED: ankyrin repeat-containing protein...    473   4e-151   
ref|XP_008345436.1|  PREDICTED: ankyrin repeat-containing protein...    473   6e-151   
ref|XP_010037883.1|  PREDICTED: ankyrin repeat-containing protein...    473   6e-151   
ref|XP_011007311.1|  PREDICTED: ankyrin repeat-containing protein...    472   6e-151   
ref|XP_003625551.1|  Ankyrin repeat-containing protein                  471   7e-151   
ref|XP_009782332.1|  PREDICTED: ankyrin repeat-containing protein...    472   8e-151   
ref|XP_002322833.2|  hypothetical protein POPTR_0016s08150g             472   9e-151   Populus trichocarpa [western balsam poplar]
ref|XP_009781799.1|  PREDICTED: ankyrin repeat-containing protein...    471   2e-150   
ref|XP_009596873.1|  PREDICTED: ankyrin repeat-containing protein...    471   2e-150   
ref|XP_003554338.1|  PREDICTED: ankyrin repeat-containing protein...    470   3e-150   
gb|AFK36069.1|  unknown                                                 469   3e-150   
ref|XP_006363351.1|  PREDICTED: ankyrin repeat-containing protein...    469   6e-150   
ref|XP_011031101.1|  PREDICTED: ankyrin repeat-containing protein...    469   1e-149   
ref|XP_002306279.1|  ankyrin repeat family protein                      468   2e-149   Populus trichocarpa [western balsam poplar]
ref|XP_010541367.1|  PREDICTED: ankyrin repeat-containing protein...    467   2e-148   
gb|EPS70729.1|  hypothetical protein M569_04030                         461   6e-147   
ref|XP_006649874.1|  PREDICTED: ankyrin repeat-containing protein...    459   5e-146   
ref|XP_010086769.1|  Ankyrin repeat-containing protein                  457   2e-145   
ref|XP_010313544.1|  PREDICTED: ankyrin repeat-containing protein...    456   8e-145   
ref|XP_010520320.1|  PREDICTED: LOW QUALITY PROTEIN: ankyrin repe...    453   8e-144   
ref|XP_007162687.1|  hypothetical protein PHAVU_001G171700g             451   6e-143   
emb|CDY10435.1|  BnaCnng03360D                                          444   3e-140   
ref|XP_002531839.1|  ankyrin repeat-containing protein, putative        439   8e-140   Ricinus communis
emb|CDY70132.1|  BnaA10g30530D                                          438   5e-138   
ref|XP_009122763.1|  PREDICTED: ankyrin repeat-containing protein...    437   8e-138   
ref|XP_010490725.1|  PREDICTED: ankyrin repeat-containing protein...    437   8e-138   
ref|XP_010452111.1|  PREDICTED: ankyrin repeat-containing protein...    437   1e-137   
ref|XP_006398720.1|  hypothetical protein EUTSA_v10013246mg             434   2e-136   
ref|XP_010423840.1|  PREDICTED: ankyrin repeat-containing protein...    433   3e-136   
gb|KFK24719.1|  hypothetical protein AALP_AA8G015800                    433   3e-136   
ref|XP_006287501.1|  hypothetical protein CARUB_v10000712mg             432   9e-136   
ref|XP_008448353.1|  PREDICTED: ankyrin repeat-containing protein...    429   1e-135   
emb|CAB85999.1|  ankyrin-like protein                                   431   2e-135   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE98405.1|  ankyrin like protein                                   431   3e-135   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195882.2|  protein ankyrin-like1                                 431   3e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010920744.1|  PREDICTED: ankyrin repeat-containing protein...    427   1e-134   
gb|KCW85626.1|  hypothetical protein EUGRSUZ_B02414                     411   2e-129   
ref|XP_009399736.1|  PREDICTED: ankyrin repeat-containing protein...    394   2e-121   
ref|NP_001169178.1|  uncharacterized protein LOC100383028               389   5e-121   Zea mays [maize]
ref|XP_008813533.1|  PREDICTED: ankyrin repeat-containing protein...    392   1e-120   
ref|XP_008677284.1|  PREDICTED: protein binding protein isoform X1      388   3e-119   
ref|XP_010910061.1|  PREDICTED: LOW QUALITY PROTEIN: ankyrin repe...    384   2e-117   
ref|XP_003570692.1|  PREDICTED: ankyrin repeat-containing protein...    381   2e-116   
ref|XP_008646211.1|  PREDICTED: ankyrin repeat-containing protein...    379   7e-116   
ref|NP_001048047.1|  Os02g0735700                                       378   2e-115   
gb|EAY87436.1|  hypothetical protein OsI_08844                          378   3e-115   
gb|EAZ24536.1|  hypothetical protein OsJ_08297                          376   3e-115   
ref|XP_011021779.1|  PREDICTED: ankyrin repeat-containing protein...    377   8e-115   
gb|ABK94575.1|  unknown                                                 376   2e-114   
ref|XP_002315857.2|  ankyrin repeat family protein                      375   3e-114   
ref|XP_004953843.1|  PREDICTED: ankyrin repeat-containing protein...    374   1e-113   
ref|XP_010271480.1|  PREDICTED: ankyrin repeat-containing protein...    373   2e-113   
ref|XP_002454323.1|  hypothetical protein SORBIDRAFT_04g028680          373   2e-113   
gb|KEH44513.1|  ankyrin repeat plant-like protein                       374   7e-113   
ref|XP_004497323.1|  PREDICTED: ankyrin repeat-containing protein...    373   1e-112   
ref|XP_004228736.1|  PREDICTED: ankyrin repeat-containing protein...    370   2e-112   
gb|KHN21607.1|  Ankyrin repeat-containing protein                       370   2e-112   
gb|EMT17023.1|  hypothetical protein F775_16760                         371   2e-112   
ref|XP_011024070.1|  PREDICTED: ankyrin repeat-containing protein...    370   3e-112   
ref|XP_003525231.1|  PREDICTED: ankyrin repeat-containing protein...    370   3e-112   
gb|ABR16367.1|  unknown                                                 372   3e-112   
ref|XP_003637659.1|  Ankyrin repeat-containing protein                  369   6e-112   
ref|XP_002525995.1|  ankyrin repeat-containing protein, putative        369   7e-112   
ref|XP_010088199.1|  Ankyrin repeat-containing protein                  368   1e-111   
ref|XP_003556545.1|  PREDICTED: ankyrin repeat-containing protein...    370   2e-111   
ref|XP_006364038.1|  PREDICTED: ankyrin repeat-containing protein...    366   7e-111   
ref|XP_002311530.2|  ankyrin repeat family protein                      366   1e-110   
ref|XP_006448167.1|  hypothetical protein CICLE_v10014855mg             365   2e-110   
emb|CDP21519.1|  unnamed protein product                                367   2e-110   
gb|KDO67812.1|  hypothetical protein CISIN_1g007755mg                   367   2e-110   
ref|XP_006448168.1|  hypothetical protein CICLE_v10014855mg             365   2e-110   
gb|KDO60747.1|  hypothetical protein CISIN_1g009457mg                   365   3e-110   
ref|XP_003530877.1|  PREDICTED: ankyrin repeat-containing protein...    363   1e-109   
ref|XP_006649024.1|  PREDICTED: ankyrin repeat-containing protein...    360   2e-109   
ref|XP_010066575.1|  PREDICTED: ankyrin repeat-containing protein...    363   3e-109   
ref|XP_004503355.1|  PREDICTED: ankyrin repeat-containing protein...    362   4e-109   
ref|XP_009591768.1|  PREDICTED: ankyrin repeat-containing protein...    362   4e-109   
gb|KDP38113.1|  hypothetical protein JCGZ_04756                         362   4e-109   
ref|XP_008389175.1|  PREDICTED: ankyrin repeat-containing protein...    362   5e-109   
ref|XP_008221463.1|  PREDICTED: ankyrin repeat-containing protein...    362   5e-109   
ref|XP_009600985.1|  PREDICTED: ankyrin repeat-containing protein...    363   5e-109   
ref|XP_009768913.1|  PREDICTED: ankyrin repeat-containing protein...    361   7e-109   
ref|XP_009764849.1|  PREDICTED: ankyrin repeat-containing protein...    363   7e-109   
ref|XP_006436137.1|  hypothetical protein CICLE_v10031031mg             362   1e-108   
gb|EYU30125.1|  hypothetical protein MIMGU_mgv1a004536mg                359   2e-108   
ref|XP_009351544.1|  PREDICTED: ankyrin repeat-containing protein...    359   3e-108   
dbj|BAJ91638.1|  predicted protein                                      351   3e-108   
ref|XP_009406959.1|  PREDICTED: ankyrin repeat-containing protein...    362   4e-108   
ref|XP_008391564.1|  PREDICTED: ankyrin repeat-containing protein...    359   5e-108   
ref|XP_008783607.1|  PREDICTED: ankyrin repeat-containing protein...    360   6e-108   
ref|XP_007045261.1|  Ankyrin repeat-containing protein                  358   8e-108   
ref|XP_002284902.1|  PREDICTED: ankyrin repeat-containing protein...    358   1e-107   
ref|XP_009384895.1|  PREDICTED: ankyrin repeat-containing protein...    360   1e-107   
ref|XP_007153252.1|  hypothetical protein PHAVU_003G019500g             357   2e-107   
ref|XP_003536781.1|  PREDICTED: ankyrin repeat-containing protein...    359   2e-107   
ref|XP_004307453.1|  PREDICTED: ankyrin repeat-containing protein...    359   2e-107   
ref|XP_003518611.1|  PREDICTED: ankyrin repeat-containing protein...    357   2e-107   
ref|XP_007160427.1|  hypothetical protein PHAVU_002G321000g             357   3e-107   
gb|KHN15448.1|  Ankyrin repeat-containing protein                       356   4e-107   
ref|XP_004297440.1|  PREDICTED: ankyrin repeat-containing protein...    356   5e-107   
ref|XP_004239763.1|  PREDICTED: ankyrin repeat-containing protein...    358   5e-107   
ref|XP_010682018.1|  PREDICTED: ankyrin repeat-containing protein...    356   6e-107   
ref|XP_010271348.1|  PREDICTED: ankyrin repeat-containing protein...    355   9e-107   
ref|XP_008359714.1|  PREDICTED: ankyrin repeat-containing protein...    353   9e-107   
ref|XP_011070571.1|  PREDICTED: ankyrin repeat-containing protein...    355   1e-106   
dbj|BAF48666.1|  IGN1                                                   357   1e-106   
ref|XP_006345920.1|  PREDICTED: ankyrin repeat-containing protein...    357   1e-106   
ref|XP_010101516.1|  Ankyrin repeat-containing protein                  357   1e-106   
ref|XP_009335923.1|  PREDICTED: ankyrin repeat-containing protein...    357   2e-106   
ref|XP_009357642.1|  PREDICTED: ankyrin repeat-containing protein...    357   2e-106   
ref|XP_007142693.1|  hypothetical protein PHAVU_007G008900g             359   3e-106   
gb|KHN26178.1|  Ankyrin repeat-containing protein                       353   4e-106   
gb|KHG06011.1|  hypothetical protein F383_02906                         353   4e-106   
ref|XP_007009581.1|  Ankyrin repeat-containing protein isoform 1        358   4e-106   
ref|XP_003529219.1|  PREDICTED: ankyrin repeat-containing protein...    353   5e-106   
ref|XP_004249518.1|  PREDICTED: ankyrin repeat-containing protein...    355   5e-106   
ref|XP_004149816.1|  PREDICTED: ankyrin repeat-containing protein...    355   9e-106   
ref|XP_006339047.1|  PREDICTED: ankyrin repeat-containing protein...    355   1e-105   
ref|XP_002312060.1|  ankyrin repeat family protein                      354   1e-105   
ref|XP_011091477.1|  PREDICTED: ankyrin repeat-containing protein...    354   2e-105   
ref|XP_008370204.1|  PREDICTED: ankyrin repeat-containing protein...    353   2e-105   
ref|XP_011020037.1|  PREDICTED: ankyrin repeat-containing protein...    353   2e-105   
ref|XP_004150616.1|  PREDICTED: ankyrin repeat-containing protein...    352   2e-105   
ref|XP_011027088.1|  PREDICTED: ankyrin repeat-containing protein...    353   4e-105   
ref|XP_006828439.1|  hypothetical protein AMTR_s00060p00113920          350   4e-105   
ref|XP_008467012.1|  PREDICTED: ankyrin repeat-containing protein...    350   5e-105   
ref|XP_002526791.1|  ankyrin repeat-containing protein, putative        352   5e-105   
ref|XP_009344901.1|  PREDICTED: ankyrin repeat-containing protein...    352   8e-105   
ref|XP_008776282.1|  PREDICTED: ankyrin repeat-containing protein...    352   8e-105   
ref|XP_008776273.1|  PREDICTED: ankyrin repeat-containing protein...    351   9e-105   
ref|XP_008233537.1|  PREDICTED: ankyrin repeat-containing protein...    352   9e-105   
ref|XP_008241691.1|  PREDICTED: ankyrin repeat-containing protein...    352   1e-104   
ref|XP_003630941.1|  Ankyrin repeat-containing protein                  350   2e-104   
ref|XP_010907440.1|  PREDICTED: ankyrin repeat-containing protein...    350   2e-104   
ref|XP_004498254.1|  PREDICTED: ankyrin repeat-containing protein...    349   3e-104   
gb|EAZ26479.1|  hypothetical protein OsJ_10369                          352   3e-104   
ref|XP_010907439.1|  PREDICTED: ankyrin repeat-containing protein...    350   3e-104   
ref|XP_007218870.1|  hypothetical protein PRUPE_ppa003217mg             350   3e-104   
ref|XP_002315257.2|  hypothetical protein POPTR_0010s21950g             350   6e-104   
gb|KDO67815.1|  hypothetical protein CISIN_1g007755mg                   346   7e-104   
ref|XP_006395862.1|  hypothetical protein EUTSA_v10003970mg             347   7e-104   
gb|KDO67814.1|  hypothetical protein CISIN_1g007755mg                   348   8e-104   
ref|XP_006649873.1|  PREDICTED: ankyrin repeat-containing protein...    352   1e-103   
ref|NP_001049740.1|  Os03g0281000                                       352   1e-103   
ref|XP_010922439.1|  PREDICTED: ankyrin repeat-containing protein...    348   2e-103   
gb|KFK33391.1|  hypothetical protein AALP_AA5G006800                    346   3e-103   
ref|XP_004142215.1|  PREDICTED: ankyrin repeat-containing protein...    347   5e-103   
ref|XP_007208035.1|  hypothetical protein PRUPE_ppa003006mg             348   5e-103   
ref|XP_008447408.1|  PREDICTED: ankyrin repeat-containing protein...    347   5e-103   
ref|XP_007224344.1|  hypothetical protein PRUPE_ppa020662mg             345   6e-103   
ref|XP_002282204.1|  PREDICTED: ankyrin repeat-containing protein...    347   7e-103   
ref|XP_008789002.1|  PREDICTED: ankyrin repeat-containing protein...    348   8e-103   
gb|EMT15358.1|  hypothetical protein F775_29354                         348   1e-102   
ref|XP_010920740.1|  PREDICTED: ankyrin repeat-containing protein...    348   1e-102   
ref|XP_009596310.1|  PREDICTED: ankyrin repeat-containing protein...    347   1e-102   
ref|XP_010658137.1|  PREDICTED: ankyrin repeat-containing protein...    347   1e-102   
ref|XP_009765479.1|  PREDICTED: ankyrin repeat-containing protein...    347   1e-102   
ref|XP_009416262.1|  PREDICTED: ankyrin repeat-containing protein...    346   2e-102   
gb|KHG08856.1|  hypothetical protein F383_13827                         348   2e-102   
ref|XP_009407467.1|  PREDICTED: ankyrin repeat-containing protein...    345   3e-102   
gb|AAM61483.1|  unknown                                                 343   3e-102   
ref|XP_010424942.1|  PREDICTED: ankyrin repeat-containing protein...    343   5e-102   
ref|XP_007027135.1|  Ankyrin repeat family protein isoform 2            345   5e-102   
ref|XP_003561764.1|  PREDICTED: ankyrin repeat-containing protein...    347   6e-102   
ref|XP_010937729.1|  PREDICTED: ankyrin repeat-containing protein...    346   7e-102   
ref|XP_006850586.1|  hypothetical protein AMTR_s00034p00071480          344   8e-102   
ref|NP_565274.1|  ankyrin repeat-containing protein                     342   1e-101   
emb|CDY36249.1|  BnaC07g21030D                                          342   1e-101   
ref|XP_010513897.1|  PREDICTED: ankyrin repeat-containing protein...    342   1e-101   
ref|XP_010502150.1|  PREDICTED: ankyrin repeat-containing protein...    341   2e-101   
ref|XP_010260015.1|  PREDICTED: ankyrin repeat-containing protein...    342   3e-101   
ref|XP_008369834.1|  PREDICTED: ankyrin repeat-containing protein...    343   3e-101   
dbj|BAD73402.1|  ankyrin-like protein                                   341   4e-101   
ref|XP_004984776.1|  PREDICTED: ankyrin repeat-containing protein...    345   5e-101   
gb|ABE11619.1|  ankyrin-repeat protein                                  341   6e-101   
emb|CDY17652.1|  BnaA06g34710D                                          340   7e-101   
gb|KDP46104.1|  hypothetical protein JCGZ_06615                         341   8e-101   
ref|XP_002277535.1|  PREDICTED: ankyrin repeat-containing protein...    343   8e-101   
ref|NP_001147449.1|  protein binding protein                            344   9e-101   
gb|EAY89498.1|  hypothetical protein OsI_11031                          342   1e-100   
ref|XP_009101323.1|  PREDICTED: ankyrin repeat-containing protein...    339   1e-100   
ref|XP_008660279.1|  PREDICTED: ankyrin repeat-containing protein...    343   1e-100   
ref|XP_006290885.1|  hypothetical protein CARUB_v10016998mg             338   2e-100   
gb|AFW88777.1|  hypothetical protein ZEAMMB73_664666                    343   2e-100   
ref|XP_010465006.1|  PREDICTED: ankyrin repeat-containing protein...    339   5e-100   
ref|XP_009399876.1|  PREDICTED: ankyrin repeat-containing protein...    338   1e-99    
ref|NP_187842.1|  protein INCREASED TOLERANCE TO NACL                   338   1e-99    
ref|XP_010534289.1|  PREDICTED: ankyrin repeat-containing protein...    338   1e-99    
ref|XP_010253362.1|  PREDICTED: ankyrin repeat-containing protein...    338   1e-99    
ref|XP_009377123.1|  PREDICTED: ankyrin repeat-containing protein...    338   2e-99    
ref|XP_010253361.1|  PREDICTED: ankyrin repeat-containing protein...    338   2e-99    
emb|CDM84871.1|  unnamed protein product                                336   2e-99    
ref|XP_008463527.1|  PREDICTED: ankyrin repeat-containing protein...    337   2e-99    
gb|AAM62711.1|  ankyrin-like protein                                    335   3e-99    
ref|XP_010520158.1|  PREDICTED: ankyrin repeat-containing protein...    337   4e-99    
ref|XP_010486937.1|  PREDICTED: ankyrin repeat-containing protein...    337   4e-99    
emb|CDY50335.1|  BnaC01g38300D                                          337   4e-99    
ref|XP_010498952.1|  PREDICTED: ankyrin repeat-containing protein...    336   6e-99    
gb|KHN19404.1|  Ankyrin repeat-containing protein                       324   8e-99    
dbj|BAJ86367.1|  predicted protein                                      335   9e-99    
ref|XP_002468069.1|  hypothetical protein SORBIDRAFT_01g039040          338   9e-99    
ref|XP_002458728.1|  hypothetical protein SORBIDRAFT_03g039140          334   1e-98    
ref|XP_003539661.2|  PREDICTED: ankyrin repeat-containing protein...    323   1e-98    
ref|XP_006407339.1|  hypothetical protein EUTSA_v10020362mg             335   2e-98    
gb|ACN33858.1|  unknown                                                 333   2e-98    
ref|XP_009146615.1|  PREDICTED: ankyrin repeat-containing protein...    334   3e-98    
ref|XP_008794370.1|  PREDICTED: ankyrin repeat-containing protein...    335   3e-98    
ref|XP_006297284.1|  hypothetical protein CARUB_v10013299mg             334   4e-98    
ref|XP_009120714.1|  PREDICTED: ankyrin repeat-containing protein...    334   4e-98    
ref|XP_009120722.1|  PREDICTED: ankyrin repeat-containing protein...    334   5e-98    
ref|XP_006378743.1|  ankyrin repeat family protein                      330   6e-98    
gb|EAZ14075.1|  hypothetical protein OsJ_03999                          331   6e-98    
emb|CDY42145.1|  BnaC05g40740D                                          333   7e-98    
emb|CDY50551.1|  BnaA01g30650D                                          333   7e-98    
ref|XP_009409539.1|  PREDICTED: ankyrin repeat-containing protein...    333   7e-98    
ref|XP_008646212.1|  PREDICTED: ankyrin repeat-containing protein...    328   8e-98    
ref|XP_010047257.1|  PREDICTED: ankyrin repeat-containing protein...    333   9e-98    
emb|CBI26836.3|  unnamed protein product                                328   1e-97    
emb|CDY08436.1|  BnaA05g26720D                                          335   1e-97    
ref|NP_001147861.1|  protein binding protein                            331   2e-97    
ref|XP_003564562.1|  PREDICTED: ankyrin repeat-containing protein...    331   2e-97    
ref|XP_010088109.1|  Ankyrin repeat-containing protein                  332   3e-97    
ref|XP_010032263.1|  PREDICTED: LOW QUALITY PROTEIN: ankyrin repe...    331   4e-97    
ref|XP_011094790.1|  PREDICTED: ankyrin repeat-containing protein...    332   4e-97    
gb|EPS60730.1|  hypothetical protein M569_14072                         335   7e-97    
ref|XP_002534261.1|  ankyrin repeat-containing protein, putative        331   7e-97    
gb|EYU41665.1|  hypothetical protein MIMGU_mgv1a003182mg                331   7e-97    
ref|XP_007009582.1|  Ankyrin repeat-containing protein isoform 2        332   1e-96    
ref|XP_011019261.1|  PREDICTED: ankyrin repeat-containing protein...    329   2e-96    
ref|XP_011019260.1|  PREDICTED: ankyrin repeat-containing protein...    329   5e-96    
ref|XP_004970502.1|  PREDICTED: ankyrin repeat-containing protein...    327   5e-96    
gb|EYU38486.1|  hypothetical protein MIMGU_mgv1a003188mg                328   6e-96    
gb|KDP35569.1|  hypothetical protein JCGZ_09007                         328   1e-95    
ref|XP_002308486.2|  hypothetical protein POPTR_0006s23100g             327   1e-95    
ref|XP_003520632.1|  PREDICTED: ankyrin repeat-containing protein...    327   1e-95    
gb|EYU33195.1|  hypothetical protein MIMGU_mgv1a002911mg                327   5e-95    
ref|XP_003625554.1|  Ankyrin repeat-containing protein                  322   5e-94    
ref|XP_007162686.1|  hypothetical protein PHAVU_001G171600g             322   8e-94    
gb|KHN42115.1|  Ankyrin repeat-containing protein                       314   8e-94    
gb|KHG25756.1|  hypothetical protein F383_00831                         324   1e-93    
ref|XP_006480721.1|  PREDICTED: ankyrin repeat-containing protein...    321   1e-93    
gb|KFK38348.1|  hypothetical protein AALP_AA3G102500                    322   1e-93    
ref|XP_006428990.1|  hypothetical protein CICLE_v10013809mg             321   2e-93    
emb|CDP16304.1|  unnamed protein product                                317   8e-93    
ref|XP_006646462.1|  PREDICTED: ankyrin repeat-containing protein...    314   1e-92    
ref|XP_009368549.1|  PREDICTED: ankyrin repeat-containing protein...    319   1e-92    
ref|XP_009341685.1|  PREDICTED: ankyrin repeat-containing protein...    319   2e-92    
ref|XP_010669794.1|  PREDICTED: ankyrin repeat-containing protein...    318   2e-92    
ref|XP_010522595.1|  PREDICTED: ankyrin repeat-containing protein...    318   2e-92    
ref|XP_008387723.1|  PREDICTED: ankyrin repeat-containing protein...    318   5e-92    
ref|XP_003553530.1|  PREDICTED: ankyrin repeat-containing protein...    317   5e-92    
ref|XP_008387724.1|  PREDICTED: ankyrin repeat-containing protein...    318   5e-92    
emb|CAN80965.1|  hypothetical protein VITISV_005609                     317   8e-92    
ref|XP_010684192.1|  PREDICTED: ankyrin repeat-containing protein...    318   2e-91    
ref|XP_010920741.1|  PREDICTED: ankyrin repeat-containing protein...    317   2e-91    
emb|CDP06667.1|  unnamed protein product                                317   2e-91    
ref|XP_004493907.1|  PREDICTED: ankyrin repeat-containing protein...    313   2e-90    
ref|NP_187566.4|  ankyrin repeat-containing protein                     312   7e-90    
dbj|BAB03143.1|  ankyrin-like protein                                   323   7e-90    
gb|EPS69712.1|  hypothetical protein M569_05048                         310   2e-89    
gb|EMT18375.1|  Ankyrin repeat-containing protein                       307   4e-89    
ref|XP_006407666.1|  hypothetical protein EUTSA_v10020325mg             309   7e-89    
ref|XP_010464601.1|  PREDICTED: ankyrin repeat-containing protein...    308   1e-88    
ref|XP_010473998.1|  PREDICTED: ankyrin repeat-containing protein...    308   2e-88    
ref|XP_006297249.1|  hypothetical protein CARUB_v10013257mg             307   3e-88    



>ref|XP_004253038.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Solanum 
lycopersicum]
 ref|XP_010314788.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Solanum 
lycopersicum]
Length=576

 Score =   893 bits (2307),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/576 (82%), Positives = 528/576 (92%), Gaps = 4/576 (1%)
 Frame = +2

Query  890   IMEKQASFRGV-MEKQQSFRN--MEKQKSFKGLMEKQKSFRIAMERQLSFGGERKRGKDS  1060
             IMEKQ SF+G  MEKQQSF+N  MEKQKSF G+MEKQKSFRIAMERQ+SFGGERKRGKDS
Sbjct  2     IMEKQVSFQGAKMEKQQSFQNGAMEKQKSFIGIMEKQKSFRIAMERQMSFGGERKRGKDS  61

Query  1061  PGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVV  1240
             PGKRGD+PLHLAARAGNL KV+EI+Q+FD K IKD L +QNQEGETALYVAAENGH+LVV
Sbjct  62    PGKRGDSPLHLAARAGNLGKVKEIIQKFDEKGIKDLLCQQNQEGETALYVAAENGHSLVV  121

Query  1241  GEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTA  1420
              E LK LDLE ASI +NNGYD  H+AA+QGHL+VL+ELL+ FPNLVMTTDSSNSTALHTA
Sbjct  122   AEFLKHLDLEIASIVANNGYDTLHVAARQGHLDVLQELLHSFPNLVMTTDSSNSTALHTA  181

Query  1421  AGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKK  1600
             A QGH+ VV++LLEIDSNLAKIARNNGKTVLHTAARMGHLE+V+SL++KDP IGFRTDKK
Sbjct  182   AAQGHIHVVNMLLEIDSNLAKIARNNGKTVLHTAARMGHLEIVRSLLSKDPEIGFRTDKK  241

Query  1601  GQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGI  1780
             GQTALHMA KGQNVDIVLELIKP+P+VLAL DNKGNTALHIATRKGR QMVQ LISIEGI
Sbjct  242   GQTALHMAAKGQNVDIVLELIKPNPAVLALEDNKGNTALHIATRKGRIQMVQCLISIEGI  301

Query  1781  NINTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDV  1960
             ++NT+NKAGET L+IAEKFGTP++V++LKEAGATHSKDHGKP   AKQLKQTVSDIKHDV
Sbjct  302   DLNTLNKAGETVLEIAEKFGTPELVSILKEAGATHSKDHGKPAGPAKQLKQTVSDIKHDV  361

Query  1961  ESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVE  2140
              SQLQQSRQTGFKVRKIA KVKKLHISGLNNAIN+ TVVAVLIATVAFAAIFTVPGQYVE
Sbjct  362   HSQLQQSRQTGFKVRKIAMKVKKLHISGLNNAINNATVVAVLIATVAFAAIFTVPGQYVE  421

Query  2141  KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINK  2320
             K+  GF+LGEA +  KAAFI+FFLFDS+ALFIS+AVVVVQTSVVVIEQKAKK+++F INK
Sbjct  422   KKTDGFSLGEAQIGRKAAFIIFFLFDSMALFISVAVVVVQTSVVVIEQKAKKRLMFWINK  481

Query  2321  LMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESR  2500
             LMW ACLFIS+AFISL+YVVVG++E+WLA+Y+TVVG +IMLTTIGSMCYCVV+HRLEESR
Sbjct  482   LMWAACLFISVAFISLSYVVVGSKERWLAVYATVVGCIIMLTTIGSMCYCVVQHRLEESR  541

Query  2501  MRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             +R+IR+ ET SRSF MS V SD EL +E+YKRMYAV
Sbjct  542   LRSIRRTETNSRSFPMS-VASDQELCSENYKRMYAV  576



>ref|XP_009758452.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Nicotiana 
sylvestris]
Length=575

 Score =   892 bits (2306),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/576 (82%), Positives = 532/576 (92%), Gaps = 5/576 (1%)
 Frame = +2

Query  893   MEKQASFRGVMEKQQSFRN--MEKQKSFKGLMEKQKSFRIAMERQLSFGG-ERKRGKDSP  1063
             MEKQ SFRGVMEKQQSFRN  +EKQKSF+GLMEKQKSFRIAMERQLSFGG ERKRGK+SP
Sbjct  1     MEKQISFRGVMEKQQSFRNGTIEKQKSFRGLMEKQKSFRIAMERQLSFGGGERKRGKESP  60

Query  1064  GKRGDNPLHLAARAGNLSKVREILQRFD-SKAIKDTLSKQNQEGETALYVAAENGHTLVV  1240
             GKRGD+PLHLA RAGN+ KV+EI+Q+ D SK I D LSKQNQEGETALYVAAENGHTLVV
Sbjct  61    GKRGDSPLHLAVRAGNVGKVKEIVQKLDNSKGISDLLSKQNQEGETALYVAAENGHTLVV  120

Query  1241  GEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTA  1420
              E+LK LDL+TASI + NGYDAFH+AAKQGH+EVLKELL+ FPNLVMTTDSSNSTALHTA
Sbjct  121   EELLKHLDLQTASILARNGYDAFHVAAKQGHIEVLKELLHSFPNLVMTTDSSNSTALHTA  180

Query  1421  AGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKK  1600
             A QGH+DV++LLLEIDSNLAKIARNNGKT+LHTAARMGHLE+V+SL++KDP IGFRTDKK
Sbjct  181   AAQGHLDVMNLLLEIDSNLAKIARNNGKTILHTAARMGHLEIVRSLLSKDPEIGFRTDKK  240

Query  1601  GQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGI  1780
             GQ+ALHM+VKGQNVDIV ELIKP+P+VLAL DNKGN ALH+AT KGRPQMVQ LISIEGI
Sbjct  241   GQSALHMSVKGQNVDIVFELIKPNPAVLALEDNKGNRALHVATIKGRPQMVQCLISIEGI  300

Query  1781  NINTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDV  1960
             ++N VNKAGETALDIAEK G+  +V++LKEAGATHSKDHG+PP+AAKQLKQTVSDI+HDV
Sbjct  301   DLNAVNKAGETALDIAEKSGSLQLVSILKEAGATHSKDHGRPPNAAKQLKQTVSDIRHDV  360

Query  1961  ESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVE  2140
             ESQLQ SRQTGFKVRKIAK VKKLHISGLNNAIN+ TVVAVLIATVAFAAIFTVPGQYVE
Sbjct  361   ESQLQHSRQTGFKVRKIAKNVKKLHISGLNNAINNATVVAVLIATVAFAAIFTVPGQYVE  420

Query  2141  KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINK  2320
             ++  G +LGEA++A KAAFI+FFLFDS+ALFISIAVVVVQTSVVVIEQKAKKQ++F INK
Sbjct  421   EKTDGVSLGEAHIARKAAFIIFFLFDSMALFISIAVVVVQTSVVVIEQKAKKQLMFWINK  480

Query  2321  LMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESR  2500
             LMW ACL ISI+FISLTYVVVG +E+ LAIY+TV+G  IMLTTIGSMCYCVVRHRLEES+
Sbjct  481   LMWAACLSISISFISLTYVVVGDKEKGLAIYATVIGSTIMLTTIGSMCYCVVRHRLEESK  540

Query  2501  MRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             MR+IR+AET SRS+SMS V SD+ELY+ESYKRMYAV
Sbjct  541   MRSIRRAETHSRSYSMS-VASDTELYSESYKRMYAV  575



>ref|XP_006342435.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006342436.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X2 [Solanum tuberosum]
Length=576

 Score =   892 bits (2304),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/576 (81%), Positives = 527/576 (91%), Gaps = 4/576 (1%)
 Frame = +2

Query  890   IMEKQASFRG-VMEKQQSFRN--MEKQKSFKGLMEKQKSFRIAMERQLSFGGERKRGKDS  1060
             IMEKQ SF+G  MEKQQSFRN  MEKQKSF+G+MEKQKSFRIAMERQ+SFGGERKRGKDS
Sbjct  2     IMEKQVSFQGATMEKQQSFRNGAMEKQKSFRGIMEKQKSFRIAMERQMSFGGERKRGKDS  61

Query  1061  PGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVV  1240
             PGKRGD+PLHLAARAGNL KV+EI+Q+FD K IKD L +QNQEGETALYVAAENGH LVV
Sbjct  62    PGKRGDSPLHLAARAGNLGKVKEIVQKFDEKGIKDLLCQQNQEGETALYVAAENGHCLVV  121

Query  1241  GEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTA  1420
              E LK LDLE ASI +NNGYD  H+AA+QGHL+VL+ELL+ FPNLVMTTDSSNSTALHTA
Sbjct  122   AEFLKHLDLEIASIVANNGYDTLHVAARQGHLDVLQELLHSFPNLVMTTDSSNSTALHTA  181

Query  1421  AGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKK  1600
             A QGH+ VV++LLEIDSNLAKIARNNGKTVLHTAARMGHLE+V+S+++KDP IGFRTDKK
Sbjct  182   AAQGHIHVVNMLLEIDSNLAKIARNNGKTVLHTAARMGHLEIVRSVLSKDPEIGFRTDKK  241

Query  1601  GQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGI  1780
             GQTALHMA KGQNVDIVLELIKP+P+VLAL DNKGNTALHIATRKGR QMVQ LISIEGI
Sbjct  242   GQTALHMAAKGQNVDIVLELIKPNPAVLALEDNKGNTALHIATRKGRIQMVQCLISIEGI  301

Query  1781  NINTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDV  1960
             ++NT+NKAGET L+IAEKFGTP++V++LKEAGATHSKDHGKPP  AKQLKQ+VSDIKHDV
Sbjct  302   DLNTLNKAGETVLEIAEKFGTPELVSILKEAGATHSKDHGKPPGPAKQLKQSVSDIKHDV  361

Query  1961  ESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVE  2140
              SQLQQS+QTGFKVRKIA KVKKLHISGLNNAIN+ TVVAVLIATVAFAAIFTVPGQYVE
Sbjct  362   HSQLQQSQQTGFKVRKIAMKVKKLHISGLNNAINNATVVAVLIATVAFAAIFTVPGQYVE  421

Query  2141  KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINK  2320
              E  GF+LGEA++  KAAFI+FFLFDS+ALFIS+AVVVVQTSVVVIEQKAKK+++F INK
Sbjct  422   NETDGFSLGEAHIGRKAAFIIFFLFDSMALFISVAVVVVQTSVVVIEQKAKKRLMFWINK  481

Query  2321  LMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESR  2500
             LMW ACLFIS+AFISL+YVVVG +E+WLA+Y+TVVG +IMLTT GSMCYCVV+HRLEESR
Sbjct  482   LMWAACLFISVAFISLSYVVVGAKERWLAVYATVVGCIIMLTTFGSMCYCVVQHRLEESR  541

Query  2501  MRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             +RNIR+ ET SRSF +S V SD EL +E+YKRMYAV
Sbjct  542   LRNIRRTETNSRSFPLS-VASDPELCSENYKRMYAV  576



>ref|XP_009593299.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Nicotiana 
tomentosiformis]
Length=575

 Score =   888 bits (2294),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/576 (82%), Positives = 529/576 (92%), Gaps = 5/576 (1%)
 Frame = +2

Query  893   MEKQASFRGVMEKQQSFRN--MEKQKSFKGLMEKQKSFRIAMERQLSFGG-ERKRGKDSP  1063
             MEKQ SFRGVMEKQ+SFRN  +EKQKSF+GLMEKQKSFRIAMERQLSFGG ERKRGK+SP
Sbjct  1     MEKQISFRGVMEKQKSFRNGTIEKQKSFRGLMEKQKSFRIAMERQLSFGGGERKRGKESP  60

Query  1064  GKRGDNPLHLAARAGNLSKVREILQRFD-SKAIKDTLSKQNQEGETALYVAAENGHTLVV  1240
             GKRGD+PLHLA RAGNL KV+EI+Q+ D SK I D LSKQNQEGETALYVAAENGHTLVV
Sbjct  61    GKRGDSPLHLAVRAGNLGKVKEIVQKLDNSKGISDLLSKQNQEGETALYVAAENGHTLVV  120

Query  1241  GEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTA  1420
              E+LK LDL+TASI + NGYDAFH+AAKQGHLEVLKELL+ FPNLVMTTD SNSTALHTA
Sbjct  121   AELLKHLDLQTASILARNGYDAFHVAAKQGHLEVLKELLHSFPNLVMTTDLSNSTALHTA  180

Query  1421  AGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKK  1600
             A QGH+DV++LLLEIDSNLAKIARNNGKT+LHTAARMGHLE+VKSL++KDP I FRTDKK
Sbjct  181   AAQGHLDVMNLLLEIDSNLAKIARNNGKTILHTAARMGHLEIVKSLLSKDPEIDFRTDKK  240

Query  1601  GQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGI  1780
             GQ+ALHM+VKGQNVDIVLELIKP+P+VLAL DNKGN ALH+AT KGR QMVQ LISIEGI
Sbjct  241   GQSALHMSVKGQNVDIVLELIKPNPAVLALEDNKGNRALHVATIKGRQQMVQCLISIEGI  300

Query  1781  NINTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDV  1960
             ++N VNKAGETALDIAEK G+  +V++LKEAGATHSKDHG+PP+AAKQLKQTVSDI+HDV
Sbjct  301   DLNAVNKAGETALDIAEKSGSLQLVSILKEAGATHSKDHGRPPNAAKQLKQTVSDIRHDV  360

Query  1961  ESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVE  2140
             ESQLQ SRQTGFKVRKIAK VKKLHISGLNNAIN+ TVVAVLIATVAFAAIFTVPGQYVE
Sbjct  361   ESQLQHSRQTGFKVRKIAKNVKKLHISGLNNAINNATVVAVLIATVAFAAIFTVPGQYVE  420

Query  2141  KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINK  2320
              +  G +LGEA++A KAAFI+FFLFDS+ALFISIAVVVVQTSVVVIEQKAKKQ++F INK
Sbjct  421   DKTDGVSLGEAHIARKAAFIIFFLFDSMALFISIAVVVVQTSVVVIEQKAKKQLMFWINK  480

Query  2321  LMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESR  2500
             LMW ACL ISI+FISLTYVVVG +E+ LAIY+TV+G  IMLTTIGSMCYCVVRHRLEES+
Sbjct  481   LMWAACLSISISFISLTYVVVGDKERGLAIYATVIGSTIMLTTIGSMCYCVVRHRLEESK  540

Query  2501  MRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             MR+IR+AET SRS+SMS V SD+ELY+ESYKRMYAV
Sbjct  541   MRSIRRAETHSRSYSMS-VASDTELYSESYKRMYAV  575



>ref|XP_004251987.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Solanum 
lycopersicum]
Length=571

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/575 (81%), Positives = 527/575 (92%), Gaps = 6/575 (1%)
 Frame = +2

Query  890   IMEKQASFRGVMEKQQSFRN--MEKQKSFKGLMEKQKSFRIAMERQLSFGGERKRGKDSP  1063
             +MEKQ SF GV+EKQQSFRN  MEKQ+SF+GLMEKQKSFRIAMERQLSFGGERKRGK+SP
Sbjct  1     MMEKQISFHGVIEKQQSFRNGTMEKQRSFRGLMEKQKSFRIAMERQLSFGGERKRGKESP  60

Query  1064  GKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVG  1243
             GKRGD+PLHLA RAGNL KV+EI+    SK+  D LSKQNQEGET LYVAAENGH+LVV 
Sbjct  61    GKRGDSPLHLAIRAGNLGKVKEIVH---SKSTNDLLSKQNQEGETVLYVAAENGHSLVVA  117

Query  1244  EILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAA  1423
             E+LK LDL+TASI +NNG+DAFHIAAKQGHLEVLKELL+ FPNLVMTTDS+NSTALHTAA
Sbjct  118   ELLKHLDLQTASILANNGFDAFHIAAKQGHLEVLKELLHSFPNLVMTTDSANSTALHTAA  177

Query  1424  GQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKG  1603
              QGH+DVV+LLLEIDSNLAKIARNNGKT+LHTAARMGHLE+V+SL++KDP IGFRTDKKG
Sbjct  178   AQGHLDVVNLLLEIDSNLAKIARNNGKTILHTAARMGHLEIVRSLLSKDPEIGFRTDKKG  237

Query  1604  QTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGIN  1783
             Q+ALHMAVKGQN DIVLEL+KP+P+VLAL DNKGN ALH+AT KGRPQMVQ LISIEGI+
Sbjct  238   QSALHMAVKGQNFDIVLELVKPNPAVLALEDNKGNRALHVATIKGRPQMVQCLISIEGID  297

Query  1784  INTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVE  1963
             +N VNKAG+TALDIAEK G+P ++++LKEAGAT SKD G+PP+AAKQLKQTVSDI+HDVE
Sbjct  298   LNAVNKAGDTALDIAEKSGSPQLISILKEAGATRSKDDGRPPTAAKQLKQTVSDIRHDVE  357

Query  1964  SQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEK  2143
             SQLQ SRQTGF+VRKIAK VKKLHISGLNNAIN+ TVVAVLIATVAFAAIFTVPGQY+E+
Sbjct  358   SQLQHSRQTGFRVRKIAKNVKKLHISGLNNAINNATVVAVLIATVAFAAIFTVPGQYIEE  417

Query  2144  EKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKL  2323
             +  G +LGEA++A KA+FI+FFLFDS+ALFISIAVVVVQTSVVVIEQKAKKQ++F INKL
Sbjct  418   KADGVSLGEAHIARKASFIIFFLFDSMALFISIAVVVVQTSVVVIEQKAKKQLMFWINKL  477

Query  2324  MWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRM  2503
             MW ACL ISI+FISLTYVVVG +E+ LAIY+TV+G  IMLTTIGSMCYCVVRHRLEESRM
Sbjct  478   MWAACLSISISFISLTYVVVGEKERALAIYATVIGSTIMLTTIGSMCYCVVRHRLEESRM  537

Query  2504  RNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             R+IR+AET S S+SMS V SD+ELY+E+YKRMYAV
Sbjct  538   RSIRRAETHSHSYSMS-VASDTELYSENYKRMYAV  571



>ref|XP_011074001.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Sesamum 
indicum]
Length=575

 Score =   875 bits (2261),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/577 (80%), Positives = 522/577 (90%), Gaps = 7/577 (1%)
 Frame = +2

Query  893   MEKQASFRG-VMEKQQSFRN--MEKQKSFKGLMEKQKSFRIAMERQLSFGGERKRGKDSP  1063
             MEKQ+SFR   MEKQQSFR   MEKQKSF+GLMEKQKSFRIAMERQLSFGG+RK+ KDSP
Sbjct  1     MEKQSSFRSPTMEKQQSFRTRAMEKQKSFRGLMEKQKSFRIAMERQLSFGGDRKKSKDSP  60

Query  1064  GKRGDNPLHLAARAGNLSKVREILQRFDS--KAIKDTLSKQNQEGETALYVAAENGHTLV  1237
             GKRGD+PLHLAARAGNL+KV+EILQ+FD+    +KD LSKQNQEGET LYVAAENGHTLV
Sbjct  61    GKRGDSPLHLAARAGNLAKVKEILQKFDNINNGVKDLLSKQNQEGETPLYVAAENGHTLV  120

Query  1238  VGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHT  1417
             VGE L+  D ET+SI +NNGYD FH+AAKQGHL+VLKELL  FP+LVMTTD++NSTALHT
Sbjct  121   VGEFLRHSDAETSSIPANNGYDPFHVAAKQGHLDVLKELLRFFPSLVMTTDTTNSTALHT  180

Query  1418  AAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDK  1597
             AA QGH+DVV+LLL+IDSNLAKIARNNGKTVLHTAARMG L+VVKSL+ KDPSIGFRTD+
Sbjct  181   AAAQGHIDVVNLLLDIDSNLAKIARNNGKTVLHTAARMGRLDVVKSLLEKDPSIGFRTDR  240

Query  1598  KGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEG  1777
             KGQTALHMAVKGQNV+IV ELIKPDPSVL L DNKGNTALHIATRKGR Q+VQ LIS EG
Sbjct  241   KGQTALHMAVKGQNVEIVTELIKPDPSVLGLEDNKGNTALHIATRKGRNQIVQCLISTEG  300

Query  1778  ININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHD  1957
             I++N  N AGET LDIAEKFGTP++V +LKE GA HSKD GKP SAAKQLKQTVSDIKHD
Sbjct  301   IDVNATNSAGETPLDIAEKFGTPELVAILKEVGAVHSKDQGKPQSAAKQLKQTVSDIKHD  360

Query  1958  VESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYV  2137
             V+SQLQQ+RQTGF+VRKIAKKVKKLHI GLNNAINS TVVAVLIATVAFAAIFTVPGQYV
Sbjct  361   VQSQLQQTRQTGFRVRKIAKKVKKLHIEGLNNAINSATVVAVLIATVAFAAIFTVPGQYV  420

Query  2138  EKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIIN  2317
             E++ +GF+LGEA++AN AAFI+FFL DS+ALFIS+AVVVVQTSVVVIE+K+KKQ++F+IN
Sbjct  421   EEKTEGFSLGEAHIANNAAFIIFFLCDSVALFISLAVVVVQTSVVVIEEKSKKQLMFVIN  480

Query  2318  KLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEES  2497
             KLMW ACL ISIAFISLTY+VVG+ E+WLA+Y+TV+G  IMLTTIGSMCYCVVRHRL++S
Sbjct  481   KLMWLACLSISIAFISLTYIVVGSHERWLAVYATVIGSTIMLTTIGSMCYCVVRHRLQDS  540

Query  2498  RMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             RMRNIRKA TLSRSFS S+  SD E+Y+E YKRMYAV
Sbjct  541   RMRNIRKARTLSRSFSFSI--SDPEMYSERYKRMYAV  575



>ref|XP_009624816.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X1 [Nicotiana tomentosiformis]
Length=576

 Score =   875 bits (2260),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/576 (80%), Positives = 522/576 (91%), Gaps = 4/576 (1%)
 Frame = +2

Query  890   IMEKQASFRG-VMEKQQSFRN--MEKQKSFKGLMEKQKSFRIAMERQLSFGGERKRGKDS  1060
             +MEKQ SF+G  MEKQQSFRN   EKQKSF+G+MEKQKSFRI+MERQLSFGGERKRGK+S
Sbjct  2     VMEKQVSFQGPTMEKQQSFRNGTTEKQKSFRGIMEKQKSFRISMERQLSFGGERKRGKES  61

Query  1061  PGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVV  1240
             PGKRGD+ LHLAAR GNL KV+EI+ +FD K IKD L KQNQEGETALYVAAENGH+ VV
Sbjct  62    PGKRGDSILHLAARGGNLGKVKEIVDKFDEKGIKDFLCKQNQEGETALYVAAENGHSFVV  121

Query  1241  GEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTA  1420
              E LK LDL+TASI +NNGYD  H+AA+QGHL+VL+ELL  FPNLVMTTDSSNSTALHTA
Sbjct  122   AEFLKHLDLQTASIVANNGYDTLHVAARQGHLDVLEELLRSFPNLVMTTDSSNSTALHTA  181

Query  1421  AGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKK  1600
             A QGH+ VV++LLEIDSNLAKIARNNGKTVLHTAARMGHLE+V+SL++KDP IGFRTDKK
Sbjct  182   AAQGHIHVVNMLLEIDSNLAKIARNNGKTVLHTAARMGHLEIVRSLLSKDPDIGFRTDKK  241

Query  1601  GQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGI  1780
             GQTALHMA KGQN  IVLELIKP+P+VLAL DNKGN ALHIATRKGR QMVQ L+SIEGI
Sbjct  242   GQTALHMAAKGQNAGIVLELIKPNPAVLALEDNKGNRALHIATRKGRVQMVQCLMSIEGI  301

Query  1781  NINTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDV  1960
             ++N +NKAGE  LDIAEKFGTP++V++LKEAGATHSKD GKPP AAKQLKQTVSDIKHDV
Sbjct  302   DLNAINKAGEAVLDIAEKFGTPELVSILKEAGATHSKDQGKPPGAAKQLKQTVSDIKHDV  361

Query  1961  ESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVE  2140
              SQLQQSRQTGF+VRKIA KVKKLHISGLNNAIN+ TVVAVLIATVAFAAIFTVPGQYVE
Sbjct  362   HSQLQQSRQTGFRVRKIALKVKKLHISGLNNAINNATVVAVLIATVAFAAIFTVPGQYVE  421

Query  2141  KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINK  2320
             ++  GF+LGEANV  KAAFI+FFLFDS+ALFIS+AVVVVQTSVVVIEQKAKK+++F INK
Sbjct  422   EKTDGFSLGEANVGRKAAFIIFFLFDSMALFISVAVVVVQTSVVVIEQKAKKRLMFWINK  481

Query  2321  LMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESR  2500
             LMW ACLFISIAFISL+YVVVG++E+WLA+Y+TV+G +IMLTTIGSMCYCVV+HRLEESR
Sbjct  482   LMWAACLFISIAFISLSYVVVGSKERWLAVYATVIGSIIMLTTIGSMCYCVVQHRLEESR  541

Query  2501  MRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             +R+IR+ ET SRSF +S V SD+EL +E+YKRMYAV
Sbjct  542   LRSIRRDETHSRSFPLS-VASDTELCSENYKRMYAV  576



>ref|XP_006353117.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Solanum 
tuberosum]
Length=571

 Score =   875 bits (2260),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/575 (81%), Positives = 524/575 (91%), Gaps = 7/575 (1%)
 Frame = +2

Query  893   MEKQASFRGVMEKQQSFRN--MEKQKSFKGLMEKQKSFRIAMERQLSFGG-ERKRGKDSP  1063
             MEKQ SF GV+EKQQSFRN  MEKQKSF+GLMEKQKSFRIAMERQLSFGG ERKRGK+SP
Sbjct  1     MEKQISFHGVIEKQQSFRNGTMEKQKSFRGLMEKQKSFRIAMERQLSFGGGERKRGKESP  60

Query  1064  GKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVG  1243
             GKRGD+PLHLA RAGNL KV+EI+    SK+  D LSKQNQEGET LYVAAENGH+LVV 
Sbjct  61    GKRGDSPLHLAVRAGNLGKVKEIVH---SKSTNDLLSKQNQEGETVLYVAAENGHSLVVA  117

Query  1244  EILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAA  1423
             E+LK LDL+TASI +NNG+DAFHIAAKQGHLEVLKELL+ FPNLVMTTDS+NSTALHTAA
Sbjct  118   ELLKHLDLQTASILANNGFDAFHIAAKQGHLEVLKELLHSFPNLVMTTDSANSTALHTAA  177

Query  1424  GQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKG  1603
              QGH+DVV+LLLEIDSNLAKIARNNGKT+LHTAARMGHLE+V++L++KDP IGFRTD KG
Sbjct  178   AQGHLDVVNLLLEIDSNLAKIARNNGKTILHTAARMGHLEIVRALLSKDPEIGFRTDTKG  237

Query  1604  QTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGIN  1783
             Q+ALHMAVKGQN DIVLELIKP+P+VLAL DNKGN ALH+AT KGRPQMVQ LISIEGI+
Sbjct  238   QSALHMAVKGQNFDIVLELIKPNPAVLALEDNKGNRALHVATTKGRPQMVQCLISIEGID  297

Query  1784  INTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVE  1963
             +N VN+AGETALDIAEK G+P +V+MLKEAGAT SKD G+PP+AAKQLKQTVSDI+HDVE
Sbjct  298   LNAVNRAGETALDIAEKSGSPQLVSMLKEAGATRSKDDGRPPTAAKQLKQTVSDIRHDVE  357

Query  1964  SQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEK  2143
             SQLQ SRQTGF+VRKIAK VKKLHISGLNNAIN+ TVVAVLIATVAFAAIFTVPGQY+E+
Sbjct  358   SQLQHSRQTGFRVRKIAKNVKKLHISGLNNAINNATVVAVLIATVAFAAIFTVPGQYIEE  417

Query  2144  EKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKL  2323
             +  G +LGEA++A KA+FI+FFLFDS+ALFISIAVVVVQTSVVVIEQKAKKQ++F INKL
Sbjct  418   KTDGVSLGEAHIARKASFIIFFLFDSMALFISIAVVVVQTSVVVIEQKAKKQLMFWINKL  477

Query  2324  MWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRM  2503
             MW ACL ISI+FISLTYVVVG +E+ LAIY+TV+G  IMLTTIGSMCYCVVRHRLEESRM
Sbjct  478   MWAACLSISISFISLTYVVVGEKERGLAIYATVIGSTIMLTTIGSMCYCVVRHRLEESRM  537

Query  2504  RNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             R+IR+AET S S+SMS V SD+ELY E+YKRMYAV
Sbjct  538   RSIRRAETHSHSYSMS-VASDTELYGENYKRMYAV  571



>ref|XP_009800727.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X1 [Nicotiana sylvestris]
Length=574

 Score =   874 bits (2258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/575 (80%), Positives = 522/575 (91%), Gaps = 4/575 (1%)
 Frame = +2

Query  893   MEKQASFRG-VMEKQQSFRN--MEKQKSFKGLMEKQKSFRIAMERQLSFGGERKRGKDSP  1063
             MEKQ SF+G  MEKQQSFRN   E+QKSF+G+MEKQKSFRIAMERQLSFGGERKRGK+SP
Sbjct  1     MEKQVSFQGPTMEKQQSFRNGATEQQKSFRGIMEKQKSFRIAMERQLSFGGERKRGKESP  60

Query  1064  GKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVG  1243
             GKRGD+ LHLAAR GNL KV+EI+ +FD K IKD L KQNQEGETALYVAAENGH+LVV 
Sbjct  61    GKRGDSILHLAARGGNLGKVKEIVDKFDEKGIKDLLCKQNQEGETALYVAAENGHSLVVA  120

Query  1244  EILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAA  1423
             E LK LDLE ASI +NNGYD  H+AA+QGHL+VL+ELL+ FPNLVMTTDSSNSTALHTAA
Sbjct  121   EFLKHLDLEIASIVANNGYDTLHVAARQGHLDVLEELLHSFPNLVMTTDSSNSTALHTAA  180

Query  1424  GQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKG  1603
              QGH+ VV++LLEIDSNL KIARNNGKTVLHTAARMGHLE+V+SL++KDP IGFRTDKKG
Sbjct  181   AQGHIHVVNMLLEIDSNLVKIARNNGKTVLHTAARMGHLEIVRSLLSKDPDIGFRTDKKG  240

Query  1604  QTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGIN  1783
             QTALHMA KGQN DIVLELIKP+P+VLAL DNKGN  LHIATRKGR QMVQ LISIEGI+
Sbjct  241   QTALHMAAKGQNGDIVLELIKPNPAVLALEDNKGNRVLHIATRKGRVQMVQCLISIEGID  300

Query  1784  INTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVE  1963
             ++ +NKAGET LDIAEKFGTP++V++L EAGATHSKDHGKPP AAKQLKQTVSDIKHDV 
Sbjct  301   LSAINKAGETVLDIAEKFGTPELVSILIEAGATHSKDHGKPPPAAKQLKQTVSDIKHDVH  360

Query  1964  SQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEK  2143
             SQLQQSRQTGF+VRKIA KVKKLHISGLNNAIN+ TVVAVLIATVAFAAIFTVPGQYVE+
Sbjct  361   SQLQQSRQTGFRVRKIALKVKKLHISGLNNAINNATVVAVLIATVAFAAIFTVPGQYVEE  420

Query  2144  EKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKL  2323
             +  GF+LGEANV  KAAFI+FFLFDS+ALFIS+AVVVVQTSVVVIEQKAKK+++F INKL
Sbjct  421   KTDGFSLGEANVGRKAAFIIFFLFDSMALFISVAVVVVQTSVVVIEQKAKKRLMFWINKL  480

Query  2324  MWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRM  2503
             MW ACLFISIAFISL+YVVVG++E+WLA+Y+TV+G +IMLTTIGSMCYCVV+HRLEESR+
Sbjct  481   MWAACLFISIAFISLSYVVVGSKERWLAVYATVIGSIIMLTTIGSMCYCVVQHRLEESRL  540

Query  2504  RNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             R+IR+ ET SRSF +S V SD+EL +E+YKRMYAV
Sbjct  541   RSIRRDETHSRSFPLS-VASDTELCSENYKRMYAV  574



>ref|XP_009624817.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X2 [Nicotiana tomentosiformis]
Length=574

 Score =   868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/576 (80%), Positives = 521/576 (90%), Gaps = 6/576 (1%)
 Frame = +2

Query  890   IMEKQASFRG-VMEKQQSFRN--MEKQKSFKGLMEKQKSFRIAMERQLSFGGERKRGKDS  1060
             +MEKQ SF+G  MEKQQSFRN   EKQKSF+G+MEKQKSFRI+MERQLSFGGERKRGK+S
Sbjct  2     VMEKQVSFQGPTMEKQQSFRNGTTEKQKSFRGIMEKQKSFRISMERQLSFGGERKRGKES  61

Query  1061  PGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVV  1240
             PGKRGD+ LHLAAR GNL KV+EI+ +FD K IKD L KQNQEGETALYVAAENGH+ VV
Sbjct  62    PGKRGDSILHLAARGGNLGKVKEIVDKFDEKGIKDFLCKQNQEGETALYVAAENGHSFVV  121

Query  1241  GEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTA  1420
              E LK LDL+TASI +NNGYD  H+AA+QGHL+VL+ELL  FPNLVMTTDSSNSTALHTA
Sbjct  122   AEFLKHLDLQTASIVANNGYDTLHVAARQGHLDVLEELLRSFPNLVMTTDSSNSTALHTA  181

Query  1421  AGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKK  1600
             A QGH+ VV++LLEIDSNLAKIARNNGKTVLHTAARMGHLE+V+SL++KDP IGFRTDKK
Sbjct  182   AAQGHIHVVNMLLEIDSNLAKIARNNGKTVLHTAARMGHLEIVRSLLSKDPDIGFRTDKK  241

Query  1601  GQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGI  1780
             GQTALHMA KGQN  IVLELIKP+P+VLAL DNKGN ALHIATRKGR  MVQ L+SIEGI
Sbjct  242   GQTALHMAAKGQNAGIVLELIKPNPAVLALEDNKGNRALHIATRKGR--MVQCLMSIEGI  299

Query  1781  NINTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDV  1960
             ++N +NKAGE  LDIAEKFGTP++V++LKEAGATHSKD GKPP AAKQLKQTVSDIKHDV
Sbjct  300   DLNAINKAGEAVLDIAEKFGTPELVSILKEAGATHSKDQGKPPGAAKQLKQTVSDIKHDV  359

Query  1961  ESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVE  2140
              SQLQQSRQTGF+VRKIA KVKKLHISGLNNAIN+ TVVAVLIATVAFAAIFTVPGQYVE
Sbjct  360   HSQLQQSRQTGFRVRKIALKVKKLHISGLNNAINNATVVAVLIATVAFAAIFTVPGQYVE  419

Query  2141  KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINK  2320
             ++  GF+LGEANV  KAAFI+FFLFDS+ALFIS+AVVVVQTSVVVIEQKAKK+++F INK
Sbjct  420   EKTDGFSLGEANVGRKAAFIIFFLFDSMALFISVAVVVVQTSVVVIEQKAKKRLMFWINK  479

Query  2321  LMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESR  2500
             LMW ACLFISIAFISL+YVVVG++E+WLA+Y+TV+G +IMLTTIGSMCYCVV+HRLEESR
Sbjct  480   LMWAACLFISIAFISLSYVVVGSKERWLAVYATVIGSIIMLTTIGSMCYCVVQHRLEESR  539

Query  2501  MRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             +R+IR+ ET SRSF +S V SD+EL +E+YKRMYAV
Sbjct  540   LRSIRRDETHSRSFPLS-VASDTELCSENYKRMYAV  574



>ref|XP_009800728.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X2 [Nicotiana sylvestris]
Length=572

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/575 (80%), Positives = 521/575 (91%), Gaps = 6/575 (1%)
 Frame = +2

Query  893   MEKQASFRG-VMEKQQSFRN--MEKQKSFKGLMEKQKSFRIAMERQLSFGGERKRGKDSP  1063
             MEKQ SF+G  MEKQQSFRN   E+QKSF+G+MEKQKSFRIAMERQLSFGGERKRGK+SP
Sbjct  1     MEKQVSFQGPTMEKQQSFRNGATEQQKSFRGIMEKQKSFRIAMERQLSFGGERKRGKESP  60

Query  1064  GKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVG  1243
             GKRGD+ LHLAAR GNL KV+EI+ +FD K IKD L KQNQEGETALYVAAENGH+LVV 
Sbjct  61    GKRGDSILHLAARGGNLGKVKEIVDKFDEKGIKDLLCKQNQEGETALYVAAENGHSLVVA  120

Query  1244  EILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAA  1423
             E LK LDLE ASI +NNGYD  H+AA+QGHL+VL+ELL+ FPNLVMTTDSSNSTALHTAA
Sbjct  121   EFLKHLDLEIASIVANNGYDTLHVAARQGHLDVLEELLHSFPNLVMTTDSSNSTALHTAA  180

Query  1424  GQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKG  1603
              QGH+ VV++LLEIDSNL KIARNNGKTVLHTAARMGHLE+V+SL++KDP IGFRTDKKG
Sbjct  181   AQGHIHVVNMLLEIDSNLVKIARNNGKTVLHTAARMGHLEIVRSLLSKDPDIGFRTDKKG  240

Query  1604  QTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGIN  1783
             QTALHMA KGQN DIVLELIKP+P+VLAL DNKGN  LHIATRKGR  MVQ LISIEGI+
Sbjct  241   QTALHMAAKGQNGDIVLELIKPNPAVLALEDNKGNRVLHIATRKGR--MVQCLISIEGID  298

Query  1784  INTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVE  1963
             ++ +NKAGET LDIAEKFGTP++V++L EAGATHSKDHGKPP AAKQLKQTVSDIKHDV 
Sbjct  299   LSAINKAGETVLDIAEKFGTPELVSILIEAGATHSKDHGKPPPAAKQLKQTVSDIKHDVH  358

Query  1964  SQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEK  2143
             SQLQQSRQTGF+VRKIA KVKKLHISGLNNAIN+ TVVAVLIATVAFAAIFTVPGQYVE+
Sbjct  359   SQLQQSRQTGFRVRKIALKVKKLHISGLNNAINNATVVAVLIATVAFAAIFTVPGQYVEE  418

Query  2144  EKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKL  2323
             +  GF+LGEANV  KAAFI+FFLFDS+ALFIS+AVVVVQTSVVVIEQKAKK+++F INKL
Sbjct  419   KTDGFSLGEANVGRKAAFIIFFLFDSMALFISVAVVVVQTSVVVIEQKAKKRLMFWINKL  478

Query  2324  MWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRM  2503
             MW ACLFISIAFISL+YVVVG++E+WLA+Y+TV+G +IMLTTIGSMCYCVV+HRLEESR+
Sbjct  479   MWAACLFISIAFISLSYVVVGSKERWLAVYATVIGSIIMLTTIGSMCYCVVQHRLEESRL  538

Query  2504  RNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             R+IR+ ET SRSF +S V SD+EL +E+YKRMYAV
Sbjct  539   RSIRRDETHSRSFPLS-VASDTELCSENYKRMYAV  572



>ref|XP_006351067.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Solanum 
tuberosum]
Length=562

 Score =   850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/563 (80%), Positives = 511/563 (91%), Gaps = 2/563 (0%)
 Frame = +2

Query  923   MEKQQSFRNMEKQKSFKGLMEKQKSFRIAMERQLSFGGERKRGKDSPGKRGDNPLHLAAR  1102
             MEK+ SF++ + +K   G+MEKQKSFRI MERQ+SF  E+KR K+SPGKRGD PLHLAAR
Sbjct  1     MEKEVSFQSEKMEKQQNGVMEKQKSFRIVMERQVSFSIEKKRDKESPGKRGDAPLHLAAR  60

Query  1103  AGNLSKVREILQRFD-SKAIKDTLSKQNQEGETALYVAAENGHTLVVGEILKQLDLETAS  1279
             AGNL KV+EI+Q+FD SK +K+ LS QNQ+GETALY+AAENGHTLVV EILK LDL+ AS
Sbjct  61    AGNLGKVKEIIQKFDNSKGVKELLSLQNQQGETALYIAAENGHTLVVVEILKHLDLQVAS  120

Query  1280  IASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLL  1459
             + +NNGYDAFH+AAKQGHLEVLKELL+ FPNLVM TDSSNSTALHTAA QGHVDVV+LLL
Sbjct  121   LVANNGYDAFHVAAKQGHLEVLKELLHSFPNLVMATDSSNSTALHTAAAQGHVDVVNLLL  180

Query  1460  EIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQN  1639
             EIDSNLAKIARNNGKTVLHTAARMGHLE+VKSL++KDP IGFRTD KGQ+ALHMAVKGQN
Sbjct  181   EIDSNLAKIARNNGKTVLHTAARMGHLEIVKSLLSKDPEIGFRTDSKGQSALHMAVKGQN  240

Query  1640  VDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGININTVNKAGETAL  1819
             V IVLELIKP+PSVLAL DNK N ALHIAT+KGRPQMVQ LISIE I++N +NKAGETAL
Sbjct  241   VGIVLELIKPNPSVLALEDNKANRALHIATKKGRPQMVQCLISIECIDLNAINKAGETAL  300

Query  1820  DIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQLQQSRQTGFk  1999
             DIAEKFG P+VV++LK AGA HSKDHGKPP+  KQLKQTVSDI+HDV+SQLQQSRQTGFK
Sbjct  301   DIAEKFGMPEVVSILKVAGAAHSKDHGKPPNNTKQLKQTVSDIRHDVQSQLQQSRQTGFK  360

Query  2000  vrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKEKKGFTLGEANV  2179
             VRKIAKKVKKLHISGLNNAIN+ TVVAVLIATVAFAAIFTVPGQYVE++K GF+LGEANV
Sbjct  361   VRKIAKKVKKLHISGLNNAINNATVVAVLIATVAFAAIFTVPGQYVEQKKDGFSLGEANV  420

Query  2180  ANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAF  2359
             A+KAAFI+FFLFDS+ALFISIAVVVVQTS+VVIE +AKK +VF IN+LMW ACLFIS++F
Sbjct  421   ADKAAFIIFFLFDSMALFISIAVVVVQTSLVVIEPRAKKLLVFWINRLMWAACLFISVSF  480

Query  2360  ISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRS  2539
             ISL YVVVG++E+WLAI++TV+G  IM+TTIGSMCYCVVRHRLEES+MRNIR+A T S S
Sbjct  481   ISLAYVVVGSKERWLAIFATVIGSTIMITTIGSMCYCVVRHRLEESKMRNIRRAGTHSHS  540

Query  2540  FSMSMVPSDSELYNESYKRMYAV  2608
             ++MS V SD+ELY ESYKRMYAV
Sbjct  541   YAMS-VASDTELYGESYKRMYAV  562



>gb|EYU36659.1| hypothetical protein MIMGU_mgv1a003600mg [Erythranthe guttata]
Length=575

 Score =   844 bits (2180),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/577 (78%), Positives = 515/577 (89%), Gaps = 7/577 (1%)
 Frame = +2

Query  893   MEKQASFRG-VMEKQQSFRN--MEKQKSFKGLMEKQKSFRIAMERQLSFGG-ERKRGKDS  1060
             MEKQ SFR   +EKQQSFRN  +EKQKSF+GLMEKQKSFRIA+ERQL+FGG +RK+ KDS
Sbjct  1     MEKQYSFRNPTIEKQQSFRNGGIEKQKSFRGLMEKQKSFRIALERQLTFGGGDRKKSKDS  60

Query  1061  PGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVV  1240
             PGKRGD+PLHLAARAGNL K +EI+Q+ ++ AI D LSKQNQEGET LY AAENGHTLVV
Sbjct  61    PGKRGDSPLHLAARAGNLGKAKEIIQKIENGAI-DLLSKQNQEGETPLYAAAENGHTLVV  119

Query  1241  GEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTA  1420
              E LK  D+ET SI +NNG+D FH+AAKQGHL+VLKELL  FP+LVMTTD++NSTALHTA
Sbjct  120   EEFLKHSDVETCSIPANNGFDPFHVAAKQGHLDVLKELLRFFPSLVMTTDTANSTALHTA  179

Query  1421  AGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKK  1600
             A QGHVDVV+LLLE DSNLAKIARNNGKTVLHTAARMGHLEVVKSL+  D SIGF+TD+K
Sbjct  180   AAQGHVDVVNLLLETDSNLAKIARNNGKTVLHTAARMGHLEVVKSLLENDSSIGFKTDRK  239

Query  1601  GQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGI  1780
             GQTALHMAVKGQN +IV ELIKPDPS+L+ GDNKGNT+LHIATRKGR Q+VQ LIS EGI
Sbjct  240   GQTALHMAVKGQNAEIVKELIKPDPSLLSFGDNKGNTSLHIATRKGRIQIVQCLISTEGI  299

Query  1781  NINTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDV  1960
             ++NT N AGET LD+A+KFGTP++V  LKE GATHSKD GKP +AAKQLKQTVSDIKHDV
Sbjct  300   DVNTPNSAGETPLDLADKFGTPELVATLKEVGATHSKDFGKPQNAAKQLKQTVSDIKHDV  359

Query  1961  ESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVE  2140
             +SQLQQ+RQTGF+VRKIAKKVKKLHI GLNNAINS TVVAVLIATVAFAAIFTVPGQYVE
Sbjct  360   QSQLQQTRQTGFRVRKIAKKVKKLHIEGLNNAINSATVVAVLIATVAFAAIFTVPGQYVE  419

Query  2141  KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINK  2320
             ++  GF+LGEA++AN AAFI+F LFDS+ALFIS+AVVVVQTS+VVIEQKAK+Q++F+INK
Sbjct  420   EKTNGFSLGEAHIANNAAFIIFILFDSVALFISLAVVVVQTSLVVIEQKAKQQLMFVINK  479

Query  2321  LMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESR  2500
             LMW ACLFISIAFISLTY+VVG  E+WLAIY+TV+GGVIM TTIGSMCYCVVRHR+E+SR
Sbjct  480   LMWCACLFISIAFISLTYIVVGVHERWLAIYATVIGGVIMTTTIGSMCYCVVRHRMEDSR  539

Query  2501  MRNIRKAETLSR-SFSMSMVPSDSELYNESYKRMYAV  2608
             MRNIR+  T  R SFS+S V SDSE+Y+E YKRMYAV
Sbjct  540   MRNIRRGGTRERSSFSLS-VASDSEMYSERYKRMYAV  575



>ref|XP_004244774.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Solanum 
lycopersicum]
Length=562

 Score =   840 bits (2169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/563 (79%), Positives = 508/563 (90%), Gaps = 2/563 (0%)
 Frame = +2

Query  923   MEKQQSFRNMEKQKSFKGLMEKQKSFRIAMERQLSFGGERKRGKDSPGKRGDNPLHLAAR  1102
             MEK  SF++ + +K   G+MEKQKSFRI MERQ+SF  E+KR K+SPGKRGD+PLHLAAR
Sbjct  1     MEKGVSFQSEKMEKQQNGVMEKQKSFRIVMERQVSFSIEKKRDKESPGKRGDSPLHLAAR  60

Query  1103  AGNLSKVREILQRFD-SKAIKDTLSKQNQEGETALYVAAENGHTLVVGEILKQLDLETAS  1279
             AGNL KV+EI+Q+FD SK IK+ LS QNQ+GETALY+AAENGHTLVV EILK LDL+ AS
Sbjct  61    AGNLGKVKEIIQKFDNSKGIKELLSLQNQQGETALYIAAENGHTLVVVEILKHLDLQVAS  120

Query  1280  IASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLL  1459
             + +NNGYDAF +AAKQGHLEVLKELL+ FPNLVM TDSSNSTALHTAA QGHVDVV+LLL
Sbjct  121   LVANNGYDAFQVAAKQGHLEVLKELLHSFPNLVMATDSSNSTALHTAAAQGHVDVVNLLL  180

Query  1460  EIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQN  1639
             EIDSNL KIARNNGKTVLHTAARMGHLE+VKSL++KDP IGFRTD KGQ+ALHMAVKGQN
Sbjct  181   EIDSNLVKIARNNGKTVLHTAARMGHLEIVKSLLSKDPDIGFRTDSKGQSALHMAVKGQN  240

Query  1640  VDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGININTVNKAGETAL  1819
             V IVLELIKP+ SVL L DNKGN ALHIAT+KGRPQMVQ LISIE I++N +NKAGETAL
Sbjct  241   VGIVLELIKPNSSVLTLEDNKGNRALHIATKKGRPQMVQCLISIECIDLNAINKAGETAL  300

Query  1820  DIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQLQQSRQTGFk  1999
             DIAEKFG P+VV++LK AGA HSKDHGKPP+  KQLKQTVSDI+HDV+SQLQQSRQTGFK
Sbjct  301   DIAEKFGMPEVVSILKLAGAVHSKDHGKPPNNTKQLKQTVSDIRHDVQSQLQQSRQTGFK  360

Query  2000  vrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKEKKGFTLGEANV  2179
             VRKIAKKVKKLHISGLNNAIN+ TVVAVLIATVAFAAIFTVPGQYVEK+K GF+LGEANV
Sbjct  361   VRKIAKKVKKLHISGLNNAINNATVVAVLIATVAFAAIFTVPGQYVEKKKDGFSLGEANV  420

Query  2180  ANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAF  2359
             A+KAAFI+FFLFDS+ALFISIAVVVVQTS+VVIE +AKK +VF IN+LMW ACLFIS++F
Sbjct  421   ADKAAFIIFFLFDSMALFISIAVVVVQTSLVVIEPRAKKLLVFWINRLMWAACLFISVSF  480

Query  2360  ISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRS  2539
             ISL YVVVG++E+WLAI++TV+G  IM+TTIGSMCYCVVRHRLEES+MR+IR+A T S S
Sbjct  481   ISLAYVVVGSKERWLAIFATVIGSTIMITTIGSMCYCVVRHRLEESKMRSIRRAGTHSHS  540

Query  2540  FSMSMVPSDSELYNESYKRMYAV  2608
             +++S V SD+ELY ESYKRMYAV
Sbjct  541   YAIS-VASDTELYGESYKRMYAV  562



>ref|XP_002279889.3| PREDICTED: ankyrin repeat-containing protein At5g02620 [Vitis 
vinifera]
 ref|XP_010650744.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Vitis 
vinifera]
Length=597

 Score =   840 bits (2171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/576 (77%), Positives = 513/576 (89%), Gaps = 4/576 (1%)
 Frame = +2

Query  890   IMEKQASFRGVMEKQQSFRN-MEKQKSFKGLMEKQKSFRIAMERQLSFGG--ERKRGKDS  1060
             +MEKQ SFRGVMEKQQSFR  MEKQKSF+G MEKQKSFRIAMERQLSFGG  ERK+ K+S
Sbjct  23    VMEKQQSFRGVMEKQQSFRGLMEKQKSFRGFMEKQKSFRIAMERQLSFGGSSERKKVKES  82

Query  1061  PGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVV  1240
             PGKRGD+ LHLAARAGNL++V+EI+++ +S  ++  LSKQNQEGET LYVA+ENGH LVV
Sbjct  83    PGKRGDSHLHLAARAGNLTRVKEIIEKCESSELQALLSKQNQEGETPLYVASENGHALVV  142

Query  1241  GEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTA  1420
              E+L+ +DL+TASI +NNGYD FH+A KQGHLEVLKELL  FPNLVMTTDSSNSTALHTA
Sbjct  143   SELLEHVDLQTASIKANNGYDPFHVATKQGHLEVLKELLRFFPNLVMTTDSSNSTALHTA  202

Query  1421  AGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKK  1600
             A QGH+DVV LLLE D NLAKIARNNGKTVLH+AARMGHLEV+K+LV+KDPSI FRTDKK
Sbjct  203   AAQGHIDVVHLLLETDPNLAKIARNNGKTVLHSAARMGHLEVLKALVSKDPSIVFRTDKK  262

Query  1601  GQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGI  1780
             GQTALHMAVKGQNV+IV  L+KPDPSV++L DNKGNTALHIATRKGR Q VQ L+S+EGI
Sbjct  263   GQTALHMAVKGQNVEIVHALLKPDPSVMSLEDNKGNTALHIATRKGRSQFVQCLLSVEGI  322

Query  1781  NINTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDV  1960
              +N  NKAGET LDIAEKFGT ++ ++L+EAGAT+S DHGKPP+AAKQLKQTVSDIKHDV
Sbjct  323   KMNATNKAGETPLDIAEKFGTQEIASILREAGATNSADHGKPPNAAKQLKQTVSDIKHDV  382

Query  1961  ESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVE  2140
             +SQLQQ+RQTG +V+ IAK++KKLHISGLNNAINS TVVAVLIATVAFAAIFTVPGQYVE
Sbjct  383   QSQLQQTRQTGVRVQHIAKRLKKLHISGLNNAINSATVVAVLIATVAFAAIFTVPGQYVE  442

Query  2141  KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINK  2320
                KG +LG+A++A  AAF++FF+FDSLALFIS+AVVVVQTSVVVIEQKAKKQ+VF+INK
Sbjct  443   VPTKGASLGQAHIARTAAFLIFFVFDSLALFISLAVVVVQTSVVVIEQKAKKQLVFVINK  502

Query  2321  LMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESR  2500
             LMW ACLFISIAFISLTYVVVG+  +WLA+ +TV+G VIMLTTIG+MCYCV+ +R+ E++
Sbjct  503   LMWMACLFISIAFISLTYVVVGSHARWLAVCATVIGSVIMLTTIGAMCYCVIVNRIAEAK  562

Query  2501  MRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
              RNIRKAE+ SRSFS+SM  S+SEL N  Y+RMYA+
Sbjct  563   KRNIRKAESRSRSFSVSMA-SESELLNSEYRRMYAL  597



>ref|XP_006493139.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Citrus 
sinensis]
Length=630

 Score =   832 bits (2150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/598 (75%), Positives = 510/598 (85%), Gaps = 26/598 (4%)
 Frame = +2

Query  890   IMEKQASF-----------RGVMEKQQSFRN------------MEKQKSFKGLMEKQKSF  1000
             +MEKQ SF           RG MEKQQSF              MEKQKSF+G +EKQKSF
Sbjct  34    VMEKQQSFNGVSTDKPPSARGAMEKQQSFHGVTIDKQPSTRGVMEKQKSFRGFIEKQKSF  93

Query  1001  RIAMERQLSF--GGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLS  1174
             R+ MERQLSF  GGERKR KDSPGKRGD  LHLAARAGNLS+V EILQ  D+   KD LS
Sbjct  94    RVVMERQLSFIGGGERKRNKDSPGKRGDLQLHLAARAGNLSRVMEILQSCDANEAKDLLS  153

Query  1175  KQNQEGETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKEL  1354
             KQNQEGET LYVAAE+GH L+V E+L+ ++LETASI + NGYD+FH+AAKQGHLEVLKEL
Sbjct  154   KQNQEGETPLYVAAESGHALIVEEMLQHMNLETASIPARNGYDSFHVAAKQGHLEVLKEL  213

Query  1355  LNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMG  1534
             L  FPNLVMTTD S STALHTAA QGH+DVV+ LLEIDSNLAKIARNNGKTVLH+AARMG
Sbjct  214   LGEFPNLVMTTDLSCSTALHTAAAQGHIDVVNFLLEIDSNLAKIARNNGKTVLHSAARMG  273

Query  1535  HLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTA  1714
             HLEVVK+LV+KDPS GFRTDKKGQTALHMAVKGQN DIVLELI+PDPSVL L DNKG+TA
Sbjct  274   HLEVVKALVSKDPSTGFRTDKKGQTALHMAVKGQNEDIVLELIRPDPSVLKLEDNKGHTA  333

Query  1715  LHIATRKGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKD  1894
             LHIA +KGR Q+V+ L+SIEGI++N++NKAGE+ LD+AEK G  ++ ++LKEAGA HSKD
Sbjct  334   LHIAIKKGRTQIVRCLLSIEGIDVNSLNKAGESPLDVAEKLGNTELFSLLKEAGAAHSKD  393

Query  1895  HGKPPSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltv  2074
             HGKPPSA KQLKQTVSDIKHDV+SQLQQSRQTGFKV KIAKK+KKLHISGLNNAINS TV
Sbjct  394   HGKPPSATKQLKQTVSDIKHDVQSQLQQSRQTGFKVHKIAKKLKKLHISGLNNAINSSTV  453

Query  2075  vavliatvafaaiftvPGQYVEKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvv  2254
             VAVLIATVAFAAIFTVPGQYVE++ +GF+LG+A++A  AAFI+FF+FDSLALFIS+AVVV
Sbjct  454   VAVLIATVAFAAIFTVPGQYVEEKTEGFSLGQAHIAKNAAFIIFFVFDSLALFISLAVVV  513

Query  2255  vqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGV  2434
             VQTSVVVIE+KAK+Q+VF+INKLMW ACLFISIAFISLTYVVVG   +WLA+ +TV+GG 
Sbjct  514   VQTSVVVIEEKAKRQLVFVINKLMWLACLFISIAFISLTYVVVGEHSRWLAVSATVIGGT  573

Query  2435  IMLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             IMLTTIGSMCYCV+ HR+E  ++RNIRKAE+ SRSFSMS V SD E+ N  YKRMYA+
Sbjct  574   IMLTTIGSMCYCVILHRMEAKKLRNIRKAESRSRSFSMS-VASDQEILNSEYKRMYAL  630



>ref|XP_006442042.1| hypothetical protein CICLE_v10019293mg [Citrus clementina]
 gb|ESR55282.1| hypothetical protein CICLE_v10019293mg [Citrus clementina]
Length=630

 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/576 (77%), Positives = 507/576 (88%), Gaps = 5/576 (1%)
 Frame = +2

Query  893   MEKQASFRGV-MEKQQSFRN-MEKQKSFKGLMEKQKSFRIAMERQLSF--GGERKRGKDS  1060
             MEKQ SF GV ++KQ S R  MEKQKSF+G +EKQKSFR+ MERQLSF  GGERK+ KDS
Sbjct  56    MEKQQSFHGVTIDKQPSTRGVMEKQKSFRGFIEKQKSFRVVMERQLSFIGGGERKKNKDS  115

Query  1061  PGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVV  1240
             PGKRGD  LHLAARAGNLS+V EILQ  D+   KD LSKQNQEGET LYVAAE+GH L+V
Sbjct  116   PGKRGDLQLHLAARAGNLSRVMEILQSCDANEAKDLLSKQNQEGETPLYVAAESGHALIV  175

Query  1241  GEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTA  1420
              E+L+ +DLETASI + NGYD+FH+AAKQGHLEVLKELL  FPNLVMTTD S STALHTA
Sbjct  176   EEMLQHMDLETASIPARNGYDSFHVAAKQGHLEVLKELLGEFPNLVMTTDLSCSTALHTA  235

Query  1421  AGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKK  1600
             A QGH+DVV+ LLEIDSNLAKIARNNGKTVLH+AARMGHLEVVK+LV+KDPS GFRTDKK
Sbjct  236   AAQGHIDVVNFLLEIDSNLAKIARNNGKTVLHSAARMGHLEVVKALVSKDPSTGFRTDKK  295

Query  1601  GQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGI  1780
             GQTALHMAVKGQN DIVLELIKPDPSVL L DNKGNTAL IA +KGR Q+V+ L+SIEGI
Sbjct  296   GQTALHMAVKGQNEDIVLELIKPDPSVLKLEDNKGNTALLIAIKKGRTQIVRCLLSIEGI  355

Query  1781  NINTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDV  1960
             ++N++NKAGE+ LDIAEK G  ++ ++LKEAGA HSKDHGKPPSA KQLKQTVSDIKHDV
Sbjct  356   DVNSLNKAGESPLDIAEKLGNTELFSLLKEAGAAHSKDHGKPPSATKQLKQTVSDIKHDV  415

Query  1961  ESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVE  2140
             +SQLQQSRQTGFKV KIAKK+KKLHISGLNNAINS TVVAVLIATVAFAAIFTVPGQYVE
Sbjct  416   QSQLQQSRQTGFKVHKIAKKLKKLHISGLNNAINSSTVVAVLIATVAFAAIFTVPGQYVE  475

Query  2141  KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINK  2320
             ++ +GF+LG+A++A  AAFI+FF+FDSLALFIS+AVVVVQTSVVVIE+KAK+Q+VF+INK
Sbjct  476   EKTEGFSLGQAHIAKNAAFIIFFVFDSLALFISLAVVVVQTSVVVIEEKAKRQLVFVINK  535

Query  2321  LMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESR  2500
             LMW ACLFISIAFISLTYVVVG   +WLA+ +TV+GG IMLTTIGSMCYCV+ HR+E  +
Sbjct  536   LMWLACLFISIAFISLTYVVVGEHSRWLAVSATVIGGTIMLTTIGSMCYCVILHRMEAKK  595

Query  2501  MRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             +RNIRKAE+ SRSFSMS V SD E+ N  YKRMYA+
Sbjct  596   LRNIRKAESRSRSFSMS-VASDQEILNSEYKRMYAL  630



>gb|KDO51600.1| hypothetical protein CISIN_1g006802mg [Citrus sinensis]
Length=630

 Score =   830 bits (2145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/576 (77%), Positives = 508/576 (88%), Gaps = 5/576 (1%)
 Frame = +2

Query  893   MEKQASFRGV-MEKQQSFRN-MEKQKSFKGLMEKQKSFRIAMERQLSF--GGERKRGKDS  1060
             MEKQ SF GV ++KQ S R  MEKQKSF+G +EKQKSFR+ MERQLSF  GGERK+ KDS
Sbjct  56    MEKQQSFHGVTIDKQPSTRGVMEKQKSFRGFIEKQKSFRVVMERQLSFIGGGERKKNKDS  115

Query  1061  PGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVV  1240
             PGKRGD  LHLAARAGNLS+V EILQ  D+   KD LSK+NQEGET LYVAAE+GH L+V
Sbjct  116   PGKRGDLQLHLAARAGNLSRVMEILQSCDANEAKDLLSKKNQEGETPLYVAAESGHALIV  175

Query  1241  GEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTA  1420
              E+L+ ++LETASI + NGYD+FH+AAKQGHLEVLKELL  FPNLVMTTD S STALHTA
Sbjct  176   EEMLQHMNLETASIPARNGYDSFHVAAKQGHLEVLKELLGEFPNLVMTTDLSCSTALHTA  235

Query  1421  AGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKK  1600
             A QGH+DVV+ LLEIDSNLAKIARNNGKTVLH+AARMGHLEVVK+LV+KDPS GFRTDKK
Sbjct  236   AAQGHIDVVNFLLEIDSNLAKIARNNGKTVLHSAARMGHLEVVKALVSKDPSTGFRTDKK  295

Query  1601  GQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGI  1780
             GQTALHMAVKGQN DIVLELI+PDPSVL L DNKGNTALHIA +KGR Q+V+ L+SIEGI
Sbjct  296   GQTALHMAVKGQNEDIVLELIRPDPSVLKLEDNKGNTALHIAIKKGRTQIVRCLLSIEGI  355

Query  1781  NINTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDV  1960
             ++N++NKAGE+ LD+AEK G  ++ ++LKEAGA HSKDHGKPPSA KQLKQTVSDIKHDV
Sbjct  356   DVNSLNKAGESPLDVAEKLGNTELFSLLKEAGAAHSKDHGKPPSATKQLKQTVSDIKHDV  415

Query  1961  ESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVE  2140
             +SQLQQSRQTGFKV KIAKK+KKLHISGLNNAINS TVVAVLIATVAFAAIFTVPGQYVE
Sbjct  416   QSQLQQSRQTGFKVHKIAKKLKKLHISGLNNAINSSTVVAVLIATVAFAAIFTVPGQYVE  475

Query  2141  KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINK  2320
             ++ +GF+LG+A++A  AAFI+FF+FDSLALFIS+AVVVVQTSVVVIE+KAK+Q+VF+INK
Sbjct  476   EKTEGFSLGQAHIAKNAAFIIFFVFDSLALFISLAVVVVQTSVVVIEEKAKRQLVFVINK  535

Query  2321  LMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESR  2500
             LMW ACLFISIAFISLTYVVVG   +WLA+ +TV+GG IMLTTIGSMCYCV+ HR+E  +
Sbjct  536   LMWLACLFISIAFISLTYVVVGEHSRWLAVSATVIGGTIMLTTIGSMCYCVILHRMEAKK  595

Query  2501  MRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             +RNIRKAE+ SRSFSMS V SD E+ N  YKRMYA+
Sbjct  596   LRNIRKAESRSRSFSMS-VASDQEILNSEYKRMYAL  630



>ref|XP_009781472.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X1 [Nicotiana sylvestris]
Length=553

 Score =   822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/562 (78%), Positives = 498/562 (89%), Gaps = 9/562 (2%)
 Frame = +2

Query  923   MEKQQSFRNMEKQKSFKGLMEKQKSFRIAMERQLSFGGERKRGKDSPGKRGDNPLHLAAR  1102
             MEKQQSFRN        G++E QKS RI M+RQ+SF  E+KR K+SPGKRGD+P HLAAR
Sbjct  1     MEKQQSFRN--------GVIENQKSIRIVMDRQVSFDVEKKRDKESPGKRGDSPFHLAAR  52

Query  1103  AGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGEILKQLDLETASI  1282
              GNL KV+E++++FD K IK  LS QNQ+GETALYVAAENGHTLVV E+LK LDL+ AS+
Sbjct  53    VGNLGKVKELIEKFDGKGIKSLLSLQNQQGETALYVAAENGHTLVVAEMLKHLDLQIASL  112

Query  1283  ASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLE  1462
              +NNGYDAF +AAKQGHLEVLKELL++FPNL+M TDSSNSTALHTAA QGH DVV+LLLE
Sbjct  113   VANNGYDAFQVAAKQGHLEVLKELLHLFPNLIMATDSSNSTALHTAAAQGHTDVVNLLLE  172

Query  1463  IDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNV  1642
             IDSNLAKIARNNGKTVLHTAARMG LE+VKSL++KDP IG RTD KGQ+ALHMAVKGQNV
Sbjct  173   IDSNLAKIARNNGKTVLHTAARMGRLEIVKSLLSKDPEIGLRTDSKGQSALHMAVKGQNV  232

Query  1643  DIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGININTVNKAGETALD  1822
             DIV ELIKP+P+VLAL DNKGN ALHIAT+KGR QMVQ LIS E I++N  NKAGETALD
Sbjct  233   DIVHELIKPNPAVLALEDNKGNRALHIATKKGRAQMVQCLISSECIDLNATNKAGETALD  292

Query  1823  IAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQLQQSRQTGFkv  2002
             IAEKFG P++V++LK AGATHSKDHGKPPS AKQLKQTVSDI+HDV+SQLQQSRQTGFKV
Sbjct  293   IAEKFGMPELVSILKVAGATHSKDHGKPPSNAKQLKQTVSDIRHDVQSQLQQSRQTGFKV  352

Query  2003  rkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKEKKGFTLGEANVA  2182
             RKIAKKVKKLHISGLNNAIN+ TVVAVLIATVAFAAIFTVPGQYVE++  GF+LGEA+VA
Sbjct  353   RKIAKKVKKLHISGLNNAINNATVVAVLIATVAFAAIFTVPGQYVEEKTDGFSLGEAHVA  412

Query  2183  NKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFI  2362
              KAAFI+FFLFDS+ALFISIAVVVVQTS+VVIE +AKK +VF IN+LMW ACLFIS++FI
Sbjct  413   EKAAFIIFFLFDSMALFISIAVVVVQTSLVVIEPRAKKLLVFWINRLMWAACLFISVSFI  472

Query  2363  SLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSF  2542
             SL+YVVVG++E+WLAIY+T  G +IMLTTIGSMCYCVVRHRLEES+MR+IR A T S S+
Sbjct  473   SLSYVVVGSKERWLAIYATATGSIIMLTTIGSMCYCVVRHRLEESKMRSIRSAGTHSHSY  532

Query  2543  SMSMVPSDSELYNESYKRMYAV  2608
             +MS V SD+ELY E+YKRMYAV
Sbjct  533   AMS-VASDTELYAENYKRMYAV  553



>ref|XP_007139079.1| hypothetical protein PHAVU_009G263200g [Phaseolus vulgaris]
 gb|ESW11073.1| hypothetical protein PHAVU_009G263200g [Phaseolus vulgaris]
Length=560

 Score =   819 bits (2115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/565 (76%), Positives = 501/565 (89%), Gaps = 10/565 (2%)
 Frame = +2

Query  923   MEKQQSFR--NMEKQKSFKGLMEKQKSFRIAMERQLSF-GGERKRGKDSPGKRGDNPLHL  1093
             MEKQ SFR   MEKQKSF+G MEKQKSFRIAME+QLSF G ERK+ KDSPGKRGD P+HL
Sbjct  3     MEKQSSFRASTMEKQKSFRGFMEKQKSFRIAMEKQLSFMGSERKKSKDSPGKRGDLPIHL  62

Query  1094  AARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGEILKQLDLET  1273
             AARAGNLS+V+EI+Q + +   KD L+KQN EGET LYVA+ENGH LVV EILK LDL+T
Sbjct  63    AARAGNLSRVKEIIQNYSNCETKDLLAKQNLEGETPLYVASENGHALVVSEILKYLDLQT  122

Query  1274  ASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDL  1453
             ASIA+ NGYD FHIAAKQGHLEVL+ELL+ FPNL MTTD SNSTALHTAA QGH+DVV+L
Sbjct  123   ASIAARNGYDPFHIAAKQGHLEVLRELLHSFPNLAMTTDLSNSTALHTAASQGHIDVVNL  182

Query  1454  LLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKG  1633
             LLE DSNLAKIARNNGKTVLH+AARMGHLEVV +L+NKDPS GFRTD+KGQTALHMAVKG
Sbjct  183   LLESDSNLAKIARNNGKTVLHSAARMGHLEVVNALLNKDPSTGFRTDRKGQTALHMAVKG  242

Query  1634  QNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGININTVNKAGET  1813
             QN +I+LEL+KPDP+VL L DNKGNTALHIAT+KGR Q V+RL+S+EGININ+ NKAGET
Sbjct  243   QNEEILLELVKPDPAVLHLEDNKGNTALHIATKKGRTQNVRRLLSMEGININSTNKAGET  302

Query  1814  ALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQLQQSRQTG  1993
              LD+AEKFG+P++V++L++AGA +S D GKPP+A+KQLKQTVSDIKHDV+SQLQQ+RQTG
Sbjct  303   PLDVAEKFGSPELVSILRDAGAANSTDQGKPPNASKQLKQTVSDIKHDVQSQLQQTRQTG  362

Query  1994  FkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKEKKGFTLGEA  2173
              +V+KIAKK+KKLHISGLNNAINS TVVAVLIATVAFAAIFTVPGQYVE +  GF+LG+A
Sbjct  363   MRVQKIAKKLKKLHISGLNNAINSATVVAVLIATVAFAAIFTVPGQYVENKTDGFSLGQA  422

Query  2174  NVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISI  2353
             N+AN AAF++FF+FDSLALFIS+AVVVVQTSVVVIEQKAKKQ+VF+INKLMW ACLFISI
Sbjct  423   NIANNAAFLIFFVFDSLALFISLAVVVVQTSVVVIEQKAKKQLVFVINKLMWMACLFISI  482

Query  2354  AFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRMRNIRKAETLS  2533
             AFISLTYVVVG+  +WLAIY+TV+G +IML+TIGSMCYCV+ HR+EE+++R      T S
Sbjct  483   AFISLTYVVVGSHSRWLAIYATVIGSLIMLSTIGSMCYCVILHRMEETKLR------TES  536

Query  2534  RSFSMSMVPSDSELYNESYKRMYAV  2608
             RSFSMS   SD E+ N  YKRMYA+
Sbjct  537   RSFSMSHA-SDQEILNSEYKRMYAL  560



>ref|XP_010101339.1| Ankyrin repeat-containing protein [Morus notabilis]
 gb|EXB88286.1| Ankyrin repeat-containing protein [Morus notabilis]
Length=587

 Score =   816 bits (2109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/580 (75%), Positives = 512/580 (88%), Gaps = 6/580 (1%)
 Frame = +2

Query  884   G*IMEKQASFRGV-MEKQQSF-RNMEKQKSFKGLMEKQKSFRIAMERQLSF--GGER-KR  1048
             G  MEKQ SFRGV MEKQ SF + +EKQKSF+G M+KQKSFRI ME+QLSF  GG+R K+
Sbjct  9     GAAMEKQQSFRGVVMEKQASFGKGIEKQKSFRGFMDKQKSFRIVMEKQLSFIGGGDRNKK  68

Query  1049  GKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGH  1228
              KDSPGKRGD+ +HLAARAGNL++VR+IL    SK   D LS+ NQEGET LYVAAE+GH
Sbjct  69    NKDSPGKRGDSQIHLAARAGNLARVRDILHSCSSKESVDWLSRTNQEGETPLYVAAESGH  128

Query  1229  TLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTA  1408
             +++VGE+LK +DL+TAS+ + NGYD FHIA +QGHL+VLKELL++FPNL MTTD SNSTA
Sbjct  129   SVMVGEMLKYMDLQTASLTARNGYDPFHIAVRQGHLDVLKELLHLFPNLAMTTDLSNSTA  188

Query  1409  LHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFR  1588
             LHTAA QGH+++V+LLLE DSNL KIARNNGKTVLH+AARMG+LEVVKSL+ KDPS GFR
Sbjct  189   LHTAATQGHIEIVNLLLETDSNLVKIARNNGKTVLHSAARMGYLEVVKSLLRKDPSTGFR  248

Query  1589  TDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLIS  1768
             TDKKGQTALHMAVKGQN  IVLEL+KPDP+VL+L DNKGNTALHIATRKGR + V+ L+S
Sbjct  249   TDKKGQTALHMAVKGQNEVIVLELLKPDPAVLSLEDNKGNTALHIATRKGRIENVRCLLS  308

Query  1769  IEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDI  1948
             +EG NIN +NKAGET LDIAEK GTP++V++LKEAGAT+S D GKPP+AAKQLKQTVSDI
Sbjct  309   VEGANINAINKAGETPLDIAEKIGTPELVSVLKEAGATNSTDQGKPPNAAKQLKQTVSDI  368

Query  1949  KHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPG  2128
             KHDV+SQLQQ+RQTG +V+KIAK++KKLHISGLNNAINS TVVAVLIATVAFAAIFTVPG
Sbjct  369   KHDVQSQLQQTRQTGVRVQKIAKRLKKLHISGLNNAINSATVVAVLIATVAFAAIFTVPG  428

Query  2129  QYVEKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVF  2308
             Q+VEKE  GFTLG+A++A  AAFIVFFLFDSLALFIS+AVVVVQTSVVVIEQ AK+Q+VF
Sbjct  429   QFVEKETPGFTLGQAHIAKSAAFIVFFLFDSLALFISLAVVVVQTSVVVIEQTAKRQLVF  488

Query  2309  IINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRL  2488
             +INK+MW ACLFISIAFISLTY+VVG+  +WLAI++TV+G  IMLTTIGSMCYCVV HR+
Sbjct  489   VINKVMWLACLFISIAFISLTYIVVGS-HKWLAIFTTVLGSSIMLTTIGSMCYCVVLHRM  547

Query  2489  EESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             EE++ RNIRKAE+ SRSFS+SM  SDSE+ N  YKRMYA+
Sbjct  548   EETKFRNIRKAESRSRSFSVSMAASDSEILNSEYKRMYAL  587



>emb|CDP19161.1| unnamed protein product [Coffea canephora]
Length=532

 Score =   813 bits (2099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/533 (81%), Positives = 480/533 (90%), Gaps = 1/533 (0%)
 Frame = +2

Query  1010  MERQLSFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQE  1189
             MERQLSFGGE+KR KDSPGKRGD PLHLA+RAGNL+KVR+I Q+ D   IKD LSKQNQE
Sbjct  1     MERQLSFGGEKKRSKDSPGKRGDTPLHLASRAGNLTKVRDIFQKCDGSVIKDLLSKQNQE  60

Query  1190  GETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFP  1369
             GETAL+VAAENGH  VVGE LK +D+ETASI +NNGYD FH+AAKQG LEVLKELL  FP
Sbjct  61    GETALFVAAENGHAFVVGEFLKYIDVETASIRANNGYDPFHVAAKQGQLEVLKELLRFFP  120

Query  1370  NLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVV  1549
             NL MTTDSSN+TALHTAA QGHVDVV+LLL+ID N+AKIARNNGKTVLHTAARMGHLEVV
Sbjct  121   NLNMTTDSSNTTALHTAAAQGHVDVVNLLLDIDPNIAKIARNNGKTVLHTAARMGHLEVV  180

Query  1550  KSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIAT  1729
             KSL++KDPSIGFRTDKKGQTALHMAVKGQNV+IV ELIKPD SVL+LGDNKGNTALHIAT
Sbjct  181   KSLLSKDPSIGFRTDKKGQTALHMAVKGQNVEIVQELIKPDSSVLSLGDNKGNTALHIAT  240

Query  1730  RKGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPP  1909
             RKGR QMVQ LI+ EGI IN  NKAGET LDI+EK   P++ ++LKEAGA HS+DHGKPP
Sbjct  241   RKGRTQMVQSLIASEGIEINATNKAGETPLDISEKLAMPELDSILKEAGALHSQDHGKPP  300

Query  1910  SAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavli  2089
             +AAKQLKQTVSDIKHDV+SQLQQ RQTGF+VRKIAKKVKKLHISGLNNAINS TVVAVLI
Sbjct  301   NAAKQLKQTVSDIKHDVQSQLQQCRQTGFRVRKIAKKVKKLHISGLNNAINSATVVAVLI  360

Query  2090  atvafaaiftvPGQYVEKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsv  2269
             ATVAFAAIFTVPGQYVE++  G +LG+A++A  AAF+VF L DSLALFIS+AVVVVQTS+
Sbjct  361   ATVAFAAIFTVPGQYVEEQTPGSSLGQAHIAKNAAFLVFILCDSLALFISLAVVVVQTSI  420

Query  2270  vvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTT  2449
             VVIEQ+AKKQ++F+INKLMW ACLFISIAFISLTYVVVG  EQWLA+Y+T++GG IML T
Sbjct  421   VVIEQRAKKQLMFVINKLMWTACLFISIAFISLTYVVVGRHEQWLAVYATIIGGTIMLAT  480

Query  2450  IGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             IGSMC+CVVRHRLE+S+MRNIR+AETLS SFS+SMV SD ELY E YKRMYAV
Sbjct  481   IGSMCFCVVRHRLEDSKMRNIRRAETLSGSFSVSMV-SDPELYGEKYKRMYAV  532



>ref|XP_008243064.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Prunus 
mume]
Length=587

 Score =   815 bits (2105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/577 (76%), Positives = 506/577 (88%), Gaps = 6/577 (1%)
 Frame = +2

Query  893   MEKQASFRGVMEKQQSFRN-MEKQKSFKGLMEKQKSFRIAMERQLSF-GGERKRGKDSPG  1066
             MEKQ SF G +E+Q SFR  MEKQKSF+G MEKQKSFRI ME+QLSF GGER++ K+SPG
Sbjct  12    MEKQPSFNGAIEQQPSFRGAMEKQKSFRGFMEKQKSFRIVMEKQLSFIGGERRKSKESPG  71

Query  1067  KRGDNPLHLAARAGNLSKVREILQRFD-SKAIKDTLSKQNQEGETALYVAAENGHTLVVG  1243
             KRGD+ LHLAARAGNL +V EILQ  + S      LSK NQEGET LY +A+NGH ++VG
Sbjct  72    KRGDSQLHLAARAGNLVRVIEILQNCNNSNESIGLLSKTNQEGETPLYASADNGHAVIVG  131

Query  1244  EILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAA  1423
             E+LK +DL+TASI + NGYD FHIA +QGHLEVLKELL+VFPNL MTTD SNSTALHTAA
Sbjct  132   EMLKHMDLQTASITARNGYDPFHIAVRQGHLEVLKELLHVFPNLAMTTDLSNSTALHTAA  191

Query  1424  GQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKG  1603
              QGH+D+V+LLLE DSNLAKIARNNGKTVLH+AARMGHLEVVKSL+NKDPS  FRTD KG
Sbjct  192   TQGHIDIVNLLLETDSNLAKIARNNGKTVLHSAARMGHLEVVKSLLNKDPSAAFRTDLKG  251

Query  1604  QTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISI--EG  1777
             QTALHMAVKG NV+IVLEL+KPDPSVL + DNKGNTALHIATRKGR + V+ L+SI  +G
Sbjct  252   QTALHMAVKGHNVEIVLELLKPDPSVLTVEDNKGNTALHIATRKGRIENVRCLLSINNDG  311

Query  1778  ININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHD  1957
              NIN  NKAGET+LDIAEKFGTP++V++LKEAGAT+SKD GKP + AKQLKQTVSDIKHD
Sbjct  312   SNINASNKAGETSLDIAEKFGTPELVSVLKEAGATNSKDQGKPANPAKQLKQTVSDIKHD  371

Query  1958  VESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYV  2137
             V+SQL+Q+RQTG +V+KIAKK+KKLHISGLNNAINS TVVAVLIATVAFAAIFTVPGQYV
Sbjct  372   VQSQLKQTRQTGARVQKIAKKLKKLHISGLNNAINSATVVAVLIATVAFAAIFTVPGQYV  431

Query  2138  EKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIIN  2317
             E++  G TLG+A++AN AAFI+FF+FDSLALFIS+AVVVVQTSVVVIEQKAKKQ+VF+IN
Sbjct  432   EEKTLGLTLGQAHIANNAAFIIFFVFDSLALFISLAVVVVQTSVVVIEQKAKKQLVFVIN  491

Query  2318  KLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEES  2497
             KLMW ACLFISIAFISLTYVVVG+  +WLA+Y+TV+G  IMLTTIGSMCYCV+ HR+EES
Sbjct  492   KLMWLACLFISIAFISLTYVVVGSHSRWLAVYATVIGSTIMLTTIGSMCYCVILHRMEES  551

Query  2498  RMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             +MRNIR+AE+ SRSFSMSM  S+ E+ N  YKRMYA+
Sbjct  552   KMRNIRRAESKSRSFSMSMA-SEHEILNSEYKRMYAL  587



>ref|XP_009601846.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Nicotiana 
tomentosiformis]
Length=553

 Score =   812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/562 (77%), Positives = 495/562 (88%), Gaps = 9/562 (2%)
 Frame = +2

Query  923   MEKQQSFRNMEKQKSFKGLMEKQKSFRIAMERQLSFGGERKRGKDSPGKRGDNPLHLAAR  1102
             MEKQQSFRN        G+ME QKS RI MERQ+SF  E+KR K+SPGKRGD+PLHLAAR
Sbjct  1     MEKQQSFRN--------GVMENQKSIRIVMERQVSFDVEKKRDKESPGKRGDSPLHLAAR  52

Query  1103  AGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGEILKQLDLETASI  1282
              GNL KV++++++FD K IK  LS QNQ+GETALYVAAENGHTLVV E+LK LDL+ AS 
Sbjct  53    VGNLGKVKQLIEKFDGKGIKSLLSLQNQQGETALYVAAENGHTLVVAEMLKYLDLQIASF  112

Query  1283  ASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLE  1462
              +NNGYDAF +AAKQGHLE+LKELL+ FPNL+M TDSSNSTALHTAA QGH DVV+LLLE
Sbjct  113   VANNGYDAFQVAAKQGHLEILKELLHSFPNLIMATDSSNSTALHTAAAQGHTDVVNLLLE  172

Query  1463  IDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNV  1642
             ID NLAKIARNNGKTVLHTAARMG LE+VKSL+++DP IG RTD KGQ+ALHMAVKGQNV
Sbjct  173   IDLNLAKIARNNGKTVLHTAARMGRLEIVKSLLSRDPEIGLRTDSKGQSALHMAVKGQNV  232

Query  1643  DIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGININTVNKAGETALD  1822
             DIV ELIKP+P+VLAL DNKGN ALHIAT+KGR QMVQ LIS E I++N  NKAGETALD
Sbjct  233   DIVRELIKPNPAVLALEDNKGNRALHIATKKGRAQMVQCLISGECIDLNGTNKAGETALD  292

Query  1823  IAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQLQQSRQTGFkv  2002
             IAEKFG P++V++LK  GATHSKDHGK PS AKQLKQTVSDI+HDV+SQLQQSRQTGFKV
Sbjct  293   IAEKFGMPELVSILKVVGATHSKDHGKAPSNAKQLKQTVSDIRHDVQSQLQQSRQTGFKV  352

Query  2003  rkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKEKKGFTLGEANVA  2182
             RKIAKKVKKLHISGLNNAIN+ TVVAVLIATVAFAAIFTVPGQYVE++  GF+LGEA+VA
Sbjct  353   RKIAKKVKKLHISGLNNAINNATVVAVLIATVAFAAIFTVPGQYVEQKTDGFSLGEAHVA  412

Query  2183  NKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFI  2362
              KAAFI+FFLFDS+ALFISIAVVVVQTS+VVIE +AKK +VF IN+LMW ACLFIS++FI
Sbjct  413   EKAAFIIFFLFDSMALFISIAVVVVQTSLVVIEPRAKKLLVFWINRLMWAACLFISVSFI  472

Query  2363  SLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSF  2542
             SL+YVVVG++E+WLAIY+T +G +IMLTTIGSMCYCVVRHRLEES+MR+IR   T S S+
Sbjct  473   SLSYVVVGSKERWLAIYATAIGSIIMLTTIGSMCYCVVRHRLEESKMRSIRSTGTHSHSY  532

Query  2543  SMSMVPSDSELYNESYKRMYAV  2608
             +MS+V SD+ELY E+YKRMYAV
Sbjct  533   AMSVV-SDTELYAENYKRMYAV  553



>ref|XP_009343658.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Pyrus 
x bretschneideri]
 ref|XP_009343659.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Pyrus 
x bretschneideri]
 ref|XP_009343660.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Pyrus 
x bretschneideri]
 ref|XP_009343661.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Pyrus 
x bretschneideri]
 ref|XP_009343662.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Pyrus 
x bretschneideri]
Length=586

 Score =   812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/576 (76%), Positives = 501/576 (87%), Gaps = 5/576 (1%)
 Frame = +2

Query  893   MEKQASFRGVMEKQQSFRN-MEKQKSFKGLMEKQKSFRIAMERQLSF-GGERKRGKDSPG  1066
             MEK  SF G +E+Q S R  MEKQKSF+G MEKQKSFRI ME+QLSF GGER+R K+SPG
Sbjct  12    MEKLPSFSGAIEQQSSSRGAMEKQKSFRGFMEKQKSFRIVMEKQLSFIGGERRRSKESPG  71

Query  1067  KRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGE  1246
             KRGD+ LHLAARAGNL +VREILQ  +S      LSK NQEGET LY +AENGH  VVGE
Sbjct  72    KRGDSQLHLAARAGNLVRVREILQNCNSTESIGLLSKMNQEGETPLYASAENGHAEVVGE  131

Query  1247  ILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAG  1426
             +LK +DL+TASIA+ NGYD FHIA +QGHLEVLKELL+VFPNL MTTD SNSTALHTAA 
Sbjct  132   MLKHMDLQTASIAARNGYDPFHIAVRQGHLEVLKELLHVFPNLAMTTDLSNSTALHTAAT  191

Query  1427  QGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQ  1606
             QGH+++V+LLLE DSNLAKIARNNGKTVLH+AARMGHLEVVKSL+ KDPS  FRTD KGQ
Sbjct  192   QGHINIVNLLLETDSNLAKIARNNGKTVLHSAARMGHLEVVKSLLRKDPSAAFRTDLKGQ  251

Query  1607  TALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISI--EGI  1780
             TALHMAVKG N +IVLEL+KPDPSVL + DNKGN ALHIATRKGR + V+RL+SI  EG 
Sbjct  252   TALHMAVKGHNEEIVLELLKPDPSVLTVEDNKGNNALHIATRKGRIENVRRLLSINKEGS  311

Query  1781  NINTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDV  1960
             NIN  NKAGE+ LDIAEK+G+P++V +LKEAGAT+SKD GKP + AKQLKQTVSDIKHDV
Sbjct  312   NINASNKAGESPLDIAEKYGSPELVAVLKEAGATNSKDQGKPANPAKQLKQTVSDIKHDV  371

Query  1961  ESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVE  2140
             +SQLQQ+RQTG +V+KIAKK+KKLHISGLNNAIN+ T+VAVLIATVAFAAIFTVPGQYVE
Sbjct  372   QSQLQQTRQTGARVQKIAKKLKKLHISGLNNAINNATIVAVLIATVAFAAIFTVPGQYVE  431

Query  2141  KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINK  2320
             +E  G TLG+A++AN AAFI+FF+FDSLALFIS+AVVVVQTSVVVIEQKAKKQ+VF+INK
Sbjct  432   EETTGLTLGQAHIANNAAFIIFFVFDSLALFISLAVVVVQTSVVVIEQKAKKQLVFVINK  491

Query  2321  LMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESR  2500
             LMW ACLFISIAFISLTYVVVG+  +WLA+Y+TV+G  IMLTTIGSMCYCV+ HR+EES+
Sbjct  492   LMWLACLFISIAFISLTYVVVGSHSRWLAVYATVIGSTIMLTTIGSMCYCVILHRIEESK  551

Query  2501  MRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             MRNIR+AE+ SRSFSMSM  S+ E+ N  YKRMYA+
Sbjct  552   MRNIRRAESKSRSFSMSMA-SEHEILNSEYKRMYAL  586



>ref|XP_009366249.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Pyrus 
x bretschneideri]
 ref|XP_009366250.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Pyrus 
x bretschneideri]
Length=586

 Score =   812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/576 (75%), Positives = 498/576 (86%), Gaps = 5/576 (1%)
 Frame = +2

Query  893   MEKQASFRGVMEKQQSFRN-MEKQKSFKGLMEKQKSFRIAMERQLSF-GGERKRGKDSPG  1066
             MEK  SF G +E+Q S R  MEKQKSF+G MEKQKSFR+ ME+QLSF GGER+R K+SPG
Sbjct  12    MEKLPSFSGAIEQQSSSRGVMEKQKSFRGFMEKQKSFRMVMEKQLSFIGGERRRSKESPG  71

Query  1067  KRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGE  1246
             KRGD+ LHLAARAGNL +VREILQ  +S      LSK NQEGET LY +AENGH +VVGE
Sbjct  72    KRGDSQLHLAARAGNLVRVREILQNCNSNESIGLLSKTNQEGETPLYASAENGHAVVVGE  131

Query  1247  ILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAG  1426
             +LK +DL+TASIA+ NGYD FHIA +QGHLEVLKELL+VFPNL MTTD SNSTALHTAA 
Sbjct  132   MLKHMDLQTASIAARNGYDPFHIAVRQGHLEVLKELLHVFPNLAMTTDLSNSTALHTAAT  191

Query  1427  QGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQ  1606
             QGH+D+V+LLLE DSNLAKIARNNGKTVLH+AARMGHLEVVKSL+ KDPS  FRTD KGQ
Sbjct  192   QGHIDIVNLLLETDSNLAKIARNNGKTVLHSAARMGHLEVVKSLLRKDPSAAFRTDLKGQ  251

Query  1607  TALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISI--EGI  1780
             TALHMAVKG N +IVLEL+KPDPSVL + DNKGN ALH ATRKGR Q V+ L+SI  EG 
Sbjct  252   TALHMAVKGHNEEIVLELLKPDPSVLTVEDNKGNNALHTATRKGRIQNVRLLLSINKEGS  311

Query  1781  NINTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDV  1960
             NIN  NKAGE+ LDIAEK+G+P++V +LKEAGAT+SKD GKP + AKQLKQTVSDIKHDV
Sbjct  312   NINASNKAGESPLDIAEKYGSPELVAVLKEAGATNSKDQGKPANPAKQLKQTVSDIKHDV  371

Query  1961  ESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVE  2140
             +SQLQQ+RQTG +V+ IAKK+KKLHISGLNNAINS TVVAVLIATVAFAAIFT+PGQYVE
Sbjct  372   QSQLQQTRQTGARVQNIAKKLKKLHISGLNNAINSATVVAVLIATVAFAAIFTIPGQYVE  431

Query  2141  KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINK  2320
              E  GFTLG+A++AN AAFI+FF+FDSLALFIS+AVVVVQTSVVVIEQKAK+Q+VF+INK
Sbjct  432   DETPGFTLGQAHIANNAAFIIFFVFDSLALFISLAVVVVQTSVVVIEQKAKRQLVFVINK  491

Query  2321  LMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESR  2500
             LMW ACLFISIAFISLTYVVVGT  +WLA+Y+TV+G  IMLTTIGSMCYC++ HR+EE +
Sbjct  492   LMWLACLFISIAFISLTYVVVGTHSRWLAVYATVIGSTIMLTTIGSMCYCIILHRMEECK  551

Query  2501  MRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             MRNIR+AE+ SRSFSMSM  S+ E+ N  YKRMYA+
Sbjct  552   MRNIRRAESKSRSFSMSMA-SEHEVLNSEYKRMYAL  586



>gb|KHG02212.1| Ankyrin-1 [Gossypium arboreum]
Length=629

 Score =   811 bits (2096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/575 (76%), Positives = 500/575 (87%), Gaps = 5/575 (1%)
 Frame = +2

Query  896   EKQASFRGVM-EKQQSFRNM-EKQKSFKGLMEKQKSFRIAMERQLSF--GGERKRGKDSP  1063
             EKQ SFRGV  EKQ S R M EKQKSF+G +EKQKSFR+ MERQLSF   GER++ ++SP
Sbjct  56    EKQQSFRGVSSEKQPSGRGMIEKQKSFRGFIEKQKSFRVVMERQLSFIGAGERRKNRESP  115

Query  1064  GKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVG  1243
             GKRGD+PLHLAAR GNLS+VREIL  F+    K+ L+KQN EGET LYVAAENG  LVV 
Sbjct  116   GKRGDSPLHLAARTGNLSRVREILHNFNVPEAKELLAKQNLEGETPLYVAAENGQPLVVA  175

Query  1244  EILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAA  1423
             E+LK +DLETASI + NGYD FH+AAKQGH+EVLKELL  FPN VMTTD S +TALHTAA
Sbjct  176   EMLKHMDLETASITARNGYDPFHVAAKQGHVEVLKELLGTFPNSVMTTDLSCTTALHTAA  235

Query  1424  GQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKG  1603
              QGH+DVV+LLLE DS+LAKIARNNGKTVLH+AARMGHLEVVKSL++KDPS GFR DKKG
Sbjct  236   AQGHIDVVNLLLETDSDLAKIARNNGKTVLHSAARMGHLEVVKSLLSKDPSTGFRVDKKG  295

Query  1604  QTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGIN  1783
             QTALHMAVKGQN +IVLEL+KPDPSVL L D KGNTALHIA  KGR Q+V+ L+S+E IN
Sbjct  296   QTALHMAVKGQNEEIVLELLKPDPSVLGLEDCKGNTALHIAVMKGRTQIVRCLLSVESIN  355

Query  1784  INTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVE  1963
             IN+ NKAGE+ LDIAEK G P++V++LKEAGA +SKDHGKPP+A KQLKQTVSDIKHDV+
Sbjct  356   INSTNKAGESPLDIAEKIGNPELVSILKEAGAINSKDHGKPPNAGKQLKQTVSDIKHDVQ  415

Query  1964  SQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEK  2143
             SQLQQ+RQTGF+V+KIAK++KKLHISGLNNAINS TVVAVLIATVAFAAIFTVPGQYVE 
Sbjct  416   SQLQQTRQTGFRVQKIAKRLKKLHISGLNNAINSATVVAVLIATVAFAAIFTVPGQYVED  475

Query  2144  EKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKL  2323
               KG +LG+A++ANKA FIVFF+FDSLALFIS+AVVVVQTSVVVIEQKAKKQ+VF+INKL
Sbjct  476   NTKGLSLGQAHIANKAPFIVFFVFDSLALFISLAVVVVQTSVVVIEQKAKKQLVFVINKL  535

Query  2324  MWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRM  2503
             MW ACLFIS+AFISLTYVVVG   +WLA+ +TV+G  IMLTTIGSMCY V+ HR+EES++
Sbjct  536   MWLACLFISVAFISLTYVVVGKESRWLAVCATVIGSTIMLTTIGSMCYFVILHRMEESKL  595

Query  2504  RNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             R+IRKAE+ SRSFSMS V SDSE+ N  YKRMYA+
Sbjct  596   RSIRKAESRSRSFSMS-VASDSEILNNEYKRMYAL  629



>ref|XP_003554805.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X1 [Glycine max]
 ref|XP_006604934.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X2 [Glycine max]
Length=558

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/565 (76%), Positives = 498/565 (88%), Gaps = 10/565 (2%)
 Frame = +2

Query  923   MEKQQSFR--NMEKQKSFKGLMEKQKSFRIAMERQLSF-GGERKRGKDSPGKRGDNPLHL  1093
             MEKQ SFR   MEKQKSF+G MEKQKSFRI ME+QLSF G ERK+ K+SPGKRGD P+HL
Sbjct  1     MEKQSSFRASTMEKQKSFRGFMEKQKSFRIVMEKQLSFIGSERKKNKESPGKRGDLPIHL  60

Query  1094  AARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGEILKQLDLET  1273
             AARAGNLS+V+EI+Q + +   KD L+KQN EGET LYVA+ENGH LVV EILK LDL+T
Sbjct  61    AARAGNLSRVKEIIQNYSNYETKDLLAKQNLEGETPLYVASENGHALVVSEILKYLDLQT  120

Query  1274  ASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDL  1453
             ASIA+ NGYD FHIAAKQGHLEVL+ELL+ FPNL MTTD SNSTALHTAA QGH+DVV+L
Sbjct  121   ASIAAKNGYDPFHIAAKQGHLEVLRELLHSFPNLAMTTDLSNSTALHTAATQGHIDVVNL  180

Query  1454  LLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKG  1633
             LLE DSNLAKIARNNGKTVLH+AARMGHLEVVK+L+NKD S GFRTDKKGQTALHMAVKG
Sbjct  181   LLESDSNLAKIARNNGKTVLHSAARMGHLEVVKALLNKDRSTGFRTDKKGQTALHMAVKG  240

Query  1634  QNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGININTVNKAGET  1813
             QN +I+LEL+KPDP+VL+L DNKGNTALHIAT+KGR Q V  L+S+EGININ  NKAGET
Sbjct  241   QNEEILLELVKPDPAVLSLEDNKGNTALHIATKKGRTQNVHCLLSMEGININATNKAGET  300

Query  1814  ALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQLQQSRQTG  1993
              LD+AEKFG+P++V++L++AGA +S D  KPP+A+KQLKQTVSDIKHDV+SQLQQ+RQTG
Sbjct  301   PLDVAEKFGSPELVSILRDAGAANSTDQRKPPNASKQLKQTVSDIKHDVQSQLQQTRQTG  360

Query  1994  FkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKEKKGFTLGEA  2173
              +V+KIAKK+KKLHISGLNNAI S TVVAVLIATVAFAAIFTVPGQYVE +  GFTLG+A
Sbjct  361   MRVQKIAKKLKKLHISGLNNAITSATVVAVLIATVAFAAIFTVPGQYVEGKTHGFTLGQA  420

Query  2174  NVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISI  2353
             N+AN AAF++FF+FDSLALFIS+AVVVVQTSVVVIEQKAKKQ+VF+INKLMW ACLFISI
Sbjct  421   NIANNAAFLIFFVFDSLALFISLAVVVVQTSVVVIEQKAKKQLVFVINKLMWMACLFISI  480

Query  2354  AFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRMRNIRKAETLS  2533
             AFISLTYVVVG++ +WLAIY+TV+G +IML+TIGSMCYCV+ HR+EE+++R    AE  S
Sbjct  481   AFISLTYVVVGSQSRWLAIYATVIGSLIMLSTIGSMCYCVILHRMEETKLR----AE--S  534

Query  2534  RSFSMSMVPSDSELYNESYKRMYAV  2608
             RSFSMS   SD E+ N  YKRMYA+
Sbjct  535   RSFSMSHA-SDQEILNSEYKRMYAL  558



>ref|XP_008362856.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Malus 
domestica]
 ref|XP_008362857.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Malus 
domestica]
Length=586

 Score =   805 bits (2080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/576 (75%), Positives = 494/576 (86%), Gaps = 5/576 (1%)
 Frame = +2

Query  893   MEKQASFRGVMEKQQSFRN-MEKQKSFKGLMEKQKSFRIAMERQLSF-GGERKRGKDSPG  1066
             MEK  SF G +E+Q S R  MEKQKSF+G MEKQKSFR+ ME+QLSF GGER+R K+SPG
Sbjct  12    MEKLPSFSGAIEQQSSSRGVMEKQKSFRGFMEKQKSFRMVMEKQLSFIGGERRRSKESPG  71

Query  1067  KRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGE  1246
             KRGD+ LHLAARAGNL +VREILQ  +S      LSK NQEGET LY +AENGH  VVGE
Sbjct  72    KRGDSQLHLAARAGNLVRVREILQNCNSNESIGLLSKTNQEGETPLYASAENGHAXVVGE  131

Query  1247  ILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAG  1426
             +L+ +DL+TASIA+ NGYD FHIA +QGHLEVLKELL+VFPNL MTTD SNSTALHTAA 
Sbjct  132   MLRHMDLQTASIAARNGYDPFHIAVRQGHLEVLKELLHVFPNLAMTTDLSNSTALHTAAT  191

Query  1427  QGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQ  1606
             QGH+D+V+LLLE DSNLAKIARNNGKTVLH+AARMGHLEVVKSL+ KDPS  FRTD KGQ
Sbjct  192   QGHIDIVNLLLETDSNLAKIARNNGKTVLHSAARMGHLEVVKSLLRKDPSAAFRTDLKGQ  251

Query  1607  TALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISI--EGI  1780
             TALHMAVKG N +IVLEL+KPDPSVL + DNKGN ALH ATRKG  Q V+ L+SI  EG 
Sbjct  252   TALHMAVKGHNEEIVLELLKPDPSVLTVEDNKGNNALHTATRKGHIQNVRLLLSINKEGS  311

Query  1781  NINTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDV  1960
             NIN  NKAGE+ LDIAEK+G+P++V +LKEAGAT+SKD GKP + AKQLKQTVSDIKHDV
Sbjct  312   NINASNKAGESPLDIAEKYGSPELVAVLKEAGATNSKDQGKPANPAKQLKQTVSDIKHDV  371

Query  1961  ESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVE  2140
             +SQLQQ+RQTG +V+ IAKK+KKLHISGLNNAINS TVVAVLIATVAFAAIFT+PGQYVE
Sbjct  372   QSQLQQTRQTGARVQNIAKKLKKLHISGLNNAINSATVVAVLIATVAFAAIFTIPGQYVE  431

Query  2141  KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINK  2320
                 G TLG+A++AN AAFI+FF+FDSLALFIS+AVVVVQTSVVVIEQKAKKQ+VF+INK
Sbjct  432   DXTPGLTLGQAHIANNAAFIIFFVFDSLALFISLAVVVVQTSVVVIEQKAKKQLVFVINK  491

Query  2321  LMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESR  2500
             LMW ACLFISIAFISLTYVVVGT  +WLA+Y+TV+G  IMLTTIGSMCYCV+ HR+EE +
Sbjct  492   LMWLACLFISIAFISLTYVVVGTHSRWLAVYATVIGSTIMLTTIGSMCYCVILHRMEECK  551

Query  2501  MRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             MRNIR+AE+ SRSFSMSM  S+ E+ N  YKRMYA+
Sbjct  552   MRNIRRAESKSRSFSMSMA-SEHEVLNSEYKRMYAL  586



>ref|XP_003521843.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Glycine 
max]
Length=566

 Score =   804 bits (2076),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/569 (75%), Positives = 498/569 (88%), Gaps = 10/569 (2%)
 Frame = +2

Query  911   FRGVMEKQQSFR--NMEKQKSFKGLMEKQKSFRIAMERQLSF-GGERKRGKDSPGKRGDN  1081
             F+  MEKQ SFR   MEKQKSF+G MEKQKSFRI ME+QLSF G ERK+ K+SPGKRGD 
Sbjct  5     FQVTMEKQSSFRASTMEKQKSFRGFMEKQKSFRIVMEKQLSFMGSERKKNKESPGKRGDL  64

Query  1082  PLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGEILKQL  1261
             P+HLAARAGNLS+V+EI+Q + +   KD L+KQN EGET LYVA+ENGH LVV EIL  L
Sbjct  65    PIHLAARAGNLSRVKEIIQNYSNNETKDLLAKQNLEGETPLYVASENGHALVVSEILNYL  124

Query  1262  DLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQGHVD  1441
             DL+TASIA+ NGYD FHIAAKQGHLEVL+ELL+ FPNL MTTD SNSTALHTAA QGH+D
Sbjct  125   DLQTASIAARNGYDPFHIAAKQGHLEVLRELLHSFPNLAMTTDLSNSTALHTAATQGHID  184

Query  1442  VVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQTALHM  1621
             VV LLLE DSNLAKIARNNGKTVLH+AARMGHLEVVK+L+NKDPS GFRTDKKGQTALHM
Sbjct  185   VVKLLLESDSNLAKIARNNGKTVLHSAARMGHLEVVKALLNKDPSTGFRTDKKGQTALHM  244

Query  1622  AVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGININTVNK  1801
             AVKGQN +I+LEL+KPDP+VL+L DNKGNTALHIAT+KGR Q V+ L+S+E ININ  NK
Sbjct  245   AVKGQNEEILLELVKPDPAVLSLEDNKGNTALHIATKKGRTQNVRCLLSMECININATNK  304

Query  1802  AGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQLQQS  1981
             AGET LD+AEKFG+P++V++L++AGA +S D  KPP+ +KQLKQTVSDIKHDV+SQLQQ+
Sbjct  305   AGETPLDVAEKFGSPELVSILRDAGAANSTDQRKPPNPSKQLKQTVSDIKHDVQSQLQQT  364

Query  1982  RQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKEKKGFT  2161
             RQTG +V+KIAKK+KKLHISGLNNAINS TVVAVLIATVAFAAIFTVPGQYVE +  GF+
Sbjct  365   RQTGMRVQKIAKKLKKLHISGLNNAINSATVVAVLIATVAFAAIFTVPGQYVEDKTHGFS  424

Query  2162  LGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKLMWGACL  2341
             LG+AN+AN AAF++FF+FDSLALFIS+AVVVVQTSVVVIEQKAKKQ+VF+INKLMW ACL
Sbjct  425   LGQANIANNAAFLIFFVFDSLALFISLAVVVVQTSVVVIEQKAKKQLVFVINKLMWMACL  484

Query  2342  FISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRMRNIRKA  2521
             FISIAFISLTYVVVG+  +WLAIY+TV+G +IML+TIGSMCYCV+ HR+EE+++R    A
Sbjct  485   FISIAFISLTYVVVGSHSRWLAIYATVIGSLIMLSTIGSMCYCVILHRMEETKLR----A  540

Query  2522  ETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             E  SRSFSMS   SD E+ N  YKRMYA+
Sbjct  541   E--SRSFSMSHA-SDQEILNSEYKRMYAL  566



>gb|KHN11342.1| Ankyrin repeat-containing protein [Glycine soja]
Length=558

 Score =   801 bits (2070),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/565 (76%), Positives = 496/565 (88%), Gaps = 10/565 (2%)
 Frame = +2

Query  923   MEKQQSFR--NMEKQKSFKGLMEKQKSFRIAMERQLSF-GGERKRGKDSPGKRGDNPLHL  1093
             MEKQ SFR   MEKQKSF+G MEKQKSFRI ME+QLSF G ERK+ K+SPGKRGD  +HL
Sbjct  1     MEKQSSFRASTMEKQKSFRGFMEKQKSFRIVMEKQLSFIGSERKKNKESPGKRGDLSIHL  60

Query  1094  AARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGEILKQLDLET  1273
             AARAGNLS+V+EI+Q + +   KD L+KQN EGET LYVA+ENGH LVV EILK LDL+T
Sbjct  61    AARAGNLSRVKEIIQNYSNYETKDLLAKQNLEGETPLYVASENGHALVVSEILKYLDLQT  120

Query  1274  ASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDL  1453
             ASIA+ NGYD FHIAAKQGHLEVL+ELL+ FPNL MTTD SNSTALHTAA QGH+DVV+L
Sbjct  121   ASIAAKNGYDPFHIAAKQGHLEVLRELLHSFPNLAMTTDLSNSTALHTAATQGHIDVVNL  180

Query  1454  LLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKG  1633
             LLE DSNLAKIARNNGKTVLH+AARMGHLEVVK+L+NKD S GFRTDKKGQTALHMAVKG
Sbjct  181   LLESDSNLAKIARNNGKTVLHSAARMGHLEVVKALLNKDRSTGFRTDKKGQTALHMAVKG  240

Query  1634  QNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGININTVNKAGET  1813
             QN +I+LEL+KPDP+VL+L DNKGNTALHIAT+KGR Q V  L+S+EGININ  NKAGET
Sbjct  241   QNEEILLELVKPDPAVLSLEDNKGNTALHIATKKGRTQNVHCLLSMEGININATNKAGET  300

Query  1814  ALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQLQQSRQTG  1993
              LD+AEKFG+P++V++L++AGA +S D  KPP+A+KQLKQTVSDIKHDV+SQLQQ+RQTG
Sbjct  301   PLDVAEKFGSPELVSILRDAGAANSTDQRKPPNASKQLKQTVSDIKHDVQSQLQQTRQTG  360

Query  1994  FkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKEKKGFTLGEA  2173
              +V+KIAKK+KKLHISGLNNAI S TVVAVLIATVAFAAIFTVPGQYVE +  GFTLG+A
Sbjct  361   MRVQKIAKKLKKLHISGLNNAITSATVVAVLIATVAFAAIFTVPGQYVEGKTHGFTLGQA  420

Query  2174  NVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISI  2353
             N+AN AAF++FF+FDSLALFIS+AVVVVQTSVVVIEQKAKKQ+VF+INKLMW ACLFISI
Sbjct  421   NIANNAAFLIFFVFDSLALFISLAVVVVQTSVVVIEQKAKKQLVFVINKLMWMACLFISI  480

Query  2354  AFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRMRNIRKAETLS  2533
             AFISLTYVVVG+  +WLAIY+TV+G +IML+TIGSMCYCV+ HR+EE+++R    AE  S
Sbjct  481   AFISLTYVVVGSHSRWLAIYATVIGSLIMLSTIGSMCYCVILHRMEETKLR----AE--S  534

Query  2534  RSFSMSMVPSDSELYNESYKRMYAV  2608
             RSFSMS   SD E+ N  YKRMYA+
Sbjct  535   RSFSMSHA-SDQEILNSEYKRMYAL  558



>ref|XP_008367732.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Malus 
domestica]
 ref|XP_008367733.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Malus 
domestica]
 ref|XP_008367735.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Malus 
domestica]
 ref|XP_008367736.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Malus 
domestica]
 ref|XP_008367737.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Malus 
domestica]
Length=586

 Score =   801 bits (2068),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/576 (75%), Positives = 495/576 (86%), Gaps = 5/576 (1%)
 Frame = +2

Query  893   MEKQASFRGVMEKQQSFRN-MEKQKSFKGLMEKQKSFRIAMERQLSF-GGERKRGKDSPG  1066
             MEK  SF G +E+Q S R  MEKQKSF+G MEKQKSFRI ME+QLSF GGER+R K+SPG
Sbjct  12    MEKLPSFSGAIEQQSSSRGAMEKQKSFRGFMEKQKSFRIVMEKQLSFIGGERRRSKESPG  71

Query  1067  KRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGE  1246
             KRGD+ LHLAARAGNL +VREILQ  +S      LSK NQEGET LY +AENGH  VVGE
Sbjct  72    KRGDSQLHLAARAGNLVRVREILQNCNSTESIGLLSKMNQEGETPLYASAENGHAEVVGE  131

Query  1247  ILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAG  1426
             +LK +DL+TASIA+ NGYD FHIA + GHLEVLKELL+VFPNL MTTD SNSTALHTAA 
Sbjct  132   MLKHMDLQTASIAARNGYDPFHIAVRHGHLEVLKELLHVFPNLAMTTDLSNSTALHTAAT  191

Query  1427  QGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQ  1606
             QGH+++V+LLLE DSNLAKIARNNGKTVLH+AAR+GHLEVVKS + KDPS  FRTD KGQ
Sbjct  192   QGHINIVNLLLETDSNLAKIARNNGKTVLHSAARLGHLEVVKSXLRKDPSAAFRTDLKGQ  251

Query  1607  TALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISI--EGI  1780
             TALHMAVKG N +IVLEL+KPDPSVL + DNKGN ALHIATRKGR + V RL+SI  E  
Sbjct  252   TALHMAVKGHNEEIVLELLKPDPSVLTVEDNKGNNALHIATRKGRIENVCRLLSINKEAS  311

Query  1781  NINTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDV  1960
             NIN  NKAGET LDIAEK+G+P++V +LKEAGAT+SKD GKP + AKQLKQTVSDIKHDV
Sbjct  312   NINASNKAGETPLDIAEKYGSPELVAVLKEAGATNSKDQGKPANPAKQLKQTVSDIKHDV  371

Query  1961  ESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVE  2140
             +SQLQQ+RQTG +V+KIAKK+KKLHISGLNNAIN+ T+VAVLIATVAFAAIFTVPGQYVE
Sbjct  372   QSQLQQTRQTGARVQKIAKKLKKLHISGLNNAINNATIVAVLIATVAFAAIFTVPGQYVE  431

Query  2141  KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINK  2320
             +E  G TLG+A++AN AAFI+FF+FDSLALFIS+AVVVVQTSVVVIEQKAK Q+VF+INK
Sbjct  432   EETPGLTLGQAHIANNAAFIIFFVFDSLALFISLAVVVVQTSVVVIEQKAKXQLVFVINK  491

Query  2321  LMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESR  2500
             LMW ACLFISIAFISLTYVVVG+  +WLA+Y+TV+G  IMLTTIGSMCYCV+ HR+EES+
Sbjct  492   LMWLACLFISIAFISLTYVVVGSHSRWLAVYATVIGSTIMLTTIGSMCYCVILHRMEESK  551

Query  2501  MRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             MRNIR+AE+ SRS SMSM  S+ E+ N  YKRMYA+
Sbjct  552   MRNIRRAESKSRSLSMSMA-SEHEILNSEYKRMYAL  586



>ref|XP_010277792.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Nelumbo 
nucifera]
Length=573

 Score =   793 bits (2049),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/574 (73%), Positives = 499/574 (87%), Gaps = 3/574 (1%)
 Frame = +2

Query  893   MEKQASFRGVMEKQQSFRNM-EKQKSFKGLMEKQKSFRIAMERQLSFGGERKRGKDSPGK  1069
             MEKQ SFR +MEKQ+SFR + EKQ SF+G+MEKQKSFRIAME+Q SF   RK  K+SPGK
Sbjct  1     MEKQKSFRVIMEKQKSFRGVVEKQLSFRGVMEKQKSFRIAMEKQQSFNDLRK-SKESPGK  59

Query  1070  RGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGEI  1249
             RGD+P HLAAR GNL++VR+ILQ  DS  +KD LSK+N  GETALY AAENGH  VV E+
Sbjct  60    RGDSPFHLAARVGNLARVRDILQECDSVNLKDLLSKKNLNGETALYAAAENGHVQVVTEL  119

Query  1250  LKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQ  1429
             LK LDLETAS+ +NN  D+FH+AAKQGH+EVLKELLN FPNL MTTD++N+TALH+AA Q
Sbjct  120   LKHLDLETASLQANNCLDSFHVAAKQGHVEVLKELLNSFPNLAMTTDAANTTALHSAANQ  179

Query  1430  GHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQT  1609
             GH+DVV+LLLE DSNLAKIA++NGKT LH+AAR GHL+VV+SL++KDPS GFRTD+KGQT
Sbjct  180   GHIDVVNLLLESDSNLAKIAKSNGKTSLHSAARKGHLKVVESLISKDPSTGFRTDRKGQT  239

Query  1610  ALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGININ  1789
             ALHMAVKGQNVDI++ELIK D SV++L DNKGNTALH ATRKGR QMV  L+S++GIN+N
Sbjct  240   ALHMAVKGQNVDILVELIKHDSSVISLEDNKGNTALHTATRKGRLQMVHCLLSVDGINVN  299

Query  1790  TVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQ  1969
              +NKAGE+ LDIAEK G  ++ ++LKEAGAT  KDH  PP+AAKQLKQTVSDIKHDV+SQ
Sbjct  300   ALNKAGESVLDIAEKSGYAEIASILKEAGATAIKDHVNPPNAAKQLKQTVSDIKHDVQSQ  359

Query  1970  LQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKEK  2149
             LQQS QTG +V+KIAK++KKL+ISGLNNAINS T VAVLIATVAFAAIFTVPGQYVE + 
Sbjct  360   LQQSHQTGVRVQKIAKRIKKLNISGLNNAINSATFVAVLIATVAFAAIFTVPGQYVEVKT  419

Query  2150  KGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKLMW  2329
             +G T+G+AN+A+K AF+VF +FDSLALFIS+AVVV QTS+VVIE+KAKKQ++F+INK+MW
Sbjct  420   EGKTIGQANIADKPAFLVFIVFDSLALFISLAVVVAQTSLVVIEEKAKKQLMFVINKIMW  479

Query  2330  GACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRMRN  2509
              ACLFIS+AFISLTY+VVG   QWLA+Y+TV+G +IMLTTIGSMCYCV+ HR+EES MRN
Sbjct  480   VACLFISVAFISLTYIVVGQHAQWLAVYATVIGSLIMLTTIGSMCYCVILHRMEESSMRN  539

Query  2510  IRK-AETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             IR+ +E+  RSFS+SMVPS+SEL N  YKRMYAV
Sbjct  540   IRRTSESQFRSFSISMVPSESELLNNEYKRMYAV  573



>gb|KEH24678.1| ankyrin repeat protein [Medicago truncatula]
Length=546

 Score =   786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/554 (76%), Positives = 490/554 (88%), Gaps = 9/554 (2%)
 Frame = +2

Query  950   MEKQKSFKGLMEKQKSFRIAMERQLSF-GGERKRGKDSPGKRGDNPLHLAARAGNLSKVR  1126
             MEKQKSF+G MEKQKSFR+ MERQLSF G ERK+ K+SPGKRGD P+HLAARAGNL+KV+
Sbjct  1     MEKQKSFRGFMEKQKSFRVVMERQLSFMGSERKKSKESPGKRGDLPIHLAARAGNLTKVK  60

Query  1127  EILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDA  1306
             EIL + + +A KD L+KQN EGET LYVA+ENGH LVV EILK LDL+TASI + NGYD 
Sbjct  61    EILLQ-NHEAAKDLLAKQNLEGETPLYVASENGHDLVVSEILKYLDLQTASIVARNGYDP  119

Query  1307  FHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKI  1486
             FH+AAKQGHLEVL+ELL+ FPNL MTTD SNSTALHTAA QGH+DVV+LLLE DSNLAKI
Sbjct  120   FHVAAKQGHLEVLRELLHSFPNLAMTTDLSNSTALHTAATQGHIDVVNLLLESDSNLAKI  179

Query  1487  ARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIK  1666
             ARNNGKTVLH+AARMGHLEVVK+L++KDPS GFRTDKKGQTALHMAVKGQN +I+LEL+K
Sbjct  180   ARNNGKTVLHSAARMGHLEVVKALLSKDPSTGFRTDKKGQTALHMAVKGQNEEILLELVK  239

Query  1667  PDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTP  1846
             PDP+VL L DNKGNTALHIA +KGR Q V+RL+S EGININ  NKAGET LD+AEKFG+P
Sbjct  240   PDPAVLNLEDNKGNTALHIAAKKGRNQNVRRLLSTEGININATNKAGETPLDVAEKFGSP  299

Query  1847  DVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvk  2026
             D+V+++++AGA +S D GKPP+AAKQLKQTVSDIKHDV+SQLQQ+RQTG +V+KIAKK+K
Sbjct  300   DLVSIMRDAGAVNSTDQGKPPNAAKQLKQTVSDIKHDVQSQLQQTRQTGMRVQKIAKKLK  359

Query  2027  kLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKEKKGFTLGEANVANKAAFIVF  2206
             KLHISGLNNAI S TVVAVLIATVAFAAIFTVPGQYVE++  GF+LG+A +AN  AF++F
Sbjct  360   KLHISGLNNAITSATVVAVLIATVAFAAIFTVPGQYVEEKVNGFSLGQATIANNPAFLIF  419

Query  2207  FLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVG  2386
             F+FDSLALFIS+AVVVVQTSVVVIEQKAKKQ+VF+INKLMW ACLFISIAFISLTYVVVG
Sbjct  420   FVFDSLALFISLAVVVVQTSVVVIEQKAKKQLVFVINKLMWLACLFISIAFISLTYVVVG  479

Query  2387  TREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSD  2566
             +  +WLAIY+TV+G +IML+TIGSMCYCV+ HR++E+++R    AE  SRSFSMS   SD
Sbjct  480   SHSRWLAIYATVIGSLIMLSTIGSMCYCVILHRIDETKLR----AE--SRSFSMSHT-SD  532

Query  2567  SELYNESYKRMYAV  2608
              E+ N  YKRMYA+
Sbjct  533   QEILNGEYKRMYAL  546



>ref|XP_004494898.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X3 [Cicer arietinum]
Length=547

 Score =   784 bits (2024),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/554 (75%), Positives = 489/554 (88%), Gaps = 8/554 (1%)
 Frame = +2

Query  950   MEKQKSFKGLMEKQKSFRIAMERQLSF-GGERKRGKDSPGKRGDNPLHLAARAGNLSKVR  1126
             MEKQKSF+G MEKQKSFR+ ME+QLSF G ERK+ K+SPGKRGD P+HLAARAGNLS+V+
Sbjct  1     MEKQKSFRGFMEKQKSFRVVMEKQLSFMGSERKKSKESPGKRGDLPIHLAARAGNLSRVK  60

Query  1127  EILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDA  1306
             EI+Q   +   KD L+KQN EGET LYVA+ENGH LVV EILK LDL+TASI + NGYD 
Sbjct  61    EIIQNCSNNETKDLLAKQNLEGETPLYVASENGHDLVVSEILKYLDLQTASIVARNGYDP  120

Query  1307  FHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKI  1486
             FH+AAKQGHLEVL+ELL+ FPNL MTTD SNSTALHTAA QGH+DVV+LLLE DSNLAKI
Sbjct  121   FHVAAKQGHLEVLRELLHSFPNLAMTTDLSNSTALHTAATQGHIDVVNLLLESDSNLAKI  180

Query  1487  ARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIK  1666
             ARNNGKTVLH+AARMGHLEVVK+L+NKDPS GFRTDKKGQTALHMAVKGQN +I+LEL+K
Sbjct  181   ARNNGKTVLHSAARMGHLEVVKALLNKDPSTGFRTDKKGQTALHMAVKGQNEEILLELVK  240

Query  1667  PDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTP  1846
             PDP+VL L DNKGNTALHIA +KGR Q V+ L+S+EGININ  NKAGET LDIAEKFG+ 
Sbjct  241   PDPAVLNLEDNKGNTALHIAAKKGRNQNVRCLLSMEGININATNKAGETPLDIAEKFGSS  300

Query  1847  DVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvk  2026
             ++V+++++AGA +S D GKPP+A KQLKQTVSDI+HDV+SQLQQ+RQTG +V+KIAKK+K
Sbjct  301   ELVSIMRDAGAANSTDQGKPPNATKQLKQTVSDIRHDVQSQLQQTRQTGMRVQKIAKKLK  360

Query  2027  kLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKEKKGFTLGEANVANKAAFIVF  2206
             KLHISGLNNAINS TVVAVLIATVAFAAIFTVPGQYVE++ +GF+LG+AN+AN A+F +F
Sbjct  361   KLHISGLNNAINSATVVAVLIATVAFAAIFTVPGQYVEEKVQGFSLGQANIANNASFRIF  420

Query  2207  FLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVG  2386
             F+FDSLALFIS+AVVVVQTSVVVIEQKAKKQ+VF+INKLMW ACLFISIAFISLTYVVVG
Sbjct  421   FVFDSLALFISLAVVVVQTSVVVIEQKAKKQLVFVINKLMWMACLFISIAFISLTYVVVG  480

Query  2387  TREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSD  2566
             +  +WLAIY+TV+G +IML+TIGSMCYCV+ HR++E+++R    AE  SRSFSMS   SD
Sbjct  481   SHSRWLAIYATVIGSLIMLSTIGSMCYCVILHRIDETKLR----AE--SRSFSMSHA-SD  533

Query  2567  SELYNESYKRMYAV  2608
              E+ N  YKRMYA+
Sbjct  534   QEILNGEYKRMYAL  547



>ref|XP_004287177.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Fragaria 
vesca subsp. vesca]
Length=589

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/582 (73%), Positives = 498/582 (86%), Gaps = 14/582 (2%)
 Frame = +2

Query  893   MEKQASFRGVMEKQQSFRN-MEKQKSFKGLMEKQKSFRIAMERQLSFGG----ERKRGKD  1057
             +EKQ SF   +EKQ SFR  MEKQKSF+GLMEKQKSFRI ME+QLSF G    ER++ K+
Sbjct  12    IEKQVSFNEAIEKQPSFRGAMEKQKSFRGLMEKQKSFRIVMEKQLSFIGGGSSERRKSKE  71

Query  1058  SPGKRGDNPLHLAARAGNLSKVREILQRFD-----SKAIKDTLSKQNQEGETALYVAAEN  1222
             SPGKRGD+ LHLAARAGNL++V+EI+   +     S AI   +SK NQEGET LY +AEN
Sbjct  72    SPGKRGDSQLHLAARAGNLARVKEIVGNCNTSTSSSDAIGLLMSKTNQEGETPLYASAEN  131

Query  1223  GHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNS  1402
             GH +VV E+LK +DL++ASIA+ NGYD FHIA +QGHL+VLKELL VFPNL MTTD SNS
Sbjct  132   GHAIVVREMLKHMDLQSASIAARNGYDPFHIAVRQGHLDVLKELLQVFPNLAMTTDLSNS  191

Query  1403  TALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIG  1582
             TALHTAA QGH+++VDLLLE DSNLAKIARNNGKTVLH+AARMGHLEVVKSL++KDP+  
Sbjct  192   TALHTAATQGHIEIVDLLLETDSNLAKIARNNGKTVLHSAARMGHLEVVKSLLSKDPTAA  251

Query  1583  FRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRL  1762
             FRTD KGQTALHMAVKGQN +IVLELIK DPSVLA+ DNKGNTALHIATRKGR + V+ L
Sbjct  252   FRTDLKGQTALHMAVKGQNEEIVLELIKRDPSVLAVEDNKGNTALHIATRKGRLENVRCL  311

Query  1763  ISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVS  1942
             +SIEGININ +NK+GET  DIAEKFG+ ++V++LKEAGA +S   GKP + AKQLKQTVS
Sbjct  312   LSIEGININAINKSGETPFDIAEKFGSSELVSVLKEAGAINS---GKPANPAKQLKQTVS  368

Query  1943  DIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftv  2122
             DIKHDV+SQLQQ+RQT  +V KIAK +KKLHISGLNNAINS T+VAVLIATVAFAAIFTV
Sbjct  369   DIKHDVQSQLQQTRQTVVRVNKIAKNLKKLHISGLNNAINSATIVAVLIATVAFAAIFTV  428

Query  2123  PGQYVEKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQM  2302
             PGQYVE +  G+TLG+A++A  AAFI+FF+FDSLALFIS+AVVVVQTSVVVIEQKAKKQ+
Sbjct  429   PGQYVEDKTPGYTLGQAHIAKNAAFIIFFVFDSLALFISLAVVVVQTSVVVIEQKAKKQL  488

Query  2303  VFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRH  2482
             VF+INKLMW ACLFISIAFISLTYVVVG++ +WLA+Y+TV+G  IMLTTIGSMCYCV+ H
Sbjct  489   VFVINKLMWLACLFISIAFISLTYVVVGSQSRWLAVYATVIGSTIMLTTIGSMCYCVILH  548

Query  2483  RLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             R+EES+ RNIRKAE+ SRSFS S V S+ E+ N  YKRMYA+
Sbjct  549   RMEESKYRNIRKAESRSRSFSTS-VASEHEILNSEYKRMYAL  589



>ref|XP_008449420.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Cucumis 
melo]
 ref|XP_008449421.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Cucumis 
melo]
Length=574

 Score =   781 bits (2017),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/565 (74%), Positives = 492/565 (87%), Gaps = 3/565 (1%)
 Frame = +2

Query  923   MEKQQSFRN-MEKQKSFKGLMEKQKSFRIAMERQLSF-GGERKRGKDSPGKRGDNPLHLA  1096
             +EKQ S R  MEKQKS +G MEKQKSFR+ MERQLSF GGERK+ K+SPGKRGD+PLHLA
Sbjct  10    LEKQPSSRVVMEKQKSIRGFMEKQKSFRMVMERQLSFMGGERKKTKESPGKRGDSPLHLA  69

Query  1097  ARAGNLSKVREILQRFDSKAIKDTL-SKQNQEGETALYVAAENGHTLVVGEILKQLDLET  1273
             ARAGN+ +V+EILQ  + K   ++L SKQN EGET LY AAENGH  VV E+LK LDLET
Sbjct  70    ARAGNVVRVKEILQNSNDKNESNSLLSKQNLEGETPLYAAAENGHDFVVAEMLKYLDLET  129

Query  1274  ASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDL  1453
             + IA+ NGYDAFH+AAK GHL+VL+ELL+VFPNL MTTDS NSTALHTAA QGH+DVV+L
Sbjct  130   SFIAARNGYDAFHVAAKHGHLKVLQELLDVFPNLAMTTDSVNSTALHTAAMQGHIDVVNL  189

Query  1454  LLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKG  1633
             LLE DS L+KIARNNGKTVLH+AARMGH+EVVK LV KDP++GFRTDKKGQT LHMAVKG
Sbjct  190   LLETDSELSKIARNNGKTVLHSAARMGHVEVVKLLVRKDPTLGFRTDKKGQTPLHMAVKG  249

Query  1634  QNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGININTVNKAGET  1813
             QN  IV+EL++PDPSVL L DNKGNTALHIA  K R + V+ L+S++GININ +NK GET
Sbjct  250   QNDSIVMELLRPDPSVLTLEDNKGNTALHIAVLKRRTENVRCLLSVKGININAINKNGET  309

Query  1814  ALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQLQQSRQTG  1993
              LDIAEKFG+ ++V +LKEAGA  SKD GKPPSAAKQLKQTVSDIKHDVESQLQQ+RQTG
Sbjct  310   PLDIAEKFGSTELVNILKEAGAVISKDQGKPPSAAKQLKQTVSDIKHDVESQLQQTRQTG  369

Query  1994  FkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKEKKGFTLGEA  2173
             F+V++IAK++KKLHISGLNNAINS TVVAVLIATVAFAAIFTVPGQ+VE++  G TLG+A
Sbjct  370   FRVQRIAKRLKKLHISGLNNAINSATVVAVLIATVAFAAIFTVPGQFVEQKSNGETLGQA  429

Query  2174  NVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISI  2353
             ++A  AAFI+F + DS+ALFIS+AVVVVQTSVVVIEQKAK+Q+VF+INKLMW ACLFIS+
Sbjct  430   HIATNAAFIIFMVSDSMALFISLAVVVVQTSVVVIEQKAKRQLVFVINKLMWLACLFISV  489

Query  2354  AFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRMRNIRKAETLS  2533
             AFIS+TYVVVG+  +WLAI +TV+G  IMLTTIGSMCYCVV+HR+EES+MR+I++AE+ S
Sbjct  490   AFISITYVVVGSNHKWLAICATVIGSTIMLTTIGSMCYCVVQHRMEESKMRSIKRAESRS  549

Query  2534  RSFSMSMVPSDSELYNESYKRMYAV  2608
              S+SMS+V S+SEL N  YKRMYA+
Sbjct  550   HSYSMSVVASESELLNNEYKRMYAL  574



>gb|KDP29560.1| hypothetical protein JCGZ_19273 [Jatropha curcas]
Length=605

 Score =   780 bits (2014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/586 (72%), Positives = 496/586 (85%), Gaps = 15/586 (3%)
 Frame = +2

Query  890   IMEKQASFRG----------VMEKQQSFRN-MEKQKSFKGLMEKQKSFRIAMERQLSF--  1030
             ++EK  SFRG          VME+  SFR  +EKQKSF+G +EKQKSFR  MERQLSF  
Sbjct  22    VIEKHPSFRGGNENQSTSGGVMERHPSFRGALEKQKSFRGFLEKQKSFRTVMERQLSFIG  81

Query  1031  GGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYV  1210
             GGE+K+ KDSPGKRGD+ +HLAARAGNL+K+REILQ  +    KD LS QNQEGET LY 
Sbjct  82    GGEKKKNKDSPGKRGDSQIHLAARAGNLTKIREILQNCEGNEAKDLLSIQNQEGETPLYA  141

Query  1211  AAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTD  1390
             AAENG+  V+ E+L  +DLETASI + NG+D FH+A KQGHLEVLKELL+ FPNL MTTD
Sbjct  142   AAENGNVGVIVEMLGYMDLETASIPARNGFDPFHVATKQGHLEVLKELLHAFPNLAMTTD  201

Query  1391  SSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKD  1570
              + +TALHTAA QGH+DVV+LLLE DSNL KIARNNGKT LH+AARMGHLEVV+S++NKD
Sbjct  202   LTCTTALHTAATQGHIDVVNLLLETDSNLVKIARNNGKTALHSAARMGHLEVVRSILNKD  261

Query  1571  PSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQM  1750
              S G RTDKKGQTALHMAVKGQN +IVLEL+KPDPSV+ L DNKGNTALHIAT+KGR Q 
Sbjct  262   LSTGHRTDKKGQTALHMAVKGQNEEIVLELVKPDPSVMCLEDNKGNTALHIATKKGRTQN  321

Query  1751  VQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLK  1930
             V+ L+S+EGININ +NKAGET LDIAEK   P++V++LKE GA  SKD GKP + AKQLK
Sbjct  322   VRCLLSVEGININAINKAGETPLDIAEKLDNPELVSVLKEGGAISSKDLGKPRNEAKQLK  381

Query  1931  QTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaa  2110
             QTVSDIKHDV+SQLQQ+RQTGFKV+KIAK++KKLHISGLNNAINS TVVAVLIATVAFAA
Sbjct  382   QTVSDIKHDVQSQLQQTRQTGFKVQKIAKRLKKLHISGLNNAINSSTVVAVLIATVAFAA  441

Query  2111  iftvPGQYVEKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKA  2290
             IFTVPGQYVE +++G +LG+A +A   AF+VFF+FDSLALFIS+AVVVVQTSVVVIEQKA
Sbjct  442   IFTVPGQYVEDKEEGTSLGQAYIAKNPAFLVFFVFDSLALFISLAVVVVQTSVVVIEQKA  501

Query  2291  KKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYC  2470
             KKQ+VF+INKLMW ACLFISIAFISLTYVVVG + +WLAIY+TV+GG IMLTTIGSMCYC
Sbjct  502   KKQLVFVINKLMWLACLFISIAFISLTYVVVGEKSRWLAIYATVIGGTIMLTTIGSMCYC  561

Query  2471  VVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             V+ HR+EESR+R+IRK E+ S S+SMSMV S+ E+ +  YKRMYA+
Sbjct  562   VILHRMEESRLRSIRK-ESRSHSYSMSMV-SEQEILDSEYKRMYAL  605



>ref|XP_007026501.1| Ankyrin repeat family protein isoform 1 [Theobroma cacao]
 gb|EOY07003.1| Ankyrin repeat family protein isoform 1 [Theobroma cacao]
Length=611

 Score =   779 bits (2012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/591 (72%), Positives = 504/591 (85%), Gaps = 20/591 (3%)
 Frame = +2

Query  893   MEKQASF-----RGVMEKQQSFRN------------MEKQKSFKGLMEKQKSFRIAMERQ  1021
             MEKQ SF     RGV+EKQ SFR             M KQKSF+G+MEKQKSFR+ MERQ
Sbjct  22    MEKQQSFKQSTARGVVEKQLSFRGVTNDRQPSGHGLMVKQKSFRGVMEKQKSFRVVMERQ  81

Query  1022  LSF--GGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGE  1195
             LSF   GER++ ++SPGKRGD+PLHLAAR GNLS+VREILQ  D    K+ L+KQN EGE
Sbjct  82    LSFIGAGERRKNRESPGKRGDSPLHLAARTGNLSRVREILQNSDGPNAKEFLAKQNLEGE  141

Query  1196  TALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNL  1375
             T LYVAAENG  ++V E+LK +DLETASI + NGYD FH+AAKQGH+EVL+ELL  FPN 
Sbjct  142   TPLYVAAENGQAVIVAEMLKHVDLETASITARNGYDPFHVAAKQGHVEVLEELLGTFPNS  201

Query  1376  VMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKS  1555
              MTTD S +TALHTAA +GH+DVV+LLLE DS+LAKIARNNGKTVLH+AAR GHLEVVKS
Sbjct  202   AMTTDLSCTTALHTAAAKGHIDVVNLLLETDSDLAKIARNNGKTVLHSAARNGHLEVVKS  261

Query  1556  LVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRK  1735
             L++KDPS GFR D+KGQTALHMAVKGQN +IVLEL+KPDPSVL L DN+GNTALHIA +K
Sbjct  262   LLSKDPSTGFRVDRKGQTALHMAVKGQNEEIVLELLKPDPSVLGLEDNRGNTALHIAIKK  321

Query  1736  GRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSA  1915
             G  ++V+ L+S+E ININ  NKAGE+ LD+AEK GTP++V++LKEAGAT+SKDHGKPP+A
Sbjct  322   GHTEIVRCLLSVERININATNKAGESPLDLAEKMGTPELVSILKEAGATNSKDHGKPPNA  381

Query  1916  AKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliat  2095
             AKQLKQTVSDIKHDV+SQLQQ+RQTGF+V+KIAK++KKLHISGLNNAINS TVVAVLIAT
Sbjct  382   AKQLKQTVSDIKHDVQSQLQQTRQTGFRVQKIAKRLKKLHISGLNNAINSATVVAVLIAT  441

Query  2096  vafaaiftvPGQYVEKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvv  2275
             VAFAAIFTVPGQYVE  K+G +LG+A++ANK  FIVFF+FDSLALFIS+AVVVVQTSVVV
Sbjct  442   VAFAAIFTVPGQYVEDMKEGVSLGQAHIANKTPFIVFFVFDSLALFISLAVVVVQTSVVV  501

Query  2276  IEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIG  2455
             IEQKAKKQ+VF+INKLMW ACLFIS+AFISLTYVVVG + +WLA+ +TV+G  IMLTTIG
Sbjct  502   IEQKAKKQLVFVINKLMWLACLFISVAFISLTYVVVGKQSRWLAVCATVIGSSIMLTTIG  561

Query  2456  SMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             SMCY V+ HR+EES++R+IRKAE+ SRSFSMSM  S+ E+ N  YKRMYA+
Sbjct  562   SMCYFVILHRMEESKLRSIRKAESRSRSFSMSMA-SEPEILNSEYKRMYAL  611



>ref|XP_004140228.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Cucumis 
sativus]
 ref|XP_004158638.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Cucumis 
sativus]
 gb|KGN47919.1| hypothetical protein Csa_6G411230 [Cucumis sativus]
Length=574

 Score =   776 bits (2004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/565 (73%), Positives = 490/565 (87%), Gaps = 3/565 (1%)
 Frame = +2

Query  923   MEKQQSFRN-MEKQKSFKGLMEKQKSFRIAMERQLSF-GGERKRGKDSPGKRGDNPLHLA  1096
             +EKQ S R  ME+QKS +G MEKQKSFR+ MERQLSF GGERK+ K+SPGKRGD+PLHLA
Sbjct  10    LEKQPSSRVVMERQKSIRGFMEKQKSFRMVMERQLSFMGGERKKTKESPGKRGDSPLHLA  69

Query  1097  ARAGNLSKVREILQRFDSKAIKDTL-SKQNQEGETALYVAAENGHTLVVGEILKQLDLET  1273
             ARAGN+ +V+EILQ  + K   ++L SKQN EGET LY AAENGH  VV E+LK LDLET
Sbjct  70    ARAGNVVRVKEILQNSNDKNESNSLLSKQNLEGETPLYAAAENGHDFVVAEMLKYLDLET  129

Query  1274  ASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDL  1453
             + +A+ NGYDAFH+AAK GHL+VL+ELL+V PNL MTTDS NSTALHTAA QGH+DVV+L
Sbjct  130   SFMAARNGYDAFHVAAKHGHLKVLQELLDVHPNLAMTTDSVNSTALHTAAMQGHIDVVNL  189

Query  1454  LLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKG  1633
             LLE DS L+KIARNNGKTVLH+AARMGH+EVVK LV+KDP++GFRTDKKGQT LHMAVKG
Sbjct  190   LLETDSELSKIARNNGKTVLHSAARMGHVEVVKLLVSKDPTLGFRTDKKGQTPLHMAVKG  249

Query  1634  QNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGININTVNKAGET  1813
             QN  IV+EL+ PDPSVL L DNKGNTALHIA  K R + V+RL+S+ GININ +NK GET
Sbjct  250   QNDSIVMELLSPDPSVLTLEDNKGNTALHIAVLKRRTENVRRLLSVNGININAINKNGET  309

Query  1814  ALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQLQQSRQTG  1993
              LDIAEKFG+ ++V +LKEAGA  SKD GKPPSAAKQLKQTVSDIKHDVESQLQQ+RQTG
Sbjct  310   PLDIAEKFGSSELVNILKEAGAVISKDQGKPPSAAKQLKQTVSDIKHDVESQLQQTRQTG  369

Query  1994  FkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKEKKGFTLGEA  2173
             F+V++IAK++KKLHISGLNNAINS TVVAVLIATVAFAAIFTVPGQ+VE++    TLG+A
Sbjct  370   FRVQRIAKRLKKLHISGLNNAINSATVVAVLIATVAFAAIFTVPGQFVEQKSNDETLGQA  429

Query  2174  NVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISI  2353
             ++A  AAFI+F + DS+ALFIS+AVVVVQTSVVVIEQKAK+Q+VF+INKLMW ACLFIS+
Sbjct  430   HIATNAAFIIFMVSDSMALFISLAVVVVQTSVVVIEQKAKRQLVFVINKLMWLACLFISV  489

Query  2354  AFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRMRNIRKAETLS  2533
             AFIS+TYVVVG+  +WLAI +TV+G  IMLTTIGSMCYCVV+HR+EES+MR+I++ E+ S
Sbjct  490   AFISITYVVVGSNHKWLAICATVIGSTIMLTTIGSMCYCVVQHRMEESKMRSIKRGESRS  549

Query  2534  RSFSMSMVPSDSELYNESYKRMYAV  2608
             RS+SMS+V S+SEL N  YKRMYA+
Sbjct  550   RSYSMSVVASESELLNNEYKRMYAL  574



>ref|XP_004494896.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X1 [Cicer arietinum]
 ref|XP_004494897.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X2 [Cicer arietinum]
Length=560

 Score =   775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/567 (74%), Positives = 490/567 (86%), Gaps = 21/567 (4%)
 Frame = +2

Query  950   MEKQKSFKGLMEKQKSFRIAMERQLSF-GGERKRGKDSPGKRGDNPLHLAARAGNLSKVR  1126
             MEKQKSF+G MEKQKSFR+ ME+QLSF G ERK+ K+SPGKRGD P+HLAARAGNLS+V+
Sbjct  1     MEKQKSFRGFMEKQKSFRVVMEKQLSFMGSERKKSKESPGKRGDLPIHLAARAGNLSRVK  60

Query  1127  EILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDA  1306
             EI+Q   +   KD L+KQN EGET LYVA+ENGH LVV EILK LDL+TASI + NGYD 
Sbjct  61    EIIQNCSNNETKDLLAKQNLEGETPLYVASENGHDLVVSEILKYLDLQTASIVARNGYDP  120

Query  1307  FHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKI  1486
             FH+AAKQGHLEVL+ELL+ FPNL MTTD SNSTALHTAA QGH+DVV+LLLE DSNLAKI
Sbjct  121   FHVAAKQGHLEVLRELLHSFPNLAMTTDLSNSTALHTAATQGHIDVVNLLLESDSNLAKI  180

Query  1487  ARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIK  1666
             ARNNGKTVLH+AARMGHLEVVK+L+NKDPS GFRTDKKGQTALHMAVKGQN +I+LEL+K
Sbjct  181   ARNNGKTVLHSAARMGHLEVVKALLNKDPSTGFRTDKKGQTALHMAVKGQNEEILLELVK  240

Query  1667  PDPSVLALGDNKGNTALHIATRKGRPQM-------------VQRLISIEGININTVNKAG  1807
             PDP+VL L DNKGNTALHIA +KGR Q+             V+ L+S+EGININ  NKAG
Sbjct  241   PDPAVLNLEDNKGNTALHIAAKKGRNQVFPFSLTVFIVYKNVRCLLSMEGININATNKAG  300

Query  1808  ETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQLQQSRQ  1987
             ET LDIAEKFG+ ++V+++++AGA +S D GKPP+A KQLKQTVSDI+HDV+SQLQQ+RQ
Sbjct  301   ETPLDIAEKFGSSELVSIMRDAGAANSTDQGKPPNATKQLKQTVSDIRHDVQSQLQQTRQ  360

Query  1988  TGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKEKKGFTLG  2167
             TG +V+KIAKK+KKLHISGLNNAINS TVVAVLIATVAFAAIFTVPGQYVE++ +GF+LG
Sbjct  361   TGMRVQKIAKKLKKLHISGLNNAINSATVVAVLIATVAFAAIFTVPGQYVEEKVQGFSLG  420

Query  2168  EANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFI  2347
             +AN+AN A+F +FF+FDSLALFIS+AVVVVQTSVVVIEQKAKKQ+VF+INKLMW ACLFI
Sbjct  421   QANIANNASFRIFFVFDSLALFISLAVVVVQTSVVVIEQKAKKQLVFVINKLMWMACLFI  480

Query  2348  SIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRMRNIRKAET  2527
             SIAFISLTYVVVG+  +WLAIY+TV+G +IML+TIGSMCYCV+ HR++E+++R    AE 
Sbjct  481   SIAFISLTYVVVGSHSRWLAIYATVIGSLIMLSTIGSMCYCVILHRIDETKLR----AE-  535

Query  2528  LSRSFSMSMVPSDSELYNESYKRMYAV  2608
              SRSFSMS   SD E+ N  YKRMYA+
Sbjct  536   -SRSFSMSHA-SDQEILNGEYKRMYAL  560



>ref|XP_010251404.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Nelumbo 
nucifera]
Length=571

 Score =   775 bits (2000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/574 (74%), Positives = 498/574 (87%), Gaps = 5/574 (1%)
 Frame = +2

Query  893   MEKQASFRGVMEKQQSFRNM-EKQKSFKGLMEKQKSFRIAMERQLSFGGERKRGKDSPGK  1069
             MEKQ SFRG+MEKQ+SFR + EKQ SF+G+MEKQKSFRIAME+Q SF  E+++ K+SPGK
Sbjct  1     MEKQKSFRGIMEKQKSFRGLIEKQLSFRGVMEKQKSFRIAMEKQQSFH-EQRKSKESPGK  59

Query  1070  RGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGEI  1249
             RGD+P HLAAR GNL+KVRE LQ  DS  +KD LSK+N  GETALY AAENGH  VV E+
Sbjct  60    RGDSPFHLAARVGNLTKVREFLQECDSGNLKDLLSKKNFNGETALYAAAENGHAEVVSEL  119

Query  1250  LKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQ  1429
             LK LDLETAS+ +NN  D+FH+AAKQGH+EVLKELLN FP+L MTTD++NSTALHTA+ Q
Sbjct  120   LKYLDLETASLPANNCLDSFHVAAKQGHVEVLKELLNSFPHLAMTTDAANSTALHTASSQ  179

Query  1430  GHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQT  1609
             GH+ VV+LLLE DSNLAKIA++NGKT LH+AAR+GHL VVKSL+ KDP+ GFRTD+KGQT
Sbjct  180   GHIGVVNLLLENDSNLAKIAKSNGKTALHSAARLGHLNVVKSLITKDPNTGFRTDRKGQT  239

Query  1610  ALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGININ  1789
             ALHMAVKG   DIVLELIKPDPSV+ L DNKGNTALHIAT KGRP+MV+ L+S+EGIN+N
Sbjct  240   ALHMAVKGHKEDIVLELIKPDPSVINLEDNKGNTALHIATTKGRPKMVRCLLSVEGINVN  299

Query  1790  TVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQ  1969
               NKAGETALDIAEK G  ++ ++LK AGAT +KDH  PPS  KQLKQTVSDIKHDV+SQ
Sbjct  300   AFNKAGETALDIAEKSGNTEIASILKGAGATTAKDHANPPSPVKQLKQTVSDIKHDVQSQ  359

Query  1970  LQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKEK  2149
             LQQS QTG +V+KIAK++KKLHISGLNNAINS TVVAVLIATVAFAAIFTVPGQYVE E 
Sbjct  360   LQQSHQTGVRVQKIAKRLKKLHISGLNNAINSATVVAVLIATVAFAAIFTVPGQYVEDEV  419

Query  2150  KGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKLMW  2329
              G +LG+A++AN  AF++FFLFDSLALFIS+AVVVVQTSVVVIEQKAK+Q++F+INKLMW
Sbjct  420   VGLSLGQAHIANNPAFLIFFLFDSLALFISLAVVVVQTSVVVIEQKAKEQLMFVINKLMW  479

Query  2330  GACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRMRN  2509
              ACLFIS+AFISLTY+VVG   +WLAIY+TV+GG IMLTTIGSMCYCV+ HR EES MRN
Sbjct  480   LACLFISVAFISLTYIVVGHHARWLAIYATVIGGSIMLTTIGSMCYCVILHRKEESNMRN  539

Query  2510  I-RKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             I R +E+ SRSFS+SMVPS+SEL NE Y+RMYAV
Sbjct  540   IRRASESRSRSFSVSMVPSESEL-NE-YRRMYAV  571



>ref|XP_010069205.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW57479.1| hypothetical protein EUGRSUZ_H00249 [Eucalyptus grandis]
Length=578

 Score =   773 bits (1997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/577 (73%), Positives = 496/577 (86%), Gaps = 13/577 (2%)
 Frame = +2

Query  896   EKQASFRGV-MEKQQSFR---NMEKQKSF-KGLMEKQKSFRIAMERQLSF-GGERKRGKD  1057
             EK+   +G+ MEKQ+SF     MEKQ+SF +GLMEKQKSFRIAMERQLSF   ++K+ K+
Sbjct  9     EKEREGKGIQMEKQKSFGRGIEMEKQRSFGRGLMEKQKSFRIAMERQLSFISSDKKKPKE  68

Query  1058  SPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLV  1237
             SPGKRGD+PLHLAARAGN  +VRE+LQ   +   K  LSK N EGET LY AAENGH   
Sbjct  69    SPGKRGDSPLHLAARAGNTGRVRELLQNCGADEPKSLLSKLNLEGETPLYAAAENGHVSA  128

Query  1238  VGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHT  1417
             V E+L+  +LE+ASIA+ NG+DAFHIAAKQGHLEVLKELL VFPNL MTTD+S +TALHT
Sbjct  129   VAELLEHSNLESASIAARNGFDAFHIAAKQGHLEVLKELLRVFPNLAMTTDTSCTTALHT  188

Query  1418  AAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDK  1597
             AAGQGH +VV+LLLE DSNL KIARNNGK+VLHTAARMGHLEVV+SL NKDPS GFRTDK
Sbjct  189   AAGQGHTNVVNLLLETDSNLIKIARNNGKSVLHTAARMGHLEVVRSLSNKDPSSGFRTDK  248

Query  1598  KGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEG  1777
             KGQTALHMAVKGQN +IVLELIKP+PSVL+  DNKGNT LHIATRKGR Q+V+ L+SIEG
Sbjct  249   KGQTALHMAVKGQNEEIVLELIKPNPSVLSTEDNKGNTPLHIATRKGRIQIVRCLLSIEG  308

Query  1778  ININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHD  1957
             IN+N +NKAGET LDIAEKFGTP++V++L  AGA+HSKD+GKPP+AAKQLKQTVSDIKHD
Sbjct  309   INLNPINKAGETPLDIAEKFGTPELVSLLTAAGASHSKDYGKPPNAAKQLKQTVSDIKHD  368

Query  1958  VESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYV  2137
             V+SQLQQ+RQTG KV+KIAK++KKLHISGLNNAINS TVVAVLIATVAFAAIFTVPGQY+
Sbjct  369   VQSQLQQTRQTGVKVQKIAKRLKKLHISGLNNAINSATVVAVLIATVAFAAIFTVPGQYI  428

Query  2138  EKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIIN  2317
             +++ KG ++GEAN+A K  F++FF+ DSLALFIS+AVVVVQTSVVVIE+KAK+Q+VF+IN
Sbjct  429   QEKTKGSSVGEANIAKKTPFVIFFISDSLALFISLAVVVVQTSVVVIEEKAKRQLVFVIN  488

Query  2318  KLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEES  2497
             KLMW ACLFISIAFISL+YVVVG+ ++WLA+ +T++G  IMLTTIGSMCYCVV HRLEE 
Sbjct  489   KLMWLACLFISIAFISLSYVVVGSSQRWLAVCATLIGSSIMLTTIGSMCYCVVMHRLEEK  548

Query  2498  RMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             ++RNI      SRS+SMSM  S+ ++ N   KRMYA+
Sbjct  549   KLRNI------SRSYSMSMA-SEPDILNSGNKRMYAL  578



>emb|CBI24749.3| unnamed protein product [Vitis vinifera]
Length=534

 Score =   771 bits (1990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/535 (76%), Positives = 476/535 (89%), Gaps = 3/535 (1%)
 Frame = +2

Query  1010  MERQLSFGG--ERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQN  1183
             MERQLSFGG  ERK+ K+SPGKRGD+ LHLAARAGNL++V+EI+++ +S  ++  LSKQN
Sbjct  1     MERQLSFGGSSERKKVKESPGKRGDSHLHLAARAGNLTRVKEIIEKCESSELQALLSKQN  60

Query  1184  QEGETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNV  1363
             QEGET LYVA+ENGH LVV E+L+ +DL+TASI +NNGYD FH+A KQGHLEVLKELL  
Sbjct  61    QEGETPLYVASENGHALVVSELLEHVDLQTASIKANNGYDPFHVATKQGHLEVLKELLRF  120

Query  1364  FPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLE  1543
             FPNLVMTTDSSNSTALHTAA QGH+DVV LLLE D NLAKIARNNGKTVLH+AARMGHLE
Sbjct  121   FPNLVMTTDSSNSTALHTAAAQGHIDVVHLLLETDPNLAKIARNNGKTVLHSAARMGHLE  180

Query  1544  VVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHI  1723
             V+K+LV+KDPSI FRTDKKGQTALHMAVKGQNV+IV  L+KPDPSV++L DNKGNTALHI
Sbjct  181   VLKALVSKDPSIVFRTDKKGQTALHMAVKGQNVEIVHALLKPDPSVMSLEDNKGNTALHI  240

Query  1724  ATRKGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGK  1903
             ATRKGR Q VQ L+S+EGI +N  NKAGET LDIAEKFGT ++ ++L+EAGAT+S DHGK
Sbjct  241   ATRKGRSQFVQCLLSVEGIKMNATNKAGETPLDIAEKFGTQEIASILREAGATNSADHGK  300

Query  1904  PPSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvav  2083
             PP+AAKQLKQTVSDIKHDV+SQLQQ+RQTG +V+ IAK++KKLHISGLNNAINS TVVAV
Sbjct  301   PPNAAKQLKQTVSDIKHDVQSQLQQTRQTGVRVQHIAKRLKKLHISGLNNAINSATVVAV  360

Query  2084  liatvafaaiftvPGQYVEKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqt  2263
             LIATVAFAAIFTVPGQYVE   KG +LG+A++A  AAF++FF+FDSLALFIS+AVVVVQT
Sbjct  361   LIATVAFAAIFTVPGQYVEVPTKGASLGQAHIARTAAFLIFFVFDSLALFISLAVVVVQT  420

Query  2264  svvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIML  2443
             SVVVIEQKAKKQ+VF+INKLMW ACLFISIAFISLTYVVVG+  +WLA+ +TV+G VIML
Sbjct  421   SVVVIEQKAKKQLVFVINKLMWMACLFISIAFISLTYVVVGSHARWLAVCATVIGSVIML  480

Query  2444  TTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             TTIG+MCYCV+ +R+ E++ RNIRKAE+ SRSFS+SM  S+SEL N  Y+RMYA+
Sbjct  481   TTIGAMCYCVIVNRIAEAKKRNIRKAESRSRSFSVSMA-SESELLNSEYRRMYAL  534



>ref|XP_002323928.2| hypothetical protein POPTR_0017s03960g [Populus trichocarpa]
 gb|EEF04061.2| hypothetical protein POPTR_0017s03960g [Populus trichocarpa]
Length=623

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/585 (72%), Positives = 493/585 (84%), Gaps = 16/585 (3%)
 Frame = +2

Query  890   IMEKQASFRGV----------MEKQQSFRNMEKQKSFKGLMEKQKSFRIAMERQLSF--G  1033
             +MEK  SF GV          MEK  SFR +EK   F+G +EKQKSFR+ MERQLSF  G
Sbjct  43    VMEKHPSFHGVTENGSTSHGVMEKHPSFRGVEK--GFRGFLEKQKSFRVVMERQLSFIGG  100

Query  1034  GERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVA  1213
             GERKR KDSPGKRGD+ +HLAAR GNLS+VREILQ  D   +K  L+ QNQ+GET LY A
Sbjct  101   GERKRPKDSPGKRGDSQIHLAARTGNLSRVREILQNSDGNDLKVLLATQNQDGETPLYAA  160

Query  1214  AENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDS  1393
             AENGH  VV ++L+ ++LETAS+A+ NGYD FH+AAKQGHL+VL ELL VFPNLVMTTD 
Sbjct  161   AENGHAGVVAKMLEYMNLETASVAARNGYDPFHVAAKQGHLDVLTELLRVFPNLVMTTDL  220

Query  1394  SNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDP  1573
             S +TALHTAA QGH+DVV+LLLE D NL KIARNNGKTVLH+AARMGHLE+V+SL++KDP
Sbjct  221   SCTTALHTAATQGHIDVVNLLLETDVNLVKIARNNGKTVLHSAARMGHLEIVRSLLSKDP  280

Query  1574  SIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMV  1753
             S GFRTDKKGQTALHMAVKGQN +IVLEL+KPD +V+ + DNKGNTALHIA  KGR Q V
Sbjct  281   STGFRTDKKGQTALHMAVKGQNEEIVLELLKPDRTVMHVEDNKGNTALHIAVMKGRTQNV  340

Query  1754  QRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQ  1933
               L+S+EGININ +NKAGET LDIAEK G  ++V++LK+AGA +SKD GKPP+AAKQLKQ
Sbjct  341   HCLLSVEGININAINKAGETPLDIAEKLGIQELVSILKKAGANNSKDCGKPPNAAKQLKQ  400

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKHDV+SQLQQ+RQTGF+V+KIAKK+KKLHISGLNNAIN+ T+VAVLIATVAFAAI
Sbjct  401   TVSDIKHDVQSQLQQTRQTGFRVQKIAKKLKKLHISGLNNAINNSTIVAVLIATVAFAAI  460

Query  2114  ftvPGQYVEKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAK  2293
             FTVPGQYVE++ +G  +G+ANVA   AF+VFF+FDSLALFIS+AVVVVQTS+VVIEQKAK
Sbjct  461   FTVPGQYVEEKIEGAAIGQANVARNPAFLVFFVFDSLALFISLAVVVVQTSIVVIEQKAK  520

Query  2294  KQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCV  2473
             KQ+VF+INKLMW ACLFIS AFISLTYVVVG   +WLAIY+TV+GG+IML TIGSMCYCV
Sbjct  521   KQLVFVINKLMWLACLFISAAFISLTYVVVGKNSRWLAIYATVIGGLIMLATIGSMCYCV  580

Query  2474  VRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             V H++EES++RNIR+ ET   S+SMS V SD E+ N  Y+RMYA+
Sbjct  581   VLHQMEESKLRNIRR-ETRPGSYSMS-VESDQEILNSEYRRMYAL  623



>ref|XP_010069206.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X2 [Eucalyptus grandis]
Length=566

 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/576 (72%), Positives = 493/576 (86%), Gaps = 14/576 (2%)
 Frame = +2

Query  893   MEKQASFRGVMEKQQSFR--NMEKQKSF-KGLMEKQKSFRIAMERQLSF-GGERKRGKDS  1060
             MEK  + R   EK++  +   MEKQ+SF +GLMEKQKSFRIAMERQLSF   ++K+ K+S
Sbjct  1     MEKPENSR---EKEREGKGIEMEKQRSFGRGLMEKQKSFRIAMERQLSFISSDKKKPKES  57

Query  1061  PGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVV  1240
             PGKRGD+PLHLAARAGN  +VRE+LQ   +   K  LSK N EGET LY AAENGH   V
Sbjct  58    PGKRGDSPLHLAARAGNTGRVRELLQNCGADEPKSLLSKLNLEGETPLYAAAENGHVSAV  117

Query  1241  GEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTA  1420
              E+L+  +LE+ASIA+ NG+DAFHIAAKQGHLEVLKELL VFPNL MTTD+S +TALHTA
Sbjct  118   AELLEHSNLESASIAARNGFDAFHIAAKQGHLEVLKELLRVFPNLAMTTDTSCTTALHTA  177

Query  1421  AGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKK  1600
             AGQGH +VV+LLLE DSNL KIARNNGK+VLHTAARMGHLEVV+SL NKDPS GFRTDKK
Sbjct  178   AGQGHTNVVNLLLETDSNLIKIARNNGKSVLHTAARMGHLEVVRSLSNKDPSSGFRTDKK  237

Query  1601  GQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGI  1780
             GQTALHMAVKGQN +IVLELIKP+PSVL+  DNKGNT LHIATRKGR Q+V+ L+SIEGI
Sbjct  238   GQTALHMAVKGQNEEIVLELIKPNPSVLSTEDNKGNTPLHIATRKGRIQIVRCLLSIEGI  297

Query  1781  NINTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDV  1960
             N+N +NKAGET LDIAEKFGTP++V++L  AGA+HSKD+GKPP+AAKQLKQTVSDIKHDV
Sbjct  298   NLNPINKAGETPLDIAEKFGTPELVSLLTAAGASHSKDYGKPPNAAKQLKQTVSDIKHDV  357

Query  1961  ESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVE  2140
             +SQLQQ+RQTG KV+KIAK++KKLHISGLNNAINS TVVAVLIATVAFAAIFTVPGQY++
Sbjct  358   QSQLQQTRQTGVKVQKIAKRLKKLHISGLNNAINSATVVAVLIATVAFAAIFTVPGQYIQ  417

Query  2141  KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINK  2320
             ++ KG ++GEAN+A K  F++FF+ DSLALFIS+AVVVVQTSVVVIE+KAK+Q+VF+INK
Sbjct  418   EKTKGSSVGEANIAKKTPFVIFFISDSLALFISLAVVVVQTSVVVIEEKAKRQLVFVINK  477

Query  2321  LMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESR  2500
             LMW ACLFISIAFISL+YVVVG+ ++WLA+ +T++G  IMLTTIGSMCYCVV HRLEE +
Sbjct  478   LMWLACLFISIAFISLSYVVVGSSQRWLAVCATLIGSSIMLTTIGSMCYCVVMHRLEEKK  537

Query  2501  MRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             +RNI      SRS+SMSM  S+ ++ N   KRMYA+
Sbjct  538   LRNI------SRSYSMSMA-SEPDILNSGNKRMYAL  566



>gb|KDO51601.1| hypothetical protein CISIN_1g006802mg [Citrus sinensis]
Length=590

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/576 (73%), Positives = 474/576 (82%), Gaps = 45/576 (8%)
 Frame = +2

Query  893   MEKQASFRGV-MEKQQSFRN-MEKQKSFKGLMEKQKSFRIAMERQLSF--GGERKRGKDS  1060
             MEKQ SF GV ++KQ S R  MEKQKSF+G +EKQKSFR+ MERQLSF  GGERK+ KDS
Sbjct  56    MEKQQSFHGVTIDKQPSTRGVMEKQKSFRGFIEKQKSFRVVMERQLSFIGGGERKKNKDS  115

Query  1061  PGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVV  1240
             PGKRGD  LHLAARAGNLS+V EILQ  D+   KD LSK+NQEGET LYVAAE+GH L+V
Sbjct  116   PGKRGDLQLHLAARAGNLSRVMEILQSCDANEAKDLLSKKNQEGETPLYVAAESGHALIV  175

Query  1241  GEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTA  1420
              E+L+ ++LETASI + NGYD+FH+AAKQGHLEVLKELL  FPNLVMTTD S STALHTA
Sbjct  176   EEMLQHMNLETASIPARNGYDSFHVAAKQGHLEVLKELLGEFPNLVMTTDLSCSTALHTA  235

Query  1421  AGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKK  1600
             A QGH+DVV+ LLEIDSNLAKIARNNGKTVLH+AARMGHLEVVK+LV+KDPS GFRTDKK
Sbjct  236   AAQGHIDVVNFLLEIDSNLAKIARNNGKTVLHSAARMGHLEVVKALVSKDPSTGFRTDKK  295

Query  1601  GQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGI  1780
             GQTALHMAVKGQN DIVLELI+PDPSVL L DNKGNTALHIA +KGR Q           
Sbjct  296   GQTALHMAVKGQNEDIVLELIRPDPSVLKLEDNKGNTALHIAIKKGRTQ-----------  344

Query  1781  NINTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDV  1960
                                          EAGA HSKDHGKPPSA KQLKQTVSDIKHDV
Sbjct  345   -----------------------------EAGAAHSKDHGKPPSATKQLKQTVSDIKHDV  375

Query  1961  ESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVE  2140
             +SQLQQSRQTGFKV KIAKK+KKLHISGLNNAINS TVVAVLIATVAFAAIFTVPGQYVE
Sbjct  376   QSQLQQSRQTGFKVHKIAKKLKKLHISGLNNAINSSTVVAVLIATVAFAAIFTVPGQYVE  435

Query  2141  KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINK  2320
             ++ +GF+LG+A++A  AAFI+FF+FDSLALFIS+AVVVVQTSVVVIE+KAK+Q+VF+INK
Sbjct  436   EKTEGFSLGQAHIAKNAAFIIFFVFDSLALFISLAVVVVQTSVVVIEEKAKRQLVFVINK  495

Query  2321  LMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESR  2500
             LMW ACLFISIAFISLTYVVVG   +WLA+ +TV+GG IMLTTIGSMCYCV+ HR+E  +
Sbjct  496   LMWLACLFISIAFISLTYVVVGEHSRWLAVSATVIGGTIMLTTIGSMCYCVILHRMEAKK  555

Query  2501  MRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             +RNIRKAE+ SRSFSMS V SD E+ N  YKRMYA+
Sbjct  556   LRNIRKAESRSRSFSMS-VASDQEILNSEYKRMYAL  590



>ref|XP_006410311.1| hypothetical protein EUTSA_v10016361mg [Eutrema salsugineum]
 gb|ESQ51764.1| hypothetical protein EUTSA_v10016361mg [Eutrema salsugineum]
Length=664

 Score =   765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/588 (71%), Positives = 498/588 (85%), Gaps = 16/588 (3%)
 Frame = +2

Query  893   MEKQASFRGV---------MEKQQSF--RNMEKQKSFKG-LMEKQKSFRIAMERQLSFGG  1036
             MEKQ SFRGV         MEK  SF   +ME+QKSF+G  +EKQKSFR+ MERQLSF G
Sbjct  77    MEKQQSFRGVTVENQKRGVMEKLPSFGKASMERQKSFRGGFLEKQKSFRVVMERQLSFIG  136

Query  1037  ERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQ-RFDS--KAIKDTLSKQNQEGETALY  1207
             ER++  +SPGKRGD+PLH+AAR GNL KV+E+++   DS  + +K+ LSKQN EGET LY
Sbjct  137   ERRKKNESPGKRGDSPLHIAARTGNLGKVKELIRGCCDSGGEELKELLSKQNLEGETPLY  196

Query  1208  VAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTT  1387
              AAENGH++VV E+LK +DLETASIA+ NG+D FH+AAKQGHLEVLK+LL  FPNL MTT
Sbjct  197   TAAENGHSIVVEEMLKHMDLETASIAARNGFDPFHVAAKQGHLEVLKKLLETFPNLAMTT  256

Query  1388  DSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNK  1567
             D S +TALHTAA QGH+DVV+LLLE DSNLAKIA+NNGKT LH+AARMGH+EVVKSL+  
Sbjct  257   DLSCTTALHTAATQGHIDVVNLLLETDSNLAKIAKNNGKTALHSAARMGHVEVVKSLIGN  316

Query  1568  DPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQ  1747
             DPSIGFRTDKKGQTALHMAVKGQN  IV+EL+KPD +VL++ DNKGNT LHIAT KGR +
Sbjct  317   DPSIGFRTDKKGQTALHMAVKGQNDGIVIELVKPDVAVLSVEDNKGNTPLHIATNKGRIK  376

Query  1748  MVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQL  1927
             +V+ L+S EGIN+N +NKAG+T LDIAEK G  ++V++LKEAGA  +KD GKP + AKQL
Sbjct  377   IVRCLVSFEGINLNPINKAGDTPLDIAEKIGNAELVSVLKEAGAATAKDLGKPQNPAKQL  436

Query  1928  KQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafa  2107
             KQTVSDIKH+V+SQLQQSRQTG +V+KIAK++KKLHISGLNNAINS TVVAVLIATVAFA
Sbjct  437   KQTVSDIKHEVQSQLQQSRQTGVRVQKIAKRLKKLHISGLNNAINSATVVAVLIATVAFA  496

Query  2108  aiftvPGQYVEKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQK  2287
             AIFT+PGQY E   KG  LG+A++ANKA F+VFF+FDSLALFIS+AVVVVQTSVVVIEQK
Sbjct  497   AIFTIPGQYEEDRSKGELLGQAHIANKAPFLVFFVFDSLALFISLAVVVVQTSVVVIEQK  556

Query  2288  AKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCY  2467
             AKK++VF+INKLMW ACLFISIAF+SL+Y+VVG  E WLA+ +TV+GG IMLTTIG+MCY
Sbjct  557   AKKKLVFVINKLMWCACLFISIAFVSLSYIVVGKEEMWLAVCATVIGGTIMLTTIGAMCY  616

Query  2468  CVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESY-KRMYAV  2608
             CVV HR+EES++++IRK  + S+SFSMS +PSDSE+ N  Y KRMYA+
Sbjct  617   CVVMHRMEESKLKSIRKERSKSQSFSMSRMPSDSEILNGEYNKRMYAL  664



>ref|NP_180741.1| ankyrin repeats-containing protein [Arabidopsis thaliana]
 gb|AAD32290.1| ankyrin-like protein [Arabidopsis thaliana]
 gb|AEC08589.1| ankyrin repeats-containing protein [Arabidopsis thaliana]
Length=662

 Score =   762 bits (1968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/585 (71%), Positives = 494/585 (84%), Gaps = 14/585 (2%)
 Frame = +2

Query  893   MEKQASFRGV---------MEKQQSF--RNMEKQKSFKG-LMEKQKSFRIAMERQLSFGG  1036
             MEKQ SFRGV         MEK  SF    ME+QKSF+G  +EKQKSFR+ MERQLSF G
Sbjct  79    MEKQQSFRGVNVENHKRGVMEKLPSFGRATMERQKSFRGGFLEKQKSFRVVMERQLSFIG  138

Query  1037  ERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAA  1216
             ER++  +SPGKRGD+ LH+AAR GNLSKV+E++ R     +K+ LSKQN EGET LY AA
Sbjct  139   ERRKKNESPGKRGDSSLHIAARTGNLSKVKELI-RGCGDELKELLSKQNLEGETPLYTAA  197

Query  1217  ENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSS  1396
             ENGH++VV E+LK +DLETASIA+ NG+D FH+AAKQGHLEVLK LL  FPNL MTTD S
Sbjct  198   ENGHSIVVEEMLKHMDLETASIAARNGFDPFHVAAKQGHLEVLKILLETFPNLAMTTDLS  257

Query  1397  NSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPS  1576
              +TALHTAA QGH+DVV+LLLE DSNLAKIA+NNGKT LH+AARMGH+EVVKSL+ KDPS
Sbjct  258   CTTALHTAATQGHIDVVNLLLETDSNLAKIAKNNGKTALHSAARMGHVEVVKSLIGKDPS  317

Query  1577  IGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQ  1756
             IGFRTDKKGQTALHMAVKGQN  IV+EL+KPD +VL++ DNKGNT LHIAT KGR ++V+
Sbjct  318   IGFRTDKKGQTALHMAVKGQNDGIVVELVKPDVAVLSVEDNKGNTPLHIATNKGRIKIVR  377

Query  1757  RLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQT  1936
              L+S EGIN+N +NKAG+T LD++EK G  ++V++LKEAGA  +KD GKP + AKQLKQT
Sbjct  378   CLVSFEGINLNPINKAGDTPLDVSEKIGNAELVSVLKEAGAATAKDLGKPQNPAKQLKQT  437

Query  1937  VSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaif  2116
             VSDIKH+V+SQLQQSRQTG +V+KIAK++KKLHISGLNNAINS TVVAVLIATVAFAAIF
Sbjct  438   VSDIKHEVQSQLQQSRQTGVRVQKIAKRLKKLHISGLNNAINSATVVAVLIATVAFAAIF  497

Query  2117  tvPGQYVEKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKK  2296
             T+PGQY E   KG  LG+A++ANKA F+VFF+FDSLALFIS+AVVVVQTSVVVIEQKAKK
Sbjct  498   TIPGQYEEDRSKGELLGQAHIANKAPFLVFFIFDSLALFISLAVVVVQTSVVVIEQKAKK  557

Query  2297  QMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVV  2476
             ++VF+INKLMW ACLFISIAF+SL+Y+VVG  E WLA+ +TV+GG IMLTTIG+MCYCVV
Sbjct  558   KLVFVINKLMWCACLFISIAFVSLSYIVVGKEEMWLAVCATVIGGTIMLTTIGAMCYCVV  617

Query  2477  RHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESY-KRMYAV  2608
              HR+EES++R+IRK  + S+SFSMS +PSDS++ N  Y KRMYA+
Sbjct  618   MHRMEESKLRSIRKERSKSQSFSMSRMPSDSDILNGEYNKRMYAL  662



>ref|XP_011011388.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Populus 
euphratica]
Length=623

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/585 (71%), Positives = 488/585 (83%), Gaps = 16/585 (3%)
 Frame = +2

Query  890   IMEKQASF----------RGVMEKQQSFRNMEKQKSFKGLMEKQKSFRIAMERQLSF--G  1033
             +MEK  SF          +GVMEK  SFR +EK    +G ++KQKSFR+ MERQLSF  G
Sbjct  43    VMEKHPSFHGVTENGSTSQGVMEKHPSFRGVEK--GLRGFLDKQKSFRVVMERQLSFIGG  100

Query  1034  GERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVA  1213
             GERK+ KDSPGKRGD+ +HLAAR GNLS+VREILQ  D   +K  L+ QNQ+GET LY A
Sbjct  101   GERKKPKDSPGKRGDSQIHLAARTGNLSRVREILQNSDGNDLKVLLATQNQDGETPLYAA  160

Query  1214  AENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDS  1393
             AENGH  VV ++L+ +DL TAS+A+ NGYD FH+AAKQGHL+VL ELL VFPNLVMTTD 
Sbjct  161   AENGHAGVVAKMLEYMDLGTASVAARNGYDPFHVAAKQGHLDVLTELLRVFPNLVMTTDL  220

Query  1394  SNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDP  1573
             S +TALHTAA QGH+DVV+LLLE D NL KIARNNGKTVLH+AARMGHLEVV+SL+ KD 
Sbjct  221   SCTTALHTAATQGHIDVVNLLLETDVNLVKIARNNGKTVLHSAARMGHLEVVRSLLIKDS  280

Query  1574  SIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMV  1753
             S GFRTDKKGQTALHMAVKGQN +IVLEL+KPDPSV+ + DNKGNTALHIA  KGR Q V
Sbjct  281   STGFRTDKKGQTALHMAVKGQNEEIVLELLKPDPSVMHVEDNKGNTALHIAVMKGRAQNV  340

Query  1754  QRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQ  1933
               L+S+EG+NIN +NKAGET LDIAEK G  ++V++LK+AGA +SKD GKPP+ AKQLKQ
Sbjct  341   HCLLSVEGVNINAINKAGETPLDIAEKLGIQELVSILKKAGANNSKDCGKPPNPAKQLKQ  400

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKHDV+SQLQQ+RQTG +V+KIAKK+KKLHISGLNNAIN+ T+VAVLIATVAFAAI
Sbjct  401   TVSDIKHDVQSQLQQTRQTGVRVQKIAKKLKKLHISGLNNAINNATIVAVLIATVAFAAI  460

Query  2114  ftvPGQYVEKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAK  2293
             FTVPGQYVE++ +G  +G+A+VA   AF+VFF+FDSLALFIS+AVVVVQTS+VVIEQKAK
Sbjct  461   FTVPGQYVEEKIEGAAIGQAHVARNPAFLVFFVFDSLALFISLAVVVVQTSIVVIEQKAK  520

Query  2294  KQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCV  2473
             KQ+VF+INKLMW ACLFIS AFISLTYVVVG   +WLAIY+TV+G +IML TIGSMCYCV
Sbjct  521   KQLVFVINKLMWLACLFISAAFISLTYVVVGKNSRWLAIYATVIGALIMLATIGSMCYCV  580

Query  2474  VRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             V H++EES++RNIR+ ET   S+SMS V SD E+ N  Y+RMYA+
Sbjct  581   VLHQMEESKLRNIRR-ETRPGSYSMS-VESDQEILNSEYRRMYAL  623



>ref|XP_010414079.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X1 [Camelina sativa]
 ref|XP_010414080.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X2 [Camelina sativa]
Length=664

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/588 (70%), Positives = 492/588 (84%), Gaps = 17/588 (3%)
 Frame = +2

Query  893   MEKQASFRGV------------MEKQQSF--RNMEKQKSFKG-LMEKQKSFRIAMERQLS  1027
             MEKQ SFRGV            MEK  SF    ME+QKSF+G  +EKQKSFR+ MERQLS
Sbjct  78    MEKQQSFRGVNNVENNNHKRGVMEKLPSFGKATMERQKSFRGGFLEKQKSFRVVMERQLS  137

Query  1028  FGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALY  1207
             F GER++  +SPGKRGD+ LH+AAR GNLSKV+E++ R     +K+ LSKQN EGET LY
Sbjct  138   FIGERRKKTESPGKRGDSSLHIAARTGNLSKVKELI-RGCGDELKELLSKQNLEGETPLY  196

Query  1208  VAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTT  1387
              AAENGH++VV E+L  +DLETASIA+ NG+D FH+AAKQGHLEVLK LL  FPNL MTT
Sbjct  197   TAAENGHSVVVEEMLTHMDLETASIAARNGFDPFHVAAKQGHLEVLKILLEAFPNLAMTT  256

Query  1388  DSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNK  1567
             D S +TALHTAA QGH+DVV+LLLE DSNLAKIA+NNGKT LH+AARMGH+EVVKSL+  
Sbjct  257   DLSCTTALHTAATQGHIDVVNLLLETDSNLAKIAKNNGKTALHSAARMGHVEVVKSLIGN  316

Query  1568  DPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQ  1747
             DPSIGFRTDKKGQTALHMAVKGQN  IV+EL+KPD +VL++ DNKGNT LHIAT KGR +
Sbjct  317   DPSIGFRTDKKGQTALHMAVKGQNDGIVVELVKPDVAVLSVEDNKGNTPLHIATNKGRIK  376

Query  1748  MVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQL  1927
             +V+ L+S EGIN+N +NKAG+T LDIAEK G  ++V++LKEAGA  +KD GKP + AKQL
Sbjct  377   IVRCLVSFEGINLNPINKAGDTPLDIAEKIGNAELVSVLKEAGAATAKDLGKPQNPAKQL  436

Query  1928  KQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafa  2107
             KQTVSDIKH+V+SQLQQSRQTG +V+KIAK++KKLHISGLNNAINS TVVAVLIATVAFA
Sbjct  437   KQTVSDIKHEVQSQLQQSRQTGVRVQKIAKRLKKLHISGLNNAINSATVVAVLIATVAFA  496

Query  2108  aiftvPGQYVEKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQK  2287
             AIFT+PGQY E   KG  LG+A++ANKA F+VFF+FDSLALFIS+AVVVVQTSVVVIEQK
Sbjct  497   AIFTIPGQYEEDRSKGSLLGQAHIANKAPFLVFFIFDSLALFISLAVVVVQTSVVVIEQK  556

Query  2288  AKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCY  2467
             AKK++VF+INKLMW ACLFISIAF+SL+Y+VVG +E WLA+ +TV+GG IMLTTIG+MCY
Sbjct  557   AKKKLVFVINKLMWCACLFISIAFVSLSYIVVGKQEIWLAVCATVIGGTIMLTTIGAMCY  616

Query  2468  CVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESY-KRMYAV  2608
             CVV HR+EES++R IRK  + S+SFSMS +PSDS++ N  Y KRMYA+
Sbjct  617   CVVMHRMEESKLRGIRKERSKSQSFSMSRMPSDSDILNGEYNKRMYAL  664



>ref|XP_010510146.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X1 [Camelina sativa]
 ref|XP_010510147.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X2 [Camelina sativa]
Length=664

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/588 (70%), Positives = 492/588 (84%), Gaps = 17/588 (3%)
 Frame = +2

Query  893   MEKQASFRGV------------MEKQQSF--RNMEKQKSFKG-LMEKQKSFRIAMERQLS  1027
             MEKQ SFRGV            MEK  SF    ME+QKSF+G  +EKQKSFR+ MERQLS
Sbjct  78    MEKQQSFRGVNNVENDNHKRGVMEKLPSFGKATMERQKSFRGGFLEKQKSFRVVMERQLS  137

Query  1028  FGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALY  1207
             F GER++  +SPGKRGD+ LH+AAR GNLSKV+E++ R     +K+ LSKQN EGET LY
Sbjct  138   FIGERRKKTESPGKRGDSSLHIAARTGNLSKVKELI-RGCGDELKELLSKQNLEGETPLY  196

Query  1208  VAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTT  1387
              AAENGH++VV E+L  +DLETASIA+ NG+D FH+AAKQGHLEVLK LL  FPNL MTT
Sbjct  197   TAAENGHSVVVEEMLTHMDLETASIAARNGFDPFHVAAKQGHLEVLKILLEAFPNLAMTT  256

Query  1388  DSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNK  1567
             D S +TALHTAA QGH+DVV+LLLE DSNLAKIA+NNGKT LH+AARMGH+EVVKSL+  
Sbjct  257   DLSCTTALHTAATQGHIDVVNLLLETDSNLAKIAKNNGKTALHSAARMGHVEVVKSLIGN  316

Query  1568  DPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQ  1747
             DPSIGFRTDKKGQTALHMAVKGQN  IV+EL+KPD +VL++ DNKGNT LHIAT KGR +
Sbjct  317   DPSIGFRTDKKGQTALHMAVKGQNDGIVVELVKPDVAVLSVEDNKGNTPLHIATNKGRIK  376

Query  1748  MVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQL  1927
             +V+ L+S EGIN+N +NKAG+T LDIAEK G  ++V++LKEAGA  +KD GKP + AKQL
Sbjct  377   IVRCLVSFEGINLNPINKAGDTPLDIAEKIGNAELVSVLKEAGAATAKDLGKPQNPAKQL  436

Query  1928  KQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafa  2107
             KQTVSDIKH+V+SQLQQSRQTG +V+KIAK++KKLHISGLNNAINS TVVAVLIATVAFA
Sbjct  437   KQTVSDIKHEVQSQLQQSRQTGVRVQKIAKRLKKLHISGLNNAINSATVVAVLIATVAFA  496

Query  2108  aiftvPGQYVEKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQK  2287
             AIFT+PGQY E   KG  LG+A++ANKA F+VFF+FDSLALFIS+AVVVVQTSVVVIEQK
Sbjct  497   AIFTIPGQYEEDRSKGSLLGQAHIANKAPFLVFFIFDSLALFISLAVVVVQTSVVVIEQK  556

Query  2288  AKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCY  2467
             AKK++VF+INKLMW ACLFISIAF+SL+Y+VVG +E WLA+ +TV+GG IMLTTIG+MCY
Sbjct  557   AKKKLVFVINKLMWCACLFISIAFVSLSYIVVGKQEIWLAVCATVIGGTIMLTTIGAMCY  616

Query  2468  CVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESY-KRMYAV  2608
             CVV HR+EES++R IRK  + S+SFSMS +PSDS++ N  Y KRMYA+
Sbjct  617   CVVMHRMEESKLRGIRKERSKSQSFSMSRMPSDSDILNGEYNKRMYAL  664



>ref|XP_002529101.1| ankyrin repeat-containing protein, putative [Ricinus communis]
 gb|EEF33285.1| ankyrin repeat-containing protein, putative [Ricinus communis]
Length=606

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/587 (72%), Positives = 500/587 (85%), Gaps = 16/587 (3%)
 Frame = +2

Query  890   IMEKQASFRGV----------MEKQQSFRN-MEKQKSFKGLMEKQKSFRIAMERQLSF--  1030
             +MEK  SF G+          MEK  SFR  +EKQKSF+G +EKQKSFR+ MERQLSF  
Sbjct  22    VMEKLPSFHGITENPPTSHGLMEKHPSFRGALEKQKSFRGFVEKQKSFRVIMERQLSFIG  81

Query  1031  GGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYV  1210
             GGERK+ K+SPGKRGD+ +HLAARAGNLS+VREILQ  D    KD L+ +NQEGET LY 
Sbjct  82    GGERKKNKESPGKRGDSQIHLAARAGNLSRVREILQNCDGNEAKDLLAIKNQEGETPLYA  141

Query  1211  AAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTD  1390
             AAENGH  +V E+L+ ++LETASI + NGYD FHIAAKQGHLEVL  LL+VFPNL MTTD
Sbjct  142   AAENGHVGIVAEMLEYMNLETASIPARNGYDPFHIAAKQGHLEVLNALLHVFPNLAMTTD  201

Query  1391  SSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKD  1570
              S +TALHTAA QGH+DVV+LLLE DSNLAKIARNNGKT LH+AARMGH+EVV+SL++KD
Sbjct  202   LSCTTALHTAATQGHIDVVNLLLETDSNLAKIARNNGKTALHSAARMGHVEVVRSLLSKD  261

Query  1571  PSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQM  1750
             PS G RTDKKGQTALHMAVKGQN +IVLEL+KPDP+ ++L DNKGNTALHIAT+KGR Q 
Sbjct  262   PSTGLRTDKKGQTALHMAVKGQNEEIVLELLKPDPAFMSLEDNKGNTALHIATKKGRTQN  321

Query  1751  VQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLK  1930
             V+ L+S+EGIN+N +NKAGET+LDIAEK G+P++V++LKEA A +SKD GKP + AKQLK
Sbjct  322   VRCLLSVEGINVNAINKAGETSLDIAEKLGSPELVSILKEARALNSKDLGKPQNPAKQLK  381

Query  1931  QTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaa  2110
             QTVSDIKHDV+SQLQQ+RQTGFKV+KIAK+++KLHISGLNNAINS TVVAVLIATVAFAA
Sbjct  382   QTVSDIKHDVQSQLQQTRQTGFKVQKIAKRLQKLHISGLNNAINSATVVAVLIATVAFAA  441

Query  2111  iftvPGQYVEKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKA  2290
             IFTVPGQY+E ++KG +LG+A++A+  AF++FF+FDSLALFIS+AVVVVQTSVVVIEQKA
Sbjct  442   IFTVPGQYIEDKEKGTSLGQAHIADNPAFLIFFVFDSLALFISLAVVVVQTSVVVIEQKA  501

Query  2291  KKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYC  2470
             KKQ+VF INKLMW ACLFISIAFISLTYVVVG + +WLAIY+TV+GG IMLTTIGSMCYC
Sbjct  502   KKQLVFFINKLMWLACLFISIAFISLTYVVVGEKYRWLAIYATVIGGSIMLTTIGSMCYC  561

Query  2471  VVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESY-KRMYAV  2608
             V+ HR+EESR+R+IR+        SMSMV S+ E+++  Y KRMYA+
Sbjct  562   VILHRMEESRLRSIRRESRSRSY-SMSMV-SEQEIFDSEYNKRMYAL  606



>ref|XP_010672502.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Beta 
vulgaris subsp. vulgaris]
Length=605

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/599 (68%), Positives = 489/599 (82%), Gaps = 26/599 (4%)
 Frame = +2

Query  884   G*IMEKQASFRGVMEKQQSFRN----------------------MEKQKSFKGLMEKQKS  997
             G  MEKQ+SFR V+EKQ SFRN                      MEKQKSF+GL++KQKS
Sbjct  9     GKTMEKQSSFRRVIEKQVSFRNVVEKPESSGKKMEKSGSFRGVVMEKQKSFRGLLDKQKS  68

Query  998   FRIAMERQLSFGG--ERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTL  1171
             F + MERQ S GG  E+K+ K+SPGKRGD+PLHL ARAGNLS+++EI Q  +S   +  L
Sbjct  69    FHLKMERQFSLGGGSEKKKPKESPGKRGDSPLHLFARAGNLSRIKEIFQ--NSSDCRSLL  126

Query  1172  SKQNQEGETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKE  1351
              KQNQEGET LYVAAENG+ LV+GE LK LDL+TASI + +GYD FHIAA+QG++EVLKE
Sbjct  127   RKQNQEGETPLYVAAENGNALVIGEFLKYLDLDTASIKARSGYDPFHIAARQGYIEVLKE  186

Query  1352  LLNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARM  1531
             L++V+PNL MTTD SN+TALHTAA QG++DVV+LLLE DSNLAKIARNNGKTVLH+AARM
Sbjct  187   LISVYPNLAMTTDPSNTTALHTAATQGNIDVVNLLLETDSNLAKIARNNGKTVLHSAARM  246

Query  1532  GHLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNT  1711
             GHLEVVK+L+ KDPSIGFRTD+KGQ ALHMAVKGQN DIV+EL+KPDPS+L+L DNKGNT
Sbjct  247   GHLEVVKALLQKDPSIGFRTDRKGQAALHMAVKGQNQDIVIELLKPDPSILSLEDNKGNT  306

Query  1712  ALHIATRKGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSK  1891
             ALHIAT+KGR Q+V  L+  EG +IN +NKA ET LDIAEK G P++V+ L+EAGA  SK
Sbjct  307   ALHIATKKGRTQIVSCLLQFEGTDINAMNKASETVLDIAEKIGPPELVSALREAGALSSK  366

Query  1892  DHGKPPSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSlt  2071
             D GKPPS  KQLKQTVSDIKH+V+SQLQQ+ QT  +V+KIAKK+KKLH +GLNNAIN+ T
Sbjct  367   DLGKPPSTEKQLKQTVSDIKHNVKSQLQQTHQTDVRVQKIAKKLKKLHTNGLNNAINNAT  426

Query  2072  vvavliatvafaaiftvPGQYVEKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvv  2251
             VVAVLIATVAFAAIF VPGQYVEK+  GF+LGEA +A+  AF +FF+FDS++LFIS+AVV
Sbjct  427   VVAVLIATVAFAAIFQVPGQYVEKKSNGFSLGEAQIADNKAFTIFFVFDSMSLFISLAVV  486

Query  2252  vvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGG  2431
             VVQTSVVVIEQKAK+Q++F+INKLMW ACL IS+AFISL+YVVVG   QWLAI++TV+G 
Sbjct  487   VVQTSVVVIEQKAKRQLMFVINKLMWVACLCISVAFISLSYVVVGPHGQWLAIWATVIGA  546

Query  2432  VIMLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             VIM+  +GSM YCVV HRL +S+ R I++AE+ S S+SMS+  SD E  +  YKRMY +
Sbjct  547   VIMIPVLGSMFYCVVMHRLSDSKSRRIKRAESKSHSYSMSVAGSDPEFLSPEYKRMYVL  605



>ref|XP_006293806.1| hypothetical protein CARUB_v10022790mg [Capsella rubella]
 gb|EOA26704.1| hypothetical protein CARUB_v10022790mg [Capsella rubella]
Length=667

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/589 (70%), Positives = 493/589 (84%), Gaps = 17/589 (3%)
 Frame = +2

Query  893   MEKQASFRGV----------MEKQQSF--RNMEKQKSFKG-LMEKQKSFRIAMERQLSFG  1033
             MEKQ SFRGV          +EK  SF    ME+QKSF+G  +EKQKSFR+ MERQLSF 
Sbjct  79    MEKQQSFRGVNVENNHKRGVLEKLPSFGKATMERQKSFRGGFLEKQKSFRVVMERQLSFI  138

Query  1034  GERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDS---KAIKDTLSKQNQEGETAL  1204
             GER++  +SPGKRGD+ LH+AAR GNL KV+E+++       + +K+ LSKQN EGET L
Sbjct  139   GERRKKTESPGKRGDSSLHIAARTGNLGKVKELIRGCGDGGGEELKELLSKQNLEGETPL  198

Query  1205  YVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMT  1384
             Y AAENGH++VV E+L  +DLETASIA+ NG+D FH+AAKQGHLEVLK LL  FPNL MT
Sbjct  199   YSAAENGHSIVVEEMLTHMDLETASIAARNGFDPFHVAAKQGHLEVLKILLETFPNLAMT  258

Query  1385  TDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVN  1564
             TD S +TALHTAA QGH+DVV+LLLE DSNLAKIA+NNGKT LH+AARMGH+EVVKSL+ 
Sbjct  259   TDLSCTTALHTAATQGHIDVVNLLLETDSNLAKIAKNNGKTALHSAARMGHVEVVKSLIC  318

Query  1565  KDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRP  1744
              DPSIGFRTDKKGQTALHMAVKGQN  IV+EL+KPD +VL++ DNKGNT LHIAT KGR 
Sbjct  319   NDPSIGFRTDKKGQTALHMAVKGQNDGIVVELVKPDVAVLSVEDNKGNTPLHIATNKGRI  378

Query  1745  QMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQ  1924
             ++V+ L+S EGIN+N +NKAG+T LDIAEK G  ++V++LKEAGA  +KD GKP + AKQ
Sbjct  379   KIVRCLVSFEGINLNPINKAGDTPLDIAEKIGNAELVSVLKEAGAATAKDLGKPQNPAKQ  438

Query  1925  LKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvaf  2104
             LKQTVSDIKH+V+SQLQQSRQTG +V+KIAK++KKLHISGLNNAINS TVVAVLIATVAF
Sbjct  439   LKQTVSDIKHEVQSQLQQSRQTGVRVQKIAKRLKKLHISGLNNAINSATVVAVLIATVAF  498

Query  2105  aaiftvPGQYVEKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             AAIFT+PGQY E   KG  LG+A++ANKA F+VFF+FDSLALFIS+AVVVVQTSVVVIEQ
Sbjct  499   AAIFTIPGQYEEDRSKGPLLGQAHIANKAPFLVFFIFDSLALFISLAVVVVQTSVVVIEQ  558

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             KAKK++VF+INKLMW ACLFISIAF+SL+Y+VVG +E WLA+ +TV+GG IMLTTIG+MC
Sbjct  559   KAKKKLVFVINKLMWCACLFISIAFVSLSYIVVGKQEIWLAVCATVIGGTIMLTTIGAMC  618

Query  2465  YCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESY-KRMYAV  2608
             YCVV HR+EES++R+IRK  + S+SFSMS +PSDSE+ N  Y KRMYA+
Sbjct  619   YCVVMHRMEESKLRSIRKERSKSQSFSMSHMPSDSEILNGEYNKRMYAL  667



>ref|XP_009141191.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Brassica 
rapa]
Length=651

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/587 (70%), Positives = 491/587 (84%), Gaps = 15/587 (3%)
 Frame = +2

Query  893   MEKQASFRGV---------MEKQQSFR---NMEKQKSFKG-LMEKQKSFRIAMERQLSFG  1033
             MEKQ SFRGV         MEK  SF    +ME+QKSF+G  +EKQKSFR+ MERQLSF 
Sbjct  65    MEKQLSFRGVENNQKRGKVMEKLPSFSKAPSMERQKSFRGGFLEKQKSFRVVMERQLSFI  124

Query  1034  GERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDS-KAIKDTLSKQNQEGETALYV  1210
             GER +  +SPGKRGD+PLH+AAR GNL KV+E+++     + +++ LSKQN EGET LY 
Sbjct  125   GERGKKTESPGKRGDSPLHIAARTGNLGKVKELIRGSSCGEELRELLSKQNLEGETPLYT  184

Query  1211  AAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTD  1390
             AAENGH+ VV E+LK + LET SIA+ NG+D FH+AAKQGHLEVLK+LL  FPNL MTTD
Sbjct  185   AAENGHSFVVEEMLKHMCLETGSIAARNGFDPFHVAAKQGHLEVLKKLLETFPNLAMTTD  244

Query  1391  SSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKD  1570
              S +TALHTAA QGH+DVV+LLLE DSNLAKIA+NNGKT LH+AARMGH+EVVKSL+  D
Sbjct  245   LSCTTALHTAATQGHIDVVNLLLETDSNLAKIAKNNGKTALHSAARMGHVEVVKSLIGND  304

Query  1571  PSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQM  1750
             PSIGFRTDKKGQTALHMAVKGQN +IV+EL+KPD +VL++ DNKGNT LHIAT KGR ++
Sbjct  305   PSIGFRTDKKGQTALHMAVKGQNDEIVVELVKPDVAVLSVEDNKGNTPLHIATNKGRVKI  364

Query  1751  VQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLK  1930
             VQ L+S EGIN+N +NKAG+T LDIAEK G  ++V++LKEAGA  +KD GKP + AKQLK
Sbjct  365   VQCLVSFEGINLNPINKAGDTPLDIAEKIGNGELVSVLKEAGAATAKDLGKPQNPAKQLK  424

Query  1931  QTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaa  2110
             QTVSDIKH+V+SQLQQSRQTG +V+KIAK++KKLHISGLNNAINS TVVAVLIATVAFAA
Sbjct  425   QTVSDIKHEVQSQLQQSRQTGVRVQKIAKRLKKLHISGLNNAINSATVVAVLIATVAFAA  484

Query  2111  iftvPGQYVEKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKA  2290
             IFT+PGQY E   KG  LG+A++AN+A F+VFF+FDSLALFIS+AVVVVQTSVVVIEQKA
Sbjct  485   IFTIPGQYEEDPSKGALLGQAHIANRAPFLVFFIFDSLALFISLAVVVVQTSVVVIEQKA  544

Query  2291  KKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYC  2470
             KK++VF+INKLMW ACLFISIAF+SL+Y+VVG  + WLA+ +TV+GG IML TIG+MCYC
Sbjct  545   KKKLVFVINKLMWCACLFISIAFVSLSYIVVGKEDMWLAVCATVIGGTIMLPTIGAMCYC  604

Query  2471  VVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESY-KRMYAV  2608
             VV HR+EES++R+IRK  + S+SFSMS + SDSE+ N  Y KRMYA+
Sbjct  605   VVMHRMEESKLRSIRKERSKSQSFSMSRMASDSEILNGEYNKRMYAL  651



>gb|KFK31178.1| hypothetical protein AALP_AA6G079100 [Arabis alpina]
Length=654

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/591 (70%), Positives = 491/591 (83%), Gaps = 20/591 (3%)
 Frame = +2

Query  893   MEKQASFRGV-------------MEKQQSFRN----MEKQKSFKG-LMEKQKSFRIAMER  1018
             MEKQ SFRGV             +EK  SF       EKQKSF+G  +EKQKSFR+ MER
Sbjct  65    MEKQRSFRGVTIENNNHSNKRGVLEKLPSFGKGLSVEEKQKSFRGGFLEKQKSFRVVMER  124

Query  1019  QLSFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGET  1198
             QLSF GER++  +SPGKRGD+PLH+AAR GNLSKV+E++ R   + +K+ LSKQN EGET
Sbjct  125   QLSFIGERRKKNESPGKRGDSPLHIAARTGNLSKVKELI-RCGGEELKELLSKQNLEGET  183

Query  1199  ALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLV  1378
              LY AAENGH++VV E+LK +DLE ASIA+ NG+D FH+AAKQGHLEVLK+LL  FPNL 
Sbjct  184   PLYTAAENGHSIVVEEMLKHMDLENASIAARNGFDPFHVAAKQGHLEVLKKLLETFPNLA  243

Query  1379  MTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSL  1558
             MTTD   +TALHTAA QGH+DVV+LLLE DSNLAKIA+NNGKT LH+AARMGH+EVVKSL
Sbjct  244   MTTDLLCTTALHTAATQGHIDVVNLLLETDSNLAKIAKNNGKTALHSAARMGHVEVVKSL  303

Query  1559  VNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKG  1738
             +  DPSIGFRTDKKGQTALHMAVKGQN  IV+EL+KPD +VL++ DNKGNT LH AT KG
Sbjct  304   IGNDPSIGFRTDKKGQTALHMAVKGQNDGIVVELVKPDIAVLSVEDNKGNTPLHTATNKG  363

Query  1739  RPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAA  1918
             R ++V+ L+S EGIN+N +NKAG+T LDIAEK G  ++V++LKEAGA  +K  GKP + A
Sbjct  364   RIKIVRCLVSFEGINLNPINKAGDTPLDIAEKIGNAELVSVLKEAGAATAKGLGKPQNPA  423

Query  1919  KQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatv  2098
             KQLKQTVSDIKH+V+SQLQQSRQTG +V+KIAK++KKLHISGLNNAINS TVVAVLIATV
Sbjct  424   KQLKQTVSDIKHEVKSQLQQSRQTGVRVQKIAKRLKKLHISGLNNAINSATVVAVLIATV  483

Query  2099  afaaiftvPGQYVEKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvI  2278
             AFAAIFTVPGQY E   KG  LG A++ANKA F+VFF+FDSLALFIS+AVVVVQTSVVVI
Sbjct  484   AFAAIFTVPGQYEEDPLKGALLGTAHIANKAPFLVFFVFDSLALFISLAVVVVQTSVVVI  543

Query  2279  EQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGS  2458
             EQKAKK++VF+INKLMW ACLFISIAF+SL+Y+VVG +E WLA+ +TV+GG IMLTTIG+
Sbjct  544   EQKAKKKLVFVINKLMWCACLFISIAFVSLSYIVVGKQEMWLAVCATVIGGTIMLTTIGA  603

Query  2459  MCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESY-KRMYAV  2608
             MCYCVV HR+EES++R+IRK  + S+SFSMS +PSDS++ N  Y KRMYA+
Sbjct  604   MCYCVVMHRMEESKLRSIRKERSKSQSFSMSRIPSDSDILNGEYNKRMYAL  654



>ref|XP_008337174.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Malus 
domestica]
Length=777

 Score =   756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/558 (74%), Positives = 474/558 (85%), Gaps = 8/558 (1%)
 Frame = +2

Query  893   MEKQASFRGVMEKQQSFRN-MEKQKSFKGLMEKQKSFRIAMERQLSF-GGERKRGKDSPG  1066
             MEK  SF G +E+Q S R  MEKQKSF+G MEKQKSFRI ME+QLSF GGER+R K+SPG
Sbjct  12    MEKLPSFSGAIEQQSSSRGAMEKQKSFRGFMEKQKSFRIVMEKQLSFIGGERRRSKESPG  71

Query  1067  KRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGE  1246
             KRGD+ LHLAARAGNL +VREILQ  +S      LSK NQEGET LY +AENGH  VVGE
Sbjct  72    KRGDSQLHLAARAGNLVRVREILQNCNSTESIGLLSKMNQEGETPLYASAENGHAEVVGE  131

Query  1247  ILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAG  1426
             +LK +DL+TASIA+ NGYD FHIA + GHLEVLKELL+VFPNL MTTD SNSTALHTAA 
Sbjct  132   MLKHMDLQTASIAARNGYDPFHIAVRHGHLEVLKELLHVFPNLAMTTDLSNSTALHTAAT  191

Query  1427  QGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQ  1606
             QGH+++V+LLLE DSNLAKIARNNGKTVLH+AAR+GHLEVVKS + KDPS  FRTD KGQ
Sbjct  192   QGHINIVNLLLETDSNLAKIARNNGKTVLHSAARLGHLEVVKSXLRKDPSAXFRTDLKGQ  251

Query  1607  TALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISI--EGI  1780
             TALHMAVKG N +IVLEL+KPDPSVL + DNK N ALHIATRK R + V RL+SI  E  
Sbjct  252   TALHMAVKGHNEEIVLELLKPDPSVLTVEDNKXNNALHIATRKXRIENVCRLLSINKEAS  311

Query  1781  NINTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDV  1960
             NIN  NKAGET LDIAEK+G+P++V +LKEAGAT+SKD GKP + AKQLKQTVSDIKHDV
Sbjct  312   NINASNKAGETPLDIAEKYGSPELVAVLKEAGATNSKDQGKPANPAKQLKQTVSDIKHDV  371

Query  1961  ESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVE  2140
             +SQLQQ+RQTG +V+KIAKK+KKLHISGLNNAIN+ T+VAVLIATVAFAAIFTVPGQYVE
Sbjct  372   QSQLQQTRQTGARVQKIAKKLKKLHISGLNNAINNATIVAVLIATVAFAAIFTVPGQYVE  431

Query  2141  KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINK  2320
             +E  G TLG+A++AN AAFI+FF+FDSLALFIS+AVVVVQTSVVVIEQKAK Q+VF+INK
Sbjct  432   EETPGLTLGQAHIANNAAFIIFFVFDSLALFISLAVVVVQTSVVVIEQKAKXQLVFVINK  491

Query  2321  LMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESR  2500
             LMW ACLFISIAFISLTYVVVG+  +WLA+Y+TV+G  IMLTTIGSMCYCV+ HR+EES+
Sbjct  492   LMWLACLFISIAFISLTYVVVGSHSRWLAVYATVIGSTIMLTTIGSMCYCVILHRMEESK  551

Query  2501  MRNIRKAETLSRSFSMSM  2554
             MRN     TL RS   S+
Sbjct  552   MRN----STLYRSIVGSL  565



>emb|CDY19113.1| BnaA04g18530D [Brassica napus]
Length=631

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/587 (69%), Positives = 492/587 (84%), Gaps = 15/587 (3%)
 Frame = +2

Query  893   MEKQASFRGV---------MEKQQSF---RNMEKQKSFKG-LMEKQKSFRIAMERQLSFG  1033
             +EKQ SF+GV         MEK  SF    +ME+QKSF+G  +EKQKSFR+ MERQLSF 
Sbjct  45    LEKQVSFQGVNVQPKTWEVMEKLPSFGKAPSMERQKSFRGGFLEKQKSFRVVMERQLSFI  104

Query  1034  GERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDS-KAIKDTLSKQNQEGETALYV  1210
             GER++  +SPGKRGD+PLH+AAR GNL KV+E+++     + +++ LSKQN EGET LY 
Sbjct  105   GERRKKTESPGKRGDSPLHIAARTGNLGKVKELIRGSSCGEELRELLSKQNLEGETPLYT  164

Query  1211  AAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTD  1390
             AAENGH+ VV E+LK + LET SIA+ NG+D FH+AAKQGHLEVLK+LL  FPNL MTTD
Sbjct  165   AAENGHSFVVEEMLKHMCLETGSIAARNGFDPFHVAAKQGHLEVLKKLLETFPNLAMTTD  224

Query  1391  SSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKD  1570
              S +TALHTAA QGH+DVV+LLLE DSNLAKIA+NNGKT LH+AARMGH++VVKSL+  D
Sbjct  225   LSCTTALHTAATQGHIDVVNLLLETDSNLAKIAKNNGKTALHSAARMGHVDVVKSLIGND  284

Query  1571  PSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQM  1750
             PSIGFRTDKKGQTALHMAVKGQN +IV+EL+KPD +VL++ DNKGNT LHIAT KGR ++
Sbjct  285   PSIGFRTDKKGQTALHMAVKGQNDEIVVELVKPDVAVLSVEDNKGNTPLHIATNKGRVKI  344

Query  1751  VQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLK  1930
             VQ L+S EGIN+N +NKAG+T LDIAEK G  ++V++LKEAGA  +KD GKP + AKQLK
Sbjct  345   VQCLVSFEGINLNPINKAGDTPLDIAEKIGNGELVSVLKEAGAATAKDLGKPQNPAKQLK  404

Query  1931  QTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaa  2110
             QTVSDIKH+V+SQLQQSRQTG +V+KIAK++KKLHISGLNNAINS TVVAVLIATVAFAA
Sbjct  405   QTVSDIKHEVQSQLQQSRQTGVRVQKIAKRLKKLHISGLNNAINSATVVAVLIATVAFAA  464

Query  2111  iftvPGQYVEKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKA  2290
             IFT+PGQY E   KG  LG+A++AN+A F+VFF+FDSLALFIS+AVVVVQTSVVVIEQKA
Sbjct  465   IFTIPGQYEEDPSKGALLGQAHIANRAPFLVFFIFDSLALFISLAVVVVQTSVVVIEQKA  524

Query  2291  KKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYC  2470
             KK++VF+INKLMW ACLFISIAF+SL+Y+VVG  + WLA+ +TV+GG IML TIG+MCYC
Sbjct  525   KKKLVFVINKLMWCACLFISIAFVSLSYIVVGKEDMWLAVCATVIGGTIMLPTIGAMCYC  584

Query  2471  VVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESY-KRMYAV  2608
             VV HR+EES++R+IRK  + S+SFSMS + SDSE+ N  Y KRMYA+
Sbjct  585   VVMHRMEESKLRSIRKERSKSQSFSMSRMASDSEILNGEYNKRMYAL  631



>ref|XP_009144041.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat-containing protein 
At5g02620 [Brassica rapa]
Length=644

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/601 (67%), Positives = 493/601 (82%), Gaps = 29/601 (5%)
 Frame = +2

Query  893   MEKQASFRGV--------------MEKQQSFRN------------MEKQKSFKG-LMEKQ  991
             +EKQ SF+GV              MEKQQSFR             ME+QKSF+G  +EKQ
Sbjct  44    LEKQVSFQGVSVENHHHPSRLGRSMEKQQSFRGVATAENQKRGVIMERQKSFRGGFLEKQ  103

Query  992   KSFRIAMERQLSFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQR-FDSKAIKDT  1168
             KSFR+ MERQLSF GER++  +SPGKRGD+PLH+AAR GNL KVRE+++   D + +++ 
Sbjct  104   KSFRVVMERQLSFIGERRKKTESPGKRGDSPLHIAARTGNLGKVRELIRGGCDGEELREL  163

Query  1169  LSKQNQEGETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLK  1348
             LSKQN EGET LY AAENGH+ VV E+L+++DL+TASIA+ NG+D FH+AAKQGHLEVLK
Sbjct  164   LSKQNLEGETPLYTAAENGHSAVVEEMLERMDLQTASIAARNGFDPFHVAAKQGHLEVLK  223

Query  1349  ELLNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAAR  1528
              LL  FPNL MTTD   +TALHTAA QGH+DVV+LLLE DSNLAKIA+NNGKT LH+AAR
Sbjct  224   ILLETFPNLAMTTDLLCTTALHTAATQGHIDVVNLLLETDSNLAKIAKNNGKTALHSAAR  283

Query  1529  MGHLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGN  1708
             MGH+EVVKSL+  DPSIGFRTDKKGQT LHMAV  QN  +V+EL+KPD +VL++ DNKGN
Sbjct  284   MGHVEVVKSLMGNDPSIGFRTDKKGQTDLHMAVXSQNDGVVVELVKPDVAVLSVEDNKGN  343

Query  1709  TALHIATRKGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHS  1888
             T LHIAT KGR ++V+ L+S EGIN+N +NKAG+T LD+AE+ G  ++ ++LKEAGA  +
Sbjct  344   TPLHIATNKGRIKIVRCLLSFEGINLNPINKAGDTPLDVAERIGNAELASVLKEAGAATA  403

Query  1889  KDHGKPPSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSl  2068
             KD GKP + AKQLKQTVSDIKH+V+SQLQQSRQTG +V+KIAK++KKLHISGLNNAINS 
Sbjct  404   KDLGKPQNPAKQLKQTVSDIKHEVQSQLQQSRQTGVRVQKIAKRLKKLHISGLNNAINSA  463

Query  2069  tvvavliatvafaaiftvPGQYVEKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAv  2248
             TVVAVLIATVAFAAIFT+PGQY E   KG  LG+A++ANKA F+VFF+FDSLALFIS+AV
Sbjct  464   TVVAVLIATVAFAAIFTIPGQYEEDRSKGELLGQAHIANKAPFLVFFIFDSLALFISLAV  523

Query  2249  vvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVG  2428
             VVVQTSVVVIE+KAKK++VF+INKLMW ACLFISIAF+SL+Y+VVG  E WLA+ +TV+G
Sbjct  524   VVVQTSVVVIEEKAKKKLVFVINKLMWCACLFISIAFVSLSYIVVGKEEMWLAVCATVIG  583

Query  2429  GVIMLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESY-KRMYA  2605
             G IMLTTIG+MCYCV+ HR+EES++++IRK  + S+SFSMS +PSDSE+ N  Y KRMYA
Sbjct  584   GTIMLTTIGAMCYCVIMHRVEESKLKSIRKERSKSQSFSMSRMPSDSEILNGEYNKRMYA  643

Query  2606  V  2608
             +
Sbjct  644   L  644



>ref|XP_010469665.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Camelina 
sativa]
Length=668

 Score =   745 bits (1923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/591 (69%), Positives = 490/591 (83%), Gaps = 19/591 (3%)
 Frame = +2

Query  893   MEKQASFRGV-----------MEKQQSF--RNMEKQKSFKG-LMEKQKSFRIAMERQLSF  1030
             MEKQ SFRGV           MEK  SF    ME+QKSF+G  +EKQKSFR+ MERQLSF
Sbjct  78    MEKQQSFRGVNVENNNHKRGVMEKLPSFGKATMERQKSFRGGFLEKQKSFRVVMERQLSF  137

Query  1031  GGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKA----IKDTLSKQNQEGET  1198
              GER++  +SPGKRGD+ LH+AAR GNL KV+E+++   +      +K+ LSKQN EGE 
Sbjct  138   IGERRKKTESPGKRGDSSLHIAARTGNLGKVKELIRGCGNDGRGDELKELLSKQNLEGEN  197

Query  1199  ALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLV  1378
              LY AAE GH++VV E+L  +DLETASIA+ NG+D FH+AAKQGHLEVLK LL  FPNL 
Sbjct  198   PLYTAAEMGHSVVVEEMLTHMDLETASIAARNGFDPFHVAAKQGHLEVLKILLEAFPNLA  257

Query  1379  MTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSL  1558
             MTTD S +TALHTAA QGH+DVV+LLLE DSNLAKIA+NNGKT LH+AARMGH+EVVKSL
Sbjct  258   MTTDLSCTTALHTAATQGHIDVVNLLLETDSNLAKIAKNNGKTALHSAARMGHVEVVKSL  317

Query  1559  VNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKG  1738
             +  DPSIGFRTDKKGQTALHMAVKGQN  IV+EL+KPD +VL++ DNKGNT LHIAT KG
Sbjct  318   IGNDPSIGFRTDKKGQTALHMAVKGQNDGIVVELVKPDVAVLSVEDNKGNTPLHIATNKG  377

Query  1739  RPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAA  1918
             R ++V+ L+S EGIN+N +NKAG+T LDIAEK G  ++V++LKEA A  +KD GKP + A
Sbjct  378   RIKIVRCLVSFEGINLNPINKAGDTPLDIAEKIGNAELVSVLKEARAATAKDLGKPQNPA  437

Query  1919  KQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatv  2098
             KQLKQTVSDIKH+V+SQLQQSRQTG +V+KIAK++KKLHISGLNNAINS TVVAVLIATV
Sbjct  438   KQLKQTVSDIKHEVQSQLQQSRQTGVRVQKIAKRLKKLHISGLNNAINSATVVAVLIATV  497

Query  2099  afaaiftvPGQYVEKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvI  2278
             AFAAIFT+PGQY E   KG  LG+A++ANKA F+VFF+FDSLALFIS+AVVVVQTSVVVI
Sbjct  498   AFAAIFTIPGQYEEDRSKGPLLGQAHIANKAPFLVFFIFDSLALFISLAVVVVQTSVVVI  557

Query  2279  EQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGS  2458
             EQKAKK++VF+INKLMW ACLFISIAF+SL+Y+VVG +E WLA+ +TV+GG IMLTTIG+
Sbjct  558   EQKAKKKLVFVINKLMWCACLFISIAFVSLSYIVVGKQEIWLAVCATVIGGTIMLTTIGA  617

Query  2459  MCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESY-KRMYAV  2608
             MCYCVV HR+EES++R+IRK  + S+SFSMS +PSDS++ N  Y KRMYA+
Sbjct  618   MCYCVVMHRMEESKLRSIRKERSKSQSFSMSRMPSDSDILNGEYNKRMYAL  668



>ref|XP_010522247.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Tarenaya 
hassleriana]
Length=658

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/577 (70%), Positives = 483/577 (84%), Gaps = 14/577 (2%)
 Frame = +2

Query  896   EKQASFRGVMEKQQSF-RNMEKQKSFKGLMEKQKSFRIAMERQLSF---GGERKRGKDSP  1063
             + Q S RGVMEK  SF R M         ME+QKSFR AMERQLSF   GGERK+  +SP
Sbjct  90    QNQPSKRGVMEKLPSFGRAM--------FMERQKSFRTAMERQLSFIGGGGERKKKNESP  141

Query  1064  GKRGDNPLHLAARAGNLSKVREILQRFDSKA-IKDTLSKQNQEGETALYVAAENGHTLVV  1240
             GKRGD+PLH AAR GNLSKV EI +  DS+  +K+ +SKQN EGET LY AAENG ++VV
Sbjct  142   GKRGDSPLHTAARTGNLSKVNEIFRSCDSREELKELMSKQNLEGETPLYAAAENGFSVVV  201

Query  1241  GEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTA  1420
              E+LK +DL+TASI + NG+D FH+AAK GHLEVLK+LL  FPNL MTTD S +TALHTA
Sbjct  202   EEMLKHIDLDTASIPARNGFDPFHVAAKHGHLEVLKKLLETFPNLAMTTDLSCTTALHTA  261

Query  1421  AGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKK  1600
             A QGH+D+V+LLL+ DSNLAKIA+NNGKT LH+AARMGHLEVVKSLV+KDP+ GFRTDKK
Sbjct  262   ATQGHIDIVNLLLDTDSNLAKIAKNNGKTALHSAARMGHLEVVKSLVSKDPTTGFRTDKK  321

Query  1601  GQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGI  1780
             GQT LHMAVKGQN DIVLEL+KPDP+VL L DNKGNT LHIAT KGR ++V+ L+S + I
Sbjct  322   GQTPLHMAVKGQNEDIVLELVKPDPAVLILEDNKGNTPLHIATNKGRTKIVRCLVSFDSI  381

Query  1781  NINTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDV  1960
             ++N +NKAGET LDIAE+ G P++V++LKEAGA  +KD G+P + AKQLKQTVSDIKH+V
Sbjct  382   SLNAINKAGETVLDIAERIGNPELVSVLKEAGAATAKDLGRPQNPAKQLKQTVSDIKHEV  441

Query  1961  ESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVE  2140
             +SQLQQS+QTG +V+KIAK++KKLHISGLNNAINS TVVAVLIATVAFAAIFT+PGQY E
Sbjct  442   KSQLQQSQQTGVRVQKIAKRLKKLHISGLNNAINSATVVAVLIATVAFAAIFTIPGQYEE  501

Query  2141  KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINK  2320
                KG  LG+A++A+KA F+VFF+FDSLALFIS+AVVVVQTSVVVIEQKAKK++VF+INK
Sbjct  502   DPSKGPLLGQAHIADKAPFLVFFVFDSLALFISLAVVVVQTSVVVIEQKAKKRLVFVINK  561

Query  2321  LMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESR  2500
             LMW ACLFISIAF+SLTY+VVG  E WLA+ +TV+GG IMLTTIG+MCYCVV HR+EES+
Sbjct  562   LMWLACLFISIAFVSLTYIVVGKDEMWLAVCATVIGGTIMLTTIGAMCYCVVMHRMEESK  621

Query  2501  MRNIRKAETLSRSFSMSMVPSDSELYNESY-KRMYAV  2608
             +R+IRK  + SRSFS+S + SDSE+ N  Y KRMYA+
Sbjct  622   LRSIRKERSKSRSFSVSRMASDSEILNGEYNKRMYAL  658



>gb|EPS61029.1| hypothetical protein M569_13769, partial [Genlisea aurea]
Length=568

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/570 (69%), Positives = 476/570 (84%), Gaps = 7/570 (1%)
 Frame = +2

Query  914   RGVMEKQQSFRN-MEKQKSFKGLMEKQKSFRIAMERQLSFGG--ERKRGKDSPGKRGDNP  1084
             +G MEKQ+SF+  MEKQKSFKG MEKQKSFRI MERQ SFG   +R++ KDSPGKRGD+P
Sbjct  1     KGPMEKQKSFKGPMEKQKSFKGPMEKQKSFRIVMERQNSFGASADRRKSKDSPGKRGDSP  60

Query  1085  LHLAARAGNLSKVREILQRFDSK--AIKDTLSKQNQEGETALYVAAENGHTLVVGEILKQ  1258
             LHLAARAGNL K REI+Q+  S   A+K+ +SKQN EGET LYVAA+NGH  VV E LK 
Sbjct  61    LHLAARAGNLGKAREIIQKIGSSENAVKELMSKQNHEGETPLYVAADNGHISVVAEFLKH  120

Query  1259  LDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQGHV  1438
              D ET +I +NNG+D FH+AAKQGH+EV+K++L  FP LVMTTD++NST LHTAA  GH 
Sbjct  121   SDAETCAIPANNGFDPFHVAAKQGHIEVVKQMLQSFPTLVMTTDATNSTVLHTAAALGHK  180

Query  1439  DVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQTALH  1618
              +VDLLL+ DSNLAKIARNNGKTVLHT ARMG+LEV+KSL++ DP   FRTD+KGQT LH
Sbjct  181   HIVDLLLDADSNLAKIARNNGKTVLHTVARMGNLEVMKSLLSSDPGSVFRTDRKGQTPLH  240

Query  1619  MAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGININTVN  1798
             MAVKGQNVD+V EL+K DPSVL+  DNKGNTALH A  KGR ++V  L+S+EGI++N VN
Sbjct  241   MAVKGQNVDVVQELVKHDPSVLSPEDNKGNTALHTAIIKGRSKIVLFLLSVEGIDVNAVN  300

Query  1799  KAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQLQQ  1978
              +GET LDIA+KFG+ ++ TML+ AGA HS +  KP SAAKQLKQTVSDIKHDV+SQLQQ
Sbjct  301   GSGETPLDIADKFGSTEMTTMLQRAGAAHS-EAKKPQSAAKQLKQTVSDIKHDVKSQLQQ  359

Query  1979  SRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKEKKGF  2158
             +RQTGF+V++IA KVKKLH  GLNNAI S TVVAVLIATVAFAAIF VPGQYV   + GF
Sbjct  360   ARQTGFRVKRIANKVKKLHTEGLNNAITSATVVAVLIATVAFAAIFIVPGQYVGSPQDGF  419

Query  2159  TLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKLMWGAC  2338
             +LGEANVAN  AF++FFLFDS+ALFIS+AVV+VQTSVVVIE +AKKQ++F+INK MW AC
Sbjct  420   SLGEANVANDPAFLLFFLFDSVALFISLAVVLVQTSVVVIEHRAKKQLMFVINKFMWMAC  479

Query  2339  LFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRMRNIRK  2518
             LFIS AF+SLTY+VVG +++ LAIY+T++G  +MLTTIGSMCYC+VRHR+E+SRMR++R+
Sbjct  480   LFISAAFVSLTYIVVGPQQRGLAIYATILGSTVMLTTIGSMCYCIVRHRMEDSRMRSLRR  539

Query  2519  AETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
               T SRS SMS V SD+ELY+E Y RMYA+
Sbjct  540   NSTHSRSMSMS-VASDTELYSERYNRMYAL  568



>ref|XP_007203633.1| hypothetical protein PRUPE_ppa003989mg [Prunus persica]
 gb|EMJ04832.1| hypothetical protein PRUPE_ppa003989mg [Prunus persica]
Length=536

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/537 (75%), Positives = 468/537 (87%), Gaps = 5/537 (1%)
 Frame = +2

Query  1010  MERQLSF-GGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFD-SKAIKDTLSKQN  1183
             ME+QLSF GGER++ K+SPGKRGD+ LHLAARAGNL +V+E+LQ  + S      LSK N
Sbjct  1     MEKQLSFIGGERRKSKESPGKRGDSQLHLAARAGNLVRVKEVLQNCNNSNESIGLLSKTN  60

Query  1184  QEGETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNV  1363
             QEGET LY +A+NGH ++VGE+L  +DL+TASI + NGYD FHIA +QGHLEVLKELL+V
Sbjct  61    QEGETPLYASADNGHAVIVGEMLTHMDLQTASITARNGYDPFHIAVRQGHLEVLKELLHV  120

Query  1364  FPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLE  1543
             FPNL MTTD SNSTALHTAA QGH+D+V+LLLE DSNLAKIARNNGKTVLH+AARMGHLE
Sbjct  121   FPNLAMTTDLSNSTALHTAATQGHIDIVNLLLETDSNLAKIARNNGKTVLHSAARMGHLE  180

Query  1544  VVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHI  1723
             VVKSL NKDPS  FRTD KGQTALHMAVKG N +IVLEL+KPDPSVL + DNKGNTALHI
Sbjct  181   VVKSLQNKDPSAAFRTDLKGQTALHMAVKGHNEEIVLELLKPDPSVLTVEDNKGNTALHI  240

Query  1724  ATRKGRPQMVQRLISI--EGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDH  1897
             ATRKGR + V+ L+SI  +G NIN  NKAGET+LDIAEKFGTP++V++LKEAGAT+SKD 
Sbjct  241   ATRKGRIENVRCLLSINNDGSNINASNKAGETSLDIAEKFGTPELVSVLKEAGATNSKDQ  300

Query  1898  GKPPSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvv  2077
             GKP + AKQLKQTVSDIKHDV+SQL+Q+RQTG +V+KIAKK+KKLHISGLNNAINS TVV
Sbjct  301   GKPANPAKQLKQTVSDIKHDVQSQLKQTRQTGARVQKIAKKLKKLHISGLNNAINSATVV  360

Query  2078  avliatvafaaiftvPGQYVEKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvv  2257
             AVLIATVAFAAIFTVPGQYVE++  G TLG+A++AN AAFI+FF+FDSLALFIS+AVVVV
Sbjct  361   AVLIATVAFAAIFTVPGQYVEEKTSGLTLGQAHIANNAAFIIFFVFDSLALFISLAVVVV  420

Query  2258  qtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVI  2437
             QTSVVVIEQKAKKQ+VF+INKLMW ACLFISIAFISLTYVVVG+  +WLA+Y+TV+G  I
Sbjct  421   QTSVVVIEQKAKKQLVFVINKLMWLACLFISIAFISLTYVVVGSHSRWLAVYATVIGSTI  480

Query  2438  MLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             MLTTIGSMCYCV+ HR+EES+MRNIR+AE+ SRS     + S+ E+ N  YKRMYA+
Sbjct  481   MLTTIGSMCYCVILHRMEESKMRNIRRAESRSRS-FSMSMASEHEILNSEYKRMYAL  536



>emb|CDY58363.1| BnaCnng33120D [Brassica napus]
Length=556

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/556 (71%), Positives = 477/556 (86%), Gaps = 3/556 (1%)
 Frame = +2

Query  950   MEKQKSFKG-LMEKQKSFRIAMERQLSFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVR  1126
             ME+QKSF+G  +EKQKSFR+ MERQLSF GER++  +SPGKRGD+PLH+AAR GNL KV+
Sbjct  1     MERQKSFRGGFLEKQKSFRVVMERQLSFIGERRKKTESPGKRGDSPLHIAARTGNLGKVK  60

Query  1127  EILQRFDS-KAIKDTLSKQNQEGETALYVAAENGHTLVVGEILKQLDLETASIASNNGYD  1303
             E+++     + +++ LSKQN EGET LY AAENGH+ VV E+LK + LET SIA+ NG+D
Sbjct  61    ELIRGSSCDEELRELLSKQNLEGETPLYTAAENGHSFVVEEMLKHMCLETGSIAARNGFD  120

Query  1304  AFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAK  1483
              FH+AAKQGHLEVLK+LL  FPNL MTTD S +TALHTAA QGH+DVV+LLLE DSNLAK
Sbjct  121   PFHVAAKQGHLEVLKKLLETFPNLAMTTDLSCTTALHTAAAQGHIDVVNLLLETDSNLAK  180

Query  1484  IARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELI  1663
             IA+NNGKT LH+AARMGH+EVVKSL+  DPSIGFRTDKKGQTALHMAVKGQN +IV+EL+
Sbjct  181   IAKNNGKTALHSAARMGHVEVVKSLIGNDPSIGFRTDKKGQTALHMAVKGQNDEIVVELV  240

Query  1664  KPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGININTVNKAGETALDIAEKFGT  1843
             KPD +VL++ DNKGNT LHIAT KGR ++VQ L S EGIN+N +NKAG+T LDIAEK G 
Sbjct  241   KPDVAVLSVEDNKGNTPLHIATNKGRVKIVQCLESFEGINLNPINKAGDTPLDIAEKIGN  300

Query  1844  PDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkv  2023
              ++V++LKEAGA  +KD GKP + AKQLKQTVSDIKH+V+SQLQQS+QTG +V+KIAK++
Sbjct  301   GELVSVLKEAGAATAKDLGKPQNPAKQLKQTVSDIKHEVQSQLQQSKQTGVRVQKIAKRL  360

Query  2024  kkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKEKKGFTLGEANVANKAAFIV  2203
             KKLHISGLNNAINS TVVAVLIATVAFAAIFT+PGQY E   KG  LG+A++AN+A F+V
Sbjct  361   KKLHISGLNNAINSATVVAVLIATVAFAAIFTIPGQYEEDPSKGALLGQAHIANRAPFLV  420

Query  2204  FFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVV  2383
             FF+FDSLALFIS+AVVVVQTSVVVIEQKAKK++VF+INKLMW ACLFISIAF+SL+Y+VV
Sbjct  421   FFVFDSLALFISLAVVVVQTSVVVIEQKAKKKLVFVINKLMWCACLFISIAFVSLSYIVV  480

Query  2384  GTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPS  2563
             G  ++WLA+ +TV+GG IML TIG+MCYCVV HR+EES++R+IRK  + S+SFSMS + S
Sbjct  481   GKEDEWLAVCATVIGGTIMLPTIGAMCYCVVMHRMEESKLRSIRKERSKSQSFSMSRMAS  540

Query  2564  DSELYNESY-KRMYAV  2608
             DSE+ N  Y KRMYA+
Sbjct  541   DSEILNGEYNKRMYAL  556



>ref|XP_002309714.2| hypothetical protein POPTR_0007s00400g [Populus trichocarpa]
 gb|EEE90164.2| hypothetical protein POPTR_0007s00400g [Populus trichocarpa]
Length=663

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/585 (70%), Positives = 482/585 (82%), Gaps = 16/585 (3%)
 Frame = +2

Query  890   IMEKQASFRGV----------MEKQQSFRNMEKQKSFKGLMEKQKSFRIAMERQLSF--G  1033
             +MEK  SF+GV          +EK  SFR +EK   F+G ++KQKSFR+ MERQLSF  G
Sbjct  83    VMEKLPSFQGVAENGSASHRVIEKHPSFRGVEK--GFRGFLDKQKSFRVVMERQLSFIGG  140

Query  1034  GERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVA  1213
             GERK+ KDSPGKRGD+ +HLAAR GNLS+VREILQ  D   ++  L+ QN EGET LY A
Sbjct  141   GERKKTKDSPGKRGDSQIHLAARTGNLSRVREILQNSDGTDLEVLLAMQNHEGETPLYAA  200

Query  1214  AENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDS  1393
             AENGH  VV E+L+ +DLETASIA+ NGYD FH+AAKQGHL+VL++LL VFPNL MTTDS
Sbjct  201   AENGHAEVVAEMLESMDLETASIAARNGYDPFHVAAKQGHLDVLRKLLGVFPNLAMTTDS  260

Query  1394  SNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDP  1573
             S +TALHTAA QGH+DVV+LLLE D+NL KIARNNGKTVLH+AARMGHLEVV+SL+ KD 
Sbjct  261   SCTTALHTAATQGHIDVVNLLLETDANLVKIARNNGKTVLHSAARMGHLEVVRSLLIKDS  320

Query  1574  SIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMV  1753
             S GFRTDKKGQTALHMAVKGQN +IVLEL+KPDPSV+ + DNKGNTALH+A +KGR Q V
Sbjct  321   STGFRTDKKGQTALHMAVKGQNEEIVLELLKPDPSVMHVEDNKGNTALHVAIKKGRAQNV  380

Query  1754  QRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQ  1933
             + L+S+EG+NIN +NKAGET LDIAEK G  D+V +LKEAGA +SKD GKPPS+AKQLKQ
Sbjct  381   RCLLSVEGVNINAINKAGETPLDIAEKLGVQDLVYILKEAGANNSKDCGKPPSSAKQLKQ  440

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVS IKHDV+SQLQQ+RQTGFKV+KIAKK+KKLHISGLNNAIN+ T+VAVLIATVAFAAI
Sbjct  441   TVSAIKHDVQSQLQQTRQTGFKVQKIAKKLKKLHISGLNNAINNATIVAVLIATVAFAAI  500

Query  2114  ftvPGQYVEKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAK  2293
             FTVPGQYVE++  G  +G+A+VA   AF+VF +FDSLALFIS+AVVVVQTSVVVIEQK K
Sbjct  501   FTVPGQYVEEKTDGAAIGQAHVARNPAFLVFIIFDSLALFISLAVVVVQTSVVVIEQKGK  560

Query  2294  KQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCV  2473
             KQ+VFIINKLMW ACLFIS AFISLTYVVVG + +WLAIY+TV+GG+IML TIGSMCY V
Sbjct  561   KQLVFIINKLMWLACLFISAAFISLTYVVVGKKFRWLAIYATVLGGIIMLATIGSMCYFV  620

Query  2474  VRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             + HR+EES +RNIR+          +   SD E+ N   KRMYA+
Sbjct  621   ILHRMEESTLRNIRRESRSRSYSMSA--ASDQEILNSECKRMYAL  663



>ref|XP_011005262.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Populus 
euphratica]
 ref|XP_011005263.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Populus 
euphratica]
 ref|XP_011005264.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Populus 
euphratica]
Length=623

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/585 (70%), Positives = 477/585 (82%), Gaps = 16/585 (3%)
 Frame = +2

Query  890   IMEKQASFRGV----------MEKQQSFRNMEKQKSFKGLMEKQKSFRIAMERQLSF--G  1033
             +MEK  SF GV          MEK  SFR +EK    +G ++KQKSFR+ MERQLSF  G
Sbjct  43    VMEKHPSFLGVAENGSASHRVMEKHPSFRGVEK--GLRGFLDKQKSFRVVMERQLSFIGG  100

Query  1034  GERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVA  1213
             GERK+ KDSPGKRGD+ +HLAAR GNL +VREIL+  D   +K  L+ QN EGET LY A
Sbjct  101   GERKKTKDSPGKRGDSQIHLAARTGNLGRVREILRNSDGTDLKVLLAMQNHEGETPLYAA  160

Query  1214  AENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDS  1393
             AENGH  VV E+L+ +DLETASIA+ NGYD FH+AAKQGHL+VL++LL VFPNL MTTDS
Sbjct  161   AENGHAEVVAEMLESMDLETASIAARNGYDPFHVAAKQGHLDVLRKLLGVFPNLAMTTDS  220

Query  1394  SNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDP  1573
             S +TALHTAA QGH+DVV+LLLE D+NL KIARNNGKTVLH+AARMGHLEVV+SL+ KD 
Sbjct  221   SCTTALHTAATQGHIDVVNLLLETDANLVKIARNNGKTVLHSAARMGHLEVVRSLLIKDS  280

Query  1574  SIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMV  1753
             S GFRTDKKGQTALHMAVKGQN +IVLEL+KPDPSV+ + DNKGNTALH+A +KGR Q V
Sbjct  281   STGFRTDKKGQTALHMAVKGQNEEIVLELLKPDPSVMHVEDNKGNTALHVAIKKGRAQNV  340

Query  1754  QRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQ  1933
             + L+S+EG+NIN  NKAGET LDIAEK G  D+V +LKEAGA +SKD GKPPS+AKQLKQ
Sbjct  341   RCLLSVEGVNINAFNKAGETPLDIAEKLGVQDLVCILKEAGANNSKDCGKPPSSAKQLKQ  400

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVS IKHDV+SQLQQ+RQTGFKV+KIAKK+KKLHISGLNNAIN+ T+VAVLIATVAFAAI
Sbjct  401   TVSAIKHDVQSQLQQTRQTGFKVQKIAKKLKKLHISGLNNAINNATIVAVLIATVAFAAI  460

Query  2114  ftvPGQYVEKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAK  2293
             FTVPGQYVE++  G  +G+A VA   AF+VF +FDSLALFIS+AVVVVQTSVVVIEQK K
Sbjct  461   FTVPGQYVEEKTDGAAIGQARVARNPAFLVFIVFDSLALFISLAVVVVQTSVVVIEQKGK  520

Query  2294  KQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCV  2473
             KQ+VFIINKLMW ACLFIS AFISLTYVVVG + +WLAIY+TV+GG+IML TIGSMCY V
Sbjct  521   KQLVFIINKLMWLACLFISAAFISLTYVVVGKKFRWLAIYATVLGGIIMLATIGSMCYFV  580

Query  2474  VRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             + HR+EES +RNIR+          +   SD E+ N   KRMYA+
Sbjct  581   ILHRMEESTLRNIRRESRSRSYSMSA--ASDQEILNSECKRMYAL  623



>ref|XP_006307001.1| hypothetical protein CARUB_v10008579mg [Capsella rubella]
 gb|EOA39899.1| hypothetical protein CARUB_v10008579mg [Capsella rubella]
Length=626

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/600 (67%), Positives = 493/600 (82%), Gaps = 19/600 (3%)
 Frame = +2

Query  860   GRERDSL*G*IMEKQASFRG-----------VMEKQQSFRNMEKQKSFKGLMEKQKSFRI  1006
             G E  +  G  +EKQ SF+             MEKQ   + ME+Q+SF+G +EKQKSFRI
Sbjct  29    GGENQARKGRPLEKQVSFQAGNVEKHGIKGRAMEKQD--KAMERQRSFRGFVEKQKSFRI  86

Query  1007  AMERQLSF---GGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSK-AIKDTLS  1174
              MERQLSF   GGERK+  +SPGKRGD PLH+AAR GNL KV E+++  +S   +K+ LS
Sbjct  87    VMERQLSFMNGGGERKKKNESPGKRGDFPLHIAARTGNLGKVMELIRGCNSTLELKELLS  146

Query  1175  KQNQEGETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKEL  1354
             KQN EGET LY AAENG++LVV E+LK +DL+TASIA+ NG+D FH+AAKQGHLE LK+L
Sbjct  147   KQNLEGETPLYTAAENGYSLVVEEMLKHMDLDTASIAARNGFDPFHVAAKQGHLEALKKL  206

Query  1355  LNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMG  1534
             L  FPNL MTTDSS +TALHTAA QGHVDVVDLLL+ + +LAKIA+NNGKT LH+AARMG
Sbjct  207   LETFPNLAMTTDSSCTTALHTAATQGHVDVVDLLLKTNPHLAKIAKNNGKTALHSAARMG  266

Query  1535  HLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTA  1714
             H EVVKSL+  D SIGFRTDKKGQTALHMAVKGQN  IVLEL+KPDP+VL++ +NKGN  
Sbjct  267   HREVVKSLIGSDASIGFRTDKKGQTALHMAVKGQNEGIVLELVKPDPAVLSVENNKGNLP  326

Query  1715  LHIATRKGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKD  1894
             LH+AT KGR ++V+ L+S +GIN+N +NKAG+TALDIAEK G  ++V +LKEAGA  +KD
Sbjct  327   LHVATNKGRTKIVRCLVSFDGINLNAMNKAGDTALDIAEKIGNSELVLVLKEAGAATAKD  386

Query  1895  HGKPPSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltv  2074
              GKP + AKQLKQTVSDIKH+V+SQLQQSRQTG +V++IAKK+KKLHI+GLNNAINS TV
Sbjct  387   LGKPQNPAKQLKQTVSDIKHEVQSQLQQSRQTGVRVQRIAKKLKKLHINGLNNAINSATV  446

Query  2075  vavliatvafaaiftvPGQYVEKEKKG-FTLGEANVANKAAFIVFFLFDSLALFISIAvv  2251
             VAVLIATVAFAAIFT+PGQY E+  KG  +LGEA +ANK  F+VFF+FDSLALFIS+AVV
Sbjct  447   VAVLIATVAFAAIFTIPGQYEEERTKGPLSLGEARIANKGPFLVFFIFDSLALFISLAVV  506

Query  2252  vvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGG  2431
             VVQTSVVVIEQKAKK++VF+INKLMW ACLFISIAF+SL+++VVG  + WLAI +TV+GG
Sbjct  507   VVQTSVVVIEQKAKKKLVFVINKLMWLACLFISIAFVSLSFIVVGEEDIWLAICATVIGG  566

Query  2432  VIMLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESY-KRMYAV  2608
              IMLTTIG+MCYCVV HR+EE +++++RK  + S+SFS+S +PS+SE+ N  + KRMYA+
Sbjct  567   TIMLTTIGAMCYCVVMHRIEECKLKSLRKERSKSKSFSLSHMPSESEILNSEFNKRMYAL  626



>ref|XP_010457656.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Camelina 
sativa]
Length=626

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/602 (66%), Positives = 495/602 (82%), Gaps = 23/602 (4%)
 Frame = +2

Query  860   GRERDSL*G*IMEKQASFRG-----------VMEKQQSFRNMEKQKSFKGLMEKQKSFRI  1006
             G E  +  G  +EKQ SF+             +EKQ   + ME+Q SF+G +EKQKSFRI
Sbjct  29    GSENQARKGIPLEKQVSFQAGNVEKHGIKGRALEKQD--KAMERQGSFRGFVEKQKSFRI  86

Query  1007  AMERQLSF--GGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTL---  1171
              MERQLSF  G ERK+  +SPGKRGD+PLH+AAR GNL KV E+++  D  +I+D L   
Sbjct  87    IMERQLSFMNGSERKKKNESPGKRGDSPLHIAARTGNLGKVMELIR--DCNSIQDQLKLL  144

Query  1172  -SKQNQEGETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLK  1348
              +KQN EGET LY A+ENG++LVV E+LK +DL+TASIA+ NG+D FH+AAKQGHLEVLK
Sbjct  145   FTKQNLEGETPLYTASENGYSLVVEEMLKHMDLDTASIAARNGFDPFHVAAKQGHLEVLK  204

Query  1349  ELLNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAAR  1528
             +LL  FPNL MTTDSS +TALHTAA QGH+DVV+LLL+ + +LAKIA+NNGKT LH+AAR
Sbjct  205   KLLETFPNLAMTTDSSCTTALHTAATQGHIDVVNLLLKTNPHLAKIAKNNGKTALHSAAR  264

Query  1529  MGHLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGN  1708
             MGH EVVKSL+  D SIGFRTDKKGQTALHMAVKGQN  IVLEL+KPDP+VL++ +NKGN
Sbjct  265   MGHREVVKSLIGNDASIGFRTDKKGQTALHMAVKGQNEGIVLELVKPDPAVLSVENNKGN  324

Query  1709  TALHIATRKGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHS  1888
               LH+AT KGR ++V+ L+  +GI++N  NKAG+TALDIAEK G  ++V++LKEAGA  +
Sbjct  325   MPLHVATNKGRTKIVRCLVLFDGIDLNATNKAGDTALDIAEKIGNSELVSVLKEAGAATA  384

Query  1889  KDHGKPPSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSl  2068
             KD GKP + AKQLKQTVSDIKH+V+SQLQQSRQTG +V++IAK++KKLHISGLNNAINS 
Sbjct  385   KDLGKPQNPAKQLKQTVSDIKHEVQSQLQQSRQTGVRVQRIAKRLKKLHISGLNNAINSA  444

Query  2069  tvvavliatvafaaiftvPGQYVEKEKKG-FTLGEANVANKAAFIVFFLFDSLALFISIA  2245
             TVVAVLIATVAFAAIFT+PGQY E+  KG  +LGEA +ANKA F+VFF+FDSLALFIS+A
Sbjct  445   TVVAVLIATVAFAAIFTIPGQYEEERTKGPLSLGEARIANKAPFLVFFIFDSLALFISLA  504

Query  2246  vvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVV  2425
             VVVVQTSVVVIEQKAKK++VF+INKLMW ACLFISIAF+SL+++VVG ++ WLAI +TV+
Sbjct  505   VVVVQTSVVVIEQKAKKKLVFVINKLMWLACLFISIAFVSLSFIVVGKKDIWLAICATVI  564

Query  2426  GGVIMLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESY-KRMY  2602
             GG IMLTTIG+MCYCVV HR+EES+++++RK  + S+SFS+S +PS+SE+ N  + KRMY
Sbjct  565   GGTIMLTTIGAMCYCVVMHRIEESKLKSLRKERSKSKSFSLSHMPSESEILNSEFNKRMY  624

Query  2603  AV  2608
             A+
Sbjct  625   AL  626



>ref|NP_172055.1| ankyrin repeats-containing protein [Arabidopsis thaliana]
 gb|AAD30616.1|AC007153_8 Hypothetical protein [Arabidopsis thaliana]
 gb|AEE27870.1| ankyrin repeats-containing protein [Arabidopsis thaliana]
Length=627

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/593 (67%), Positives = 487/593 (82%), Gaps = 20/593 (3%)
 Frame = +2

Query  884   G*IMEKQASFRGV------------MEKQQSFRNMEKQKSFKGLMEKQKSFRIAMERQLS  1027
             G  ++KQ SF  V            MEKQ+  R ME+Q+SF+G +EKQKSFR+ MERQLS
Sbjct  37    GRALDKQVSFLAVNVVEKHGIKGRAMEKQE--RAMERQRSFRGFVEKQKSFRVVMERQLS  94

Query  1028  F---GGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDS-KAIKDTLSKQNQEGE  1195
             F   GGERK+  DSPGKRGD+PLHLAAR GNL KV E+++  +  + +K+  SKQN EGE
Sbjct  95    FMNVGGERKKKTDSPGKRGDSPLHLAARTGNLGKVMELIRACNGIEELKELSSKQNLEGE  154

Query  1196  TALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNL  1375
             T LY AAENGH+LVV E+LK +DL+TAS+ + NG+D FH+AAKQGH+E LK+LL  FPNL
Sbjct  155   TPLYSAAENGHSLVVEEMLKHMDLDTASVKARNGFDPFHVAAKQGHIEALKKLLETFPNL  214

Query  1376  VMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKS  1555
              MT D S +TALHTAA QGH DVV+LLL+ DS+LAKIA+NNGKT LH+AARMGH EVVKS
Sbjct  215   AMTVDLSCTTALHTAASQGHTDVVNLLLKTDSHLAKIAKNNGKTALHSAARMGHREVVKS  274

Query  1556  LVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRK  1735
             L+  D SIGFRTDKKGQTALHMAVKGQN  IVLEL+KPDP++L++ D+KGNT LH AT K
Sbjct  275   LIGNDASIGFRTDKKGQTALHMAVKGQNEGIVLELVKPDPAILSVEDSKGNTPLHTATNK  334

Query  1736  GRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSA  1915
             GR ++V+ L+S +GIN+N +NKAG+TALDIAEK G P++V++LKEAGA  +KD GKP + 
Sbjct  335   GRIKIVRCLVSFDGINLNAMNKAGDTALDIAEKIGNPELVSVLKEAGAATAKDLGKPRNP  394

Query  1916  AKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliat  2095
             AKQL QTVSDIKH+V+SQLQQSRQTG +VR+IAK++KKLHI+GLNNAINS TVVAVLIAT
Sbjct  395   AKQLNQTVSDIKHEVQSQLQQSRQTGVRVRRIAKRLKKLHINGLNNAINSATVVAVLIAT  454

Query  2096  vafaaiftvPGQYVEKEKKG-FTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvv  2272
             VAFAAIFT+PGQY E   KG   LGEA +A KA F+VFF+FDSLALFIS+AVVVVQTSVV
Sbjct  455   VAFAAIFTIPGQYEEDRTKGLLLLGEARIAGKAPFLVFFIFDSLALFISLAVVVVQTSVV  514

Query  2273  vIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTI  2452
             VIEQKAKK +VF+INKLMW ACLFIS+AF+SL+++VVG  + WLAI +T++GG IMLTTI
Sbjct  515   VIEQKAKKNLVFVINKLMWLACLFISVAFVSLSFIVVGKEDIWLAICATIIGGTIMLTTI  574

Query  2453  GSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESY-KRMYAV  2608
             G+MCYCVV HR+EES+++++RK  + S+SFS+S +PS+SE+ N  + KRMYA+
Sbjct  575   GAMCYCVVMHRIEESKLKSLRKERSKSKSFSLSHMPSESEILNGEFNKRMYAL  627



>ref|XP_010485156.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Camelina 
sativa]
Length=629

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/605 (66%), Positives = 494/605 (82%), Gaps = 26/605 (4%)
 Frame = +2

Query  860   GRERDSL*G*IMEKQASFRG-----------VMEKQQSFRNMEKQKSFKGLMEKQKSFRI  1006
             G E  +  G  +EKQ SF+             +EKQ+  + ME+Q SF+G +EKQKSFRI
Sbjct  29    GSENQARKGIPLEKQVSFQAGNAEKHGIKGRALEKQE--KPMERQGSFRGFVEKQKSFRI  86

Query  1007  AMERQLSF-----GGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTL  1171
              MERQLSF     G ERK+  +SPGKRGD+PLH+AAR GNL KV E+++  D  +I+D L
Sbjct  87    IMERQLSFMNGGSGSERKKKNESPGKRGDSPLHIAARTGNLGKVMELIR--DCNSIQDQL  144

Query  1172  ----SKQNQEGETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLE  1339
                 SKQN EGET LY A+ENG +LVV E+LK +DL+TASIA+ NG+D FH+AAKQGHLE
Sbjct  145   KLLLSKQNLEGETPLYTASENGCSLVVEEMLKHMDLDTASIAARNGFDPFHVAAKQGHLE  204

Query  1340  VLKELLNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHT  1519
              LK+LL  FPNL MTTDSS +TALHTAA QGH+DVV+LLL+ + +LAKIA+NNGKT LH+
Sbjct  205   ALKKLLETFPNLAMTTDSSCTTALHTAATQGHIDVVNLLLKTNPHLAKIAKNNGKTALHS  264

Query  1520  AARMGHLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDN  1699
             AARMGH EVVKSL+  D SIGFRTDKKGQTALHMAVKGQN  IVLEL+KPDP+VL++ +N
Sbjct  265   AARMGHREVVKSLIGNDASIGFRTDKKGQTALHMAVKGQNEGIVLELVKPDPAVLSVENN  324

Query  1700  KGNTALHIATRKGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGA  1879
             KGN  LH+AT KGR ++V+ L+  +GIN+N +NKAG+TALDIAEK G  ++V++LKEAGA
Sbjct  325   KGNMPLHVATNKGRTKIVRCLVLFDGINLNAMNKAGDTALDIAEKTGNSELVSVLKEAGA  384

Query  1880  THSKDHGKPPSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAI  2059
               +KD GKP + AKQLKQTVSDIKH+V+SQLQQSRQTG +V+KIAK++KKLHISGLNNAI
Sbjct  385   ATAKDLGKPQNPAKQLKQTVSDIKHEVQSQLQQSRQTGVRVQKIAKRLKKLHISGLNNAI  444

Query  2060  NSltvvavliatvafaaiftvPGQYVEKEKKG-FTLGEANVANKAAFIVFFLFDSLALFI  2236
             NS TVVAVLIATVAFAAIFT+PGQY E+  KG  +LGEA +ANKA F+VFF+FDSLALFI
Sbjct  445   NSATVVAVLIATVAFAAIFTIPGQYEEERTKGPLSLGEARIANKAPFLVFFIFDSLALFI  504

Query  2237  SIAvvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYS  2416
             S+AVVVVQTSVVVIEQKAKK++VF+INKLMW ACLFISIAF+SL+++VVG  + WLAI +
Sbjct  505   SLAVVVVQTSVVVIEQKAKKKLVFVINKLMWLACLFISIAFVSLSFIVVGKEDIWLAICA  564

Query  2417  TVVGGVIMLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESY-K  2593
             T++GG IMLTTIG+MCYCVV HR+EES+++++RK  + S+SFS+S +PS+SE+ N  + K
Sbjct  565   TIIGGTIMLTTIGAMCYCVVMHRIEESKLKSLRKERSKSKSFSLSHMPSESEILNSEFNK  624

Query  2594  RMYAV  2608
             RMYA+
Sbjct  625   RMYAL  629



>ref|XP_010475269.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Camelina 
sativa]
Length=630

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/609 (66%), Positives = 496/609 (81%), Gaps = 27/609 (4%)
 Frame = +2

Query  851   RR*GRERDSL*G*IMEKQASF------------RGVMEKQQSFRNMEKQKSFKGLMEKQK  994
             RR G E  +  G  +EKQ SF            RG +EKQ   + ME+Q SF+G +EKQK
Sbjct  26    RRVGSENQARKGRPLEKQVSFQAGNVEKHGIKGRGALEKQD--KAMERQGSFRGFVEKQK  83

Query  995   SFRIAMERQLSF-----GGERKR-GKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKA  1156
             SFRI MERQLSF     G ERK+  + SPGKRGD+PLH+AAR GNL KV E+++  D  +
Sbjct  84    SFRIIMERQLSFMNGGSGSERKKKNESSPGKRGDSPLHIAARTGNLGKVMELIR--DCNS  141

Query  1157  IKDT---LSKQNQEGETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQ  1327
             I+D    LSKQN EGET LY AAENG++LVV E+LK +DL+TASIA+ NG+D FH+AAKQ
Sbjct  142   IQDLKLLLSKQNLEGETPLYTAAENGYSLVVEEMLKHMDLDTASIAARNGFDPFHVAAKQ  201

Query  1328  GHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKT  1507
              HLE LK+LL  FPNL MTTDSS +TALHTAA QGH+DVV+LLL+ + +LAKIA+NNGKT
Sbjct  202   DHLEALKKLLETFPNLAMTTDSSCTTALHTAATQGHIDVVNLLLKTNPHLAKIAKNNGKT  261

Query  1508  VLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLA  1687
              LH+AARMGH EVVKSL+  D SIGFRTDKKGQTALHMAVKGQN  IVLEL+KPDP+VL+
Sbjct  262   ALHSAARMGHREVVKSLIGNDASIGFRTDKKGQTALHMAVKGQNEGIVLELVKPDPAVLS  321

Query  1688  LGDNKGNTALHIATRKGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLK  1867
             + +NKGN  LH+AT KGR ++V+ L+  +GI++N +NKAG+TALDIAEK G  ++V++LK
Sbjct  322   VENNKGNMPLHVATNKGRTKIVRCLVLFDGIDLNAMNKAGDTALDIAEKTGNSELVSVLK  381

Query  1868  EAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGL  2047
             EAGA  +KD GKP + AKQLKQTVSDIKH+V+SQLQQSRQTG +V++IAK++KKLHISGL
Sbjct  382   EAGAATAKDLGKPQNPAKQLKQTVSDIKHEVQSQLQQSRQTGVRVQRIAKRLKKLHISGL  441

Query  2048  NNAINSltvvavliatvafaaiftvPGQYVEKEKKG-FTLGEANVANKAAFIVFFLFDSL  2224
             NNAINS TVVAVLIATVAFAAIFT+PGQY E+  KG  +LGEA +ANKA F+VFF+FDSL
Sbjct  442   NNAINSATVVAVLIATVAFAAIFTIPGQYEEERTKGPLSLGEARIANKAPFLVFFIFDSL  501

Query  2225  ALFISIAvvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWL  2404
             ALFIS+AVVVVQTSVVVIEQKAKK++VF+INKLMW ACLFISIAF+SL+++VVG  + WL
Sbjct  502   ALFISLAVVVVQTSVVVIEQKAKKKLVFVINKLMWLACLFISIAFVSLSFIVVGKEDIWL  561

Query  2405  AIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNE  2584
             AI +T++GG IMLTTIG+MCYCVV HR+EES+++++RK  + S+SFS+S +PS+SE+ N 
Sbjct  562   AICATIIGGTIMLTTIGAMCYCVVMHRIEESKLKSLRKERSKSKSFSLSHMPSESEILNS  621

Query  2585  SY-KRMYAV  2608
              + KRMYA+
Sbjct  622   EFNKRMYAL  630



>ref|XP_009111045.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Brassica 
rapa]
Length=612

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/577 (67%), Positives = 483/577 (84%), Gaps = 9/577 (2%)
 Frame = +2

Query  893   MEKQASFRGVMEKQQSFRNMEKQKSFKGLMEKQKSFRIAMERQLSF-GGERKRGK-DSPG  1066
             +EKQ SF+   E     R ME+Q+S +G +EKQKSFR+ +ERQLSF  GE+K  K +SPG
Sbjct  40    LEKQVSFQHGTEG----RAMERQRSLRGFVEKQKSFRVVIERQLSFMNGEKKMKKNESPG  95

Query  1067  KRGDNPLHLAARAGNLSKVREILQRFD-SKAIKDTLSKQNQEGETALYVAAENGHTLVVG  1243
             KRGD+PLH+AAR GNL KV E ++  + ++ +K+ LSKQN EGET LY AA+NGH+LVV 
Sbjct  96    KRGDSPLHIAARTGNLGKVLESIRSCNGAEELKELLSKQNLEGETPLYTAADNGHSLVVE  155

Query  1244  EILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAA  1423
             E+LK ++LETASIA+ NG+D FH+AAKQGHLE LK+LL  FPNL MTTD   +TALHTAA
Sbjct  156   EMLKHMNLETASIAARNGFDPFHVAAKQGHLETLKKLLETFPNLAMTTDLLCTTALHTAA  215

Query  1424  GQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKG  1603
              QGH+DVV+LLL+ DS+LAKIA+NNGKT LH+AARMGH+EVVKSL+  D SIGFRTDKKG
Sbjct  216   TQGHIDVVNLLLKTDSHLAKIAKNNGKTALHSAARMGHVEVVKSLIGNDASIGFRTDKKG  275

Query  1604  QTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGIN  1783
             QTALHMAVKG+   IVLEL++PDP VL++ DNKGNT LHIAT+KGR ++V+ L+S +GIN
Sbjct  276   QTALHMAVKGKQEGIVLELVRPDPKVLSVEDNKGNTPLHIATKKGRTKIVRCLVSFDGIN  335

Query  1784  INTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVE  1963
             +N +NKAG+TALDIAEK G  ++V +LKEAGA  +KD GKP + AKQLKQTVSDI+H+V+
Sbjct  336   LNALNKAGDTALDIAEKIGNAELVLVLKEAGAATAKDLGKPQNPAKQLKQTVSDIRHEVQ  395

Query  1964  SQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEK  2143
             SQLQQSRQTG +V++IAK++KKLHI+GLNNAINS TVVAVLIATVAFAAIFT+PGQY E 
Sbjct  396   SQLQQSRQTGARVQRIAKRLKKLHINGLNNAINSATVVAVLIATVAFAAIFTIPGQYEED  455

Query  2144  EKKG-FTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINK  2320
               +G   LGEA +AN+A F+VFF+FDSLALFIS+AVVVVQTSVVVIEQKAKK++VF+INK
Sbjct  456   RTRGPLVLGEARIANEAPFLVFFIFDSLALFISLAVVVVQTSVVVIEQKAKKKLVFVINK  515

Query  2321  LMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESR  2500
             LMW ACLFISIAF+SL+++VVG  + WLAI +TV+GG IMLTTIG+MCYCVV HR+EE +
Sbjct  516   LMWLACLFISIAFVSLSFIVVGKEDMWLAICATVIGGTIMLTTIGAMCYCVVMHRIEECK  575

Query  2501  MRNIRKAETLSRSFSMSMVPSDSELYN-ESYKRMYAV  2608
             ++ +RK  + SRSFS+S +PS+SE+ N E  KRMYA+
Sbjct  576   LKQMRKERSKSRSFSLSHMPSESEILNGELNKRMYAL  612



>emb|CDY15549.1| BnaA08g28330D [Brassica napus]
Length=558

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/558 (68%), Positives = 473/558 (85%), Gaps = 5/558 (1%)
 Frame = +2

Query  950   MEKQKSFKGLMEKQKSFRIAMERQLSF-GGERKRGK-DSPGKRGDNPLHLAARAGNLSKV  1123
             ME+Q+S +G +EKQKSFR+ +ERQLSF  GE+K  K +SPGKRGD+PLH+AAR GNL KV
Sbjct  1     MERQRSLRGFVEKQKSFRVVIERQLSFMNGEKKMKKNESPGKRGDSPLHIAARTGNLGKV  60

Query  1124  REILQRFD-SKAIKDTLSKQNQEGETALYVAAENGHTLVVGEILKQLDLETASIASNNGY  1300
              E ++  + ++ +K+ LSKQN EGET LY AA+NGH+LVV E+LK ++LE ASIA+ NG+
Sbjct  61    LESIRSCNGAEELKELLSKQNLEGETPLYTAADNGHSLVVEEMLKHMNLEIASIAARNGF  120

Query  1301  DAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLA  1480
             D FH+AAKQGHLE LK+LL  FPNL MTTD   +TALHTAA QGH+DVV+LLL+ DS+LA
Sbjct  121   DPFHVAAKQGHLETLKKLLETFPNLAMTTDLLCTTALHTAATQGHIDVVNLLLKTDSHLA  180

Query  1481  KIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLEL  1660
             KIA+NNGKT LH+AARMGH+EVVKSL+  D SIGFRTDKKGQTALHMAVKG+   IVLEL
Sbjct  181   KIAKNNGKTALHSAARMGHVEVVKSLIGNDASIGFRTDKKGQTALHMAVKGKQEGIVLEL  240

Query  1661  IKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGININTVNKAGETALDIAEKFG  1840
             ++PDP VL++ DNKGNT LHIAT+KGR ++V+ L+S +GIN+N +NKAG+TALDIAEK G
Sbjct  241   VRPDPKVLSVEDNKGNTPLHIATKKGRTKIVRCLVSFDGINLNALNKAGDTALDIAEKIG  300

Query  1841  TPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakk  2020
               ++V +LKEAGA  +KD GKP + AKQLKQTVSDI+H+V+SQLQQSRQTG +V++IAK+
Sbjct  301   NAELVLVLKEAGAATAKDLGKPQNPAKQLKQTVSDIRHEVQSQLQQSRQTGARVQRIAKR  360

Query  2021  vkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKEKKG-FTLGEANVANKAAF  2197
             +KKLHI+GLNNAINS TVVAVLIATVAFAAIFT+PGQY E   +G   LGEA +AN+A F
Sbjct  361   LKKLHINGLNNAINSATVVAVLIATVAFAAIFTIPGQYEEDRTRGPLVLGEARIANEAPF  420

Query  2198  IVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYV  2377
             +VFF+FDSLALFIS+AVVVVQTSVVVIEQKAKK++VF+INKLMW ACLFISIAF+SL+++
Sbjct  421   LVFFIFDSLALFISLAVVVVQTSVVVIEQKAKKKLVFVINKLMWLACLFISIAFVSLSFI  480

Query  2378  VVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMV  2557
             VVG  + WLAI +TV+GG IMLTTIG+MCYCVV HR+EE +++ +RK  + SRSFS+S +
Sbjct  481   VVGKEDMWLAICATVIGGTIMLTTIGAMCYCVVMHRIEECKLKQMRKERSKSRSFSLSHM  540

Query  2558  PSDSELYN-ESYKRMYAV  2608
             PS+SE+ N E  KRMYA+
Sbjct  541   PSESEILNGELNKRMYAL  558



>emb|CDY42071.1| BnaA05g11150D [Brassica napus]
Length=622

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/601 (65%), Positives = 479/601 (80%), Gaps = 48/601 (8%)
 Frame = +2

Query  893   MEKQASFRGV--------------MEKQQSFRN------------MEKQKSFKG-LMEKQ  991
             +EKQ SF+GV              MEKQQSFR             ME+QKSF+G  +EKQ
Sbjct  41    LEKQVSFQGVSVENHHHPSRLGRSMEKQQSFRGVATAENQKRGVIMERQKSFRGGFLEKQ  100

Query  992   KSFRIAMERQLSFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQR-FDSKAIKDT  1168
             KSFR+ MERQLSF GER++  +SPGKRGD+PLH+AAR GNL KVRE+++   D + +++ 
Sbjct  101   KSFRVVMERQLSFIGERRKKTESPGKRGDSPLHIAARTGNLGKVRELIRGGCDGEELREL  160

Query  1169  LSKQNQEGETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLK  1348
             LSKQN EGET LY AAENGH+ VV E+L+++DL+TASIA+ NG+D FH+AAKQGHLEVLK
Sbjct  161   LSKQNLEGETPLYTAAENGHSAVVEEMLERMDLQTASIAARNGFDPFHVAAKQGHLEVLK  220

Query  1349  ELLNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAAR  1528
              LL  FPNL MTTD   +TALHTAA QGH+DVV+LLLE DSNLAKIA+NNGKT LH+AAR
Sbjct  221   ILLETFPNLAMTTDLLCTTALHTAATQGHIDVVNLLLETDSNLAKIAKNNGKTALHSAAR  280

Query  1529  MGHLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGN  1708
             MGH+E                   GQTALHMAVKGQN  IV+EL+KPD +VL++ DNKGN
Sbjct  281   MGHVE-------------------GQTALHMAVKGQNDGIVVELVKPDVAVLSVEDNKGN  321

Query  1709  TALHIATRKGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHS  1888
             T LHIAT KGR ++V+ L+S EGIN+N +NKAG+T LD+AE+ G  ++ ++LKEAGA  +
Sbjct  322   TPLHIATNKGRIKIVRCLLSFEGINLNPINKAGDTPLDVAERIGNAELASVLKEAGAATA  381

Query  1889  KDHGKPPSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSl  2068
             KD GKP + AKQLKQTVSDIKH+V+SQLQQSRQTG +V+KIAK++KKLHISGLNNAINS 
Sbjct  382   KDLGKPQNPAKQLKQTVSDIKHEVQSQLQQSRQTGVRVQKIAKRLKKLHISGLNNAINSA  441

Query  2069  tvvavliatvafaaiftvPGQYVEKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAv  2248
             TVVAVLIATVAFAAIFT+PGQY E   KG  LG+A++ANKA F+VFF+FDSLALFIS+AV
Sbjct  442   TVVAVLIATVAFAAIFTIPGQYEEDRSKGDLLGQAHIANKAPFLVFFIFDSLALFISLAV  501

Query  2249  vvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVG  2428
             VVVQTSVVVIE+KAKK++VF+INKLMW ACLFISIAF+SL+Y+VVG  E WLA+ +TV+G
Sbjct  502   VVVQTSVVVIEEKAKKKLVFVINKLMWCACLFISIAFVSLSYIVVGKEEMWLAVCATVIG  561

Query  2429  GVIMLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESY-KRMYA  2605
             G IMLTTIG+MCYCV+ HR+EES++++IRK  + S+SFSMS +PSDSE+ N  Y KRMYA
Sbjct  562   GTIMLTTIGAMCYCVIMHRVEESKLKSIRKERSKSQSFSMSRMPSDSEILNGEYNKRMYA  621

Query  2606  V  2608
             +
Sbjct  622   L  622



>emb|CAN68139.1| hypothetical protein VITISV_035656 [Vitis vinifera]
Length=598

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/608 (65%), Positives = 468/608 (77%), Gaps = 85/608 (14%)
 Frame = +2

Query  890   IMEKQASFRGVMEKQQSFRN-MEKQKSFKGLMEKQKSFRIAMERQLSFGG--ERKRGKDS  1060
             +MEKQ SFRGVMEKQQSFR  MEKQKSF+G MEKQKSFRIAMERQLSFGG  ERK+ K+S
Sbjct  10    VMEKQQSFRGVMEKQQSFRGLMEKQKSFRGFMEKQKSFRIAMERQLSFGGSSERKKVKES  69

Query  1061  PGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVV  1240
             PGKRGD+ LHLAARAGNL++V+EI+++ +S  ++  LSKQNQEGET LYVA+ENGH LVV
Sbjct  70    PGKRGDSHLHLAARAGNLTRVKEIIEKCESSELQALLSKQNQEGETPLYVASENGHALVV  129

Query  1241  GEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTA  1420
              E+L+ +DL+TASI +NNGYD FH+A KQGHL                            
Sbjct  130   SELLEHVDLQTASIKANNGYDPFHVATKQGHL----------------------------  161

Query  1421  AGQGHVDV-VDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDK  1597
                GHV +     L+ D NLAKIARNNGKTVLH+AARMGHLEV+K+LV+KDPSI FRTDK
Sbjct  162   ---GHVAIWCTSFLKTDPNLAKIARNNGKTVLHSAARMGHLEVLKALVSKDPSIVFRTDK  218

Query  1598  KGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQM---------  1750
             KGQTALHMAVKGQNV+IV  L+KPDPSV++L DNKGNTALHIATRKGR Q+         
Sbjct  219   KGQTALHMAVKGQNVEIVHALLKPDPSVMSLEDNKGNTALHIATRKGRSQVFTSAIDYLH  278

Query  1751  -----------------------------------------VQRLISIEGININTVNKAG  1807
                                                      VQ L+S+EGI +N  NKAG
Sbjct  279   SDGQRDMFCFLYPAEYFVILHIEASVGHNRIYVLCNIYTYFVQCLLSVEGIKMNATNKAG  338

Query  1808  ETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQLQQSRQ  1987
             ET LDIAEKFGT ++ ++L+EAGAT+S DHGKPP+AAKQLKQTVSDIKHDV+SQLQQ+RQ
Sbjct  339   ETPLDIAEKFGTQEIASILREAGATNSADHGKPPNAAKQLKQTVSDIKHDVQSQLQQTRQ  398

Query  1988  TGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKEKKGFTLG  2167
             TG +V+ IAK++KKLHISGLNNAINS TVVAVLIATVAFAAIFTVPGQYVE   KG +LG
Sbjct  399   TGVRVQHIAKRLKKLHISGLNNAINSATVVAVLIATVAFAAIFTVPGQYVEVPTKGASLG  458

Query  2168  EANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFI  2347
             +A++A  AAF++FF+FDSLALFIS+AVVVVQTSVVVIEQKAKKQ+VF+INKLMW ACLFI
Sbjct  459   QAHIARTAAFLIFFVFDSLALFISLAVVVVQTSVVVIEQKAKKQLVFVINKLMWMACLFI  518

Query  2348  SIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRMRNIRKAET  2527
             SIAFISLTYVVVG+  +WLA+ +TV+G VIMLTTIG+MCYCV+ +R+ E++ RNIRKAE+
Sbjct  519   SIAFISLTYVVVGSHARWLAVCATVIGSVIMLTTIGAMCYCVIVNRIAEAKKRNIRKAES  578

Query  2528  LSRSFSMS  2551
              SRSFS+S
Sbjct  579   RSRSFSVS  586



>gb|EPS61725.1| hypothetical protein M569_13069, partial [Genlisea aurea]
Length=544

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/547 (68%), Positives = 464/547 (85%), Gaps = 8/547 (1%)
 Frame = +2

Query  893   MEKQASFRGVMEKQQSFRN-MEKQKSFKG-LMEKQKSFRIAMERQLSFGGE-RKRGKDSP  1063
             ME Q S    +EKQ+SF+  MEKQKSFKG LMEKQKSF+IAMERQ+SFG + R++ KDSP
Sbjct  1     MESQQSVDDSIEKQESFKGLMEKQKSFKGILMEKQKSFKIAMERQVSFGIDTRRKSKDSP  60

Query  1064  GKRGDNPLHLAARAGNLSKVREILQRFDS--KAIKDTLSKQNQEGETALYVAAENGHTLV  1237
             GKRGD+PLH+AAR+GN+ K +EI+Q+  +    +K+ +S++N EGET +YVAAENGH  V
Sbjct  61    GKRGDSPLHIAARSGNVEKAKEIIQKLSNTENGVKELMSRKNHEGETPVYVAAENGHISV  120

Query  1238  VGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHT  1417
             + E LK  D ET +I +NNG+D FH+AA+QGH +VLK++L  FP LVMTTD+SNSTALHT
Sbjct  121   ISEFLKHSDAETCAIPANNGFDPFHVAARQGHFDVLKQMLQFFPTLVMTTDASNSTALHT  180

Query  1418  AAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDK  1597
             AA  GH D+VDLLL+ DSNLAKIARNNGKTVLHTAARMGHL V++SL+ KDPS GFRTD+
Sbjct  181   AAALGHGDIVDLLLDADSNLAKIARNNGKTVLHTAARMGHLGVLRSLLEKDPSFGFRTDR  240

Query  1598  KGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEG  1777
             KGQTALHMA KGQNVD+V  +++ D SVL LGDNKGNTALHIA  KGR ++V+ L+S+EG
Sbjct  241   KGQTALHMASKGQNVDVVKAIVETDSSVLGLGDNKGNTALHIAIVKGRIKIVEYLLSVEG  300

Query  1778  ININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHD  1957
             I++N  N AGET LD+AEK G+P++V +L+E+GA+ S    KP +++KQLKQTVSDIKHD
Sbjct  301   IDVNAENGAGETPLDVAEKLGSPEMVAVLRESGASRSN---KPGNSSKQLKQTVSDIKHD  357

Query  1958  VESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYV  2137
             VESQL+QSRQTGF+VRKIAKKVKKLH+ GLNNAINS TVVAVLIATVAFAAIFTVPGQYV
Sbjct  358   VESQLRQSRQTGFRVRKIAKKVKKLHVEGLNNAINSATVVAVLIATVAFAAIFTVPGQYV  417

Query  2138  EKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIIN  2317
              + ++GF+LGEA++A+  AF++FF+FD  ALFIS+AVV+VQTS+VVIE +AK+Q++F+IN
Sbjct  418   SQPQEGFSLGEASIADGPAFLIFFVFDGAALFISLAVVLVQTSLVVIEHRAKRQLMFVIN  477

Query  2318  KLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEES  2497
             KLMW AC FIS+AF+SLTYVVVG+ ++WLAIY+TVVG  IM  TIGSM +CVVRHRLE+S
Sbjct  478   KLMWIACAFISVAFVSLTYVVVGSAQRWLAIYATVVGTTIMTATIGSMFFCVVRHRLEDS  537

Query  2498  RMRNIRK  2518
             RMR+IR+
Sbjct  538   RMRSIRR  544



>ref|XP_010557050.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Tarenaya 
hassleriana]
Length=637

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/584 (67%), Positives = 478/584 (82%), Gaps = 12/584 (2%)
 Frame = +2

Query  893   MEKQASFRG-VMEKQQSFRN-----MEKQKSFKGLMEKQKSFRIAMERQLSF--GGERKR  1048
             +EKQ SF G  M+ Q   +      MEK  SF   ME+QKSFR+ MERQLSF  G E K+
Sbjct  54    LEKQQSFHGATMDNQDQNQPSKPGVMEKHPSFGRAMERQKSFRVIMERQLSFMAGSEGKK  113

Query  1049  GK-DSPGKRGDNPLHLAARAGNLSKVREILQRFD-SKAIKDTLSKQNQEGETALYVAAEN  1222
              K +SPGKRGD+PLH AAR GN SKV+EI+   + S+ +K  +S QN EGET LY AAEN
Sbjct  114   KKNESPGKRGDSPLHTAARTGNSSKVKEIIHSCNNSECLKQIMSNQNLEGETPLYAAAEN  173

Query  1223  GHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNS  1402
             G  +VV E+LK +DLETASI++ NG+D FH+A+KQGHL+VLK+L+  FPNL MTTD S +
Sbjct  174   GVLVVVEEMLKHMDLETASISARNGFDPFHVASKQGHLDVLKKLVETFPNLAMTTDLSCT  233

Query  1403  TALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIG  1582
             TALHTAA QGHV++V+LLLE DSNLAKIA+NNGKT LH+AARMGHLEVVKSL++KDPS G
Sbjct  234   TALHTAATQGHVEIVNLLLETDSNLAKIAKNNGKTALHSAARMGHLEVVKSLISKDPSSG  293

Query  1583  FRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRL  1762
             FRTDKKGQTALHMAVKGQN +IVLEL+KPDP+VL + DNKGN  LHIAT KGR ++V+ L
Sbjct  294   FRTDKKGQTALHMAVKGQNEEIVLELVKPDPTVLNVEDNKGNAPLHIATNKGRTKIVRCL  353

Query  1763  ISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVS  1942
             +S + I++  +NKAGETALDIAE+ G  ++V++LK+AGA  +KD G+P + AKQLKQTVS
Sbjct  354   VSFDAIDVKAINKAGETALDIAERIGNQELVSVLKDAGAERAKDLGRPQNPAKQLKQTVS  413

Query  1943  DIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftv  2122
             DIKH+V+SQLQQSR+TGF+V+KIAK+++KLHISGLNNAINS T+VAVLIATVAFAAIFT+
Sbjct  414   DIKHEVQSQLQQSRKTGFRVQKIAKRLEKLHISGLNNAINSATIVAVLIATVAFAAIFTI  473

Query  2123  PGQYVEKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQM  2302
             PGQY E   KG  LG+A +A+KA F+VFF+FDSLALFIS+AVVVVQTSVVVIEQKAKK++
Sbjct  474   PGQYEEDPSKGSVLGQARIADKAPFLVFFVFDSLALFISLAVVVVQTSVVVIEQKAKKRL  533

Query  2303  VFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRH  2482
             VF+INKLMW ACLFIS++F+SL Y+VVG  E WLA+ +TV+GG IM+TTIG+MCYCVV H
Sbjct  534   VFVINKLMWLACLFISVSFVSLAYIVVGKEEMWLAVCATVIGGSIMVTTIGAMCYCVVMH  593

Query  2483  RLEESRMRNIRK-AETLSRSFSMSMVPSDSELYNESY-KRMYAV  2608
             R+EES++R+IRK       SFS S + SDSE+ N  Y KRMYA+
Sbjct  594   RMEESKLRSIRKERSKSRSSFSPSRMASDSEILNGEYNKRMYAL  637



>ref|XP_010908526.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Elaeis 
guineensis]
Length=575

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/578 (66%), Positives = 470/578 (81%), Gaps = 9/578 (2%)
 Frame = +2

Query  893   MEKQASFR-GVMEKQQSFR--NMEKQKSFK-GLMEKQKSFRI-AMERQLSFGGERKRGKD  1057
             MEKQ S R G  EK QSFR   MEKQKSF+ G +EKQKSFR+ +M++Q SF  + +R K+
Sbjct  1     MEKQQSLRLGAFEKLQSFRLGAMEKQKSFRMGSLEKQKSFRLGSMDKQQSF--KERRNKE  58

Query  1058  SPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLV  1237
             SPGKRGD  LHLAARAGN   V+ IL       +K+ +SKQNQ+GETALYVAAE GH  V
Sbjct  59    SPGKRGDTLLHLAARAGNAVHVQGILSDCGESQLKELISKQNQDGETALYVAAEKGHVEV  118

Query  1238  VGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHT  1417
             V EILK  D ++A+  ++N +DAFHIAAKQGHLEVLKELL+ FP L MTT+S NSTAL T
Sbjct  119   VREILKVSDFQSANTKASNSFDAFHIAAKQGHLEVLKELLHSFPALAMTTNSLNSTALDT  178

Query  1418  AAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDK  1597
             A+ QGH+DVV+LLLE D++LAKIARNNGKTVLH+AARMGH+EVVKSL+NKDPSIG RTDK
Sbjct  179   ASTQGHLDVVNLLLETDASLAKIARNNGKTVLHSAARMGHVEVVKSLLNKDPSIGLRTDK  238

Query  1598  KGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEG  1777
             KGQTA+HMAVKGQNV+IV EL+KPD S++   DNKGN  LHIATRKG   +V  L+S+EG
Sbjct  239   KGQTAIHMAVKGQNVEIVQELVKPDKSIIHSEDNKGNRPLHIATRKGNCGIVLALLSVEG  298

Query  1778  ININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHD  1957
             I++N VNKAGETAL IAEK    ++  +L+E GA  +K+   PP+ AKQLKQTVSDIKHD
Sbjct  299   IDVNAVNKAGETALGIAEKCCHEEISVVLREFGAVVAKEQANPPNPAKQLKQTVSDIKHD  358

Query  1958  VESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYV  2137
             V++Q++Q+RQT  +V+KI K+++KLHI GLNNAINS TVVAVLIATVAFAAIFTVPGQ+V
Sbjct  359   VQNQIRQTRQTQMRVQKIKKRLQKLHIGGLNNAINSNTVVAVLIATVAFAAIFTVPGQFV  418

Query  2138  EKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIIN  2317
             E+ + G+TLG+A VAN AAFI+F +FDSLALFIS+AVVVVQTS++V+EQKAK+ MVF++N
Sbjct  419   EQPENGYTLGQAYVANNAAFIIFLVFDSLALFISLAVVVVQTSLIVVEQKAKRMMVFVMN  478

Query  2318  KLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEES  2497
             KLMW ACLFIS++FISLTYVVVG  + WLA  +  +G  IMLTT+GSMCYC++ HRLEE 
Sbjct  479   KLMWLACLFISVSFISLTYVVVGHDDWWLAWSTMAIGASIMLTTLGSMCYCIIVHRLEEK  538

Query  2498  RMRNIRKAETLSRSFSMSM-VPSDSELYNESYKRMYAV  2608
              +RNIR+A ++SRS S ++ V SDSE+ N  YK++YA+
Sbjct  539   NLRNIRRA-SVSRSHSWTISVASDSEILNSEYKKLYAI  575



>ref|XP_008788257.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Phoenix 
dactylifera]
 ref|XP_008788258.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Phoenix 
dactylifera]
Length=578

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/581 (66%), Positives = 467/581 (80%), Gaps = 12/581 (2%)
 Frame = +2

Query  893   MEKQASFR-GVMEKQQSFR--NMEKQKSFK-GLMEKQKSFRI-AMERQLSFGGERKRGKD  1057
             MEKQ SFR G  EK QSFR   MEKQKSF+ G +EKQKS R+ +M++Q SF  + +R KD
Sbjct  1     MEKQQSFRLGAFEKLQSFRLGAMEKQKSFRMGSLEKQKSGRLGSMDKQQSF--KERRNKD  58

Query  1058  SPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLV  1237
             SPGKRGD PLHLA+RAGN   V+ IL       +K+ +SKQNQ+GETALYVAAE GH  V
Sbjct  59    SPGKRGDTPLHLASRAGNAVHVQRILSDCGESHLKELISKQNQDGETALYVAAEKGHVEV  118

Query  1238  VGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHT  1417
             V EILK  D ++A+  +NN +DA HIAAKQGHLEVLKELL+ FP L MTT+  NSTAL T
Sbjct  119   VREILKVSDFQSANTKANNSFDALHIAAKQGHLEVLKELLHFFPALAMTTNLLNSTALDT  178

Query  1418  AAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDK  1597
             AA QGH+DVV+LLLE D++LAKIARNNGKTVLH+AARMGH+EVVKSL+NKDPSI FR DK
Sbjct  179   AATQGHLDVVNLLLETDASLAKIARNNGKTVLHSAARMGHVEVVKSLLNKDPSIVFRIDK  238

Query  1598  KGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEG  1777
             KGQTA HMAVKGQNV+IV EL+KPD S++ L DNKGN  LHIATRKG   +V  L+S+EG
Sbjct  239   KGQTAFHMAVKGQNVEIVQELLKPDKSIIHLEDNKGNRPLHIATRKGNCGIVLALLSVEG  298

Query  1778  ININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHD  1957
             I++N VNKAGETAL IAEK    ++  +L+E GA  +K+   PP+ AKQLKQTVSDIKHD
Sbjct  299   IDVNAVNKAGETALGIAEKCCHEEIAAVLREFGAVVAKEQANPPNPAKQLKQTVSDIKHD  358

Query  1958  VESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYV  2137
             V+SQL+Q+RQT  +V+KI K+++KLHI GLNNAINS TVVAVLIATVAFAAIFTVPGQ+V
Sbjct  359   VQSQLRQTRQTQMRVQKIRKRLQKLHIGGLNNAINSNTVVAVLIATVAFAAIFTVPGQFV  418

Query  2138  EK---EKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVF  2308
             E+   E++G+TLG+A VA  AAFI+F +FDS+ALFIS+AVVVVQTS++V+EQKAK+ MVF
Sbjct  419   EQPQEEEEGYTLGQAYVAKNAAFIIFLVFDSMALFISLAVVVVQTSLIVVEQKAKRMMVF  478

Query  2309  IINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRL  2488
             ++NKLMW ACLFIS++FISLTYVVVG  + WLA  +  +G  IMLTT+GSMCYC++ HRL
Sbjct  479   VMNKLMWLACLFISVSFISLTYVVVGHSDWWLAWSTMAIGASIMLTTLGSMCYCIIVHRL  538

Query  2489  EESRMRNIRKAETLSRSFSMSM-VPSDSELYNESYKRMYAV  2608
             EE  +RNIR+A   SRS S ++ V SDSE+ N  YK++YA+
Sbjct  539   EEKNLRNIRRASG-SRSHSWTVSVASDSEILNSEYKKLYAI  578



>emb|CDY34515.1| BnaC04g12840D [Brassica napus]
Length=627

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/589 (65%), Positives = 468/589 (79%), Gaps = 42/589 (7%)
 Frame = +2

Query  893   MEKQASFRGV-----------MEKQQSF----RNMEKQKSFK-GLMEKQKSFRIAMERQL  1024
             MEKQ SFRGV           MEK  SF      ME+QKSF+ G +EKQKSFR+ MERQL
Sbjct  64    MEKQQSFRGVTTAENQKRGLIMEKLPSFGKASTTMERQKSFRGGFLEKQKSFRVVMERQL  123

Query  1025  SFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETAL  1204
             SF GER++  +SPGKRGD+PLH+AAR GNL KV+++ +       ++ LSKQN EGET L
Sbjct  124   SFIGERRKKTESPGKRGDSPLHIAARTGNLGKVKDLFR--GGCDGEELLSKQNLEGETPL  181

Query  1205  YVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMT  1384
             Y AAENGH+ VV E+L+++DL+TASIA+ NG+D FH+AAKQGHLEVLK LL  FPNL MT
Sbjct  182   YTAAENGHSAVVEEMLERMDLQTASIAARNGFDPFHVAAKQGHLEVLKILLETFPNLAMT  241

Query  1385  TDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVN  1564
             TD   +TALHTAA QGH+DVV+LLLE DSNLAKIA+NNGKT LH+AARMGH+EVVKSL+ 
Sbjct  242   TDLLCTTALHTAATQGHIDVVNLLLETDSNLAKIAKNNGKTALHSAARMGHVEVVKSLI-  300

Query  1565  KDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRP  1744
                                   GQN  IV+EL+KPD +VL++ DNKGNT LHIAT KGR 
Sbjct  301   ----------------------GQNDGIVVELVKPDVAVLSVEDNKGNTPLHIATNKGRI  338

Query  1745  QMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQ  1924
             ++V+ L+S EGIN+N +NKAG+T LD+AE+ G  ++ ++LKEAGA  +KD GKP + AKQ
Sbjct  339   KIVRCLLSFEGINLNPINKAGDTPLDVAERIGNAELASVLKEAGAATAKDLGKPQNPAKQ  398

Query  1925  LKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvaf  2104
             LKQTVSDIKH+V+SQLQQSRQTG +V+KIAK++KKLHISGLNNAINS TVVAVLIATVAF
Sbjct  399   LKQTVSDIKHEVQSQLQQSRQTGVRVQKIAKRLKKLHISGLNNAINSATVVAVLIATVAF  458

Query  2105  aaiftvPGQYVEKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             AAIFT+PGQY E   KG  LG+A++ANKA F+VFF+FDSLALFIS+AVVVVQTSVVVIE+
Sbjct  459   AAIFTIPGQYEEDRSKGDLLGQAHIANKAPFLVFFIFDSLALFISLAVVVVQTSVVVIEE  518

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             KAKK++VF+INKLMW ACLFISIAF+SL+Y+VVG  E WLA+ +TV+GG IMLTTIG+MC
Sbjct  519   KAKKKLVFVINKLMWCACLFISIAFVSLSYIVVGKEEMWLAVCATVIGGTIMLTTIGAMC  578

Query  2465  YCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESY-KRMYAV  2608
             YCV+ HR+EES++++IRK  + S+SFSMS +PSDSE+ N  Y KRMYA+
Sbjct  579   YCVIMHRVEESKLKSIRKERSKSQSFSMSRMPSDSEILNGEYNKRMYAL  627



>ref|XP_009781473.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X2 [Nicotiana sylvestris]
Length=453

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/454 (80%), Positives = 413/454 (91%), Gaps = 1/454 (0%)
 Frame = +2

Query  1247  ILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAG  1426
             +LK LDL+ AS+ +NNGYDAF +AAKQGHLEVLKELL++FPNL+M TDSSNSTALHTAA 
Sbjct  1     MLKHLDLQIASLVANNGYDAFQVAAKQGHLEVLKELLHLFPNLIMATDSSNSTALHTAAA  60

Query  1427  QGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQ  1606
             QGH DVV+LLLEIDSNLAKIARNNGKTVLHTAARMG LE+VKSL++KDP IG RTD KGQ
Sbjct  61    QGHTDVVNLLLEIDSNLAKIARNNGKTVLHTAARMGRLEIVKSLLSKDPEIGLRTDSKGQ  120

Query  1607  TALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGINI  1786
             +ALHMAVKGQNVDIV ELIKP+P+VLAL DNKGN ALHIAT+KGR QMVQ LIS E I++
Sbjct  121   SALHMAVKGQNVDIVHELIKPNPAVLALEDNKGNRALHIATKKGRAQMVQCLISSECIDL  180

Query  1787  NTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVES  1966
             N  NKAGETALDIAEKFG P++V++LK AGATHSKDHGKPPS AKQLKQTVSDI+HDV+S
Sbjct  181   NATNKAGETALDIAEKFGMPELVSILKVAGATHSKDHGKPPSNAKQLKQTVSDIRHDVQS  240

Query  1967  QLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKE  2146
             QLQQSRQTGFKVRKIAKKVKKLHISGLNNAIN+ TVVAVLIATVAFAAIFTVPGQYVE++
Sbjct  241   QLQQSRQTGFKVRKIAKKVKKLHISGLNNAINNATVVAVLIATVAFAAIFTVPGQYVEEK  300

Query  2147  KKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKLM  2326
               GF+LGEA+VA KAAFI+FFLFDS+ALFISIAVVVVQTS+VVIE +AKK +VF IN+LM
Sbjct  301   TDGFSLGEAHVAEKAAFIIFFLFDSMALFISIAVVVVQTSLVVIEPRAKKLLVFWINRLM  360

Query  2327  WGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRMR  2506
             W ACLFIS++FISL+YVVVG++E+WLAIY+T  G +IMLTTIGSMCYCVVRHRLEES+MR
Sbjct  361   WAACLFISVSFISLSYVVVGSKERWLAIYATATGSIIMLTTIGSMCYCVVRHRLEESKMR  420

Query  2507  NIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             +IR A T S S++MS V SD+ELY E+YKRMYAV
Sbjct  421   SIRSAGTHSHSYAMS-VASDTELYAENYKRMYAV  453


 Score = 97.8 bits (242),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 63/186 (34%), Positives = 101/186 (54%), Gaps = 6/186 (3%)
 Frame = +2

Query  1073  GDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGEIL  1252
             G +   +AA+ G+L  ++E+L  F      + +   +    TAL+ AA  GHT VV  +L
Sbjct  17    GYDAFQVAAKQGHLEVLKELLHLF-----PNLIMATDSSNSTALHTAAAQGHTDVVN-LL  70

Query  1253  KQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQG  1432
              ++D   A IA NNG    H AA+ G LE++K LL+  P + + TDS   +ALH A    
Sbjct  71    LEIDSNLAKIARNNGKTVLHTAARMGRLEIVKSLLSKDPEIGLRTDSKGQSALHMAVKGQ  130

Query  1433  HVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQTA  1612
             +VD+V  L++ +  +  +  N G   LH A + G  ++V+ L++ +      T+K G+TA
Sbjct  131   NVDIVHELIKPNPAVLALEDNKGNRALHIATKKGRAQMVQCLISSECIDLNATNKAGETA  190

Query  1613  LHMAVK  1630
             L +A K
Sbjct  191   LDIAEK  196



>ref|XP_009383357.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Musa 
acuminata subsp. malaccensis]
Length=570

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/575 (65%), Positives = 457/575 (79%), Gaps = 8/575 (1%)
 Frame = +2

Query  893   MEKQASFR-GVMEKQQSFR--NMEKQKSFKGLMEKQKSFRIAMERQLSFGGERKRGKDSP  1063
             MEKQ+S R G +EK QSFR   MEKQKSF+  M+KQ+SFR+  +RQ SF  + ++ K+SP
Sbjct  1     MEKQSSLRIGALEKLQSFRLGVMEKQKSFR--MDKQRSFRLG-DRQQSF--KERKNKESP  55

Query  1064  GKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVG  1243
             GKRGD  LHLAARAGN  +V +IL       +KD L KQNQ+GETALY+AAE G+   V 
Sbjct  56    GKRGDLELHLAARAGNAVRVHKILSECSETQLKDLLFKQNQDGETALYIAAEKGYVEAVR  115

Query  1244  EILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAA  1423
             EILK  D+++A I +NN YD+FHIAAKQGHLEVLKEL + FP L MTT+S NSTAL TAA
Sbjct  116   EILKVSDIQSAGIKANNNYDSFHIAAKQGHLEVLKELFHSFPALAMTTNSLNSTALDTAA  175

Query  1424  GQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKG  1603
              QGHVDVV+LLLE D++LAKIARNNGKTVLH+AARMGH+ VVKSL++KDP IG RTDKKG
Sbjct  176   TQGHVDVVNLLLETDASLAKIARNNGKTVLHSAARMGHVNVVKSLLDKDPRIGLRTDKKG  235

Query  1604  QTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGIN  1783
             QTA HMAVKGQNV++V+EL+KPDPS++ L DNKGN  LHIATRKG P++VQ LIS+EGI+
Sbjct  236   QTAFHMAVKGQNVEMVMELLKPDPSIINLEDNKGNKPLHIATRKGNPKIVQALISVEGID  295

Query  1784  INTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVE  1963
             IN VN+AGETAL IAEK    ++  +L+E GA  +K+     +AAKQLKQTVSDIKHDV+
Sbjct  296   INAVNRAGETALSIAEKCENEEIAAILREFGAVVAKEPANTMTAAKQLKQTVSDIKHDVQ  355

Query  1964  SQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEK  2143
             SQL+Q+ QT  KV+KI K+++KLH+ GLNNAINS TVVAVLIATVAFAAIF +PGQ+V  
Sbjct  356   SQLRQTHQTEMKVQKIKKRLQKLHLGGLNNAINSNTVVAVLIATVAFAAIFQLPGQFVPD  415

Query  2144  EKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKL  2323
              + GFTLG+A +A  AAFI+F +FDSLALFIS+AVVVVQTS++V+EQKAK++MVF++NKL
Sbjct  416   AEDGFTLGQAYIAKNAAFIIFLVFDSLALFISLAVVVVQTSLIVVEQKAKRRMVFVMNKL  475

Query  2324  MWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRM  2503
             MW ACLFIS+AFISLTY+VVG  + WLA  +  +G  IMLTT+GSMCYC++ HR+EE  M
Sbjct  476   MWLACLFISVAFISLTYIVVGHHDLWLAWSTMAIGATIMLTTLGSMCYCIIVHRIEEKNM  535

Query  2504  RNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             RNIR+            V SDSE+ N  YK+MYA+
Sbjct  536   RNIRRNSGSRSRSWSISVGSDSEILNSEYKKMYAL  570



>gb|KFK42900.1| hypothetical protein AALP_AA1G053200 [Arabis alpina]
Length=1008

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/576 (66%), Positives = 476/576 (83%), Gaps = 11/576 (2%)
 Frame = +2

Query  893   MEKQASFRGVMEKQQSFRNMEKQKSFKGLMEKQKSFRIAMERQLSF--GGERKRGKDSPG  1066
             +EKQ SF+ V  +       E+Q++  G +EKQKSFR+ +ERQLSF  GG  ++  + PG
Sbjct  440   LEKQVSFQFVNVENHV---TERQRNIHGFVEKQKSFRVVLERQLSFMNGGSERKKNELPG  496

Query  1067  KRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGE  1246
             KRGD+ LH+AAR GNL  V E+++      I++ LSKQN EGET+LY AAENGH LVV E
Sbjct  497   KRGDSSLHIAARTGNLGNVIELIR--GCNGIEELLSKQNLEGETSLYTAAENGHWLVVEE  554

Query  1247  ILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAG  1426
             +LK +DL+TASIA+ NG+D FHIAAKQGHLE LK+LL+ FPNL MTTDSS +TALHTAA 
Sbjct  555   MLKHMDLDTASIAARNGFDPFHIAAKQGHLEALKQLLDTFPNLAMTTDSSCTTALHTAAT  614

Query  1427  QGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQ  1606
             QGH+DVV+LLL+ DS+LAKIA+NNGKT LH+AARMGH+EVVKSL+  D  IGFRTDKKGQ
Sbjct  615   QGHIDVVNLLLKTDSHLAKIAKNNGKTALHSAARMGHVEVVKSLIGNDAKIGFRTDKKGQ  674

Query  1607  TALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGINI  1786
             TALHMAVKGQN  +V EL+KPDP+VL++ DNKGNT LHIA++KGR ++V+ L+S +GIN+
Sbjct  675   TALHMAVKGQNKGVVHELVKPDPAVLSVEDNKGNTPLHIASKKGRAKIVRCLVSFDGINL  734

Query  1787  NTVNKAGETALDIAEKFGTPDVVTMLKEAG-ATHSKDHGKPPSAAKQLKQTVSDIKHDVE  1963
             N +NKAG+TALDIAEK G  ++V++LKEAG AT +KD GKP + AKQLKQTVSDI+H+V+
Sbjct  735   NAMNKAGDTALDIAEKIGNSELVSILKEAGAATTAKDLGKPQNPAKQLKQTVSDIRHEVQ  794

Query  1964  SQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEK  2143
             SQLQQSRQTG +V++IAK++KKLHI+GLNNAINS TVVAVLIATVAFAAIFT+PGQY E+
Sbjct  795   SQLQQSRQTGARVQRIAKRLKKLHINGLNNAINSATVVAVLIATVAFAAIFTIPGQYEEE  854

Query  2144  EKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKL  2323
                G  LGEA +ANKA F+VFF+FDSLALFIS+AVVVVQTSVVVIEQKAKK++VF+INKL
Sbjct  855   RTIGMLLGEARIANKAPFLVFFIFDSLALFISLAVVVVQTSVVVIEQKAKKKLVFVINKL  914

Query  2324  MWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRM  2503
             MW ACLFIS+AF+SL+++VVG  +  LAI  TV+GG IMLTTIG+MCYCV+ HR+EE+++
Sbjct  915   MWLACLFISVAFVSLSFIVVGKEDILLAICETVIGGTIMLTTIGAMCYCVIMHRIEETKL  974

Query  2504  RNIRKAETLSRSFSMSMVPSDSE-LYNESYKRMYAV  2608
             +++RK    S+S S S +PS+SE L  E  KRMYA+
Sbjct  975   KSMRKER--SKSISSSHMPSESEILKGEFNKRMYAL  1008



>ref|XP_008807257.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Phoenix 
dactylifera]
 ref|XP_008807258.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Phoenix 
dactylifera]
 ref|XP_008807259.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Phoenix 
dactylifera]
 ref|XP_008807260.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Phoenix 
dactylifera]
Length=574

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/577 (66%), Positives = 454/577 (79%), Gaps = 8/577 (1%)
 Frame = +2

Query  893   MEKQASFR-GVMEKQQSFR--NMEKQKSFK-GLMEKQKSFRI-AMERQLSFGGERKRGKD  1057
             MEKQ S   G +EK QSFR   MEKQKSF+ G MEKQKSFR+ +M++Q SF  + +R +D
Sbjct  1     MEKQQSVHHGALEKLQSFRLEAMEKQKSFRMGSMEKQKSFRLGSMDKQQSF--KERRYRD  58

Query  1058  SPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLV  1237
             SPGKRGD PLHLA+RAGN+  V+ IL   +   +KD +SKQNQ+GET LYVAAE GH  V
Sbjct  59    SPGKRGDTPLHLASRAGNVVHVQRILSDCNESHLKDLISKQNQDGETMLYVAAEKGHVEV  118

Query  1238  VGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHT  1417
             V EILK  D ++AS  +NN +DAFHIAAKQGHLE+LKELL  FP L MTT+  NSTAL T
Sbjct  119   VREILKVSDFQSASTMANNSFDAFHIAAKQGHLEILKELLQSFPALAMTTNLLNSTALDT  178

Query  1418  AAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDK  1597
             AA QGH+DVV+LLLE D+NL KIARNNGKTVLH+AARMGH+EVVKSL+NKDPS+G RTDK
Sbjct  179   AATQGHLDVVNLLLETDANLTKIARNNGKTVLHSAARMGHVEVVKSLLNKDPSVGLRTDK  238

Query  1598  KGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEG  1777
             KGQTA HMAVKGQNVDIV EL+KPD S++ L DNKGN  LHIATRKG   +VQ L+S+EG
Sbjct  239   KGQTAFHMAVKGQNVDIVQELLKPDISIIHLEDNKGNRPLHIATRKGNLGIVQALLSVEG  298

Query  1778  ININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHD  1957
             I++N +N+AGETAL IAEK     +  +L+E GA  SK+   P + AKQLKQTVSDIKHD
Sbjct  299   IDVNAINRAGETALGIAEKCCNEQISAILREFGAVTSKEQANPLNPAKQLKQTVSDIKHD  358

Query  1958  VESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYV  2137
             V+SQL+Q+ QT   V+KI K+++KLHI GLNNAINS TVVAVLIATVAFAAIFTVPGQ+V
Sbjct  359   VQSQLRQTHQTEMSVQKIKKRLQKLHIGGLNNAINSNTVVAVLIATVAFAAIFTVPGQFV  418

Query  2138  EKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIIN  2317
             +   KG+TLG+A VA KAAFI+F +FDSLALFIS+AVVVVQTS++V+EQKAKK MVF++N
Sbjct  419   DTSTKGYTLGQAYVAKKAAFIIFLVFDSLALFISLAVVVVQTSLIVVEQKAKKMMVFVMN  478

Query  2318  KLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEES  2497
             KLMW ACLFIS +FISLTYVVVG  + WLA  +  +G  IMLTT+GSMCY ++ HR EE 
Sbjct  479   KLMWLACLFISASFISLTYVVVG-HDWWLAWSTMAIGASIMLTTLGSMCYFIIVHRFEEK  537

Query  2498  RMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
              +RNIR+A           V SDSE+ N  YK++YA+
Sbjct  538   TLRNIRRASASRSRSWSLSVASDSEILNSEYKKLYAI  574



>ref|XP_010927921.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Elaeis 
guineensis]
Length=574

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/577 (64%), Positives = 454/577 (79%), Gaps = 8/577 (1%)
 Frame = +2

Query  893   MEKQASFR-GVMEKQQSFR--NMEKQKSFK-GLMEKQKSFRI-AMERQLSFGGERKRGKD  1057
             MEKQ SFR G ++K QSFR   MEKQKSF+ G MEKQKSFR+ +M++Q SF  + +R +D
Sbjct  1     MEKQQSFRLGALDKLQSFRLGAMEKQKSFRMGSMEKQKSFRLGSMDKQQSF--KERRYRD  58

Query  1058  SPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLV  1237
             SPGKRGD PLHLA+RAGN+  V+ IL   D + +KD +SKQNQ+GETALYVAAE GH  V
Sbjct  59    SPGKRGDTPLHLASRAGNVVHVQRILSDCDERQLKDLISKQNQDGETALYVAAEKGHVEV  118

Query  1238  VGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHT  1417
             V EIL   D ++AS  +NN +DAFHIAAKQGHLE+LKELL  FP L MTT+  NSTAL T
Sbjct  119   VHEILMVSDFQSASTKANNSFDAFHIAAKQGHLEILKELLQSFPALAMTTNLMNSTALDT  178

Query  1418  AAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDK  1597
             AA QGH+DVV+LLLE D+ L KIARNNGKTVLH+AARMGH+EVVKSL+NKDPS+G RTDK
Sbjct  179   AATQGHLDVVNLLLETDAKLTKIARNNGKTVLHSAARMGHVEVVKSLLNKDPSVGLRTDK  238

Query  1598  KGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEG  1777
             KGQTA HMAVKGQNV+IV EL+KP+ S++ L DNKGN  LHIATRK    +VQ L+S+EG
Sbjct  239   KGQTAFHMAVKGQNVEIVQELLKPEISIIHLEDNKGNRPLHIATRKANLGIVQALLSVEG  298

Query  1778  ININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHD  1957
             I++N +N+AGETAL IAEK     +  +L+E GA  +K+   P + AKQLKQTVSDIKHD
Sbjct  299   IDVNAINRAGETALGIAEKCCNEQIAAILREFGAVVAKEQANPSNPAKQLKQTVSDIKHD  358

Query  1958  VESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYV  2137
             V+SQL+Q+RQT  +V+KI K+++KLH+ GLNNAINS T+VAVLIATVAFAAIFTVPGQ+V
Sbjct  359   VQSQLRQTRQTEMRVQKIKKRLQKLHMGGLNNAINSNTLVAVLIATVAFAAIFTVPGQFV  418

Query  2138  EKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIIN  2317
             E    G++LG+A VA KAAFI+F +FDSLALFIS+AVVVVQTS++V+EQKAK  MVF++N
Sbjct  419   EDPTPGYSLGQAYVAKKAAFIIFLVFDSLALFISLAVVVVQTSLIVVEQKAKTMMVFVMN  478

Query  2318  KLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEES  2497
             KLMW ACLFIS +FISLTYVVVG  + WLA  +  +G  IMLTT+G MCY +V H+ EE 
Sbjct  479   KLMWLACLFISASFISLTYVVVG-HDWWLAWSTLAIGASIMLTTLGFMCYFIVVHQFEEK  537

Query  2498  RMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
              +RNIR+A           V SD+E+ N  YK++YA+
Sbjct  538   TLRNIRRASGSRSRSWSLSVASDTEILNSEYKKLYAI  574



>gb|KFK42901.1| hypothetical protein AALP_AA1G053200 [Arabis alpina]
Length=975

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/577 (66%), Positives = 473/577 (82%), Gaps = 15/577 (3%)
 Frame = +2

Query  896   EKQASFRG--VMEKQQSFRNMEKQKSFKGLMEKQKSFRIAMERQLSF--GGERKRGKDSP  1063
             E  +S RG  + E+QQS R +  +   +     +KSFR+ +ERQLSF  GG  ++  + P
Sbjct  408   EPPSSSRGKSMEEQQQSLRCIGTENQVR-----KKSFRVVLERQLSFMNGGSERKKNELP  462

Query  1064  GKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVG  1243
             GKRGD+ LH+AAR GNL  V E+++      I++ LSKQN EGET+LY AAENGH LVV 
Sbjct  463   GKRGDSSLHIAARTGNLGNVIELIR--GCNGIEELLSKQNLEGETSLYTAAENGHWLVVE  520

Query  1244  EILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAA  1423
             E+LK +DL+TASIA+ NG+D FHIAAKQGHLE LK+LL+ FPNL MTTDSS +TALHTAA
Sbjct  521   EMLKHMDLDTASIAARNGFDPFHIAAKQGHLEALKQLLDTFPNLAMTTDSSCTTALHTAA  580

Query  1424  GQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKG  1603
              QGH+DVV+LLL+ DS+LAKIA+NNGKT LH+AARMGH+EVVKSL+  D  IGFRTDKKG
Sbjct  581   TQGHIDVVNLLLKTDSHLAKIAKNNGKTALHSAARMGHVEVVKSLIGNDAKIGFRTDKKG  640

Query  1604  QTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGIN  1783
             QTALHMAVKGQN  +V EL+KPDP+VL++ DNKGNT LHIA++KGR ++V+ L+S +GIN
Sbjct  641   QTALHMAVKGQNKGVVHELVKPDPAVLSVEDNKGNTPLHIASKKGRAKIVRCLVSFDGIN  700

Query  1784  INTVNKAGETALDIAEKFGTPDVVTMLKEAG-ATHSKDHGKPPSAAKQLKQTVSDIKHDV  1960
             +N +NKAG+TALDIAEK G  ++V++LKEAG AT +KD GKP + AKQLKQTVSDI+H+V
Sbjct  701   LNAMNKAGDTALDIAEKIGNSELVSILKEAGAATTAKDLGKPQNPAKQLKQTVSDIRHEV  760

Query  1961  ESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVE  2140
             +SQLQQSRQTG +V++IAK++KKLHI+GLNNAINS TVVAVLIATVAFAAIFT+PGQY E
Sbjct  761   QSQLQQSRQTGARVQRIAKRLKKLHINGLNNAINSATVVAVLIATVAFAAIFTIPGQYEE  820

Query  2141  KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINK  2320
             +   G  LGEA +ANKA F+VFF+FDSLALFIS+AVVVVQTSVVVIEQKAKK++VF+INK
Sbjct  821   ERTIGMLLGEARIANKAPFLVFFIFDSLALFISLAVVVVQTSVVVIEQKAKKKLVFVINK  880

Query  2321  LMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESR  2500
             LMW ACLFIS+AF+SL+++VVG  +  LAI  TV+GG IMLTTIG+MCYCV+ HR+EE++
Sbjct  881   LMWLACLFISVAFVSLSFIVVGKEDILLAICETVIGGTIMLTTIGAMCYCVIMHRIEETK  940

Query  2501  MRNIRKAETLSRSFSMSMVPSDSE-LYNESYKRMYAV  2608
             ++++RK    S+S S S +PS+SE L  E  KRMYA+
Sbjct  941   LKSMRKER--SKSISSSHMPSESEILKGEFNKRMYAL  975



>ref|XP_009384270.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384271.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Musa 
acuminata subsp. malaccensis]
Length=569

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/575 (64%), Positives = 455/575 (79%), Gaps = 9/575 (2%)
 Frame = +2

Query  893   MEKQASFR-GVMEKQQSFRN--MEKQKSFKGLMEKQKSFRIAMERQLSFGGERKRGKDSP  1063
             ME+Q SFR G +EK QSFR   MEKQKSF+  M+KQ+SFR+  +RQ SF  +  + K+SP
Sbjct  1     MERQQSFRIGALEKLQSFRVTVMEKQKSFR--MDKQRSFRMG-DRQQSF--KEGKSKESP  55

Query  1064  GKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVG  1243
             GKRGD  LHLAARAGN  +V ++L       +KD L KQNQ+GETALY+AAE GH  VV 
Sbjct  56    GKRGDLELHLAARAGNAVRVHKVLSECSETQLKDLLCKQNQDGETALYIAAEKGHVEVVQ  115

Query  1244  EILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAA  1423
             EILK  D ++A+I +NN YD+FHIAAKQGHLEVLK+LL  FP L MTT+S NSTAL TAA
Sbjct  116   EILKVSDTQSAAIKANNSYDSFHIAAKQGHLEVLKDLLRSFPALAMTTNSLNSTALDTAA  175

Query  1424  GQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKG  1603
              QGH+DVV+LLLE D++LAKIARNNGKTVLH+AARMGH+ VVKSL++KDPSIG RTDKKG
Sbjct  176   TQGHIDVVNLLLETDASLAKIARNNGKTVLHSAARMGHVLVVKSLLDKDPSIGLRTDKKG  235

Query  1604  QTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGIN  1783
             QTA HMAVKGQNV++V+EL+KPD S++ L DNKGN  LHIATRKG P+++Q L+S++ I+
Sbjct  236   QTAFHMAVKGQNVEMVMELLKPDISIINLEDNKGNKPLHIATRKGNPKILQVLLSVKEID  295

Query  1784  INTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVE  1963
             IN VN+AGETAL IAEKF   ++ ++L+E GA  ++      +AAKQLKQTVSDIKHDV+
Sbjct  296   INAVNRAGETALSIAEKFSNEEIASILREFGAVVAQQPANTMTAAKQLKQTVSDIKHDVQ  355

Query  1964  SQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEK  2143
             SQL+Q+RQT  KV KI K++KKLH+ GLNNAINS TVVAVLIATVAFAAIF +PGQ+V++
Sbjct  356   SQLRQTRQTEMKVYKIKKRLKKLHLGGLNNAINSNTVVAVLIATVAFAAIFQLPGQFVQE  415

Query  2144  EKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKL  2323
              +  FTLG+A +A  AAFI+F + DSLALFIS+AVVVVQTS++V+EQKAK +MVF++NKL
Sbjct  416   HQTEFTLGQAYIAKYAAFIIFLVSDSLALFISLAVVVVQTSLIVVEQKAKSRMVFVMNKL  475

Query  2324  MWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRM  2503
             MW ACLFIS+AFISLTYVVVG  + WLA  +  +G  IMLTT+GSMCY VV HR+EE  M
Sbjct  476   MWLACLFISVAFISLTYVVVG-HDSWLAWSTMAIGTTIMLTTLGSMCYFVVAHRIEEKNM  534

Query  2504  RNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             RNIR+            V SDSE+ N  +K+MYA+
Sbjct  535   RNIRRNSGSRSRSWSLSVGSDSEILNSEFKKMYAL  569



>ref|XP_009410730.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009410731.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Musa 
acuminata subsp. malaccensis]
Length=572

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/572 (63%), Positives = 456/572 (80%), Gaps = 10/572 (2%)
 Frame = +2

Query  923   MEKQQSFR---NMEKQKSFK-GLMEKQKSFRIAMERQLSFGG-----ERKRGKDSPGKRG  1075
             MEKQQ  R    +EK  SF+ G+MEKQKSFR+  +R    GG     + ++ K+SPGKRG
Sbjct  1     MEKQQGSRMGAALEKLHSFRLGVMEKQKSFRMDKQRSFRLGGGQQSFKERKNKESPGKRG  60

Query  1076  DNPLHLAARAGNLSKVREILQRFDSKA-IKDTLSKQNQEGETALYVAAENGHTLVVGEIL  1252
             D  LHLAARAGN + +R+I+    S++ +KD + KQNQ+GETALYVAAE GH   V EIL
Sbjct  61    DTELHLAARAGNAAHIRKIVSECSSESELKDLVCKQNQDGETALYVAAEMGHVAAVPEIL  120

Query  1253  KQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQG  1432
             K  D+++A+I ++N YDAFHIAAKQGHLEVLK+LL+ FP L MTT+S NSTAL TAA QG
Sbjct  121   KVSDVQSAAIKAHNSYDAFHIAAKQGHLEVLKDLLHSFPALAMTTNSLNSTALDTAATQG  180

Query  1433  HVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQTA  1612
             H+++V+LLLE D++LAKIARNNGKTVLH+AARMGH+EVVKSL+++DPSIG RTDKKGQTA
Sbjct  181   HIEIVNLLLETDASLAKIARNNGKTVLHSAARMGHVEVVKSLLDQDPSIGLRTDKKGQTA  240

Query  1613  LHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGININT  1792
              HMAVKGQNV++VLEL+KPD S++ L D+KGN  LHIATRKG P+++Q L+S+ GI+IN 
Sbjct  241   FHMAVKGQNVEMVLELLKPDVSIINLEDSKGNRPLHIATRKGNPKILQALLSVGGIDINA  300

Query  1793  VNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQL  1972
             VNKAGETAL IAEKF   ++ ++L+E GA  +K+     +AAKQLK+TVSDIKHDV+SQL
Sbjct  301   VNKAGETALSIAEKFANEEIASILREFGAVVAKEPANSMTAAKQLKKTVSDIKHDVQSQL  360

Query  1973  QQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKEKK  2152
             +Q+RQT  KV+KI K+++KLHI GLNNAINS TVVAVLIATVAFAAIF +PGQYV+  + 
Sbjct  361   KQTRQTEMKVQKIKKRLQKLHIGGLNNAINSNTVVAVLIATVAFAAIFQLPGQYVDLPQD  420

Query  2153  GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKLMWG  2332
             G++ G+A +A  AAFI+F +FDSLALFIS+AVVVVQTS++V+EQKAK++MVF++NKLMW 
Sbjct  421   GYSPGQAYIARNAAFIIFLVFDSLALFISLAVVVVQTSLIVVEQKAKRRMVFVMNKLMWL  480

Query  2333  ACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRMRNI  2512
             ACLFIS++FISLTYVVVG  E WLA  +  +G  IMLTT+GSMCYCV+ HR+E + +RNI
Sbjct  481   ACLFISVSFISLTYVVVGRHEWWLAWATMAIGTTIMLTTLGSMCYCVIVHRIEANNLRNI  540

Query  2513  RKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             R+            V SDSEL N  YK+MYA+
Sbjct  541   RRNSGSRSRSWSLSVVSDSELLNSEYKKMYAL  572



>ref|XP_004957374.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Setaria 
italica]
Length=562

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/578 (62%), Positives = 454/578 (79%), Gaps = 22/578 (4%)
 Frame = +2

Query  893   MEKQASFR-GVMEKQQSFRNMEKQKSFKGL-MEKQKSFRIAMERQLSFGGERKRGKDSPG  1066
             MEKQ+S R G +EK +SFR +EKQ+SFK L MEKQ+SF              KR KDSPG
Sbjct  1     MEKQSSTRHGPLEKLKSFRGIEKQRSFKFLSMEKQQSF--------------KRNKDSPG  46

Query  1067  KRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGE  1246
             KRGD  LHLAARAGN++ V++IL   D + + +  ++ NQ+GETALYV+AE GH  VV E
Sbjct  47    KRGDTELHLAARAGNVAHVQKILAECDPELVAELAARPNQDGETALYVSAEKGHIEVVCE  106

Query  1247  ILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAG  1426
             ILK  D+++A I ++N +DAFHIAAKQGHL+VLKELL  FP L MTT+S N+TAL TAA 
Sbjct  107   ILKACDVQSAGIKASNSFDAFHIAAKQGHLDVLKELLQAFPALAMTTNSVNATALDTAAT  166

Query  1427  QGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQ  1606
             QGH+D+V+LLLE D++LA+IARNNGKTVLH+AARMGH+EVV +L+NKDP IGFRTDKKGQ
Sbjct  167   QGHIDIVNLLLETDASLARIARNNGKTVLHSAARMGHVEVVTALLNKDPGIGFRTDKKGQ  226

Query  1607  TALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGINI  1786
             TALHMA KGQN +I+LEL+KPD SV+ + D+KGN  LH+ATRKG   MVQ LIS+EGI I
Sbjct  227   TALHMASKGQNAEILLELLKPDVSVIHVEDSKGNRPLHVATRKGNTIMVQTLISVEGIEI  286

Query  1787  NTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVES  1966
             N VN+AGETA  IAEK G  +++ +LKE G   +K+   PP+ AKQLKQTVSDI+HDV+S
Sbjct  287   NAVNRAGETAFAIAEKQGNEELINILKEVGGVTAKEQVNPPNPAKQLKQTVSDIRHDVQS  346

Query  1967  QLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVE--  2140
             Q++Q+RQT  + +KI K+++KLHI GLNNAINS TVVAVLIATVAFAAIF +PG ++E  
Sbjct  347   QIKQTRQTKMQFQKIKKRIQKLHIGGLNNAINSNTVVAVLIATVAFAAIFQLPGNFLESM  406

Query  2141  --KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFII  2314
               +     TLG+A +A+  AFI+F +FD+LALFIS+AVVVVQTS++V+EQKAKK+MVF+I
Sbjct  407   PPQPDPNLTLGQALIASDPAFIIFLVFDALALFISLAVVVVQTSLIVVEQKAKKKMVFVI  466

Query  2315  NKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEE  2494
             NKLMW ACL IS AFI+LTYVVVG  ++WLA  +  +G VIM+ T+GSMCYC+V HR+EE
Sbjct  467   NKLMWLACLCISAAFIALTYVVVGRDDEWLAWCTMAIGTVIMVATLGSMCYCIVTHRMEE  526

Query  2495  SRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
               MR IR+  T S+S+S+S + S++EL N  YK+MYA+
Sbjct  527   KSMRKIRRTST-SQSWSIS-IDSETELMNSEYKKMYAL  562



>ref|XP_002460533.1| hypothetical protein SORBIDRAFT_02g030070 [Sorghum bicolor]
 gb|EER97054.1| hypothetical protein SORBIDRAFT_02g030070 [Sorghum bicolor]
Length=562

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/578 (62%), Positives = 454/578 (79%), Gaps = 22/578 (4%)
 Frame = +2

Query  893   MEKQASFR-GVMEKQQSFRNMEKQKSFKGL-MEKQKSFRIAMERQLSFGGERKRGKDSPG  1066
             M+KQ+S R G +EK +SFR +EKQ+SFK L MEKQ+SF              KR KDSPG
Sbjct  1     MDKQSSTRHGTLEKLKSFRGIEKQRSFKFLSMEKQQSF--------------KRNKDSPG  46

Query  1067  KRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGE  1246
             KRGD  LHLAARAG+++ V+ IL   D + + +  ++QNQ+GETALYV+AE GH  VV E
Sbjct  47    KRGDTELHLAARAGSVAHVQRILAECDPELVVELAARQNQDGETALYVSAEKGHVEVVCE  106

Query  1247  ILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAG  1426
             ILK  D+++A + ++N +DAFHIAAKQGHL+VLKELL  FP+L MTT+S N+TAL TAA 
Sbjct  107   ILKASDVQSAGLKASNSFDAFHIAAKQGHLDVLKELLQAFPSLAMTTNSVNATALDTAAT  166

Query  1427  QGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQ  1606
             QGH+D+V+LLLE D++LA+IARNNGKTVLH+AARMGH+EVV +L+NKDP IGFRTDKKGQ
Sbjct  167   QGHIDIVNLLLETDASLARIARNNGKTVLHSAARMGHVEVVTALLNKDPGIGFRTDKKGQ  226

Query  1607  TALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGINI  1786
             TALHMA KGQN +I+LEL+KPD SV+ + D KGN  LH+ATRKG   MVQ LIS+EGI I
Sbjct  227   TALHMASKGQNAEILLELLKPDVSVIHVEDGKGNRPLHVATRKGNTIMVQTLISVEGIEI  286

Query  1787  NTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVES  1966
             N VN+AGETA  IAEK G  +++ +L+E G   +K+   PP+ AKQLKQTVSDI+HDV+S
Sbjct  287   NAVNRAGETAFAIAEKQGNEELINILREVGGETAKEQVNPPNPAKQLKQTVSDIRHDVQS  346

Query  1967  QLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKE  2146
             Q++Q+RQT  + +KI K+++KLHI GLNNAINS TVVAVLIATVAFAAIF +PG ++E  
Sbjct  347   QIKQTRQTKMQFQKIKKRIQKLHIGGLNNAINSNTVVAVLIATVAFAAIFQLPGNFLEDI  406

Query  2147  KKG----FTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFII  2314
              +      TLG+A +A+  AFI+F +FD+LALFIS+AVVVVQTS++V+EQKAKK+MVF+I
Sbjct  407   TQAPYPDMTLGQALIASDPAFIIFLVFDALALFISLAVVVVQTSLIVVEQKAKKKMVFVI  466

Query  2315  NKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEE  2494
             NKLMW ACL IS AFI+LTYVVVG  ++WLA  +  +G VIM+ T+GSMCYC+V HR+EE
Sbjct  467   NKLMWLACLCISAAFIALTYVVVGRDDEWLAWCTMAIGTVIMVATLGSMCYCIVAHRMEE  526

Query  2495  SRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
               MR IR+  T S+SFS+S + S++EL N  YK+MYA+
Sbjct  527   KSMRKIRRTST-SQSFSIS-IDSETELMNSEYKKMYAL  562



>ref|XP_008670326.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Zea 
mays]
 tpg|DAA40560.1| TPA: hypothetical protein ZEAMMB73_635403 [Zea mays]
Length=562

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/578 (62%), Positives = 453/578 (78%), Gaps = 22/578 (4%)
 Frame = +2

Query  893   MEKQASFR-GVMEKQQSFRNMEKQKSFKGL-MEKQKSFRIAMERQLSFGGERKRGKDSPG  1066
             MEKQ S R G +EK +SFR MEKQ+SFK L MEKQ+SF              KR KDSPG
Sbjct  1     MEKQPSVRHGALEKLKSFRGMEKQRSFKFLSMEKQQSF--------------KRNKDSPG  46

Query  1067  KRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGE  1246
             KRGD  LHLAARAG+++ V++IL   D + + +   + NQ+GETALYV+AE GH  VV E
Sbjct  47    KRGDTALHLAARAGSVAHVQKILAECDPELVVELAGRTNQDGETALYVSAEKGHVEVVCE  106

Query  1247  ILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAG  1426
             ILK  D+++A I ++N +DAFHIAAKQGHL+VLKELL  FP+L MTT+S N+TAL TAA 
Sbjct  107   ILKASDVQSAGIKASNSFDAFHIAAKQGHLDVLKELLQAFPSLAMTTNSVNATALDTAAT  166

Query  1427  QGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQ  1606
             QGHVD+V+LLLE D++LA+IARNNGKTVLH+AARMGH+EVV +L+NKDP IGFRTDKKGQ
Sbjct  167   QGHVDIVNLLLETDASLARIARNNGKTVLHSAARMGHVEVVTALLNKDPGIGFRTDKKGQ  226

Query  1607  TALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGINI  1786
             TALHMA KGQN +I+LEL+KPD SV+ + D+KGN  LH+ATRKG   MVQ LIS+EGI I
Sbjct  227   TALHMASKGQNAEILLELLKPDISVIHVEDSKGNRPLHVATRKGNTIMVQTLISVEGIEI  286

Query  1787  NTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVES  1966
             N VN+AGETA  IA+K G  ++V +L+E G   +K+   PP+ AKQLKQTVSDI+HDV+S
Sbjct  287   NAVNRAGETAFAIADKQGNEELVNILREVGGGTAKEQVNPPNPAKQLKQTVSDIRHDVQS  346

Query  1967  QLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKE  2146
             Q++Q+RQT  + +KI K+++KLHI GLNNAINS TVVAVLIATVAFAAIF +PG ++E  
Sbjct  347   QMKQTRQTKMQFQKIKKRIQKLHIGGLNNAINSNTVVAVLIATVAFAAIFQLPGNFLEDM  406

Query  2147  KKG----FTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFII  2314
              +      TLG+A +A+  AFI+F +FD+LALFIS+AVVVVQTS++V+EQKAKK+MVF+I
Sbjct  407   TQAPDPDMTLGQALIASDPAFIIFLVFDALALFISLAVVVVQTSLIVVEQKAKKKMVFVI  466

Query  2315  NKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEE  2494
             NKLMW ACL IS AFI+LTYVVVG  ++WLA  +  +G V M+ T+GSMCYCVV HR+EE
Sbjct  467   NKLMWLACLCISAAFIALTYVVVGRDDEWLAWCTMAIGTVTMVATVGSMCYCVVAHRMEE  526

Query  2495  SRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
               +R IR+  ++S+S+S+S + S++EL N  YK+MYA+
Sbjct  527   KSLRKIRRT-SMSQSWSIS-IDSEAELMNSEYKKMYAL  562



>ref|XP_008651626.1| PREDICTED: uncharacterized protein LOC100381797 isoform X1 [Zea 
mays]
 ref|XP_008651627.1| PREDICTED: uncharacterized protein LOC100381797 isoform X1 [Zea 
mays]
 ref|XP_008651628.1| PREDICTED: uncharacterized protein LOC100381797 isoform X1 [Zea 
mays]
 ref|XP_008652939.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Zea 
mays]
 ref|XP_008652940.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Zea 
mays]
 ref|XP_008652941.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Zea 
mays]
 tpg|DAA62305.1| TPA: hypothetical protein ZEAMMB73_262775 [Zea mays]
 tpg|DAA62306.1| TPA: hypothetical protein ZEAMMB73_262775 [Zea mays]
 tpg|DAA62309.1| TPA: hypothetical protein ZEAMMB73_314947 [Zea mays]
 tpg|DAA62310.1| TPA: hypothetical protein ZEAMMB73_314947 [Zea mays]
Length=567

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/583 (61%), Positives = 457/583 (78%), Gaps = 27/583 (5%)
 Frame = +2

Query  893   MEKQASFR-GVMEKQQSFRNMEKQKSFKGL-MEKQKSFRIAMERQLSFGGERKRGKDSPG  1066
             MEKQ+S R G +EK +SFR +EKQ+SFK L MEKQ+SF              KR KDSPG
Sbjct  1     MEKQSSTRHGALEKLKSFRGIEKQRSFKFLSMEKQQSF--------------KRNKDSPG  46

Query  1067  KRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGE  1246
             KRGD  LHLAARAG+++ V+ IL   D + + +  ++QNQ+GETALYV+AE GH  VV E
Sbjct  47    KRGDTALHLAARAGSVAHVQRILAECDPELLVELAARQNQDGETALYVSAEKGHVEVVCE  106

Query  1247  ILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAG  1426
             ILK  D+++A + ++N +DAFHIAAKQGHL+VLKELL+ FP+L MTT+S N+TAL TAA 
Sbjct  107   ILKASDVQSAGLKASNSFDAFHIAAKQGHLDVLKELLHAFPSLAMTTNSVNATALDTAAT  166

Query  1427  QGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQ  1606
             QGH+D+V+LLLE D++LA+IA+NNGKTVLH+AARMGH+EVV +L+NKDP +GFRTDKKGQ
Sbjct  167   QGHIDIVNLLLETDASLARIAKNNGKTVLHSAARMGHVEVVTALLNKDPGLGFRTDKKGQ  226

Query  1607  TALHM-----AVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISI  1771
             TALHM     A KGQN +I+LEL+KPD SV+ + D KGN  LH+ATRKG   MVQ LIS+
Sbjct  227   TALHMASKGLASKGQNAEILLELLKPDVSVIHVEDGKGNRPLHVATRKGNTIMVQTLISV  286

Query  1772  EGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIK  1951
             EGI IN VN+AGETA  IAEK G  ++V +L+EAG   +K+   PP+ AKQLKQTVSDI+
Sbjct  287   EGIEINAVNRAGETAFAIAEKQGNEELVNILREAGGVTAKEQVNPPNPAKQLKQTVSDIR  346

Query  1952  HDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQ  2131
             HDV+SQ++Q+RQT  + +KI K+++KLHI GLNNAINS TVVAVLIATVAFAAIF +PG 
Sbjct  347   HDVQSQIKQTRQTKMQFQKIKKRIEKLHIGGLNNAINSNTVVAVLIATVAFAAIFQLPGN  406

Query  2132  YVEKEKKG----FTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQ  2299
             ++E   +      TLG+A +A++ AFI+F +FD+LALFIS+AVVVVQTS++V+EQKAKK+
Sbjct  407   FLEDMSQAHGPDMTLGQAWIASEPAFIIFLVFDALALFISLAVVVVQTSLIVVEQKAKKK  466

Query  2300  MVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVR  2479
             MVF+INKLMW ACL IS AFI+LTYVVVG  ++WLA  +  +G VIM+ T+GSMCYC+V 
Sbjct  467   MVFVINKLMWLACLCISAAFIALTYVVVGRDDEWLAWCTMAIGTVIMVATLGSMCYCIVA  526

Query  2480  HRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             HR+EE  MR IR+  T S+S+S+S + S++EL N  YK+MYA+
Sbjct  527   HRMEEKSMRRIRRTST-SQSWSIS-IDSETELMNSEYKKMYAI  567



>gb|KHN16372.1| Ankyrin repeat-containing protein [Glycine soja]
Length=467

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/448 (76%), Positives = 395/448 (88%), Gaps = 3/448 (1%)
 Frame = +2

Query  911   FRGVMEKQQSFR--NMEKQKSFKGLMEKQKSFRIAMERQLSF-GGERKRGKDSPGKRGDN  1081
             F+  MEKQ SFR   MEKQKSF+G MEKQKSFRI ME+QLSF G ERK+ K+SPGKRGD 
Sbjct  5     FQVTMEKQSSFRASTMEKQKSFRGFMEKQKSFRIVMEKQLSFMGSERKKNKESPGKRGDL  64

Query  1082  PLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGEILKQL  1261
             P+HLAARAGNLS+V+EI+Q + +   KD L+KQN EGET LYVA+ENGH LVV EIL  L
Sbjct  65    PIHLAARAGNLSRVKEIIQNYSNNETKDLLAKQNLEGETPLYVASENGHALVVSEILNYL  124

Query  1262  DLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQGHVD  1441
             DL+TASIA+ NGYD FHIAAKQGHLEVL+ELL+ FPNL MTTD SNSTALHTAA QGH+D
Sbjct  125   DLQTASIAARNGYDPFHIAAKQGHLEVLRELLHSFPNLAMTTDLSNSTALHTAATQGHID  184

Query  1442  VVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQTALHM  1621
             VV LLLE DSNLAKIARNNGKTVLH+AARMGHLEVVK+L+NKDPS GFRTDKKGQTALHM
Sbjct  185   VVKLLLESDSNLAKIARNNGKTVLHSAARMGHLEVVKALLNKDPSTGFRTDKKGQTALHM  244

Query  1622  AVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGININTVNK  1801
             AVKGQN +I+LEL+KPDP+VL+L DNKGNTALHIAT+KGR Q V+ L+S+E ININ  NK
Sbjct  245   AVKGQNEEILLELVKPDPAVLSLEDNKGNTALHIATKKGRTQNVRCLLSMECININATNK  304

Query  1802  AGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQLQQS  1981
             AGET LD+AEKFG+P++V++L++AGA +S D  KPP+ +KQLKQTVSDIKHDV+SQLQQ+
Sbjct  305   AGETPLDVAEKFGSPELVSILRDAGAANSTDQRKPPNPSKQLKQTVSDIKHDVQSQLQQT  364

Query  1982  RQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKEKKGFT  2161
             RQTG +V+KIAKK+KKLHISGLNNAINS TVVAVLIATVAFAAIFTVPGQYVE +  GF+
Sbjct  365   RQTGMRVQKIAKKLKKLHISGLNNAINSATVVAVLIATVAFAAIFTVPGQYVEDKTHGFS  424

Query  2162  LGEANVANKAAFIVFFLFDSLALFISIA  2245
             LG+AN+AN AAF++FF+FDSLALFIS+A
Sbjct  425   LGQANIANNAAFLIFFVFDSLALFISLA  452



>ref|XP_004974098.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Setaria 
italica]
Length=561

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/578 (62%), Positives = 448/578 (78%), Gaps = 23/578 (4%)
 Frame = +2

Query  893   MEKQASFR-GVMEKQQSFRNMEKQKSFKGLMEKQKSFRIAMERQLSFGGERKRGKDSPGK  1069
             ME+Q+S R G +EK +SFR MEKQKSF+G+M        ++ER         R +DSPGK
Sbjct  1     MERQSSIRLGALEKLKSFRGMEKQKSFRGIM--------SLER---------RSRDSPGK  43

Query  1070  RGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGEI  1249
             RGD PLHLAAR+G+++  + IL   D   + +  +KQNQ+GET LYVAAE GH  VV EI
Sbjct  44    RGDTPLHLAARSGSVAHAQRILAELDPALVAEMAAKQNQDGETPLYVAAEKGHAEVVREI  103

Query  1250  LKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQ  1429
             LK  D++TA I ++N +DAFHIAAKQGHLEVLKE+L  FP L MTT+S N+TAL TAA Q
Sbjct  104   LKVSDVQTAGIKASNSFDAFHIAAKQGHLEVLKEMLQAFPALAMTTNSVNATALDTAAIQ  163

Query  1430  GHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQT  1609
             GHVD+V+LLLE D++LA+IARNNGKTVLH+AARMGH+EVV+SL+NKDPSIG RTDKKGQT
Sbjct  164   GHVDIVNLLLETDASLARIARNNGKTVLHSAARMGHVEVVRSLLNKDPSIGLRTDKKGQT  223

Query  1610  ALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGININ  1789
             ALHMA KGQN +IV+EL+KPD SV+ + D +GN  LH+A+RKG   +VQ L+S+EGI++N
Sbjct  224   ALHMASKGQNAEIVVELLKPDTSVVHIEDKQGNRPLHVASRKGNIIIVQTLLSVEGIDVN  283

Query  1790  TVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQ  1969
              VN++GETA  IAEK    ++V +LKEAG   +K+   PP++AKQLKQTVSDI+HDV+SQ
Sbjct  284   AVNRSGETAFAIAEKMNNEELVNILKEAGGVTAKEPAHPPNSAKQLKQTVSDIRHDVQSQ  343

Query  1970  LQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKEK  2149
             ++Q+RQT  +V KI K+++KLHI GLNNAINS TVVAVLIATVAFAAIFTVPG +VE   
Sbjct  344   IKQTRQTKMQVHKIKKRLEKLHIGGLNNAINSNTVVAVLIATVAFAAIFTVPGNFVEDLS  403

Query  2150  KG---FTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINK  2320
             +     +LG+A VA+  AFIVF +FD+LALFIS+AVVVVQTS++V+EQKAKK+MVF++NK
Sbjct  404   QAPPEMSLGQAYVASNPAFIVFLVFDALALFISLAVVVVQTSLIVVEQKAKKRMVFVMNK  463

Query  2321  LMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESR  2500
             LMW ACLFIS+AFI+LTYVVVG  + WLA  +  +G VIMLTT+GSMCYC++ HRL E  
Sbjct  464   LMWLACLFISVAFIALTYVVVGRDDWWLAWCTMAIGTVIMLTTLGSMCYCIITHRLNEKN  523

Query  2501  MRNIRKAE-TLSRSFSMSMVPSDSELYNESYK-RMYAV  2608
              R IRKA  + SR      V SD E+ N  YK +MYA+
Sbjct  524   TRKIRKASASQSRGSWSRSVDSDEEILNSEYKTKMYAL  561



>ref|XP_006660851.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Oryza 
brachyantha]
Length=562

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/578 (62%), Positives = 448/578 (78%), Gaps = 22/578 (4%)
 Frame = +2

Query  893   MEKQASFR-GVMEKQQSFRNMEKQKSFKGL-MEKQKSFRIAMERQLSFGGERKRGKDSPG  1066
             ME+Q+S R G +EK +SFR +EKQ+SFK L MEKQ+SF              KR KDSPG
Sbjct  1     MERQSSIRLGALEKLKSFRGIEKQRSFKFLSMEKQQSF--------------KRNKDSPG  46

Query  1067  KRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGE  1246
             KRGD  LHLAARAG++  V++I    D + + +  ++QNQ+GETALYV+AE GHT VV E
Sbjct  47    KRGDTELHLAARAGSVPHVQKIFADSDPELVGELAARQNQDGETALYVSAEKGHTEVVSE  106

Query  1247  ILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAG  1426
             ILK  DL++A I + N +DAFHIAAKQGHL+VLKELL  FP L MTT+S N+TAL TAA 
Sbjct  107   ILKFCDLQSAGIKATNSFDAFHIAAKQGHLDVLKELLQAFPALAMTTNSVNATALDTAAT  166

Query  1427  QGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQ  1606
             QGH+D+V+LLLE D++LA+IARNNGKTVLH+AARMGH+EVV +L+NKDP IGFRTDKKGQ
Sbjct  167   QGHIDIVNLLLETDASLARIARNNGKTVLHSAARMGHVEVVTALLNKDPGIGFRTDKKGQ  226

Query  1607  TALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGINI  1786
             TALHMA KGQN DI+LEL+KPD SV+ L DNKGN  LH+ATRKG   MVQ LIS+EGI I
Sbjct  227   TALHMASKGQNADILLELLKPDLSVIHLEDNKGNRPLHVATRKGNTIMVQTLISVEGIVI  286

Query  1787  NTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVES  1966
             N VN+AGETA  IAEK G  ++  +L+E G   +K+   PP++AKQLK+TVSDI+HDV+S
Sbjct  287   NAVNRAGETAFAIAEKLGNEELSNLLREVGGETAKEKVNPPNSAKQLKKTVSDIRHDVQS  346

Query  1967  QLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKE  2146
              ++Q+RQT  + +KI K+++KLHI GLNNAINS TVVAVLIATVAFAAIFT+PG ++E  
Sbjct  347   GIKQTRQTKMQFQKIKKRIQKLHIGGLNNAINSNTVVAVLIATVAFAAIFTIPGNFLEDL  406

Query  2147  KKG----FTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFII  2314
             K+      TLG+A VA+  AFI+F +FD+LALFIS+AVVVVQTS++V+EQKAKK+MVF++
Sbjct  407   KQAPDPDMTLGQALVASNPAFIIFLVFDALALFISLAVVVVQTSLIVVEQKAKKKMVFVM  466

Query  2315  NKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEE  2494
             NKLMW ACLFIS AFI+LTYVVVG  ++WLA  +  +G  IML TIGSMCYC++ HR+EE
Sbjct  467   NKLMWLACLFISAAFIALTYVVVGRDDRWLAWCTMAIGTAIMLATIGSMCYCIIAHRMEE  526

Query  2495  SRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
               M+ +R++ T         V SD+EL N  YK++YA+
Sbjct  527   KNMKKLRRSSTSQS--WSISVESDTELLNNEYKKIYAL  562



>ref|XP_002445764.1| hypothetical protein SORBIDRAFT_07g025390 [Sorghum bicolor]
 gb|EES15259.1| hypothetical protein SORBIDRAFT_07g025390 [Sorghum bicolor]
Length=562

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/580 (61%), Positives = 450/580 (78%), Gaps = 26/580 (4%)
 Frame = +2

Query  893   MEKQASFR-GVMEKQQSFRNMEKQKSFKGLMEKQKSFRIAMERQLSFGGERKRGKDSPGK  1069
             ME+Q+S R G +EK +SFR MEKQKSF+G+M        ++ER         R +DSPGK
Sbjct  1     MERQSSIRLGALEKLKSFRGMEKQKSFRGIM--------SLER---------RSRDSPGK  43

Query  1070  RGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGEI  1249
             RGD PLHLAAR+G+++  + IL   D   + +  +KQNQ+GET LYVAAE GH  VV EI
Sbjct  44    RGDTPLHLAARSGSVAHAQRILAELDRALVAEMAAKQNQDGETPLYVAAEKGHAEVVREI  103

Query  1250  LKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQ  1429
             LK  D++TA I ++N +DAFHIAAKQGHLEVLKE+L   P L MTT+S N+TAL TAA  
Sbjct  104   LKVSDVQTAGIKASNSFDAFHIAAKQGHLEVLKEMLQALPALAMTTNSVNATALDTAAIL  163

Query  1430  GHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQT  1609
             GHVD+V+LLLE D++LA+IARNNGKTVLH+AARMGH+EVV+SL+NKDP IG RTDKKGQT
Sbjct  164   GHVDIVNLLLETDASLARIARNNGKTVLHSAARMGHVEVVRSLLNKDPGIGLRTDKKGQT  223

Query  1610  ALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGININ  1789
             ALHMA KGQN +IV+EL+KPD SV+ + DNKGN  LH+ATRKG   +VQ L+S+EGI++N
Sbjct  224   ALHMASKGQNAEIVVELLKPDVSVIHIEDNKGNRPLHVATRKGNIIIVQTLLSVEGIDVN  283

Query  1790  TVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQ  1969
              VN++GETA  IAEK    ++V +LKEAG   +K    PP++AKQLKQTVSDI+HDV+SQ
Sbjct  284   AVNRSGETAFAIAEKMNNEELVNILKEAGGETAKQQVHPPNSAKQLKQTVSDIRHDVQSQ  343

Query  1970  LQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVE---  2140
             ++Q+RQT  +V +I K+++KLHI GLNNAINS TVVAVLIATVAFAAIFTVPG +VE   
Sbjct  344   IKQTRQTKMQVNQIKKRLEKLHIGGLNNAINSNTVVAVLIATVAFAAIFTVPGNFVEDLT  403

Query  2141  KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINK  2320
             +   G +LG+A VA+  AFI+F +FD+LALFIS+AVVVVQTS++V+E++AKK+MVF++NK
Sbjct  404   QAPPGMSLGQAYVASNPAFIIFLVFDALALFISLAVVVVQTSLIVVERRAKKRMVFVMNK  463

Query  2321  LMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESR  2500
             LMW ACLFIS+AFI+LTYVVVG  + WLA  +  +G VIMLTT+GSMCYC++ HRLEE  
Sbjct  464   LMWLACLFISVAFIALTYVVVGRDDWWLAWCTMAIGTVIMLTTLGSMCYCIIAHRLEEKN  523

Query  2501  MRNIRKAETLSR---SFSMSMVPSDSELYNESYK-RMYAV  2608
              R IRK  + S+   S+S S V SD E+ N  YK +MYA+
Sbjct  524   TRKIRKKASASQSRGSWSRS-VDSDEEILNSEYKTKMYAL  562



>ref|XP_003578456.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Brachypodium 
distachyon]
Length=565

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/579 (61%), Positives = 443/579 (77%), Gaps = 21/579 (4%)
 Frame = +2

Query  893   MEKQASFR-GVMEKQQSFRNMEKQKSFKGL-MEKQKSFRIAMERQLSFGGERKRGKDSPG  1066
             ME+Q+S R G +EK +SFR +EKQ+SFK L MEKQ SF+             +R KDSPG
Sbjct  1     MERQSSSRLGALEKLKSFRGIEKQRSFKFLSMEKQHSFK------------ERRSKDSPG  48

Query  1067  KRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGE  1246
             KRGD+ LHLAARAG+++ V++I    D + + +  S QNQ+GETALYV+AE GH  VV E
Sbjct  49    KRGDSALHLAARAGSVAHVQKIFADCDPELVGELASHQNQDGETALYVSAEKGHVEVVCE  108

Query  1247  ILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAG  1426
             ILK  D+++A + +NN +DAFHIAAKQGHL+VL+ELL  FP L MTT S N+TAL TAA 
Sbjct  109   ILKVCDVQSAGLKANNSFDAFHIAAKQGHLDVLQELLQAFPALAMTTSSVNATALDTAAT  168

Query  1427  QGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQ  1606
             QGH+ +V+LLLE D++LA+IARNNGKTVLH+AARMGH+EVV SL+NKDP I FRTDKKGQ
Sbjct  169   QGHIGIVNLLLETDASLARIARNNGKTVLHSAARMGHVEVVASLLNKDPGISFRTDKKGQ  228

Query  1607  TALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGINI  1786
             TALHMA KGQN +I+LEL+KPD SV+ + DNKGN  LH+ATRKG   MVQ LIS+EGI+I
Sbjct  229   TALHMASKGQNAEILLELLKPDVSVIHMEDNKGNRPLHVATRKGNTIMVQTLISVEGIDI  288

Query  1787  NTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVES  1966
             N  NKAGETA  IAEK G  ++V +L+E G   +K+   PP +AKQLKQTVSDI+HDV+S
Sbjct  289   NATNKAGETAFAIAEKLGNEELVNILREVGGVTAKEQVNPPKSAKQLKQTVSDIRHDVQS  348

Query  1967  QLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKE  2146
             Q +Q+ QT     KI K+++KLHI GLNNAINS TVVAVLIATVAFAAIFT+PG ++E  
Sbjct  349   QFKQTHQTKMHFHKIKKRLQKLHIGGLNNAINSNTVVAVLIATVAFAAIFTIPGNFLEDM  408

Query  2147  KKG----FTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFII  2314
             KK      TLG+A VA+K AFI+F +FDSLALFIS+AVVVVQTS++V+EQKAK++MVF++
Sbjct  409   KKAPDPNMTLGQALVASKPAFIIFLVFDSLALFISLAVVVVQTSLIVVEQKAKQKMVFVM  468

Query  2315  NKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEE  2494
             NKLMW AC+ IS AFI+LTYVVVG  ++WLA  +  +G VIML T+GSMCYC++ HR+EE
Sbjct  469   NKLMWLACICISAAFIALTYVVVGRDDEWLAWCTMAIGTVIMLATLGSMCYCIITHRMEE  528

Query  2495  SRMRNIRKAETLSRSFSMSMVPSDSEL-YNESYKRMYAV  2608
               MR IR++ T         V SD+EL  N   KRMYA+
Sbjct  529   KSMRRIRRSSTSQS--WSISVDSDTELELNSGKKRMYAI  565



>ref|XP_008679639.1| PREDICTED: protein binding protein isoform X1 [Zea mays]
 ref|XP_008679643.1| PREDICTED: protein binding protein isoform X1 [Zea mays]
 ref|XP_008679650.1| PREDICTED: protein binding protein isoform X1 [Zea mays]
 ref|XP_008669959.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat-containing protein 
At5g02620-like [Zea mays]
 gb|ACR36603.1| unknown [Zea mays]
 tpg|DAA48335.1| TPA: protein binding protein isoform 1 [Zea mays]
 tpg|DAA48336.1| TPA: protein binding protein isoform 2 [Zea mays]
Length=561

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/578 (61%), Positives = 444/578 (77%), Gaps = 23/578 (4%)
 Frame = +2

Query  893   MEKQASFR-GVMEKQQSFRNMEKQKSFKGLMEKQKSFRIAMERQLSFGGERKRGKDSPGK  1069
             ME+Q+S R G +EK +SFR MEKQKSF+G+M        ++ER         R +DSPGK
Sbjct  1     MERQSSIRLGALEKLRSFRGMEKQKSFRGIM--------SLER---------RSRDSPGK  43

Query  1070  RGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGEI  1249
             RGD PLHLAARAG+++ V+ IL   D     +  ++QNQ+GET LYVAAE GH  VV EI
Sbjct  44    RGDTPLHLAARAGSVAHVQRILAELDRALAAEMAARQNQDGETPLYVAAEKGHAEVVREI  103

Query  1250  LKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQ  1429
             LK   ++TA I ++N +DAFHIAAKQGHLEVLKE+L   P L MTT+S N+TAL TAA Q
Sbjct  104   LKVCGVQTAGIKASNSFDAFHIAAKQGHLEVLKEMLQALPALAMTTNSVNATALDTAAIQ  163

Query  1430  GHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQT  1609
             GHVD+V+LLLE D++LA+I RNNGKTVLH+AARMGH+EVV+SL+NKDP IG RTDKKGQT
Sbjct  164   GHVDIVNLLLETDASLARITRNNGKTVLHSAARMGHVEVVRSLLNKDPRIGLRTDKKGQT  223

Query  1610  ALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGININ  1789
             ALHMA K QN +IV+EL+KPD SV+ + DNKGN  LH+ATRKG   +VQ L+S+EGI++N
Sbjct  224   ALHMASKAQNAEIVVELLKPDVSVIHIEDNKGNRPLHVATRKGNIIIVQTLLSVEGIDVN  283

Query  1790  TVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQ  1969
              VN++GETA  IAEK  + ++V +LKEAG   +K    PP++AKQLK+TVSDI+HDV+SQ
Sbjct  284   AVNRSGETAFAIAEKMDSVELVNILKEAGGEAAKQQVHPPNSAKQLKETVSDIRHDVQSQ  343

Query  1970  LQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVE---  2140
              +Q+RQT  +V +I K+++KLHI GLNNAINS TVVAVLIATVAFAAIFTVPG +VE   
Sbjct  344   FKQTRQTKMQVNQIKKRLEKLHIGGLNNAINSNTVVAVLIATVAFAAIFTVPGNFVEELS  403

Query  2141  KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINK  2320
             +   G +LG+A VA+  AFIVF +FD+LALFIS+AVVVVQTS++V+E++AKK+MVF++NK
Sbjct  404   QAPPGMSLGQAYVASNPAFIVFLVFDALALFISLAVVVVQTSLIVVERRAKKRMVFVMNK  463

Query  2321  LMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESR  2500
             LMW ACLFIS+AFI+LTYVVVG  + WLA  +  +G  IMLTT+GSMCYC+V HRLEE  
Sbjct  464   LMWLACLFISVAFIALTYVVVGRDDWWLAWCTMGIGAAIMLTTLGSMCYCIVAHRLEEKN  523

Query  2501  MRNIRKAE-TLSRSFSMSMVPSDSELYNESYK-RMYAV  2608
              R IR+A  + SR      V SD E+ N  YK +MYA+
Sbjct  524   TRKIRRASASQSRGSWSRSVDSDEEILNSEYKTKMYAL  561



>ref|XP_010930296.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Elaeis 
guineensis]
Length=574

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/578 (63%), Positives = 451/578 (78%), Gaps = 10/578 (2%)
 Frame = +2

Query  893   MEKQASFR-GVMEKQQSFR--NMEKQKSFK-GLMEKQKSFRI-AMERQLSFGGERKRGKD  1057
             MEKQ SF  G +E+ +SFR   MEKQKSF+ G+MEKQKS R  +ME+Q SF  E+KR KD
Sbjct  1     MEKQQSFHVGALEELRSFRLGAMEKQKSFRLGVMEKQKSVRRGSMEKQQSFH-EKKR-KD  58

Query  1058  SPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLV  1237
                KRGD PLHLAARAGN+    +IL       +KD +SKQNQ+GETALY+AAE GH  V
Sbjct  59    GFRKRGDTPLHLAARAGNMVHAMKILLDCSDSHLKDLISKQNQDGETALYIAAEMGHIGV  118

Query  1238  VGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHT  1417
             V EIL   D+++AS+ + N +DAFHIAA++GHLEVLK  L+ FP L MTTDSSNSTAL+T
Sbjct  119   VREILSVSDVQSASLKATNNFDAFHIAARKGHLEVLKVFLHSFPALAMTTDSSNSTALYT  178

Query  1418  AAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDK  1597
             AA QGH +VVDLLLE D++LAKIAR+NGKT LH+AARMGH+EVVKSL+ +DPS+G RTDK
Sbjct  179   AATQGHTNVVDLLLETDASLAKIARSNGKTALHSAARMGHVEVVKSLLREDPSLGLRTDK  238

Query  1598  KGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEG  1777
             KGQTA+HMAVKG  V+IVLEL++  PSV +L DNKGNT LHIATRKGR +++Q L+S++G
Sbjct  239   KGQTAIHMAVKGHGVEIVLELLRTYPSVASLEDNKGNTPLHIATRKGRHEIMQALLSVDG  298

Query  1778  ININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHD  1957
             I +N VN+AGETAL IAEK     ++  LKE GA  +K H  PP+AAKQLKQTVSDIKH+
Sbjct  299   IKVNAVNRAGETALSIAEKSCDGKIMAFLKEVGAVAAKKHPNPPNAAKQLKQTVSDIKHE  358

Query  1958  VESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYV  2137
             V+ QL Q+R+T  +V+ I KK++KLH  GLNNAINS TVVAVLIA VAFAAIFTVPGQYV
Sbjct  359   VQFQLLQTRRTEIRVQNIKKKLQKLHRGGLNNAINSNTVVAVLIAAVAFAAIFTVPGQYV  418

Query  2138  EKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIIN  2317
             E    G TLG+  +A  AAFIVF +FDSLALFI++AVVVVQTS++VIE+KAK+ MVF+IN
Sbjct  419   ETPTDGSTLGQVYIAENAAFIVFLVFDSLALFIALAVVVVQTSLIVIEEKAKRLMVFVIN  478

Query  2318  KLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEES  2497
             KLMW ACLFIS +F+SL YVVVG +  WLA  +TV+G +IMLTT+GSMCY ++ HR+E  
Sbjct  479   KLMWLACLFISASFMSLCYVVVGRQGYWLAWVTTVIGALIMLTTLGSMCYFMIIHRIERK  538

Query  2498  RMRNIRKAETLSRSFSMSM-VPSDSELYNESYKRMYAV  2608
              + NIR+A   SR+ S SM   S+SE+    YK MYA+
Sbjct  539   NLTNIRRASG-SRTLSWSMSAASESEMLKNEYK-MYAL  574



>gb|EAZ07847.1| hypothetical protein OsI_30106 [Oryza sativa Indica Group]
Length=557

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/577 (61%), Positives = 446/577 (77%), Gaps = 25/577 (4%)
 Frame = +2

Query  893   MEKQASFR-GVMEKQQSFRNMEKQKSFKGLMEKQKSFRIAMERQLSFGGERKRGKDSPGK  1069
             ME+Q SFR G +EK +SFR MEKQKSFK  M    +FR              R +DSPGK
Sbjct  1     MERQTSFRLGALEKLKSFRGMEKQKSFK--MMSMDNFR--------------RHRDSPGK  44

Query  1070  RGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGEI  1249
             RGD PLHLAAR+GN +  + I+  FD +   +  ++ N +GET LYVAAE GHT VV EI
Sbjct  45    RGDTPLHLAARSGNAAGAQRIIAEFDPEVAAERAAQANHDGETPLYVAAERGHTDVVREI  104

Query  1250  LKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQ  1429
             LK  D++TA + +NN +DAFHIAAKQGHLEVLKELL  FP L MTT+S N+TAL TAA  
Sbjct  105   LKVSDVQTAGVKANNSFDAFHIAAKQGHLEVLKELLQAFPALAMTTNSVNATALDTAAIL  164

Query  1430  GHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQT  1609
             GH ++V+LLLE D+NLA+IARNNGKTVLH+AAR+GH+E+V+SL+++DP IG RTDKKGQT
Sbjct  165   GHTEIVNLLLESDANLARIARNNGKTVLHSAARLGHVEIVRSLLSRDPGIGLRTDKKGQT  224

Query  1610  ALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGININ  1789
             ALHMA KGQN +IV+EL+KPD SV+ L DNKGN  LH+ATRK    +VQ L+S+EGI +N
Sbjct  225   ALHMASKGQNAEIVIELLKPDISVIHLEDNKGNRPLHVATRKANIVIVQTLLSVEGIEVN  284

Query  1790  TVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQ  1969
              VN++G TAL IAE+    ++V +L+EAG   +K+   PP+ AKQLKQTVSDI+HDV+SQ
Sbjct  285   AVNRSGHTALAIAEQLNNEELVNILREAGGVTAKEQVHPPNPAKQLKQTVSDIRHDVQSQ  344

Query  1970  LQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVE---  2140
             ++Q++QT  +V+KI K+++KLHI GLNNAINS TVVAVLIATVAFAAIFTVPG +VE   
Sbjct  345   IKQTKQTKMQVQKIKKRLEKLHIGGLNNAINSNTVVAVLIATVAFAAIFTVPGNFVEDIT  404

Query  2141  KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINK  2320
             +   G +LG+A VA+  AF+VF +FD+LALFIS+AVVVVQTS++V+EQKAK++MVF++NK
Sbjct  405   QAPPGMSLGQAYVASNPAFLVFLVFDALALFISLAVVVVQTSLIVVEQKAKRRMVFVMNK  464

Query  2321  LMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESR  2500
             LMW ACLFIS+AFI+LTYVVVG  + WLA  +  +G VIMLTT+GSMCYC++ HR++E  
Sbjct  465   LMWLACLFISVAFIALTYVVVGRDDWWLAWCTMAIGAVIMLTTLGSMCYCIIAHRMDE--  522

Query  2501  MRNIRKAET-LSRSFSMSMVPSDSELYNESYKRMYAV  2608
              R IRKA T  SRS+S + V SD +L N  YK+MYA+
Sbjct  523   -RKIRKASTSQSRSWSQT-VDSDPDLLNSEYKKMYAL  557



>ref|NP_001062394.1| Os08g0542700 [Oryza sativa Japonica Group]
 dbj|BAF24308.1| Os08g0542700 [Oryza sativa Japonica Group]
 gb|EAZ43522.1| hypothetical protein OsJ_28140 [Oryza sativa Japonica Group]
 dbj|BAG94706.1| unnamed protein product [Oryza sativa Japonica Group]
Length=557

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/577 (61%), Positives = 446/577 (77%), Gaps = 25/577 (4%)
 Frame = +2

Query  893   MEKQASFR-GVMEKQQSFRNMEKQKSFKGLMEKQKSFRIAMERQLSFGGERKRGKDSPGK  1069
             ME+Q SFR G +EK +SFR MEKQKSFK  M    +FR              R +DSPGK
Sbjct  1     MERQTSFRLGALEKLKSFRGMEKQKSFK--MMSTDNFR--------------RHRDSPGK  44

Query  1070  RGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGEI  1249
             RGD PLHLAAR+GN +  + I+  FD +   +  ++ N +GET LYVAAE GHT VV EI
Sbjct  45    RGDTPLHLAARSGNAAGAQRIIAEFDPEVAAERAAQANHDGETPLYVAAERGHTDVVREI  104

Query  1250  LKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQ  1429
             LK  D++TA + +NN +DAFHIAAKQGHLEVLKELL  FP L MTT+S N+TAL TAA  
Sbjct  105   LKVSDVQTAGVKANNSFDAFHIAAKQGHLEVLKELLQAFPALAMTTNSVNATALDTAAIL  164

Query  1430  GHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQT  1609
             GH ++V+LLLE D+NLA+IARNNGKTVLH+AAR+GH+E+V+SL+++DP IG RTDKKGQT
Sbjct  165   GHTEIVNLLLESDANLARIARNNGKTVLHSAARLGHVEIVRSLLSRDPGIGLRTDKKGQT  224

Query  1610  ALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGININ  1789
             ALHMA KGQN +IV+EL+KPD SV+ L DNKGN  LH+ATRK    +VQ L+S+EGI +N
Sbjct  225   ALHMASKGQNAEIVIELLKPDISVIHLEDNKGNRPLHVATRKANIVIVQTLLSVEGIEVN  284

Query  1790  TVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQ  1969
              VN++G TAL IAE+    ++V +L+EAG   +K+   PP+ AKQLKQTVSDI+HDV+SQ
Sbjct  285   AVNRSGHTALAIAEQLNNEELVNILREAGGVTAKEQVHPPNPAKQLKQTVSDIRHDVQSQ  344

Query  1970  LQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVE---  2140
             ++Q++QT  +V+KI K+++KLHI GLNNAINS TVVAVLIATVAFAAIFTVPG +VE   
Sbjct  345   IKQTKQTKMQVQKIKKRLEKLHIGGLNNAINSNTVVAVLIATVAFAAIFTVPGNFVEDIT  404

Query  2141  KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINK  2320
             +   G +LG+A VA+  AF+VF +FD+LALFIS+AVVVVQTS++V+EQKAK++MVF++NK
Sbjct  405   QAPPGMSLGQAYVASNPAFLVFLVFDALALFISLAVVVVQTSLIVVEQKAKRRMVFVMNK  464

Query  2321  LMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESR  2500
             LMW ACLFIS+AFI+LTYVVVG  + WLA  +  +G VIMLTT+GSMCYC++ HR++E  
Sbjct  465   LMWLACLFISVAFIALTYVVVGRDDWWLAWCTMAIGAVIMLTTLGSMCYCIIAHRMDE--  522

Query  2501  MRNIRKAET-LSRSFSMSMVPSDSELYNESYKRMYAV  2608
              R IRKA T  SRS+S + V SD +L N  YK+MYA+
Sbjct  523   -RKIRKASTSQSRSWSQT-VDSDPDLLNSEYKKMYAL  557



>gb|EMT16664.1| hypothetical protein F775_21555 [Aegilops tauschii]
Length=565

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/579 (61%), Positives = 442/579 (76%), Gaps = 21/579 (4%)
 Frame = +2

Query  893   MEKQASFR-GVMEKQQSFRNMEKQKSFKGL-MEKQKSFRIAMERQLSFGGERKRGKDSPG  1066
             ME+Q+S R G +EK +SFR +EKQ+SFK L MEKQ+SF+             +R +DSPG
Sbjct  1     MERQSSSRFGALEKLKSFRGIEKQRSFKFLSMEKQQSFK------------ERRSRDSPG  48

Query  1067  KRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGE  1246
             KRGD+ LHLAARAGN+S V+ I    D + + +  + QN +GETALYVAAE GH  VV E
Sbjct  49    KRGDSALHLAARAGNVSHVQRIFADCDPELVGELAAHQNLDGETALYVAAEKGHVDVVCE  108

Query  1247  ILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAG  1426
             ILK  D+++A + + N +DAFHIAAKQGHL+VL+ELL  FP L MTT S N+TAL TAA 
Sbjct  109   ILKACDVQSAGLKATNSFDAFHIAAKQGHLDVLQELLQAFPALAMTTSSVNATALDTAAT  168

Query  1427  QGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQ  1606
             QGH+ +V+LLL+ D++LA+IAR+NGKTVLH+AARMGH+EVV SL+NKDP IGFRTD+KGQ
Sbjct  169   QGHIGIVNLLLDTDASLARIARSNGKTVLHSAARMGHVEVVASLLNKDPDIGFRTDRKGQ  228

Query  1607  TALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGINI  1786
             TALHMA KGQN +I+LEL+KPD SV+ L DNKGN ALH+ATRKG   MVQ LISIE I+I
Sbjct  229   TALHMASKGQNAEILLELLKPDVSVIHLEDNKGNRALHVATRKGNTIMVQTLISIEEIDI  288

Query  1787  NTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVES  1966
             N VNKAGETA  IAEK G  ++V +L+E G   +K+   PP +AKQLKQTVSDIKHDV+S
Sbjct  289   NAVNKAGETAFAIAEKQGNEELVNILREVGGITAKEQANPPKSAKQLKQTVSDIKHDVQS  348

Query  1967  QLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKE  2146
             Q++Q+RQT   V KI K+++KLHI GLNNAINS TVVAVLIATVAFA+IFT+PG ++E  
Sbjct  349   QIKQTRQTKMHVHKIKKRIQKLHIGGLNNAINSNTVVAVLIATVAFASIFTIPGNFLESM  408

Query  2147  KKG----FTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFII  2314
              K      TLG+A VA++ AFI+F +FDSLALFIS+AVVVVQTS++V+EQKAK++MVF++
Sbjct  409   DKATEPDMTLGQALVASRPAFIIFLVFDSLALFISLAVVVVQTSLIVVEQKAKQKMVFVM  468

Query  2315  NKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEE  2494
             NKLMW ACL IS AFI+LTYVVVG  ++WLA  +  +G VIMLTTIG MCYC++ HR+E 
Sbjct  469   NKLMWLACLCISAAFIALTYVVVGRNDEWLAWCTMAIGTVIMLTTIGCMCYCIISHRMEA  528

Query  2495  SRMRNIRKAETLSRSFSMSMVPSDSELYNESY-KRMYAV  2608
               MR IR++           V SD+EL   S  K MYA+
Sbjct  529   QSMRRIRRSSMSQS--WSISVDSDTELDMTSRNKTMYAL  565



>ref|NP_001063687.1| Os09g0518500 [Oryza sativa Japonica Group]
 dbj|BAD34405.1| ankyrin-like protein [Oryza sativa Japonica Group]
 dbj|BAD34362.1| ankyrin-like protein [Oryza sativa Japonica Group]
 dbj|BAF25601.1| Os09g0518500 [Oryza sativa Japonica Group]
 gb|EAZ45386.1| hypothetical protein OsJ_30032 [Oryza sativa Japonica Group]
 dbj|BAG94786.1| unnamed protein product [Oryza sativa Japonica Group]
Length=562

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/578 (61%), Positives = 446/578 (77%), Gaps = 22/578 (4%)
 Frame = +2

Query  893   MEKQASFR-GVMEKQQSFRNMEKQKSFKGL-MEKQKSFRIAMERQLSFGGERKRGKDSPG  1066
             ME+Q+S R G +EK +SFR +EKQ+SFK L MEKQ+SF              KR KDSPG
Sbjct  1     MERQSSSRLGALEKLKSFRGIEKQRSFKFLSMEKQQSF--------------KRNKDSPG  46

Query  1067  KRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGE  1246
             KRGD  LHLAARAG++  V++I    D + + +  ++QNQ+GETALYV+AE GHT VV E
Sbjct  47    KRGDTELHLAARAGSVPHVQKIFAASDPELVGELAARQNQDGETALYVSAEKGHTEVVSE  106

Query  1247  ILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAG  1426
             ILK  DL++A + + N +DAFHIAAKQGHL+VLKELL  FP L MTT+S N+TAL TAA 
Sbjct  107   ILKFCDLQSAGLKATNSFDAFHIAAKQGHLDVLKELLQAFPALAMTTNSVNATALDTAAT  166

Query  1427  QGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQ  1606
             QGH+D+V+LLLE D++LA+IARNNGKTVLH+AARMGH+EVV +L+NKDP IGFRTDKKGQ
Sbjct  167   QGHIDIVNLLLETDASLARIARNNGKTVLHSAARMGHVEVVTALLNKDPGIGFRTDKKGQ  226

Query  1607  TALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGINI  1786
             TALHMA KGQN +I+LEL+KPD SV+ + DNKGN ALH+ATRKG   +VQ LIS++ I I
Sbjct  227   TALHMASKGQNAEILLELLKPDLSVIHVEDNKGNRALHVATRKGNTVIVQTLISVKEIVI  286

Query  1787  NTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVES  1966
             N VN+AGETA  IAEK G  ++  +L+E G   +K+   PP++AKQLK+TVSDI+HDV+S
Sbjct  287   NAVNRAGETAFAIAEKLGNEELSNILREVGGETAKEQVNPPNSAKQLKKTVSDIRHDVQS  346

Query  1967  QLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKE  2146
              ++Q+RQT  + +KI K+++KLHI GLNNAINS TVVAVLIATVAFAAIFT+PG ++E  
Sbjct  347   GIKQTRQTKMQFQKIKKRIQKLHIGGLNNAINSNTVVAVLIATVAFAAIFTIPGNFLEDM  406

Query  2147  KK----GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFII  2314
             K       TLG+A VA+  AFI+F +FD+LALFIS+AVVVVQTS++V+EQKAKK+MVF++
Sbjct  407   KDPHDPNMTLGQAFVASNPAFIIFLVFDALALFISLAVVVVQTSLIVVEQKAKKKMVFVM  466

Query  2315  NKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEE  2494
             NKLMW ACL IS AFI+LTYVVVG  ++WLA  +  +G  IML T+GSMCYC++ HR+EE
Sbjct  467   NKLMWMACLCISAAFIALTYVVVGRDDRWLAWCTMAIGTAIMLATLGSMCYCIIAHRMEE  526

Query  2495  SRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
               M+ IR++ T         V SD+EL N  YK++YA+
Sbjct  527   KNMKKIRRSSTSQS--WSISVDSDTELLNNEYKKIYAL  562



>gb|EAZ09775.1| hypothetical protein OsI_32062 [Oryza sativa Indica Group]
Length=562

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/578 (61%), Positives = 446/578 (77%), Gaps = 22/578 (4%)
 Frame = +2

Query  893   MEKQASFR-GVMEKQQSFRNMEKQKSFKGL-MEKQKSFRIAMERQLSFGGERKRGKDSPG  1066
             ME+Q+S R G +EK +SFR +EKQ+SFK L MEKQ+SF              KR KDSPG
Sbjct  1     MERQSSSRLGALEKLKSFRGIEKQRSFKFLSMEKQQSF--------------KRNKDSPG  46

Query  1067  KRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGE  1246
             KRGD  LHLAARAG++  V++I    D + + +  ++QNQ+GETALYV+AE GHT VV E
Sbjct  47    KRGDTELHLAARAGSVPHVQKIFAASDPELVGELAARQNQDGETALYVSAEKGHTEVVSE  106

Query  1247  ILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAG  1426
             ILK  DL++A + + N +DAFHIAAKQGHL+VLKELL  FP L MTT+S N+TAL TAA 
Sbjct  107   ILKFCDLQSAGLKATNSFDAFHIAAKQGHLDVLKELLQAFPALAMTTNSVNATALDTAAT  166

Query  1427  QGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQ  1606
             QGH+D+V+LLLE D++LA+IARNNGKTVLH+AARMGH+EVV +L+NKDP IGFRTDKKGQ
Sbjct  167   QGHIDIVNLLLETDASLARIARNNGKTVLHSAARMGHVEVVTALLNKDPGIGFRTDKKGQ  226

Query  1607  TALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGINI  1786
             TALHMA KGQN +I+LEL+KPD SV+ + DNKGN ALH+ATRKG   +VQ LIS++ I I
Sbjct  227   TALHMASKGQNAEILLELLKPDLSVIHVEDNKGNRALHVATRKGNTVIVQTLISVKEIVI  286

Query  1787  NTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVES  1966
             N VN+AGETA  IAEK G  ++  +L+E G   +K+   PP++AKQLK+TVSDI+HDV+S
Sbjct  287   NAVNRAGETAFAIAEKLGNEELSNILREVGGETAKEQVNPPNSAKQLKKTVSDIRHDVQS  346

Query  1967  QLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKE  2146
              ++Q+RQT  + +KI K+++KLHI GLNNAINS TVVAVLIATVAFAAIFT+PG ++E  
Sbjct  347   GIKQTRQTKMQFQKIKKRIQKLHIGGLNNAINSNTVVAVLIATVAFAAIFTIPGNFLEDM  406

Query  2147  KK----GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFII  2314
             K       TLG+A VA+  AFI+F +FD+LALFIS+AVVVVQTS++V+EQKAKK+MVF++
Sbjct  407   KDPHDPSMTLGQAFVASNPAFIIFLVFDALALFISLAVVVVQTSLIVVEQKAKKKMVFVM  466

Query  2315  NKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEE  2494
             NKLMW ACL IS AFI+LTYVVVG  ++WLA  +  +G  IML T+GSMCYC++ HR+EE
Sbjct  467   NKLMWMACLCISAAFIALTYVVVGRDDRWLAWCTMAIGTAIMLATLGSMCYCIIAHRMEE  526

Query  2495  SRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
               M+ IR++ T         V SD+EL N  YK++YA+
Sbjct  527   KNMKKIRRSSTSQS--WSISVDSDTELLNNEYKKIYAL  562



>dbj|BAK00823.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=551

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/551 (64%), Positives = 437/551 (79%), Gaps = 8/551 (1%)
 Frame = +2

Query  980   MEKQKSFRI-AMERQLSFGG--ERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDS  1150
             ME+Q SFR+ A+E+  SF G    +R KDSPGKRGD PLHLAARAGN+S V+ IL     
Sbjct  1     MERQTSFRLGALEKLKSFRGMDNFRRSKDSPGKRGDTPLHLAARAGNVSNVQRILAEPGR  60

Query  1151  KAIKDTLSKQNQEGETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQG  1330
             +   +  ++ NQ+GETALYVAA+ GHT VV EILK  D++TA I ++N +DAFHIAAKQG
Sbjct  61    ELAGELAARPNQDGETALYVAADKGHTEVVREILKVSDMQTAGIKASNSFDAFHIAAKQG  120

Query  1331  HLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTV  1510
             HL+VLKELL  FP L MTT+S N+TAL TAA QGH+D+V+LLLE D++LAKIARNNGKTV
Sbjct  121   HLDVLKELLQAFPALAMTTNSVNATALETAAIQGHIDIVNLLLETDASLAKIARNNGKTV  180

Query  1511  LHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLAL  1690
             LH+AARMGH+EVV+SL+NKDP IG RTDKKGQTALHMA KG N +IV+EL+KPD SV  L
Sbjct  181   LHSAARMGHVEVVRSLLNKDPGIGLRTDKKGQTALHMASKGTNAEIVVELLKPDVSVSHL  240

Query  1691  GDNKGNTALHIATRKGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKE  1870
              DNKGN  LH+ATRKG   +VQ L+S+EGI++N VN++GETAL IAEK    ++V +L++
Sbjct  241   EDNKGNRPLHVATRKGNIIIVQTLLSVEGIDVNAVNRSGETALAIAEKMNNQELVNILRD  300

Query  1871  AGA-THSKDHGKPPSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGL  2047
             AG    +K+   P + AKQLKQTVSDI+HDV+SQ++Q+RQT  +V+KI  +++KLHI GL
Sbjct  301   AGGVVTAKEPVHPANPAKQLKQTVSDIRHDVQSQIKQTRQTKMQVQKIKSRLEKLHIGGL  360

Query  2048  NNAINSltvvavliatvafaaiftvPGQYVE---KEKKGFTLGEANVANKAAFIVFFLFD  2218
             NNAINS TVVAVLIATVAFAAIFTVPG +VE   +   G +LG+A VA+  AFI+F +FD
Sbjct  361   NNAINSNTVVAVLIATVAFAAIFTVPGNFVEAMSQAPPGMSLGQAYVASDPAFIMFLVFD  420

Query  2219  SLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQ  2398
             SLALFIS+AVVVVQTS++V+EQKAK++MVF++NKLMW ACLFIS AFI+LTYVVVG  + 
Sbjct  421   SLALFISLAVVVVQTSLIVVEQKAKRRMVFVMNKLMWLACLFISAAFIALTYVVVGRDDW  480

Query  2399  WLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRMRNIRKAE-TLSRSFSMSMVPSDSEL  2575
             WLA  +  +G VIMLTT+GSMCYC+V HR+EE  MR IRKA  + SRS+SM +   D E+
Sbjct  481   WLAWCTMAIGAVIMLTTLGSMCYCIVAHRMEEKSMRKIRKASASQSRSWSMPVDSDDPEM  540

Query  2576  YNESYKRMYAV  2608
              N  YK+MYA+
Sbjct  541   INTEYKKMYAL  551



>ref|NP_001151505.1| protein binding protein [Zea mays]
 gb|ACG43111.1| protein binding protein [Zea mays]
Length=562

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/579 (61%), Positives = 443/579 (77%), Gaps = 24/579 (4%)
 Frame = +2

Query  893   MEKQASFR-GVMEKQQSFRNMEKQKSFKGLMEKQKSFRIAMERQLSFGGERKRGKDSPGK  1069
             ME+Q+S R G +EK +SFR MEKQKSF+G+M        ++ER         R +DSPGK
Sbjct  1     MERQSSIRLGALEKLRSFRGMEKQKSFRGIM--------SLER---------RSRDSPGK  43

Query  1070  RGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGEI  1249
             RGD PLHLAARAG+++  + IL   D     +  ++QNQ+GET LYVAAE GH  VV EI
Sbjct  44    RGDTPLHLAARAGSVAHAQRILAELDRALAAEMAARQNQDGETPLYVAAEKGHAEVVREI  103

Query  1250  LKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQ  1429
             LK   ++TA I ++N +DAFHIAAKQGHLEVLKE+L   P L MTT+S N+TAL TAA Q
Sbjct  104   LKVCGVQTAGIKASNSFDAFHIAAKQGHLEVLKEMLQALPALAMTTNSVNATALDTAAIQ  163

Query  1430  GHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQT  1609
             GHVD+V+LLLE D++LA+I RNNGKTVLH+AARMGH+EVV+SL+NKDP IG RTDKKGQT
Sbjct  164   GHVDIVNLLLETDASLARITRNNGKTVLHSAARMGHVEVVRSLLNKDPRIGLRTDKKGQT  223

Query  1610  ALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGININ  1789
             ALHMA K QN +IV+EL+KPD SV+ + DNKGN  LH+ATRKG   +VQ L+S+EGI++N
Sbjct  224   ALHMASKAQNAEIVVELLKPDVSVIHIEDNKGNRPLHVATRKGNIIIVQTLLSVEGIDVN  283

Query  1790  TVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHG-KPPSAAKQLKQTVSDIKHDVES  1966
              VN++GETA  IAEK  + ++V +LKEAG   +K     PP++AKQLK+TVSDI+HDV+S
Sbjct  284   AVNRSGETAFAIAEKMDSVELVNILKEAGGEAAKQQQVHPPNSAKQLKETVSDIRHDVQS  343

Query  1967  QLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVE--  2140
             Q +Q+RQT  +V +I K+++KLHI GLNNAINS TVVAVLIATVAFAAIFTVPG +VE  
Sbjct  344   QFKQTRQTKMQVNQIKKRLEKLHIGGLNNAINSNTVVAVLIATVAFAAIFTVPGNFVEEL  403

Query  2141  -KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIIN  2317
              +   G +LG+A VA+  AFIVF +FD+LALFIS+AVVVVQTS++V+E++AKK+MVF++N
Sbjct  404   SQAPPGMSLGQAYVASNPAFIVFLVFDALALFISLAVVVVQTSLIVVERRAKKRMVFVMN  463

Query  2318  KLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEES  2497
             KLMW ACLFIS+AFI+LTYVVVG  + WLA  +  +G  IMLTT+GSMCYC+V HRLEE 
Sbjct  464   KLMWLACLFISVAFIALTYVVVGRDDWWLAWCTMGIGAAIMLTTLGSMCYCIVAHRLEEK  523

Query  2498  RMRNIRKAE-TLSRSFSMSMVPSDSELYNESYK-RMYAV  2608
               R IR+A  + SR      V SD E+ N  YK +MYA+
Sbjct  524   NTRKIRRASASQSRGSWSRSVDSDEEILNSEYKTKMYAL  562



>ref|XP_006659650.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Oryza 
brachyantha]
Length=555

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/577 (61%), Positives = 446/577 (77%), Gaps = 27/577 (5%)
 Frame = +2

Query  893   MEKQASFR-GVMEKQQSFRNMEKQKSFKGLMEKQKSFRIAMERQLSFGGERKRGKDSPGK  1069
             ME+Q SFR G +EK +SFR MEKQKSFK  M    +FR              R +DSPGK
Sbjct  1     MERQTSFRLGALEKLKSFRGMEKQKSFK--MMSMDNFR--------------RHRDSPGK  44

Query  1070  RGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGEI  1249
             RGD PLHLAAR+GN +  + I+  FD +   +  ++QN +GET LYVAAE GHT VV EI
Sbjct  45    RGDTPLHLAARSGNAAGAQRIIAEFDPEVAAERAAQQNNDGETPLYVAAEKGHTEVVREI  104

Query  1250  LKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQ  1429
             LK  D++TA I +NN +DAFHIAAKQGHLEVLKELL  FP L MTT+S N+TAL TAA  
Sbjct  105   LKVSDVQTAGIKANNSFDAFHIAAKQGHLEVLKELLQTFPALAMTTNSVNATALDTAAHL  164

Query  1430  GHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQT  1609
             GH D+V+LLLE D+NLA+IARNNGKTVLH+AAR+GH+E+VKSL++KDP IG RTDKKGQT
Sbjct  165   GHTDIVNLLLESDANLARIARNNGKTVLHSAARLGHVEIVKSLLDKDPGIGLRTDKKGQT  224

Query  1610  ALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGININ  1789
             ALHMA KGQN +IV+EL+KPD SV+ L DNKGN  LH+ATRK    +VQ L+S+EGI++N
Sbjct  225   ALHMASKGQNAEIVIELLKPDISVIHLEDNKGNRPLHVATRKANIVIVQTLLSVEGIDVN  284

Query  1790  TVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQ  1969
              VN++G TA  IAE+    ++V +L+EAG   +K+   PP+ AKQLKQTVSDI+HDV+SQ
Sbjct  285   AVNRSGHTAFAIAEQLNNEELVNILREAGGVTAKEQVHPPNPAKQLKQTVSDIRHDVQSQ  344

Query  1970  LQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVE---  2140
             ++Q+RQT  +V+KI K+++KLHI GLNNAINS TVVAVLIATVAFAAIFTVPG ++E   
Sbjct  345   IKQTRQTKMQVQKIKKRLEKLHIGGLNNAINSNTVVAVLIATVAFAAIFTVPGNFLEDMS  404

Query  2141  KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINK  2320
             +   G +LG+A VA+  AF+VF +FD+LALFIS+AVVVVQTS++V+EQKAK++MVF++NK
Sbjct  405   QAPPGMSLGQAYVASNPAFLVFLVFDALALFISLAVVVVQTSLIVVEQKAKRRMVFVMNK  464

Query  2321  LMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESR  2500
             LMW ACLFIS+AFI+LTYVVVG  + WLA  +  +G VIMLTT+GSMCYC++ HR++E  
Sbjct  465   LMWLACLFISVAFIALTYVVVGHDDWWLAWCTMAIGAVIMLTTLGSMCYCIIAHRMDE--  522

Query  2501  MRNIRKAET-LSRSFSMSMVPSDSELYNESYKRMYAV  2608
              R I+KA +  SRS+S + V S+ E+ N   K+MYA+
Sbjct  523   -RKIKKASSNQSRSWSQT-VDSEPEVLNS--KKMYAL  555



>gb|KDO51603.1| hypothetical protein CISIN_1g006802mg [Citrus sinensis]
Length=437

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/437 (77%), Positives = 387/437 (89%), Gaps = 2/437 (0%)
 Frame = +2

Query  1301  DAFHIAAKQGH-LEVLKELLNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNL  1477
             D  H   +Q   + VLKELL  FPNLVMTTD S STALHTAA QGH+DVV+ LLEIDSNL
Sbjct  2     DMIHFMWQQSRVILVLKELLGEFPNLVMTTDLSCSTALHTAAAQGHIDVVNFLLEIDSNL  61

Query  1478  AKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLE  1657
             AKIARNNGKTVLH+AARMGHLEVVK+LV+KDPS GFRTDKKGQTALHMAVKGQN DIVLE
Sbjct  62    AKIARNNGKTVLHSAARMGHLEVVKALVSKDPSTGFRTDKKGQTALHMAVKGQNEDIVLE  121

Query  1658  LIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGININTVNKAGETALDIAEKF  1837
             LI+PDPSVL L DNKGNTALHIA +KGR Q+V+ L+SIEGI++N++NKAGE+ LD+AEK 
Sbjct  122   LIRPDPSVLKLEDNKGNTALHIAIKKGRTQIVRCLLSIEGIDVNSLNKAGESPLDVAEKL  181

Query  1838  GTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiak  2017
             G  ++ ++LKEAGA HSKDHGKPPSA KQLKQTVSDIKHDV+SQLQQSRQTGFKV KIAK
Sbjct  182   GNTELFSLLKEAGAAHSKDHGKPPSATKQLKQTVSDIKHDVQSQLQQSRQTGFKVHKIAK  241

Query  2018  kvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKEKKGFTLGEANVANKAAF  2197
             K+KKLHISGLNNAINS TVVAVLIATVAFAAIFTVPGQYVE++ +GF+LG+A++A  AAF
Sbjct  242   KLKKLHISGLNNAINSSTVVAVLIATVAFAAIFTVPGQYVEEKTEGFSLGQAHIAKNAAF  301

Query  2198  IVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYV  2377
             I+FF+FDSLALFIS+AVVVVQTSVVVIE+KAK+Q+VF+INKLMW ACLFISIAFISLTYV
Sbjct  302   IIFFVFDSLALFISLAVVVVQTSVVVIEEKAKRQLVFVINKLMWLACLFISIAFISLTYV  361

Query  2378  VVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMV  2557
             VVG   +WLA+ +TV+GG IMLTTIGSMCYCV+ HR+E  ++RNIRKAE+ SRSFSMS V
Sbjct  362   VVGEHSRWLAVSATVIGGTIMLTTIGSMCYCVILHRMEAKKLRNIRKAESRSRSFSMS-V  420

Query  2558  PSDSELYNESYKRMYAV  2608
              SD E+ N  YKRMYA+
Sbjct  421   ASDQEILNSEYKRMYAL  437


 Score = 58.2 bits (139),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 77/180 (43%), Gaps = 40/180 (22%)
 Frame = +2

Query  1121  VREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGEILKQLDLETASIASNNGY  1300
             ++E+L  F +  +   LS       TAL+ AA  GH  VV  +L ++D   A IA NNG 
Sbjct  17    LKELLGEFPNLVMTTDLS-----CSTALHTAAAQGHIDVVNFLL-EIDSNLAKIARNNGK  70

Query  1301  DAFHIAAKQGHLEVLK----------------------------------ELLNVFPNLV  1378
                H AA+ GHLEV+K                                  EL+   P+++
Sbjct  71    TVLHSAARMGHLEVVKALVSKDPSTGFRTDKKGQTALHMAVKGQNEDIVLELIRPDPSVL  130

Query  1379  MTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSL  1558
                D+  +TALH A  +G   +V  LL I+          G++ L  A ++G+ E+   L
Sbjct  131   KLEDNKGNTALHIAIKKGRTQIVRCLLSIEGIDVNSLNKAGESPLDVAEKLGNTELFSLL  190



>ref|XP_003574859.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Brachypodium 
distachyon]
 ref|XP_010235359.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Brachypodium 
distachyon]
 ref|XP_010235360.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Brachypodium 
distachyon]
 ref|XP_010235361.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Brachypodium 
distachyon]
 ref|XP_010235362.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Brachypodium 
distachyon]
Length=549

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/559 (63%), Positives = 436/559 (78%), Gaps = 16/559 (3%)
 Frame = +2

Query  950   MEKQKSFK-GLMEKQKSFRIAMERQLSFGGER-KRGKDSPGKRGDNPLHLAARAGNLSKV  1123
             ME+Q SF  G +EK KSFR         G E  +R KDSPGKRGD  LHLAAR+G+++ V
Sbjct  1     MERQTSFHLGALEKLKSFR---------GIENFRRSKDSPGKRGDTALHLAARSGSVAHV  51

Query  1124  REILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGEILKQLDLETASIASNNGYD  1303
             ++IL  FD + + +  ++ NQ+GET LYVAAE GHT VV EILK  D++TA I ++N +D
Sbjct  52    QKILAEFDRELVGELAARPNQDGETPLYVAAEKGHTEVVREILKVSDVQTAGIKASNSFD  111

Query  1304  AFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAK  1483
             AFH+AAKQGHLEVLKELL  FP L MTT+S N+TAL TAA QGH+D+V+LLLE D++LAK
Sbjct  112   AFHVAAKQGHLEVLKELLQAFPALAMTTNSVNATALETAAIQGHIDIVNLLLETDASLAK  171

Query  1484  IARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELI  1663
             IARNNGKTVLH+AARMGH+EVV+SL+NKDP IG R DKKGQTALHMA KG N +IV+EL+
Sbjct  172   IARNNGKTVLHSAARMGHVEVVRSLLNKDPGIGLRKDKKGQTALHMASKGTNAEIVVELL  231

Query  1664  KPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGININTVNKAGETALDIAEKFGT  1843
             KPD SV  L DNKGN  LH+A+RKG   +VQ L+SIEGI +N VN++GETAL IAEK   
Sbjct  232   KPDVSVSHLEDNKGNRPLHVASRKGNIVIVQILLSIEGIEVNAVNRSGETALAIAEKINN  291

Query  1844  PDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkv  2023
              ++V +L++AG   +K+   P + AKQLK+TVSDI+HDV+SQ++Q+RQT  +V+KI  ++
Sbjct  292   EELVNILRDAGGETAKEQVHPANPAKQLKKTVSDIRHDVQSQIKQTRQTKMQVQKIKNRL  351

Query  2024  kkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKEKKG---FTLGEANVANKAA  2194
             +KLHI GLNNAINS TVVAVLIATVAFAAIFTVPG +VE   +     +LG+A VA+  A
Sbjct  352   EKLHIGGLNNAINSNTVVAVLIATVAFAAIFTVPGNFVEDMSQAGPDMSLGQAYVASNPA  411

Query  2195  FIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTY  2374
             FI F +FDSLALFIS+AVVVVQTS++V+EQKAK++MVF++NKLMW ACLFIS AFI+LTY
Sbjct  412   FIAFLVFDSLALFISLAVVVVQTSLIVVEQKAKRRMVFVMNKLMWLACLFISAAFIALTY  471

Query  2375  VVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSM  2554
             VVVG  + WLA  +  +G VIMLTT+GSMCYC+V HR+EE  MR IRKA   S+S S SM
Sbjct  472   VVVGNSDWWLAWCTMAIGAVIMLTTLGSMCYCIVAHRMEEKSMRKIRKASG-SQSHSWSM  530

Query  2555  -VPSDSELYNESYKRMYAV  2608
              V SD E+ N  YK+MYA+
Sbjct  531   PVDSDPEMMNTEYKKMYAL  549



>gb|EMT05138.1| hypothetical protein F775_28341 [Aegilops tauschii]
Length=581

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/548 (64%), Positives = 436/548 (80%), Gaps = 9/548 (2%)
 Frame = +2

Query  980   MEKQKSFRI-AMERQLSFGG--ERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDS  1150
             ME+Q SFR+ A+E+  SF G    +R KDSPGKRGD PLHLAARAGN+S V+ IL     
Sbjct  1     MERQTSFRLGALEKLKSFRGMDNFRRSKDSPGKRGDTPLHLAARAGNVSNVQRILAESGQ  60

Query  1151  KAIKDTLSKQNQEGETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQG  1330
             +   +  ++ NQ+GETALYVAA+ GHT VV EILK  D++TA I ++N +DAFHIAAKQG
Sbjct  61    EMAGELAARPNQDGETALYVAADKGHTEVVREILKVSDMQTAGIKASNSFDAFHIAAKQG  120

Query  1331  HLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTV  1510
             HL+VLKELL  FP L MTT+S N+TAL TAA QGH+D+V+LLLE D++LAKIARNNGKTV
Sbjct  121   HLDVLKELLQAFPALAMTTNSVNATALETAAIQGHIDIVNLLLETDASLAKIARNNGKTV  180

Query  1511  LHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLAL  1690
             LH+AARMGH+EVV+SL+NKDP IG RTDKKGQTALHMA KG N +IV+EL+KPD SV  L
Sbjct  181   LHSAARMGHVEVVRSLLNKDPGIGLRTDKKGQTALHMASKGTNAEIVVELLKPDFSVSHL  240

Query  1691  GDNKGNTALHIATRKGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKE  1870
              DNKGN  LH+ATRKG   +VQ L+S+EGI++N VN++GETAL IAEK    ++V +L++
Sbjct  241   EDNKGNRPLHVATRKGNIVIVQTLLSVEGIDVNAVNRSGETALAIAEKMNNQELVNILRD  300

Query  1871  AGA-THSKDHGKPPSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGL  2047
             AG    +K+   P + AKQLKQTVSDI+HDV+SQ++Q+RQT  +V+KI  +++KLHI GL
Sbjct  301   AGGVVTAKEPVHPANPAKQLKQTVSDIRHDVQSQIKQTRQTKMQVQKIKSRLEKLHIGGL  360

Query  2048  NNAINSltvvavliatvafaaiftvPGQYVE---KEKKGFTLGEANVANKAAFIVFFLFD  2218
             NNAINS TVVAVLIATVAFAAIFTVPG +VE   +   G +LG+A VA++ AFI+F +FD
Sbjct  361   NNAINSNTVVAVLIATVAFAAIFTVPGNFVEDMSQAPPGMSLGQAYVASEPAFIMFLVFD  420

Query  2219  SLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQ  2398
             SLALFIS+AVVVVQTS++V+EQKAK++MVF++NKLMW ACLFIS AFI+LTYVVVG  + 
Sbjct  421   SLALFISLAVVVVQTSLIVVEQKAKRRMVFVMNKLMWLACLFISAAFIALTYVVVGRGDW  480

Query  2399  WLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRMRNIRKAE-TLSRSFSMSMVPSDSEL  2575
             WLA  +  +G VIMLTT+GSMCYC+V HR+EE  MR IRKA  + SRS+SM  V SD EL
Sbjct  481   WLAWCTMAIGAVIMLTTLGSMCYCIVAHRMEEKSMRKIRKASASQSRSWSMP-VDSDPEL  539

Query  2576  YNESYKRM  2599
              N  YK++
Sbjct  540   INTEYKKI  547



>dbj|BAD08980.1| ankyrin-like protein [Oryza sativa Japonica Group]
Length=528

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/526 (62%), Positives = 420/526 (80%), Gaps = 8/526 (2%)
 Frame = +2

Query  1043  KRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAEN  1222
             +R +DSPGKRGD PLHLAAR+GN +  + I+  FD +   +  ++ N +GET LYVAAE 
Sbjct  7     RRHRDSPGKRGDTPLHLAARSGNAAGAQRIIAEFDPEVAAERAAQANHDGETPLYVAAER  66

Query  1223  GHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNS  1402
             GHT VV EILK  D++TA + +NN +DAFHIAAKQGHLEVLKELL  FP L MTT+S N+
Sbjct  67    GHTDVVREILKVSDVQTAGVKANNSFDAFHIAAKQGHLEVLKELLQAFPALAMTTNSVNA  126

Query  1403  TALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIG  1582
             TAL TAA  GH ++V+LLLE D+NLA+IARNNGKTVLH+AAR+GH+E+V+SL+++DP IG
Sbjct  127   TALDTAAILGHTEIVNLLLESDANLARIARNNGKTVLHSAARLGHVEIVRSLLSRDPGIG  186

Query  1583  FRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRL  1762
              RTDKKGQTALHMA KGQN +IV+EL+KPD SV+ L DNKGN  LH+ATRK    +VQ L
Sbjct  187   LRTDKKGQTALHMASKGQNAEIVIELLKPDISVIHLEDNKGNRPLHVATRKANIVIVQTL  246

Query  1763  ISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVS  1942
             +S+EGI +N VN++G TAL IAE+    ++V +L+EAG   +K+   PP+ AKQLKQTVS
Sbjct  247   LSVEGIEVNAVNRSGHTALAIAEQLNNEELVNILREAGGVTAKEQVHPPNPAKQLKQTVS  306

Query  1943  DIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftv  2122
             DI+HDV+SQ++Q++QT  +V+KI K+++KLHI GLNNAINS TVVAVLIATVAFAAIFTV
Sbjct  307   DIRHDVQSQIKQTKQTKMQVQKIKKRLEKLHIGGLNNAINSNTVVAVLIATVAFAAIFTV  366

Query  2123  PGQYVE---KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAK  2293
             PG +VE   +   G +LG+A VA+  AF+VF +FD+LALFIS+AVVVVQTS++V+EQKAK
Sbjct  367   PGNFVEDITQAPPGMSLGQAYVASNPAFLVFLVFDALALFISLAVVVVQTSLIVVEQKAK  426

Query  2294  KQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCV  2473
             ++MVF++NKLMW ACLFIS+AFI+LTYVVVG  + WLA  +  +G VIMLTT+GSMCYC+
Sbjct  427   RRMVFVMNKLMWLACLFISVAFIALTYVVVGRDDWWLAWCTMAIGAVIMLTTLGSMCYCI  486

Query  2474  VRHRLEESRMRNIRKAET-LSRSFSMSMVPSDSELYNESYKRMYAV  2608
             + HR++E   R IRKA T  SRS+S + V SD +L N  YK+MYA+
Sbjct  487   IAHRMDE---RKIRKASTSQSRSWSQT-VDSDPDLLNSEYKKMYAL  528



>emb|CDX86566.1| BnaC08g01370D [Brassica napus]
Length=577

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/580 (59%), Positives = 435/580 (75%), Gaps = 50/580 (9%)
 Frame = +2

Query  893   MEKQASFRGVMEKQQSFRNMEKQKSFKGLMEKQKSFRIAMERQLSF-GGERKRGK-DSPG  1066
             +EKQ SF+   E     R ME+Q+S +G +EKQKSFR+ +ERQLSF  GERK  K +SPG
Sbjct  40    LEKQVSFQHGTEG----RAMERQRSLRGFVEKQKSFRVVIERQLSFMNGERKMKKNESPG  95

Query  1067  KRGDNPLHLAARAGNLSKVREILQRFD-SKAIKDTLSKQNQEGETALYVAAENGHTLVVG  1243
             KRGD+PLH+AAR GNL KV E ++  + ++ +++ LSKQN EGET LY AA+NGH+LVV 
Sbjct  96    KRGDSPLHIAARTGNLGKVMESIRSCNGAEELRELLSKQNLEGETPLYTAADNGHSLVVE  155

Query  1244  EILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAA  1423
             E+LK ++LE ASIA+ NG+D FH+AAK                                 
Sbjct  156   EMLKHMNLEIASIAARNGFDPFHVAAK---------------------------------  182

Query  1424  GQGHVDVVDLLLEI---DSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTD  1594
              QGH+    ++LE+   D  +  +  N G T LH AA+ G+      L   D SIGFRTD
Sbjct  183   -QGHLVPFGIVLELVRPDPKVLSVEDNKGNTPLHIAAKKGN----TPLHRNDASIGFRTD  237

Query  1595  KKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIE  1774
             KKGQTALHMAVKG++  IVLEL++PDP VL++ DNKGNT LHIAT+KGR ++V+ L+S +
Sbjct  238   KKGQTALHMAVKGKHEGIVLELVRPDPKVLSVEDNKGNTPLHIATKKGRTKIVRCLVSFD  297

Query  1775  GININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKH  1954
             GIN+N +NKAG+TALDIAEK G  ++V +LKEAGA  +KD GKP + AK LKQTVSDI+H
Sbjct  298   GINLNALNKAGDTALDIAEKIGNAELVLVLKEAGAATAKDLGKPLNPAKHLKQTVSDIRH  357

Query  1955  DVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQY  2134
             +V+SQLQQSRQTG +V++IAK++KKLHI+GLNNAINS TVVAVLIATVAFAAIFT+PGQY
Sbjct  358   EVQSQLQQSRQTGARVQRIAKRLKKLHINGLNNAINSATVVAVLIATVAFAAIFTIPGQY  417

Query  2135  VEKEKKG-FTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFI  2311
              E   KG   LGEA +AN+A F+VFF+FDSLALFIS+AVVVVQTSVVVIEQKAKK++VF+
Sbjct  418   EEDRTKGPLVLGEARIANEAPFLVFFIFDSLALFISLAVVVVQTSVVVIEQKAKKKLVFV  477

Query  2312  INKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLE  2491
             INKLMW ACLFISIAF+SL+++VVG  + WLAI +TV+GG IMLTTIG MCYCVV HR+E
Sbjct  478   INKLMWLACLFISIAFVSLSFIVVGKEDMWLAICATVIGGTIMLTTIGVMCYCVVMHRIE  537

Query  2492  ESRMRNIRKAETLSRSFSMSMVPSDSELYN-ESYKRMYAV  2608
             E +++ +RK  + SRSFS+S +PS+S++ N E  KRMYA+
Sbjct  538   ECKLKQMRKERSKSRSFSLSHMPSESDILNGELNKRMYAL  577



>ref|XP_006854391.1| hypothetical protein AMTR_s00039p00181370 [Amborella trichopoda]
 gb|ERN15858.1| hypothetical protein AMTR_s00039p00181370 [Amborella trichopoda]
Length=533

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/530 (61%), Positives = 424/530 (80%), Gaps = 6/530 (1%)
 Frame = +2

Query  1037  ERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQ-----RFDSKAIKDTLSKQNQEGETA  1201
             ++K  K+  GKR D+PLH+AARAGNL+  +EIL+           +K  L  QNQ GET 
Sbjct  4     KKKMNKELSGKRDDSPLHMAARAGNLALAQEILRDPSDGESGEVVLKGLLLNQNQAGETP  63

Query  1202  LYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVM  1381
             +YVAAENGH+ VV EILK  D+ +A+I + NGYDAFHIAAKQ H+EVLK LLN  P L M
Sbjct  64    IYVAAENGHSEVVKEILKFSDVGSAAIKARNGYDAFHIAAKQDHIEVLKVLLNSLPELAM  123

Query  1382  TTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLV  1561
             TTD SNSTALHTA+ +GH DVV+LLL+ D++LAKIA++NGKT +H+A+RMGH +VV++L+
Sbjct  124   TTDPSNSTALHTASTRGHTDVVNLLLQTDASLAKIAKSNGKTAVHSASRMGHAQVVRALL  183

Query  1562  NKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGR  1741
              K+PSIG RTD KGQTALHMAVKGQ+V++V EL+K + S+++L DNK NTALHIATRK R
Sbjct  184   TKEPSIGLRTDTKGQTALHMAVKGQSVEVVEELLKRNASMISLADNKDNTALHIATRKCR  243

Query  1742  PQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAK  1921
              Q++Q L+++EG+++N +NKAGETALDIAEK    +++++L+ AGA  +++H  PP+  +
Sbjct  244   TQILQTLLTVEGVDVNALNKAGETALDIAEKSSQAEIISLLRGAGALTAREHSNPPNPTR  303

Query  1922  QLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatva  2101
             QLKQTVSDIKH+V SQLQQ+RQTG +V+KIAK+VKKLHI GLNNAINS TVVAVLIATVA
Sbjct  304   QLKQTVSDIKHEVHSQLQQTRQTGKRVQKIAKRVKKLHIGGLNNAINSATVVAVLIATVA  363

Query  2102  faaiftvPGQYVE-KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvI  2278
             FAAIFTVPGQY E K++ G++LG+A++A  A+F++FF+ DS+ALFIS+AVVVVQTS+VVI
Sbjct  364   FAAIFTVPGQYAESKDEVGYSLGQAHIAQSASFLIFFISDSIALFISLAVVVVQTSIVVI  423

Query  2279  EQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGS  2458
             EQKAKKQ++F+INKLMW AC+ IS+AF++L+Y+VVG     LA+  TV+G +IM+ T+G 
Sbjct  424   EQKAKKQLMFVINKLMWIACVQISVAFVALSYIVVGHHAWGLAVAVTVIGSLIMVGTLGI  483

Query  2459  MCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             M YCV++HR+E S  R IRK+           V SDSEL+NE YK++YA+
Sbjct  484   MSYCVIQHRIEASSSRRIRKSSESRSRSWSLSVVSDSELFNEDYKKIYAL  533



>gb|KDO51602.1| hypothetical protein CISIN_1g006802mg [Citrus sinensis]
Length=561

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/577 (60%), Positives = 415/577 (72%), Gaps = 76/577 (13%)
 Frame = +2

Query  893   MEKQASFRGV-MEKQQSFRN-MEKQKSFKGLMEKQKSFRIAMERQLSF--GGERKRGKDS  1060
             MEKQ SF GV ++KQ S R  MEKQKSF+G +EKQKSFR+ MERQLSF  GGERK     
Sbjct  56    MEKQQSFHGVTIDKQPSTRGVMEKQKSFRGFIEKQKSFRVVMERQLSFIGGGERK-----  110

Query  1061  PGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVV  1240
               K  D+P                                 + G+  L++AA  G+   V
Sbjct  111   --KNKDSP--------------------------------GKRGDLQLHLAARAGNLSRV  136

Query  1241  GEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTA  1420
              EIL+  D   A                               +L+   +    T L+ A
Sbjct  137   MEILQSCDANEAK------------------------------DLLSKKNQEGETPLYVA  166

Query  1421  AGQGHVDVVDLLLE-IDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDK  1597
             A  GH  +V+ +L+ ++   A I   NG    H AA+ GHL VVK+LV+KDPS GFRTDK
Sbjct  167   AESGHALIVEEMLQHMNLETASIPARNGYDSFHVAAKQGHL-VVKALVSKDPSTGFRTDK  225

Query  1598  KGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEG  1777
             KGQTALHMAVKGQN DIVLELI+PDPSVL L DNKGNTALHIA +KGR Q+V+ L+SIEG
Sbjct  226   KGQTALHMAVKGQNEDIVLELIRPDPSVLKLEDNKGNTALHIAIKKGRTQIVRCLLSIEG  285

Query  1778  ININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHD  1957
             I++N++NKAGE+ LD+AEK G  ++ ++LKEAGA HSKDHGKPPSA KQLKQTVSDIKHD
Sbjct  286   IDVNSLNKAGESPLDVAEKLGNTELFSLLKEAGAAHSKDHGKPPSATKQLKQTVSDIKHD  345

Query  1958  VESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYV  2137
             V+SQLQQSRQTGFKV KIAKK+KKLHISGLNNAINS TVVAVLIATVAFAAIFTVPGQYV
Sbjct  346   VQSQLQQSRQTGFKVHKIAKKLKKLHISGLNNAINSSTVVAVLIATVAFAAIFTVPGQYV  405

Query  2138  EKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIIN  2317
             E++ +GF+LG+A++A  AAFI+FF+FDSLALFIS+AVVVVQTSVVVIE+KAK+Q+VF+IN
Sbjct  406   EEKTEGFSLGQAHIAKNAAFIIFFVFDSLALFISLAVVVVQTSVVVIEEKAKRQLVFVIN  465

Query  2318  KLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEES  2497
             KLMW ACLFISIAFISLTYVVVG   +WLA+ +TV+GG IMLTTIGSMCYCV+ HR+E  
Sbjct  466   KLMWLACLFISIAFISLTYVVVGEHSRWLAVSATVIGGTIMLTTIGSMCYCVILHRMEAK  525

Query  2498  RMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             ++RNIRKAE+ SRSFSMS V SD E+ N  YKRMYA+
Sbjct  526   KLRNIRKAESRSRSFSMS-VASDQEILNSEYKRMYAL  561


 Score =   248 bits (633),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 140/278 (50%), Positives = 180/278 (65%), Gaps = 26/278 (9%)
 Frame = +2

Query  890   IMEKQASFRG-----------VMEKQQSFRN------------MEKQKSFKGLMEKQKSF  1000
             +MEKQ SF G            MEKQQSF              MEKQKSF+G +EKQKSF
Sbjct  34    VMEKQQSFNGESTDKPPSALGPMEKQQSFHGVTIDKQPSTRGVMEKQKSFRGFIEKQKSF  93

Query  1001  RIAMERQLSF--GGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLS  1174
             R+ MERQLSF  GGERK+ KDSPGKRGD  LHLAARAGNLS+V EILQ  D+   KD LS
Sbjct  94    RVVMERQLSFIGGGERKKNKDSPGKRGDLQLHLAARAGNLSRVMEILQSCDANEAKDLLS  153

Query  1175  KQNQEGETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKEL  1354
             K+NQEGET LYVAAE+GH L+V E+L+ ++LETASI + NGYD+FH+AAKQGHL V+K L
Sbjct  154   KKNQEGETPLYVAAESGHALIVEEMLQHMNLETASIPARNGYDSFHVAAKQGHL-VVKAL  212

Query  1355  LNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMG  1534
             ++  P+    TD    TALH A    + D+V  L+  D ++ K+  N G T LH A + G
Sbjct  213   VSKDPSTGFRTDKKGQTALHMAVKGQNEDIVLELIRPDPSVLKLEDNKGNTALHIAIKKG  272

Query  1535  HLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDI  1648
               ++V+ L++ +       +K G++ L +A K  N ++
Sbjct  273   RTQIVRCLLSIEGIDVNSLNKAGESPLDVAEKLGNTEL  310



>tpg|DAA39352.1| TPA: hypothetical protein ZEAMMB73_862375 [Zea mays]
Length=663

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/580 (57%), Positives = 412/580 (71%), Gaps = 59/580 (10%)
 Frame = +2

Query  893   MEKQASFR-GVMEKQQSFRNMEKQKSFKGLMEKQKSFRIAMERQLSFGGERKRGKDSPGK  1069
             ME+Q+S R G +EK +SFR MEKQKSF+G+M        ++ER         R +DSPGK
Sbjct  1     MERQSSIRLGALEKLRSFRGMEKQKSFRGIM--------SLER---------RSRDSPGK  43

Query  1070  RGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGEI  1249
             RGD PLHLAARAG+++ V+ IL   D     +  ++QNQ+GET LYVAAE GH  VV EI
Sbjct  44    RGDTPLHLAARAGSVAHVQRILAELDRALAAEMAARQNQDGETPLYVAAEKGHAEVVREI  103

Query  1250  LKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQ  1429
             LK   ++TA I ++N +DAFHIAAKQGHLEVLKE+L   P L MTT+S N+TAL TAA Q
Sbjct  104   LKVCGVQTAGIKASNSFDAFHIAAKQGHLEVLKEMLQALPALAMTTNSVNATALDTAAIQ  163

Query  1430  GHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQT  1609
             GHVD+V+LLLE D++LA+I RNNGKTVLH+AARMGH+EVV+SL+NKDP IG RTDKKGQT
Sbjct  164   GHVDIVNLLLETDASLARITRNNGKTVLHSAARMGHVEVVRSLLNKDPRIGLRTDKKGQT  223

Query  1610  ALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGININ  1789
             ALHMA K QN +IV+EL+KPD SV+ + DNKGN  LH+ATRKG   +VQ L+S+EGI++N
Sbjct  224   ALHMASKAQNAEIVVELLKPDVSVIHIEDNKGNRPLHVATRKGNIIIVQTLLSVEGIDVN  283

Query  1790  TVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQ  1969
              VN++GETA  IAEK  + ++V +LKEAG            AAKQ       IK  +E  
Sbjct  284   AVNRSGETAFAIAEKMDSVELVNILKEAGG----------EAAKQ------QIKKRLEK-  326

Query  1970  LQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVE---  2140
                                 LHI GLNNAINS TVVAVLIATVAFAAIFTVPG +VE   
Sbjct  327   --------------------LHIGGLNNAINSNTVVAVLIATVAFAAIFTVPGNFVEELS  366

Query  2141  KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINK  2320
             +   G +LG+A VA+  AFIVF +FD+LALFIS+AVVVVQTS++V+E++AKK+MVF++NK
Sbjct  367   QAPPGMSLGQAYVASNPAFIVFLVFDALALFISLAVVVVQTSLIVVERRAKKRMVFVMNK  426

Query  2321  LMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESR  2500
             LMW ACLFIS+AFI+LTYVVVG  + WLA  +  +G  IMLTT+GSMCYC+V HRLEE  
Sbjct  427   LMWLACLFISVAFIALTYVVVGRDDWWLAWCTMGIGAAIMLTTLGSMCYCIVAHRLEEKN  486

Query  2501  MRNIRKAE-TLSRSFSMSMVPSDSELYNESYKRMYAV*KQ  2617
              R IR+A  + SR      V SD E+ N  YK   A+ +Q
Sbjct  487   TRKIRRASASQSRGSWSRSVDSDEEILNSEYKTKIALFRQ  526


 Score =   136 bits (343),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 83/113 (73%), Gaps = 2/113 (2%)
 Frame = +2

Query  2276  IEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIG  2455
             +E++AKK+MVF++NKLMW ACLFIS+AFI+LTYVVVG  + WLA  +  +G  IMLTT+G
Sbjct  551   VERRAKKRMVFVMNKLMWLACLFISVAFIALTYVVVGRDDWWLAWCTMGIGAAIMLTTLG  610

Query  2456  SMCYCVVRHRLEESRMRNIRKAE-TLSRSFSMSMVPSDSELYNESYK-RMYAV  2608
             SMCYC++ HRLEE   R IR+A  + SR      V SD E+ N  YK +MYA+
Sbjct  611   SMCYCIIAHRLEEKNTRKIRRASASQSRGSWSRSVDSDEEILNSEYKTKMYAL  663



>ref|XP_007026502.1| Ankyrin repeat family protein isoform 2 [Theobroma cacao]
 gb|EOY07004.1| Ankyrin repeat family protein isoform 2 [Theobroma cacao]
Length=409

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/410 (75%), Positives = 366/410 (89%), Gaps = 1/410 (0%)
 Frame = +2

Query  1379  MTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSL  1558
             MTTD S +TALHTAA +GH+DVV+LLLE DS+LAKIARNNGKTVLH+AAR GHLEVVKSL
Sbjct  1     MTTDLSCTTALHTAAAKGHIDVVNLLLETDSDLAKIARNNGKTVLHSAARNGHLEVVKSL  60

Query  1559  VNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKG  1738
             ++KDPS GFR D+KGQTALHMAVKGQN +IVLEL+KPDPSVL L DN+GNTALHIA +KG
Sbjct  61    LSKDPSTGFRVDRKGQTALHMAVKGQNEEIVLELLKPDPSVLGLEDNRGNTALHIAIKKG  120

Query  1739  RPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAA  1918
               ++V+ L+S+E ININ  NKAGE+ LD+AEK GTP++V++LKEAGAT+SKDHGKPP+AA
Sbjct  121   HTEIVRCLLSVERININATNKAGESPLDLAEKMGTPELVSILKEAGATNSKDHGKPPNAA  180

Query  1919  KQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatv  2098
             KQLKQTVSDIKHDV+SQLQQ+RQTGF+V+KIAK++KKLHISGLNNAINS TVVAVLIATV
Sbjct  181   KQLKQTVSDIKHDVQSQLQQTRQTGFRVQKIAKRLKKLHISGLNNAINSATVVAVLIATV  240

Query  2099  afaaiftvPGQYVEKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvI  2278
             AFAAIFTVPGQYVE  K+G +LG+A++ANK  FIVFF+FDSLALFIS+AVVVVQTSVVVI
Sbjct  241   AFAAIFTVPGQYVEDMKEGVSLGQAHIANKTPFIVFFVFDSLALFISLAVVVVQTSVVVI  300

Query  2279  EQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGS  2458
             EQKAKKQ+VF+INKLMW ACLFIS+AFISLTYVVVG + +WLA+ +TV+G  IMLTTIGS
Sbjct  301   EQKAKKQLVFVINKLMWLACLFISVAFISLTYVVVGKQSRWLAVCATVIGSSIMLTTIGS  360

Query  2459  MCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             MCY V+ HR+EES++R+IRKAE+ SRS     + S+ E+ N  YKRMYA+
Sbjct  361   MCYFVILHRMEESKLRSIRKAESRSRS-FSMSMASEPEILNSEYKRMYAL  409


 Score = 66.6 bits (161),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 53/158 (34%), Positives = 82/158 (52%), Gaps = 6/158 (4%)
 Frame = +2

Query  1085  LHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGEILKQLD  1264
             LH AA  G++  V  +L+  DS   K  +++ N  G+T L+ AA NGH  VV  +L + D
Sbjct  11    LHTAAAKGHIDVVNLLLET-DSDLAK--IARNN--GKTVLHSAARNGHLEVVKSLLSK-D  64

Query  1265  LETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQGHVDV  1444
               T       G  A H+A K  + E++ ELL   P+++   D+  +TALH A  +GH ++
Sbjct  65    PSTGFRVDRKGQTALHMAVKGQNEEIVLELLKPDPSVLGLEDNRGNTALHIAIKKGHTEI  124

Query  1445  VDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSL  1558
             V  LL ++          G++ L  A +MG  E+V  L
Sbjct  125   VRCLLSVERININATNKAGESPLDLAEKMGTPELVSIL  162


 Score = 59.7 bits (143),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 93/192 (48%), Gaps = 11/192 (6%)
 Frame = +2

Query  1073  GDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGEIL  1252
             G   LH AAR G+L  V+ +L +  S   +      +++G+TAL++A +  +  +V E+L
Sbjct  41    GKTVLHSAARNGHLEVVKSLLSKDPSTGFR-----VDRKGQTALHMAVKGQNEEIVLELL  95

Query  1253  KQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQG  1432
             K  D     +  N G  A HIA K+GH E+++ LL+V    +  T+ +  + L  A   G
Sbjct  96    KP-DPSVLGLEDNRGNTALHIAIKKGHTEIVRCLLSVERININATNKAGESPLDLAEKMG  154

Query  1433  HVDVVDLLLEIDSNLAK---IARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKG  1603
               ++V +L E  +  +K      N  K +  T + + H   V+S + +    GFR  K  
Sbjct  155   TPELVSILKEAGATNSKDHGKPPNAAKQLKQTVSDIKH--DVQSQLQQTRQTGFRVQKIA  212

Query  1604  QTALHMAVKGQN  1639
             +    + + G N
Sbjct  213   KRLKKLHISGLN  224



>ref|XP_009412600.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Musa 
acuminata subsp. malaccensis]
Length=538

 Score =   550 bits (1416),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 317/527 (60%), Positives = 404/527 (77%), Gaps = 5/527 (1%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D PLH AARAGNL   +EIL   +   +KD L KQNQ GETAL+VAAE
Sbjct  13    KKMTKQLTGKRDDTPLHSAARAGNLVVAKEILSGTNDGELKDLLCKQNQVGETALFVAAE  72

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  VV E++K  D+  A I + NGYDA HIAAKQG ++V+KELL   P L +T D SN
Sbjct  73    YGYVDVVHEMMKHYDVAMAEIRAKNGYDALHIAAKQGDVDVVKELLKALPELSLTVDLSN  132

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TAL+TAA QGH+DVV+LLLE D +LA IAR+NGKT LH+AAR GHLEVVK+L+ K+ +I
Sbjct  133   TTALNTAATQGHIDVVNLLLETDKSLALIARSNGKTALHSAARNGHLEVVKALLRKESAI  192

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQTALHMAVK  ++++V+EL++ +PS+L L D KGNTALHIA RKGR Q+V+R
Sbjct  193   ATRTDKKGQTALHMAVKATSLELVVELLESEPSLLNLVDTKGNTALHIAARKGRAQIVKR  252

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPS-AAKQLKQT  1936
             L+ I+ + I  +NK+GETALD AEK G  +V ++L E G   ++    PP+  A++LKQT
Sbjct  253   LLEIKDLEIKAINKSGETALDTAEKMGHMEVASVLLEHGVPSARTMKPPPANPARELKQT  312

Query  1937  VSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaif  2116
             VSDIKH+V SQL+ +RQT  +V+ IAK++ KLH  GLNNAINS TVVAVLIA+VAFAAIF
Sbjct  313   VSDIKHEVHSQLEHTRQTRRRVQGIAKRLNKLHQEGLNNAINSNTVVAVLIASVAFAAIF  372

Query  2117  tvPGQYVEKEK--KGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKA  2290
             TVPG+YVE +    G TLGEANVA++  F++FF+FDS+ALFIS+AVVVVQTSVVVIE KA
Sbjct  373   TVPGEYVESDNLAPGLTLGEANVAHQTPFMIFFVFDSVALFISLAVVVVQTSVVVIESKA  432

Query  2291  KKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYC  2470
             KKQM+ IINKLMW AC+ IS+AF++L ++VVG  ++WLAI  TV+G VI+ TT+G+M Y 
Sbjct  433   KKQMMAIINKLMWIACVLISVAFLALCFIVVGRTQKWLAIGVTVIGTVILATTLGTMLYW  492

Query  2471  VVRHRLEESRMRNIRKAETLSRSFSMSMVP-SDSELYNESYKRMYAV  2608
             V+ HR+E  +MR IR+A TL RS S S+   SDSE  N+ YK+MYA+
Sbjct  493   VIAHRIEAKKMREIRRA-TLGRSRSWSVSGMSDSEWVNKEYKKMYAI  538



>ref|XP_004487042.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Cicer 
arietinum]
Length=541

 Score =   546 bits (1406),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 314/527 (60%), Positives = 405/527 (77%), Gaps = 5/527 (1%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D PLH AARAGNL  V++ L+  +   + D L++QNQ+GETALYVAAE
Sbjct  16    KKMTKQLTGKRDDTPLHSAARAGNLDVVKDTLKDAEEDELLDLLARQNQDGETALYVAAE  75

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  VV E+++  DL  A + + NG+DAFHIAAKQG +++LK L+ V P L MT D SN
Sbjct  76    YGYIDVVREMIQYYDLTAAGVKARNGFDAFHIAAKQGDIDILKILMEVHPELSMTVDPSN  135

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH+++V  LLE  S+LA IA++NGKT LH+AAR GHLEVVK+L+ K+PS+
Sbjct  136   TTALHTAATQGHIEIVKFLLEAGSSLATIAKSNGKTALHSAARNGHLEVVKALLEKEPSV  195

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQTALHMAVKGQN+++V +LIK DPS + + D KGNTALHIATRK R Q+V+ 
Sbjct  196   AIRTDKKGQTALHMAVKGQNLEVVEKLIKADPSTINMVDTKGNTALHIATRKARCQIVKM  255

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTV  1939
             L+  +  NI+ VN++GETA+D AEK G+ DV  +L E G   +K   KP + A++LKQTV
Sbjct  256   LLGEKETNISAVNRSGETAIDTAEKVGSHDVQAILLEHGVQSAKS-IKPQTTARELKQTV  314

Query  1940  SDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaift  2119
             SDIKH+V  QL+ +RQT  +V+ IAK++ K+H  GLNNAINS TVVAVLIATVAFAAIFT
Sbjct  315   SDIKHEVHYQLEHTRQTRKRVQGIAKRINKMHAEGLNNAINSTTVVAVLIATVAFAAIFT  374

Query  2120  vPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKA  2290
             VPGQ+V+       G TLGEAN+A +A FI+FF+FDS+ALFIS+AVVVVQTSVVVIE KA
Sbjct  375   VPGQFVDDPNNIPPGMTLGEANIAPQAPFIIFFVFDSIALFISLAVVVVQTSVVVIESKA  434

Query  2291  KKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYC  2470
             KKQM+ IINKLMW AC+ +S+AF++L++VVVG  E+WLAI  T++G  IM TT+G+MCY 
Sbjct  435   KKQMMAIINKLMWLACVLVSVAFLALSFVVVGKEEKWLAIGVTIIGTTIMATTLGTMCYW  494

Query  2471  VVRHRLEESRMRNIRKAETLSRSFSMSMVP-SDSELYNESYKRMYAV  2608
             V++HR+E S +RNIRK+   S+S S S+   SDSEL N  +K+MYA+
Sbjct  495   VIKHRIESSNLRNIRKSSMESKSKSFSVSAFSDSELLNNEFKKMYAI  541



>ref|XP_006424729.1| hypothetical protein CICLE_v10028165mg [Citrus clementina]
 ref|XP_006424730.1| hypothetical protein CICLE_v10028165mg [Citrus clementina]
 ref|XP_006424731.1| hypothetical protein CICLE_v10028165mg [Citrus clementina]
 ref|XP_006488235.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X1 [Citrus sinensis]
 ref|XP_006488236.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X2 [Citrus sinensis]
 ref|XP_006488237.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X3 [Citrus sinensis]
 ref|XP_006488238.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X4 [Citrus sinensis]
 gb|ESR37969.1| hypothetical protein CICLE_v10028165mg [Citrus clementina]
 gb|ESR37970.1| hypothetical protein CICLE_v10028165mg [Citrus clementina]
 gb|ESR37971.1| hypothetical protein CICLE_v10028165mg [Citrus clementina]
 gb|KDO72999.1| hypothetical protein CISIN_1g009344mg [Citrus sinensis]
Length=537

 Score =   541 bits (1394),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 305/532 (57%), Positives = 406/532 (76%), Gaps = 6/532 (1%)
 Frame = +2

Query  1031  GGE--RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETAL  1204
             GG+  +K  K   GKR D  LH AARAGNL +V++IL   +   +K+ L KQNQ GETAL
Sbjct  6     GGQPKKKMTKQLTGKRDDTALHSAARAGNLDEVKDILTGTEEAKLKELLPKQNQSGETAL  65

Query  1205  YVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMT  1384
             YVAAE GH  +V E++K  DL  A I + NG+DAFHIAAK+GHLEVLK LL V+P L MT
Sbjct  66    YVAAEYGHVDLVAEMIKCYDLADAGIKARNGFDAFHIAAKEGHLEVLKVLLAVYPELAMT  125

Query  1385  TDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVN  1564
              D +N+TALHTAA QGHV+V++ L+E +S+L  I+R+NGKT LH+AAR G LEV+K+L+ 
Sbjct  126   VDLTNTTALHTAAMQGHVEVLNFLIEAESSLITISRSNGKTALHSAARNGRLEVLKTLLA  185

Query  1565  KDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRP  1744
              D  I  RTDKKGQTALHMAVKGQN+++V ELIK +P+ + + D KGN+ LHIATRKGR 
Sbjct  186   ADSVIAIRTDKKGQTALHMAVKGQNIEVVQELIKAEPASVNMVDTKGNSPLHIATRKGRE  245

Query  1745  QMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQ  1924
             Q+V+ L++    N+N VN+ GETALD AEK G  ++  +L+E G   +K+     + A++
Sbjct  246   QIVRLLLANSETNLNGVNRTGETALDTAEKTGHSNLAALLREHGVESAKNMKPQNNPARE  305

Query  1925  LKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvaf  2104
             LKQTVSDIKH+V  QL+ +RQT  +V  IAK++ K+H  GLNNAINS TVVAVLIAT+AF
Sbjct  306   LKQTVSDIKHEVHYQLEHTRQTRRRVHGIAKRLHKMHAEGLNNAINSTTVVAVLIATIAF  365

Query  2105  aaiftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvv  2275
             AAIF VPGQ+V+K ++   G  LGEA+V+ K AFI+FF+FDS+ALFIS+AVVVVQTSVVV
Sbjct  366   AAIFQVPGQFVDKPEEAVDGVALGEAHVSQKPAFIIFFVFDSIALFISLAVVVVQTSVVV  425

Query  2276  IEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIG  2455
             IE KAK+Q++ +INKLMW AC+ IS+A+++++++VVG RE+W+A+  T+VG VIM  T+G
Sbjct  426   IESKAKRQLMAVINKLMWLACVLISVAYLAMSFIVVGKREKWMAVAVTIVGAVIMAATLG  485

Query  2456  SMCYCVVRHRLEESRMRNIRKAETLSRSFSMSM-VPSDSELYNESYKRMYAV  2608
             +M Y V+RHR+E+S MR+IRK+   SRS S S+ + SD+E+ N  YK++YA+
Sbjct  486   TMIYWVIRHRIEDSNMRSIRKSSMGSRSKSGSINMMSDTEVLNNDYKKLYAI  537



>ref|XP_008794360.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Phoenix 
dactylifera]
Length=551

 Score =   541 bits (1393),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 311/533 (58%), Positives = 401/533 (75%), Gaps = 4/533 (1%)
 Frame = +2

Query  1016  RQLSFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGE  1195
             RQ SF   +K  K   GKR D PLH AARAGNL+ V+EI+   D + + + L+KQNQ GE
Sbjct  21    RQQSFR-RKKMTKQLTGKRDDTPLHSAARAGNLAVVKEIISGADEQELAELLTKQNQAGE  79

Query  1196  TALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNL  1375
             TAL+VAAE G   VV E++K  D+ TA I + NGYDA H+AAKQG ++V+KELL   P L
Sbjct  80    TALFVAAEYGFVDVVNEMIKYHDVLTAGIKAKNGYDALHVAAKQGDVDVMKELLMALPEL  139

Query  1376  VMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKS  1555
              MT D SN+TALHTAA QGH++VV+LLLE D +LA IAR+NGKT LH+AAR GHLEVVK+
Sbjct  140   SMTVDLSNTTALHTAATQGHIEVVNLLLEADGSLALIARSNGKTALHSAARNGHLEVVKA  199

Query  1556  LVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRK  1735
             LVN++  I  R DKKGQTALHMAVKG ++D+V EL+K +P+++ L D+KGNTALHIA RK
Sbjct  200   LVNRESGIATRIDKKGQTALHMAVKGTSLDLVEELLKCEPTLVNLVDSKGNTALHIAARK  259

Query  1736  GRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSA  1915
             GR Q+V+RL+ ++ I+I  +NK+GE+ALD AEK G  DV  +L   G   ++  G PP+ 
Sbjct  260   GRIQIVKRLLELKEIDIQAINKSGESALDTAEKMGNSDVACILVAHGVQSARTIG-PPNP  318

Query  1916  AKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliat  2095
             A++LKQ VSDIKH+V SQL+ +RQT  +V+ IAK++ KLH  GLNNAINS T+VAVLIAT
Sbjct  319   ARELKQQVSDIKHEVHSQLEHTRQTRRRVQGIAKRLNKLHAEGLNNAINSNTIVAVLIAT  378

Query  2096  vafaaiftvPGQYVEKEK--KGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsv  2269
             VAFAAIFTVPGQ V+ E    G TLGEAN++++  FI+FF+FDS+ALFIS+AVVVVQTS+
Sbjct  379   VAFAAIFTVPGQSVDPENLAPGLTLGEANISHQTPFIIFFVFDSVALFISLAVVVVQTSI  438

Query  2270  vvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTT  2449
             VVIE KAKKQM+ IINKLMW AC+ IS AF++L+++VVG  E+WLAI  T++G  I+ TT
Sbjct  439   VVIESKAKKQMMAIINKLMWLACVLISAAFLALSFIVVGNHEKWLAIGVTIIGSTILATT  498

Query  2450  IGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             +G+M Y V+ HR+E  ++RNIR++             SD EL N  YK+MYA+
Sbjct  499   LGTMLYWVIAHRIESKKLRNIRRSSLSRSRSFSVSGMSDGELLNNEYKKMYAI  551



>ref|XP_010937738.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Elaeis 
guineensis]
Length=536

 Score =   540 bits (1391),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 310/525 (59%), Positives = 403/525 (77%), Gaps = 3/525 (1%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D PLH AARAGNL+ V+EI+   + + +++ L KQNQ GETAL+VAAE
Sbjct  13    KKMTKQLTGKRDDTPLHSAARAGNLTVVKEIISGANEEELEEMLMKQNQAGETALFVAAE  72

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  VV E++K  D+  A I + NGYDA HIAAKQG ++V+KELL   P L MT D SN
Sbjct  73    YGYVDVVNEMIKYHDVFMAGIKAKNGYDALHIAAKQGDVDVVKELLMALPELSMTVDLSN  132

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH++VV+LLLE D +LA IAR+NGKT LH+AAR GHLEVVK+L+N+DP I
Sbjct  133   TTALHTAATQGHIEVVNLLLEADGSLALIARSNGKTALHSAARNGHLEVVKALLNRDPGI  192

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQTALHMAVKG ++D++ EL+K + + + L D KGNTAL IA RKGR Q+V+R
Sbjct  193   ATRTDKKGQTALHMAVKGTSLDVIEELLKCETTPVNLVDTKGNTALQIAARKGRTQIVKR  252

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTV  1939
             L+++E I+I T+NK+GETALD AEK G  DV T+L + G  +++   +PP+ A++LKQ V
Sbjct  253   LLALEEIDIKTINKSGETALDTAEKLGNTDVATILVQHGVQNARTI-RPPNPARELKQQV  311

Query  1940  SDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaift  2119
             S+IKH+V SQL+ +RQT  +V+ IAKK+ KLH  GLNNAINS TVVAVLIATVAFAAIFT
Sbjct  312   SEIKHEVHSQLEHTRQTRKRVQGIAKKLNKLHAEGLNNAINSNTVVAVLIATVAFAAIFT  371

Query  2120  vPGQYVEKEK--KGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAK  2293
             VPG+YVE E    G TLGEAN+A++  F++FF+FDS+ALFIS+AVVVVQTSVVVIE KAK
Sbjct  372   VPGEYVEYENLAPGVTLGEANIAHQTPFMIFFIFDSVALFISLAVVVVQTSVVVIESKAK  431

Query  2294  KQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCV  2473
             KQM+ IINKLMW AC+ IS+AF++L+++VVG  E+WLAI  T++G  I+ TT+G+M Y V
Sbjct  432   KQMMAIINKLMWLACVLISVAFLALSFIVVGKHERWLAIGVTIIGTTILATTLGTMLYWV  491

Query  2474  VRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             + HR+E  ++RNIR++             SD +L+N  YK+MYA+
Sbjct  492   IAHRIEAKKLRNIRRSSLSRSRSFSPSGLSDGDLFNNEYKKMYAI  536



>ref|XP_010112932.1| Ankyrin repeat-containing protein [Morus notabilis]
 gb|EXC35081.1| Ankyrin repeat-containing protein [Morus notabilis]
Length=546

 Score =   539 bits (1389),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 312/530 (59%), Positives = 400/530 (75%), Gaps = 8/530 (2%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D+ LH AARAGN++ VREIL       +K+ LSKQNQ GETALYVAAE
Sbjct  18    KKITKQLTGKRDDSALHSAARAGNVAVVREILTGAGEAELKEHLSKQNQSGETALYVAAE  77

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  +V E+++  DL  A I + NG+DAFHIAAKQG L+VLK L+   P L MT D SN
Sbjct  78    YGNVDLVKEMIQYYDLADAGIKARNGFDAFHIAAKQGDLDVLKVLVEAHPGLTMTVDVSN  137

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH + V LLLE  S+LA IAR+NGKT LH+AAR GHL+VVK+L+ K+PS+
Sbjct  138   TTALHTAATQGHSETVSLLLEAGSSLATIARSNGKTALHSAARNGHLKVVKALLQKEPSL  197

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQTALHMAVKGQN+++V ELIK DPS + + D KGNTALHIATRKGR Q+V+ 
Sbjct  198   ATRTDKKGQTALHMAVKGQNLEVVEELIKADPSTINMVDTKGNTALHIATRKGRAQIVRL  257

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKP---PSAAKQLK  1930
             L+S    +   VN++GETA+D AEK G  ++  +L+E G   +K   KP    S A++LK
Sbjct  258   LLSQSETDKMAVNRSGETAIDTAEKTGNGNISAILQEHGVQSAKTM-KPQATTSTARELK  316

Query  1931  QTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaa  2110
             QTVSDIKH+V  QL+ +RQT  +V+ IAK++ K+H  GLNNAINS TVVAVLIATVAFAA
Sbjct  317   QTVSDIKHEVHYQLEHTRQTRRRVQGIAKRLNKMHAEGLNNAINSTTVVAVLIATVAFAA  376

Query  2111  iftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIE  2281
             IFTVPGQYV+  K+   GF+LGEA +A+K  F++FF+FD++ALFIS+AVVVVQTSVVVIE
Sbjct  377   IFTVPGQYVDDPKQIPPGFSLGEARIASKVPFLIFFVFDAIALFISLAVVVVQTSVVVIE  436

Query  2282  QKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSM  2461
              KAKKQM+ +INKLMW AC+ +S+AF++L++VVVG +++WLAI  T++G  IM TT+G+M
Sbjct  437   SKAKKQMMAVINKLMWLACVLVSVAFLALSFVVVGEKQKWLAIGVTIIGTTIMATTLGTM  496

Query  2462  CYCVVRHRLEESRMRNIRKAET-LSRSFSMSMVPSDSELYNESYKRMYAV  2608
             CY V+RHR+E S +R+IRK+            V S+SE+ N  YK+MYA+
Sbjct  497   CYWVIRHRIEASNLRSIRKSSMGSRSRSLSLSVMSESEILNSEYKKMYAI  546



>ref|XP_009406960.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Musa 
acuminata subsp. malaccensis]
Length=538

 Score =   533 bits (1374),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 313/539 (58%), Positives = 399/539 (74%), Gaps = 7/539 (1%)
 Frame = +2

Query  1010  MERQLSFGGE----RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSK  1177
             ME   S G +    +K  K   GKR D PLH AAR+GNL+ V  +L   D + +K+ LS+
Sbjct  1     MEMDSSVGRQSFRRKKMTKQLTGKRDDTPLHSAARSGNLAVVNGLLSGADDEDLKELLSR  60

Query  1178  QNQEGETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELL  1357
             QNQ GETAL+VAAE G+  VV E++K  D+  A I + NGYDA HIAAKQG ++V+KELL
Sbjct  61    QNQAGETALFVAAEYGYVDVVQEMIKYYDVAAAGIKAKNGYDALHIAAKQGDVDVVKELL  120

Query  1358  NVFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGH  1537
             N  P L +T D SN+TALHTAA QGH++VV+LLLE D +LA IA++NGKT LH+AAR GH
Sbjct  121   NALPELSLTVDLSNTTALHTAAAQGHIEVVNLLLEADKSLALIAKSNGKTALHSAARNGH  180

Query  1538  LEVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTAL  1717
             LEVVKSL+ K+  I  RTDKKGQTALHMA KG ++D+V EL++ +PS+L L D KGNTAL
Sbjct  181   LEVVKSLLRKESGIAARTDKKGQTALHMAAKGTSLDLVQELLENEPSLLNLVDTKGNTAL  240

Query  1718  HIATRKGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDH  1897
             HIA RK R Q+V+RL+  + +    +NK+GETALD AEK G  DV  ML E G   ++  
Sbjct  241   HIAARKSRAQIVRRLLEFKELETKAINKSGETALDTAEKMGNSDVTGMLLEHGVQSARAI  300

Query  1898  GKPPSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvv  2077
                P+ A++LKQTVSDIKH+V SQL+ +RQT  +V+ IAK++ KLH  GLNNAINS TVV
Sbjct  301   RPSPNPARELKQTVSDIKHEVHSQLEHTRQTRRRVQGIAKRLNKLHEDGLNNAINSNTVV  360

Query  2078  avliatvafaaiftvPGQYVEKEK--KGFTLGEANVANKAAFIVFFLFDSLALFISIAvv  2251
             AVLIATVAFAAIFTVPG+YVE +    G TLGEANVA++  F++FF+FDS+ALFIS+AVV
Sbjct  361   AVLIATVAFAAIFTVPGEYVESDNLAPGLTLGEANVAHQTPFMIFFVFDSVALFISLAVV  420

Query  2252  vvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGG  2431
             VVQTSVVVIE KAKKQM+ IINKLMW AC+ ISIAF++L ++VVG  ++WLAI  T++G 
Sbjct  421   VVQTSVVVIESKAKKQMMAIINKLMWIACVLISIAFLALCFIVVGRSQRWLAIGVTIMGT  480

Query  2432  VIMLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             VI+ TT+ +M Y V+ HR+E  ++RNIR++         +   SDSEL+N  YK MYA+
Sbjct  481   VILATTLATMLYWVIAHRIEAKKLRNIRRSSLSRSRSWSASGVSDSELFNSEYK-MYAI  538



>ref|XP_008448352.1| PREDICTED: ankyrin repeat-containing protein At5g02620 isoform 
X1 [Cucumis melo]
Length=547

 Score =   533 bits (1372),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 319/531 (60%), Positives = 401/531 (76%), Gaps = 10/531 (2%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D PLH AARAGNL+   EIL   D   +++ L+KQN  GETALYVAAE
Sbjct  19    KKMTKQLTGKRDDTPLHSAARAGNLTAAMEILTDTDEMDLRELLAKQNHSGETALYVAAE  78

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  +V E+LK  DL  A I + NG+DAFHIA KQG LE+LK L+   P L MT D SN
Sbjct  79    YGYVDLVRELLKYYDLADAEIKARNGFDAFHIATKQGDLEILKVLMEAHPELSMTVDISN  138

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH+++VD LLE  S LA IAR+NGKT LH+AAR GHL+VV++L+ K+P +
Sbjct  139   TTALHTAATQGHIEIVDFLLEAGSGLATIARSNGKTALHSAARNGHLQVVRALLAKEPIV  198

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQTAL MA KGQN+++V ELIK DPS + + DNKGNTALHIA RKGR ++V+ 
Sbjct  199   ATRTDKKGQTALQMASKGQNLEVVEELIKADPSSINMVDNKGNTALHIAARKGRAEIVRM  258

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPP--SAAKQLKQ  1933
             L+     N   VN++GETALD AEK G PD+  +LKE G   +K   KP   + A++LKQ
Sbjct  259   LLRQNETNTKAVNRSGETALDTAEKTGNPDIALILKEHGVQTAKAI-KPEVKNPARELKQ  317

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH+V  QL+ +RQT  +V+ IAK++ K+H  GLNNAINS TVVAVLIATVAFAAI
Sbjct  318   TVSDIKHEVHYQLEHTRQTRRRVQGIAKRLNKMHTEGLNNAINSTTVVAVLIATVAFAAI  377

Query  2114  ftvPGQYV---EKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             FTVPGQYV   E    GF+LGEAN+A KA FI+FF+FDS+ALFIS+AVVVVQTSVVVIE 
Sbjct  378   FTVPGQYVDDPEDVPAGFSLGEANIAPKAPFIIFFIFDSIALFISLAVVVVQTSVVVIES  437

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             +AKKQM+ IINKLMW AC+ IS+AF++L++VVVG RE+WLAI  T++G  IM TT+G+MC
Sbjct  438   QAKKQMMAIINKLMWLACVLISVAFLALSFVVVGEREKWLAIGVTLIGTTIMATTLGTMC  497

Query  2465  YCVVRHRLEESRMRNIRKAE---TLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             Y V++HR+E S +R+IRK+    + S+S S+S V SDSE+ N  +K+MYA+
Sbjct  498   YWVIKHRIEASNLRSIRKSSMGGSRSKSCSLS-VMSDSEILNNEFKKMYAI  547



>emb|CDP08980.1| unnamed protein product [Coffea canephora]
Length=541

 Score =   532 bits (1371),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 306/528 (58%), Positives = 399/528 (76%), Gaps = 5/528 (1%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D  LH AARAGNL  V EI+ +   + + + LSKQN  GETALYVA E
Sbjct  14    KKMTKQLTGKRDDTALHSAARAGNLKAVWEIIHQSSEEELIELLSKQNSAGETALYVAVE  73

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  +V E++K  DL  A I + NG+DA HIAAKQG L+++K L+     L MT D++N
Sbjct  74    YGYLELVKEMIKYYDLAAAGIKARNGFDALHIAAKQGDLDIVKVLMEAHSELSMTVDTAN  133

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH++VV+ LLE++S+LA IAR+NGKT LH+AAR GH+ VVK+L++K+P I
Sbjct  134   TTALHTAATQGHIEVVNYLLELESSLAAIARSNGKTALHSAARNGHVHVVKALLSKEPGI  193

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               R DKKGQTALHMAVKGQN+++V ELIK DPS++ + DNKGNTALHIATRKGR Q+V+ 
Sbjct  194   APRNDKKGQTALHMAVKGQNLEVVEELIKGDPSLINMVDNKGNTALHIATRKGRAQIVRM  253

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKD-HGKPPSAAKQLKQT  1936
             L++    +I  VN++ ETALD AEK G  D+ ++L+E G   ++    +P + A++LKQT
Sbjct  254   LLAQNETDITAVNRSSETALDTAEKTGQADIASILQEHGVQSARTLKPQPTNPARELKQT  313

Query  1937  VSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaif  2116
             VSDIKH+V  QL+ +RQT  +V+ IAK++ K+H  GLNNAINS TVVAVLIATVAFAAIF
Sbjct  314   VSDIKHEVHYQLEHTRQTRKRVQGIAKRLNKMHAEGLNNAINSTTVVAVLIATVAFAAIF  373

Query  2117  tvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQK  2287
             TVPGQYV+       G +LGEAN+A +  FI+FF+FDS+ALFIS+AVVVVQTSVVVIE K
Sbjct  374   TVPGQYVDDPNNIPPGQSLGEANIAPQVPFIIFFVFDSIALFISLAVVVVQTSVVVIESK  433

Query  2288  AKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCY  2467
             AKKQM+ IINKLMW AC+ IS+AF++L++VVVG  E+WLAI  T++G  I+ TT+G+MCY
Sbjct  434   AKKQMMAIINKLMWLACVLISVAFLALSFVVVGQHERWLAIGVTIIGTTILATTLGTMCY  493

Query  2468  CVVRHRLEESRMRNIRKAETLSRSFSMSM-VPSDSELYNESYKRMYAV  2608
              V+ HR+E S  R+IRK    SRS S SM V SDS++ +  +K+MYA+
Sbjct  494   WVIMHRIESSNKRSIRKNSQASRSRSWSMSVLSDSDVLHTDFKKMYAI  541



>ref|XP_006850626.1| hypothetical protein AMTR_s00034p00179220 [Amborella trichopoda]
 gb|ERN12207.1| hypothetical protein AMTR_s00034p00179220 [Amborella trichopoda]
Length=541

 Score =   531 bits (1367),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 318/538 (59%), Positives = 400/538 (74%), Gaps = 9/538 (2%)
 Frame = +2

Query  1016  RQLSFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQR---FDSKAIKDTLSKQNQ  1186
             RQ SF   +K  K   GKR D  LH AAR+GN   V EI       D    ++ LS+QNQ
Sbjct  6     RQPSFV-RKKMTKQLTGKRDDTALHSAARSGNAGVVSEIFSSAAPHDGGNFEELLSRQNQ  64

Query  1187  EGETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVF  1366
              GET LYVAAE G+  VV E+LK  D+ TA I + NGYDAFHIAAKQG L+++KELL+  
Sbjct  65    AGETPLYVAAEYGYGDVVREMLKYSDILTAGIKARNGYDAFHIAAKQGDLDIVKELLHAL  124

Query  1367  PNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEV  1546
             P L MTTDSSN+TALHTAA QGH+DVV+LLLE D NLAKI R+NGKT LH+AAR GH+EV
Sbjct  125   PPLSMTTDSSNATALHTAATQGHIDVVNLLLEADGNLAKITRSNGKTALHSAARNGHVEV  184

Query  1547  VKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIA  1726
             VK+L+  +P I  R D KGQTA HMAVKGQN++IV EL+K +P V+ L DNKGNTALHIA
Sbjct  185   VKTLLRANPEIAIRNDNKGQTAFHMAVKGQNIEIVEELLKSEPLVINLVDNKGNTALHIA  244

Query  1727  TRKGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKP  1906
             +RKGR Q+V++L+  EGI+I  VN++ ETALD AEK G  ++ ++L+EAG   ++   + 
Sbjct  245   SRKGRAQIVRKLLEFEGIDIKLVNRSQETALDTAEKTGNLEITSILREAGVESTRGANQ-  303

Query  1907  PSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavl  2086
             PS  ++LKQTVSDIKH+V SQL+Q+RQT  +V+ IAK++ KLH  GLNNAINS TVVAVL
Sbjct  304   PSKERELKQTVSDIKHEVHSQLEQTRQTRKRVQGIAKRINKLHEEGLNNAINSTTVVAVL  363

Query  2087  iatvafaaiftvPGQYVEKE---KKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvv  2257
             IATVAFAAIFTVPGQYV          ++GEA +A+   F +FF+FDS+ALFIS+AVVVV
Sbjct  364   IATVAFAAIFTVPGQYVTDPNDISPTVSMGEAYIAHMTPFHIFFIFDSIALFISLAVVVV  423

Query  2258  qtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVI  2437
             QTSVVVIE +AKKQ++ +INKLMW AC+ IS+AFI+L+Y+VVG   +WLAI  T++G +I
Sbjct  424   QTSVVVIESRAKKQLMTVINKLMWLACVLISVAFIALSYIVVGKHLRWLAIAVTLIGTLI  483

Query  2438  MLTTIGSMCYCVVRHRLEESRM-RNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             M TT+G+MCY V+ HR+E S M    R   + SRS SMS + SD E+ N  YK+MYA+
Sbjct  484   MATTLGTMCYWVIMHRIEASNMRSIRRSFNSRSRSGSMSAIFSDPEVLNTDYKKMYAI  541



>ref|XP_004148223.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Cucumis 
sativus]
 ref|XP_004157019.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Cucumis 
sativus]
 gb|KGN47348.1| hypothetical protein Csa_6G302160 [Cucumis sativus]
Length=547

 Score =   528 bits (1359),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 316/531 (60%), Positives = 399/531 (75%), Gaps = 10/531 (2%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D PLH AARAGNL+   EIL   D   +++ L+KQN  GETALYVAAE
Sbjct  19    KKMTKQLTGKRDDTPLHSAARAGNLTAAMEILTDTDEMDLRELLAKQNHSGETALYVAAE  78

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  +V E+LK  DL  A I + NG+DAFHIA KQG LE+L+ L+   P L MT D SN
Sbjct  79    YGYVDLVRELLKYYDLADAEIKARNGFDAFHIATKQGDLEILRVLMEAHPELSMTVDISN  138

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH+++VD LLE  S LA IAR+NGKT LH+AAR GHL V+++L+ K+P +
Sbjct  139   TTALHTAATQGHIEIVDFLLEAGSGLATIARSNGKTALHSAARNGHLHVIRALLAKEPIV  198

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQTAL MA KGQN+++V ELIK DPS + + DNKGNT LHIA RKGR ++V+ 
Sbjct  199   ATRTDKKGQTALQMASKGQNLEVVEELIKADPSSINMVDNKGNTVLHIAARKGRAEIVRM  258

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPP--SAAKQLKQ  1933
             L+     N   VN++GETALD AEK G PD+   LKE G   +K   KP   + A++LKQ
Sbjct  259   LLRHSETNTKAVNRSGETALDTAEKTGNPDIALTLKEHGVQSAKAI-KPEVKNPARELKQ  317

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH+V  QL+ +RQT  +V+ IAK++ K+H  GLNNAINS TVVAVLIATVAFAAI
Sbjct  318   TVSDIKHEVHYQLEHTRQTRRRVQGIAKRLNKMHSEGLNNAINSTTVVAVLIATVAFAAI  377

Query  2114  ftvPGQYV---EKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             FTVPGQYV   E   +GF+LGEAN+A KA FI+FF+FDS+ALFIS+AVVVVQTSVVVIE 
Sbjct  378   FTVPGQYVDDPEDVPEGFSLGEANIAPKAPFIIFFIFDSIALFISLAVVVVQTSVVVIES  437

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             +AKKQM+ IINKLMW AC+ IS+AF++L++VVVG RE+WLAI  T++G  IM TT+G+MC
Sbjct  438   QAKKQMMAIINKLMWLACVLISVAFLALSFVVVGEREKWLAIGVTLIGTTIMATTLGTMC  497

Query  2465  YCVVRHRLEESRMRNIRKAE---TLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             Y V++HR+E S +R+IRK+    + S+S S+S V SDSE+ N  +K+MYA+
Sbjct  498   YWVIKHRIEASNLRSIRKSSMGGSRSKSCSLS-VMSDSEILNNEFKKMYAI  547



>ref|XP_003597310.1| Ankyrin repeat-containing protein [Medicago truncatula]
 gb|AES67561.1| ankyrin repeat plant protein [Medicago truncatula]
Length=544

 Score =   527 bits (1358),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 307/530 (58%), Positives = 398/530 (75%), Gaps = 8/530 (2%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D PLH AAR+GNL  VR+IL       + + L++QNQ+GETALYVAAE
Sbjct  16    KKMTKQLTGKRDDTPLHSAARSGNLDVVRDILNDAQEDELLELLARQNQDGETALYVAAE  75

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  VV  +++  DL  A I + NG+DAFHIAAKQG +++LK L+ V P L MT D SN
Sbjct  76    YGYIDVVRGMIQYYDLACAGIKARNGFDAFHIAAKQGDIDILKILMEVHPELSMTVDPSN  135

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH+++V  LLE  S+LA IA++NGKT LH+AAR GH EVVK+L+ K+P +
Sbjct  136   TTALHTAATQGHIEIVKFLLEAGSSLATIAKSNGKTALHSAARNGHSEVVKALLEKEPGV  195

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQTALHMAVKGQN+++V ELIK DPS + + DNKGNT LHIATRK R ++V  
Sbjct  196   ATRTDKKGQTALHMAVKGQNLEVVEELIKADPSTINMVDNKGNTTLHIATRKARTRIVNM  255

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKP---PSAAKQLK  1930
             L+  +  +++ VN++GETA+D AEK G  DV  +L + G   +K   KP    S A +LK
Sbjct  256   LLGQKETDVSAVNRSGETAVDTAEKIGNQDVKAILLDHGVQSAKSM-KPQGSKSTAHELK  314

Query  1931  QTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaa  2110
             QTVSDIKH+V  QL+ +RQT  +V+ IAK++ K++  GLNNAINS TVVAVLIATVAFAA
Sbjct  315   QTVSDIKHEVHYQLEHTRQTRKRVQGIAKRINKMNTEGLNNAINSTTVVAVLIATVAFAA  374

Query  2111  iftvPGQYVEKEK---KGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIE  2281
             IFTVPGQ+V+      +G  LGEAN++ +A FI+FF+FDS+ALFIS+AVVVVQTSVVVIE
Sbjct  375   IFTVPGQFVDDPNNIPEGMILGEANISPEAPFIIFFVFDSIALFISLAVVVVQTSVVVIE  434

Query  2282  QKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSM  2461
              KAKKQM  IINKLMW AC+ IS+AF++L++VVVG  E+WLAI+ T++G  IM TT+G+M
Sbjct  435   SKAKKQMAAIINKLMWLACVLISVAFLALSFVVVGKEEKWLAIFVTIIGATIMATTLGTM  494

Query  2462  CYCVVRHRLEESRMRNIRKAETLSRSFSMSMVP-SDSELYNESYKRMYAV  2608
             CY V++HR+E S +RNIRK+   S+S S ++   SDSEL N  +K+MYA+
Sbjct  495   CYWVIKHRIEASNLRNIRKSSMESKSKSFTVTALSDSELMNNEFKKMYAI  544



>ref|XP_010685856.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Beta 
vulgaris subsp. vulgaris]
Length=544

 Score =   527 bits (1357),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 311/532 (58%), Positives = 399/532 (75%), Gaps = 11/532 (2%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D+ LH AARAGNL +V EIL     + +K+ L KQNQ GETALY AAE
Sbjct  15    KKMKKQLTGKRDDSKLHAAARAGNLDEVMEILNGTGEEELKELLVKQNQAGETALYSAAE  74

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G   +V E++K  D   ASI + NG+DAFHIAAK+G LE LK L+   P+L MT D+SN
Sbjct  75    YGQVDIVREMIKYYDPSAASIKAKNGFDAFHIAAKEGDLETLKVLMETHPDLSMTCDTSN  134

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TAL TAA QGH +VV+ LLE  S LA I R+NGKT LH AAR GH+ VVK+L+ K+  I
Sbjct  135   TTALQTAATQGHTEVVNFLLETGSGLATIGRSNGKTALHAAARNGHVAVVKALLGKETGI  194

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQTALHMAVKGQN+++V ELI+ DPS++ + D+KGNT LHIATRKGR Q+V R
Sbjct  195   TTRTDKKGQTALHMAVKGQNLEVVEELIRADPSLINMTDSKGNTPLHIATRKGRHQIVTR  254

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSA---AKQLK  1930
             L++    +   VN+AGETA D AEK   P+++  L+E G   +K   KP +    A+ LK
Sbjct  255   LLAENEKDTTVVNRAGETAFDTAEKMSHPEILETLREHGVQSAKV-IKPQATSNNARALK  313

Query  1931  QTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaa  2110
             QTVSDIKH+V  QL+ +RQT  +V  IAK++ K+H  GLNNAINS TVVAVLIATVAFAA
Sbjct  314   QTVSDIKHEVHHQLEHTRQTRRRVHGIAKRINKMHTEGLNNAINSTTVVAVLIATVAFAA  373

Query  2111  iftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIE  2281
             IFTVPGQYV+       G +LGEA++A KAAF++FF+FDS+ALFIS+AVVVVQTSVVVIE
Sbjct  374   IFTVPGQYVDDPDNVPPGSSLGEAHIAPKAAFLIFFVFDSVALFISLAVVVVQTSVVVIE  433

Query  2282  QKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSM  2461
              KAKKQM+ IINKLMW AC+ IS++F++L+++VVG RE+WLAI  T++G  IM+TT+G+M
Sbjct  434   SKAKKQMMAIINKLMWLACVLISVSFLALSFIVVGARERWLAIGVTIIGTTIMVTTLGTM  493

Query  2462  CYCVVRHRLEESRMRNIRKA--ETLSRSFSMSMVPSDSELYN-ESYKRMYAV  2608
             CY V++HR+E   +R+IRK+  E+ SRS+S+S + SDSE+ N E +K+MYA+
Sbjct  494   CYWVIQHRIEAKSLRSIRKSSLESKSRSWSVSAM-SDSEILNAEKFKKMYAI  544



>ref|XP_008810497.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Phoenix 
dactylifera]
 ref|XP_008810498.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Phoenix 
dactylifera]
Length=536

 Score =   526 bits (1356),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 305/542 (56%), Positives = 405/542 (75%), Gaps = 14/542 (3%)
 Frame = +2

Query  989   QKSFRIAMERQLSFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDT  1168
             Q+SFR            +K  K   GKR D PLH AARAGNL+ V+EI+   + K +++ 
Sbjct  7     QQSFR-----------RKKMTKQLTGKRDDTPLHSAARAGNLTVVKEIISGANEKGLEEL  55

Query  1169  LSKQNQEGETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLK  1348
             L KQNQ GETAL+VAAE G+  VV E++K  D+  A + + NGYDA HIAAKQG  +V+K
Sbjct  56    LMKQNQAGETALFVAAEYGYVDVVNEMIKYHDVAMAGMKAKNGYDALHIAAKQGDADVVK  115

Query  1349  ELLNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAAR  1528
             ELL   P L MT D SN+TALHTAA QGH++VV+LLLE D +LA IAR+NGK+ LH+AAR
Sbjct  116   ELLMALPELSMTVDLSNTTALHTAATQGHIEVVNLLLEADGSLALIARSNGKSALHSAAR  175

Query  1529  MGHLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGN  1708
              GHLEVVK+L+NKD  I  RTDKKGQTALHMAVKG ++D+V EL+K  P+++ L D KGN
Sbjct  176   NGHLEVVKALLNKDSGIATRTDKKGQTALHMAVKGTSLDLVEELLKCKPTLVNLVDAKGN  235

Query  1709  TALHIATRKGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHS  1888
              ALHIA RKGR Q+V+RL+ ++ I+I  +NK+GETALD A+K G  DV T+L E G  ++
Sbjct  236   MALHIAARKGRTQIVRRLVELKEIDIAAINKSGETALDTAQKTGNTDVATILVEHGVQNA  295

Query  1889  KDHGKPPSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSl  2068
             +   +PP+ A++LKQ VS+IKH+V SQL+ +RQT  +V+ IAKK+ KLH  GLNNAINS 
Sbjct  296   RTI-RPPNPARELKQQVSEIKHEVHSQLEHTRQTRKRVQGIAKKLNKLHAEGLNNAINSN  354

Query  2069  tvvavliatvafaaiftvPGQYVEKEK--KGFTLGEANVANKAAFIVFFLFDSLALFISI  2242
             TVVAVLIATVAFAAIFTVPG+YV+ E    G +LGEA+++++  F++FF+FDS+ALFIS+
Sbjct  355   TVVAVLIATVAFAAIFTVPGEYVDSENLAPGLSLGEASISHQTPFMIFFIFDSVALFISL  414

Query  2243  AvvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTV  2422
             AVVVVQTS+VVIE KAKKQM+ +INKLMW AC+ IS+AF++L+++VVG  E+WLA+  T+
Sbjct  415   AVVVVQTSIVVIESKAKKQMMAVINKLMWLACVLISVAFLALSFIVVGKHERWLAVGVTI  474

Query  2423  VGGVIMLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMY  2602
             +G  I+ TT+G+M Y V+ HR+E  ++R+IR++         +   SD EL+   YK+MY
Sbjct  475   IGTTILATTLGTMLYWVIAHRIEAKKLRSIRRSSLSRSRSFSASCMSDGELFGNEYKKMY  534

Query  2603  AV  2608
             A+
Sbjct  535   AI  536



>ref|XP_002284522.2| PREDICTED: ankyrin repeat-containing protein At5g02620 [Vitis 
vinifera]
 ref|XP_010651073.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Vitis 
vinifera]
 ref|XP_010651074.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Vitis 
vinifera]
 emb|CBI16206.3| unnamed protein product [Vitis vinifera]
Length=542

 Score =   525 bits (1351),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 317/529 (60%), Positives = 403/529 (76%), Gaps = 7/529 (1%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D PLH AARAG L  V   L     + + + LSKQNQ GETALYVAAE
Sbjct  15    KKMTKQLTGKRDDTPLHSAARAGQLEVVARTLSSAGEEELLELLSKQNQSGETALYVAAE  74

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  VV E+++  DL TASI + NGYDAFHIAAKQG LEVLK L+   P L +T D SN
Sbjct  75    YGYVDVVREMIQYHDLSTASIKARNGYDAFHIAAKQGDLEVLKILMEALPGLSLTEDVSN  134

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QG+++VV+LLLE  S +A IA++NGKT LH+AAR GHLEV+K+L+ K+P +
Sbjct  135   TTALHTAANQGYIEVVNLLLESGSGVAAIAKSNGKTALHSAARKGHLEVIKALLEKEPGV  194

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               R DKKGQTALHMAVKGQN+++V EL+K DPS++ + D KGNTALHIA+RKGR Q+V++
Sbjct  195   ATRIDKKGQTALHMAVKGQNLEVVEELMKADPSLVNMVDTKGNTALHIASRKGREQIVRK  254

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKP--PSAAKQLKQ  1933
             L+S +  +   VNK+GETA D AEK G P++ T+L+E G   +K   KP   S A++LKQ
Sbjct  255   LLSHDETDTKAVNKSGETAFDTAEKTGNPNIATILQEHGVQSAKAM-KPQVTSTARELKQ  313

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH+V  QL+ +RQT  +V+ IAK++ K+H  GLNNAINS TVVAVLIATVAFAAI
Sbjct  314   TVSDIKHEVHYQLEHTRQTRRRVQGIAKRLNKMHGEGLNNAINSTTVVAVLIATVAFAAI  373

Query  2114  ftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             FTVPGQYV+       GF+LGEAN+A K +FI+FF+FDS+ALFIS+AVVVVQTSVVVIE 
Sbjct  374   FTVPGQYVDDPTNIPYGFSLGEANIAPKISFIIFFIFDSIALFISLAVVVVQTSVVVIES  433

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             KAKKQM+ IINKLMW AC+ IS+AF++L +VVVG  E+WLAI  T++G  IM TT+G+MC
Sbjct  434   KAKKQMMAIINKLMWLACVLISVAFLALAFVVVGDHEKWLAIGVTIIGTTIMATTLGTMC  493

Query  2465  YCVVRHRLEESRMRNIRKAETLSRSFSMSM-VPSDSELYNESYKRMYAV  2608
             Y V+RHR+E  +MR++R+    S+S S +M V SDSE+ N  +K+MYA+
Sbjct  494   YWVIRHRIEAKKMRSVRRMSMPSKSRSWTMSVMSDSEILNNEFKKMYAI  542



>ref|XP_004294623.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Fragaria 
vesca subsp. vesca]
Length=555

 Score =   524 bits (1349),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 301/530 (57%), Positives = 394/530 (74%), Gaps = 7/530 (1%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D PLH AARAGN++ V++IL+    + +K+ L+KQN   ET LYVA+E
Sbjct  26    KKMTKQLTGKRDDTPLHSAARAGNMAVVKDILENSGEEELKELLAKQNSSAETPLYVASE  85

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  +V E+++  DL  A I + NG+DAFHIAAKQG L+VL  L++  P L MT D SN
Sbjct  86    YGYVDLVREMIQYYDLADAGIKARNGFDAFHIAAKQGDLDVLTILMDAHPELTMTVDLSN  145

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGHVDVV  LLE  S+LA IAR+NGKT LH+AAR GHLEV+K+L+ K+P I
Sbjct  146   TTALHTAANQGHVDVVKFLLEAGSSLATIARSNGKTALHSAARNGHLEVMKALLQKEPGI  205

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQTALHMAVKGQN+++V  LI  DP+++ + DNK NTALHIATRKGR ++V+ 
Sbjct  206   ATRTDKKGQTALHMAVKGQNLEVVELLINADPALINMCDNKENTALHIATRKGRTEIVKM  265

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKD-HGKPPSAAKQLKQT  1936
             L+      + T+NK+ ETALD AEK G  ++  +L+  G   +KD   +P + A++LKQT
Sbjct  266   LLKHSETEVKTINKSTETALDTAEKTGNSEIKALLQAHGIPSAKDLKPQPKNPARELKQT  325

Query  1937  VSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaif  2116
             VSDIKH+V  QL+ +RQT  +V+ IAK++ K+H  GLNNAINS TVVAVLIATV FAAIF
Sbjct  326   VSDIKHEVHHQLEHTRQTRRRVQGIAKRLHKMHTEGLNNAINSNTVVAVLIATVTFAAIF  385

Query  2117  tvPGQYVEKE---KKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQK  2287
              +PGQ+V+      +G +LGEAN+A  +AF VFF+FDS+ALFIS+AVVVVQTSVVV+E K
Sbjct  386   QIPGQWVDDPDHIPEGQSLGEANIAPNSAFKVFFIFDSIALFISLAVVVVQTSVVVVESK  445

Query  2288  AKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCY  2467
             AKKQM+ IINKLMW ACL +S+AF++L++VVVG   +WLAI  T++G VIM  T+G+M +
Sbjct  446   AKKQMMAIINKLMWLACLLLSVAFLALSFVVVGEHHKWLAIGVTIIGTVIMAATLGTMSF  505

Query  2468  CVVRHRLEESRMRNIRK---AETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
              +VR+R+E   MR IR+       SRS+S+S V S+SEL N  YK+MYA+
Sbjct  506   WIVRNRIEAKNMRTIRRNSMGSQQSRSWSLSAVMSESELLNNEYKKMYAI  555



>ref|XP_007150267.1| hypothetical protein PHAVU_005G139900g [Phaseolus vulgaris]
 gb|ESW22261.1| hypothetical protein PHAVU_005G139900g [Phaseolus vulgaris]
Length=545

 Score =   523 bits (1347),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 306/533 (57%), Positives = 397/533 (74%), Gaps = 11/533 (2%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D PLH AARAGNL  +++ +   D   + + LSKQNQ+GET LY+AAE
Sbjct  14    KKMTKQLTGKRDDTPLHFAARAGNLDVLKDAILGTDEAELHELLSKQNQDGETLLYIAAE  73

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  VV E+++  DL  A I + NG+DA HIAAKQG L+V+K L+   P L MT D SN
Sbjct  74    YGYIDVVREMIQYYDLADAGIKARNGFDALHIAAKQGDLDVMKVLMESHPELSMTVDPSN  133

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH ++V  LLE  S+LA IAR+NGKT LH+AAR GH+ VVK+++ K+P +
Sbjct  134   TTALHTAAIQGHTEIVKFLLEAGSSLATIARSNGKTALHSAARNGHVVVVKAILEKEPGV  193

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQTALHMA KGQ +++V ELIK DPS + + D+KGNTALHIATRKGR ++V+ 
Sbjct  194   ATRTDKKGQTALHMAAKGQKLEMVEELIKADPSSINMVDSKGNTALHIATRKGRSKIVKL  253

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPP-----SAAKQ  1924
             L+  +    + VN++GETALD AEK G  DV  +L E G   ++   KPP     + A++
Sbjct  254   LLEQKETITSAVNRSGETALDTAEKTGNNDVKAILLEYGVQSART-IKPPQGTTATTARE  312

Query  1925  LKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvaf  2104
             LKQTVSDIKH+V  QL+ +RQT  +V+ IAK++ K+H  GLNNAINS TVVAVLIATVAF
Sbjct  313   LKQTVSDIKHEVHHQLEHTRQTRKRVQGIAKRINKMHAEGLNNAINSTTVVAVLIATVAF  372

Query  2105  aaiftvPGQYVEKE---KKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvv  2275
             AAIFTVPGQ+V+       G +LGEAN+A + +FI+FF+FDS+ALFIS+AVVVVQTSVVV
Sbjct  373   AAIFTVPGQFVDDPHDIPPGMSLGEANIAPEVSFIIFFVFDSVALFISLAVVVVQTSVVV  432

Query  2276  IEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIG  2455
             IE KAKKQM+ +INKLMW AC+ IS+AF++L++VVVG  E+WLAI  +++G  IM TT+G
Sbjct  433   IESKAKKQMMAVINKLMWLACVLISVAFLALSFVVVGKEEKWLAIGVSIIGTTIMATTLG  492

Query  2456  SMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVP-SDSELYN-ESYKRMYAV  2608
             +MCY V+RHR+E S ++N+RK+   SRS S S+   SDSEL N E YK+MYA+
Sbjct  493   TMCYWVIRHRIEASNLKNVRKSSLHSRSKSFSVSAFSDSELLNSEYYKKMYAI  545



>ref|XP_010253368.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Nelumbo 
nucifera]
Length=535

 Score =   523 bits (1346),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 298/491 (61%), Positives = 375/491 (76%), Gaps = 3/491 (1%)
 Frame = +2

Query  1034  GERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVA  1213
             G +K  K   GKR D PLH AAR G+L  V+EIL       +K  LSKQNQ GETALY A
Sbjct  11    GPKKMTKQLTGKREDTPLHSAAREGHLDAVKEILSGTGDDELKGLLSKQNQSGETALYAA  70

Query  1214  AENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDS  1393
             AE GH  VV E++K  D+ +ASI + NGYDAFHIAAKQG LEVLK LL V P L+MT D 
Sbjct  71    AEYGHVDVVEEMIKYYDIVSASIKAKNGYDAFHIAAKQGDLEVLKVLLKVLPELLMTVDL  130

Query  1394  SNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDP  1573
             SN+T LHTAA QGHV+VV+ LLE  S+LA IAR+NGKT LH+AAR G++EVVK+L++K+P
Sbjct  131   SNTTVLHTAATQGHVEVVNFLLEERSSLATIARSNGKTALHSAARNGNVEVVKALLSKEP  190

Query  1574  SIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMV  1753
             SI  R DKKGQTALHMAVKGQ +++V EL+K  PS++ + D KGNTALHIATRK RPQ+V
Sbjct  191   SIAKRNDKKGQTALHMAVKGQKLEVVEELVKSVPSLINMVDTKGNTALHIATRKNRPQIV  250

Query  1754  QRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQ  1933
             ++L+     +   VN+ GETA+DIAEK G  ++V +L+E G   ++    PP+ A++LKQ
Sbjct  251   RKLLDYTDTDRKAVNRLGETAIDIAEKMGYSELVALLEEYGVQSARAMKLPPNPARELKQ  310

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH V  QL+ +RQT  +V+ IAK++ K+H  GLNNAINS TVVAVLIATVAFAAI
Sbjct  311   TVSDIKHGVHYQLEHTRQTRKRVQGIAKQLNKMHAEGLNNAINSTTVVAVLIATVAFAAI  370

Query  2114  ftvPGQYVEKEK---KGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             FTVPGQYV+  K    G +LGEA++A KA F++FF+FDS+ALFIS+AVVVVQTSVVVIE 
Sbjct  371   FTVPGQYVDDPKNIPPGLSLGEAHIAPKAPFMIFFIFDSVALFISLAVVVVQTSVVVIES  430

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             KAKKQM+ IINKLMW AC+ +S+AF++L ++VVG  E+WLAI   ++G  I+ TT+G+MC
Sbjct  431   KAKKQMMAIINKLMWLACVLVSVAFLALAFIVVGKNERWLAIGVAIIGTTILATTLGTMC  490

Query  2465  YCVVRHRLEES  2497
             Y +V HR+E S
Sbjct  491   YWIVMHRIEAS  501



>gb|KHN30214.1| Ankyrin repeat-containing protein [Glycine soja]
Length=540

 Score =   521 bits (1343),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 312/533 (59%), Positives = 400/533 (75%), Gaps = 11/533 (2%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D PLH AARAG L+ +++I+   D   + + L+KQNQ+GET LY+AAE
Sbjct  9     KKMTKQLTGKRDDTPLHSAARAGKLAVLKDIILETDETELHELLAKQNQDGETPLYIAAE  68

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  VV E+++  DL  A I + NG+DA HIAAKQG L+VLK L+   P L MT D SN
Sbjct  69    YGYVDVVREMIQYYDLVDAGIKARNGFDALHIAAKQGDLDVLKILMEGHPELSMTVDPSN  128

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH ++V  LLE  S+LA IAR+NGKT LH+AAR GHLEVVK+L+ K+P +
Sbjct  129   TTALHTAAIQGHTEIVKFLLEAGSSLATIARSNGKTALHSAARNGHLEVVKALLEKEPGV  188

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQTALHMAVKGQ +++V ELIK DPS++ + D+KGNTALHIATRKGR Q+V+ 
Sbjct  189   ATRTDKKGQTALHMAVKGQKIEVVEELIKADPSLINMLDSKGNTALHIATRKGRAQIVKL  248

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPP-----SAAKQ  1924
             L+  +    + VN+ GETA+D AEK G  +V  +L E G   ++   KPP     + A++
Sbjct  249   LLEQKENVTSAVNRCGETAVDTAEKTGNHEVQAILLEHGVQSART-IKPPQGTTATTARE  307

Query  1925  LKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvaf  2104
             LKQTVSDIKH+V  QL+ +RQT  +V+ IAK++ K+H  GLNNAINS TVVAVLIATVAF
Sbjct  308   LKQTVSDIKHEVHHQLEHTRQTRKRVQGIAKRINKMHAEGLNNAINSTTVVAVLIATVAF  367

Query  2105  aaiftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvv  2275
             AAIFTVPGQ+V+       G +LGEAN+A +A FI+FF+FDS+ALFIS+AVVVVQTSVVV
Sbjct  368   AAIFTVPGQFVDDPNNIPPGMSLGEANIAPQAPFIIFFVFDSIALFISLAVVVVQTSVVV  427

Query  2276  IEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIG  2455
             IE KAKKQM+ +INKLMW AC+ IS+AF++L++VVVG  E+WLAI  T++G  IM TT+G
Sbjct  428   IESKAKKQMMAVINKLMWLACVLISVAFLALSFVVVGKEEKWLAIGVTIIGTTIMATTLG  487

Query  2456  SMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVP-SDSELYN-ESYKRMYAV  2608
             +MCY V+RHR+E S +RNIRK+   S+S S S+   SDSEL N E YK+MYA+
Sbjct  488   TMCYWVIRHRIEASNLRNIRKSSLQSKSKSFSVSAFSDSELLNSEYYKKMYAI  540



>ref|XP_010920742.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010920743.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X1 [Elaeis guineensis]
Length=548

 Score =   521 bits (1343),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 303/525 (58%), Positives = 398/525 (76%), Gaps = 3/525 (1%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D PLH AARAG+L+ V+EI+   + + + + L+KQNQ GETAL+VAAE
Sbjct  25    KKMTKQLTGKRDDTPLHSAARAGDLAVVKEIISGANEEELAELLTKQNQAGETALFVAAE  84

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  VV E+++  D+ TA I + +GYDA H+AAKQG ++V+KELL   P L MT D SN
Sbjct  85    YGYVDVVNEMIQYHDVLTAGIKAKSGYDALHVAAKQGDVDVVKELLMALPELSMTVDLSN  144

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH++VV+LLLE D +LA IAR+NGKT LH+AAR GHLEVVK+LVN++  I
Sbjct  145   TTALHTAATQGHIEVVNLLLEADGSLALIARSNGKTALHSAARNGHLEVVKALVNRESGI  204

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQTALHMA KG N+D+V EL+  +P+++ L D+KGNTALH A RKGR Q+V+R
Sbjct  205   ATRTDKKGQTALHMAAKGTNLDLVEELVMCEPTLVNLVDSKGNTALHTAARKGRIQIVKR  264

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTV  1939
             L+ ++ I+I  +NK+GE+ALD AEK G  DV ++L   G   S    +PP+ A++LKQ V
Sbjct  265   LLELKEIDIKAINKSGESALDTAEKMGNSDVASILAMHG-VQSVRTIRPPNPARELKQQV  323

Query  1940  SDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaift  2119
             SDIKH+V SQL+ +RQT   V+ IAK++ KLH  GLNNAINS T+VAVLIATVAFAAIFT
Sbjct  324   SDIKHEVHSQLEHTRQTRKGVQGIAKRLNKLHAEGLNNAINSNTIVAVLIATVAFAAIFT  383

Query  2120  vPGQYVEKEK--KGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAK  2293
             VPGQYV+ E    G  LGEAN++++  FI+FF+FDS+ALFIS+AVVVVQTSVVVIE KAK
Sbjct  384   VPGQYVDSENLAPGLNLGEANISHQTPFIIFFVFDSVALFISLAVVVVQTSVVVIESKAK  443

Query  2294  KQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCV  2473
             KQM+ IINKLMW AC+ IS+AF++L+++VVG  E+WLAI  T++G +I+ TT+G+M Y V
Sbjct  444   KQMMAIINKLMWLACVLISVAFLALSFIVVGKHERWLAIGVTIIGTIILATTLGTMLYWV  503

Query  2474  VRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             + HR+E  ++RNIR++             SD EL+N  YK+MYA+
Sbjct  504   IAHRIEAKKLRNIRRSSFSRSHSFSVSGISDGELFNNEYKKMYAI  548



>ref|XP_006595004.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X1 [Glycine max]
 ref|XP_006595005.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X2 [Glycine max]
 ref|XP_006595006.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X3 [Glycine max]
Length=545

 Score =   521 bits (1342),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 312/533 (59%), Positives = 400/533 (75%), Gaps = 11/533 (2%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D PLH AARAG L+ +++I+   D   + + L+KQNQ+GET LY+AAE
Sbjct  14    KKMTKQLTGKRDDTPLHSAARAGKLAVLKDIILGTDETELHELLAKQNQDGETPLYIAAE  73

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  VV E+++  DL  A I + NG+DA HIAAKQG L+VLK L+   P L MT D SN
Sbjct  74    YGYVDVVREMIQYYDLVDAGIKARNGFDALHIAAKQGDLDVLKILMEGHPELSMTVDPSN  133

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH ++V  LLE  S+LA IAR+NGKT LH+AAR GHLEVVK+L+ K+P +
Sbjct  134   TTALHTAAIQGHTEIVKFLLEAGSSLATIARSNGKTALHSAARNGHLEVVKALLEKEPGV  193

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQTALHMAVKGQ +++V ELIK DPS++ + D+KGNTALHIATRKGR Q+V+ 
Sbjct  194   ATRTDKKGQTALHMAVKGQKIEVVEELIKADPSLINMLDSKGNTALHIATRKGRAQIVKL  253

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPP-----SAAKQ  1924
             L+  +    + VN+ GETA+D AEK G  +V  +L E G   ++   KPP     + A++
Sbjct  254   LLEQKENVTSAVNRCGETAVDTAEKTGNHEVQAILLEHGVQSART-IKPPQGTTATTARE  312

Query  1925  LKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvaf  2104
             LKQTVSDIKH+V  QL+ +RQT  +V+ IAK++ K+H  GLNNAINS TVVAVLIATVAF
Sbjct  313   LKQTVSDIKHEVHHQLEHTRQTRKRVQGIAKRINKMHAEGLNNAINSTTVVAVLIATVAF  372

Query  2105  aaiftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvv  2275
             AAIFTVPGQ+V+       G +LGEAN+A +A FI+FF+FDS+ALFIS+AVVVVQTSVVV
Sbjct  373   AAIFTVPGQFVDDPNNIPPGMSLGEANIAPQAPFIIFFVFDSIALFISLAVVVVQTSVVV  432

Query  2276  IEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIG  2455
             IE KAKKQM+ +INKLMW AC+ IS+AF++L++VVVG  E+WLAI  T++G  IM TT+G
Sbjct  433   IESKAKKQMMAVINKLMWLACVLISVAFLALSFVVVGKEEKWLAIGVTIIGTTIMATTLG  492

Query  2456  SMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVP-SDSELYN-ESYKRMYAV  2608
             +MCY V+RHR+E S +RNIRK+   S+S S S+   SDSEL N E YK+MYA+
Sbjct  493   TMCYWVIRHRIEASNLRNIRKSSLQSKSKSFSVSAFSDSELLNSEYYKKMYAI  545



>ref|XP_010653499.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Vitis 
vinifera]
 emb|CBI32659.3| unnamed protein product [Vitis vinifera]
Length=541

 Score =   520 bits (1338),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 310/542 (57%), Positives = 397/542 (73%), Gaps = 11/542 (2%)
 Frame = +2

Query  1007  AMERQLSFGGERKR-GKDSPGKRGDNPLHLAARAGNLSKVREILQRF-DSKAIKDTLSKQ  1180
             A  RQ SF   RK   K   GKR D  LH AARAGNL    +IL +  D++A+K+ LSKQ
Sbjct  3     APARQQSF--RRKNITKQLTGKRDDTSLHSAARAGNLELALDILSKCEDAEALKELLSKQ  60

Query  1181  NQEGETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLN  1360
             NQ GETALYVAAE GH  +V E+++  D+ +A I + NGYDAFHIAAKQG LEVLK L+ 
Sbjct  61    NQSGETALYVAAEYGHCDLVKEMMEYYDVSSAGIQARNGYDAFHIAAKQGDLEVLKVLME  120

Query  1361  VFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHL  1540
               P   MT D SN+TALHTAA QGH+ VV  LLE  S+LA IA++NGKT LH+AAR GHL
Sbjct  121   AIPETSMTVDLSNTTALHTAAAQGHISVVSFLLEKGSSLANIAKSNGKTALHSAARKGHL  180

Query  1541  EVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALH  1720
             +VVK+L++K+P I  RTDKKGQTALHMAVKGQN+++V EL+K DPS++ + D K NT LH
Sbjct  181   KVVKALLSKEPGISTRTDKKGQTALHMAVKGQNIEVVDELMKSDPSLINMVDAKDNTTLH  240

Query  1721  IATRKGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHG  1900
             +A RK R Q+VQ+L+S +  +   +NK+GETALD AEK G  ++ T+L+E G   +K   
Sbjct  241   VAVRKCRAQIVQQLLSHKATDTEAINKSGETALDTAEKTGHAEITTILQEHGVKSAKS-I  299

Query  1901  KPPS--AAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltv  2074
              PP+   A++LKQTVSDIKH+V  QL+ +RQT  +V+ IAK++ K+H  GLNNAINS TV
Sbjct  300   MPPTKNKARELKQTVSDIKHEVHHQLEHTRQTRKRVQGIAKRINKMHSEGLNNAINSTTV  359

Query  2075  vavliatvafaaiftvPGQYV---EKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIA  2245
             VAVLIATVAFAAIF VPGQY    E    G + GEAN+A +  F++FF+FDSLALFIS+A
Sbjct  360   VAVLIATVAFAAIFNVPGQYADDPEHVPPGLSPGEANIAPRTPFMLFFIFDSLALFISLA  419

Query  2246  vvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVV  2425
             VVVVQTS+VVIE+KAKK+M+ IINKLMW AC+ +S+AF+SL+Y+VVGT+E+WLA+  T +
Sbjct  420   VVVVQTSIVVIERKAKKKMMAIINKLMWLACVLVSVAFLSLSYIVVGTKERWLAVGVTGI  479

Query  2426  GGVIMLTTIGSMCYCVVRHRLEESR-MRNIRKAETLSRSFSMSMVPSDSELYNESYKRMY  2602
             G VIM TT+G+MCY V+ HR+E  +     R   +     S   V SDSE+ N  YK++Y
Sbjct  480   GTVIMATTLGTMCYWVIVHRIEAKKSRSIRRSTMSSRSRSSPMSVMSDSEILNNEYKKLY  539

Query  2603  AV  2608
             A+
Sbjct  540   AI  541



>ref|XP_006597296.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Glycine 
max]
Length=545

 Score =   519 bits (1336),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 311/533 (58%), Positives = 398/533 (75%), Gaps = 11/533 (2%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D PLH AARAGNL+ +++ +   D   + + L+KQNQ+GET LY+AAE
Sbjct  14    KKMTKQLTGKRDDTPLHSAARAGNLAVLKDTILETDEAELHELLAKQNQDGETPLYIAAE  73

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  VV E+++  DL  A I + NG+DA HIAAKQG L+VLK L+   P L MT D SN
Sbjct  74    YGYVDVVREMIQYYDLADAGIKARNGFDALHIAAKQGDLDVLKILMEGHPELSMTVDPSN  133

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH ++V  LLE  S+LA IAR+NGKT LH+AAR GHL VVK+L+ K+P +
Sbjct  134   TTALHTAAIQGHTEIVKFLLEAGSSLATIARSNGKTALHSAARNGHLVVVKALLEKEPGV  193

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQTALHMAVKGQN+++V ELIK DPS + + D+KGNTALHIATRKGR Q+V+ 
Sbjct  194   ATRTDKKGQTALHMAVKGQNIEVVEELIKADPSSINMVDSKGNTALHIATRKGRAQIVKL  253

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPP-----SAAKQ  1924
             L+  +    + VN+ GETA+D AEK G   V  +L E G   ++   KPP     + A++
Sbjct  254   LLEQKENVTSAVNRCGETAVDTAEKTGNHAVQAILLEHGVESART-IKPPQGTTATTARE  312

Query  1925  LKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvaf  2104
             LKQTVSDIKH+V  QL+ +RQT  +V+ IAK++ K+H  GLNNAINS TVVAVLIATVAF
Sbjct  313   LKQTVSDIKHEVHHQLEHTRQTRKRVQGIAKRINKMHAEGLNNAINSTTVVAVLIATVAF  372

Query  2105  aaiftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvv  2275
             AAIFTVPGQ+V+       G +LGEAN+A +A FI+FF+FDS+ALFIS+AVVVVQTSVVV
Sbjct  373   AAIFTVPGQFVDDPNNIPAGMSLGEANIAPQATFIIFFVFDSIALFISLAVVVVQTSVVV  432

Query  2276  IEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIG  2455
             IE KAKKQM+ +INKLMW AC+ IS+AF++L++VVVG  E+WLAI  T++G  IM TT+G
Sbjct  433   IESKAKKQMMAVINKLMWLACVLISVAFLALSFVVVGKEEKWLAIGVTIIGTTIMATTLG  492

Query  2456  SMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVP-SDSELYN-ESYKRMYAV  2608
             +MCY V+RHR+E S +R+IRK+   S+S S S+   SDSEL N E YK+MYA+
Sbjct  493   TMCYWVIRHRIETSNLRSIRKSSLQSKSKSFSVSAFSDSELLNSEYYKKMYAI  545



>ref|XP_011022863.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Populus 
euphratica]
 ref|XP_011022864.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Populus 
euphratica]
Length=544

 Score =   518 bits (1333),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 303/545 (56%), Positives = 399/545 (73%), Gaps = 13/545 (2%)
 Frame = +2

Query  1010  MERQLSFGGE-----RKR-GKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTL  1171
             M+   S GG+     RKR  K   GKR D PLH AARAGNL  V EIL     + +K+ L
Sbjct  1     MDPMESPGGQPSPVSRKRMTKQLTGKRDDTPLHSAARAGNLGAVMEILTGTGEEELKELL  60

Query  1172  SKQNQEGETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKE  1351
              +QNQ GETALYVAAE G+  VV E++K  DL  A I + NG+DAFH+AAKQG +E+L+ 
Sbjct  61    ERQNQSGETALYVAAEYGYVDVVTEMIKYYDLANAGIKARNGFDAFHVAAKQGDIEILRV  120

Query  1352  LLNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARM  1531
             L+   P L MT D SN+TALHTAA QGH+++V+ LL+  S+L+ I ++NGKT LH+AAR 
Sbjct  121   LMEAHPELSMTVDLSNTTALHTAATQGHIEIVNFLLDAGSSLSTIDKSNGKTALHSAARN  180

Query  1532  GHLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNT  1711
             GH+EVV++L+  +P I  R DKKGQTALHMAVKGQN+++V ELI  D S +   D KGNT
Sbjct  181   GHVEVVRALLTMEPGIATRIDKKGQTALHMAVKGQNIEVVEELIVADSSAVNRIDTKGNT  240

Query  1712  ALHIATRKGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSK  1891
              LHIATRKGR Q+V+ L+     ++  VN+  ETALD AEK G P++  +L+E G   +K
Sbjct  241   PLHIATRKGRAQIVKLLLRHSRTDVKAVNRTTETALDTAEKTGHPEIAVILQEHGVQSAK  300

Query  1892  D-HGKPPSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSl  2068
                    +  ++LKQTVSD+KH+V  QL+ +RQT  +V+ IAK++ K+H+ GLNNAINS 
Sbjct  301   TIQPLEINPERELKQTVSDVKHEVHHQLEHTRQTRKRVKGIAKRLNKMHVEGLNNAINST  360

Query  2069  tvvavliatvafaaiftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFIS  2239
             TVVAVLIA+VAFAAI+TVPG+Y +   +   G +LGEAN+A K  FI+FF+FDS ALFIS
Sbjct  361   TVVAVLIASVAFAAIYTVPGEYADDPDEIPPGQSLGEANIAPKVPFIIFFIFDSTALFIS  420

Query  2240  IAvvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYST  2419
             +AVVVVQTSVV IE KAKK+M+ +INKLMW AC  +S+AF++L++VVVG RE+WLAI  T
Sbjct  421   LAVVVVQTSVVAIESKAKKKMMAVINKLMWIACTLVSVAFLALSFVVVGEREKWLAIGVT  480

Query  2420  VVGGVIMLTTIGSMCYCVVRHRLEESRMRNIRKAE--TLSRSFSMSMVPSDSELYNESYK  2593
             +VG  IM TT G+MCY V++HR+E S M+NIR++   ++SRSFS+S+V SD+E+ N  YK
Sbjct  481   IVGASIMATTFGTMCYWVIKHRIEASNMKNIRRSTLGSMSRSFSVSLV-SDTEIINSDYK  539

Query  2594  RMYAV  2608
             +MYA+
Sbjct  540   KMYAI  544



>ref|XP_004505914.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X1 [Cicer arietinum]
 ref|XP_004505915.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X2 [Cicer arietinum]
Length=548

 Score =   517 bits (1331),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 300/529 (57%), Positives = 388/529 (73%), Gaps = 6/529 (1%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D PLH AARAGN++ +++ +   +   + +  +KQNQ GETALYVAAE
Sbjct  20    KKMTKQLTGKRDDTPLHSAARAGNMASLKDTVAGAEEGKLHELFAKQNQGGETALYVAAE  79

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+   V E+++  DL  A I + NG+DA HIAAKQG L++LK L+   P L MT D SN
Sbjct  80    YGYVDFVREMIQYYDLSDAGIKARNGFDALHIAAKQGDLDILKILMEAHPELSMTVDPSN  139

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH ++V  LLE  S+LA IAR+NGKT LH+AAR GHL+VVK+++ K+P +
Sbjct  140   TTALHTAATQGHTEIVKFLLEAGSSLATIARSNGKTALHSAARNGHLDVVKAILEKEPGV  199

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQTALHMAVKGQN+++V ELIK DPS + + DNKGNTALHIATRKGR Q+++ 
Sbjct  200   VTRTDKKGQTALHMAVKGQNLEVVEELIKADPSSINMVDNKGNTALHIATRKGRIQIIKL  259

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPP--SAAKQLKQ  1933
             L+     N   +NK+GETALD AEK G   V  +L E G    K     P  + A++LKQ
Sbjct  260   LLGQNETNGMAINKSGETALDTAEKTGNSQVKEILIEHGIQIGKSIKSQPTTTTARELKQ  319

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH+V  QL+ +RQT   V+ IAK++ K+H  GLNNAINS  VVAVLIATVAFAAI
Sbjct  320   TVSDIKHEVHHQLEHTRQTRKSVQGIAKRLNKMHTEGLNNAINSTIVVAVLIATVAFAAI  379

Query  2114  ftvPGQYVEKEK---KGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             FTVPGQ+V+  K    G +LGEAN+A KAAF++FF+FDS+ALFIS+AVVVVQTS+VVIE 
Sbjct  380   FTVPGQFVDDPKHIPAGKSLGEANIAPKAAFLIFFVFDSVALFISLAVVVVQTSIVVIES  439

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             KAKKQM+ IINKLMW AC+ IS++F++L+++VVG  E+WLAI  T++G +IM TT+G+MC
Sbjct  440   KAKKQMMAIINKLMWLACVLISVSFLALSFLVVGKDERWLAISVTIIGTIIMATTLGTMC  499

Query  2465  YCVVRHRLEESRMRNIRKAET-LSRSFSMSMVPSDSELYNESYKRMYAV  2608
             Y V+RHR+E S +R+IRK+            V SDSE+ N   ++MYA+
Sbjct  500   YWVIRHRIEASNLRSIRKSSLGSRSRSFSVSVMSDSEILNNDRRKMYAI  548



>ref|XP_004505916.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X3 [Cicer arietinum]
Length=541

 Score =   516 bits (1329),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 300/529 (57%), Positives = 388/529 (73%), Gaps = 6/529 (1%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D PLH AARAGN++ +++ +   +   + +  +KQNQ GETALYVAAE
Sbjct  13    KKMTKQLTGKRDDTPLHSAARAGNMASLKDTVAGAEEGKLHELFAKQNQGGETALYVAAE  72

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+   V E+++  DL  A I + NG+DA HIAAKQG L++LK L+   P L MT D SN
Sbjct  73    YGYVDFVREMIQYYDLSDAGIKARNGFDALHIAAKQGDLDILKILMEAHPELSMTVDPSN  132

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH ++V  LLE  S+LA IAR+NGKT LH+AAR GHL+VVK+++ K+P +
Sbjct  133   TTALHTAATQGHTEIVKFLLEAGSSLATIARSNGKTALHSAARNGHLDVVKAILEKEPGV  192

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQTALHMAVKGQN+++V ELIK DPS + + DNKGNTALHIATRKGR Q+++ 
Sbjct  193   VTRTDKKGQTALHMAVKGQNLEVVEELIKADPSSINMVDNKGNTALHIATRKGRIQIIKL  252

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPP--SAAKQLKQ  1933
             L+     N   +NK+GETALD AEK G   V  +L E G    K     P  + A++LKQ
Sbjct  253   LLGQNETNGMAINKSGETALDTAEKTGNSQVKEILIEHGIQIGKSIKSQPTTTTARELKQ  312

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH+V  QL+ +RQT   V+ IAK++ K+H  GLNNAINS  VVAVLIATVAFAAI
Sbjct  313   TVSDIKHEVHHQLEHTRQTRKSVQGIAKRLNKMHTEGLNNAINSTIVVAVLIATVAFAAI  372

Query  2114  ftvPGQYVEKEK---KGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             FTVPGQ+V+  K    G +LGEAN+A KAAF++FF+FDS+ALFIS+AVVVVQTS+VVIE 
Sbjct  373   FTVPGQFVDDPKHIPAGKSLGEANIAPKAAFLIFFVFDSVALFISLAVVVVQTSIVVIES  432

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             KAKKQM+ IINKLMW AC+ IS++F++L+++VVG  E+WLAI  T++G +IM TT+G+MC
Sbjct  433   KAKKQMMAIINKLMWLACVLISVSFLALSFLVVGKDERWLAISVTIIGTIIMATTLGTMC  492

Query  2465  YCVVRHRLEESRMRNIRKAET-LSRSFSMSMVPSDSELYNESYKRMYAV  2608
             Y V+RHR+E S +R+IRK+            V SDSE+ N   ++MYA+
Sbjct  493   YWVIRHRIEASNLRSIRKSSLGSRSRSFSVSVMSDSEILNNDRRKMYAI  541



>ref|XP_010260012.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Nelumbo 
nucifera]
 ref|XP_010260013.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Nelumbo 
nucifera]
Length=534

 Score =   513 bits (1320),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 302/529 (57%), Positives = 397/529 (75%), Gaps = 12/529 (2%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D PLH AAR G L   +EIL     + +K+ L KQNQ GETALYVAAE
Sbjct  12    KKMTKQLTGKRNDTPLHTAARGGRLEVAKEILSGAKDEELKELLIKQNQSGETALYVAAE  71

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G   VV EI+K  D+ +ASI + NGYDAFHIAA+QG LEVLK LL   P L MT D SN
Sbjct  72    YGFVDVVEEIIKYYDIVSASIKAKNGYDAFHIAARQGDLEVLKVLLKALPELSMTVDLSN  131

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH+DVV+ LLE  S+LA IAR+NGKT LH+AAR GHLEVVK++++K+P +
Sbjct  132   TTALHTAAAQGHIDVVNFLLEQGSSLATIARSNGKTALHSAARNGHLEVVKAILSKEPFV  191

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               R DKKGQTALHMAVKGQ +++V  LI  + S++ + D KGNTALH ATRKGR ++V++
Sbjct  192   VTRNDKKGQTALHMAVKGQKLEVVEVLINSNTSLINMVDTKGNTALHTATRKGRDKIVKK  251

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSA--AKQLKQ  1933
             L+  +GI+   +N++GETALDIAE     ++VT+LKE G   +K   KP +   A++LKQ
Sbjct  252   LLDHKGIDTKVINRSGETALDIAEMIANSELVTLLKEYGVLSAKAI-KPETTNPARELKQ  310

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSD+KH+V  QL+ +RQT  +V+ IA+++ K+H  GLNNAINS TVVAVLIATVAFAAI
Sbjct  311   TVSDLKHEVHDQLEHTRQTRKRVQGIARRLNKMHEDGLNNAINSTTVVAVLIATVAFAAI  370

Query  2114  ftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             FTVPGQYV+  +    G +LGEAN++ +  F++FFLFDS+ALFIS+AVVVVQTSVVVIE 
Sbjct  371   FTVPGQYVDDPENIPPGLSLGEANISQRTPFVIFFLFDSVALFISLAVVVVQTSVVVIES  430

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             KAKKQM+ IINKLMW AC+ +S+AF++LT++VVG  E+WLAI  T++G  I+ TT+G+M 
Sbjct  431   KAKKQMMAIINKLMWLACVLVSVAFLALTFIVVGEHERWLAIGVTIIGTTILATTLGTMS  490

Query  2465  YCVVRHRLEESRMRNIRKAET-LSRSFSMSMVPSDSELYNESYKRMYAV  2608
             + VV HR++ S  R+IR++    S+S+SMS++   SE  +++  +MYA+
Sbjct  491   FWVVMHRIKASNQRSIRRSSLGRSQSWSMSLL---SETDHDT--KMYAI  534



>ref|XP_009354547.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Pyrus 
x bretschneideri]
 ref|XP_009354548.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Pyrus 
x bretschneideri]
 ref|XP_009354549.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Pyrus 
x bretschneideri]
 ref|XP_009354550.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Pyrus 
x bretschneideri]
Length=549

 Score =   513 bits (1320),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 304/530 (57%), Positives = 398/530 (75%), Gaps = 9/530 (2%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D PLH   R+GN++ V +IL+  +  A+K+ L+KQN   ETALYVAAE
Sbjct  22    KKMTKQLTGKRDDTPLHSGVRSGNMAVVMDILENTEEGALKELLTKQNSSDETALYVAAE  81

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  +V E++K  DL  A I + NG+DAFHIAAKQG ++VL  L+   P L MT D SN
Sbjct  82    YGYVDLVREMIKCYDLSDAGIKARNGFDAFHIAAKQGDMDVLNVLMEAHPELTMTVDLSN  141

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH++VV  LLE  S+LA IA++NGKT LH+AAR GHLEV+K+L++K+P I
Sbjct  142   TTALHTAAAQGHIEVVSFLLEAGSSLATIAKSNGKTALHSAARNGHLEVLKALLDKEPGI  201

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               R DKKGQTALHMA KGQN+++V +LI  DPS++ + DNK NTALHIATRKGR ++V+ 
Sbjct  202   ATRVDKKGQTALHMAAKGQNLEVVEQLINADPSLINMADNKDNTALHIATRKGRGEIVKI  261

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPS--AAKQLKQ  1933
             L+     N   VNK+ ETALD AEK G  D+   L+E G   +K+  KP +   A++LKQ
Sbjct  262   LLEHSETNTKAVNKSAETALDTAEKTGNSDIKAFLQERGVQSAKE-IKPQARNPARELKQ  320

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH+V  QL+ +RQT  +V+ IAK++ K+H  GLNNAINS TVVAVLIATV FAAI
Sbjct  321   TVSDIKHEVHHQLEHTRQTRRRVQGIAKRLHKMHSEGLNNAINSNTVVAVLIATVTFAAI  380

Query  2114  ftvPGQYVEKEK---KGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             F +PGQYV+  +   KG +LGEAN+A K AFI+FF+FDS+ALFIS+AVVVVQTSVVVIE 
Sbjct  381   FQIPGQYVDDPEDIPKGQSLGEANIAPKLAFIIFFIFDSIALFISLAVVVVQTSVVVIES  440

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             KAKKQM+ I+NKLMW AC+ +S+AF++L++VVVG  ++WLAI  T++G VIM  T+G+MC
Sbjct  441   KAKKQMMAIMNKLMWLACVLVSVAFLALSFVVVG-EQKWLAIGVTIIGTVIMAATLGTMC  499

Query  2465  YCVVRHRLEESRMRNIRKA--ETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             + VVRHR+E   MR+I++   ++ SRS+S+S V S+SEL N  YK+MYA+
Sbjct  500   FWVVRHRIEAKNMRSIQRTSLDSRSRSWSLSAVMSESELLNNDYKKMYAI  549



>ref|XP_007016551.1| Ankyrin repeat family protein isoform 1 [Theobroma cacao]
 ref|XP_007016552.1| Ankyrin repeat family protein isoform 1 [Theobroma cacao]
 gb|EOY34170.1| Ankyrin repeat family protein isoform 1 [Theobroma cacao]
 gb|EOY34171.1| Ankyrin repeat family protein isoform 1 [Theobroma cacao]
Length=544

 Score =   512 bits (1318),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 321/538 (60%), Positives = 406/538 (75%), Gaps = 9/538 (2%)
 Frame = +2

Query  1019  QLSFGGERKR-GKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGE  1195
             Q S    RK+  K   GKR D PLH AARAGNL+ V EIL       +K+ L KQNQ GE
Sbjct  8     QPSVPARRKKMTKQLTGKREDTPLHSAARAGNLAVVTEILTGTPEDELKELLPKQNQSGE  67

Query  1196  TALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNL  1375
             TALYVAAE G+  +V E++   DL  A I + NG+DAFHIAAKQG L++L  LL V P L
Sbjct  68    TALYVAAEYGYVDLVKEMINYYDLADAGIKARNGFDAFHIAAKQGDLDILAVLLAVHPEL  127

Query  1376  VMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKS  1555
              MT D SN+TALHTAA QGH+ +V+ LLE  S+LA IAR+NGKT LH+AAR GH+EVVK+
Sbjct  128   AMTVDLSNTTALHTAATQGHIGIVNFLLEAGSSLATIARSNGKTALHSAARNGHVEVVKA  187

Query  1556  LVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSV-LALGDNKGNTALHIATR  1732
             L+  +P I  RTDKKGQTALHMAVKGQNV++V ELI+ DPS+ + + D KGNT+LHIATR
Sbjct  188   LLASEPGIASRTDKKGQTALHMAVKGQNVEVVEELIRVDPSLTINMVDTKGNTSLHIATR  247

Query  1733  KGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKP--  1906
             KGR Q+V+ L+  +  +   VN++GETA+D AEK G P++ T+L++ G   ++   KP  
Sbjct  248   KGRAQIVKLLLGYKETDTKAVNRSGETAIDTAEKTGHPEIATILQQHGVQSARTI-KPAA  306

Query  1907  PSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavl  2086
             P+ A++LKQTVSDIKH+V  QL+ +RQT  +V+ IAK++ K+H  GLNNAINS TVVAVL
Sbjct  307   PNPARELKQTVSDIKHEVHYQLEHTRQTRKRVQGIAKRLNKMHAEGLNNAINSTTVVAVL  366

Query  2087  iatvafaaiftvPGQYVEKE---KKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvv  2257
             IATVAFAAIFTVPGQYV+       G +LGEAN+A   AFI+FF+FDS+ALFIS+AVVVV
Sbjct  367   IATVAFAAIFTVPGQYVDDPNDIPPGHSLGEANIAPNPAFIIFFIFDSIALFISLAVVVV  426

Query  2258  qtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVI  2437
             QTSVVVIE KAKKQM+ IINKLMW AC+ IS+AF++L++VVVGT E+WLAI  T++G  I
Sbjct  427   QTSVVVIESKAKKQMMAIINKLMWLACVLISVAFLALSFVVVGTEERWLAIGVTIIGTSI  486

Query  2438  MLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSM-VPSDSELYNESYKRMYAV  2608
             M TT+G+MCY V+RHR+E S MR+IR++   SRS S S+ V SDSE+ N  +K+MYA+
Sbjct  487   MATTLGTMCYWVIRHRIEASNMRSIRRSSLGSRSRSWSLSVMSDSEILNNEFKKMYAI  544



>ref|XP_010043606.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Eucalyptus 
grandis]
Length=542

 Score =   511 bits (1315),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 307/530 (58%), Positives = 395/530 (75%), Gaps = 7/530 (1%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSK--QNQEGETALYVA  1213
             +K  K   GKR D  LH AARAG+L+ + EI+ +      +       QNQ GETALYVA
Sbjct  13    KKMTKQLTGKRDDTALHSAARAGHLAVIMEIISKAAEAEAELKELLEKQNQAGETALYVA  72

Query  1214  AENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDS  1393
             AE G+  VV E++K  DL  A I + NG+DA HIAAKQG LE+LK LL V P L MT D+
Sbjct  73    AEYGYVDVVREMIKHYDLADAGIKARNGFDALHIAAKQGDLEILKVLLEVHPELAMTVDT  132

Query  1394  SNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDP  1573
             SN+TALHTAA QGH+D+V++LLE  S LA IA++NGKT LH+AAR GHLEVVK L++++P
Sbjct  133   SNTTALHTAATQGHIDLVNVLLEAGSGLATIAKSNGKTALHSAARNGHLEVVKLLLDREP  192

Query  1574  SIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMV  1753
             SI  R DKKGQTALHMAVKGQ+V++V ELI+ DPS + + D KGNT+LHIA+RKGR Q+V
Sbjct  193   SIVTRVDKKGQTALHMAVKGQSVEVVDELIRADPSSINMVDTKGNTSLHIASRKGRDQIV  252

Query  1754  QRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKD-HGKPPSAAKQLK  1930
             + L+S    N   +N++GETALD AEK G  +V  +L+E G   +K    +  +AA++LK
Sbjct  253   RLLLSCSETNTELINRSGETALDTAEKMGHSNVAMILQECGVQSAKAIQPQATTAARELK  312

Query  1931  QTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaa  2110
             QTVSDIKH+V  QL+ +RQT  +V+ IAK++ K+H  GLNNAINS TVVAVLIATVAFAA
Sbjct  313   QTVSDIKHEVHYQLEHTRQTRKRVQGIAKRLNKMHGEGLNNAINSTTVVAVLIATVAFAA  372

Query  2111  iftvPGQYVEKE---KKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIE  2281
             IFTVPGQYV+       G +LGEAN+A +  F++FF+FDS+ALFIS+AVVVVQTSVVVIE
Sbjct  373   IFTVPGQYVDDPTDIPPGQSLGEANIAPQVPFVIFFIFDSVALFISLAVVVVQTSVVVIE  432

Query  2282  QKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSM  2461
              KAKKQM+ IINKLMW AC+ +S+A+++L++VVVG +E+WLAI  T++G  IM TT+G+M
Sbjct  433   SKAKKQMMAIINKLMWLACVLVSVAYLALSFVVVGQKERWLAIGVTIIGTTIMATTLGTM  492

Query  2462  CYCVVRHRLEESRMRNIRKAETLSRSFSMSMVP-SDSELYNESYKRMYAV  2608
              Y V+ HR+E S MRNIR++   SRS S S+   SDSE+    YK+MYA+
Sbjct  493   IYWVIMHRIEASNMRNIRRSSLGSRSRSWSVSAMSDSEILTNEYKKMYAI  542



>dbj|BAK03736.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=554

 Score =   511 bits (1316),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 295/530 (56%), Positives = 386/530 (73%), Gaps = 10/530 (2%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D  LH AARAG L  V+E L     + ++  LSKQNQ GET L+VAAE
Sbjct  28    KKMTKQLTGKRDDTALHGAARAGLLVAVQETLSGAAPEELRALLSKQNQAGETPLFVAAE  87

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  +V E++K  D+ TA I + +GYDA HIAAKQG +EV+KELL   P L MT D+SN
Sbjct  88    YGYVALVNEMVKYHDVATAGIKARSGYDALHIAAKQGDVEVVKELLQALPELAMTVDASN  147

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TAL+TAA QGH++VV LLLE+D  L  IAR+NGKT LH+AAR GH+EVV++L+  +PSI
Sbjct  148   TTALNTAATQGHMEVVRLLLEVDGTLTLIARSNGKTALHSAARNGHVEVVRALLRAEPSI  207

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               R DKKGQTALHMA KG N+D+V  L+  DPS+L L DNKGNTALHIA+RK R Q+++R
Sbjct  208   ALRVDKKGQTALHMAAKGINLDLVDALLAADPSLLNLPDNKGNTALHIASRKARHQIIKR  267

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSK-----DHGKPPSAAKQ  1924
             L+ +   N+  +N+A ET LD AEK G  +V  +L E G   ++       G P   A++
Sbjct  268   LLELPDTNLKAINRAAETPLDTAEKMGNGEVAGVLAENGVQSARALSPTGGGNP---ARE  324

Query  1925  LKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvaf  2104
             LKQ VSDIKH+V SQL+Q+RQT  +++ I K++ KLH  GLNNAINS TVVAVLIATVAF
Sbjct  325   LKQQVSDIKHEVHSQLEQTRQTRVRMQGIQKRINKLHEEGLNNAINSTTVVAVLIATVAF  384

Query  2105  aaiftvPGQYVEKEK--KGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvI  2278
             AAIFTVPG+YV+ +    G  LGEAN+A++  FI+FF+FDS+ALFIS+AVVVVQTSVVVI
Sbjct  385   AAIFTVPGEYVDADSLAPGQELGEANIAHETPFIIFFVFDSVALFISLAVVVVQTSVVVI  444

Query  2279  EQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGS  2458
             E+KAKKQM+ +INKLMW AC+ IS+AF++L++VVVG  E+WLA+  T++G  I++TTIG+
Sbjct  445   ERKAKKQMMAVINKLMWVACVLISVAFLALSFVVVGRTERWLAVAVTIMGATILVTTIGT  504

Query  2459  MCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             M Y V+ HR+E  RMRNI+++             S+ E  +E +K+MYA+
Sbjct  505   MLYWVIAHRIEAKRMRNIKRSSMSRSRSHSGSGLSEHEWVDEEFKKMYAI  554



>ref|XP_011089841.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Sesamum 
indicum]
Length=543

 Score =   510 bits (1313),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 298/536 (56%), Positives = 392/536 (73%), Gaps = 7/536 (1%)
 Frame = +2

Query  1019  QLSFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQ-RFDSKAIKDTLSKQNQEGE  1195
             Q      +K  K   GKR D PLH AARAGN+  VR+I+      + +++ LSKQN  GE
Sbjct  9     QPPTAARKKMTKQLTGKREDTPLHSAARAGNVVAVRDIINGAAGEEELRELLSKQNSAGE  68

Query  1196  TALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNL  1375
             TALYVAAE G+  +V E++K  DL  A I + NG+DA HIAAKQG LEV+K L+   P L
Sbjct  69    TALYVAAEYGYFELVMEMIKHYDLVDAGIKARNGFDALHIAAKQGDLEVVKVLMEAHPEL  128

Query  1376  VMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKS  1555
              MT D++N+TALHTAA QGH+++V+  LE +S+LA IAR+NGKT LH++AR GH++VVK+
Sbjct  129   SMTVDTTNATALHTAATQGHIEIVNFFLESESSLATIARSNGKTALHSSARNGHVQVVKA  188

Query  1556  LVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRK  1735
             LV+KDP I  RTDKKGQTALHMAVKGQN+++V ELI+ DPS + + D +GNT LHIATRK
Sbjct  189   LVDKDPGITTRTDKKGQTALHMAVKGQNLEVVEELIRADPSTINMVDTRGNTVLHIATRK  248

Query  1736  GRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSA  1915
             GR Q+V+ L+S    +   VN++ ETA D AEK G  D+  +L+E G   ++   KP S 
Sbjct  249   GRAQIVKMLLSHNETDTKVVNRSNETAFDTAEKMGHLDITAILQEKGVLSARV-IKPQST  307

Query  1916  --AKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavli  2089
               A++LKQTVSDIKH+V +QL+ +RQT   V+ IAK++ K+H  GLNNAINS TVVAVLI
Sbjct  308   NPARELKQTVSDIKHEVHNQLEHTRQTRKHVQGIAKRLNKMHTEGLNNAINSTTVVAVLI  367

Query  2090  atvafaaiftvPGQYVEKE--KKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqt  2263
             ATVAFAAIFTVPG YV +     G +LGEAN++ +  F++FF+FDS+ALFIS+AVVVVQT
Sbjct  368   ATVAFAAIFTVPGDYVNRRHIPPGLSLGEANISPQLPFLIFFVFDSVALFISLAVVVVQT  427

Query  2264  svvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIML  2443
             SVVVIE KAKKQM+ IINKLMW AC+ +S+A+++L+++VVG  E+WLAI  TV+G  I++
Sbjct  428   SVVVIESKAKKQMMAIINKLMWLACVLVSVAYLALSFIVVGKHERWLAIGVTVIGTSILV  487

Query  2444  TTIGSMCYCVVRHRLEESRMRNIRK-AETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             TT+G+MCY V+ HR+E    R+IRK +           V SDSE+ N  +K+MYA+
Sbjct  488   TTLGTMCYWVIMHRIETKNKRSIRKNSPGSRSRSWSVSVLSDSEVLNNDFKKMYAI  543



>ref|XP_006350741.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Solanum 
tuberosum]
Length=535

 Score =   509 bits (1311),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 295/529 (56%), Positives = 389/529 (74%), Gaps = 7/529 (1%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             ++  K   GKR D+ LH  ARAGNL ++R I+     K + + L KQN  GET+LYVAAE
Sbjct  8     KRMKKQLTGKREDSVLHRLARAGNLVEIRGIIDNTGEKELTELLVKQNSAGETSLYVAAE  67

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  +V E++K  DL  A I + NG+DA HIAAKQG L+V+K L+ V P L MT D +N
Sbjct  68    YGYCDLVKEMIKYYDLAAAGIKARNGFDALHIAAKQGDLDVVKVLMMVHPELSMTVDVAN  127

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALH+AA QGH+ +V+ LLE +S+LA IA++NGKT LH+A+R GH+EVVK+L+ K+P +
Sbjct  128   TTALHSAANQGHIQMVNYLLEAESSLATIAKSNGKTALHSASRNGHVEVVKALLYKEPRM  187

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQTALHMAVKGQN+++V ELI+ D  ++ + D KGNTALHIA+RKGR Q+V+ 
Sbjct  188   ASRTDKKGQTALHMAVKGQNLEVVEELIRADAKLINIIDTKGNTALHIASRKGRAQIVKF  247

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSA--AKQLKQ  1933
             L+     +   VN++ ETALD AEK G  ++  +L+EAG   S    KP +   A+QLKQ
Sbjct  248   LLGQNETDTKAVNRSKETALDTAEKMGQANIAVILQEAG-VQSARAIKPQTTNPARQLKQ  306

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH+V  Q++ +RQT  ++  IAK++ K+H  GLNNAINS TVVAVLIATVAFAAI
Sbjct  307   TVSDIKHEVHYQMEHTRQTRKRIHGIAKRLDKMHAEGLNNAINSTTVVAVLIATVAFAAI  366

Query  2114  ftvPGQYVEKEK---KGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             F+VPGQY+E  +    G +LGEAN+A   +F++F +FDS ALFIS+AVVVVQTS+VVIE 
Sbjct  367   FSVPGQYIEYPEDVPPGHSLGEANIAPTPSFLIFLVFDSFALFISLAVVVVQTSIVVIES  426

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             KAKKQM+ IINKLMW AC+ IS+AF++L+YVVVG  E+WLAI  T++G  I++TT+G+MC
Sbjct  427   KAKKQMMAIINKLMWLACVLISVAFLALSYVVVGKNEKWLAIVVTIIGTAILVTTLGTMC  486

Query  2465  YCVVRHRLEESRMRNIRKAETLSRSFSMSM-VPSDSELYNESYKRMYAV  2608
             Y V+ HR+E S  R IRK    SRS S S  V SDS++ N   K+MYA+
Sbjct  487   YWVIMHRIESSNKRTIRKNSLASRSLSWSASVVSDSDVLNNKNKKMYAI  535



>emb|CAN80966.1| hypothetical protein VITISV_005610 [Vitis vinifera]
Length=539

 Score =   509 bits (1311),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 307/542 (57%), Positives = 394/542 (73%), Gaps = 13/542 (2%)
 Frame = +2

Query  1007  AMERQLSFGGERKR-GKDSPGKRGDNPLHLAARAGNLSKVREILQRF-DSKAIKDTLSKQ  1180
             A  RQ SF   RK   K   GKR D  LH AARAGNL    +IL +  D++A+K+ LSKQ
Sbjct  3     APARQQSF--RRKNITKQLTGKRDDTSLHSAARAGNLELALDILSKCEDAEALKELLSKQ  60

Query  1181  NQEGETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLN  1360
             NQ GETALYVAAE GH  +V E+++  D+ +A I + NGYDAFHIAAKQG L  +K L+ 
Sbjct  61    NQSGETALYVAAEYGHCDLVKEMMEYYDVSSAGIQARNGYDAFHIAAKQGDL--VKVLME  118

Query  1361  VFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHL  1540
               P   MT D SN+TALHTAA QGH+ VV  LLE  S+LA IA++NGKT LH+AAR GHL
Sbjct  119   AIPETSMTVDLSNTTALHTAAAQGHISVVSFLLEKGSSLANIAKSNGKTALHSAARKGHL  178

Query  1541  EVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALH  1720
              VVK+L++K+P I  RTDKKGQTALHMAVKGQN+++V EL+K DPS++ + D K NT LH
Sbjct  179   XVVKALLSKEPGISTRTDKKGQTALHMAVKGQNIEVVDELMKSDPSLINMVDAKDNTTLH  238

Query  1721  IATRKGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHG  1900
             +A RK R Q+VQ+L+S +  +   +NK+GETALD AEK G  ++ T+L+E G   +K   
Sbjct  239   VAVRKCRAQIVQQLLSHKATDTEAINKSGETALDTAEKTGHAEITTILQEHGVKSAKS-I  297

Query  1901  KPPS--AAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltv  2074
              PP+   A++LKQTVSDIKH+V  QL+ +RQT  +V+ IAK++ K+H  GLNNAINS TV
Sbjct  298   MPPTKNKARELKQTVSDIKHEVHHQLEHTRQTRKRVQGIAKRINKMHSEGLNNAINSTTV  357

Query  2075  vavliatvafaaiftvPGQYV---EKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIA  2245
             VAVLIATVAFAAIF VPGQY    E    G + GEAN+A +  F++FF+FDSLALFIS+A
Sbjct  358   VAVLIATVAFAAIFNVPGQYADDPEHVPPGLSPGEANIAPRTPFMLFFIFDSLALFISLA  417

Query  2246  vvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVV  2425
             VVVVQTS+VVIE+KAKK+M+ IINKLMW AC+ +S+AF+SL+Y+VVGT+E+WLA+  T +
Sbjct  418   VVVVQTSIVVIERKAKKKMMAIINKLMWLACVLVSVAFLSLSYIVVGTKERWLAVGVTGI  477

Query  2426  GGVIMLTTIGSMCYCVVRHRLEESR-MRNIRKAETLSRSFSMSMVPSDSELYNESYKRMY  2602
             G VIM TT+G+MCY V+ HR+E  +     R   +     S   V SDSE+ N  YK++Y
Sbjct  478   GTVIMATTLGTMCYWVIVHRIEAKKSRSIRRSTMSSRSRSSPMSVMSDSEILNNEYKKLY  537

Query  2603  AV  2608
             A+
Sbjct  538   AI  539



>ref|XP_007132130.1| hypothetical protein PHAVU_011G069200g [Phaseolus vulgaris]
 gb|ESW04124.1| hypothetical protein PHAVU_011G069200g [Phaseolus vulgaris]
Length=546

 Score =   509 bits (1312),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 299/529 (57%), Positives = 383/529 (72%), Gaps = 6/529 (1%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D  LH AARAGNLS +++ +   +   ++  L+KQN  GET LYVAAE
Sbjct  18    KKMTKQLTGKRDDTSLHSAARAGNLSVLKDTVSGTEGGELRALLTKQNHAGETVLYVAAE  77

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  +V E+++  DL  A I + NG+DA HIAAKQG L+++K L+     L MT D SN
Sbjct  78    YGYVDMVREMIQYYDLAGAGIKARNGFDALHIAAKQGDLDIVKILMETHSELSMTVDLSN  137

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH ++V  LLE  S+LA IAR+NGKT LH+AAR GH+EVVK+L+ K+P++
Sbjct  138   TTALHTAALQGHTEIVKFLLEAGSSLATIARSNGKTALHSAARNGHVEVVKALLEKEPAV  197

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQTALHMAVKGQN+ +V ELIK DPS + + DNKGNT LHI TRK R Q+V+ 
Sbjct  198   ATRTDKKGQTALHMAVKGQNLAVVEELIKADPSTINMVDNKGNTPLHITTRKSRAQIVKL  257

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQLKQTV  1939
             L+     +   VN+AGETALD AEK G  +V  +L E G   +K     P+ A++LKQTV
Sbjct  258   LLGQTETDSLAVNRAGETALDTAEKTGNSEVKDILLEHGVRSAKALKAQPTTARELKQTV  317

Query  1940  SDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaift  2119
             SDIKH+V  QL+ +RQT   V+ IAK++ K+H  GLNNAINS TVVAVLIATVAFAAIFT
Sbjct  318   SDIKHEVHYQLEHTRQTRRGVQGIAKRINKMHAEGLNNAINSTTVVAVLIATVAFAAIFT  377

Query  2120  vPGQYVEKEK-----KGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             VPGQ+ +  K      G T+GEAN+A +AAF++FF+FDS+ALFIS+AVVVVQTSVV+IE 
Sbjct  378   VPGQFADDPKDISPGSGMTIGEANIAPQAAFLIFFVFDSIALFISLAVVVVQTSVVIIES  437

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             KAKKQM+ IINKLMW AC+ IS+AF++LT+VVVG  ++WLAI  T++G  IM TT+G+MC
Sbjct  438   KAKKQMMAIINKLMWLACVLISVAFLALTFVVVGKDQKWLAIGVTIIGTTIMATTLGTMC  497

Query  2465  YCVVRHRLEESRMRNIRKAET-LSRSFSMSMVPSDSELYNESYKRMYAV  2608
             Y V+RHR+E S +R+IRK+            V SDSEL N   K +YA+
Sbjct  498   YWVIRHRIEASNLRSIRKSSMGSRSRSFSVSVMSDSELLNNDRKILYAI  546



>ref|XP_007205036.1| hypothetical protein PRUPE_ppa004158mg [Prunus persica]
 gb|EMJ06235.1| hypothetical protein PRUPE_ppa004158mg [Prunus persica]
Length=526

 Score =   508 bits (1308),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 306/526 (58%), Positives = 393/526 (75%), Gaps = 9/526 (2%)
 Frame = +2

Query  1052  KDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHT  1231
             K   GKR D PLH AAR+GN+  V +IL+  +   +K+ L+KQN   ETALYVAAE G+ 
Sbjct  3     KQLTGKRDDTPLHSAARSGNMGVVMDILENTEEAELKELLAKQNSSDETALYVAAEYGYV  62

Query  1232  LVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTAL  1411
              +V EI+K  DL  A I + NG+DAFHIAAKQG ++VL  L+   P L MT D SN+TAL
Sbjct  63    DLVREIIKYYDLADAGIKARNGFDAFHIAAKQGDMDVLNVLMEAHPELTMTVDLSNTTAL  122

Query  1412  HTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRT  1591
             HTAA QGH +VV+ LLE  S+LA IAR+NGKT LH+AAR GHL VVK+L+ K+P I  R 
Sbjct  123   HTAATQGHTEVVNFLLEAGSSLATIARSNGKTALHSAARNGHLVVVKALLEKEPGIATRV  182

Query  1592  DKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISI  1771
             DKKGQTALHMA KGQN++++ ELIK DPS++ + DNK NTALHIATRKGR ++V+ L+  
Sbjct  183   DKKGQTALHMAAKGQNLEMMEELIKADPSLINMADNKDNTALHIATRKGRAEIVKLLLEH  242

Query  1772  EGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSA--AKQLKQTVSD  1945
                +   VNK+ ETALD AEK G  D+   L+E G   +K+  KP +   A++LKQTVSD
Sbjct  243   SETDTKAVNKSAETALDTAEKTGNSDIKAFLQERGVQSAKE-IKPQATNPARELKQTVSD  301

Query  1946  IKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvP  2125
             IKH+V  QL+ +RQT  +V+ IAK++ K+H  GLNNAINS TVVAVLIATV FAAI+ +P
Sbjct  302   IKHEVHHQLEHTRQTRRRVQGIAKRLHKMHTEGLNNAINSNTVVAVLIATVTFAAIYQIP  361

Query  2126  GQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKK  2296
             GQYV+  K    G +LGEAN+A K AF++FF+FDS+ALFIS+AVVVVQTSVVVIE KAKK
Sbjct  362   GQYVDDPKDIPHGQSLGEANIAPKLAFMIFFIFDSIALFISLAVVVVQTSVVVIESKAKK  421

Query  2297  QMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVV  2476
             QM+ IINKLMW AC+ +S+AF++L++VVVG  ++WLAI  T++G VIM  T+G+MC+ VV
Sbjct  422   QMMAIINKLMWLACVLVSVAFLALSFVVVGG-QKWLAIGVTIIGTVIMAATLGTMCFWVV  480

Query  2477  RHRLEESRMRNIRKAETLSRSFSMSM--VPSDSELYNESYKRMYAV  2608
             RHR+E   MR+IR++   SRS S+S+  V S+SEL N  YK+MYA+
Sbjct  481   RHRIEAKNMRSIRRSSLGSRSRSLSLSAVISESELLNNDYKKMYAI  526



>ref|XP_003539755.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Glycine 
max]
Length=548

 Score =   509 bits (1310),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 298/531 (56%), Positives = 390/531 (73%), Gaps = 8/531 (2%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D PLH AARAGN++ +++ +   +   ++  L+KQN  GET LYVAAE
Sbjct  18    KKMTKQLTGKRDDTPLHSAARAGNMTVLKDTVGGTEEGELRVLLTKQNHAGETVLYVAAE  77

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  +V E+++  DL  A I + NG+DA HIAAKQG L+++K L+   P L MT D SN
Sbjct  78    YGYVDMVRELIQYYDLAGAGIKARNGFDALHIAAKQGDLDIVKILMEAHPELSMTVDPSN  137

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TA+HTAA QGH ++V LLLE  SNLA I+R+NGKT LH+AAR GHLEVVK+L+ K+PS+
Sbjct  138   TTAVHTAALQGHTEIVKLLLEAGSNLATISRSNGKTALHSAARNGHLEVVKALLGKEPSV  197

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQTA+HMAVKGQ++++V ELIK DPS + + DNKGNTALHIATRKGR ++V+ 
Sbjct  198   ATRTDKKGQTAIHMAVKGQSLEVVEELIKADPSTINMVDNKGNTALHIATRKGRARIVKL  257

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPP--SAAKQLKQ  1933
             L+     +   VN++GETALD AEK G  +V  +L E G   +K     P  + A++LKQ
Sbjct  258   LLGQTETDALVVNRSGETALDTAEKTGNSEVKDILLEHGVRRAKAIKAQPGTATARELKQ  317

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH+V  QL+ +RQT   V+ IAK++ K+H  GLNNAINS TVVAVLIATVAFAAI
Sbjct  318   TVSDIKHEVHYQLEHTRQTRRGVQGIAKRINKMHTEGLNNAINSTTVVAVLIATVAFAAI  377

Query  2114  ftvPGQYVEKEK-----KGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvI  2278
             FTVPGQ+ ++ K      G T+GEAN+A +AAF++FF+FDS+ALFIS+AVVVVQTSVV+I
Sbjct  378   FTVPGQFADEPKDIPAGSGMTIGEANIAPQAAFLIFFVFDSIALFISLAVVVVQTSVVII  437

Query  2279  EQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGS  2458
             E KAKKQM+ IINKLMW AC+ IS+AF++L++VVVG  ++WLAI  T++G  IM TT+G+
Sbjct  438   ESKAKKQMMAIINKLMWLACVLISVAFLALSFVVVGKDQKWLAIGVTIIGTTIMATTLGT  497

Query  2459  MCYCVVRHRLEESRMRNIRKAET-LSRSFSMSMVPSDSELYNESYKRMYAV  2608
             M Y V+RHR+E S +R+IRK+            V SDSEL N   K +YA+
Sbjct  498   MSYWVIRHRIEASNLRSIRKSSMGSRSRSFSVSVMSDSELLNNDRKILYAI  548



>ref|XP_004302802.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Fragaria 
vesca subsp. vesca]
Length=543

 Score =   508 bits (1309),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 304/543 (56%), Positives = 392/543 (72%), Gaps = 17/543 (3%)
 Frame = +2

Query  1016  RQLSFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGE  1195
             RQ SF  E+K  K   GKR D PLHLAAR GNL  V EI+       + + L KQN  GE
Sbjct  6     RQQSFC-EKKMTKQLTGKREDAPLHLAARTGNLGLVLEIISNCGEAELDEVLMKQNHSGE  64

Query  1196  TALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNL  1375
              ALYVAAE G+  VV E++K  D   ASI + NG+DAFHIA+KQGHLEVLK L+   P L
Sbjct  65    IALYVAAECGYVDVVKEMMKYCDAGLASIKARNGFDAFHIASKQGHLEVLKVLMEAIPEL  124

Query  1376  VMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKS  1555
              MT D +N+TALHTAA QGH++VV+ LLE D  L  IAR+N KT  H+AAR GHL+V+K+
Sbjct  125   SMTVDQTNTTALHTAAAQGHIEVVNFLLENDCRLVSIARSNAKTAFHSAARNGHLDVIKA  184

Query  1556  LVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRK  1735
             L+ K+P    R DKKGQTALHMAVKGQNV++V EL K DPS++ + DNKGNTALHIATRK
Sbjct  185   LLRKEPETATRKDKKGQTALHMAVKGQNVELVDELAKADPSMINMVDNKGNTALHIATRK  244

Query  1736  GRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPS-  1912
             GR Q+VQ+L+  +GI    +NK+GET LD A+K G   +  +L+E G   +K   +PP+ 
Sbjct  245   GRAQIVQQLLGYKGIATTIINKSGETVLDTAQKNGQSVIAAILEEQGIQSAKSM-RPPTI  303

Query  1913  -AAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavli  2089
              A ++LKQTVSDIKH+V  Q++Q+R T  +V  + K++ K+H  GLNNAINS T VAVLI
Sbjct  304   MANRELKQTVSDIKHEVHDQIKQTRHTRKQVHGMVKRLSKMHSDGLNNAINSTTFVAVLI  363

Query  2090  atvafaaiftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvq  2260
             ATVAFAAIFTVPGQY ++E      ++ GEAN+A KA FIVFF+FDS ALFIS+AVVVVQ
Sbjct  364   ATVAFAAIFTVPGQYPKEEDNLPPEYSPGEANIAPKAEFIVFFVFDSFALFISLAVVVVQ  423

Query  2261  tsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIM  2440
             TS+VVIE+K K+Q++ IINKLMW AC+ +S+AF++L+YV+VG +E+WLA+  T +G VI+
Sbjct  424   TSIVVIERKQKEQLMSIINKLMWMACVMVSVAFLALSYVIVGEKEKWLAVGVTGIGTVIL  483

Query  2441  LTTIGSMCYCVVRHRLEESRMRNIRKAETLSR-----SFSMSMVPSDSELYNESY--KRM  2599
               T+G+MCY +V  RLE S++R+  +  ++S      SFS   V SDSEL N  +  KR+
Sbjct  484   GMTLGTMCYWMVVQRLEASKLRSSTRRSSMSTRSHSGSFS---VMSDSELINTEFKKKRV  540

Query  2600  YAV  2608
             YA+
Sbjct  541   YAI  543



>ref|XP_003539100.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Glycine 
max]
Length=549

 Score =   508 bits (1309),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 299/529 (57%), Positives = 388/529 (73%), Gaps = 6/529 (1%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D PLH AARAGN+S +++ +   +   ++  L+KQN  GET L+VAAE
Sbjct  21    KKMTKQLTGKRDDTPLHSAARAGNMSVLKDTVSGSEEGELRVLLTKQNHSGETILFVAAE  80

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  +V E+++  D   A I ++NG+DA HIAAKQG L+++K L+   P L MT D SN
Sbjct  81    YGYVEMVRELIQYYDPAGAGIKASNGFDALHIAAKQGDLDIVKILMEAHPELSMTVDPSN  140

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TA+HTAA QGH ++V LLLE  SNLA IAR+NGKT LH+AAR GHLEVVK+L+ K+P +
Sbjct  141   TTAVHTAALQGHTEIVKLLLEAGSNLATIARSNGKTALHSAARNGHLEVVKALLGKEPVV  200

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQTALHMAVKGQ++++V ELIK DPS + + DNKGNTALHIATRKGR Q+++ 
Sbjct  201   ATRTDKKGQTALHMAVKGQSLEVVEELIKADPSTINMVDNKGNTALHIATRKGRAQIIKL  260

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPP--SAAKQLKQ  1933
             L+     N   VNK+GETALD AEK G  ++  +L E G   +K     P  + A++LKQ
Sbjct  261   LLGQTETNGLVVNKSGETALDTAEKTGNSEIKDILLEHGVRSAKAIKAQPGTATARELKQ  320

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH+V  QL+ +RQT   V+ IAK++ K+H  GLNNAINS TVVAVLIATVAFAAI
Sbjct  321   TVSDIKHEVHYQLEHTRQTRRGVQGIAKRINKMHAEGLNNAINSTTVVAVLIATVAFAAI  380

Query  2114  ftvPGQYVEKEK---KGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             FTVPGQ+ +  K    G T+GEAN+A +AAF++FF+FDS+ALFIS+AVVVVQTSVV+IE 
Sbjct  381   FTVPGQFADDPKVLPAGMTIGEANIAPQAAFLIFFVFDSIALFISLAVVVVQTSVVIIES  440

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             KAKKQM+ IINKLMW AC+ IS+AF++L++VVVG  ++WLAI  T++G  IM TT+G+M 
Sbjct  441   KAKKQMMAIINKLMWLACVLISVAFLALSFVVVGKDQKWLAIGVTIIGTTIMATTLGTMS  500

Query  2465  YCVVRHRLEESRMRNIRKAET-LSRSFSMSMVPSDSELYNESYKRMYAV  2608
             Y V+RHR+E S +R+IRK+            V SDSEL N   K +YA+
Sbjct  501   YWVIRHRIEASNLRSIRKSSMESRSRSFSVSVMSDSELLNNERKILYAI  549



>ref|XP_008222732.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Prunus 
mume]
Length=547

 Score =   508 bits (1309),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 306/530 (58%), Positives = 395/530 (75%), Gaps = 9/530 (2%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D PLH AAR+GN+  V +IL+  +   +K+ L+KQN   ETALYVAAE
Sbjct  20    KKMTKQLTGKRDDTPLHSAARSGNMGVVMDILENTEEAELKELLAKQNSSDETALYVAAE  79

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  +V E++K  DL  A I + NG+DAFHIAAKQG ++VL  L+   P L MT D SN
Sbjct  80    YGYVDLVREMIKYYDLADAGIKARNGFDAFHIAAKQGDMDVLNVLMEAHPELTMTVDLSN  139

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH +VV+ LLE  S+LA IAR+NGKT LH+AAR GHL VVK+L+ K+P I
Sbjct  140   TTALHTAATQGHTEVVNFLLEAGSSLATIARSNGKTALHSAARNGHLVVVKALLEKEPGI  199

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               R DKKGQTALHMA KGQN++++ ELIK DPS++ + DNK NTALHIATRKGR ++V+ 
Sbjct  200   ATRVDKKGQTALHMAAKGQNLEMMEELIKADPSLINMADNKDNTALHIATRKGRAEIVKL  259

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSA--AKQLKQ  1933
             L+     +   VNK+ ETALD AEK G  D+   L+E G   +K+  KP +   A++LKQ
Sbjct  260   LLEHSETDTKAVNKSAETALDTAEKTGNSDIKAFLQERGVQSAKE-IKPQATNPARELKQ  318

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH+V  QL+ +RQT  +V+ IAK++ K+H  GLNNAINS TVVAVLIATV FAAI
Sbjct  319   TVSDIKHEVHHQLEHTRQTRRRVQGIAKRLHKMHTEGLNNAINSNTVVAVLIATVTFAAI  378

Query  2114  ftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             + +PGQYV+  K    G +LGEAN+A K AF++FF+FDS+ALFIS+AVVVVQTSVVVIE 
Sbjct  379   YQIPGQYVDDPKDIPHGQSLGEANIAPKLAFMIFFIFDSIALFISLAVVVVQTSVVVIES  438

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             KAKKQM+ IINKLMW AC+ +S+AF++L++VVVG  ++WLAI  T++G VIM  T+G+MC
Sbjct  439   KAKKQMMAIINKLMWLACVLVSVAFLALSFVVVGG-QKWLAIGVTIIGTVIMAATLGTMC  497

Query  2465  YCVVRHRLEESRMRNIRKAETLSRSFSMSM--VPSDSELYNESYKRMYAV  2608
             + VVRHR+E   MR+IR++   SRS S+S+  V S+SEL N  YK+MYA+
Sbjct  498   FWVVRHRIEAKNMRSIRRSSLGSRSRSLSLSAVISESELLNNDYKKMYAI  547



>ref|XP_008385187.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Malus 
domestica]
 ref|XP_008385189.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Malus 
domestica]
Length=549

 Score =   508 bits (1309),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 302/530 (57%), Positives = 396/530 (75%), Gaps = 9/530 (2%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D PLH  AR+G+++ V +IL+  +  A+K+ L+KQN   ETALY+AAE
Sbjct  22    KKMTKQLTGKRDDTPLHSGARSGSMAVVMDILENTEEGALKELLTKQNSSDETALYIAAE  81

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  +V E++K  DL  A I + NG+DAFHIAAKQG ++VL  L+   P L MT D SN
Sbjct  82    YGYVDLVREMIKYYDLADAGIKARNGFDAFHIAAKQGDMDVLNVLMEAHPELTMTVDLSN  141

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH++VV+ LLE  S+LA IA++NGKT LH+AAR GHLEV+ + ++K+P I
Sbjct  142   TTALHTAAAQGHIEVVNFLLEAGSSLATIAKSNGKTALHSAARNGHLEVLVAFLDKEPGI  201

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               R DKKGQTALHMA KGQN+++V +LI  DPS++ + DNK NTALHIATRKGR ++V+ 
Sbjct  202   ATRVDKKGQTALHMAAKGQNLEVVEQLINADPSLINMADNKDNTALHIATRKGRGEIVKM  261

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPS--AAKQLKQ  1933
             L+     N   VNK+ ETALD AEK G  D+   L+E G   +K+  KP +   A++LKQ
Sbjct  262   LLEHSETNTRAVNKSAETALDTAEKTGNSDIKAFLQERGVQSAKEI-KPQARNPARELKQ  320

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH+V  QL+ +RQT  +V+ IAK++ K+H  GLNNAINS TVVAVLIATV FAAI
Sbjct  321   TVSDIKHEVHHQLEHTRQTRRRVQGIAKRLHKMHSEGLNNAINSNTVVAVLIATVTFAAI  380

Query  2114  ftvPGQYVEKE---KKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             F +PGQYV+      KG +LGEAN+A K AFI+FF+FDS+ALFIS+AVVVVQTSVVVIE 
Sbjct  381   FQIPGQYVDDPGDIPKGQSLGEANIAPKLAFIIFFIFDSIALFISLAVVVVQTSVVVIES  440

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             KAKKQM+ IINKLMW AC+ +S+AF++L++VVVG  ++WLAI  T++G VIM  T+G+MC
Sbjct  441   KAKKQMMAIINKLMWLACVLVSVAFLALSFVVVG-EQKWLAIGVTIIGTVIMAATLGTMC  499

Query  2465  YCVVRHRLEESRMRNIRKA--ETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             + VVRHR+E   MR+I +   ++ SRS+S+S V S+SEL N  YK+MYA+
Sbjct  500   FWVVRHRIEAKNMRSIGRTSLDSRSRSWSLSAVMSESELLNNDYKKMYAI  549



>ref|XP_004246736.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Solanum 
lycopersicum]
Length=541

 Score =   506 bits (1304),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 289/532 (54%), Positives = 394/532 (74%), Gaps = 12/532 (2%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKRGD  +H   R+GNL  V EI+   +   + + LSKQNQ GE ALYVAAE
Sbjct  13    KKMTKQLTGKRGDTQIHSVVRSGNLELVLEIITCCNEAELIELLSKQNQSGENALYVAAE  72

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
             +G  ++V E++K  D+  ASI + NGYDAFH+AAKQG  E++K LL  FP L +T D SN
Sbjct  73    SGDLVLVKELIKYYDIGLASIKARNGYDAFHVAAKQGDFEMVKVLLEAFPQLSVTFDQSN  132

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             STALHTA+ QGH+DVV+ LLE +S+LA I +NNGKT LH++AR GH+ VVK+L++K+  I
Sbjct  133   STALHTASAQGHIDVVNFLLETNSSLATIPKNNGKTALHSSARNGHVAVVKALLSKEEGI  192

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
                 DKKGQTALHMAVKGQ+VD+V ELI  DP++  + D KGNTALHIATRKGR ++VQ 
Sbjct  193   LNWRDKKGQTALHMAVKGQSVDVVNELILSDPTLATIIDGKGNTALHIATRKGRVEIVQA  252

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDH--GKPPSAAKQLKQ  1933
             ++  + +  + +NK+GETALD+AEK    ++  +LKE G   +K+     P  +AK+LKQ
Sbjct  253   VVKDKRMKWDAINKSGETALDVAEKARNSEIAAILKEHGVLTAKNMKLALPTRSAKELKQ  312

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKHDV +QL+ + QT  +V+ IAK++ K+H  GLNNAINS TVVAVLIATV FAAI
Sbjct  313   TVSDIKHDVHNQLEHTFQTQKRVKNIAKRLNKMHTEGLNNAINSTTVVAVLIATVTFAAI  372

Query  2114  ftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             F +PGQY +  K+   G+++GE  +A +  F++FF+FDSLALFIS+AVVVVQTS+VV+E+
Sbjct  373   FNLPGQYTDNPKEIPPGYSIGEGRIAPQPPFVIFFIFDSLALFISLAVVVVQTSIVVVER  432

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             +AKKQM+ IINKLMW AC+F+S+AF++L+Y+V+G  E+W+A   T +G  IM+ T+G++C
Sbjct  433   RAKKQMMAIINKLMWLACVFVSVAFLALSYIVIGKDERWMASAVTFMGTFIMVATLGTLC  492

Query  2465  YCVVRHRLEESRMRNIRK----AETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             Y VV HR+E S +R+ RK    ++TLSRS S   + S+SE+  + YK++YA+
Sbjct  493   YWVVMHRIESSNLRSQRKSARSSKTLSRSVS---IMSESEIPEDQYKKLYAI  541



>gb|KHN22008.1| Ankyrin repeat-containing protein [Glycine soja]
Length=549

 Score =   507 bits (1305),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 298/529 (56%), Positives = 388/529 (73%), Gaps = 6/529 (1%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D PLH A+RAGN+S +++ +   +   ++  L+KQN  GET L+VAAE
Sbjct  21    KKMTKQLTGKRDDTPLHSASRAGNMSVLKDTVSGSEEGELRVLLTKQNHAGETILFVAAE  80

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  +V E+++  D   A I ++NG+DA HIAAKQG L+++K L+   P L MT D SN
Sbjct  81    YGYVEMVRELIQYYDPAGAGIKASNGFDALHIAAKQGDLDIVKILMEAHPELSMTVDPSN  140

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TA+HTAA QGH ++V LLLE  SNLA IAR+NGKT LH+AAR GHLEVVK+L+ K+P +
Sbjct  141   TTAVHTAALQGHTEIVKLLLEAGSNLATIARSNGKTALHSAARNGHLEVVKALLGKEPVV  200

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQTALHMAVKGQ++++V ELIK DPS + + DNKGNTALHIATRKGR Q+++ 
Sbjct  201   ATRTDKKGQTALHMAVKGQSLEVVEELIKADPSTINMVDNKGNTALHIATRKGRAQIIKL  260

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPP--SAAKQLKQ  1933
             L+     N   VNK+GETALD AEK G  ++  +L E G   +K     P  + A++LKQ
Sbjct  261   LLGQTETNGLVVNKSGETALDTAEKTGNSEIKDILLEHGVRSAKAIKAQPGTATARELKQ  320

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH+V  QL+ +RQT   V+ IAK++ K+H  GLNNAINS TVVAVLIATVAFAAI
Sbjct  321   TVSDIKHEVHYQLEHTRQTRRGVQGIAKRINKMHAEGLNNAINSTTVVAVLIATVAFAAI  380

Query  2114  ftvPGQYVEKEK---KGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             FTVPGQ+ +  K    G T+GEAN+A +AAF++FF+FDS+ALFIS+AVVVVQTSVV+IE 
Sbjct  381   FTVPGQFADDPKVLPAGMTIGEANIAPQAAFLIFFVFDSIALFISLAVVVVQTSVVIIES  440

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             KAKKQM+ IINKLMW AC+ IS+AF++L++VVVG  ++WLAI  T++G  IM TT+G+M 
Sbjct  441   KAKKQMMAIINKLMWLACVLISVAFLALSFVVVGKDQKWLAIGVTIIGTTIMATTLGTMS  500

Query  2465  YCVVRHRLEESRMRNIRKAET-LSRSFSMSMVPSDSELYNESYKRMYAV  2608
             Y V+RHR+E S +R+IRK+            V SDSEL N   K +YA+
Sbjct  501   YWVIRHRIEASNLRSIRKSSMGSRSRSFSVSVMSDSELLNNERKILYAI  549



>gb|KHN33422.1| Ankyrin repeat-containing protein [Glycine soja]
Length=567

 Score =   507 bits (1306),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 311/555 (56%), Positives = 400/555 (72%), Gaps = 33/555 (6%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D PLH AARAGNL+ +++ +   D   + + L+KQNQ+GET LY+AAE
Sbjct  14    KKMTKQLTGKRDDTPLHSAARAGNLAVLKDTILETDEAELHELLAKQNQDGETPLYIAAE  73

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  VV E+++  DL  A I + NG+DA HIAAKQG L+VLK L+   P L MT D SN
Sbjct  74    YGYVDVVREMIQYYDLADAGIKARNGFDALHIAAKQGDLDVLKILMEGHPELSMTVDPSN  133

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH ++V  LLE  S+LA IAR+NGKT LH+AAR GHL VVK+L+ K+P +
Sbjct  134   TTALHTAAIQGHTEIVKFLLEAGSSLATIARSNGKTALHSAARNGHLVVVKALLEKEPGV  193

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQM---  1750
               RTDKKGQTALHMAVKGQN+++V ELIK DPS + + D+KGNTALHIATRKGR Q+   
Sbjct  194   ATRTDKKGQTALHMAVKGQNIEVVEELIKADPSSINMVDSKGNTALHIATRKGRAQITTP  253

Query  1751  ------------------VQRLISIEGININT-VNKAGETALDIAEKFGTPDVVTMLKEA  1873
                               + +L+  +  N+ + VN+ GETA+D AEK G   V  +L E 
Sbjct  254   AVDEFVFSMIWLSVAVLTIVKLLLEQKENVTSAVNRCGETAVDTAEKTGNHAVQAILLEH  313

Query  1874  GATHSKDHGKPP-----SAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHI  2038
             G   ++   KPP     + A++LKQTVSDIKH+V  QL+ +RQT  +V+ IAK++ K+H 
Sbjct  314   GVESART-IKPPQGTTATTARELKQTVSDIKHEVHHQLEHTRQTRKRVQGIAKRINKMHA  372

Query  2039  SGLNNAINSltvvavliatvafaaiftvPGQYVEKEKK---GFTLGEANVANKAAFIVFF  2209
              GLNNAINS TVVAVLIATVAFAAIFTVPGQ+V+       G +LGEAN+A +A FI+FF
Sbjct  373   EGLNNAINSTTVVAVLIATVAFAAIFTVPGQFVDDPNNIPAGMSLGEANIAPQATFIIFF  432

Query  2210  LFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGT  2389
             +FDS+ALFIS+AVVVVQTSVVVIE KAKKQM+ +INKLMW AC+ IS+AF++L++VVVG 
Sbjct  433   VFDSIALFISLAVVVVQTSVVVIESKAKKQMMAVINKLMWLACVLISVAFLALSFVVVGK  492

Query  2390  REQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVP-SD  2566
              E+WLAI  T++G  IM TT+G+MCY V+RHR+E S +R+IRK+   S+S S S+   SD
Sbjct  493   EEKWLAIGVTIIGTTIMATTLGTMCYWVIRHRIEASNLRSIRKSSLQSKSKSFSVSAFSD  552

Query  2567  SELYN-ESYKRMYAV  2608
             SEL N E YK+MYA+
Sbjct  553   SELLNSEYYKKMYAI  567



>ref|XP_004241254.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Solanum 
lycopersicum]
 ref|XP_010322376.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Solanum 
lycopersicum]
Length=535

 Score =   506 bits (1303),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 294/529 (56%), Positives = 389/529 (74%), Gaps = 7/529 (1%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             ++  K   GKR D+ LH  ARAGNL +++ I+     K + + L KQN  GET+LYVAAE
Sbjct  8     KRMKKQLTGKREDSVLHRLARAGNLVEIKGIIDYTGEKELTELLVKQNSAGETSLYVAAE  67

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  +V E++K  DL  A I + NG+DA HIAAKQG L+V+K L+ V P L MT D +N
Sbjct  68    YGYCDLVKEMIKYYDLVAAGIKARNGFDALHIAAKQGDLDVVKVLMMVHPELSMTVDVAN  127

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALH+AA QGH+ +V+ LLE +S+LA IA++NGKT LH+AAR GH+EVVK+L+NK+  +
Sbjct  128   TTALHSAANQGHIQMVNYLLEAESSLATIAKSNGKTALHSAARNGHVEVVKALLNKEARM  187

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQTALHMAVKGQN+++V ELI+ D  ++ + D KGNTALHIA+RKGR Q+V+ 
Sbjct  188   ASRTDKKGQTALHMAVKGQNLEVVEELIRADAKLINIVDTKGNTALHIASRKGRAQIVKF  247

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSA--AKQLKQ  1933
             L+     +   VN++ ETALD AEK G  ++  +L+EAG   S    KP +   A+QLKQ
Sbjct  248   LLGQNETDTKAVNRSKETALDTAEKMGQANIAVILQEAG-VQSARAIKPQTTNPARQLKQ  306

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH+V  Q++ +RQT  ++  IAK++ K+H  GLNNAINS TVVAVLIATVAFAAI
Sbjct  307   TVSDIKHEVHYQMEHTRQTRKRIHGIAKRLDKMHAEGLNNAINSTTVVAVLIATVAFAAI  366

Query  2114  ftvPGQYVEKEK---KGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             F+VPGQY+E  +    G +LGEAN+A   +F++F +FDS ALFIS+AVVVVQTS+VVIE 
Sbjct  367   FSVPGQYIEYPEDVPPGHSLGEANIAPSPSFLIFLVFDSFALFISLAVVVVQTSIVVIES  426

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             KAKKQM+ IINKLMW AC+ IS+AF++L+YVVVG  E+WLAI  T++G  I++TT+G+MC
Sbjct  427   KAKKQMMAIINKLMWLACVLISVAFLALSYVVVGKNEKWLAIVVTIIGTAILVTTLGTMC  486

Query  2465  YCVVRHRLEESRMRNIRKAETLSRSFSMSM-VPSDSELYNESYKRMYAV  2608
             Y V+ HR+E S  RNIRK    SRS S S  V S+S++ N    +MYA+
Sbjct  487   YWVIMHRIESSNKRNIRKNSLASRSLSWSASVLSNSDVLNNKNNKMYAI  535



>ref|XP_006380398.1| hypothetical protein POPTR_0007s04760g [Populus trichocarpa]
 gb|ERP58195.1| hypothetical protein POPTR_0007s04760g [Populus trichocarpa]
Length=541

 Score =   506 bits (1304),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 301/529 (57%), Positives = 391/529 (74%), Gaps = 7/529 (1%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D PLH AARAGNL  V EIL     + +K+ L KQNQ GETALYVAAE
Sbjct  14    KKMTKQLTGKRDDTPLHSAARAGNLGAVMEILTGTGEEELKELLEKQNQSGETALYVAAE  73

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  VV E++K  DL  A I + NG+DAFH+AAKQG +E+L+ L+   P L MT D SN
Sbjct  74    YGYVDVVREMIKYYDLADAGIKARNGFDAFHVAAKQGDIEILRVLMEAHPELSMTVDLSN  133

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH+++V+ LL+  S+L+ I ++NGKT LH+AAR GH+EVV++L+  +P I
Sbjct  134   TTALHTAATQGHIEIVNFLLDAGSSLSTIDKSNGKTALHSAARNGHVEVVRALLTMEPGI  193

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               R DKKGQTALHMAVKGQN+++V ELI  DPS +   D KGNT LHIATRKGR Q+V+ 
Sbjct  194   ATRIDKKGQTALHMAVKGQNIEVVEELIVADPSAVNRIDTKGNTPLHIATRKGRAQIVKL  253

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKD-HGKPPSAAKQLKQT  1936
             L+     ++  VN+  ETALD AEK G P++  +L+E G   +K       + A++LKQT
Sbjct  254   LLRHSRTDVKAVNRTTETALDTAEKTGHPEIAVILQEHGVQSAKTIQPLEINPARELKQT  313

Query  1937  VSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaif  2116
             VSD+KH+V  QL+ +RQT  +V+ IAK++ K+H+ GLNNAINS TVVAVLIA+VAFAAI+
Sbjct  314   VSDVKHEVHHQLEHTRQTRKRVKGIAKRLNKMHVEGLNNAINSTTVVAVLIASVAFAAIY  373

Query  2117  tvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQK  2287
             TVPGQYV+   +   G +LGEAN+A K  FI+FF+FDS ALFIS+AVVVVQTSVV IE K
Sbjct  374   TVPGQYVDDPNEIPPGQSLGEANIAPKVPFIIFFIFDSTALFISLAVVVVQTSVVAIESK  433

Query  2288  AKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCY  2467
             AKK+M+ +INKLMW AC  +S+AF++L++VVVG RE+WLAI  T+VG  IM TT G+MCY
Sbjct  434   AKKKMMAVINKLMWIACTLVSVAFLALSFVVVGEREKWLAIGVTIVGASIMATTFGTMCY  493

Query  2468  CVVRHRLEESRMRNI--RKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
              V++HR+E S M+NI      + SRSFS+S+V SD+E+ N  YK+MYA+
Sbjct  494   WVIKHRIEASNMKNIRRSSLGSRSRSFSVSLV-SDTEIVNSDYKKMYAI  541



>ref|XP_004984777.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Setaria 
italica]
Length=567

 Score =   506 bits (1304),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 295/535 (55%), Positives = 399/535 (75%), Gaps = 13/535 (2%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D  +H AARAG L+ +RE+L   D++ +   LS+QNQ GET L+VAAE
Sbjct  34    KKMTKQLTGKRDDTAMHAAARAGQLASMREMLSGKDTEEVAALLSRQNQAGETPLFVAAE  93

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  +V E++K  D+ TASI + +GYDA HIAAKQG ++V++ELL   P L MT D+SN
Sbjct  94    YGYVALVAELIKYHDVATASIKARSGYDALHIAAKQGDVDVVRELLLALPQLAMTVDASN  153

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TAL+TAA QGH+DVV LLL++D +LA IAR+NGKT LH+AAR GH+EVV++L+  +PSI
Sbjct  154   TTALNTAATQGHMDVVQLLLQVDGSLALIARSNGKTALHSAARNGHVEVVRALLEAEPSI  213

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQTALHMA KG  +D+V  L+  +P++L   DNK NTALHIA RK R ++++R
Sbjct  214   ALRTDKKGQTALHMAAKGTRLDLVDALLAAEPALLNQPDNKDNTALHIAARKARHEIIRR  273

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSA--------  1915
             L++    N+N +N++ ET LD AEK G  +V  +L E G   ++                
Sbjct  274   LVAAPDANLNAINRSRETPLDTAEKMGNAEVAELLAEHGVVTARALSPGGGGGGGGGGKQ  333

Query  1916  AKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliat  2095
             A++LKQ VSDIKH+V SQL+Q+RQT  +++ IAK++ KLH  GLNNAINS TVVAVLIAT
Sbjct  334   ARELKQQVSDIKHEVHSQLEQTRQTRVRMQGIAKRINKLHEEGLNNAINSTTVVAVLIAT  393

Query  2096  vafaaiftvPGQYVEKE---KKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqts  2266
             VAFAAIFTVPG+YV+       G  LGEAN++++ AFI+FF+FDS++LFIS+AVVVVQTS
Sbjct  394   VAFAAIFTVPGEYVQDPGSLAPGQQLGEANISHETAFIIFFVFDSVSLFISLAVVVVQTS  453

Query  2267  vvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLT  2446
             VVVIE+KAKKQM+ +INKLMW AC+ IS++F++L++VVVG  E+WLA+  T++GG I++T
Sbjct  454   VVVIERKAKKQMMAVINKLMWVACVLISVSFLALSFVVVGRAERWLAVCVTIMGGTILVT  513

Query  2447  TIGSMCYCVVRHRLEESRMRNIRKAE-TLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             TIG+M Y V+ HR+E  RMR+I++A  + SRSFS S + S++E  +E YKRMYA+
Sbjct  514   TIGTMLYWVIAHRVEAKRMRSIKRASLSRSRSFSCSGM-SEAEWIDEEYKRMYAI  567



>ref|XP_009776901.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Nicotiana 
sylvestris]
Length=541

 Score =   504 bits (1298),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 301/536 (56%), Positives = 395/536 (74%), Gaps = 7/536 (1%)
 Frame = +2

Query  1019  QLSFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGET  1198
             Q  F G +K  K   GKRGD   H   R GNL    EI+       + + LSKQNQ  ET
Sbjct  7     QQIFSG-KKMTKQLTGKRGDTEFHSVVRGGNLELALEIINGCVEGELVELLSKQNQSAET  65

Query  1199  ALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLV  1378
             ALYVAAE GH  +V E++K  D+ TASI + NGYDAFH+AAKQG  E +K L  VFP L 
Sbjct  66    ALYVAAEYGHLDLVKEMIKYYDIGTASIKARNGYDAFHVAAKQGDFETVKVLFEVFPQLS  125

Query  1379  MTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSL  1558
             +T D SNSTALHTAA QGH++VV+ LL+ +S+LA I +NNGKT LH++AR GH+ VVK+L
Sbjct  126   VTFDQSNSTALHTAASQGHINVVNFLLDTNSSLATIPKNNGKTALHSSARNGHVAVVKAL  185

Query  1559  VNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKG  1738
             ++K+  I    DKKGQTALHMAVKGQ+VD+V ELI+ DPS+  + D KGNTALHIATRKG
Sbjct  186   LSKEEGILNWRDKKGQTALHMAVKGQSVDVVNELIQSDPSLATIIDGKGNTALHIATRKG  245

Query  1739  RPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHG--KPPS  1912
             R ++VQ L+  + +  + +NK+GETALDIAEK    ++ T+LKE G   +K+     P  
Sbjct  246   RVEIVQALVKDKRMKWDAINKSGETALDIAEKVRQSEIETILKEHGILSAKNMKLVLPTR  305

Query  1913  AAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavlia  2092
             +AK+LKQTVSDIKHDV +QL+ + QT  +V+ IAK++ K+H  GLNNAINS TVVAVLIA
Sbjct  306   SAKELKQTVSDIKHDVHNQLEHTFQTQKRVKNIAKRLNKMHSEGLNNAINSTTVVAVLIA  365

Query  2093  tvafaaiftvPGQYVEKEK---KGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqt  2263
             TVAFAAIF +PGQYV+  K    G++LGE N+A +  F +FF+FDSLALFIS+AVVVVQT
Sbjct  366   TVAFAAIFNLPGQYVDNRKHIPPGYSLGEGNIAPQLPFAIFFIFDSLALFISLAVVVVQT  425

Query  2264  svvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIML  2443
             S+VV+E++AKKQM+ IINKLMW AC F+S+AF++L+YVVVG  E+W+A   T +G  IM+
Sbjct  426   SIVVVERRAKKQMMSIINKLMWLACAFVSVAFLALSYVVVGKEERWMATAVTFMGTFIMV  485

Query  2444  TTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVP-SDSELYNESYKRMYAV  2608
             TT+G++CY VV HR+E S +R++RK+   S+S S S+   S+SE+ ++ YK++YA+
Sbjct  486   TTLGTLCYWVVMHRIESSNLRSLRKSARSSKSLSRSISIMSESEIPDDEYKKLYAI  541



>ref|XP_009607373.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Nicotiana 
tomentosiformis]
Length=535

 Score =   503 bits (1296),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 285/525 (54%), Positives = 389/525 (74%), Gaps = 7/525 (1%)
 Frame = +2

Query  1052  KDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHT  1231
             K   GKR D  LH  ARAGNL ++REI+ +   + +++ L KQN  GET LYV+AE G+ 
Sbjct  12    KQLTGKREDTVLHSLARAGNLVEIREIIDKTGKEELEELLIKQNSAGETPLYVSAEYGYY  71

Query  1232  LVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTAL  1411
              +V E++K  DL +A I + NG+DA HIAAKQG L+V+K L+   P L MT D++N+TAL
Sbjct  72    ELVKEMIKYYDLVSAGIKARNGFDALHIAAKQGDLDVVKVLMGAHPELSMTVDNANTTAL  131

Query  1412  HTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRT  1591
             H+AA QGH++VV+ LLE + +LA IA++NGKT LH+AAR GH++VVK+L+NK+  I  R 
Sbjct  132   HSAANQGHIEVVNYLLEAEKSLATIAKSNGKTALHSAARNGHVQVVKALLNKERGIASRM  191

Query  1592  DKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISI  1771
             DKKGQTALHMAVKGQN+++V ELI+ D   + + D KGNTALHIA RKGR Q+V+ L+  
Sbjct  192   DKKGQTALHMAVKGQNLEVVEELIRADAKSINMVDTKGNTALHIAARKGRAQIVKLLLGQ  251

Query  1772  EGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSA--AKQLKQTVSD  1945
             +  +   VN++ ETA+D AEK G  ++  +L+E+G   S    KP +   A++LKQTVSD
Sbjct  252   KETDTKAVNRSNETAIDTAEKMGQVNIAVILQESG-VQSIRAIKPQATNPARELKQTVSD  310

Query  1946  IKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvP  2125
             IKH+V  Q++ +R+T  ++  IAK++ K+H  GLNNAINS TVVAVLIATVA+AAIF+VP
Sbjct  311   IKHEVHYQMEHTRRTRKRIHGIAKRIDKMHAEGLNNAINSTTVVAVLIATVAYAAIFSVP  370

Query  2126  GQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKK  2296
             GQY+E  +    G +LGEAN+A    F++FF+ DS+ALFIS+AVV+VQTS+VVIE KAKK
Sbjct  371   GQYIEYAEDIPPGHSLGEANIAPSPLFLIFFVLDSIALFISLAVVIVQTSIVVIESKAKK  430

Query  2297  QMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVV  2476
             QM+ IINKLMW AC+ IS+AF++L++VVVG  E+WLA+  T++G +I++ T+G++CY V+
Sbjct  431   QMMAIINKLMWLACVLISVAFLALSFVVVGKNEKWLAVVVTIIGTIILVATLGTLCYWVI  490

Query  2477  RHRLEESRMRNIRKAETLSRSFSMSM-VPSDSELYNESYKRMYAV  2608
              HR+E S  RNIRK    SRS S S  V SDS++ N  YK+MYA+
Sbjct  491   MHRIESSNKRNIRKNSLASRSLSWSASVISDSDVLNNEYKKMYAI  535



>gb|KHG23432.1| Ankyrin-2 [Gossypium arboreum]
 gb|KHG24042.1| Ankyrin-2 [Gossypium arboreum]
Length=540

 Score =   503 bits (1294),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 304/537 (57%), Positives = 394/537 (73%), Gaps = 11/537 (2%)
 Frame = +2

Query  1019  QLSFGGERKR-GKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGE  1195
             Q S    RK+  K   GKR D  LH AARAGNL+ V EIL+      +K+ L KQNQ GE
Sbjct  8     QPSVPARRKKMTKQLTGKRDDTNLHAAARAGNLAAVSEILKNTGPDELKELLPKQNQSGE  67

Query  1196  TALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNL  1375
             TALYVAAE G+  +V E++   DL  A I + NG+DAFHIAAKQG LE+LK LL V P L
Sbjct  68    TALYVAAEYGYVDLVEEMINYYDLTDAGIKARNGFDAFHIAAKQGDLEILKLLLGVHPEL  127

Query  1376  VMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKS  1555
              MT D SN+TALHTAA QGH+++V  LLE  S LA IAR+NGKT LH+AAR GHLEVVK+
Sbjct  128   AMTVDLSNTTALHTAATQGHIEIVKFLLEAGSGLATIARSNGKTALHSAARNGHLEVVKA  187

Query  1556  LVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVL-ALGDNKGNTALHIATR  1732
             L+  +P I  RTDKKGQTALHMAVKGQN+ +V ELI  DPS++ ++ D+KGNTALHIA+R
Sbjct  188   LLASEPGIAPRTDKKGQTALHMAVKGQNLVVVEELIGVDPSLMISMVDSKGNTALHIASR  247

Query  1733  KGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKP--  1906
             KGR ++V+ L+  +  ++  VN++GETA D AEK G PD+  +L++ G   S    KP  
Sbjct  248   KGRIEIVKLLLRYKETDMKAVNRSGETAFDTAEKTGQPDIAALLQQHG-VQSARLIKPAT  306

Query  1907  PSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavl  2086
             P+ A++LKQTVSDIKH+V +QL+ +RQT   V+ I K++ K+H  GLNNAINS TVVAVL
Sbjct  307   PNPARELKQTVSDIKHEVHNQLEHTRQTRKHVQGIVKRLHKMHSEGLNNAINSTTVVAVL  366

Query  2087  iatvafaaiftvPGQYVEKEK---KGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvv  2257
             IATVAFA IF VPGQYV+  K    G +LGEA +    AF++FF+FDS++LFIS+AVVVV
Sbjct  367   IATVAFAGIFQVPGQYVDDAKNVPPGLSLGEARIGQNPAFVIFFIFDSISLFISLAVVVV  426

Query  2258  qtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVI  2437
             QTSVVVIE KAKKQ++ +INK+MW AC+ +S+A+++L++VVVG  E+WLAI  T++G VI
Sbjct  427   QTSVVVIESKAKKQLMAVINKIMWLACVLVSVAYLALSFVVVGD-ERWLAIGVTIIGSVI  485

Query  2438  MLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             M  T+G+MCY V+RHR++ S  RNIR++   S+S S  +  SD+E+ N    +MYA+
Sbjct  486   MFATLGTMCYWVIRHRIKASSKRNIRRSSMESQSHSYPL--SDTEILNNELNKMYAI  540



>ref|XP_009416260.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Musa 
acuminata subsp. malaccensis]
Length=532

 Score =   502 bits (1292),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 300/530 (57%), Positives = 393/530 (74%), Gaps = 3/530 (1%)
 Frame = +2

Query  1025  SFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETAL  1204
             S G  +K  K   GKR D PLH AARAGNL+ V E L   + + +K+ L KQNQ GETAL
Sbjct  4     SVGRRKKITKQLTGKREDTPLHSAARAGNLAVVNEFLSGNNEENLKELLCKQNQAGETAL  63

Query  1205  YVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMT  1384
             +VA+E G+  +V E++K  D+  A I + NGYDA HIAAKQG  +V+KELLN  P L +T
Sbjct  64    FVASEYGYIDLVQEMIKHHDVAMAGIKAKNGYDALHIAAKQGDEDVVKELLNALPELSLT  123

Query  1385  TDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVN  1564
              D SN+TALHTAA QG ++VV+LLLE D +LA IA++NGKT LH+AAR GHLEVVK+L+ 
Sbjct  124   VDFSNTTALHTAATQGRIEVVNLLLEADKSLALIAKSNGKTALHSAARNGHLEVVKALLR  183

Query  1565  KDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRP  1744
             K+P I  RTDKKGQTALHMA KG ++++V EL++ +P +++  D KGNTALHIA RKGR 
Sbjct  184   KEPGIATRTDKKGQTALHMAAKGTSLELVEELLEHEPYLISSVDTKGNTALHIAARKGRA  243

Query  1745  QMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAAKQ  1924
             Q+++RL+ I+ +    +NK+GETALDIAEK G   ++++L E G   ++    P + A++
Sbjct  244   QIIKRLLEIKELETKAINKSGETALDIAEKMGNSGIISILLEHGVQSARTIRPPQNPARE  303

Query  1925  LKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvaf  2104
             LKQTVSDIKH+V SQL+ +RQT   V+ I K++ KLH  GL NAINS TVVAVLIA+VAF
Sbjct  304   LKQTVSDIKHEVHSQLEHARQTRRHVQGIVKRINKLHEEGLTNAINSNTVVAVLIASVAF  363

Query  2105  aaiftvPGQYVEKEK--KGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvI  2278
             AAIFTVPG+YVE +    G TLGEANVA++  F++FF+FDS+ALFIS+AVVVVQTSVVVI
Sbjct  364   AAIFTVPGEYVEFDNLAPGLTLGEANVAHQTPFMIFFVFDSVALFISLAVVVVQTSVVVI  423

Query  2279  EQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGS  2458
             E KAKKQM+ IINKLMW AC+ ISIAF++L ++VVG + +WLAI  T++G VI+ TT G+
Sbjct  424   ESKAKKQMMAIINKLMWIACVLISIAFLALCFIVVGRKGRWLAIGVTIIGAVILATTFGT  483

Query  2459  MCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             M Y V+ HR+E  ++R+I+++             SDSEL+N  YK MYA+
Sbjct  484   MIYWVIVHRIEAKKLRSIQRSSFSRSRSWSVSGVSDSELFNGEYK-MYAI  532



>ref|XP_009599077.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Nicotiana 
tomentosiformis]
Length=541

 Score =   501 bits (1289),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 294/529 (56%), Positives = 392/529 (74%), Gaps = 6/529 (1%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKRGD   H   R GNL    EI+       + + +SKQNQ  ETALYVAAE
Sbjct  13    KKMTKQLTGKRGDTEFHSVVRGGNLELALEIINGCVEGELVELMSKQNQSAETALYVAAE  72

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              GH  +V E+ K  D+ +ASI + NGYDAFH+AAKQG  E++K +L VFP L +T D SN
Sbjct  73    YGHVELVKEMSKYYDIGSASIKARNGYDAFHVAAKQGDFEMVKVILEVFPQLSVTFDQSN  132

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             STALHTAA QGH++VV+ LLE +S+LA I +NNGKT LH++AR GH+ VVK+L++K+  I
Sbjct  133   STALHTAAAQGHINVVNFLLETNSSLATIPKNNGKTALHSSARNGHVAVVKALLSKEEGI  192

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
                 DKKGQTA HMAVKGQ+VD+V ELI+ DPS+  + D KGNTALHIATRKGR ++VQ 
Sbjct  193   LNWRDKKGQTAFHMAVKGQSVDVVNELIQSDPSLATIIDGKGNTALHIATRKGRVEIVQA  252

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHG--KPPSAAKQLKQ  1933
             L+  + +  + +NK+GETALDIAEK    ++ T+LKE G   +K+     P  +AK+LKQ
Sbjct  253   LVKDKRMKWDVINKSGETALDIAEKGRQSEIATILKEHGILSAKNMKLVLPTRSAKELKQ  312

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKHDV +QL+ + QT  +V+ IAK++ K+H+ GLNNAINS TVVAVLIATVAFAAI
Sbjct  313   TVSDIKHDVHNQLEHTFQTQKRVKNIAKRLNKMHLEGLNNAINSTTVVAVLIATVAFAAI  372

Query  2114  ftvPGQYVEKEK---KGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             F +PGQYV+  +    G+ LGE N+A +  F +FF+FDSLALFIS+AVVVVQTS+VV+E+
Sbjct  373   FNLPGQYVDNREHIPPGYLLGEGNIAPQLPFAIFFIFDSLALFISLAVVVVQTSIVVVER  432

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             +AKKQM+ IINKLMW AC F+S+AF++L+Y+VVG  E+W+A   T +G  IM+TT+G++C
Sbjct  433   RAKKQMMSIINKLMWLACAFVSVAFLALSYIVVGKEERWMATAVTFMGTFIMVTTLGTLC  492

Query  2465  YCVVRHRLEESRMRNIRKAETLSRSFSMSMVP-SDSELYNESYKRMYAV  2608
             Y VV HR+E S +R++RK+   S+S S S+   S+SE+ ++ YK++YA+
Sbjct  493   YWVVMHRIESSNLRSLRKSARSSKSLSRSISIMSESEIADDEYKKLYAI  541



>ref|XP_009796770.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Nicotiana 
sylvestris]
Length=535

 Score =   501 bits (1289),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 285/525 (54%), Positives = 386/525 (74%), Gaps = 7/525 (1%)
 Frame = +2

Query  1052  KDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHT  1231
             K   GKR D  LH  ARAGNL ++REI+     + +++ L KQN  GET LYV+AE G+ 
Sbjct  12    KQLTGKREDTVLHSLARAGNLVEIREIIDNKGKEELEELLIKQNSAGETPLYVSAEYGYY  71

Query  1232  LVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTAL  1411
              +V E++   DL  A I + NG+DA HIAAKQG L+V+K L+   P L MT D++N+TAL
Sbjct  72    ELVKEMINYYDLVAAGIKARNGFDALHIAAKQGDLDVVKVLMGPHPELSMTVDNANTTAL  131

Query  1412  HTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRT  1591
             H+AA QGH++VV+ LLE + +LA IAR+NGKT LH+AAR GH++VVK+L+NK+  I  R 
Sbjct  132   HSAANQGHIEVVNYLLEAEKSLATIARSNGKTALHSAARNGHVQVVKALLNKERGIASRM  191

Query  1592  DKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISI  1771
             DKKGQTALHMAVKGQN+++V ELI+ D   + + D KGNTALHIA RKGR Q+V+ L+  
Sbjct  192   DKKGQTALHMAVKGQNLEVVEELIRADAKSINMADTKGNTALHIAARKGRAQIVKLLLGQ  251

Query  1772  EGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSA--AKQLKQTVSD  1945
             +  +   VN++ ETA+D AEK G  ++  +L+E+G   S    KP +   A++LKQTVSD
Sbjct  252   KETDTKAVNRSNETAIDTAEKMGQVNIAAILQESG-VQSIRAIKPQATNPARELKQTVSD  310

Query  1946  IKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvP  2125
             IKH+V  Q++ +R+T  ++  IAK++ K+H  GLNNAINS TVVAVLIATVA+AAIF+VP
Sbjct  311   IKHEVHYQMEHTRRTRKRIHDIAKRIDKMHAEGLNNAINSTTVVAVLIATVAYAAIFSVP  370

Query  2126  GQYVEKEK---KGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKK  2296
             GQY+E  +    G +LGEAN+A    F++FF+ DS+ALFIS+AVV+VQTS+VVIE KAKK
Sbjct  371   GQYIEYPEDIPPGHSLGEANIAPSPLFLIFFVLDSIALFISLAVVIVQTSIVVIESKAKK  430

Query  2297  QMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVV  2476
             QM+ IINKLMW AC+ IS+AF++L++VVVG  E+WLA+  T++G +I++ T+G++CY V+
Sbjct  431   QMMAIINKLMWLACVLISVAFLALSFVVVGKNEKWLAVVVTIIGTIILVATLGTLCYWVI  490

Query  2477  RHRLEESRMRNIRKAETLSRSFSMSM-VPSDSELYNESYKRMYAV  2608
              HR+E S  RNIRK    SRS S S  V SDS++ N  YK+MYA+
Sbjct  491   MHRIESSNKRNIRKNSLASRSLSWSASVVSDSDVLNNEYKKMYAI  535



>ref|XP_009358305.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Pyrus 
x bretschneideri]
 ref|XP_009358306.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Pyrus 
x bretschneideri]
Length=549

 Score =   501 bits (1290),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 306/530 (58%), Positives = 394/530 (74%), Gaps = 9/530 (2%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D PLH AAR+G ++ V +IL+  +   +K+ L+KQN   ETALYVAAE
Sbjct  22    KKMTKQLTGKRDDTPLHSAARSGRMAVVMDILENTEEGELKELLAKQNSSDETALYVAAE  81

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  +V E++K  DL  A I + NG+DAFHIAAKQG ++VL  L+   P L MT D SN
Sbjct  82    YGYVDLVREMIKYYDLANAGIKARNGFDAFHIAAKQGDMDVLNVLMEAHPELTMTVDLSN  141

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH++VV+ LLE  S+LA IAR+NGKT LH+AAR GHLEVVK+L++K+P I
Sbjct  142   TTALHTAAMQGHIEVVNFLLEAGSSLATIARSNGKTALHSAARNGHLEVVKALLDKEPGI  201

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               R DKKGQTALHMA KGQN+++V +LIK DPS++ + D K NTALHIATRKGR ++V+ 
Sbjct  202   ATRVDKKGQTALHMAAKGQNLEVVEQLIKADPSLINMVDGKDNTALHIATRKGRAEIVKM  261

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSA--AKQLKQ  1933
             L+     N   VNK+ ETALD AEK G PD+   L+E G   +K+  KP +   A++LKQ
Sbjct  262   LLEHSETNTKAVNKSAETALDTAEKTGNPDIKAFLQERGVQSAKE-IKPQATNPARELKQ  320

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH+V  QL+ +RQT  +V+ IAK++ K+H  GLNNAINS TVVAVLIATV FAAI
Sbjct  321   TVSDIKHEVHHQLEHTRQTRRRVQGIAKRLHKMHTEGLNNAINSNTVVAVLIATVTFAAI  380

Query  2114  ftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             F +PGQYV+  +    G +LGEAN+A K AFI+FF+FDS+ALFIS+AVVVVQTSVVVIE 
Sbjct  381   FQIPGQYVDDPEDIPAGQSLGEANIAPKLAFIIFFIFDSIALFISLAVVVVQTSVVVIES  440

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             KAKKQM+ IINKLMW AC+ +S+AF++L++VVVG R+ WLAI  T++G VIM  T+G+MC
Sbjct  441   KAKKQMMAIINKLMWLACVLVSVAFLALSFVVVG-RQTWLAIGVTIIGTVIMAATLGTMC  499

Query  2465  YCVVRHRLEESRM--RNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             + VVRHR+E   M        ++ SRS+S+S V S+SEL N  YK+MYA+
Sbjct  500   FWVVRHRIEAKNMRSIRRSSLDSRSRSWSLSAVMSESELLNNDYKKMYAI  549



>gb|KHN05690.1| Ankyrin repeat-containing protein [Glycine soja]
Length=558

 Score =   501 bits (1290),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 298/541 (55%), Positives = 390/541 (72%), Gaps = 18/541 (3%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D PLH AARAGN++ +++ +   +   ++  L+KQN  GET LYVAAE
Sbjct  18    KKMTKQLTGKRDDTPLHSAARAGNMTVLKDTVGGTEEGELRVLLTKQNHAGETVLYVAAE  77

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  +V E+++  DL  A I + NG+DA HIAAKQG L+++K L+   P L MT D SN
Sbjct  78    YGYVDMVRELIQYYDLAGAGIKARNGFDALHIAAKQGDLDIVKILMEAHPELSMTVDPSN  137

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TA+HTAA QGH ++V LLLE  SNLA I+R+NGKT LH+AAR GHLEVVK+L+ K+PS+
Sbjct  138   TTAVHTAALQGHTEIVKLLLEAGSNLATISRSNGKTALHSAARNGHLEVVKALLGKEPSV  197

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQ----  1747
               RTDKKGQTA+HMAVKGQ++++V ELIK DPS + + DNKGNTALHIATRKGR +    
Sbjct  198   ATRTDKKGQTAIHMAVKGQSLEVVEELIKADPSTINMVDNKGNTALHIATRKGRARVLVS  257

Query  1748  ------MVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPP  1909
                   +V+ L+     +   VN++GETALD AEK G  +V  +L E G   +K     P
Sbjct  258   SDLGLMIVKLLLGQTETDALVVNRSGETALDTAEKTGNSEVKDILLEHGVRRAKAIKAQP  317

Query  1910  --SAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvav  2083
               + A++LKQTVSDIKH+V  QL+ +RQT   V+ IAK++ K+H  GLNNAINS TVVAV
Sbjct  318   GTATARELKQTVSDIKHEVHYQLEHTRQTRRGVQGIAKRINKMHTEGLNNAINSTTVVAV  377

Query  2084  liatvafaaiftvPGQYVEKEK-----KGFTLGEANVANKAAFIVFFLFDSLALFISIAv  2248
             LIATVAFAAIFTVPGQ+ ++ K      G T+GEAN+A +AAF++FF+FDS+ALFIS+AV
Sbjct  378   LIATVAFAAIFTVPGQFADEPKDIPAGSGMTIGEANIAPQAAFLIFFVFDSIALFISLAV  437

Query  2249  vvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVG  2428
             VVVQTSVV+IE KAKKQM+ IINKLMW AC+ IS+AF++L++VVVG  ++WLAI  T++G
Sbjct  438   VVVQTSVVIIESKAKKQMMAIINKLMWLACVLISVAFLALSFVVVGKDQKWLAIGVTIIG  497

Query  2429  GVIMLTTIGSMCYCVVRHRLEESRMRNIRKAET-LSRSFSMSMVPSDSELYNESYKRMYA  2605
               IM TT+G+M Y V+RHR+E S +R+IRK+            V SDSEL N   K +YA
Sbjct  498   TTIMATTLGTMSYWVIRHRIEASNLRSIRKSSMGSRSRSFSVSVMSDSELLNNDRKILYA  557

Query  2606  V  2608
             +
Sbjct  558   I  558



>gb|KDP35568.1| hypothetical protein JCGZ_09006 [Jatropha curcas]
Length=537

 Score =   499 bits (1286),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 298/537 (55%), Positives = 395/537 (74%), Gaps = 11/537 (2%)
 Frame = +2

Query  1016  RQLSFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGE  1195
             RQ SF  + K  K    KR D+ LH AAR GNL  VRE++       +K+ LSKQNQ GE
Sbjct  6     RQKSFW-QTKMTKQLTKKRDDSLLHAAAREGNLEMVREMMSETAEAELKEMLSKQNQSGE  64

Query  1196  TALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNL  1375
             TALYVAAE GH  +V E++K  D  +ASI + NG DAFHIAAKQG LE L  L+   P+L
Sbjct  65    TALYVAAECGHADLVKEMMKYYDTGSASIKARNGCDAFHIAAKQGELETLVVLMEANPDL  124

Query  1376  VMTTDSSNSTALHTAAGQGHVDVVDLLLEI-DSNLAKIARNNGKTVLHTAARMGHLEVVK  1552
              MT DSSN+TALH+AA QGHV+VV+ LLE   SNL  IA++N KT LH+AAR GHLE++K
Sbjct  125   AMTYDSSNTTALHSAASQGHVEVVNFLLEKGSSNLVSIAKSNYKTALHSAARNGHLEILK  184

Query  1553  SLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATR  1732
             +LVNK+P I  R DKKGQTALHMAVKGQ V++V ELI  DP+++ + D+KGNTALHIA R
Sbjct  185   ALVNKEPGIATRIDKKGQTALHMAVKGQKVELVDELIMSDPALINMVDSKGNTALHIAAR  244

Query  1733  KGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKP--  1906
             KGR Q+V +L+  +G++   +NK+GETA D AEK G  +++++L++    HS    K   
Sbjct  245   KGRAQIVSKLLDHKGLDKIAINKSGETAFDSAEKTGHSEILSILEQ----HSVQSAKSMK  300

Query  1907  PSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavl  2086
             P+ A++LKQTVSDIKH+V +QLQ +R T  +V+ IAK+V K+H  GLNNAINS TVVAVL
Sbjct  301   PNTARELKQTVSDIKHEVHNQLQTTRITRKRVQGIAKRVNKMHTEGLNNAINSTTVVAVL  360

Query  2087  iatvafaaiftvPGQYVEKEK---KGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvv  2257
             IATVAFAAI+ VPGQ+ +  K    G + G+AN A++  F++F +FDS+ALFIS+AVVVV
Sbjct  361   IATVAFAAIYQVPGQFADDPKHLAPGQSAGQANAASRPEFMIFIIFDSIALFISLAVVVV  420

Query  2258  qtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVI  2437
             QTSVVVIE+KAKKQ++ +INKLMW AC+ ISIAF++L +VVVG +E+WLA++ T +G VI
Sbjct  421   QTSVVVIERKAKKQLMSVINKLMWLACVLISIAFLALAFVVVGNKERWLAVWITGIGTVI  480

Query  2438  MLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             M+TTIG+MCY V+  R+E S++R+IR++           + ++SE+    YK++YA+
Sbjct  481   MVTTIGTMCYWVIVQRIESSKLRSIRRSSMSRSLSGSMSIMAESEILENEYKKLYAI  537



>ref|XP_010542612.1| PREDICTED: ankyrin repeat-containing protein At5g02620 isoform 
X1 [Tarenaya hassleriana]
Length=544

 Score =   499 bits (1286),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 297/534 (56%), Positives = 386/534 (72%), Gaps = 21/534 (4%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D PLH A R G+L  V EIL +     ++D L KQNQ GETALYVAAE
Sbjct  21    KKMAKQLTGKREDTPLHSAVRRGSLEGVVEILTKTGEIELRDLLGKQNQPGETALYVAAE  80

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G   +V E++K  DL  A I + NG+DAFH+A+KQG L+VLK L    P L MT D SN
Sbjct  81    YGDVEIVKEMIKYYDLPLAEIKARNGFDAFHLASKQGDLDVLKVLAEAHPELAMTVDLSN  140

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH +VVD LLE+ S L  IA++NGKT LH+AAR GH+EVVK L+  +P+I
Sbjct  141   TTALHTAATQGHSEVVDFLLELGSGLVSIAKSNGKTALHSAARNGHVEVVKVLLETEPAI  200

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPD----PSVLALGDNKGNTALHIATRKGRPQ  1747
               RTDKKGQTALHMA KG NV +V ELIK D     S + + D KGNTALHIA RKGR +
Sbjct  201   AVRTDKKGQTALHMAAKGTNVTVVEELIKADRSSSSSSINMVDTKGNTALHIAARKGRTE  260

Query  1748  MVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSK-----DHGKPPS  1912
             +V+ L++ +  +   VN++GETALD AEK G P+V  +L+  G   +K      H  P  
Sbjct  261   IVRLLLANDVTDTKVVNRSGETALDTAEKIGNPEVAEILQTHGVQSAKTIKPQSHNNP--  318

Query  1913  AAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavlia  2092
              A++LKQTVSDIKH+V +QL+ +R+T   V+ IAK++ K+H  GLNNAINS TVVAVLIA
Sbjct  319   -ARELKQTVSDIKHEVHNQLEHTRKTRRHVQGIAKQLNKMHTEGLNNAINSTTVVAVLIA  377

Query  2093  tvafaaiftvPGQYVEKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvv  2272
             TVAFAAIFTVPGQYV+  ++G +LGEAN+A +  FI+F++FDS+ALFIS+AVVVVQTSVV
Sbjct  378   TVAFAAIFTVPGQYVDDPREGESLGEANIAKRTPFIIFYVFDSIALFISLAVVVVQTSVV  437

Query  2273  vIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTI  2452
             VIE KAKKQM+ +INKLMW AC+ +S+AF++L++VVVG  E+WLAI  T +G  IM+TT+
Sbjct  438   VIESKAKKQMMAVINKLMWMACVLVSVAFLALSFVVVGEEERWLAIGVTGIGASIMVTTL  497

Query  2453  GSMCYCVVRHRLEESRMRNIRKAETLSR--SFSMSMVPSDSELYNESYKRMYAV  2608
             G+MCY V++HR+E    R++R+    S+  S+++S   SDS++ N    +MYA+
Sbjct  498   GTMCYWVIQHRIEA---RSLRRCSMNSKSGSWAISSYVSDSDVLN----KMYAI  544



>ref|XP_006417764.1| hypothetical protein EUTSA_v10009425mg [Eutrema salsugineum]
 gb|ESQ36117.1| hypothetical protein EUTSA_v10009425mg [Eutrema salsugineum]
Length=543

 Score =   499 bits (1284),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 299/530 (56%), Positives = 386/530 (73%), Gaps = 7/530 (1%)
 Frame = +2

Query  1037  ERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAA  1216
             ++K  K   GKR D PLH A R GN   V EIL R     + + L KQNQ GETALYVAA
Sbjct  15    KKKMAKQLTGKRDDTPLHSAVRRGNKDDVVEILTRTRGTELNELLGKQNQSGETALYVAA  74

Query  1217  ENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSS  1396
             E G   +V E++   DL    I + NG+DAFHIAAKQG LEVLK L      L MT D  
Sbjct  75    EYGDVEIVKEMINCYDLALVEIKARNGFDAFHIAAKQGDLEVLKVLAQAHSELAMTVDLL  134

Query  1397  NSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPS  1576
             N+TALHTAA QGH +VV+ LLE+ S+LA IA++NGKT LH+A+R GH++V+K+L+  +P+
Sbjct  135   NTTALHTAATQGHTEVVNFLLELGSSLAGIAKSNGKTALHSASRNGHVQVIKALLASEPA  194

Query  1577  IGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQ  1756
             I  R DKKGQTALHMAVKG NV +V ELIK D S + + D KGNTALHIA RKGR Q+V+
Sbjct  195   IAIRMDKKGQTALHMAVKGTNVQVVEELIKADRSSINIADTKGNTALHIAARKGRSQIVR  254

Query  1757  RLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKP-PSAAKQLKQ  1933
              L++    +   VN+ GETALD AEK G PDV  +LK+ G   +K   +P P+ A++LKQ
Sbjct  255   LLLANNMTDTKAVNRTGETALDTAEKIGNPDVALILKKHGVPSAKTIQQPGPNPARELKQ  314

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH+V +QL+ +RQT  +V+ IAK++ K+H  GLNNAINS TVVAVLIATVAFAAI
Sbjct  315   TVSDIKHEVHNQLEHTRQTRKRVQGIAKQLNKMHTEGLNNAINSTTVVAVLIATVAFAAI  374

Query  2114  ftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             FTVPGQYVE   K   G +LGEAN+A+   FI+FF+FDS+ALFIS+AVVVVQTSVVVIE 
Sbjct  375   FTVPGQYVEDTSKIPDGHSLGEANIASTTPFIIFFIFDSIALFISLAVVVVQTSVVVIES  434

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             +AKKQM+ +INKLMW AC+ IS+AF++L++VVVG  E+WLAI  T +G  IM+TT+G+MC
Sbjct  435   RAKKQMMAVINKLMWLACVLISVAFLALSFVVVGEEEKWLAIGVTAIGATIMITTLGTMC  494

Query  2465  YCVVRHRLEESRMRNIRKAETLSRSFSMSMVP--SDSELYNESYKRMYAV  2608
             Y +++H++E +  RNIR++   S+S S   +P  +D+++     K+MYA+
Sbjct  495   YWIIQHKIEAANARNIRRSSINSKSGSWG-IPQLTDTDVLQNECKKMYAI  543



>ref|XP_008355149.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Malus 
domestica]
Length=549

 Score =   498 bits (1282),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 305/530 (58%), Positives = 394/530 (74%), Gaps = 9/530 (2%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D PLH AAR+G ++ V +IL+  +   +K+ L+KQN   ETALYVAAE
Sbjct  22    KKMTKQLTGKRDDTPLHSAARSGKMAVVMDILENTEEGELKELLAKQNSSDETALYVAAE  81

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  +V E++K  DL  A I + NG+DAFHIAAKQG ++VL  L++    L MT D SN
Sbjct  82    YGYVDLVREMIKYYDLTDAGIKARNGFDAFHIAAKQGDMDVLNALMDAHAELTMTVDLSN  141

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH++VV+ LLE  S+LA IAR+NGKT LH+AAR GHLEVVK+L++K+P I
Sbjct  142   TTALHTAATQGHIEVVNFLLEAGSSLATIARSNGKTALHSAARNGHLEVVKALLDKEPGI  201

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               R DKKGQTALHMA KGQN+++V +LIK DPS++ + D K NTALHIATRKGR ++V+ 
Sbjct  202   ATRVDKKGQTALHMAAKGQNLEVVEQLIKXDPSLINMVDGKDNTALHIATRKGRAEIVKM  261

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSA--AKQLKQ  1933
             L+     N   VNK+ ETALD AEK G PD+   L+E G   +K+  KP +   A++LKQ
Sbjct  262   LLEHSETNTKAVNKSAETALDTAEKTGNPDIKAFLQERGVQSAKE-IKPQATNPARELKQ  320

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH+V  QL+ +RQT  +V+ IAK++ K+H  GLNNAINS TVVAVLIATV FAAI
Sbjct  321   TVSDIKHEVHHQLEHTRQTRRRVQGIAKRLHKMHTEGLNNAINSNTVVAVLIATVTFAAI  380

Query  2114  ftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             F +PGQYV+  +    G +LGEAN+A K AFI+FF+FDS+ALFIS+AVVVVQTSVVVIE 
Sbjct  381   FQIPGQYVDDPEDIPAGQSLGEANIAPKLAFIIFFIFDSIALFISLAVVVVQTSVVVIES  440

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             KAKKQM+ IINKLMW AC+ +S+AF++L++VVVG R+ WLAI  T++G VIM  T+G+MC
Sbjct  441   KAKKQMMAIINKLMWLACVLVSVAFLALSFVVVG-RQTWLAIGVTIIGTVIMAATLGTMC  499

Query  2465  YCVVRHRLEESRM--RNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             + VVRHR+E   M        ++ SRS+S+S V S+SEL N  YK+MYA+
Sbjct  500   FWVVRHRIEAKNMRSIRRSSLDSRSRSWSLSAVMSESELLNNDYKKMYAI  549



>ref|XP_011077490.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat-containing protein 
At3g12360-like [Sesamum indicum]
Length=1146

 Score =   516 bits (1328),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 307/540 (57%), Positives = 398/540 (74%), Gaps = 7/540 (1%)
 Frame = +2

Query  1007  AMERQLSFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQ  1186
             A + Q SF  +++  K   GKR D  LH AARAGNL  V EI+     + +K  LSKQNQ
Sbjct  608   APDGQQSFH-KKQMKKQLTGKRDDTELHSAARAGNLEVVLEIIGGSGEEELKKLLSKQNQ  666

Query  1187  EGETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVF  1366
              GET LYVAAE GH  +V E++K  D+ +A+I + NGYDAFHIA+K G+L VL+ LL   
Sbjct  667   SGETVLYVAAECGHVDLVEEMIKYYDIGSAAIKARNGYDAFHIASKLGNLGVLRILLEAM  726

Query  1367  PNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEV  1546
             P L+ T D +N+T LHTA+ QGHV+VVD LLE +S+LA IARNNGKT LH++AR GH EV
Sbjct  727   PQLLATVDQANTTPLHTASAQGHVEVVDFLLERNSSLATIARNNGKTALHSSARNGHSEV  786

Query  1547  VKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIA  1726
             VK+L++K+P I   +DKKGQTALHMAVKG +  +V ELI  D ++L + D KGNTALHIA
Sbjct  787   VKALLSKEPGIATWSDKKGQTALHMAVKGNSTKVVDELIASDATLLTIVDGKGNTALHIA  846

Query  1727  TRKGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKD-HGK  1903
             TRKGRPQ+VQ L+  +GIN   +NK+GETA D AEK G  ++ ++L+E G   +K    +
Sbjct  847   TRKGRPQIVQTLLKHKGINKEAINKSGETAFDTAEKTGRSEIASILRECGVKSAKSLTPQ  906

Query  1904  PP-SAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvva  2080
             PP SAA++LKQTVSDIKH+V  QL+ +RQT  +VR IAK++ K+   GLNNAI S TVVA
Sbjct  907   PPASAARELKQTVSDIKHEVHDQLEHTRQTRRRVRGIAKRLNKMQSEGLNNAITSTTVVA  966

Query  2081  vliatvafaaiftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvv  2251
             VLIATVAFAAIFT+PGQYV+  K    GF+LGEAN+A    F  F      ALFIS+AVV
Sbjct  967   VLIATVAFAAIFTLPGQYVDDPKNVPPGFSLGEANIAPNIEFTTFLXXXXXALFISLAVV  1026

Query  2252  vvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGG  2431
             VVQTSVVV+E+KAKKQ++ +INKLMW AC F+S+AF++L Y++VG +E+WLAI  TV+G 
Sbjct  1027  VVQTSVVVVERKAKKQLMAVINKLMWLACAFVSVAFLALCYIIVGDQERWLAIGVTVIGT  1086

Query  2432  VIMLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSM-VPSDSELYNESYKRMYAV  2608
             VIM TT+G+MCY V+ HR+E S +R++R++   SRS S S+ V SDSE+  + YK++YA+
Sbjct  1087  VIMATTLGTMCYWVIMHRIEASNLRSLRRSARNSRSQSWSVSVLSDSEITGDDYKKLYAL  1146


 Score =   311 bits (796),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 218/506 (43%), Positives = 317/506 (63%), Gaps = 34/506 (7%)
 Frame = +2

Query  1016  RQLSFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKD----------  1165
             +++   G++K  K   G+  D  LHLAA+ G++  VR+I+   + + +K           
Sbjct  70    KKMDQSGKKKYVKQVTGRHNDTELHLAAQKGDVEAVRQIMGEINDQMLKTLGGAEFDAEV  129

Query  1166  ------TLSKQNQEGETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQ  1327
                    +++ N+ GETAL+ AAE G   VV E+L     E   + +++G+D  HIAA +
Sbjct  130   AEIRAAVVNEINELGETALFTAAERGCIDVVKELLPYSTREGIRLKNSSGFDPLHIAASR  189

Query  1328  GHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKT  1507
             GH +++  LL   P L  T   SN+T L +AA +GH+ VV+ LL  DS+L +I R+NGK 
Sbjct  190   GHRDIVHILLEHDPALSKTFGQSNATPLVSAATKGHLAVVNELLARDSSLLEIPRSNGKN  249

Query  1508  VLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLA  1687
              LH AAR GH +VVK L+ KDP +  RTDKKGQTALHMAVKG +  +V  L++ D +++ 
Sbjct  250   ALHLAARQGHADVVKELLKKDPQLARRTDKKGQTALHMAVKGVSCAVVKLLLQADRAIVM  309

Query  1688  LGDNKGNTALHIATRKGRPQMVQRLISIEGININTVNKAGETALDIAEKFG----TPDVV  1855
             L D  GNTALHIATRK R ++V  L+ +   N+N +++  +TALDIAE       T ++ 
Sbjct  310   LPDKFGNTALHIATRKKRAEIVNELLLLRDTNVNALSRDHKTALDIAEGLPLSEETLEIK  369

Query  1856  TMLKEAGATHSKDHGKPPSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLH  2035
               L   GA  + +  +P     +L+ TVS+IK DV +QL+Q+R+T   V  IAK+++KLH
Sbjct  370   QCLTHYGAVRANELNQPRD---ELRITVSEIKKDVHTQLEQARKTDKNVNGIAKELRKLH  426

Query  2036  ISGLNNAINSltvvavliatvafaaiftvPG--QYVEKEKKGFTLGEANVANKAAFIVFF  2209
               G+NNA NS+TVVAVL ATVAFAAIFTVPG   Y          GEA + +   F VFF
Sbjct  427   REGINNATNSVTVVAVLFATVAFAAIFTVPGGDDYN---------GEAVMVSSVPFKVFF  477

Query  2210  LFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGT  2389
             + +++ALF S+AVVVVQ +VV  E K+++++V +INKLMW A +  ++AFI+ +Y+V+G 
Sbjct  478   ISNAVALFTSLAVVVVQITVVRGEIKSERRVVEVINKLMWLASVCTTVAFIASSYIVIGR  537

Query  2390  REQWLAIYSTVVGGVIMLTTIGSMCY  2467
             R +W AI  TV+G V M   +G+M +
Sbjct  538   RYRWAAILVTVIGAVTMAGVLGAMTF  563



>ref|XP_010457974.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X3 [Camelina sativa]
Length=544

 Score =   496 bits (1277),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 297/530 (56%), Positives = 388/530 (73%), Gaps = 7/530 (1%)
 Frame = +2

Query  1037  ERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAA  1216
             ++K  K   GKR D  LH A R GN  KV EIL +     + + L KQNQ GETALYVAA
Sbjct  16    KKKMAKQLTGKREDTLLHSAVRQGNKDKVVEILTQTRESELDELLGKQNQSGETALYVAA  75

Query  1217  ENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSS  1396
             E G   +V E++K  DL    I + NG+DAFHIAAKQGHL+VLK L      L +T D S
Sbjct  76    EYGDVEIVKEMIKCYDLALVEIKARNGFDAFHIAAKQGHLDVLKVLAEAHSELALTVDLS  135

Query  1397  NSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPS  1576
             N+TALHTAA QGH +VV+ LLE+ S+LA IA++NGKT LH+A+R GH++V+K+L+  +P+
Sbjct  136   NTTALHTAATQGHTEVVNFLLELGSSLAGIAKSNGKTALHSASRNGHVKVIKALLASEPA  195

Query  1577  IGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQ  1756
             I  R DKKGQTALHMAVKG  V++V ELIK D S + + D KGNTALHIA RKGR Q+V+
Sbjct  196   IAVRMDKKGQTALHMAVKGTKVEVVEELIKADRSSINIADTKGNTALHIAARKGRSQIVK  255

Query  1757  RLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKD-HGKPPSAAKQLKQ  1933
              L++    +   VN++GETALD AEK G P+V  +L++ G   +K      P+ A++LKQ
Sbjct  256   LLLANNMTDTKAVNRSGETALDTAEKIGNPEVALILQKHGVPSAKTIKASGPNPARELKQ  315

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH+V +QL+ +R T  +V+ IAK++ K+H  GLNNAINS TVVAVLIATVAFAAI
Sbjct  316   TVSDIKHEVHNQLEHTRLTRKRVQGIAKQLNKMHTEGLNNAINSTTVVAVLIATVAFAAI  375

Query  2114  ftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             FTVPGQYVE   K   G +LGEAN+A+   FI+FF+FDS+ALFIS+AVVVVQTSVVVIE 
Sbjct  376   FTVPGQYVEDTSKIPDGHSLGEANIASTTPFIIFFIFDSIALFISLAVVVVQTSVVVIES  435

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             KAKKQM+ +INKLMW AC+ IS+AF++L++VVVG  E+WLAI+ T +G  IM+TT+G+MC
Sbjct  436   KAKKQMMAVINKLMWLACVLISVAFLALSFVVVGEEEKWLAIWVTAIGATIMITTLGTMC  495

Query  2465  YCVVRHRLEESRMRNIRKAETLSRSFSMSMVP--SDSELYNESYKRMYAV  2608
             Y +++HR+E +  RNIR++   S+S S   +P  +DS++     K+MYA+
Sbjct  496   YWIIQHRIEAANARNIRRSSINSKSGSWG-IPQLTDSDILQNECKKMYAI  544



>gb|ACJ85550.1| unknown [Medicago truncatula]
 gb|ACJ85665.1| unknown [Medicago truncatula]
 gb|AFK43200.1| unknown [Medicago truncatula]
Length=546

 Score =   495 bits (1275),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 301/530 (57%), Positives = 399/530 (75%), Gaps = 10/530 (2%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D PLH AARAGN++ +++ +   +   +++  +KQNQ GETALYVAAE
Sbjct  20    KKMTKQLTGKRDDTPLHSAARAGNMASLKDTVDGAEEGKLREIFAKQNQGGETALYVAAE  79

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  +V E+++  DL  A I + NG+DA HIAAKQG L+++K L+     L MT D SN
Sbjct  80    YGYVDMVREMIQYYDLADAGIKARNGFDALHIAAKQGDLDIVKILMEAHSELSMTVDPSN  139

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH ++V  LLE  S+LA IAR+NGKT LH+AAR GHLEVVK+++ K+P +
Sbjct  140   TTALHTAATQGHTEIVKYLLEAGSSLATIARSNGKTALHSAARNGHLEVVKAILEKEPGV  199

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQTALHMAVKGQ++ +V ELIK DPS + + DNKGNTALHIATRKGR Q+++ 
Sbjct  200   VTRTDKKGQTALHMAVKGQSLVVVEELIKADPSTINMVDNKGNTALHIATRKGRTQIIKL  259

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPP--SAAKQLKQ  1933
             ++     N   VNK+GETALD AEK G  +V ++L E G  +SK     P  +A ++LKQ
Sbjct  260   ILGQSETNGMAVNKSGETALDTAEKTGNSEVKSILTEHGVQNSKSIKSQPKTAATRELKQ  319

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH+V  QL+ +RQT   V+ IAK++ K+H  GLNNAINS TVVAVLIATVAFAAI
Sbjct  320   TVSDIKHEVHHQLEHTRQTRRSVQGIAKRLNKMHTEGLNNAINSTTVVAVLIATVAFAAI  379

Query  2114  ftvPGQYVE---KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             FTVPGQ+V+   K +KG +LGEAN+A++ AF+VF +FDS+ALFIS+AVVVVQTS+VV+E 
Sbjct  380   FTVPGQFVDDPKKVRKGKSLGEANIASEPAFLVFIVFDSVALFISLAVVVVQTSIVVVES  439

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             KAKKQM+ IINKLMW AC+ IS++F++L+++VVG +++WLAI  T++G  IM TT+G+M 
Sbjct  440   KAKKQMMAIINKLMWVACVLISVSFLALSFLVVGKKQRWLAIGVTIIGTTIMATTLGTMS  499

Query  2465  YCVVRHRLEESRMRNIRKAE--TLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             Y V+RHR+E S   +IRK+   + SRSFS+S+V SDSE+ N    +MYA+
Sbjct  500   YWVIRHRIEAS---SIRKSSMGSRSRSFSVSVVMSDSEILNNERTKMYAI  546



>ref|XP_003606581.1| Ankyrin repeat-containing protein [Medicago truncatula]
 gb|AES88778.1| ankyrin repeat plant protein [Medicago truncatula]
Length=546

 Score =   495 bits (1275),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 301/530 (57%), Positives = 398/530 (75%), Gaps = 10/530 (2%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D PLH AARAGN++ +++ +   +   +++  +KQNQ GETALYVAAE
Sbjct  20    KKMTKQLTGKRDDTPLHSAARAGNMASLKDTVDGAEEGKLREIFAKQNQGGETALYVAAE  79

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  +V E+++  DL  A I + NG+DA HIAAKQG L+++K L+     L MT D SN
Sbjct  80    YGYVDMVREMIQYYDLADAGIKARNGFDALHIAAKQGDLDIVKILMEAHSELSMTVDPSN  139

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH ++V  LLE  S+LA IAR+NGKT LH+AAR GHLEVVK+++ K+P +
Sbjct  140   TTALHTAATQGHTEIVKYLLEAGSSLATIARSNGKTALHSAARNGHLEVVKAILEKEPGV  199

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQTALHMAVKGQ++ +V ELIK DPS + + DNKGNTALHIATRKGR Q+++ 
Sbjct  200   VTRTDKKGQTALHMAVKGQSLVVVEELIKADPSTINMVDNKGNTALHIATRKGRTQIIKL  259

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPP--SAAKQLKQ  1933
             ++     N   VNK+GETALD AEK G  +V ++L E G   SK     P  +A ++LKQ
Sbjct  260   ILGQSETNGMAVNKSGETALDTAEKTGNSEVKSILTEHGVQSSKSIKSQPKTAATRELKQ  319

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH+V  QL+ +RQT   V+ IAK++ K+H  GLNNAINS TVVAVLIATVAFAAI
Sbjct  320   TVSDIKHEVHHQLEHTRQTRRSVQGIAKRLNKMHTEGLNNAINSTTVVAVLIATVAFAAI  379

Query  2114  ftvPGQYVE---KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             FTVPGQ+V+   K +KG +LGEAN+A++ AF+VF +FDS+ALFIS+AVVVVQTS+VV+E 
Sbjct  380   FTVPGQFVDDPKKVRKGKSLGEANIASEPAFLVFIVFDSVALFISLAVVVVQTSIVVVES  439

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             KAKKQM+ IINKLMW AC+ IS++F++L+++VVG +++WLAI  T++G  IM TT+G+M 
Sbjct  440   KAKKQMMAIINKLMWVACVLISVSFLALSFLVVGKKQRWLAIGVTIIGTTIMATTLGTMS  499

Query  2465  YCVVRHRLEESRMRNIRKAE--TLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             Y V+RHR+E S   +IRK+   + SRSFS+S+V SDSE+ N    +MYA+
Sbjct  500   YWVIRHRIEAS---SIRKSSMGSRSRSFSVSVVMSDSEILNNERTKMYAI  546



>ref|XP_006400885.1| hypothetical protein EUTSA_v10016051mg [Eutrema salsugineum]
 gb|ESQ42338.1| hypothetical protein EUTSA_v10016051mg [Eutrema salsugineum]
Length=546

 Score =   494 bits (1273),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 296/528 (56%), Positives = 383/528 (73%), Gaps = 13/528 (2%)
 Frame = +2

Query  1049  GKDSPGKRGDNPLHLAARAGNLSKVREILQRF--DSKAIKDTLSKQNQEGETALYVAAEN  1222
              K   GKR D+PLHLA R G+ S V++IL       + +++ L KQNQ GETALYVAAE 
Sbjct  24    AKQLTGKREDSPLHLAVRRGDFSAVKKILSDHMESDEELREVLQKQNQCGETALYVAAEY  83

Query  1223  GHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNS  1402
             G   VV E++K  DL  A   + NG+D FHIAAKQG LEVL+ L+   P L MT D SN+
Sbjct  84    GDAEVVAELIKYYDLADAETKARNGFDPFHIAAKQGELEVLRVLMEEHPELAMTVDLSNT  143

Query  1403  TALHTAAGQGHVDVVDLLLEI-DSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             TALHTAA QGHV+VV+ LLE   S+LA IA++NGKT LH+AAR GH EVVK++V  +P  
Sbjct  144   TALHTAAAQGHVEVVEYLLEAAGSSLAAIAKSNGKTALHSAARNGHAEVVKAIVAVEPDT  203

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQT LHMAVKGQ++D+VLEL+K   S L + D+KGNTALH+ATRKGR ++V+ 
Sbjct  204   ATRTDKKGQTPLHMAVKGQSLDVVLELMKGHRSSLNIVDSKGNTALHVATRKGRTKIVEL  263

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSK--DHGKPPSAAKQLKQ  1933
             L+     +   +N+AGET LD AEK G P++  +LK  G   +K  ++   P+AA++LKQ
Sbjct  264   LLENSETSTKAINRAGETPLDTAEKTGHPELAAVLKNRGVPSAKAINNTTRPNAARELKQ  323

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH+V  QL+ +R+T  +V+ IAK++ K+H+ GL+NAINS TVVAVLIATVAFAAI
Sbjct  324   TVSDIKHEVHHQLEHARETRKRVQGIAKRINKMHVEGLDNAINSTTVVAVLIATVAFAAI  383

Query  2114  ftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             FTVPGQY ++        TLGEAN+A++ AF +FF+FDS+ALFIS+AVVVVQTSVV IE 
Sbjct  384   FTVPGQYADELSSLSPRQTLGEANIADRPAFAIFFVFDSIALFISLAVVVVQTSVVAIEH  443

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             KAKK M+ +INKLMW AC+ ISIAF++L +VVVG  E+WLA+  TV G  IMLTTIG+MC
Sbjct  444   KAKKNMMAVINKLMWLACVLISIAFLALAFVVVGEEERWLAVGVTVFGATIMLTTIGTMC  503

Query  2465  YCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             Y V+ HR+E S +R+ R+ E+++RS    ++     L     KRMYA+
Sbjct  504   YWVIMHRIEASNVRSARR-ESMARSRQSGLLDFSGIL----TKRMYAI  546



>gb|ACR34761.1| unknown [Zea mays]
 tpg|DAA44736.1| TPA: hypothetical protein ZEAMMB73_954459 [Zea mays]
Length=562

 Score =   495 bits (1274),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 291/535 (54%), Positives = 393/535 (73%), Gaps = 15/535 (3%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D  +H AARAG L  +R+++   D++ +   LS+QNQ GET L+VAAE
Sbjct  31    KKMTKQLTGKRDDTAMHAAARAGQLESMRQMMSGKDAEELGALLSRQNQAGETPLFVAAE  90

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  +V E++K  D+ TA I + +GYDA HIAAKQG ++V++ELL   P L MT DSSN
Sbjct  91    YGYVALVAEMIKYHDVATAGIKARSGYDALHIAAKQGDVDVVRELLRALPQLSMTVDSSN  150

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TAL+TAA QGH+DVV LLLE+D +LA IAR+NGKT LH+AAR GH+EVV++L+  +PSI
Sbjct  151   TTALNTAATQGHMDVVRLLLEVDGSLALIARSNGKTALHSAARNGHVEVVRALLEAEPSI  210

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQTALHMA KG  +D+V  L+  +P++L   D+KGNTALHIA RK R ++++R
Sbjct  211   ALRTDKKGQTALHMAAKGTRLDLVDALLAAEPALLNQTDSKGNTALHIAARKARHEIIRR  270

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSA--------  1915
             L+++   ++  +N++ ET LD AEK G  D   +L E G   ++     P          
Sbjct  271   LVTMPDTDVRAINRSRETPLDTAEKMGNTDAAELLAEHGVQSAR--AISPCGGGGGGNKQ  328

Query  1916  AKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliat  2095
             A++LKQ VSDIKH+V SQL+Q+RQT  +++ IAK++ KLH  GLNNAINS TVVAVLIAT
Sbjct  329   ARELKQQVSDIKHEVHSQLEQTRQTRVRMQGIAKRINKLHEEGLNNAINSTTVVAVLIAT  388

Query  2096  vafaaiftvPGQYVEKE---KKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqts  2266
             VAFAAIFTVPG+YV+       G  LGEAN++++ AFI+FF+FDS++LFIS+AVVVVQTS
Sbjct  389   VAFAAIFTVPGEYVQDPGSLAPGHDLGEANISHQTAFIIFFVFDSVSLFISLAVVVVQTS  448

Query  2267  vvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLT  2446
             VVVIE+KAKKQM+ +INKLMW AC+ IS++F++L++VVVG  E+WLA+  T++G  I++T
Sbjct  449   VVVIERKAKKQMMAVINKLMWVACVLISVSFLALSFVVVGRTERWLAVSVTIMGATILVT  508

Query  2447  TIGSMCYCVVRHRLEESRMRNI-RKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             TIG+M Y V+ HR+E  R+R I R   T SRSFS S + S+ E  +E +KRMYA+
Sbjct  509   TIGTMLYWVIAHRIEAKRIRTIKRNTLTHSRSFSCSGM-SEGEWVDEDFKRMYAI  562



>ref|XP_006345675.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Solanum 
tuberosum]
Length=541

 Score =   494 bits (1271),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 282/529 (53%), Positives = 386/529 (73%), Gaps = 6/529 (1%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKRGD  +H   R+GNL  V EI+       + + LSKQNQ GE ALYVAAE
Sbjct  13    KKMTKQLTGKRGDTQIHSVVRSGNLELVLEIITCCGEAELVELLSKQNQSGENALYVAAE  72

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
             +G  ++V E++K  D+  ASI + NGYDAFH+AAKQG  E++K LL  FP L +T D SN
Sbjct  73    SGDLVLVKELIKYYDIGLASIKARNGYDAFHVAAKQGDFEMVKVLLEAFPQLSVTFDQSN  132

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             STALHTA+ QGH+DVV+ LLE +S+LA I +NNGKT LH++AR GH+ VVK+L++K+  I
Sbjct  133   STALHTASAQGHIDVVNFLLETNSSLATIQKNNGKTALHSSARNGHVAVVKALLSKEEGI  192

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
                 DKKGQTALHMAVKGQ+VD+V ELI  DP++  + D KGNT+LHIATRKGR ++VQ 
Sbjct  193   LNWRDKKGQTALHMAVKGQSVDVVNELILSDPTLATIIDGKGNTSLHIATRKGRVEIVQA  252

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDH--GKPPSAAKQLKQ  1933
             L+  + +  + +NK+GETALD+AEK    ++  +LKE G   +K+     P  +AK+LKQ
Sbjct  253   LVKDKRMKWDAINKSGETALDVAEKARNSEIAAILKEHGVLTAKNMKLALPTRSAKELKQ  312

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKHDV +QL+ + QT  +V+ IAK++ K+H  G+NNAINS TVVAVLIATV FAAI
Sbjct  313   TVSDIKHDVHNQLEHTFQTQKRVKNIAKRLNKMHTEGINNAINSTTVVAVLIATVTFAAI  372

Query  2114  ftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             F +PGQY +  K+   G+++GE  +A +  F++FF+FDSLALFIS+AVVVVQTS+VV+E+
Sbjct  373   FNLPGQYTDNPKEVPPGYSIGEGRIAPQPPFVIFFIFDSLALFISLAVVVVQTSIVVVER  432

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             +AKKQM+ IINKLMW AC+F+S+AF++L+Y+V+G  E+W+A   T +G  IM+ T+G++C
Sbjct  433   RAKKQMMAIINKLMWLACVFVSVAFLALSYIVIGKDERWMASAVTFMGTFIMVATLGTLC  492

Query  2465  YCVVRHRLEESRMRNIR-KAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             Y VV HR+E S +R+ R  A +         + S+SE+  + YK++YA+
Sbjct  493   YWVVMHRIESSNLRSQRKSARSSKSLSRSVSIMSESEIPEDQYKKLYAI  541



>ref|XP_010475540.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Camelina 
sativa]
Length=556

 Score =   493 bits (1270),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 296/530 (56%), Positives = 388/530 (73%), Gaps = 7/530 (1%)
 Frame = +2

Query  1037  ERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAA  1216
             ++K  K   GKR D  LH A R GN  KV EIL +     + + L KQNQ GETALYVAA
Sbjct  16    KKKMAKQLTGKREDTLLHSAVRQGNKDKVVEILTQTRESELNELLGKQNQSGETALYVAA  75

Query  1217  ENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSS  1396
             E G   +V E++K  DL    I + NG+DAFHIAAKQGHL+VLK L      L MT D S
Sbjct  76    EYGDVEIVKEMIKCYDLALVEIKARNGFDAFHIAAKQGHLDVLKVLAEAHSELAMTVDLS  135

Query  1397  NSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPS  1576
             N+TALHTAA QGH +VV+ LLE+ S+LA IA++NGKT LH+A+R GH++V+K+L+  +P+
Sbjct  136   NTTALHTAATQGHTEVVNFLLELGSSLAGIAKSNGKTALHSASRNGHVKVIKALLASEPA  195

Query  1577  IGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQ  1756
             I  R DKKGQTALHMAVKG NV++V ELIK D S + + D KGNTALHIA RKGR Q+V+
Sbjct  196   IAVRMDKKGQTALHMAVKGTNVEVVEELIKADRSSINIADTKGNTALHIAARKGRSQIVK  255

Query  1757  RLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKD-HGKPPSAAKQLKQ  1933
              L++    +   VN++GETALD AEK G P+V  +L++ G   +K      P+ A++LKQ
Sbjct  256   LLLANNMTDTKAVNRSGETALDTAEKIGNPEVALILQKHGVPSAKTIKASGPNPARELKQ  315

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH+V +QL+ +R T  +V+ IAK++ K+H  GLNNAINS TVVAVLIATVAFAAI
Sbjct  316   TVSDIKHEVHNQLEHTRLTRKRVQGIAKQLNKMHTEGLNNAINSTTVVAVLIATVAFAAI  375

Query  2114  ftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             FTVPGQYVE+  K   G +LGEAN+A+   FI+FF+FDS+ALFIS+AVVVVQTSVVVIE 
Sbjct  376   FTVPGQYVEETSKIPDGHSLGEANIASTTPFIIFFIFDSIALFISLAVVVVQTSVVVIES  435

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             KAKKQM+ +INKLMW AC+ IS+AF++L++VVVG  E+WLAI+ T +G  IM+TT+G+MC
Sbjct  436   KAKKQMMAVINKLMWLACVLISVAFLALSFVVVGEEEKWLAIWVTAIGATIMITTLGTMC  495

Query  2465  YCVVRHRLEESRMRNIRKAETLSRSFSMSMVP--SDSELYNESYKRMYAV  2608
             Y +++HR+E +  RNIR++   S+S S   +P  +DS++     K++  +
Sbjct  496   YWIIQHRIEAANARNIRRSSINSKSGSWG-IPQLTDSDILQNECKKITGI  544



>ref|XP_010455898.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Camelina 
sativa]
Length=548

 Score =   492 bits (1267),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 299/533 (56%), Positives = 385/533 (72%), Gaps = 15/533 (3%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRF--DSKAIKDTLSKQNQEGETALYVA  1213
             +K  K   GKR D+PLH A R G+ S V EIL       + + + L KQNQ GETALYVA
Sbjct  21    KKMAKQLTGKREDSPLHSAVRRGDFSAVNEILSNHMESEEELSELLRKQNQCGETALYVA  80

Query  1214  AENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDS  1393
             AE G   VV E++K  DLE A   + NG+D FHIAAKQG L+VL+ L+   P L MT D 
Sbjct  81    AEYGDAEVVAELIKYYDLEDAETKARNGFDPFHIAAKQGELDVLRVLMEEHPELAMTVDL  140

Query  1394  SNSTALHTAAGQGHVDVVDLLLEI-DSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKD  1570
             SN+TALHTAA QGHV+VV+ LLE   S+LA IA++NGKT LH+AAR GH EVVK++V  +
Sbjct  141   SNTTALHTAAAQGHVEVVEYLLEAAGSSLAAIAKSNGKTALHSAARNGHAEVVKAIVAVE  200

Query  1571  PSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQM  1750
             P    RTDKKGQT LHMAVKGQ++D+V+EL+K   S L + D+KGNTALH+ATRKGR ++
Sbjct  201   PDTATRTDKKGQTPLHMAVKGQSIDVVVELMKGHRSSLNMVDSKGNTALHVATRKGRIKI  260

Query  1751  VQRLISIEGININT--VNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKP--PSAA  1918
             V+ L+     + +T  +N+AGET LD AEK G P++  +LK  G   +K    P  P+AA
Sbjct  261   VELLLDNNETSTSTTAINRAGETPLDTAEKTGHPEIAAVLKTRGVPSAKAMNNPTRPNAA  320

Query  1919  KQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatv  2098
             ++LKQTVSDIKH+V  QL+ +R+T  +V+ IAK++ K+HI GL+NAINS TVVAVLIATV
Sbjct  321   RELKQTVSDIKHEVHHQLEHARETRKRVQGIAKRINKMHIEGLDNAINSTTVVAVLIATV  380

Query  2099  afaaiftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsv  2269
             AFAAIFTVPGQY ++      G +LGEAN+A++ AF +FF+FDS+ALFIS+AVVVVQTSV
Sbjct  381   AFAAIFTVPGQYADELSSLSPGQSLGEANIADRPAFAIFFIFDSIALFISLAVVVVQTSV  440

Query  2270  vvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTT  2449
             V IEQKAKK M+ +INKLMW AC+ IS+AF++L +VVVG  E+WLA+  TV G  IMLTT
Sbjct  441   VAIEQKAKKNMMAVINKLMWLACVLISVAFLALAFVVVGEDERWLAVGVTVFGATIMLTT  500

Query  2450  IGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             +G+MCY V+ HR+E S +R  RK E+++RS    ++    E      KRMYA+
Sbjct  501   LGTMCYWVIMHRIEASNVRKSRK-ESMARSRQSGLL----EFSGMLTKRMYAI  548



>ref|XP_006306426.1| hypothetical protein CARUB_v10012363mg [Capsella rubella]
 gb|EOA39324.1| hypothetical protein CARUB_v10012363mg [Capsella rubella]
Length=543

 Score =   491 bits (1264),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 294/530 (55%), Positives = 388/530 (73%), Gaps = 7/530 (1%)
 Frame = +2

Query  1037  ERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAA  1216
             ++K  K   GKR D  LH A R G+  +V EIL +     + + L KQNQ GETALYVAA
Sbjct  15    KKKMAKQLTGKREDTLLHSAVRRGDKDRVVEILTQTRESELDELLGKQNQSGETALYVAA  74

Query  1217  ENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSS  1396
             E G   +V E++   DL    I + NG+DAFHIAAKQG L+VLK L      L MT D S
Sbjct  75    EYGDVDIVKEMINCYDLALVEIKARNGFDAFHIAAKQGDLDVLKVLAEAHSELAMTVDLS  134

Query  1397  NSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPS  1576
             N+TALHTAA QGH +VV+ LLE+ S+LA IA++NGKT LH+A+R GH++V+K+L+  +P+
Sbjct  135   NTTALHTAATQGHTEVVNFLLELGSSLAGIAKSNGKTALHSASRNGHVKVIKALLASEPA  194

Query  1577  IGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQ  1756
             I  R DKKGQTALHMAVKG NV++V ELIK D S + + D KGNTALHIA+RKGR Q+V+
Sbjct  195   IAIRMDKKGQTALHMAVKGTNVEVVEELIKADRSSINIADTKGNTALHIASRKGRSQIVK  254

Query  1757  RLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKD-HGKPPSAAKQLKQ  1933
              L++    +   VN++GETALD AEK G P+V  +L++ G   +K      P+ A++LKQ
Sbjct  255   LLLANNMTDTKAVNRSGETALDTAEKIGNPEVALILQKHGVPSAKTIKASGPNPARELKQ  314

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH+V +QL+ +R T  +V+ IAK++ K+H  GLNNAINS TVVAVLIATVAFAAI
Sbjct  315   TVSDIKHEVHNQLEHTRVTRKRVQGIAKQLNKMHTEGLNNAINSTTVVAVLIATVAFAAI  374

Query  2114  ftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             FTVPGQYVE   K   G +LGEAN+A+   FI+FF+FDS+ALFIS+AVVVVQTSVVVIE 
Sbjct  375   FTVPGQYVEDTSKIPDGHSLGEANIASTTPFIIFFIFDSIALFISLAVVVVQTSVVVIES  434

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             KAKKQM+ +INKLMW AC+ IS+AF++L++VVVG  E+WLAI+ T +G  IM+TT+G+MC
Sbjct  435   KAKKQMMAVINKLMWLACVLISVAFLALSFVVVGEEEKWLAIWVTAIGATIMITTLGTMC  494

Query  2465  YCVVRHRLEESRMRNIRKAETLSRSFSMSMVP--SDSELYNESYKRMYAV  2608
             Y +++H++E +  RNIR++   S+S S   +P  +DS++     K+MYA+
Sbjct  495   YWIIQHKIEAANARNIRRSSIHSKSGSWG-IPQLTDSDILQNECKKMYAI  543



>ref|XP_010487878.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X2 [Camelina sativa]
 ref|XP_010487886.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X2 [Camelina sativa]
 ref|XP_010487894.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X2 [Camelina sativa]
Length=574

 Score =   492 bits (1267),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 297/545 (54%), Positives = 393/545 (72%), Gaps = 7/545 (1%)
 Frame = +2

Query  1037  ERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAA  1216
             ++K  K   GKR D  LH A R GN  KV EIL +     + + L KQNQ GETALYV A
Sbjct  16    KKKMAKQLTGKREDTLLHSAVRQGNKDKVVEILTQTRESELNELLGKQNQSGETALYVVA  75

Query  1217  ENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSS  1396
             E G   +V E++K  DL    I + NG+DAFHIAAKQGHL+VLK L      L MT D S
Sbjct  76    EYGDVEIVKEMIKCYDLALVEIKARNGFDAFHIAAKQGHLDVLKVLAEAHSELAMTVDLS  135

Query  1397  NSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPS  1576
             N+TALHTAA QGH +VV+ LLE+ S+LA IA++NGKT LH+A+R GH++V+K+L+  +P+
Sbjct  136   NTTALHTAATQGHTEVVNFLLELGSSLAGIAKSNGKTALHSASRNGHVKVIKALLASEPA  195

Query  1577  IGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQ  1756
             I  R DKKGQTALHMAVKG NV++V ELIK D S + + D KGNTALHIA RKGR Q+V+
Sbjct  196   IAVRMDKKGQTALHMAVKGTNVEVVEELIKADRSSINIADTKGNTALHIAARKGRSQIVK  255

Query  1757  RLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKD-HGKPPSAAKQLKQ  1933
              L++    +   VN++GETALD AEK G P+V  +L++ G   +K      P+ A++LKQ
Sbjct  256   LLLANNMTDTKAVNRSGETALDTAEKIGNPEVALILQKHGVPSAKTIKASGPNPARELKQ  315

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH+V +QL+ +R T  +V+ IAK++ K+H  GLNNAINS TVVAVLIATVAFAAI
Sbjct  316   TVSDIKHEVHNQLEHTRLTRKRVQGIAKQLNKMHTEGLNNAINSTTVVAVLIATVAFAAI  375

Query  2114  ftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             FTVPGQYVE+  K   G +LGEAN+A+   FI+FF+FDS+ALFIS+AVVVVQTSVVVIE 
Sbjct  376   FTVPGQYVEETSKIPDGHSLGEANIASTIPFIIFFIFDSIALFISLAVVVVQTSVVVIES  435

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             KAKKQM+ +INKLMW AC+ IS+AF++L++VVVG  E+WLAI+ T +G  IM+TT+G+MC
Sbjct  436   KAKKQMMAVINKLMWLACVLISVAFLALSFVVVGEEEKWLAIWVTAIGATIMITTLGTMC  495

Query  2465  YCVVRHRLEESRMRNIRKAETLSRSFSMSMVP--SDSELYNESYKRMYAV*KQTELESIE  2638
             Y +++HR+E +  RNIR++   S+S S   +P  +DS++     K++  + +  E+    
Sbjct  496   YWIIQHRIEAANARNIRRSSINSKSGSWG-IPQLTDSDILQNECKKITGIEELPEMLCTP  554

Query  2639  KTTIR  2653
             +  I+
Sbjct  555   RNRIK  559



>ref|XP_010542613.1| PREDICTED: ankyrin repeat-containing protein At5g02620 isoform 
X2 [Tarenaya hassleriana]
Length=537

 Score =   490 bits (1261),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 294/534 (55%), Positives = 382/534 (72%), Gaps = 28/534 (5%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D PLH A R G+L  V EIL +     ++D L KQNQ GETALYVAAE
Sbjct  21    KKMAKQLTGKREDTPLHSAVRRGSLEGVVEILTKTGEIELRDLLGKQNQPGETALYVAAE  80

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G   +V E++K  DL  A I + NG+DAFH+A+KQG LE         P L MT D SN
Sbjct  81    YGDVEIVKEMIKYYDLPLAEIKARNGFDAFHLASKQGDLEA-------HPELAMTVDLSN  133

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH +VVD LLE+ S L  IA++NGKT LH+AAR GH+EVVK L+  +P+I
Sbjct  134   TTALHTAATQGHSEVVDFLLELGSGLVSIAKSNGKTALHSAARNGHVEVVKVLLETEPAI  193

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPD----PSVLALGDNKGNTALHIATRKGRPQ  1747
               RTDKKGQTALHMA KG NV +V ELIK D     S + + D KGNTALHIA RKGR +
Sbjct  194   AVRTDKKGQTALHMAAKGTNVTVVEELIKADRSSSSSSINMVDTKGNTALHIAARKGRTE  253

Query  1748  MVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSK-----DHGKPPS  1912
             +V+ L++ +  +   VN++GETALD AEK G P+V  +L+  G   +K      H  P  
Sbjct  254   IVRLLLANDVTDTKVVNRSGETALDTAEKIGNPEVAEILQTHGVQSAKTIKPQSHNNP--  311

Query  1913  AAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavlia  2092
              A++LKQTVSDIKH+V +QL+ +R+T   V+ IAK++ K+H  GLNNAINS TVVAVLIA
Sbjct  312   -ARELKQTVSDIKHEVHNQLEHTRKTRRHVQGIAKQLNKMHTEGLNNAINSTTVVAVLIA  370

Query  2093  tvafaaiftvPGQYVEKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvv  2272
             TVAFAAIFTVPGQYV+  ++G +LGEAN+A +  FI+F++FDS+ALFIS+AVVVVQTSVV
Sbjct  371   TVAFAAIFTVPGQYVDDPREGESLGEANIAKRTPFIIFYVFDSIALFISLAVVVVQTSVV  430

Query  2273  vIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTI  2452
             VIE KAKKQM+ +INKLMW AC+ +S+AF++L++VVVG  E+WLAI  T +G  IM+TT+
Sbjct  431   VIESKAKKQMMAVINKLMWMACVLVSVAFLALSFVVVGEEERWLAIGVTGIGASIMVTTL  490

Query  2453  GSMCYCVVRHRLEESRMRNIRKAETLSR--SFSMSMVPSDSELYNESYKRMYAV  2608
             G+MCY V++HR+E    R++R+    S+  S+++S   SDS++ N    +MYA+
Sbjct  491   GTMCYWVIQHRIE---ARSLRRCSMNSKSGSWAISSYVSDSDVLN----KMYAI  537



>gb|EYU38487.1| hypothetical protein MIMGU_mgv1a004270mg [Erythranthe guttata]
Length=535

 Score =   490 bits (1261),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 292/500 (58%), Positives = 371/500 (74%), Gaps = 10/500 (2%)
 Frame = +2

Query  1019  QLSFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREIL--QRFDSKAIKDTLSKQNQEG  1192
             Q SF  +++  K   GKR D  LH AAR+GNL  V EI+  +    + ++  L KQNQ G
Sbjct  7     QQSFP-KKQMKKQLTGKRDDTALHSAARSGNLELVLEIINGESVGEEELRKLLCKQNQSG  65

Query  1193  ETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPN  1372
             ETALYVAAE GH  +V E +K  D+ +A+I +  G+DAFHIAAK G L+VLK L+   P 
Sbjct  66    ETALYVAAECGHVNLVQEFVKYYDVGSAAIKAK-GFDAFHIAAKLGELDVLKVLMEAIPQ  124

Query  1373  LVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVK  1552
             L+ T D SN+TALHTAA QGH++VV  LLE +S+LA IARNNGKT LH++AR GH EVVK
Sbjct  125   LLATVDQSNTTALHTAAAQGHIEVVGFLLEKNSSLATIARNNGKTALHSSARNGHFEVVK  184

Query  1553  SLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATR  1732
             SL++K+P I   +DKKGQTALHMAVKG N  ++ ELI  D S+L + D KGNTALHIATR
Sbjct  185   SLLSKEPGIAVWSDKKGQTALHMAVKGNNTQVIDELISSDASLLTISDGKGNTALHIATR  244

Query  1733  KGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPS  1912
             KGRPQ+VQ L+  +G+N   +NK+GETALD AEK G  DV T+L+E G  ++K       
Sbjct  245   KGRPQIVQTLLKHKGLNKEAINKSGETALDTAEKSGHSDVATILRENGVKNAKS---LTP  301

Query  1913  AAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavlia  2092
              A++LKQTVSDIKH+V  QL+ +RQT  KVR IAK++ K+   GLNNAI S TVVAVLIA
Sbjct  302   QARELKQTVSDIKHEVHDQLEHTRQTRKKVRGIAKRLNKMQSEGLNNAITSTTVVAVLIA  361

Query  2093  tvafaaiftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqt  2263
             TVAFAAIFTVPGQYV+  K    GF+ GEAN+A    F +F +FDSLALFIS+AVV+VQT
Sbjct  362   TVAFAAIFTVPGQYVDDPKNIPAGFSAGEANIAPNVEFTIFLIFDSLALFISLAVVIVQT  421

Query  2264  svvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIML  2443
             SVVV+E+KAKKQ++ +INKLMW AC+F+S+AF++L Y+VVG  E+WLAI  T++G +IM 
Sbjct  422   SVVVVERKAKKQLMAVINKLMWLACVFVSVAFLALCYIVVGDGERWLAIGVTIIGTLIMA  481

Query  2444  TTIGSMCYCVVRHRLEESRM  2503
             TT+G++CY VV HR+E S +
Sbjct  482   TTLGTLCYWVVMHRIEASNL  501



>gb|KDP44171.1| hypothetical protein JCGZ_05638 [Jatropha curcas]
Length=541

 Score =   490 bits (1261),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 303/534 (57%), Positives = 382/534 (72%), Gaps = 7/534 (1%)
 Frame = +2

Query  1025  SFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETAL  1204
             S    +K  K   GK+ D PLH AARAGNL+   EIL       +K+ L KQNQ GETAL
Sbjct  9     SSAPRKKITKQLTGKKDDTPLHSAARAGNLAAAMEILTGTQEAELKELLEKQNQSGETAL  68

Query  1205  YVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMT  1384
             YVAAE G+  +V E++K  DL  ASI + NG+DAFHIAAKQG L++L  L+   P L MT
Sbjct  69    YVAAEYGYVDLVREMIKYYDLSDASIKARNGFDAFHIAAKQGDLDILAILMEAHPELAMT  128

Query  1385  TDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVN  1564
              D SN+TALHTAA QGH++VV LLL   S+LA IAR+NGKT LH+AAR GHLEVV++LV 
Sbjct  129   VDLSNTTALHTAATQGHIEVVRLLLNAGSSLATIARSNGKTALHSAARNGHLEVVRALVA  188

Query  1565  KDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRP  1744
              +P I  R DKKGQTALHMAVKGQNV++V ELI  +PS + + D KGNTALHIATRKGR 
Sbjct  189   MEPGIVIRVDKKGQTALHMAVKGQNVEVVEELINAEPSSVNMVDTKGNTALHIATRKGRT  248

Query  1745  QMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKP--PSAA  1918
             ++V  L+     +   VN+ GETA D AEK G  DV  +L+E G   S    KP   + A
Sbjct  249   KIVMLLLRCNQTDTKAVNRTGETAFDTAEKTGHSDVAAILREHG-VQSATIIKPELTNPA  307

Query  1919  KQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatv  2098
             ++LKQTVSDIKH+V  QL+ +RQT  +V+ IAK++ K+H  GLNNAINS TVVAVLIATV
Sbjct  308   RELKQTVSDIKHEVHYQLEHTRQTRKRVQGIAKRLNKMHTEGLNNAINSTTVVAVLIATV  367

Query  2099  afaaiftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsv  2269
             AFAAIFTVPGQYVE + +   G +LG AN+A +A F++FF+FDS+ALFIS+AVV+VQTSV
Sbjct  368   AFAAIFTVPGQYVEDQNEMPPGQSLGAANIARRAPFLIFFVFDSIALFISLAVVIVQTSV  427

Query  2270  vvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTT  2449
             VVIE KAKKQM+ IINKLMW AC  IS+AF++L+++VVG  E WLAI  T++G  IM+TT
Sbjct  428   VVIESKAKKQMMAIINKLMWLACALISVAFLALSFIVVGKHEIWLAISVTIIGTGIMVTT  487

Query  2450  IGSMCYCVVRHRLEESRM-RNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             +G+MCY V++HR+E S M    R +           + SD+++    YK+MYA+
Sbjct  488   LGTMCYWVIKHRIEASNMRSIRRSSLGSRSRSFSMSMMSDTDIITNEYKKMYAI  541



>ref|NP_172250.1| ankyrin repeats-containing protein [Arabidopsis thaliana]
 gb|AAF75083.1|AC007583_19 It contains Ank repeat PF|00023. EST gb|AI996003 comes from this 
gene [Arabidopsis thaliana]
 gb|AEE28168.1| ankyrin repeats-containing protein [Arabidopsis thaliana]
Length=543

 Score =   489 bits (1260),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 297/531 (56%), Positives = 388/531 (73%), Gaps = 9/531 (2%)
 Frame = +2

Query  1037  ERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAA  1216
             ++K  K   GKR D  LH A R GN  +V EIL +     +   L KQNQ GETALYVAA
Sbjct  15    KKKMMKQLTGKRDDTLLHSAVRHGNKDRVVEILTKTRESELNQLLGKQNQSGETALYVAA  74

Query  1217  ENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSS  1396
             E G   +V E++   DL    I + NG+DAFHIAAKQG L+VLK L      L MT D S
Sbjct  75    EYGDVEIVKEMINCYDLALVEIKARNGFDAFHIAAKQGDLDVLKVLAEAHSELAMTVDLS  134

Query  1397  NSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPS  1576
             N+TALHTAA QGH +VV+ LLE+ S+LA IA++NGKT LH+A+R GH++V+K+L+  +P+
Sbjct  135   NTTALHTAATQGHTEVVNFLLELGSSLAGIAKSNGKTALHSASRNGHVKVIKALLASEPA  194

Query  1577  IGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQ  1756
             I  R DKKGQTALHMAVKG NV++V ELIK D S + + D KGNTALHIA RKGR Q+V+
Sbjct  195   IAIRMDKKGQTALHMAVKGTNVEVVEELIKADRSSINIADTKGNTALHIAARKGRSQIVK  254

Query  1757  RLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKP--PSAAKQLK  1930
              L++    +   VN++GETALD AEK G P+V  +L++ G   +K   KP  P+ A++LK
Sbjct  255   LLLANNMTDTKAVNRSGETALDTAEKIGNPEVALILQKHGVPSAKTI-KPSGPNPARELK  313

Query  1931  QTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaa  2110
             QTVSDIKH+V +QL+ +R T  +V+ IAK++ K+H  GLNNAINS TVVAVLIATVAFAA
Sbjct  314   QTVSDIKHEVHNQLEHTRLTRKRVQGIAKQLNKMHTEGLNNAINSTTVVAVLIATVAFAA  373

Query  2111  iftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIE  2281
             IFTVPGQYVE   K   G +LGEAN+A+   FI+FF+FDS+ALFIS+AVVVVQTSVVVIE
Sbjct  374   IFTVPGQYVEDTSKIPDGHSLGEANIASTTPFIIFFIFDSIALFISLAVVVVQTSVVVIE  433

Query  2282  QKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSM  2461
              KAKKQM+ +INKLMW AC+ IS+AF++L++VVVG  E+WLAI+ T +G  IM+TT+G+M
Sbjct  434   SKAKKQMMAVINKLMWLACVLISVAFLALSFVVVGEEEKWLAIWVTAIGATIMITTLGTM  493

Query  2462  CYCVVRHRLEESRMRNIRKAETLSRSFSMSMVP--SDSELYNESYKRMYAV  2608
             CY +++H++E + +RNIR++   S S S   +P  +DS++     K+MYA+
Sbjct  494   CYWIIQHKIEAANLRNIRRSSINSISGSWG-IPQLTDSDILQNECKKMYAI  543



>ref|XP_010321907.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Solanum 
lycopersicum]
Length=540

 Score =   489 bits (1258),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 287/529 (54%), Positives = 385/529 (73%), Gaps = 7/529 (1%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D+ LH AAR+GNL  +REIL     + + + L KQN  GETALYVAAE
Sbjct  13    KKMTKQLTGKRDDSSLHAAARSGNLVAIREILDETGEEDLAEMLIKQNSAGETALYVAAE  72

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  +V +++   DL  A I + NGYDA HIAAKQG L+++K L+   P L MT D SN
Sbjct  73    YGYYQLVRDMIHYYDLVAAGIKARNGYDALHIAAKQGDLDMVKVLMEAHPELSMTVDISN  132

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH++VV+ LLE +S+LA IA++NGKT LH+AAR GHL+V+K+L+NK+P I
Sbjct  133   TTALHTAANQGHIEVVNYLLEAESSLATIAKSNGKTALHSAARNGHLQVLKALLNKEPGI  192

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               R DKKGQTALHMAVKGQ++++V EL + DPS++ + DNKGNTALHIA RKGR Q+V+ 
Sbjct  193   ATRMDKKGQTALHMAVKGQSLEVVEELTRADPSLINMVDNKGNTALHIAARKGRDQIVKL  252

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSA--AKQLKQ  1933
             L+     +   VN++ E+ALD AEK G P++VT+L+E G   ++   KP +   A++LK+
Sbjct  253   LLVQNETDTRVVNRSNESALDTAEKLGQPELVTVLQEHGVQSARS-IKPQTTNPARELKK  311

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH V  QL+ +  T  ++++IAK+V K+H  GLNNAINS TVVAVLIATVAF  I
Sbjct  312   TVSDIKHGVHYQLETTALTRRRIQEIAKRVYKMHAQGLNNAINSTTVVAVLIATVAFGGI  371

Query  2114  ftvPGQYV---EKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             F + GQ+V   +      TLGEAN+  K AF+VFF+F+SL+LFIS+AVVVVQT++VVIE 
Sbjct  372   FQINGQWVDDPDDIPPDHTLGEANIGPKPAFVVFFIFNSLSLFISLAVVVVQTTIVVIES  431

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             +AKK+M+ IINKLMW ACLFISIA++SL+Y+VVG    W+ +  +V+G VIM TT G++C
Sbjct  432   RAKKKMMSIINKLMWVACLFISIAYLSLSYIVVGNHNLWMPVLISVLGAVIMSTTFGTLC  491

Query  2465  YCVVRHRLEESRMRNIRKAETLSRSFSMSM-VPSDSELYNESYKRMYAV  2608
             Y +V +R+  S  R++RK    +RS S S  V SDS+  N  YK++YA+
Sbjct  492   YWIVMNRVRSSNKRSLRKNSMNNRSRSWSASVLSDSDALNNEYKKIYAI  540



>ref|XP_008387720.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Malus 
domestica]
 ref|XP_008350415.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Malus 
domestica]
Length=551

 Score =   489 bits (1259),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 292/547 (53%), Positives = 381/547 (70%), Gaps = 17/547 (3%)
 Frame = +2

Query  1016  RQLSFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGE  1195
             RQ SF G +K  K   GKR D PLHLAAR G+L  V +IL +     + + LSKQN  GE
Sbjct  6     RQQSFVG-KKMTKQLTGKREDGPLHLAAREGDLGLVVQILSKCGEAELNELLSKQNHMGE  64

Query  1196  TALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNL  1375
             T LY+AA+ G+  +V E++K  D+ +A I + NG DAFHIA+KQGHLEVLK L+   P L
Sbjct  65    TPLYLAADCGYVDLVKEMMKYYDVGSAGIKARNGCDAFHIASKQGHLEVLKVLMEAIPEL  124

Query  1376  VMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKS  1555
              MT D +N+TALH AA QGH +VV  LLE   +L  IAR+NGKT LH+AAR GHLEV+++
Sbjct  125   SMTVDRTNTTALHIAAAQGHTEVVSFLLETGCSLVSIARSNGKTALHSAARKGHLEVIQA  184

Query  1556  LVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRK  1735
             L++KD  I  R D KGQTALHMAVKGQNV++V EL K DPSV+ + DNKGNTALH+AT K
Sbjct  185   LLSKDTGIALRRDNKGQTALHMAVKGQNVELVGELAKADPSVINVVDNKGNTALHVATGK  244

Query  1736  GRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPP-S  1912
             G  Q+VQ L+S +G+    +N++GE+  D A K G   + T+L E G   +K    P  +
Sbjct  245   GHAQIVQTLLSHKGVAKXIINRSGESVFDTAXKSGHTKIATILAEHGIQXAKSMKLPTMN  304

Query  1913  AAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavlia  2092
               ++LKQTVS+IKH+V  QL+Q+RQT  +V  + K++ K+H+ GLNNAINS TVVAVLIA
Sbjct  305   PNRELKQTVSEIKHEVHDQLKQTRQTRKQVHGMVKRLSKMHLEGLNNAINSTTVVAVLIA  364

Query  2093  tvafaaiftvPGQYVEKEK---KGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqt  2263
             TVAFAAIFTVPGQY + EK   +GF+ GEAN+A K  F+VFF+FDS ALFIS+AVVVVQT
Sbjct  365   TVAFAAIFTVPGQYPDPEKPLPRGFSPGEANIAPKPEFLVFFIFDSFALFISLAVVVVQT  424

Query  2264  svvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIML  2443
             S+VV+E++AK++M+ IINKLMW AC+ IS++F++L+Y++VG  E+WLAI  T +G VIM 
Sbjct  425   SIVVVEREAKEKMMSIINKLMWMACVMISVSFLALSYIIVGKEEKWLAIGVTAIGTVIMG  484

Query  2444  TTIGSMCYCVVRHRLEESR----------MRNIRKAETLSRSFSMSMVPSDSELYNESY-  2590
              T+G+MCY +V  R+E S+            N               V SDSEL N  Y 
Sbjct  485   MTLGTMCYWMVVQRVEASKHRRSLRRSSMSTNSHSLSCSHSHSPSFSVISDSELLNTEYK  544

Query  2591  -KRMYAV  2608
              K++YA+
Sbjct  545   SKKVYAI  551



>gb|KHG07452.1| hypothetical protein F383_11113 [Gossypium arboreum]
Length=557

 Score =   489 bits (1258),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 292/534 (55%), Positives = 389/534 (73%), Gaps = 6/534 (1%)
 Frame = +2

Query  1022  LSFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETA  1201
             LSF  ++K  K    K+    LH A RAG+   V EI+   +   +KD LSK+NQ GETA
Sbjct  25    LSFQ-KKKMTKQLTSKKDATRLHSAVRAGDFELVLEIINGLEDGELKDLLSKRNQSGETA  83

Query  1202  LYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVM  1381
             LYVAAE GH  +V EI+K  D+  A + + NGYDAFHIAAKQG LEVLK L+     L M
Sbjct  84    LYVAAECGHADLVKEIMKHCDIVLAGLKARNGYDAFHIAAKQGDLEVLKILMKANLELSM  143

Query  1382  TTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLV  1561
             T DS N+TAL TAA QGH +VV  LLE  SN+A IARNNGKT LH+AAR GHLE+VKSL+
Sbjct  144   TFDSYNTTALQTAASQGHTEVVKFLLEKGSNVAAIARNNGKTALHSAARNGHLEIVKSLL  203

Query  1562  NKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGR  1741
              K+P I  R DKKGQTALHMAVKG NV++   L+K DPS++ + D KGNTALHI ++KGR
Sbjct  204   AKEPGIATRIDKKGQTALHMAVKGHNVEVADVLLKSDPSLINMVDAKGNTALHIGSQKGR  263

Query  1742  PQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKD-HGKPPSAA  1918
              Q+V++L++  G++   +NK+ ETALD AEK    D+  +LKE G   +K     P ++A
Sbjct  264   LQIVEKLLNDSGLDKLVINKSRETALDAAEKNKLSDIACILKEHGVQSAKSIKPHPANSA  323

Query  1919  KQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatv  2098
             ++LKQTVSDIK+ V  QL+ +R+TG +V+ IAK++ K+H+  LNNAINS TVVA+LIA+V
Sbjct  324   RELKQTVSDIKNGVHYQLEHTRKTGKRVQGIAKRLNKMHVESLNNAINSSTVVAILIASV  383

Query  2099  afaaiftvPGQYVEKE---KKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsv  2269
             AFAAIF VPGQYV+       G + G+A +A K  F++F +FDS+ALFIS+AVVVVQTSV
Sbjct  384   AFAAIFNVPGQYVDSPSDISPGVSPGQARIAAKLPFMIFVVFDSIALFISLAVVVVQTSV  443

Query  2270  vvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTT  2449
             VVI++KAKKQM+ +INKLMW AC+ IS+AF++L+YVVVG  E+WLA   T +G VIM++T
Sbjct  444   VVIQRKAKKQMMAVINKLMWLACVLISVAFLALSYVVVGKDERWLANLITGIGTVIMVST  503

Query  2450  IGSMCYCVVRHRLEESRMRNIRKAETLSRSFSM-SMVPSDSELYNESYKRMYAV  2608
             +G++CY V+ +R+E S++R+IR++   S S S+ +   SD+E+ N  +K++YAV
Sbjct  504   LGTLCYWVIVNRIEASKLRSIRRSSMTSGSRSLPTPYTSDTEILNNEHKKLYAV  557



>ref|XP_002525011.1| ankyrin repeat-containing protein, putative [Ricinus communis]
 gb|EEF37338.1| ankyrin repeat-containing protein, putative [Ricinus communis]
Length=537

 Score =   488 bits (1256),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 293/537 (55%), Positives = 392/537 (73%), Gaps = 11/537 (2%)
 Frame = +2

Query  1016  RQLSFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGE  1195
             RQ SF    K  K   GKR D+P H AARAGNL  V EI+   D   +K+ LSKQNQ GE
Sbjct  6     RQTSFR-RSKMTKQLTGKRDDSPFHAAARAGNLETVLEIVSETDEAELKELLSKQNQSGE  64

Query  1196  TALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNL  1375
             TALYVAAE GH  +V E++K  D+  A I + NGYDAFHIAAKQG L+ L  L+   P L
Sbjct  65    TALYVAAEYGHVELVKEMIKYYDIGLAGIKARNGYDAFHIAAKQGDLKTLTVLMEANPEL  124

Query  1376  VMTTDSSNSTALHTAAGQGHVDVVDLLLEI-DSNLAKIARNNGKTVLHTAARMGHLEVVK  1552
              MT DSSN+TALH+AA QGHV+VV+ LLE   SNL  IA++N KT LH+AAR GHLE+++
Sbjct  125   AMTFDSSNTTALHSAASQGHVEVVNFLLEKGSSNLVTIAKSNSKTALHSAARNGHLEILR  184

Query  1553  SLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATR  1732
             +L+ K+P I  R D+KGQTALHMAVKGQNV++V ELI  +  ++ + D+KGNT LHIA R
Sbjct  185   ALLIKEPGIATRIDRKGQTALHMAVKGQNVELVDELIMSETCLINMVDSKGNTPLHIAAR  244

Query  1733  KGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKP--  1906
             KGR Q+V++L+  +G++   +N++GETA D AEK G  +V ++L+E G   ++   KP  
Sbjct  245   KGRTQIVKKLLEHKGLDKIAINRSGETAFDTAEKTGQSEVASVLEEHGVQSARSM-KPGT  303

Query  1907  PSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavl  2086
              + A++LKQTVSDIKH+V  Q+Q +RQT  +V+ IAK++ K+H  GLNNAINS TVVAVL
Sbjct  304   TTTARELKQTVSDIKHEVHDQIQTTRQTRKRVQGIAKRLNKMHTEGLNNAINSTTVVAVL  363

Query  2087  iatvafaaiftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvv  2257
             IATVAFAAI+ VPGQ+ +  +    G + GEAN A+K  F++F +FDS+ALFIS+AVVVV
Sbjct  364   IATVAFAAIYQVPGQFADNPEHLALGQSAGEANAASKPEFMIFIIFDSIALFISLAVVVV  423

Query  2258  qtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVI  2437
             QTS+VVIE+KAKKQ++ +INKLMW AC+ ISIAF++L YVVVG +E+WLA++ T +G VI
Sbjct  424   QTSIVVIERKAKKQLMAVINKLMWLACVLISIAFLALAYVVVGDQEKWLALWVTGIGTVI  483

Query  2438  MLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             M  TIG+MCY V+  ++E S++R    + +LS S S   V +++E+    +K++YA+
Sbjct  484   MAATIGTMCYWVIMQKIESSQLRRSSISRSLSGSMS---VMAETEILENEHKKLYAI  537



>gb|KHG07451.1| hypothetical protein F383_11113 [Gossypium arboreum]
Length=526

 Score =   487 bits (1254),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 288/524 (55%), Positives = 383/524 (73%), Gaps = 5/524 (1%)
 Frame = +2

Query  1052  KDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHT  1231
             K    K+    LH A RAG+   V EI+   +   +KD LSK+NQ GETALYVAAE GH 
Sbjct  3     KQLTSKKDATRLHSAVRAGDFELVLEIINGLEDGELKDLLSKRNQSGETALYVAAECGHA  62

Query  1232  LVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTAL  1411
              +V EI+K  D+  A + + NGYDAFHIAAKQG LEVLK L+     L MT DS N+TAL
Sbjct  63    DLVKEIMKHCDIVLAGLKARNGYDAFHIAAKQGDLEVLKILMKANLELSMTFDSYNTTAL  122

Query  1412  HTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRT  1591
              TAA QGH +VV  LLE  SN+A IARNNGKT LH+AAR GHLE+VKSL+ K+P I  R 
Sbjct  123   QTAASQGHTEVVKFLLEKGSNVAAIARNNGKTALHSAARNGHLEIVKSLLAKEPGIATRI  182

Query  1592  DKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISI  1771
             DKKGQTALHMAVKG NV++   L+K DPS++ + D KGNTALHI ++KGR Q+V++L++ 
Sbjct  183   DKKGQTALHMAVKGHNVEVADVLLKSDPSLINMVDAKGNTALHIGSQKGRLQIVEKLLND  242

Query  1772  EGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKD-HGKPPSAAKQLKQTVSDI  1948
              G++   +NK+ ETALD AEK    D+  +LKE G   +K     P ++A++LKQTVSDI
Sbjct  243   SGLDKLVINKSRETALDAAEKNKLSDIACILKEHGVQSAKSIKPHPANSARELKQTVSDI  302

Query  1949  KHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPG  2128
             K+ V  QL+ +R+TG +V+ IAK++ K+H+  LNNAINS TVVA+LIA+VAFAAIF VPG
Sbjct  303   KNGVHYQLEHTRKTGKRVQGIAKRLNKMHVESLNNAINSSTVVAILIASVAFAAIFNVPG  362

Query  2129  QYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQ  2299
             QYV+       G + G+A +A K  F++F +FDS+ALFIS+AVVVVQTSVVVI++KAKKQ
Sbjct  363   QYVDSPSDISPGVSPGQARIAAKLPFMIFVVFDSIALFISLAVVVVQTSVVVIQRKAKKQ  422

Query  2300  MVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVR  2479
             M+ +INKLMW AC+ IS+AF++L+YVVVG  E+WLA   T +G VIM++T+G++CY V+ 
Sbjct  423   MMAVINKLMWLACVLISVAFLALSYVVVGKDERWLANLITGIGTVIMVSTLGTLCYWVIV  482

Query  2480  HRLEESRMRNIRKAETLSRSFSM-SMVPSDSELYNESYKRMYAV  2608
             +R+E S++R+IR++   S S S+ +   SD+E+ N  +K++YAV
Sbjct  483   NRIEASKLRSIRRSSMTSGSRSLPTPYTSDTEILNNEHKKLYAV  526



>ref|XP_010457973.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X2 [Camelina sativa]
Length=556

 Score =   488 bits (1257),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 294/530 (55%), Positives = 386/530 (73%), Gaps = 7/530 (1%)
 Frame = +2

Query  1037  ERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAA  1216
             ++K  K   GKR D  LH A R GN  KV EIL +     + + L KQNQ GETALYVAA
Sbjct  16    KKKMAKQLTGKREDTLLHSAVRQGNKDKVVEILTQTRESELDELLGKQNQSGETALYVAA  75

Query  1217  ENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSS  1396
             E G   +V E++K  DL    I + NG+DAFHIAAKQGHL+VLK L      L +T D S
Sbjct  76    EYGDVEIVKEMIKCYDLALVEIKARNGFDAFHIAAKQGHLDVLKVLAEAHSELALTVDLS  135

Query  1397  NSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPS  1576
             N+TALHTAA QGH +VV+ LLE+ S+LA IA++NGKT LH+A+R GH++V+K+L+  +P+
Sbjct  136   NTTALHTAATQGHTEVVNFLLELGSSLAGIAKSNGKTALHSASRNGHVKVIKALLASEPA  195

Query  1577  IGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQ  1756
             I  R DKKGQTALHMAVKG  V++V ELIK D S + + D KGNTALHIA RKGR Q+V+
Sbjct  196   IAVRMDKKGQTALHMAVKGTKVEVVEELIKADRSSINIADTKGNTALHIAARKGRSQIVK  255

Query  1757  RLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKD-HGKPPSAAKQLKQ  1933
              L++    +   VN++GETALD AEK G P+V  +L++ G   +K      P+ A++LKQ
Sbjct  256   LLLANNMTDTKAVNRSGETALDTAEKIGNPEVALILQKHGVPSAKTIKASGPNPARELKQ  315

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH+V +QL+ +R T  +V+ IAK++ K+H  GLNNAINS TVVAVLIATVAFAAI
Sbjct  316   TVSDIKHEVHNQLEHTRLTRKRVQGIAKQLNKMHTEGLNNAINSTTVVAVLIATVAFAAI  375

Query  2114  ftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             FTVPGQYVE   K   G +LGEAN+A+   FI+FF+FDS+ALFIS+AVVVVQTSVVVIE 
Sbjct  376   FTVPGQYVEDTSKIPDGHSLGEANIASTTPFIIFFIFDSIALFISLAVVVVQTSVVVIES  435

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             KAKKQM+ +INKLMW AC+ IS+AF++L++VVVG  E+WLAI+ T +G  IM+TT+G+MC
Sbjct  436   KAKKQMMAVINKLMWLACVLISVAFLALSFVVVGEEEKWLAIWVTAIGATIMITTLGTMC  495

Query  2465  YCVVRHRLEESRMRNIRKAETLSRSFSMSMVP--SDSELYNESYKRMYAV  2608
             Y +++HR+E +  RNIR++   S+S S   +P  +DS++     K++  +
Sbjct  496   YWIIQHRIEAANARNIRRSSINSKSGSWG-IPQLTDSDILQNECKKITGI  544



>ref|XP_010487870.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X1 [Camelina sativa]
Length=627

 Score =   490 bits (1262),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 297/545 (54%), Positives = 393/545 (72%), Gaps = 7/545 (1%)
 Frame = +2

Query  1037  ERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAA  1216
             ++K  K   GKR D  LH A R GN  KV EIL +     + + L KQNQ GETALYV A
Sbjct  69    KKKMAKQLTGKREDTLLHSAVRQGNKDKVVEILTQTRESELNELLGKQNQSGETALYVVA  128

Query  1217  ENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSS  1396
             E G   +V E++K  DL    I + NG+DAFHIAAKQGHL+VLK L      L MT D S
Sbjct  129   EYGDVEIVKEMIKCYDLALVEIKARNGFDAFHIAAKQGHLDVLKVLAEAHSELAMTVDLS  188

Query  1397  NSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPS  1576
             N+TALHTAA QGH +VV+ LLE+ S+LA IA++NGKT LH+A+R GH++V+K+L+  +P+
Sbjct  189   NTTALHTAATQGHTEVVNFLLELGSSLAGIAKSNGKTALHSASRNGHVKVIKALLASEPA  248

Query  1577  IGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQ  1756
             I  R DKKGQTALHMAVKG NV++V ELIK D S + + D KGNTALHIA RKGR Q+V+
Sbjct  249   IAVRMDKKGQTALHMAVKGTNVEVVEELIKADRSSINIADTKGNTALHIAARKGRSQIVK  308

Query  1757  RLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKD-HGKPPSAAKQLKQ  1933
              L++    +   VN++GETALD AEK G P+V  +L++ G   +K      P+ A++LKQ
Sbjct  309   LLLANNMTDTKAVNRSGETALDTAEKIGNPEVALILQKHGVPSAKTIKASGPNPARELKQ  368

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH+V +QL+ +R T  +V+ IAK++ K+H  GLNNAINS TVVAVLIATVAFAAI
Sbjct  369   TVSDIKHEVHNQLEHTRLTRKRVQGIAKQLNKMHTEGLNNAINSTTVVAVLIATVAFAAI  428

Query  2114  ftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             FTVPGQYVE+  K   G +LGEAN+A+   FI+FF+FDS+ALFIS+AVVVVQTSVVVIE 
Sbjct  429   FTVPGQYVEETSKIPDGHSLGEANIASTIPFIIFFIFDSIALFISLAVVVVQTSVVVIES  488

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             KAKKQM+ +INKLMW AC+ IS+AF++L++VVVG  E+WLAI+ T +G  IM+TT+G+MC
Sbjct  489   KAKKQMMAVINKLMWLACVLISVAFLALSFVVVGEEEKWLAIWVTAIGATIMITTLGTMC  548

Query  2465  YCVVRHRLEESRMRNIRKAETLSRSFSMSMVP--SDSELYNESYKRMYAV*KQTELESIE  2638
             Y +++HR+E +  RNIR++   S+S S   +P  +DS++     K++  + +  E+    
Sbjct  549   YWIIQHRIEAANARNIRRSSINSKSGSWG-IPQLTDSDILQNECKKITGIEELPEMLCTP  607

Query  2639  KTTIR  2653
             +  I+
Sbjct  608   RNRIK  612



>ref|XP_010457972.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X1 [Camelina sativa]
Length=565

 Score =   488 bits (1256),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 294/530 (55%), Positives = 386/530 (73%), Gaps = 7/530 (1%)
 Frame = +2

Query  1037  ERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAA  1216
             ++K  K   GKR D  LH A R GN  KV EIL +     + + L KQNQ GETALYVAA
Sbjct  25    KKKMAKQLTGKREDTLLHSAVRQGNKDKVVEILTQTRESELDELLGKQNQSGETALYVAA  84

Query  1217  ENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSS  1396
             E G   +V E++K  DL    I + NG+DAFHIAAKQGHL+VLK L      L +T D S
Sbjct  85    EYGDVEIVKEMIKCYDLALVEIKARNGFDAFHIAAKQGHLDVLKVLAEAHSELALTVDLS  144

Query  1397  NSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPS  1576
             N+TALHTAA QGH +VV+ LLE+ S+LA IA++NGKT LH+A+R GH++V+K+L+  +P+
Sbjct  145   NTTALHTAATQGHTEVVNFLLELGSSLAGIAKSNGKTALHSASRNGHVKVIKALLASEPA  204

Query  1577  IGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQ  1756
             I  R DKKGQTALHMAVKG  V++V ELIK D S + + D KGNTALHIA RKGR Q+V+
Sbjct  205   IAVRMDKKGQTALHMAVKGTKVEVVEELIKADRSSINIADTKGNTALHIAARKGRSQIVK  264

Query  1757  RLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKD-HGKPPSAAKQLKQ  1933
              L++    +   VN++GETALD AEK G P+V  +L++ G   +K      P+ A++LKQ
Sbjct  265   LLLANNMTDTKAVNRSGETALDTAEKIGNPEVALILQKHGVPSAKTIKASGPNPARELKQ  324

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH+V +QL+ +R T  +V+ IAK++ K+H  GLNNAINS TVVAVLIATVAFAAI
Sbjct  325   TVSDIKHEVHNQLEHTRLTRKRVQGIAKQLNKMHTEGLNNAINSTTVVAVLIATVAFAAI  384

Query  2114  ftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             FTVPGQYVE   K   G +LGEAN+A+   FI+FF+FDS+ALFIS+AVVVVQTSVVVIE 
Sbjct  385   FTVPGQYVEDTSKIPDGHSLGEANIASTTPFIIFFIFDSIALFISLAVVVVQTSVVVIES  444

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             KAKKQM+ +INKLMW AC+ IS+AF++L++VVVG  E+WLAI+ T +G  IM+TT+G+MC
Sbjct  445   KAKKQMMAVINKLMWLACVLISVAFLALSFVVVGEEEKWLAIWVTAIGATIMITTLGTMC  504

Query  2465  YCVVRHRLEESRMRNIRKAETLSRSFSMSMVP--SDSELYNESYKRMYAV  2608
             Y +++HR+E +  RNIR++   S+S S   +P  +DS++     K++  +
Sbjct  505   YWIIQHRIEAANARNIRRSSINSKSGSWG-IPQLTDSDILQNECKKITGI  553



>gb|KHG02476.1| Ankyrin-2 [Gossypium arboreum]
Length=544

 Score =   486 bits (1252),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 313/545 (57%), Positives = 403/545 (74%), Gaps = 13/545 (2%)
 Frame = +2

Query  1010  MER----QLSFGGERKR-GKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLS  1174
             MER    Q S    RK+  K   GKR D  LH AARAGNL+ V+EIL   +  A+K+ L+
Sbjct  1     MERPITEQPSVPARRKKMTKQLTGKRDDTALHSAARAGNLAAVKEILTGIEEDALKEQLA  60

Query  1175  KQNQEGETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKEL  1354
             KQN  GETALYVAAE G+  +V E++   DL  A I + NG+DA HIAAKQG L++LK L
Sbjct  61    KQNHSGETALYVAAEYGYVDLVKEMINYYDLVNAGIKARNGFDALHIAAKQGDLDILKVL  120

Query  1355  LNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMG  1534
             L   P L MT D SN+TALHTAA QGH++ V  LLE+ S+LA IAR+NGKT LH+A+R G
Sbjct  121   LAAHPELAMTVDLSNTTALHTAATQGHIENVKFLLEVGSSLAIIARSNGKTPLHSASRNG  180

Query  1535  HLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLA-LGDNKGNT  1711
             HL+VVK+L+  +P I  R DKKGQTALHMAVKGQ++ +V ELI+ +PS++  + D KGNT
Sbjct  181   HLDVVKALLACEPGIAPRIDKKGQTALHMAVKGQSLAVVEELIRVNPSLMINMVDTKGNT  240

Query  1712  ALHIATRKGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSK  1891
             +LHIATRKGR Q+V+ L+  +  +I  VN+ GETA DIAEK G  ++ +ML++ G   S 
Sbjct  241   SLHIATRKGRAQIVKLLLGYKETDIKAVNRCGETAFDIAEKTGHLEIASMLQQHG-VQSA  299

Query  1892  DHGKPPSA--AKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINS  2065
                KP +   A++LKQTVSDIKH+V  QL+ + QT  +V+ IAK++ K+H  GLNNAINS
Sbjct  300   RAIKPAATNPARELKQTVSDIKHEVHYQLEHTLQTRKQVQGIAKRINKMHSEGLNNAINS  359

Query  2066  ltvvavliatvafaaiftvPGQYVEKEK---KGFTLGEANVANKAAFIVFFLFDSLALFI  2236
              TVVAVLIATVAFAAIFTVPGQYV+       G +LGEAN+A K AFI+FF+FDS+ALFI
Sbjct  360   TTVVAVLIATVAFAAIFTVPGQYVDDPNDIPPGDSLGEANIAPKPAFIIFFIFDSIALFI  419

Query  2237  SIAvvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYS  2416
             S+AVVVVQTSVVVI+ K KKQM+ IINKLMW AC+ +S+AF++L+++VVG  E+WLAI  
Sbjct  420   SLAVVVVQTSVVVIDSKGKKQMMAIINKLMWLACVLVSVAFLALSFIVVGKDEKWLAIGV  479

Query  2417  TVVGGVIMLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSM-VPSDSELYNESYK  2593
             T++G  IM TT+G+MCY V+RHR+E S MR+IR++   SRS S +M V SDSE+ N  +K
Sbjct  480   TIIGTSIMATTLGTMCYWVIRHRIEASNMRSIRRSSQASRSRSWTMSVMSDSEILNNEFK  539

Query  2594  RMYAV  2608
             +MYA+
Sbjct  540   KMYAI  544



>ref|XP_006366327.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Solanum 
tuberosum]
Length=541

 Score =   486 bits (1251),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 285/531 (54%), Positives = 384/531 (72%), Gaps = 11/531 (2%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D+ LH AAR+GNL  +REIL     + + + + KQN  GETALYVAAE
Sbjct  14    KKMTKQLTGKRDDSSLHAAARSGNLVAIREILDETGEEDLAEMMIKQNSAGETALYVAAE  73

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  +V +++   DL  A I + NGYDA HIAAKQG L+++K L+   P L MT D SN
Sbjct  74    YGYYQLVRDMIHYYDLVAAGIKARNGYDALHIAAKQGDLDMVKVLMEAHPELSMTVDISN  133

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH++VV+ LLE +S+LA IA++NGKT LH+AAR GHL+VVK+L+NK+P I
Sbjct  134   TTALHTAANQGHIEVVNYLLEAESSLATIAKSNGKTALHSAARNGHLQVVKALLNKEPGI  193

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               R DKKGQTALHMAVKGQN+++V EL + DPS++ + DNKGNTALHIA RKGR Q+V+ 
Sbjct  194   ATRMDKKGQTALHMAVKGQNLEVVEELTRADPSLINMVDNKGNTALHIAARKGRDQIVKL  253

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAG---ATHSKDHGKPPSAAKQLK  1930
             L++    +   VN++ E+ALD AEK G  ++VT+L+E G   A   K   K P  A++LK
Sbjct  254   LLAQNETDTRVVNRSNESALDTAEKLGQSELVTVLQEHGVQSARSIKPQTKNP--ARELK  311

Query  1931  QTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaa  2110
             +TVSDIKH V  QL+ +  T  +++ IAK+V K+H  GLNNAINS TVVAVLIATVAF  
Sbjct  312   KTVSDIKHGVHYQLETTALTRRRIQDIAKRVYKMHAQGLNNAINSTTVVAVLIATVAFGG  371

Query  2111  iftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIE  2281
             IF + GQ+V+         +LGEAN+    AF+VFF+FDSL+LFI++AVVVVQT++VVIE
Sbjct  372   IFQINGQWVDDPDDIPADHSLGEANIGPNPAFVVFFIFDSLSLFIALAVVVVQTTIVVIE  431

Query  2282  QKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSM  2461
              +AKK+M+ IINKLMW ACLFISIA++SL+Y+VVG    W+ +  + +G +IM TT+G++
Sbjct  432   SRAKKKMMSIINKLMWVACLFISIAYLSLSYIVVGDANLWMPVLISFIGAIIMATTLGTL  491

Query  2462  CYCVVRHRLEESRMRNIRKAETL--SRSFSMSMVPSDSELYNESYKRMYAV  2608
             CY +V +R+  S  R++RK      SRS+S S++ SDS+  N  YK++YA+
Sbjct  492   CYWIVMNRISSSNKRSLRKNSMANRSRSWSASLL-SDSDALNNEYKKIYAI  541



>ref|XP_006428986.1| hypothetical protein CICLE_v10011445mg [Citrus clementina]
 ref|XP_006428987.1| hypothetical protein CICLE_v10011445mg [Citrus clementina]
 ref|XP_006428988.1| hypothetical protein CICLE_v10011445mg [Citrus clementina]
 ref|XP_006428989.1| hypothetical protein CICLE_v10011445mg [Citrus clementina]
 ref|XP_006480718.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X1 [Citrus sinensis]
 ref|XP_006480719.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X2 [Citrus sinensis]
 ref|XP_006480720.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X3 [Citrus sinensis]
 gb|ESR42226.1| hypothetical protein CICLE_v10011445mg [Citrus clementina]
 gb|ESR42227.1| hypothetical protein CICLE_v10011445mg [Citrus clementina]
 gb|ESR42228.1| hypothetical protein CICLE_v10011445mg [Citrus clementina]
 gb|ESR42229.1| hypothetical protein CICLE_v10011445mg [Citrus clementina]
Length=537

 Score =   486 bits (1251),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 291/536 (54%), Positives = 389/536 (73%), Gaps = 8/536 (1%)
 Frame = +2

Query  1013  ERQLSFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEG  1192
             E+Q S+   +K  K    KR D PL    R G++  V +++  +    +++ LSK NQ G
Sbjct  6     EQQQSW---KKMKKQLTAKRDDTPLQSLVRTGSVELVLDMISSYGDMELREMLSKMNQSG  62

Query  1193  ETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPN  1372
             ETALYVAAE G+  +V E+++  D   A I + NGYDAFHIAAKQG LEVLK L+   P 
Sbjct  63    ETALYVAAEYGYVDMVREMIRYHDTSLAGIKARNGYDAFHIAAKQGCLEVLKILMEALPE  122

Query  1373  LVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVK  1552
             L+MT DSSN+TALHTA+ QGHV+VV  LLE  S LA IAR+NGKT LH+AAR GHLE+VK
Sbjct  123   LLMTFDSSNTTALHTASSQGHVEVVKFLLEKGSTLATIARSNGKTALHSAARNGHLEIVK  182

Query  1553  SLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATR  1732
             +L++K+P I  R DKKGQTALHMAVKGQ++++V EL+K DP ++ + D KGN+ALHIATR
Sbjct  183   ALLSKEPGIVLRNDKKGQTALHMAVKGQSIELVDELVKVDPVIINMVDAKGNSALHIATR  242

Query  1733  KGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPS  1912
             KGR Q+VQ+L++I G++   +NK+ ETALD AEK G  ++  +LKE G    K      +
Sbjct  243   KGRVQIVQKLLNINGVDKAVINKSRETALDTAEKTGHSEIGVILKEHGVPCGKSIKPQAN  302

Query  1913  AAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavlia  2092
             +A++LKQ VSDIKH+V  QL+ +R+T   V  IAK++ K+H  GLNNAINS TVVAVLIA
Sbjct  303   SARELKQAVSDIKHEVHDQLEHTRETRKHVHGIAKRINKMHTEGLNNAINSTTVVAVLIA  362

Query  2093  tvafaaiftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqt  2263
             TVAFAAIF+VPGQ+ +K  +     + GEA++A K  F++F +FDS+ALFIS+AVV+VQT
Sbjct  363   TVAFAAIFSVPGQFADKPDELPPKVSPGEAHIAPKTPFLIFIIFDSIALFISLAVVIVQT  422

Query  2264  svvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIML  2443
             SVVVIE+KAKKQM+ +INKLMW AC+ IS+AF++L+Y+VVG   +  A+  T +G VIM+
Sbjct  423   SVVVIERKAKKQMMAVINKLMWLACIMISVAFLALSYIVVGDDGRGWAVAVTFIGTVIMV  482

Query  2444  TTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSM-VPSDSELYNESYKRMYAV  2608
             +TIG+M Y V+ +R+E S++R+IR++   S S SMS  V  DSE  N   K +YAV
Sbjct  483   STIGTMSYWVIVNRIEASKIRSIRRSSMDSGSRSMSASVMLDSEFLNNEIK-LYAV  537



>ref|XP_011031106.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Populus 
euphratica]
 ref|XP_011031108.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Populus 
euphratica]
 ref|XP_011031109.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Populus 
euphratica]
Length=541

 Score =   486 bits (1251),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 300/528 (57%), Positives = 389/528 (74%), Gaps = 5/528 (1%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GK+ D PLH AARAGNL  V EIL     + +K+ L KQNQ GETALYVAAE
Sbjct  14    KKMTKQLTGKKDDTPLHSAARAGNLGAVMEILTGTGEEELKELLEKQNQSGETALYVAAE  73

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  VV E++K  DL  A I + NG+DAFH+AAKQG +E+L+ L+   P L MT D SN
Sbjct  74    YGYVDVVREMIKYYDLADAGIKARNGFDAFHVAAKQGDMEILRVLMEAHPELSMTVDLSN  133

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA +GH+++V+LLL+  S+LA IA++NGKT LH+AAR GH+EVV++L+  +P +
Sbjct  134   TTALHTAATKGHIEIVNLLLDAGSSLATIAKSNGKTALHSAARNGHVEVVRALLTMEPGM  193

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQTA HMA KGQN++IV ELI   PS + + D KGNTALHIATRKGR Q+V+ 
Sbjct  194   ATRTDKKGQTAFHMAAKGQNIEIVEELIVAQPSSINMVDTKGNTALHIATRKGRIQIVRL  253

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSK-DHGKPPSAAKQLKQT  1936
             L+   G ++  VN+  ETALD AEK G  ++  +L+E G   +K    +  + A++LKQT
Sbjct  254   LLGHSGTDLKAVNRTNETALDTAEKTGHSEIAAILQEHGVQSAKTTQPQEKNPARELKQT  313

Query  1937  VSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaif  2116
             VSDIKH+V  QL+ +RQT  +V+ IAK++ K+H  GLNNAINS TVVAVLIATVAFAAIF
Sbjct  314   VSDIKHEVYYQLEHTRQTRKRVQGIAKRLNKMHAEGLNNAINSTTVVAVLIATVAFAAIF  373

Query  2117  tvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQK  2287
             TVPG+YVE  ++   G +LGEAN+A +A FI+FF+FDS+ALFIS+AVVVVQTSVVVIE K
Sbjct  374   TVPGEYVENPEEIPPGQSLGEANIAPQAPFIIFFIFDSIALFISLAVVVVQTSVVVIESK  433

Query  2288  AKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCY  2467
             AKKQM+ IINKLMW AC  IS+AF++L+++VVG RE+WLAI  T++G  IM+TT+G+MCY
Sbjct  434   AKKQMMAIINKLMWIACALISVAFLALSFIVVGEREKWLAIGVTIIGATIMVTTLGTMCY  493

Query  2468  CVVRHRLEESRM-RNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
              VV+HR+E S M    R +           V SD+E+ N  YK+MYA+
Sbjct  494   WVVKHRIEASNMRSIRRSSLGSRSRSFSVSVVSDAEILNNDYKKMYAI  541



>ref|XP_009341692.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Pyrus 
x bretschneideri]
 ref|XP_009341694.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Pyrus 
x bretschneideri]
Length=551

 Score =   486 bits (1252),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 290/548 (53%), Positives = 382/548 (70%), Gaps = 19/548 (3%)
 Frame = +2

Query  1016  RQLSFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGE  1195
             RQ SF G +K  K   GKR D PLHLAAR G+L  V EIL       + + LSKQN  GE
Sbjct  6     RQQSFVG-KKMTKQLTGKREDGPLHLAAREGDLGLVVEILSNCGEAELNELLSKQNHMGE  64

Query  1196  TALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNL  1375
             TALY+AA+ G+  +V E++K  D+ +A I + NG DAFHIA+KQGHLEVLK L+   P L
Sbjct  65    TALYLAADCGYVDLVKEMMKYYDVGSAGIKARNGCDAFHIASKQGHLEVLKVLMEAIPEL  124

Query  1376  VMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKS  1555
              MT D +N+TALH AA QGH +VV  LLE D +L  IAR+NGKT LH+AAR GHLEV+++
Sbjct  125   SMTVDRTNTTALHIAAAQGHTEVVSFLLETDCSLVAIARSNGKTALHSAARKGHLEVIQA  184

Query  1556  LVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRK  1735
              ++KD  I  R D KGQTALHMAVKGQNV++V EL K DPS++ + DNKGNTALH+AT K
Sbjct  185   FLSKDTGIALRRDNKGQTALHMAVKGQNVELVGELAKADPSLINVVDNKGNTALHVATGK  244

Query  1736  GRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPS-  1912
             G  Q+V+ L+S +G+    +N++GE+  D AEK G   + T+L E G   +K   KPP+ 
Sbjct  245   GHAQIVRTLLSHKGVAKTIINRSGESVFDTAEKSGHTKIATILAEHGIQSAKSM-KPPTM  303

Query  1913  -AAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavli  2089
                ++LKQTVS+IKH+V  QL+Q+RQT  +V  + K++ K+H+ GLNNAINS TVVAVLI
Sbjct  304   NPNRELKQTVSEIKHEVHDQLKQTRQTRKQVHGMVKQLSKMHLDGLNNAINSTTVVAVLI  363

Query  2090  atvafaaiftvPGQYVEKEK---KGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvq  2260
             ATVAFAAIFTVPGQY + +K   +GF+ GEAN+  K  F+VFF+FDS ALFIS+AVVVVQ
Sbjct  364   ATVAFAAIFTVPGQYPDPKKPLPRGFSPGEANIGPKPEFVVFFIFDSFALFISLAVVVVQ  423

Query  2261  tsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIM  2440
             TS+VV+E++AK++M+ +INKLMW AC+ IS++F++L+Y++VG  E+WLAI  T +G VIM
Sbjct  424   TSIVVVEREAKEKMMSVINKLMWMACVMISVSFLALSYIIVGKEEKWLAIGVTAIGTVIM  483

Query  2441  LTTIGSMCYCVVRHRLEESR----------MRNIRKAETLSRSFSMSMVPSDSELYNESY  2590
               T+G+MCY +V   +E S+            +               V SDSEL N  Y
Sbjct  484   GMTLGTMCYWMVVQHVEASKHRRSLRRSSMSTHSHSLSCSHSHSPSFSVISDSELLNTEY  543

Query  2591  --KRMYAV  2608
               K++YA+
Sbjct  544   KSKKVYAI  551



>gb|EAY89499.1| hypothetical protein OsI_11032 [Oryza sativa Indica Group]
Length=565

 Score =   486 bits (1252),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 288/538 (54%), Positives = 384/538 (71%), Gaps = 23/538 (4%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D  LH AARAG L  V++ L       ++  LSKQNQ GET L+VAAE
Sbjct  36    KKMTKQLTGKRDDTALHGAARAGQLVAVQQTLSGAPPDELRALLSKQNQAGETPLFVAAE  95

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  +V E++K  D+ TA I + +GYDA HIAAKQG +EV+ ELL   P L MT D+SN
Sbjct  96    YGYVALVAEMIKYHDIATACIKARSGYDALHIAAKQGDVEVVNELLKALPELSMTVDASN  155

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TAL+TAA QGH++VV LLLE D++LA IAR+NGKT LH+AAR GH+EVV++L+  +PSI
Sbjct  156   TTALNTAATQGHMEVVRLLLEADASLAVIARSNGKTALHSAARNGHVEVVRALMEAEPSI  215

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               R DKKGQTALHMA KG  +DIV  L+  +P++L L D+KGNTALHIA RK R  +V+R
Sbjct  216   AARVDKKGQTALHMAAKGTRLDIVDALLAGEPTLLNLADSKGNTALHIAARKARTPIVKR  275

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAA-------  1918
             L+ +   ++  +N++ ETA D AEK G  + V +L E        HG P + A       
Sbjct  276   LLELPDTDLKAINRSRETAFDTAEKMGNTESVAVLAE--------HGVPSARAMSPTGGG  327

Query  1919  -----KQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvav  2083
                  ++LKQ VSDIKH+V SQL+Q+RQT  +++ IAK++ KLH  GLNNAINS TVVAV
Sbjct  328   GGNPGRELKQQVSDIKHEVHSQLEQTRQTRVRMQGIAKQINKLHDEGLNNAINSTTVVAV  387

Query  2084  liatvafaaiftvPGQYVEKE---KKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvv  2254
             LIATVAFAAIFTVPG+YV+       G  LGEAN++++ AF++FF+FDS+ALFIS+AVVV
Sbjct  388   LIATVAFAAIFTVPGEYVDDAGSLTPGQALGEANISHQTAFLIFFVFDSVALFISLAVVV  447

Query  2255  vqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGV  2434
             VQTSVVVIE+KAKKQM+ +INKLMW AC+ +S+AF++L++VVVG  E+WLA+  T++G  
Sbjct  448   VQTSVVVIERKAKKQMMAVINKLMWVACVLVSVAFLALSFVVVGKAERWLAVGVTIMGAT  507

Query  2435  IMLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             I++TTIG+M Y V+ HR+E  RMR+I+++         +   S++E   E +KRMYA+
Sbjct  508   ILVTTIGTMLYWVIAHRIEAKRMRSIKRSSLSRSRSFSASGMSEAEWVEEEFKRMYAI  565



>ref|NP_001049741.1| Os03g0281100 [Oryza sativa Japonica Group]
 gb|AAN64473.1| putative ankyrin repeat containing protein [Oryza sativa Japonica 
Group]
 gb|ABF95307.1| Ank repeat PF|00023 containing protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11655.1| Os03g0281100 [Oryza sativa Japonica Group]
 gb|EAZ26480.1| hypothetical protein OsJ_10370 [Oryza sativa Japonica Group]
Length=565

 Score =   486 bits (1252),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 288/538 (54%), Positives = 384/538 (71%), Gaps = 23/538 (4%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D  LH AARAG L  V++ L       ++  LSKQNQ GET L+VAAE
Sbjct  36    KKMTKQLTGKRDDTALHGAARAGQLVAVQQTLSGAPPDELRALLSKQNQAGETPLFVAAE  95

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  +V E++K  D+ TA I + +GYDA HIAAKQG +EV+ ELL   P L MT D+SN
Sbjct  96    YGYVALVAEMIKYHDVATACIKARSGYDALHIAAKQGDVEVVNELLKALPELSMTVDASN  155

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TAL+TAA QGH++VV LLLE D++LA IAR+NGKT LH+AAR GH+EVV++L+  +PSI
Sbjct  156   TTALNTAATQGHMEVVRLLLEADASLAVIARSNGKTALHSAARNGHVEVVRALMEAEPSI  215

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               R DKKGQTALHMA KG  +DIV  L+  +P++L L D+KGNTALHIA RK R  +V+R
Sbjct  216   AARVDKKGQTALHMAAKGTRLDIVDALLAGEPTLLNLADSKGNTALHIAARKARTPIVKR  275

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAA-------  1918
             L+ +   ++  +N++ ETA D AEK G  + V +L E        HG P + A       
Sbjct  276   LLELPDTDLKAINRSRETAFDTAEKMGNTESVAVLAE--------HGVPSARAMSPTGGG  327

Query  1919  -----KQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvav  2083
                  ++LKQ VSDIKH+V SQL+Q+RQT  +++ IAK++ KLH  GLNNAINS TVVAV
Sbjct  328   GGNPGRELKQQVSDIKHEVHSQLEQTRQTRVRMQGIAKQINKLHDEGLNNAINSTTVVAV  387

Query  2084  liatvafaaiftvPGQYVEKE---KKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvv  2254
             LIATVAFAAIFTVPG+YV+       G  LGEAN++++ AF++FF+FDS+ALFIS+AVVV
Sbjct  388   LIATVAFAAIFTVPGEYVDDAGSLTPGQALGEANISHQTAFLIFFVFDSVALFISLAVVV  447

Query  2255  vqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGV  2434
             VQTSVVVIE+KAKKQM+ +INKLMW AC+ +S+AF++L++VVVG  E+WLA+  T++G  
Sbjct  448   VQTSVVVIERKAKKQMMAVINKLMWVACVLVSVAFLALSFVVVGKAERWLAVGVTIMGAT  507

Query  2435  IMLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             I++TTIG+M Y V+ HR+E  RMR+I+++         +   S++E   E +KRMYA+
Sbjct  508   ILVTTIGTMLYWVIAHRIEAKRMRSIKRSSLSRSRSFSASGMSEAEWVEEEFKRMYAI  565



>ref|XP_010485246.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Camelina 
sativa]
Length=548

 Score =   486 bits (1250),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 295/530 (56%), Positives = 383/530 (72%), Gaps = 15/530 (3%)
 Frame = +2

Query  1049  GKDSPGKRGDNPLHLAARAGNLSKVREILQRF--DSKAIKDTLSKQNQEGETALYVAAEN  1222
              K   GKR D+PLH A R G+ S V EIL       + + + L KQNQ GETALYVAAE 
Sbjct  24    AKQLTGKREDSPLHSAVRRGDFSAVNEILSNHMESEEELSELLRKQNQCGETALYVAAEY  83

Query  1223  GHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNS  1402
             G   VV E++K  DLE A   + NG+D FHIAAKQG L+VL+ L+   P L MT D SN+
Sbjct  84    GDAEVVAELIKYYDLEDAETKARNGFDPFHIAAKQGELDVLRVLMEEHPELAMTVDLSNT  143

Query  1403  TALHTAAGQGHVDVVDLLLEI-DSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             TALHTAA QGHV+VV+ LLE   S+LA IA++NGKT LH+AAR GH EVVK++V  +P  
Sbjct  144   TALHTAAAQGHVEVVEYLLEAAGSSLAAIAKSNGKTALHSAARNGHAEVVKAIVAVEPDT  203

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQT LHMAVKGQ++D+V+EL+K   S L + D+KGNTALH+ATRKGR ++V+ 
Sbjct  204   ATRTDKKGQTPLHMAVKGQSIDVVVELMKGHRSSLNMVDSKGNTALHVATRKGRIKIVEL  263

Query  1760  LISIEGININT--VNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKP--PSAAKQL  1927
             L+     + +T  +N+AGET LD A+K G P++  +LK  G   +K    P  P+AA++L
Sbjct  264   LLDNNETSTSTTAINRAGETPLDTADKTGHPEISAILKTRGVPSAKAINNPTRPNAAREL  323

Query  1928  KQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafa  2107
             KQTVSDIKH+V  QL+ +R+T  +V+ IAK++ K+H+ GL+NAINS TVVAVLIATVAFA
Sbjct  324   KQTVSDIKHEVHHQLEHARETRKRVQGIAKRINKMHVEGLDNAINSTTVVAVLIATVAFA  383

Query  2108  aiftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvI  2278
             AIFTVPGQY ++      G +LGEAN+A++ AF +FF+FDS+ALFIS+AVVVVQTSVV I
Sbjct  384   AIFTVPGQYADELSSLSPGKSLGEANIADRPAFAIFFIFDSIALFISLAVVVVQTSVVAI  443

Query  2279  EQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGS  2458
             +QKAKK M+ +INKLMW AC+ IS+AF++L +VVVG  E+WLA+  TV G  IMLTT+G+
Sbjct  444   DQKAKKNMMAVINKLMWLACVLISVAFLALAFVVVGEDERWLAVGVTVFGATIMLTTLGT  503

Query  2459  MCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             MCY V+ HR+E S +R  RK E+++RS    ++    E      KRMYA+
Sbjct  504   MCYWVIMHRIEASNVRKSRK-ESMARSRQSGLL----EFSGMLTKRMYAI  548



>ref|XP_009377124.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Pyrus 
x bretschneideri]
 ref|XP_009377125.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Pyrus 
x bretschneideri]
Length=556

 Score =   485 bits (1248),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 291/547 (53%), Positives = 385/547 (70%), Gaps = 17/547 (3%)
 Frame = +2

Query  1016  RQLSFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGE  1195
             RQ SF G +K  K   GKR + PLHLAARAG+L  V EI+  F  + + + LSKQN  GE
Sbjct  11    RQQSFAG-KKMTKLLTGKRDNGPLHLAARAGDLGLVVEIMSNFGEEELNELLSKQNYAGE  69

Query  1196  TALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNL  1375
             TALY+AA  G+  +V E++K  D+  ASI + NG DAFH+A+KQGHLEVLK L+   P L
Sbjct  70    TALYLAAGCGYVGLVKEMMKYYDVGAASIKAENGCDAFHVASKQGHLEVLKILMEAIPEL  129

Query  1376  VMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKS  1555
              MT D +N+TALH AA QGH +VV  LLE   +L  IAR+NGKT LH+AAR GHLEVV++
Sbjct  130   SMTVDRANTTALHIAAAQGHTEVVSFLLETGCSLMSIARSNGKTALHSAARKGHLEVVQA  189

Query  1556  LVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRK  1735
             L++KD     R D KGQTALHMAVKGQNV++V EL K +PS +   DNKGNTALH+AT K
Sbjct  190   LLSKDTGTAIRKDSKGQTALHMAVKGQNVELVDELAKANPSSINEVDNKGNTALHVATGK  249

Query  1736  GRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPP-S  1912
             GR Q+V+ L+S +G+    +N++GE+  D AEK G   + T+L E G   +K    P  +
Sbjct  250   GRAQIVRTLLSYKGVAKIIINRSGESVFDTAEKSGHSKIATILAEHGIQSAKSMKLPTLN  309

Query  1913  AAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavlia  2092
               ++LKQTVS+IKH+V  QL+Q+RQT  KV ++ K++ K+H  GLNNAINS TVVAVL A
Sbjct  310   PNRELKQTVSEIKHEVHDQLKQTRQTRKKVHEMVKRLGKMHSEGLNNAINSTTVVAVLTA  369

Query  2093  tvafaaiftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqt  2263
             TVAFAAIF+VPGQY + +K    GF+ GEAN+A K  FIVFF+FDS ALFIS+ VVVVQT
Sbjct  370   TVAFAAIFSVPGQYPDPKKPLPDGFSPGEANIAPKTEFIVFFIFDSFALFISLGVVVVQT  429

Query  2264  svvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIML  2443
             S+VV+E++AK++++ +INKLMW AC+ +S+AF++L+YV+VG  E+WLA+  T +G VIM 
Sbjct  430   SIVVVEREAKERLMAVINKLMWMACVMVSVAFLALSYVIVGKEEKWLAVGVTAIGTVIMG  489

Query  2444  TTIGSMCYCVVRHRLEESRMR-NIRKAETLSR---------SFSMSMVPSDSELYNESY-  2590
              T+G+MCY +V  R+E S+ R +IR++    R               V SDSEL N  + 
Sbjct  490   MTLGTMCYWMVVQRVEASKYRCHIRRSSLSIRSHSHSNSNSHSCSFSVISDSELLNTEFK  549

Query  2591  -KRMYAV  2608
              K++YA+
Sbjct  550   SKKVYAI  556



>gb|KDO49826.1| hypothetical protein CISIN_1g009331mg [Citrus sinensis]
Length=537

 Score =   484 bits (1246),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 290/536 (54%), Positives = 389/536 (73%), Gaps = 8/536 (1%)
 Frame = +2

Query  1013  ERQLSFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEG  1192
             E+Q S+   +K  K    KR D PL    R G++  V +++  +    +++ LSK NQ G
Sbjct  6     EQQQSW---KKMKKQLTAKRDDTPLQSLVRTGSVELVLDMISSYGDMELREMLSKMNQSG  62

Query  1193  ETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPN  1372
             ETALYVAAE G+  +V E+++  D   A I + NGYDAFHIAAKQG LEVLK L+   P 
Sbjct  63    ETALYVAAEYGYVDMVREMIRYHDTSLAGIKARNGYDAFHIAAKQGCLEVLKILMEALPE  122

Query  1373  LVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVK  1552
             L+MT DSSN+TALHTA+ QGHV+VV  LLE  S LA IAR+NGKT LH+AAR GHLE+VK
Sbjct  123   LLMTFDSSNTTALHTASSQGHVEVVKFLLEKGSTLATIARSNGKTALHSAARNGHLEIVK  182

Query  1553  SLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATR  1732
             +L++K+P I  R DKKGQTALHMAVKGQ++++V EL+K +P ++ + D KGN+ALHIATR
Sbjct  183   ALLSKEPGIVLRNDKKGQTALHMAVKGQSIELVDELVKVEPVIINMVDAKGNSALHIATR  242

Query  1733  KGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPS  1912
             KGR Q+VQ+L++I G++   +NK+ ETALD AEK G  ++  +LKE G    K      +
Sbjct  243   KGRVQIVQKLLNINGVDKAVINKSRETALDTAEKTGHSEIGVILKEHGVPCGKSIKPQAN  302

Query  1913  AAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavlia  2092
             +A++LKQ VSDIKH+V  QL+ +R+T   V  IAK++ K+H  GLNNAINS TVVAVLIA
Sbjct  303   SARELKQAVSDIKHEVHDQLEHTRETRKHVHGIAKRINKMHTEGLNNAINSTTVVAVLIA  362

Query  2093  tvafaaiftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqt  2263
             TVAFAAIF+VPGQ+ +K  +     + GEA++A K  F++F +FDS+ALFIS+AVV+VQT
Sbjct  363   TVAFAAIFSVPGQFADKPDELPPKVSPGEAHIAPKTPFLIFIIFDSIALFISLAVVIVQT  422

Query  2264  svvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIML  2443
             SVVVIE+KAKKQM+ +INKLMW AC+ IS+AF++L+Y+VVG   +  A+  T +G VIM+
Sbjct  423   SVVVIERKAKKQMMAVINKLMWLACIMISVAFLALSYIVVGDDGRGWAVAVTFIGTVIMV  482

Query  2444  TTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSM-VPSDSELYNESYKRMYAV  2608
             +TIG+M Y V+ +R+E S++R+IR++   S S SMS  V  DSE  N   K +YAV
Sbjct  483   STIGTMSYWVIVNRIEASKIRSIRRSSMDSGSRSMSASVMLDSEFLNNEIK-LYAV  537



>ref|XP_009131955.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Brassica 
rapa]
Length=546

 Score =   484 bits (1246),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 292/527 (55%), Positives = 382/527 (72%), Gaps = 13/527 (2%)
 Frame = +2

Query  1052  KDSPGKRGDNPLHLAARAGNLSKVREILQRF--DSKAIKDTLSKQNQEGETALYVAAENG  1225
             K   GKR D+PLH A R G+ S V++IL       + +++ L KQNQ GETALYVAAE G
Sbjct  25    KQFTGKREDSPLHSAVRRGDFSAVKKILSDHIESEEELRELLQKQNQCGETALYVAAEYG  84

Query  1226  HTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNST  1405
                VV E++K  DL+ A   + NG+D FHIAAKQG LEVL+ L+   P L MT D SN+T
Sbjct  85    DAEVVAELIKYYDLDDAETKARNGFDPFHIAAKQGELEVLRVLMEEHPELAMTVDLSNTT  144

Query  1406  ALHTAAGQGHVDVVDLLLEI-DSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIG  1582
             ALHTAA QGHV+VV+ LLE   S+LA IA++NGKT LH+AAR GH EVVK++V  +P   
Sbjct  145   ALHTAAAQGHVEVVEYLLEAAGSSLAAIAKSNGKTALHSAARNGHAEVVKAIVAVEPDTA  204

Query  1583  FRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRL  1762
              RTDKKGQTALHMAVKGQ++D+V+EL+K   S L + D+KGNTALH+ATRKGR ++V+ L
Sbjct  205   TRTDKKGQTALHMAVKGQSLDVVVELMKGHRSSLNMVDSKGNTALHVATRKGRTKIVELL  264

Query  1763  ISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSK--DHGKPPSAAKQLKQT  1936
             +     +   +N+AGET LD AEK G P +  +LK  G   +K  ++   P+ A++LKQT
Sbjct  265   LENNETSTKAINRAGETPLDTAEKTGHPQLAAVLKTRGVPSAKSINNTTRPNPARELKQT  324

Query  1937  VSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaif  2116
             VSDIKH+V  QL+ +R+T  +V+ IAK++ K+H+ GL+NAINS TVVAVLIATVAFAAIF
Sbjct  325   VSDIKHEVHDQLEHARETRKRVQGIAKRINKMHVEGLDNAINSTTVVAVLIATVAFAAIF  384

Query  2117  tvPGQYVEKEK---KGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQK  2287
             TVPGQY ++      G +LGEAN+A+  AF +FF+FDS+ALFIS+ VVVVQTSVV IE K
Sbjct  385   TVPGQYADERSTLTPGQSLGEANIADNPAFAIFFIFDSIALFISLGVVVVQTSVVAIEHK  444

Query  2288  AKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCY  2467
             AKK M+ IINKLMW AC+ IS+AF++L +VVVG  E+WLA+  TV G  IMLTT+G+MCY
Sbjct  445   AKKNMMAIINKLMWLACVLISVAFLALAFVVVGEDERWLAVGVTVFGATIMLTTLGTMCY  504

Query  2468  CVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
              V+RHR+E S +R+ R+ E+++R+    ++     L     KRMYA+
Sbjct  505   WVIRHRIEASNVRSARR-ESMARTRQSGLMDFSGIL----TKRMYAI  546



>ref|XP_002468068.1| hypothetical protein SORBIDRAFT_01g039030 [Sorghum bicolor]
 gb|EER95066.1| hypothetical protein SORBIDRAFT_01g039030 [Sorghum bicolor]
Length=567

 Score =   484 bits (1247),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 282/534 (53%), Positives = 386/534 (72%), Gaps = 13/534 (2%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D  +H AARAG L+ +RE++   D++ +   LS+QNQ GET L+VAAE
Sbjct  36    KKMTKQLTGKRDDTAMHAAARAGQLASMREMMSGKDAEELGALLSRQNQAGETPLFVAAE  95

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  +VGE+++  D+ TASI + +GYDA HIAAKQG ++V++ELL   P L +T DSSN
Sbjct  96    YGYVALVGEMIRCHDVATASIKARSGYDALHIAAKQGDVDVVRELLQALPQLSLTVDSSN  155

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TAL++AA QGH+DVV LLL++D +LA IAR+NGKT LH+AAR GH+EVV++L+  +PSI
Sbjct  156   TTALNSAATQGHLDVVRLLLQVDRSLALIARSNGKTALHSAARNGHVEVVRALLEAEPSI  215

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQTALHMA K   +D+V  L+  +P++L   DNKGNTALHIA RK R ++++R
Sbjct  216   ALRTDKKGQTALHMASKATRLDLVDALLAAEPALLNQKDNKGNTALHIAARKARHEIIRR  275

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSAA-------  1918
             L+++   ++  +N++GET LD AEK G  D   +L E G   ++     P A        
Sbjct  276   LVTMPDTDLKAINRSGETPLDTAEKMGNGDAAELLAEHGVQSAR--AISPGAGGGNNKQQ  333

Query  1919  KQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatv  2098
             ++LKQ VSDIKH+V SQL+Q+RQT  +++ IAK++ KLH  GLNNAINS TVVAVLIATV
Sbjct  334   RELKQQVSDIKHEVHSQLEQTRQTRVRMQGIAKRINKLHEEGLNNAINSTTVVAVLIATV  393

Query  2099  afaaiftvPGQYVEKEKKGFT----LGEANVANKAAFIVFFLFDSLALFISIAvvvvqts  2266
             AFA IFTVPG+YVE  +   T    +GEAN++++ AFI+FF+FDS++LFIS+AVVVVQTS
Sbjct  394   AFAGIFTVPGEYVEDPRSSLTPGKDVGEANISHQTAFIIFFVFDSVSLFISLAVVVVQTS  453

Query  2267  vvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLT  2446
             VVVIE+KAKKQM+ +INKLMW AC+ IS++F++L++VVVG  E+WLA+  T++G  I+ T
Sbjct  454   VVVIERKAKKQMMAVINKLMWVACVLISVSFLALSFVVVGRAERWLAVSVTIMGTTILAT  513

Query  2447  TIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             TIG+M Y V+ HR+E  R+R  ++              S+ E   E YKRMYA+
Sbjct  514   TIGTMLYWVIAHRMEAKRIRTNKRNRLSRSRSLSISGMSEGEWVEEEYKRMYAI  567



>emb|CDX71059.1| BnaC03g11430D [Brassica napus]
Length=546

 Score =   484 bits (1245),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 292/527 (55%), Positives = 382/527 (72%), Gaps = 13/527 (2%)
 Frame = +2

Query  1052  KDSPGKRGDNPLHLAARAGNLSKVREIL--QRFDSKAIKDTLSKQNQEGETALYVAAENG  1225
             K   GKR D+PLH A R G+ S V++IL       + +++ L KQNQ GETALYVAAE G
Sbjct  25    KQFTGKREDSPLHSAVRRGDFSAVKKILIDHIESEEELRELLQKQNQCGETALYVAAEYG  84

Query  1226  HTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNST  1405
                VV E++K  DL+ A   + NG+D FHIAAKQG LEVL+ L+   P L MT D SN+T
Sbjct  85    DAEVVAELIKYYDLDDAETKARNGFDPFHIAAKQGELEVLRVLMEEHPELAMTVDLSNTT  144

Query  1406  ALHTAAGQGHVDVVDLLLEI-DSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIG  1582
             ALHTAA QGHV+VV+ LLE   S+LA IA++NGKT LH+AAR GH EVVK++V  +P   
Sbjct  145   ALHTAAAQGHVEVVEYLLEAAGSSLAAIAKSNGKTALHSAARNGHAEVVKAIVAVEPDTA  204

Query  1583  FRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRL  1762
              RTDKKGQTALHMAVKGQ++D+V+EL+K   S L + D+KGNTALH+ATRKGR ++V+ L
Sbjct  205   TRTDKKGQTALHMAVKGQSLDVVVELMKGHRSSLNMVDSKGNTALHVATRKGRTKIVELL  264

Query  1763  ISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSK--DHGKPPSAAKQLKQT  1936
             +     +   +N+AGET LD AEK G P +  +LK  G   +K  ++   P+ A++LKQT
Sbjct  265   LENNETSTKAINRAGETPLDTAEKTGHPQLAAVLKTRGVPSAKSINNTTRPNPARELKQT  324

Query  1937  VSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaif  2116
             VSDIKH+V  QL+ +R+T  +V+ IAK++ K+H+ GL+NAINS TVVAVLIATVAFAAIF
Sbjct  325   VSDIKHEVHDQLEHARETRKRVQGIAKRINKMHVEGLDNAINSTTVVAVLIATVAFAAIF  384

Query  2117  tvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQK  2287
             TVPGQY ++      G +LGEAN+A+  AF +FF+FDS+ALFIS+ VVVVQTSVV IE K
Sbjct  385   TVPGQYADERSSLTPGQSLGEANIADNPAFAIFFIFDSIALFISLGVVVVQTSVVAIEHK  444

Query  2288  AKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCY  2467
             AKK M+ IINKLMW AC+ IS+AF++L +VVVG  E+WLA+  TV G  IMLTT+G+MCY
Sbjct  445   AKKNMMAIINKLMWLACVLISVAFLALAFVVVGEDERWLAVGVTVFGATIMLTTLGTMCY  504

Query  2468  CVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
              V+RHR+E S +R+ R+ E+++R+    ++     L     KRMYA+
Sbjct  505   WVIRHRIEASNVRSARR-ESMARTRQSGLMDFSGIL----TKRMYAI  546



>ref|XP_002306278.2| hypothetical protein POPTR_0005s07030g [Populus trichocarpa]
 gb|EEE93274.2| hypothetical protein POPTR_0005s07030g [Populus trichocarpa]
Length=541

 Score =   483 bits (1244),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 298/528 (56%), Positives = 389/528 (74%), Gaps = 5/528 (1%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GK+ D PLH AARAGNL  V EIL     + +K+ L KQNQ GETALYVA+E
Sbjct  14    KKMTKQLTGKKDDTPLHSAARAGNLGAVMEILTGTGEEELKELLEKQNQSGETALYVASE  73

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  VV E++K  DL  A I + NG+DAFH+AAKQG +E+L+ L+   P L MT D SN
Sbjct  74    YGYVDVVREMIKYYDLADAGIKARNGFDAFHVAAKQGDMEILRLLMEAHPELSMTVDLSN  133

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA +GH+++V+LLL+  S+LA IA++NGKT LH+AAR GH+EVV++L+  +P +
Sbjct  134   TTALHTAATKGHIEIVNLLLDAGSSLATIAKSNGKTALHSAARNGHVEVVRALLTMEPGM  193

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQTA HMA KGQN++IV ELI   PS + + D KGNTALHIATRKGR Q+V+ 
Sbjct  194   ATRTDKKGQTAFHMAAKGQNIEIVEELIVAQPSSINMVDTKGNTALHIATRKGRIQIVRL  253

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKD-HGKPPSAAKQLKQT  1936
             L+   G ++  VN+  ETALD AEK G  ++  +L+E G   +K    +  + A++LKQT
Sbjct  254   LLGHSGTDLKAVNRTNETALDTAEKTGHSEIAAILQEHGVQSAKTMQPQEKNPARELKQT  313

Query  1937  VSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaif  2116
             VSDIKH+V  QL+ +RQT  +V+ IAK++ K+H  GLNNAINS TVVAVLIATVAFAAIF
Sbjct  314   VSDIKHEVYYQLEHTRQTRKRVQGIAKRLNKMHAEGLNNAINSTTVVAVLIATVAFAAIF  373

Query  2117  tvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQK  2287
             TVPG+YV+  ++   G +LGEAN+A +A FI+FF+FDS+ALFIS+AVVVVQTSVVVIE K
Sbjct  374   TVPGEYVDDPEEIPPGQSLGEANIAPQAPFIIFFIFDSIALFISLAVVVVQTSVVVIESK  433

Query  2288  AKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCY  2467
             AKKQM+ IINKLMW AC  IS+AF++L+++VVG RE+WLAI  T++G  IM+TT+G+MCY
Sbjct  434   AKKQMMAIINKLMWIACALISVAFLALSFIVVGEREKWLAIGVTIIGATIMVTTLGTMCY  493

Query  2468  CVVRHRLEESRM-RNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
              VV+HR+E S M    R +           V SD+E+ N  YK+MYA+
Sbjct  494   WVVKHRIEASNMRSIRRSSLGSRSRSFSVSVVSDAEILNNDYKKMYAI  541



>ref|XP_010443799.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Camelina 
sativa]
Length=548

 Score =   484 bits (1245),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 295/530 (56%), Positives = 381/530 (72%), Gaps = 15/530 (3%)
 Frame = +2

Query  1049  GKDSPGKRGDNPLHLAARAGNLSKVREIL--QRFDSKAIKDTLSKQNQEGETALYVAAEN  1222
              K   GKR D+PLH A R G+ S V EIL       + + + L KQNQ GET+LYVAAE 
Sbjct  24    AKQLTGKREDSPLHSAIRRGDFSAVNEILSDHMESEEELSELLRKQNQCGETSLYVAAEY  83

Query  1223  GHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNS  1402
             G   VV E++K  DLE A   + NG+D FHIAAKQG L+VL+ L+   P L MT D SN+
Sbjct  84    GDAEVVAELIKYYDLEDAETKARNGFDPFHIAAKQGELDVLRILMEEHPELAMTVDLSNT  143

Query  1403  TALHTAAGQGHVDVVDLLLEI-DSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             TALHTAA QGHV+VV+ LLE   S+LA IA++NGKT LH+AAR GH EVVK++V  +P  
Sbjct  144   TALHTAAAQGHVEVVEYLLEAAGSSLAAIAKSNGKTALHSAARNGHAEVVKAIVAVEPDT  203

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQT LHMAVKGQ++D+V+EL+K   S L + D+KGNTALH+ATRKGR ++V+ 
Sbjct  204   ATRTDKKGQTPLHMAVKGQSIDVVVELMKGHRSSLNMVDSKGNTALHVATRKGRIKIVEL  263

Query  1760  LISIEGININT--VNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKP--PSAAKQL  1927
             L+     + +T  +N+AGET LD AEK G P++  +LK  G   +K    P  P+ A++L
Sbjct  264   LLDNNETSTSTRAINRAGETPLDTAEKTGHPEIAAILKTRGVPSAKAINNPTRPNVAREL  323

Query  1928  KQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafa  2107
             KQTVSDIKH+V  QL+ +R+T  +V+ IAK++ K+HI GL+NAINS TVVAVLIATVAFA
Sbjct  324   KQTVSDIKHEVHHQLEHARETRKRVQGIAKRINKMHIEGLDNAINSTTVVAVLIATVAFA  383

Query  2108  aiftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvI  2278
             AIFTVPGQY ++      G +LGEAN+A++ AF +FF+FDS+ALFIS+AVVVVQTSVV I
Sbjct  384   AIFTVPGQYADELSSLSPGQSLGEANIADRPAFAIFFIFDSIALFISLAVVVVQTSVVAI  443

Query  2279  EQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGS  2458
             E KAKK M+ +INKLMW AC+ IS+AF++L +VVVG  E+WLA+  TV G  IMLTT+G+
Sbjct  444   EHKAKKNMMAVINKLMWVACVLISVAFLALAFVVVGEDERWLAVGVTVFGATIMLTTLGT  503

Query  2459  MCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             MCY V+ HR+E S +R  RK E+++RS    ++    E      KRMYA+
Sbjct  504   MCYWVIMHRIEASNVRKSRK-ESMARSRQSGLL----EFSGMLTKRMYAI  548



>ref|NP_200815.1| ankyrin repeat-containing protein [Arabidopsis thaliana]
 dbj|BAA96936.1| ankyrin-like protein [Arabidopsis thaliana]
 gb|AAY78871.1| ankyrin repeat family protein [Arabidopsis thaliana]
 gb|AED97273.1| ankyrin repeat-containing protein [Arabidopsis thaliana]
Length=548

 Score =   483 bits (1244),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 294/530 (55%), Positives = 381/530 (72%), Gaps = 15/530 (3%)
 Frame = +2

Query  1049  GKDSPGKRGDNPLHLAARAGNLSKVREILQRF--DSKAIKDTLSKQNQEGETALYVAAEN  1222
              K   GKR D+ L  A R G+ S V+EIL         ++D L KQNQ GETALYVAAE 
Sbjct  24    AKQFTGKREDSQLLSAVRRGDFSAVKEILSNHMESEDELRDLLRKQNQCGETALYVAAEY  83

Query  1223  GHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNS  1402
             G   VV E++K  DLE A   + NG+D FHIAAKQG L+VL+ L+   P L MT D SN+
Sbjct  84    GDADVVAELIKYYDLEDAETKARNGFDPFHIAAKQGELDVLRVLMEEHPELSMTVDLSNT  143

Query  1403  TALHTAAGQGHVDVVDLLLEI-DSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             TALHTAA QGHV+VV+ LLE   S+LA IA++NGKT LH+AAR GH EVVK++V  +P  
Sbjct  144   TALHTAAAQGHVEVVEYLLEAAGSSLAAIAKSNGKTALHSAARNGHAEVVKAIVAVEPDT  203

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQT LHMAVKGQ++D+V+EL+K   S L + D+KGNTALH+ATRKGR ++V+ 
Sbjct  204   ATRTDKKGQTPLHMAVKGQSIDVVVELMKGHRSSLNMADSKGNTALHVATRKGRIKIVEL  263

Query  1760  LISIEGININT--VNKAGETALDIAEKFGTPDVVTMLKEAGATHSK--DHGKPPSAAKQL  1927
             L+     + +T  +N+AGET LD AEK G P +  +LK  G   +K  ++   P+AA++L
Sbjct  264   LLDNNETSPSTKAINRAGETPLDTAEKTGHPQIAAVLKTRGVPSAKAINNTTRPNAAREL  323

Query  1928  KQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafa  2107
             KQTVSDIKH+V  QL+ +R+T  +V+ IAK++ K+H+ GL+NAINS TVVAVLIATVAFA
Sbjct  324   KQTVSDIKHEVHHQLEHARETRKRVQGIAKRINKMHVEGLDNAINSTTVVAVLIATVAFA  383

Query  2108  aiftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvI  2278
             AIFTVPGQY ++      G +LGEAN+A++ AF +FF+FDS+ALFIS+AVVVVQTSVV I
Sbjct  384   AIFTVPGQYADELSSLLPGQSLGEANIADRPAFAIFFIFDSIALFISLAVVVVQTSVVAI  443

Query  2279  EQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGS  2458
             E KAKK M+ +INKLMW AC+ IS+AF++L +VVVG  E+WLA+  TV G  IMLTT+G+
Sbjct  444   EHKAKKNMMAVINKLMWLACVLISVAFLALAFVVVGEEERWLAVGVTVFGATIMLTTLGT  503

Query  2459  MCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             MCY V+ HR+E S +R  RK E+++RS    ++    E      KRMYA+
Sbjct  504   MCYWVIMHRIEASNVRKSRK-ESMARSRQSGLL----EFSGILTKRMYAI  548



>ref|XP_003520633.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X1 [Glycine max]
 ref|XP_006576989.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X2 [Glycine max]
Length=521

 Score =   482 bits (1240),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 277/492 (56%), Positives = 368/492 (75%), Gaps = 5/492 (1%)
 Frame = +2

Query  1052  KDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHT  1231
             K   G RGD+PL  A RAGNL  V EI+ +   + +K+ LSKQN   ETALYVAAENGH 
Sbjct  4     KQLTGIRGDSPLQSAIRAGNLELVLEIISQSPEEELKELLSKQNNSCETALYVAAENGHL  63

Query  1232  LVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTAL  1411
              ++ E+++  D+  AS  + NG+DAFHIAAK GHLE+LK L+  FP + MT D SN+T L
Sbjct  64    DILKELIRYHDIGLASFKARNGFDAFHIAAKNGHLEILKVLMEAFPEISMTVDLSNTTVL  123

Query  1412  HTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRT  1591
             HTAA QGH++VV+ LLE  ++L  IA++NGKTVLH++AR G++EVVK+LV+K+P I  R 
Sbjct  124   HTAAAQGHIEVVNFLLEKGNSLVTIAKSNGKTVLHSSARNGYMEVVKALVSKEPEIAMRI  183

Query  1592  DKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISI  1771
             DKKGQTALHMAVKGQN+++V EL+K +PS+  + D KGNTALHIATRKGR Q+VQ+L+  
Sbjct  184   DKKGQTALHMAVKGQNLELVDELVKLNPSLANMVDTKGNTALHIATRKGRLQVVQKLLDC  243

Query  1772  EGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPS-AAKQLKQTVSDI  1948
               IN + +NK+GETALD AEK G  ++   L+  GA  +K    P +  A +LKQTVSDI
Sbjct  244   REINTDVINKSGETALDTAEKNGRLEIANFLQHHGAQSAKSIKSPTTNTALELKQTVSDI  303

Query  1949  KHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPG  2128
             K  V +QL+ + +T  +++ IAK++ K+H  GLNNAINS  VVAVLIATVAFAAIF VPG
Sbjct  304   KSGVHNQLEHTIKTQRRMQGIAKRINKMHTEGLNNAINSNIVVAVLIATVAFAAIFNVPG  363

Query  2129  QYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQ  2299
             QY EK  +   G + GEA +A    F++F +FDS ALFIS+AVV+VQTSVVVIE+KAK+Q
Sbjct  364   QYPEKPSELSPGMSPGEAYIAPDIGFMIFIIFDSTALFISLAVVIVQTSVVVIERKAKRQ  423

Query  2300  MVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVR  2479
             M+ +INKLMW AC+ IS+AFI+++Y++VG  ++ LAI +T +G VIM  T+G++CY V+ 
Sbjct  424   MMAVINKLMWVACVLISVAFIAMSYIIVGDHKE-LAIAATALGTVIMAATLGTLCYWVIA  482

Query  2480  HRLEESRMRNIR  2515
             HRLE SR+R++R
Sbjct  483   HRLEASRLRSLR  494



>ref|XP_006282166.1| hypothetical protein CARUB_v10028425mg [Capsella rubella]
 gb|EOA15064.1| hypothetical protein CARUB_v10028425mg [Capsella rubella]
Length=548

 Score =   483 bits (1242),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 295/530 (56%), Positives = 381/530 (72%), Gaps = 15/530 (3%)
 Frame = +2

Query  1049  GKDSPGKRGDNPLHLAARAGNLSKVREILQRF--DSKAIKDTLSKQNQEGETALYVAAEN  1222
              K   GKR D+PLH A R G+ S V EIL       + +++ L KQNQ GETALYVAAE 
Sbjct  24    AKQLTGKREDSPLHSAVRRGDFSAVTEILSNHMESEEELRELLRKQNQCGETALYVAAEY  83

Query  1223  GHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNS  1402
             G   VV E++K  DLE A   + NG+D FHIAAKQG L+VL+ L+   P L MT D SN+
Sbjct  84    GDAEVVAELIKYYDLEDAETKARNGFDPFHIAAKQGELDVLRVLMEEHPELAMTVDLSNT  143

Query  1403  TALHTAAGQGHVDVVDLLLEI-DSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             TALHTAA QGHV+VV+ LLE   S+LA IA++NGKT LH+AAR GH EVVK++V  +P  
Sbjct  144   TALHTAAAQGHVEVVEYLLEAAGSSLAAIAKSNGKTALHSAARNGHEEVVKAIVAVEPDT  203

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQT LHMAVKGQ++D+V+EL+K   S L + D KGNTALH+ATRKGR ++V+ 
Sbjct  204   ATRTDKKGQTPLHMAVKGQSIDVVVELMKGHRSSLNMADFKGNTALHVATRKGRIKIVEL  263

Query  1760  LISIEGININT--VNKAGETALDIAEKFGTPDVVTMLKEAGATHSK--DHGKPPSAAKQL  1927
             L+     + +T  +N+AGET LD AEK G P++  +LK  G   +K  ++   P+AA++L
Sbjct  264   LLDNNETSTSTTAINRAGETPLDTAEKIGHPEIAAVLKTRGVPSAKAINNSTRPNAAREL  323

Query  1928  KQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafa  2107
             KQTVSDIKH+V  QL+ +R+T  +V+ IAK++ K+H+ GL+NAINS TVVAVLIATVAFA
Sbjct  324   KQTVSDIKHEVHHQLEHARETRKRVQGIAKRINKMHVEGLDNAINSTTVVAVLIATVAFA  383

Query  2108  aiftvPGQYVE---KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvI  2278
             AIFTVPGQY +       G +LGEAN+A++ AF +FF+FDS+ALFIS+AVVVVQTSVV I
Sbjct  384   AIFTVPGQYADDLSSLSPGQSLGEANIADRPAFAIFFIFDSIALFISLAVVVVQTSVVAI  443

Query  2279  EQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGS  2458
             E KAKK M+ +INKLMW AC+ IS+AF++L +VVVG  E+WLA+  TV G  IMLTT+G+
Sbjct  444   EHKAKKNMMAVINKLMWLACVLISVAFLALAFVVVGDDERWLAVGVTVFGASIMLTTLGT  503

Query  2459  MCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             MCY V+ HR+E S +R  RK E++ RS    ++    E      KRMYA+
Sbjct  504   MCYWVIMHRIEASNVRKSRK-ESMERSRQSGLL----EFSGILTKRMYAI  548



>ref|XP_007208006.1| hypothetical protein PRUPE_ppa003717mg [Prunus persica]
 gb|EMJ09205.1| hypothetical protein PRUPE_ppa003717mg [Prunus persica]
Length=554

 Score =   483 bits (1242),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 294/552 (53%), Positives = 386/552 (70%), Gaps = 24/552 (4%)
 Frame = +2

Query  1016  RQLSFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGE  1195
             RQ SF  E+K  K   GKR D PLHLAAR GNL  V EI+       + + LSKQN  GE
Sbjct  6     RQQSFS-EKKMTKQLTGKREDTPLHLAARQGNLGLVIEIISNCGEADLNEVLSKQNHSGE  64

Query  1196  TALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNL  1375
             TALYVAAE G+  +V E++K  D+ +A I + NG+DAFHIA+KQG+LEVL  L+   P L
Sbjct  65    TALYVAAECGYVDLVKEMMKYYDIGSAGIKARNGFDAFHIASKQGNLEVLTVLMEAIPEL  124

Query  1376  VMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKS  1555
              MT D SNSTALHTAA QGH++VV+ LLE   +L  IA+ NGKT LH+AAR GHLEVVK+
Sbjct  125   SMTVDHSNSTALHTAAAQGHIEVVNFLLETGCSLVSIAQRNGKTALHSAARKGHLEVVKA  184

Query  1556  LVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRK  1735
             L++K+  I  R DKKGQTALHMAVKGQNV++V EL K DPS++ + DNKGNTALHIAT+K
Sbjct  185   LLSKETGIATRNDKKGQTALHMAVKGQNVELVNELTKADPSLINVVDNKGNTALHIATQK  244

Query  1736  GRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPS-  1912
                Q+V+ L+S +G+   T+NK+GETALD AE+ G   +  +L E G   +K   KPP+ 
Sbjct  245   ALVQIVRVLLSYKGVAETTINKSGETALDTAERSGHSLIAAILVEHGIESAKSI-KPPTL  303

Query  1913  -AAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavli  2089
                ++LKQTVS+IKH+V  QL+ +RQT  +V  + K++ K+H  GLNNAINS TVVAVLI
Sbjct  304   NTNRELKQTVSEIKHEVHDQLKHTRQTRKQVHGMVKRLSKMHSEGLNNAINSTTVVAVLI  363

Query  2090  atvafaaiftvPGQY-------------VEKEKKGFTLGEANVANKAAFIVFFLFDSLAL  2230
             ATVAFAAIFT+PGQY             +E+   G++ GEAN+A +  F+VFF+FDS AL
Sbjct  364   ATVAFAAIFTLPGQYPKPPEKAPPGNIALEEVPPGYSPGEANIAPRTEFVVFFIFDSFAL  423

Query  2231  FISIAvvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAI  2410
             FIS+AVVVVQTS+VVIE+KAK++++ +INKLMW AC+ +S+AF++L+ ++VG  E+WLA+
Sbjct  424   FISLAVVVVQTSIVVIERKAKEKLMTVINKLMWMACVMVSVAFLALSCIIVG-EEKWLAV  482

Query  2411  YSTVVGGVIMLTTIGSMCYCVVRHRLE----ESRMRNIRKAETLSRSFSMSMVPSDSELY  2578
               T +G VIM TT+G+MCY ++  R+E     S  R    +           V SDSEL 
Sbjct  483   GVTAIGTVIMGTTLGTMCYWMIAQRVEASKMRSSTRRSSMSSWSHSHSCSFSVMSDSELL  542

Query  2579  NESY--KRMYAV  2608
             N  +  K++YA+
Sbjct  543   NTQFKSKKVYAI  554



>ref|XP_008241703.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Prunus 
mume]
 ref|XP_008241711.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Prunus 
mume]
 ref|XP_008241719.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Prunus 
mume]
Length=554

 Score =   482 bits (1240),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 293/552 (53%), Positives = 387/552 (70%), Gaps = 24/552 (4%)
 Frame = +2

Query  1016  RQLSFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGE  1195
             RQ SF  E+K  K   GKR D PLHLAAR GNL  V EI+       + + LSKQN  GE
Sbjct  6     RQQSFS-EKKMTKQLTGKREDTPLHLAARQGNLGLVIEIISNCGEADLNEVLSKQNHSGE  64

Query  1196  TALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNL  1375
             TALYVAAE G+  +V E++K  D+ +A I + NG+DAFHIA+KQG+ EVLK L+   P L
Sbjct  65    TALYVAAECGYVDLVKEMMKYYDIGSAGIKARNGFDAFHIASKQGNFEVLKVLMEAIPEL  124

Query  1376  VMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKS  1555
              MT D SNSTALHTAA QGH++VV+ LLE   +L  IA+ NGKT LH+AAR GHLEVVK+
Sbjct  125   SMTVDHSNSTALHTAAAQGHIEVVNFLLETGCSLVSIAQRNGKTALHSAARKGHLEVVKA  184

Query  1556  LVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRK  1735
             L++K+  I  R DKKGQTALHMAVKG+NV++V EL K DPS++ + DNKGNTALHIAT+K
Sbjct  185   LLSKETGIATRNDKKGQTALHMAVKGRNVELVNELAKADPSLINVVDNKGNTALHIATQK  244

Query  1736  GRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPS-  1912
                Q+V+ L+S +G+   T+NK+GETALD AE+ G   +  +L E G   +K   KPP+ 
Sbjct  245   ALVQIVRVLLSYKGVAETTINKSGETALDTAERSGHSLIAAILVEHGIESAKSI-KPPTL  303

Query  1913  -AAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavli  2089
                ++LKQTVS+IKH+V  QL+ +RQT  +V  + K++ K+H  GLNNAINS TVVAVLI
Sbjct  304   NTNRELKQTVSEIKHEVHDQLKHTRQTRKQVHGMVKRLSKMHSEGLNNAINSTTVVAVLI  363

Query  2090  atvafaaiftvPGQY-------------VEKEKKGFTLGEANVANKAAFIVFFLFDSLAL  2230
             ATVAFAAIFT+PGQY             +E+   G++ GEAN+A++  F+VFF+FDS AL
Sbjct  364   ATVAFAAIFTLPGQYPKPPEKAPPGNIALEEVPPGYSPGEANIASRTEFVVFFIFDSFAL  423

Query  2231  FISIAvvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAI  2410
             FIS+AVVVVQTS+VVIE+KAK++++ +INKLMW AC+ +S+AF++L+ ++VG  E+WLA+
Sbjct  424   FISLAVVVVQTSIVVIERKAKEKLMTVINKLMWMACVMVSVAFLALSCIIVG-EEKWLAV  482

Query  2411  YSTVVGGVIMLTTIGSMCYCVVRHRLE----ESRMRNIRKAETLSRSFSMSMVPSDSELY  2578
               T +G VIM TT+G+MCY ++  R+E     S  R    +           V SDSEL 
Sbjct  483   GVTAIGTVIMGTTLGTMCYWMIAQRVEASKMRSSTRRSSMSSWSHSHSCSFSVMSDSELL  542

Query  2579  NESY--KRMYAV  2608
             N  +  K++YA+
Sbjct  543   NTQFKSKKVYAI  554



>ref|XP_011089403.1| PREDICTED: ankyrin repeat-containing protein At5g02620 isoform 
X1 [Sesamum indicum]
Length=564

 Score =   482 bits (1241),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 293/558 (53%), Positives = 399/558 (72%), Gaps = 6/558 (1%)
 Frame = +2

Query  950   MEKQKSFKGLMEKQKSFRIAMERQLSFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVRE  1129
             ME  K +   +  Q    +A          +K  K   GKR D  LH AARAGN+  +R+
Sbjct  8     MEGGKRWLLFLHNQVKMEVASSGPTPTTPRKKMTKQLTGKRDDTELHAAARAGNIVAIRD  67

Query  1130  ILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAF  1309
             ++     + + + L+KQN  GET LYVAAE G+  VV E+++  D+  A I + NG+DA 
Sbjct  68    VINGAGEEELVELLAKQNSAGETPLYVAAEYGYYEVVREMIQYYDMAAAGIKARNGFDAL  127

Query  1310  HIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIA  1489
             HIAAKQG LEV+K L+   P L MT D +N+T LHTAA QG ++VV+  L+ +S+LA IA
Sbjct  128   HIAAKQGDLEVVKVLMEAHPELSMTVDMANTTVLHTAAAQGRMEVVNYFLDAESSLAAIA  187

Query  1490  RNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKP  1669
             R+NGKT LH+AAR GH+EVVK+L++K+  +  RTDKKGQTALHMAVKGQN+++V ELI+ 
Sbjct  188   RSNGKTALHSAARNGHVEVVKALLSKERGMTARTDKKGQTALHMAVKGQNLEVVEELIRA  247

Query  1670  DPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPD  1849
             DP  L + D KGNT LHIA+RKGR Q V++L+S + I+   VN++ ETA+D AEK G  D
Sbjct  248   DPLTLNMVDTKGNTPLHIASRKGRSQNVEKLLSNKEIDTRVVNRSNETAIDTAEKMGNSD  307

Query  1850  VVTMLKEAGATHSKD-HGKPPSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvk  2026
             +  +L+  G   ++    +  +  ++LKQTVSDIKH+V +QL+ +RQT  +V+ IAK++ 
Sbjct  308   IAAILRGHGVLSARAISPQSTNPVRELKQTVSDIKHEVHNQLEHTRQTRKRVQGIAKRIN  367

Query  2027  kLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKEKK---GFTLGEANVANKAAF  2197
             K+H  GLNNAINS TVVAVLIATVAFAAIFT+PGQYV+  +    G  LGEA++A K  F
Sbjct  368   KMHAEGLNNAINSTTVVAVLIATVAFAAIFTIPGQYVDDARSIPDGQVLGEAHIAPKVPF  427

Query  2198  IVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYV  2377
             I+FF+FDS+ALFIS+AVVVVQTS+VVIE KAKKQM+ IINKLMW AC+ +S+A+++L++V
Sbjct  428   IIFFIFDSIALFISLAVVVVQTSIVVIESKAKKQMMAIINKLMWLACVLVSVAYLALSFV  487

Query  2378  VVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFS-MSM  2554
             VVG RE+WLAI  T++G  I++TT+  MCY VV HR+E S M+ +RK    SRS S +++
Sbjct  488   VVGNREKWLAIGVTIIGTSILVTTLSIMCYWVVMHRIESSSMKGLRKDSLGSRSRSGLAL  547

Query  2555  VPSDSELYNESYKRMYAV  2608
             +PS++E  N S K+MYA+
Sbjct  548   IPSETEALN-SEKKMYAI  564



>ref|XP_011089404.1| PREDICTED: ankyrin repeat-containing protein At5g02620 isoform 
X2 [Sesamum indicum]
Length=541

 Score =   481 bits (1238),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 288/528 (55%), Positives = 391/528 (74%), Gaps = 6/528 (1%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D  LH AARAGN+  +R+++     + + + L+KQN  GET LYVAAE
Sbjct  15    KKMTKQLTGKRDDTELHAAARAGNIVAIRDVINGAGEEELVELLAKQNSAGETPLYVAAE  74

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  VV E+++  D+  A I + NG+DA HIAAKQG LEV+K L+   P L MT D +N
Sbjct  75    YGYYEVVREMIQYYDMAAAGIKARNGFDALHIAAKQGDLEVVKVLMEAHPELSMTVDMAN  134

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +T LHTAA QG ++VV+  L+ +S+LA IAR+NGKT LH+AAR GH+EVVK+L++K+  +
Sbjct  135   TTVLHTAAAQGRMEVVNYFLDAESSLAAIARSNGKTALHSAARNGHVEVVKALLSKERGM  194

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               RTDKKGQTALHMAVKGQN+++V ELI+ DP  L + D KGNT LHIA+RKGR Q V++
Sbjct  195   TARTDKKGQTALHMAVKGQNLEVVEELIRADPLTLNMVDTKGNTPLHIASRKGRSQNVEK  254

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKD-HGKPPSAAKQLKQT  1936
             L+S + I+   VN++ ETA+D AEK G  D+  +L+  G   ++    +  +  ++LKQT
Sbjct  255   LLSNKEIDTRVVNRSNETAIDTAEKMGNSDIAAILRGHGVLSARAISPQSTNPVRELKQT  314

Query  1937  VSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaif  2116
             VSDIKH+V +QL+ +RQT  +V+ IAK++ K+H  GLNNAINS TVVAVLIATVAFAAIF
Sbjct  315   VSDIKHEVHNQLEHTRQTRKRVQGIAKRINKMHAEGLNNAINSTTVVAVLIATVAFAAIF  374

Query  2117  tvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQK  2287
             T+PGQYV+  +    G  LGEA++A K  FI+FF+FDS+ALFIS+AVVVVQTS+VVIE K
Sbjct  375   TIPGQYVDDARSIPDGQVLGEAHIAPKVPFIIFFIFDSIALFISLAVVVVQTSIVVIESK  434

Query  2288  AKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCY  2467
             AKKQM+ IINKLMW AC+ +S+A+++L++VVVG RE+WLAI  T++G  I++TT+  MCY
Sbjct  435   AKKQMMAIINKLMWLACVLVSVAYLALSFVVVGNREKWLAIGVTIIGTSILVTTLSIMCY  494

Query  2468  CVVRHRLEESRMRNIRKAETLSRSFS-MSMVPSDSELYNESYKRMYAV  2608
              VV HR+E S M+ +RK    SRS S ++++PS++E  N S K+MYA+
Sbjct  495   WVVMHRIESSSMKGLRKDSLGSRSRSGLALIPSETEALN-SEKKMYAI  541



>ref|XP_007027137.1| Ankyrin repeat family protein isoform 2 [Theobroma cacao]
 gb|EOY07639.1| Ankyrin repeat family protein isoform 2 [Theobroma cacao]
Length=537

 Score =   480 bits (1236),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 296/538 (55%), Positives = 398/538 (74%), Gaps = 6/538 (1%)
 Frame = +2

Query  1010  MERQLSFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQE  1189
             ME+   FG ++K  K   GKR D PLH A RAG+   V EI+   +   ++D LSKQNQ 
Sbjct  1     MEQSFGFG-KKKMTKQMTGKRDDTPLHSAVRAGDFELVLEIISGGEDGELRDLLSKQNQS  59

Query  1190  GETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFP  1369
             GETALYVAAE G+  +V E++K  D++ A   + NGYDAFHIAAKQG L VLK L+    
Sbjct  60    GETALYVAAECGYADLVKEMIKYCDIDLAGAQARNGYDAFHIAAKQGDLGVLKILMEANL  119

Query  1370  NLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVV  1549
             +L MT+DS N+TALHTAA QGH +VV+ LLE  SN+A IAR NGKT LH+AA+ GHLE+V
Sbjct  120   DLSMTSDSLNTTALHTAASQGHTEVVNFLLENGSNMATIARRNGKTALHSAAKNGHLEIV  179

Query  1550  KSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIAT  1729
             K+L++K+P I  R DKKGQTALHMAVKG+NV++V ELIK DPS++ + D KGNTALHI T
Sbjct  180   KALLSKEPGIAMRIDKKGQTALHMAVKGKNVEVVDELIKSDPSLINMVDTKGNTALHIGT  239

Query  1730  RKGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSK-DHGKP  1906
             +KGR Q+VQ L++  G+N   +NK GETALD AEK    D+  +L E G   +K    +P
Sbjct  240   QKGRIQIVQMLLNHSGVNKLVINKFGETALDTAEKNKRSDIAGILGEHGVQSAKFIKSQP  299

Query  1907  PSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavl  2086
              ++A++LKQTVSDIK+ V  QL+ +RQT  +V+ IAK++ K+H+ GLNNAINS TVVAVL
Sbjct  300   TNSARELKQTVSDIKNGVHHQLEHTRQTRKRVQGIAKRLNKMHVEGLNNAINSTTVVAVL  359

Query  2087  iatvafaaiftvPGQYV---EKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvv  2257
             IAT+AFAAIF VPGQY    E +  G + G+A  A+K  F++F +FDS+ALFIS+AVVVV
Sbjct  360   IATIAFAAIFNVPGQYADSPEDKAPGVSPGQARTASKPPFMIFIVFDSIALFISLAVVVV  419

Query  2258  qtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVI  2437
             QTSVVVI++ AK+QM+ +INKLMW AC+ IS+AF++L+Y+VVG  E+WLA   T +G VI
Sbjct  420   QTSVVVIQRNAKEQMMAVINKLMWLACVLISVAFLALSYIVVGEDERWLANLITGIGTVI  479

Query  2438  MLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSM-VPSDSELYNESYKRMYAV  2608
             M++T+G++CY ++ +R+E S++R+IR++   SRS S+SM   SD ++ ++  K++Y V
Sbjct  480   MVSTLGTLCYWLIVNRIEASKIRSIRRSSINSRSRSLSMSYMSDMDILHDEQKKLYVV  537



>tpg|DAA48337.1| TPA: hypothetical protein ZEAMMB73_216697 [Zea mays]
Length=424

 Score =   476 bits (1225),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 267/424 (63%), Positives = 337/424 (79%), Gaps = 5/424 (1%)
 Frame = +2

Query  1352  LLNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARM  1531
             +L   P L MTT+S N+TAL TAA QGHVD+V+LLLE D++LA+I RNNGKTVLH+AARM
Sbjct  1     MLQALPALAMTTNSVNATALDTAAIQGHVDIVNLLLETDASLARITRNNGKTVLHSAARM  60

Query  1532  GHLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNT  1711
             GH+EVV+SL+NKDP IG RTDKKGQTALHMA K QN +IV+EL+KPD SV+ + DNKGN 
Sbjct  61    GHVEVVRSLLNKDPRIGLRTDKKGQTALHMASKAQNAEIVVELLKPDVSVIHIEDNKGNR  120

Query  1712  ALHIATRKGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSK  1891
              LH+ATRKG   +VQ L+S+EGI++N VN++GETA  IAEK  + ++V +LKEAG   +K
Sbjct  121   PLHVATRKGNIIIVQTLLSVEGIDVNAVNRSGETAFAIAEKMDSVELVNILKEAGGEAAK  180

Query  1892  DHGKPPSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSlt  2071
                 PP++AKQLK+TVSDI+HDV+SQ +Q+RQT  +V +I K+++KLHI GLNNAINS T
Sbjct  181   QQVHPPNSAKQLKETVSDIRHDVQSQFKQTRQTKMQVNQIKKRLEKLHIGGLNNAINSNT  240

Query  2072  vvavliatvafaaiftvPGQYVE---KEKKGFTLGEANVANKAAFIVFFLFDSLALFISI  2242
             VVAVLIATVAFAAIFTVPG +VE   +   G +LG+A VA+  AFIVF +FD+LALFIS+
Sbjct  241   VVAVLIATVAFAAIFTVPGNFVEELSQAPPGMSLGQAYVASNPAFIVFLVFDALALFISL  300

Query  2243  AvvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTV  2422
             AVVVVQTS++V+E++AKK+MVF++NKLMW ACLFIS+AFI+LTYVVVG  + WLA  +  
Sbjct  301   AVVVVQTSLIVVERRAKKRMVFVMNKLMWLACLFISVAFIALTYVVVGRDDWWLAWCTMG  360

Query  2423  VGGVIMLTTIGSMCYCVVRHRLEESRMRNIRKAE-TLSRSFSMSMVPSDSELYNESYK-R  2596
             +G  IMLTT+GSMCYC+V HRLEE   R IR+A  + SR      V SD E+ N  YK +
Sbjct  361   IGAAIMLTTLGSMCYCIVAHRLEEKNTRKIRRASASQSRGSWSRSVDSDEEILNSEYKTK  420

Query  2597  MYAV  2608
             MYA+
Sbjct  421   MYAL  424


 Score = 53.5 bits (127),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 72/137 (53%), Gaps = 6/137 (4%)
 Frame = +2

Query  1073  GDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGEIL  1252
             G   LH AAR G++  VR +L +     ++      +++G+TAL++A++  +  +V E+L
Sbjct  50    GKTVLHSAARMGHVEVVRSLLNKDPRIGLRT-----DKKGQTALHMASKAQNAEIVVELL  104

Query  1253  KQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQG  1432
             K  D+    I  N G    H+A ++G++ +++ LL+V    V   + S  TA   A    
Sbjct  105   KP-DVSVIHIEDNKGNRPLHVATRKGNIIIVQTLLSVEGIDVNAVNRSGETAFAIAEKMD  163

Query  1433  HVDVVDLLLEIDSNLAK  1483
              V++V++L E     AK
Sbjct  164   SVELVNILKEAGGEAAK  180



>gb|KHN09446.1| Ankyrin repeat-containing protein [Glycine soja]
Length=520

 Score =   480 bits (1235),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 276/492 (56%), Positives = 368/492 (75%), Gaps = 5/492 (1%)
 Frame = +2

Query  1052  KDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHT  1231
             K   G RGD+PL  A RAGNL  V EI+ +   + +K+ LSKQN   ETALYVAAENGH 
Sbjct  3     KQLTGIRGDSPLQSAIRAGNLELVLEIISQSPEEELKELLSKQNNSCETALYVAAENGHL  62

Query  1232  LVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTAL  1411
              ++ E+++  D+  AS  + NG+DAFHIAAK GHLE+LK L+  FP + MT D SN+T L
Sbjct  63    DILKELIRYHDIGLASFKARNGFDAFHIAAKNGHLEILKVLMEAFPEISMTVDLSNTTVL  122

Query  1412  HTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRT  1591
             HTAA QGH++VV+ LLE  ++L  IA++NGKTVLH++AR G++EVVK+LV+K+P I  R 
Sbjct  123   HTAAAQGHIEVVNFLLEKGNSLVTIAKSNGKTVLHSSARNGYMEVVKALVSKEPEIAMRI  182

Query  1592  DKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISI  1771
             DKKGQTALHMAVKGQN+++V EL+K +PS+  + D KGNTALHIATRKGR Q+VQ+L+  
Sbjct  183   DKKGQTALHMAVKGQNLELVDELVKLNPSLANMVDAKGNTALHIATRKGRLQVVQKLLDC  242

Query  1772  EGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPS-AAKQLKQTVSDI  1948
               IN + +NK+GETALD AEK G  ++   L+  GA  +K    P +  A +LKQTVSDI
Sbjct  243   REINTDVINKSGETALDTAEKNGRLEIANFLQHHGAQSAKSIKSPTTNMALELKQTVSDI  302

Query  1949  KHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPG  2128
             K  V +QL+ + +T  +++ IAK++ K+H  GLNNAINS  VVAVLIATVAFAAIF VPG
Sbjct  303   KSGVHNQLEHTIKTQRRMQGIAKRINKMHTEGLNNAINSNIVVAVLIATVAFAAIFNVPG  362

Query  2129  QYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQ  2299
             QY EK  +   G + GEA +A    F++F +FDS ALFIS+AVV+VQTSVVVIE+KAK+Q
Sbjct  363   QYPEKPSELSPGMSPGEAYIAPDIGFMIFIIFDSTALFISLAVVIVQTSVVVIERKAKRQ  422

Query  2300  MVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVR  2479
             M+ +INKLMW AC+ IS+AFI+++Y++VG  ++ LAI +T +G +IM  T+G++CY V+ 
Sbjct  423   MMAVINKLMWVACVLISVAFIAMSYIIVGDHKE-LAIAATALGTLIMAATLGTLCYWVIA  481

Query  2480  HRLEESRMRNIR  2515
             HRLE SR+R++R
Sbjct  482   HRLEASRLRSLR  493



>ref|XP_009148027.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Brassica 
rapa]
Length=607

 Score =   482 bits (1241),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 297/532 (56%), Positives = 388/532 (73%), Gaps = 10/532 (2%)
 Frame = +2

Query  1037  ERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAA  1216
             ++K  K   GKR D  LH A R GN  +V EIL +     + + L KQNQ GETALYVAA
Sbjct  78    KKKMAKQLTGKREDTLLHSAVRRGNKDEVVEILTKTREPQLNELLGKQNQSGETALYVAA  137

Query  1217  ENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSS  1396
             E G   +V E++K+ DL    I + NG+DAFHIAAKQG L+VLK L      L MT D  
Sbjct  138   EYGDVEIVKEMIKRYDLSLVEIKARNGFDAFHIAAKQGDLDVLKVLAEAHSELAMTVDLL  197

Query  1397  NSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPS  1576
             N+TALHTAA QGH DVV+ LLE+ S+LA IA++NGKT LH+A+R GH++VVK+L+  +P+
Sbjct  198   NTTALHTAATQGHTDVVNFLLELGSSLAGIAKSNGKTALHSASRNGHVKVVKALLASEPA  257

Query  1577  IGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQ  1756
             I  R DKKGQTALHMA KG NV++V ELIK D S + + D KGNTALHIA RKGR Q+V+
Sbjct  258   IAIRMDKKGQTALHMAAKGTNVEVVEELIKADRSSINIADTKGNTALHIAARKGRSQIVK  317

Query  1757  RLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSA--AKQLK  1930
              L+     +   VN+ GETALD AEK G P+V  +L++ G   +K   KP  A  A++LK
Sbjct  318   LLLDNNITDTKAVNRTGETALDTAEKVGNPEVALILQKHGVPSAKT-IKPSGANPARELK  376

Query  1931  QTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaa  2110
             QTVSDIKH+V +QL+ +RQT  +V+ IAK++ K+H  GLNNAINS TVVAVLIATVAFAA
Sbjct  377   QTVSDIKHEVHNQLEHTRQTRRRVQGIAKQLNKMHTEGLNNAINSTTVVAVLIATVAFAA  436

Query  2111  iftvPGQYVE---KEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIE  2281
             IFTVPGQYVE       G +LGEAN+A+   FI+FF+FDS+ALFIS+AVVVVQTSVVVIE
Sbjct  437   IFTVPGQYVEDITNLPDGHSLGEANIASTTPFIIFFIFDSIALFISLAVVVVQTSVVVIE  496

Query  2282  QKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSM  2461
              KAKKQM+ +INKLMW AC+ IS+AF++L++VVVG  E+WLAI+ T +G  IM+TT+G+M
Sbjct  497   SKAKKQMMAVINKLMWLACVLISVAFLALSFVVVGEEEKWLAIWVTAIGATIMITTLGTM  556

Query  2462  CYCVVRHRLEESRMRNIRKAETLSRSFSMSM-VP--SDSELYNESYKRMYAV  2608
             CY +++H++E +  RNIR++ +++ S S S  +P  +D+++     K+MYA+
Sbjct  557   CYWIIQHKIEAANARNIRRS-SINNSKSGSWGIPQLTDTDVLQNECKKMYAI  607



>ref|XP_007027136.1| Ankyrin repeat family protein isoform 1 [Theobroma cacao]
 gb|EOY07638.1| Ankyrin repeat family protein isoform 1 [Theobroma cacao]
Length=587

 Score =   481 bits (1239),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 298/549 (54%), Positives = 402/549 (73%), Gaps = 6/549 (1%)
 Frame = +2

Query  977   LMEKQKSFRIAMERQLSFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKA  1156
             L E ++     ME+   FG ++K  K   GKR D PLH A RAG+   V EI+   +   
Sbjct  40    LKEAKEQETTGMEQSFGFG-KKKMTKQMTGKRDDTPLHSAVRAGDFELVLEIISGGEDGE  98

Query  1157  IKDTLSKQNQEGETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHL  1336
             ++D LSKQNQ GETALYVAAE G+  +V E++K  D++ A   + NGYDAFHIAAKQG L
Sbjct  99    LRDLLSKQNQSGETALYVAAECGYADLVKEMIKYCDIDLAGAQARNGYDAFHIAAKQGDL  158

Query  1337  EVLKELLNVFPNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLH  1516
              VLK L+    +L MT+DS N+TALHTAA QGH +VV+ LLE  SN+A IAR NGKT LH
Sbjct  159   GVLKILMEANLDLSMTSDSLNTTALHTAASQGHTEVVNFLLENGSNMATIARRNGKTALH  218

Query  1517  TAARMGHLEVVKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGD  1696
             +AA+ GHLE+VK+L++K+P I  R DKKGQTALHMAVKG+NV++V ELIK DPS++ + D
Sbjct  219   SAAKNGHLEIVKALLSKEPGIAMRIDKKGQTALHMAVKGKNVEVVDELIKSDPSLINMVD  278

Query  1697  NKGNTALHIATRKGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAG  1876
              KGNTALHI T+KGR Q+VQ L++  G+N   +NK GETALD AEK    D+  +L E G
Sbjct  279   TKGNTALHIGTQKGRIQIVQMLLNHSGVNKLVINKFGETALDTAEKNKRSDIAGILGEHG  338

Query  1877  ATHSK-DHGKPPSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNN  2053
                +K    +P ++A++LKQTVSDIK+ V  QL+ +RQT  +V+ IAK++ K+H+ GLNN
Sbjct  339   VQSAKFIKSQPTNSARELKQTVSDIKNGVHHQLEHTRQTRKRVQGIAKRLNKMHVEGLNN  398

Query  2054  AINSltvvavliatvafaaiftvPGQYV---EKEKKGFTLGEANVANKAAFIVFFLFDSL  2224
             AINS TVVAVLIAT+AFAAIF VPGQY    E +  G + G+A  A+K  F++F +FDS+
Sbjct  399   AINSTTVVAVLIATIAFAAIFNVPGQYADSPEDKAPGVSPGQARTASKPPFMIFIVFDSI  458

Query  2225  ALFISIAvvvvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWL  2404
             ALFIS+AVVVVQTSVVVI++ AK+QM+ +INKLMW AC+ IS+AF++L+Y+VVG  E+WL
Sbjct  459   ALFISLAVVVVQTSVVVIQRNAKEQMMAVINKLMWLACVLISVAFLALSYIVVGEDERWL  518

Query  2405  AIYSTVVGGVIMLTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSM-VPSDSELYN  2581
             A   T +G VIM++T+G++CY ++ +R+E S++R+IR++   SRS S+SM   SD ++ +
Sbjct  519   ANLITGIGTVIMVSTLGTLCYWLIVNRIEASKIRSIRRSSINSRSRSLSMSYMSDMDILH  578

Query  2582  ESYKRMYAV  2608
             +  K++Y V
Sbjct  579   DEQKKLYVV  587



>ref|XP_011019262.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Populus 
euphratica]
Length=538

 Score =   479 bits (1234),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 288/530 (54%), Positives = 388/530 (73%), Gaps = 11/530 (2%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDT--LSKQNQEGETALYVA  1213
             +K  K   GKR D P H   RAGNL  V+E++     +A + T  LSKQNQ GETALYVA
Sbjct  13    KKMTKQLTGKRDDTPFHSVVRAGNLKLVKEMIAENLGEAAELTVMLSKQNQSGETALYVA  72

Query  1214  AENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDS  1393
             +E  H  +V E++K  D   AS+ + NGYDAFHIAAKQG LE++K L+ V P L +T DS
Sbjct  73    SEYSHVDIVKELIKYYDTSLASLKARNGYDAFHIAAKQGDLEIVKVLMEVDPELSLTFDS  132

Query  1394  SNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDP  1573
             SN+TALH+AA QGHV+VV+ LLE  S+LA IA++NGKT LH+AAR GHLE++K+L++K+P
Sbjct  133   SNTTALHSAASQGHVEVVNFLLEKCSSLALIAKSNGKTALHSAARNGHLEILKALLSKEP  192

Query  1574  SIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMV  1753
              +  + DKKGQTALHMAVKGQ V++V ELI  DPS++ + DNKGN+ALHIA RKGR Q+V
Sbjct  193   GLVIKIDKKGQTALHMAVKGQAVELVEELIMSDPSLMNMVDNKGNSALHIAVRKGRDQIV  252

Query  1754  QRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPP--SAAKQL  1927
             ++L+  +GI+   VN++ ETA DIAEK G   + ++L+E G   +K   KP   +A ++L
Sbjct  253   RKLLDQKGIDKTIVNRSRETAFDIAEKNGHRGIASVLEEHGVLSAKSM-KPTTKTANREL  311

Query  1928  KQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafa  2107
             KQTVSDIKH V +QL+ +R T  +V+ IAK++ K+H  GLNNAINS TVVAVLIATVAFA
Sbjct  312   KQTVSDIKHGVHNQLETTRLTRKRVQGIAKRINKMHTEGLNNAINSTTVVAVLIATVAFA  371

Query  2108  aiftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvI  2278
             AIF +PGQ+ +       G + GEA +A K  F++F +FDS+ALFIS+AVVVVQTS+VVI
Sbjct  372   AIFQLPGQFADNPDNLAPGQSAGEAKIAPKPEFMIFIIFDSIALFISLAVVVVQTSIVVI  431

Query  2279  EQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGS  2458
             E+KAKKQ++ +INKLMW AC+ IS+AF++L+YVVVG  E+WLA+  TV+G +IM+TTIG+
Sbjct  432   ERKAKKQLMSVINKLMWLACVLISVAFLALSYVVVGADEKWLALSVTVIGTIIMVTTIGT  491

Query  2459  MCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             M Y V+  R+E S++R    + + S S S      +SE+    +K++YA+
Sbjct  492   MGYWVIVQRIETSKLRRSLTSRSRSESMSFM---EESEILENDFKKLYAI  538



>gb|EYU36245.1| hypothetical protein MIMGU_mgv1a019161mg, partial [Erythranthe 
guttata]
Length=522

 Score =   479 bits (1232),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 290/521 (56%), Positives = 382/521 (73%), Gaps = 16/521 (3%)
 Frame = +2

Query  1094  AARAGNLSKVREILQ----RFDSKAIKDTLSKQNQEGETALYVAAENGHTLVVGEILKQL  1261
             AAR GN+  +R+I+     + +  A+++ LSKQN  GETALYVAAE G+  +V E++   
Sbjct  2     AARGGNVVAIRDIINGAANQEEEDALRELLSKQNSSGETALYVAAEYGYFELVKEMINHY  61

Query  1262  DLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTALHTAAGQGHVD  1441
             +L  ASI + NG+DA HIAAKQG  EV+K LL   P L MT D+SN+TALHTAA QGH+D
Sbjct  62    NLAEASIKAKNGFDALHIAAKQGDFEVVKVLLEAQPELSMTVDASNTTALHTAATQGHLD  121

Query  1442  VVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRTDKKGQTALHM  1621
             +V+  L+ +SNL  IA++NGKT LH+AAR GH+E+VK+L+ K+P+I  R DKKGQTALHM
Sbjct  122   IVNYFLDSESNLVAIAKSNGKTALHSAARNGHVEIVKALLVKEPAITTRIDKKGQTALHM  181

Query  1622  AVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISIEGI-NINTVN  1798
             AVKGQN+++V ELI+ D S + + D KGNTALHIATRKGR Q+V+ L+  + I +   VN
Sbjct  182   AVKGQNLEVVEELIRADSSTINMVDTKGNTALHIATRKGRAQIVKMLLEEKEITDTRAVN  241

Query  1799  KAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPS----AAKQLKQTVSDIKHDVES  1966
             +A ETA D +EK G  ++  +LKE G    +   KP S     A++LKQTVSDIKH+V  
Sbjct  242   RANETAFDTSEKMGHSNITAILKENGVLSVRAIMKPQSTANPTARELKQTVSDIKHEVHH  301

Query  1967  QLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPGQYVEKE  2146
             QL+ +RQT  +V+ IAK++ K+H  GLNNAINS TVVAVLIATVAFAAIFTVPGQY +  
Sbjct  302   QLEHTRQTRKRVQGIAKRINKMHTEGLNNAINSTTVVAVLIATVAFAAIFTVPGQYADDP  361

Query  2147  ---KKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQMVFIIN  2317
                  G +LGEAN++ K  F++FF+FDS ALFIS+AVVVVQTSVVVIE +AKK+M+ +IN
Sbjct  362   GNIPAGLSLGEANISPKIPFLIFFIFDSFALFISLAVVVVQTSVVVIESRAKKKMMAVIN  421

Query  2318  KLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVRHRLEES  2497
             KLMW AC+F+S+A++ L++VVVG  E+WLAI  TV+G  IM  T+G+MCY V+ HR++ S
Sbjct  422   KLMWAACVFVSVAYLGLSFVVVGEEERWLAIGVTVIGTAIMAATLGTMCYWVIVHRIDLS  481

Query  2498  RM-RNI-RKAETLSRSFSMSMVP--SDSELYNESYKRMYAV  2608
             R  RNI RK    S S S S+V   SDSE+ +  +K+MYA+
Sbjct  482   RSKRNILRKNSRGSGSRSCSVVSLLSDSEVLDNEFKKMYAI  522



>emb|CDX95126.1| BnaC05g05450D [Brassica napus]
Length=540

 Score =   478 bits (1231),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 295/542 (54%), Positives = 386/542 (71%), Gaps = 11/542 (2%)
 Frame = +2

Query  1010  MERQLSFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQE  1189
             ME +     ++K  K   GKR D  LH A R GN  +V EIL +     + + L KQNQ 
Sbjct  1     MEGEEDTVPKKKMAKQLTGKREDTQLHSAVRRGNKDEVVEILTKAREPELNELLGKQNQS  60

Query  1190  GETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFP  1369
             GETALYVAAE G   +V E++K+ DL    I + NG+DAFHIAAKQG L+VLK L     
Sbjct  61    GETALYVAAEYGDVEIVKEMIKRYDLSLVEIKARNGFDAFHIAAKQGDLDVLKVLAEAHS  120

Query  1370  NLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVV  1549
              L MT D  N+TALHTAA QGH +VV+ LLE+ S+LA IA++NGKT LH+A+R GH++VV
Sbjct  121   ELAMTVDLLNTTALHTAATQGHTEVVNFLLELGSSLAGIAKSNGKTALHSASRNGHVKVV  180

Query  1550  KSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIAT  1729
             K+L+  +P+I  R DKKGQT+LHMA KG NV++V ELIK D S + + D KGNTALHIA 
Sbjct  181   KALLASEPAISIRMDKKGQTSLHMAAKGTNVEVVEELIKADRSSINIADTKGNTALHIAA  240

Query  1730  RKGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKP-  1906
             RKGR  +V+ L+     +   VN+ GETALD AEK G P+V  +L++ G   +K   KP 
Sbjct  241   RKGRSHIVKLLLDNNITDTKAVNRTGETALDTAEKVGNPEVALILQKHGVPSAKTI-KPS  299

Query  1907  --PSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvva  2080
                + A++LKQTVSDIKH+V +QL+ +RQT  +V+ IAK++ K+H  GLNNAINS TVVA
Sbjct  300   GGANPARELKQTVSDIKHEVHNQLEHTRQTRRRVQGIAKQLNKMHTEGLNNAINSTTVVA  359

Query  2081  vliatvafaaiftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvv  2251
             VLIATVAFAAIFTVPGQYVE       G +LGEAN+A+   FI+FF+FDS+ALFIS+AVV
Sbjct  360   VLIATVAFAAIFTVPGQYVEDTSNLPDGHSLGEANIASTTPFIIFFIFDSIALFISLAVV  419

Query  2252  vvqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGG  2431
             VVQTSVVVIE KAKKQM+ +INKLMW AC+ IS+AF++L++VVVG  E+WLAI+ T +G 
Sbjct  420   VVQTSVVVIESKAKKQMMAVINKLMWLACVLISVAFLALSFVVVGEEEKWLAIWVTAIGA  479

Query  2432  VIMLTTIGSMCYCVVRHRLEESRMRNIRKAE---TLSRSFSMSMVPSDSELYNESYKRMY  2602
              IM+TT+G+MCY +++H++E +  RNIR++    + S S+ +  +     L NE  K+MY
Sbjct  480   TIMITTLGTMCYWIIQHKIEAANARNIRRSSINNSKSGSWGIPQLTDTDALQNEC-KKMY  538

Query  2603  AV  2608
             A+
Sbjct  539   AI  540



>ref|XP_010228779.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Brachypodium 
distachyon]
 ref|XP_010228780.1| PREDICTED: ankyrin repeat-containing protein At5g02620 [Brachypodium 
distachyon]
Length=545

 Score =   478 bits (1231),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 296/531 (56%), Positives = 389/531 (73%), Gaps = 8/531 (2%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D  LH AARAG L+ VRE L     + ++  LSKQN  GET L+VAAE
Sbjct  15    KKMTKQLTGKRDDTALHAAARAGQLAAVRETLSGAAPEELRALLSKQNTAGETPLFVAAE  74

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  +V E++K  D+ TA I + +GYDA HIAAKQG +EV+KELL   P L MT D+SN
Sbjct  75    YGYVALVSEMIKYHDVATAGIKARSGYDALHIAAKQGDVEVVKELLGALPELAMTVDASN  134

Query  1400  STALHTAAGQGHVDVVDLLLEIDSN--LAKIARNNGKTVLHTAARMGHLEVVKSLVNKDP  1573
             +TAL+TAA QGH +VV LLL ++ +  LA IAR+NGKT LH+AAR GH+E V++L+  +P
Sbjct  135   TTALNTAATQGHAEVVRLLLGVEGSQSLALIARSNGKTALHSAARNGHVEAVRALLEAEP  194

Query  1574  SIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMV  1753
             SI  R DKKGQTALHMA KG ++D+V  L+  DPS+L L D KGNTALHIA RK R Q++
Sbjct  195   SIALRVDKKGQTALHMAAKGTSLDLVDALLGADPSLLNLPDTKGNTALHIAARKARHQII  254

Query  1754  QRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKD---HGKPPSAAKQ  1924
             +RL+ +   ++  +N+AGET LD AEK G  +V   L E G   ++D    G     A++
Sbjct  255   KRLLEMPDTDLKAINRAGETPLDTAEKMGNGEVSGALAEGGVQSARDLNPAGGGGKQARE  314

Query  1925  LKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvaf  2104
             LKQ VSDIKH+V SQL+Q+RQT  +++ IAK++ KLH  GLNNAINS TVVAVLIATVAF
Sbjct  315   LKQEVSDIKHEVHSQLEQTRQTRVRMQGIAKRINKLHEEGLNNAINSTTVVAVLIATVAF  374

Query  2105  aaiftvPGQYVEKEK--KGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvI  2278
             AAIFTVPG+YV+ +    G  LGEAN+A++  FI+FF+FDS+ALFIS+AVVVVQTSVVVI
Sbjct  375   AAIFTVPGEYVDADSLGPGQELGEANIAHETPFIIFFVFDSVALFISLAVVVVQTSVVVI  434

Query  2279  EQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGS  2458
             E+KAKKQM+ +INKLMW AC+ +S+AF++L++VVVG  E+WLA+  T++G  I++TTIG+
Sbjct  435   ERKAKKQMMAVINKLMWVACVLVSVAFLALSFVVVGRAERWLAVAVTIMGATILVTTIGT  494

Query  2459  MCYCVVRHRLEESRMRNIR-KAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             M Y V+ HR+E  R+RNI+  + + SRS S S   S+SE  +E  K+MYA+
Sbjct  495   MLYWVIAHRIEAKRLRNIKRSSMSRSRSQSGSGGLSESEWIDEECKKMYAI  545



>emb|CDX88738.1| BnaA03g09110D [Brassica napus]
Length=536

 Score =   478 bits (1230),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 289/524 (55%), Positives = 378/524 (72%), Gaps = 17/524 (3%)
 Frame = +2

Query  1052  KDSPGKRGDNPLHLAARAGNLSKVREILQRF--DSKAIKDTLSKQNQEGETALYVAAENG  1225
             K   GKR D+PLH A R G+ S V++IL       + +++ L KQNQ GETALYVAAE G
Sbjct  25    KQFTGKREDSPLHSAVRRGDFSAVKKILSDHIESEEELRELLQKQNQCGETALYVAAEYG  84

Query  1226  HTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNST  1405
                VV E++K  DL+ A   + NG+D FHIAAKQG LEVL+ L+   P L MT D SN+T
Sbjct  85    DAEVVAELIKYYDLDDAETKARNGFDPFHIAAKQGELEVLRVLMEEHPELAMTVDLSNTT  144

Query  1406  ALHTAAGQGHVDVVDLLLEI-DSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIG  1582
             ALHTAA QGHV+VV+ LLE   S+LA IA++NGKT LH+AAR GH EVVK++V  +P   
Sbjct  145   ALHTAAAQGHVEVVEYLLEAAGSSLAAIAKSNGKTALHSAARNGHAEVVKAIVAVEPDTA  204

Query  1583  FRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRL  1762
              RTDKKGQTALHMAVKGQ++D+V+EL+K   S L + D+KGNTALH+ATRKGR ++V+ L
Sbjct  205   TRTDKKGQTALHMAVKGQSLDVVVELMKGHRSSLNMVDSKGNTALHVATRKGRTKIVELL  264

Query  1763  ISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSK--DHGKPPSAAKQLKQT  1936
             +     +   +N+AGET LD AEK G P +  +LK  G   +K  ++   P+ A++LKQT
Sbjct  265   LENNETSTKAINRAGETPLDTAEKTGHPQLAAVLKTRGVPSAKSINNTTRPNPARELKQT  324

Query  1937  VSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaif  2116
             VSDIKH+V  QL+ +R+T  +V+ IAK++ K+H+ GL+NAINS TVVAVLIATVAFAAIF
Sbjct  325   VSDIKHEVHDQLEHARETRKRVQGIAKRINKMHVEGLDNAINSTTVVAVLIATVAFAAIF  384

Query  2117  tvPGQYVEKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKK  2296
             TVPGQY ++ K       AN+A+  AF +FF+FDS+ALFIS+ VVVVQTSVV IE KAKK
Sbjct  385   TVPGQYADERK-------ANIADNPAFAIFFIFDSIALFISLGVVVVQTSVVAIEHKAKK  437

Query  2297  QMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVV  2476
              M+ IINKLMW AC+ IS+AF++L +VVVG  E+WLA+  TV G  IMLTT+G+MCY V+
Sbjct  438   NMMAIINKLMWLACVLISVAFLALAFVVVGEDERWLAVGVTVFGATIMLTTLGTMCYWVI  497

Query  2477  RHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             RHR+E S +R+ R+ E+++R+    ++     L     KRMYA+
Sbjct  498   RHRIEASNVRSARR-ESMARTRQSGLMDFSGIL----TKRMYAI  536



>ref|XP_002308487.2| hypothetical protein POPTR_0006s23110g [Populus trichocarpa]
 gb|EEE92010.2| hypothetical protein POPTR_0006s23110g [Populus trichocarpa]
Length=538

 Score =   477 bits (1228),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 287/531 (54%), Positives = 387/531 (73%), Gaps = 11/531 (2%)
 Frame = +2

Query  1037  ERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDT--LSKQNQEGETALYV  1210
             ++K  K   GKR D P H   RAGNL  V+E++     +A + T  LSKQNQ GETALYV
Sbjct  12    QKKMTKQLTGKRDDTPFHAVVRAGNLKLVKEMVAENLGEAAELTVMLSKQNQSGETALYV  71

Query  1211  AAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTD  1390
             A+E  H  +V E++K  D   AS+ + NGYD FHIAAKQG LE++K L+ V P L +T D
Sbjct  72    ASEYSHVDIVKELIKYYDTGLASLKARNGYDTFHIAAKQGDLEIVKVLMEVDPELSLTFD  131

Query  1391  SSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKD  1570
             SSN+TALH+AA QGHV+VV+ LLE  S LA IA++NGKT LH+AAR GHLE++K+L++K+
Sbjct  132   SSNTTALHSAASQGHVEVVNFLLEKCSGLALIAKSNGKTALHSAARNGHLEILKALLSKE  191

Query  1571  PSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQM  1750
             P +  + DKKGQTALHMAVKGQ V++V ELI  DPS++ + DNKGN+ALHIA RKGR Q+
Sbjct  192   PGLVIKIDKKGQTALHMAVKGQTVELVEELIMSDPSLMNMVDNKGNSALHIAVRKGRDQI  251

Query  1751  VQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPP--SAAKQ  1924
             V++L+  +GI+   VN++ ET  DIAEK G   + ++L+E G   +K   KP   +A ++
Sbjct  252   VRKLLDQQGIDKTIVNRSRETPFDIAEKNGHRGIASILEEHGVLSAKSM-KPTTKTANRE  310

Query  1925  LKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvaf  2104
             LKQTVSDIKH V +QL+ +R T  +V+ IAK++ K+H  GLNNAINS TVVAVLIATVAF
Sbjct  311   LKQTVSDIKHGVHNQLETTRLTRKRVQGIAKRLNKMHTEGLNNAINSTTVVAVLIATVAF  370

Query  2105  aaiftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvv  2275
             AAIF +PGQ+V+       G + GEA +A K  F++F +FDS+ALFIS+AVVVVQTS+VV
Sbjct  371   AAIFQLPGQFVDNPDNLAPGQSAGEAKIAPKPEFMIFIIFDSIALFISLAVVVVQTSIVV  430

Query  2276  IEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIG  2455
             IE+KAKKQ++ +INKLMW AC+ IS+AF++L+YVVVG  E+WLA+  TV+G +IM+TTIG
Sbjct  431   IERKAKKQLMSVINKLMWLACVLISVAFLALSYVVVGDDEKWLALSVTVIGTIIMVTTIG  490

Query  2456  SMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             +M Y V+  R+E S++R    + + S S S      +SE+    +K++YA+
Sbjct  491   TMGYWVIVQRIETSKLRRSLTSRSRSESMSFM---EESEILENDFKKLYAI  538



>gb|KDO49827.1| hypothetical protein CISIN_1g009331mg [Citrus sinensis]
Length=534

 Score =   476 bits (1226),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 289/536 (54%), Positives = 387/536 (72%), Gaps = 11/536 (2%)
 Frame = +2

Query  1013  ERQLSFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEG  1192
             E+Q S+   +K  K    KR D PL    R G++  V +++  +    +++ LSK NQ G
Sbjct  6     EQQQSW---KKMKKQLTAKRDDTPLQSLVRTGSVELVLDMISSYGDMELREMLSKMNQSG  62

Query  1193  ETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPN  1372
             ETALYVAAE G+  +V E+++  D   A I + NGYDAFHIAAKQG LEVLK L+   P 
Sbjct  63    ETALYVAAEYGYVDMVREMIRYHDTSLAGIKARNGYDAFHIAAKQGCLEVLKILMEALPE  122

Query  1373  LVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVK  1552
             L+MT DSSN+TALHTA+ QGHV+VV  LLE  S LA IAR+NGKT LH+AAR GHLE+VK
Sbjct  123   LLMTFDSSNTTALHTASSQGHVEVVKFLLEKGSTLATIARSNGKTALHSAARNGHLEIVK  182

Query  1553  SLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATR  1732
             +L++K+P I  R DKKGQTALHMAVKGQ++++V EL+K +P ++ + D KGN+ALHIATR
Sbjct  183   ALLSKEPGIVLRNDKKGQTALHMAVKGQSIELVDELVKVEPVIINMVDAKGNSALHIATR  242

Query  1733  KGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPS  1912
             KGR   VQ+L++I G++   +NK+ ETALD AEK G  ++  +LKE G    K      +
Sbjct  243   KGR---VQKLLNINGVDKAVINKSRETALDTAEKTGHSEIGVILKEHGVPCGKSIKPQAN  299

Query  1913  AAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavlia  2092
             +A++LKQ VSDIKH+V  QL+ +R+T   V  IAK++ K+H  GLNNAINS TVVAVLIA
Sbjct  300   SARELKQAVSDIKHEVHDQLEHTRETRKHVHGIAKRINKMHTEGLNNAINSTTVVAVLIA  359

Query  2093  tvafaaiftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqt  2263
             TVAFAAIF+VPGQ+ +K  +     + GEA++A K  F++F +FDS+ALFIS+AVV+VQT
Sbjct  360   TVAFAAIFSVPGQFADKPDELPPKVSPGEAHIAPKTPFLIFIIFDSIALFISLAVVIVQT  419

Query  2264  svvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIML  2443
             SVVVIE+KAKKQM+ +INKLMW AC+ IS+AF++L+Y+VVG   +  A+  T +G VIM+
Sbjct  420   SVVVIERKAKKQMMAVINKLMWLACIMISVAFLALSYIVVGDDGRGWAVAVTFIGTVIMV  479

Query  2444  TTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSM-VPSDSELYNESYKRMYAV  2608
             +TIG+M Y V+ +R+E S++R+IR++   S S SMS  V  DSE  N   K +YAV
Sbjct  480   STIGTMSYWVIVNRIEASKIRSIRRSSMDSGSRSMSASVMLDSEFLNNEIK-LYAV  534



>ref|XP_009762672.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Nicotiana 
sylvestris]
 ref|XP_009762673.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Nicotiana 
sylvestris]
Length=537

 Score =   475 bits (1223),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 280/529 (53%), Positives = 382/529 (72%), Gaps = 10/529 (2%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D+ LH AARAGN+  +RE ++    + + + L KQN  GET LYVAAE
Sbjct  13    KKMTKQLTGKRDDSALHSAARAGNIVAIRETIKNTGEEELAELLIKQNSAGETPLYVAAE  72

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  VV E++   DL TA I + NG+DA HIAAKQG L+++K LL   P L MT D +N
Sbjct  73    YGYYEVVREMIMYYDLVTAGIKARNGFDALHIAAKQGDLDMVKVLLEAHPELAMTVDVAN  132

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH++VV+  L   S+LA IA++NGKT LH++AR GHL+V+K+L++K+P I
Sbjct  133   TTALHTAANQGHIEVVNYFLAEQSSLATIAKSNGKTALHSSARNGHLQVLKALLSKEPGI  192

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               R D KGQTALHMAVKGQN+++V ELIK DPS++ + DNKGNT LHIA RKGR ++V+ 
Sbjct  193   ATRMDNKGQTALHMAVKGQNLEVVEELIKTDPSLINMVDNKGNTPLHIAARKGRSEIVKL  252

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPS--AAKQLKQ  1933
             L+     +   +N++ ETALD AEK    D V +L+E G   ++   KP +   A++LKQ
Sbjct  253   LLGQNETDKKVINRSHETALDTAEKMSQADTVAILQEHGVESARVL-KPQAINPARELKQ  311

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH+V  QL+ +RQT  +++ IAK++ K+H  GLNNAINS TVVAVLIATVAFA I
Sbjct  312   TVSDIKHEVHDQLKHTRQTRKRIQGIAKRLHKMHREGLNNAINSTTVVAVLIATVAFAGI  371

Query  2114  ftvPGQYV---EKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             F VPGQY    +    G  +GEAN++N   F+VFF+FDS+ALFIS+AVVVVQT+VVVIE 
Sbjct  372   FQVPGQYYMDPDNLPPGHIIGEANISNHPVFLVFFIFDSIALFISLAVVVVQTTVVVIES  431

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             KAKK+++ IINKLMW AC+ +S+A+++L++VVVGTR + +AI  +++G VIM++TIG M 
Sbjct  432   KAKKKLMSIINKLMWVACVLVSVAYLALSFVVVGTRYRLMAIIVSILGAVIMISTIGVML  491

Query  2465  YCVVRHRLEESRMRNIRKAETLSRSFSMS-MVPSDSELYNESYKRMYAV  2608
             + V+ HR+E S  +++RK    S+S  +S  V SD    N+ YK++YA+
Sbjct  492   FWVISHRIESSNKKSMRKNSMASKSLDLSDSVLSDD---NDEYKKIYAI  537



>ref|XP_004493908.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Cicer 
arietinum]
Length=520

 Score =   474 bits (1219),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 279/524 (53%), Positives = 382/524 (73%), Gaps = 11/524 (2%)
 Frame = +2

Query  1052  KDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHT  1231
             K   G RGD+ LH A RAGNL  V E++       +K+ LSK+N  GETALY+AAENGH 
Sbjct  3     KQLTGLRGDSTLHSAIRAGNLELVLEMISENQGDELKELLSKKNNSGETALYIAAENGHL  62

Query  1232  LVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTAL  1411
              +V E++K  D+   S+ + NG+DAFH+AAK G+LE+LK L   FP + MT D +N+TAL
Sbjct  63    DMVKELIKYHDIGLVSLKARNGFDAFHVAAKNGNLEILKVLTEAFPEISMTVDLTNTTAL  122

Query  1412  HTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRT  1591
             HTA  QGH++VV+ LLE  S++  IA++NGKT  H+AAR GH+EV+K+L++ +P I  R 
Sbjct  123   HTAVVQGHIEVVNFLLEKSSSVVTIAKSNGKTAFHSAARNGHVEVIKALLSSEPEIAMRI  182

Query  1592  DKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISI  1771
             DKKGQTALHMAVKGQN+++V EL+K +PS   + D KGNTALHI TRKGR Q+VQ+L+  
Sbjct  183   DKKGQTALHMAVKGQNLEVVDELLKLNPSFANMVDTKGNTALHITTRKGRLQIVQKLLDC  242

Query  1772  EGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPS-AAKQLKQTVSDI  1948
             +  + + +NK+GETALDIAE+ G  D+   L++ GA +++    P +  A +LKQTVSDI
Sbjct  243   KETDTDVINKSGETALDIAERNGRLDIAKFLQDRGAQNARSIKSPSTNRALELKQTVSDI  302

Query  1949  KHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPG  2128
             K  V +QL+ + +T  +++ IAK++ K+   GLNNAINS TVVAVLIATVAFAAIFTVPG
Sbjct  303   KSGVHNQLEHTFKTQRRMKGIAKRINKMQAEGLNNAINSNTVVAVLIATVAFAAIFTVPG  362

Query  2129  QYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQ  2299
             QY +  K    G + GEAN+A    F++F +FDS ALFIS+AVV+VQTSVVVIE++AKKQ
Sbjct  363   QYPQNTKNLAPGMSPGEANIAPNIDFLLFVIFDSTALFISLAVVIVQTSVVVIEREAKKQ  422

Query  2300  MVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVR  2479
             M  IINKLMW AC+ IS+AF++++Y+VVG +++ LAI +T +G VIM  T+G++CY V+ 
Sbjct  423   MTAIINKLMWVACVLISVAFLAMSYIVVGDQKE-LAIAATALGTVIMAATLGTLCYWVIA  481

Query  2480  HRLEESRMRNIRKAETLSRSFSMS-MVPSDSELYNESYKRMYAV  2608
             HRLE SR+R++R   +  +S +MS M  S++E     YK +YA+
Sbjct  482   HRLETSRLRSLRTMTSSRQSLTMSGMSASENE-----YKTVYAI  520



>ref|XP_009598255.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Nicotiana 
tomentosiformis]
 ref|XP_009598256.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Nicotiana 
tomentosiformis]
Length=537

 Score =   473 bits (1216),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 277/530 (52%), Positives = 379/530 (72%), Gaps = 12/530 (2%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D+ LH AARAGN+  +RE ++    + + + L KQN  GET LYVAAE
Sbjct  13    KKMTKQLTGKRDDSALHSAARAGNIVAIRETIKNTGEEELAELLIKQNSAGETPLYVAAE  72

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  VV E++   DL  A I + NG+DA HIAAKQG L+++K L+   P L MT D +N
Sbjct  73    YGYYEVVREMIMYYDLVAAGIKARNGFDALHIAAKQGDLDMVKVLMEAHPELAMTVDVAN  132

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH++VV+  LE  S+LA IA++NGKT LH++AR GHL+V+K+L++K+P I
Sbjct  133   TTALHTAANQGHIEVVNYFLEEQSSLATIAKSNGKTALHSSARNGHLQVLKALLSKEPGI  192

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               R D KGQT LHMAVKGQN+++V ELIK DPS++ + DNKGNT LHIA RKGR ++V+ 
Sbjct  193   ATRMDNKGQTVLHMAVKGQNLEVVEELIKTDPSLINMVDNKGNTPLHIAARKGRSEIVKL  252

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHS---KDHGKPPSAAKQLK  1930
             L+     +   +N++ ETALD AEK    + V +L+E G   +   K H   P  A++LK
Sbjct  253   LLGQNETDKKLINRSHETALDTAEKMSQAETVAILQEHGVESARVLKPHATNP--ARELK  310

Query  1931  QTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaa  2110
             QTVSDIKH+V  QL+ +RQT  +++ IAK++ K+H  GLNNAINS TVVAVLIATVAFA 
Sbjct  311   QTVSDIKHEVHDQLKHTRQTRKRIQGIAKRLHKMHREGLNNAINSTTVVAVLIATVAFAG  370

Query  2111  iftvPGQYV---EKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIE  2281
             IF VPGQY         G  +GEAN++N   F++FF+FDS+ALFIS+AVVVVQT+VVVIE
Sbjct  371   IFQVPGQYYMDPHNLPPGHIIGEANISNHHGFLIFFIFDSIALFISLAVVVVQTTVVVIE  430

Query  2282  QKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSM  2461
              KAKK+++ IINKLMW AC+ +S+A+++L++VVVGTR + +AI  +++G VIM++TIG M
Sbjct  431   SKAKKKLMSIINKLMWVACVLVSVAYLALSFVVVGTRYRLMAIIVSILGAVIMISTIGVM  490

Query  2462  CYCVVRHRLEESRMRNIRKAETLSRSFSMS-MVPSDSELYNESYKRMYAV  2608
              + V+ HR+E S  +++RK    S+S  +S  V SD    N+ YK++YA+
Sbjct  491   LFWVISHRIESSNKKSMRKNSMASKSLELSDSVLSDD---NDEYKKIYAI  537



>ref|XP_008345436.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Malus 
domestica]
 ref|XP_008345437.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Malus 
domestica]
 ref|XP_008345438.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Malus 
domestica]
Length=556

 Score =   473 bits (1217),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 289/547 (53%), Positives = 383/547 (70%), Gaps = 17/547 (3%)
 Frame = +2

Query  1016  RQLSFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGE  1195
             RQ SF G +K  K   GKR + PLHLAARAG+L  V EI+     + + + LS+QN  GE
Sbjct  11    RQQSFAG-KKMPKQLTGKRDNGPLHLAARAGDLGLVVEIMSNCGEEELNELLSEQNYAGE  69

Query  1196  TALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNL  1375
             TALY+AA  G+  +V E++K  D+  ASI + NG DAFHIA+KQGHLEVLK L+   P L
Sbjct  70    TALYLAAGGGYVGLVKEMMKYHDVGAASIKAGNGCDAFHIASKQGHLEVLKILMESIPEL  129

Query  1376  VMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKS  1555
              MT D +N+TALH AA QGH +VV  LLE   +L  IAR+NGKT LH+AAR GHLEVV++
Sbjct  130   SMTVDRANTTALHIAAAQGHTEVVSFLLETGCSLMSIARSNGKTALHSAARKGHLEVVQA  189

Query  1556  LVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRK  1735
             L++KD     R D KGQTALHMAVKG NV++V EL K +PS++   DNKGNTALH+AT K
Sbjct  190   LLSKDTGSAIRKDSKGQTALHMAVKGLNVELVDELAKANPSLINEVDNKGNTALHVATGK  249

Query  1736  GRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPP-S  1912
             GR Q+V+ L+S +G+    +N++GE+  D AEK G   + T+L E G   +K    P  +
Sbjct  250   GRAQIVRTLLSYKGVAKTIINRSGESVFDTAEKSGHSKIATVLAEHGIQSAKSMKLPTLN  309

Query  1913  AAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavlia  2092
               ++LKQTVS+IKH+V  QL+Q+RQT  KV  + K++ K+H+ GLNNAINS TVVAVL A
Sbjct  310   PNRELKQTVSEIKHEVHDQLKQTRQTRKKVHGMVKRLGKMHLEGLNNAINSTTVVAVLTA  369

Query  2093  tvafaaiftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqt  2263
             TVAFAAIF+VPGQY + +K    GF+ GEAN+A K  FIVFF+FDS ALFIS+AVVVVQT
Sbjct  370   TVAFAAIFSVPGQYPDPKKPLPDGFSPGEANIAPKTEFIVFFIFDSFALFISLAVVVVQT  429

Query  2264  svvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIML  2443
             S+VV+E++AK++++ +INKLMW AC+ +S+AF++L+YV+VG  E+WLA+  T +G VIM 
Sbjct  430   SIVVVEREAKERLMTVINKLMWMACVMVSVAFLALSYVIVGKEEKWLAVGVTAIGTVIMG  489

Query  2444  TTIGSMCYCVVRHRLEESRMR-NIRK---------AETLSRSFSMSMVPSDSELYNESY-  2590
              T+G+MCY +V  R+E S+ R  IR+             +       V SDSEL N  + 
Sbjct  490   MTLGTMCYWMVVQRVEASKYRCCIRRSSLSIHSHSHSNSNSHSCSFSVISDSELLNTEFK  549

Query  2591  -KRMYAV  2608
              K++YA+
Sbjct  550   SKKVYAI  556



>ref|XP_010037883.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Eucalyptus 
grandis]
 ref|XP_010037885.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Eucalyptus 
grandis]
 gb|KCW49663.1| hypothetical protein EUGRSUZ_K03177 [Eucalyptus grandis]
Length=545

 Score =   473 bits (1216),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 300/544 (55%), Positives = 391/544 (72%), Gaps = 13/544 (2%)
 Frame = +2

Query  1010  MERQLSFGGERKRGKDSPG-KRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQ  1186
             +ERQ SF   RK+    P  KR D PLHLAAR+G+   + + L     +  K  L+KQNQ
Sbjct  4     LERQKSF--PRKKMTKQPTVKRDDTPLHLAARSGDTEVLLDALSMAGVEEWKGLLTKQNQ  61

Query  1187  EGETALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVF  1366
              GET LYVAAE GH  +V E++   D+ +A I + NGYDAFHIAAKQG L+VLK L+   
Sbjct  62    SGETILYVAAECGHVDLVRELMPYYDIGSAGIKARNGYDAFHIAAKQGDLDVLKILMEKS  121

Query  1367  PNLVMTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEV  1546
               L MT+DS+N+TALHTAA QGH +VV  LLE   NLA IA+NNGK  LH+A+R GHLEV
Sbjct  122   HELSMTSDSANTTALHTAAAQGHFEVVKFLLEECGNLALIAKNNGKMALHSASRNGHLEV  181

Query  1547  VKSLVNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIA  1726
             VK+ ++K+P +    DKKGQTALHMAVKGQ+ D+V EL+   PS L + D KGNTALHIA
Sbjct  182   VKAFLSKEPGLATVCDKKGQTALHMAVKGQSPDVVEELLNLHPSPLNMVDTKGNTALHIA  241

Query  1727  TRKGRPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKP  1906
             TRK R Q++ +L++   ++   VN++GETALD AEK G  ++  +L++ G   +K    P
Sbjct  242   TRKARTQILSKLLNHSDLDKTAVNRSGETALDTAEKAGQSEIAAVLRDHGVPSAKSLNPP  301

Query  1907  -PSAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvav  2083
              P+ A++LKQTVSDIKH+V  QL+ +RQT  +V+ I K++ K+H  GLNNAINS TVVAV
Sbjct  302   TPTGARELKQTVSDIKHEVHDQLEHTRQTRRRVQGIVKRIDKMHSEGLNNAINSTTVVAV  361

Query  2084  liatvafaaiftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvv  2254
             LIATVAFAAIF+VPGQY +  K    G +LGEAN+A K  FIVFF+FDS+ALFIS+AVVV
Sbjct  362   LIATVAFAAIFSVPGQYADNPKDVPAGHSLGEANIAPKPEFIVFFIFDSIALFISLAVVV  421

Query  2255  vqtsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGV  2434
             VQTSVVVIE+KAKKQM+ +INKLMW AC+ +S++F++L YVVVG R+  LA+  TVVG V
Sbjct  422   VQTSVVVIERKAKKQMMTVINKLMWLACVMVSVSFLALCYVVVGKRDLALAVGVTVVGAV  481

Query  2435  IMLTTIGSMCYCVVRHRLEESRM------RNIRKAETLSRSFSMSMVPSDSELYNESYKR  2596
             IML T+G+MCY V+ HR+E  ++          ++ + S S SMSM+ SDSE+ N  +K+
Sbjct  482   IMLATLGTMCYWVIMHRIEAYKLRSVRRSSMSSRSRSRSMSMSMSMMMSDSEILNSEFKK  541

Query  2597  MYAV  2608
             +YA+
Sbjct  542   VYAL  545



>ref|XP_011007311.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Populus 
euphratica]
 ref|XP_011007313.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Populus 
euphratica]
 ref|XP_011007314.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Populus 
euphratica]
Length=542

 Score =   472 bits (1215),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 285/531 (54%), Positives = 388/531 (73%), Gaps = 7/531 (1%)
 Frame = +2

Query  1037  ERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTL--SKQNQEGETALYV  1210
             ++K  K   GKR D PLH   R GNL  V E++     +A + TL  SKQNQ GETALYV
Sbjct  12    QKKMTKQLTGKRDDTPLHAVVRDGNLELVMEMIADNLGEAAELTLLLSKQNQSGETALYV  71

Query  1211  AAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTD  1390
             A++ GH  +V E++K  D   A + + NGYDAFHIAAKQG LE+++ L+ V P+L +T D
Sbjct  72    ASDCGHVYIVKELIKYYDTGLAGLKARNGYDAFHIAAKQGDLEIVEVLMEVNPDLSLTFD  131

Query  1391  SSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKD  1570
             SSN+TALH+AA QGHV+VV+ LLE  S LA IA++NGKT LH+ AR GHLE++K+L++K+
Sbjct  132   SSNTTALHSAASQGHVEVVNFLLEKCSGLALIAKSNGKTALHSVARNGHLEILKALLSKE  191

Query  1571  PSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQM  1750
             P +  + DKKGQTALHMAVKGQNV++V ELI  DPS++ + D+KGN+ALHIA+RKGR Q+
Sbjct  192   PGLANKIDKKGQTALHMAVKGQNVELVEELIMSDPSLMNMVDHKGNSALHIASRKGRDQV  251

Query  1751  VQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDH--GKPPSAAKQ  1924
             V++L+  +GI+   VN++ ETA D AEK G   + ++L+E G   +K    G   +A ++
Sbjct  252   VRKLLDQKGIDKTIVNRSRETAFDTAEKTGHSGIASVLQEHGVLSAKSMKPGTTSTANRE  311

Query  1925  LKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvaf  2104
             LKQTVSDIKH+V +QL+ +R T  +V+ IAK++ K+H  GLNNAINS TVVAVLIATVAF
Sbjct  312   LKQTVSDIKHEVHNQLETTRLTRKRVQGIAKRLNKVHTEGLNNAINSTTVVAVLIATVAF  371

Query  2105  aaiftvPGQYVEKE---KKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvv  2275
             AAIF +PGQ+ +       G + GEA +A K  F++F +FDS+ALFIS+AVVVVQTS+VV
Sbjct  372   AAIFQLPGQFADDPGNLAPGQSAGEAKIATKPEFMIFIIFDSIALFISLAVVVVQTSIVV  431

Query  2276  IEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIG  2455
             IE+KAKKQ++ +INKLMW AC+ IS+AF++L+YVVVG  ++WLA+  T VG VIM+TTIG
Sbjct  432   IERKAKKQLMSVINKLMWLACVLISVAFLALSYVVVGDNQRWLALIVTAVGTVIMVTTIG  491

Query  2456  SMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             +M Y V+  R+E SR+R+IR++ T            +SE+    YK++YA+
Sbjct  492   TMSYWVIAQRIETSRLRSIRRSSTSRSRSETLSFMEESEILENDYKKLYAI  542



>ref|XP_003625551.1| Ankyrin repeat-containing protein [Medicago truncatula]
 gb|AES81769.1| ankyrin repeat plant protein [Medicago truncatula]
Length=520

 Score =   471 bits (1213),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 277/524 (53%), Positives = 379/524 (72%), Gaps = 11/524 (2%)
 Frame = +2

Query  1052  KDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHT  1231
             K   G RGD+ LH A R GNL  V EI+     + +K+  SKQN   ETALY+AAENGH 
Sbjct  3     KQLTGLRGDSHLHSAIRVGNLELVLEIISENQGEELKELFSKQNNSSETALYIAAENGHL  62

Query  1232  LVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTAL  1411
              +V E++K  D+  AS+ + NG+DAFH+AAK G+LE+LK L   FP + MT D +N+TAL
Sbjct  63    DIVKELIKYHDIGLASLKARNGFDAFHVAAKNGNLEILKVLTEAFPEISMTVDLTNTTAL  122

Query  1412  HTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRT  1591
             HTA  QGH+++V+ LLE  S++  IA++NGKT  H+AAR GH+EV+K+L+  +P I  R 
Sbjct  123   HTAVSQGHIEIVNFLLEKSSSVVTIAKSNGKTAFHSAARNGHVEVIKALLGSEPEIAMRV  182

Query  1592  DKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISI  1771
             DKKGQTALHMAVKGQN+++V EL+K +PS   + D KGNTALHI TRKGR Q+VQ+L+  
Sbjct  183   DKKGQTALHMAVKGQNLEVVDELLKLNPSFANMVDAKGNTALHITTRKGRLQIVQKLLEC  242

Query  1772  EGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPP-SAAKQLKQTVSDI  1948
             + I+ + ++K+GETALDIAE+ G  D+   L++ GA +++    P  + A +LKQTVSDI
Sbjct  243   KEIDTDVIDKSGETALDIAERTGRLDIAKFLQDRGAQNARSVKSPSKNRALELKQTVSDI  302

Query  1949  KHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPG  2128
             K  V +QL+ + +T  +++ IAK++ K+   GLNNAINS TVVAVLIATVAFAAIFTVPG
Sbjct  303   KSGVHNQLEHTFKTQRRMKGIAKRINKMQAEGLNNAINSNTVVAVLIATVAFAAIFTVPG  362

Query  2129  QYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQ  2299
             QY +  K    G + GEAN+A    F++F +FDS ALFIS+AVV+VQTSVVVIE++AKKQ
Sbjct  363   QYPQNTKNLAPGMSPGEANIAPNIEFLIFVIFDSTALFISLAVVIVQTSVVVIEREAKKQ  422

Query  2300  MVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVR  2479
             M  +INKLMW AC+ IS+AF++++Y+VVG +++ LAI +T +G VIM  T+G++CY V+ 
Sbjct  423   MTAVINKLMWIACVLISVAFLAMSYIVVGDQKE-LAIAATALGTVIMAATLGTLCYWVIA  481

Query  2480  HRLEESRMRNIRKAETLSRSFSMS-MVPSDSELYNESYKRMYAV  2608
             HRLE SR+R+ R   +   S +MS M  S++E     YK +YA+
Sbjct  482   HRLEASRLRSQRTMTSSRHSLTMSGMSASENE-----YKTVYAI  520



>ref|XP_009782332.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Nicotiana 
sylvestris]
Length=537

 Score =   472 bits (1214),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 278/529 (53%), Positives = 382/529 (72%), Gaps = 10/529 (2%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D+ LH AARAGN+  +RE ++    + + + L KQN  GET LYVAAE
Sbjct  13    KKMTKQLTGKRDDSALHSAARAGNIVAIRETIKNTGEEELAELLIKQNSAGETPLYVAAE  72

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  VV E++   DL TA I + NG+DA HIAAKQG L+++K LL   P L MT D +N
Sbjct  73    YGYYEVVREMIMYYDLVTAGIKARNGFDALHIAAKQGDLDMVKVLLEAHPELAMTVDVAN  132

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH++VV+  L   S+LA IA++NGKT LH++AR GHL+V+K+L++K+P I
Sbjct  133   TTALHTAANQGHIEVVNYFLAEQSSLATIAKSNGKTALHSSARNGHLQVLKALLSKEPGI  192

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               R D KGQTALHMAVKGQN+++V ELIK DPS++ + DNKGNT LHIA RKGR ++V+ 
Sbjct  193   ATRMDNKGQTALHMAVKGQNLEVVEELIKTDPSLINMVDNKGNTPLHIAARKGRSEIVKL  252

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPP--SAAKQLKQ  1933
             L+     +   +N++ ETALD AEK    + V +L+E G   ++   KP   + A++LKQ
Sbjct  253   LLGQNETDKKVINRSHETALDTAEKMSQAETVAILQEHGVESARVL-KPQKINPARELKQ  311

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH+V  QL+ +RQT  +++ IAK++ K+H  GLNNAINS TVVAVLIATVAFA I
Sbjct  312   TVSDIKHEVHDQLKHTRQTRKRIQGIAKRLHKMHREGLNNAINSTTVVAVLIATVAFAGI  371

Query  2114  ftvPGQYV---EKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             F VPGQY    +    G  +GEAN++N   F+VFF+FDS+ALFIS++VVVVQT+VVVIE 
Sbjct  372   FQVPGQYYMDPDNLPPGHIIGEANISNHPGFLVFFIFDSIALFISLSVVVVQTTVVVIES  431

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             KAKK+++ IINKLMW AC+ +S+A+++L++VVVGTR + +AI  +++G VIM++TIG M 
Sbjct  432   KAKKKLMSIINKLMWVACVLVSVAYLALSFVVVGTRYRLMAIIVSILGAVIMISTIGVML  491

Query  2465  YCVVRHRLEESRMRNIRKAETLSRSFSMS-MVPSDSELYNESYKRMYAV  2608
             + V+ HR+E S  +++RK    S+S  +S  V SD    N+ YK++YA+
Sbjct  492   FWVISHRIESSNKKSMRKNSMASKSLDLSDSVLSDD---NDEYKKIYAI  537



>ref|XP_002322833.2| hypothetical protein POPTR_0016s08150g [Populus trichocarpa]
 gb|EEF04594.2| hypothetical protein POPTR_0016s08150g [Populus trichocarpa]
Length=542

 Score =   472 bits (1214),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 286/532 (54%), Positives = 388/532 (73%), Gaps = 9/532 (2%)
 Frame = +2

Query  1037  ERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTL--SKQNQEGETALYV  1210
             ++K  K   GKR D PLH   R GNL  V E++     +A + TL  SKQNQ GET LYV
Sbjct  12    QKKMTKQLTGKRDDTPLHAVVRDGNLELVMEMIADNLGEAAELTLLLSKQNQSGETPLYV  71

Query  1211  AAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTD  1390
             A+E GH  +V E++K  D   A + + NGYDAFHIAAKQG LE+++ L+ V P+L +T D
Sbjct  72    ASECGHVYIVKELIKYYDTGLAGLKARNGYDAFHIAAKQGDLEIVEVLMEVNPDLSLTFD  131

Query  1391  SSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKD  1570
             SSN+TALH+AA QGHV+VV+ LLE  S LA IA++NGKT LH+ AR GHLE++K+L++K+
Sbjct  132   SSNTTALHSAASQGHVEVVNFLLEKCSGLALIAKSNGKTALHSVARNGHLEILKALLSKE  191

Query  1571  PSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQM  1750
             P +  + DKKGQTALHMAVKGQNV++V ELI  DPS++ + DNKGN+ALHIA+RKGR Q+
Sbjct  192   PGLANKIDKKGQTALHMAVKGQNVELVEELIMSDPSLMNMVDNKGNSALHIASRKGRDQI  251

Query  1751  VQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPP---SAAK  1921
             V++L+  +GI+   VN++ ETA D AEK G   + ++L+E G   +K   KP    +A +
Sbjct  252   VRKLLDQKGIDKTIVNRSRETAFDTAEKTGHSGIASVLQEHGVLSAKSM-KPSTTNTANR  310

Query  1922  QLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatva  2101
             +LKQTVSDIKH+V +QL+ +R T  +V+ IAK++ K+H  GLNNAINS TVVAVLIATVA
Sbjct  311   ELKQTVSDIKHEVHNQLETTRLTRKRVQGIAKRLNKVHTEGLNNAINSTTVVAVLIATVA  370

Query  2102  faaiftvPGQYVEKE---KKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvv  2272
             FAAIF +PGQ+ +       G + GEA +A K  F++F +FDS+ALFIS+AVVVVQTS+V
Sbjct  371   FAAIFQLPGQFADDPGNLAPGQSAGEAKIATKPEFMIFIIFDSIALFISLAVVVVQTSIV  430

Query  2273  vIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTI  2452
             VIE+KAKKQ++ +INKLMW AC+ IS+AF++L+YVVVG  ++WLA+  T +G VIM+TTI
Sbjct  431   VIERKAKKQLMSVINKLMWLACVLISVAFLALSYVVVGDHQRWLALSVTAIGTVIMVTTI  490

Query  2453  GSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             G+M Y V+  R+E SR+R+IR++ T            +SE+    YK++YA+
Sbjct  491   GTMSYWVIAQRIETSRLRSIRRSSTSRSRSETLSFMEESEILENDYKKLYAI  542



>ref|XP_009781799.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Nicotiana 
sylvestris]
Length=540

 Score =   471 bits (1212),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 284/529 (54%), Positives = 382/529 (72%), Gaps = 7/529 (1%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D+ +H AARAGN+  +REIL++ + + + + + KQN  GETALYVAAE
Sbjct  13    KKMTKQLTGKRDDSSMHAAARAGNIVAIREILEKTEEEELAELIIKQNSAGETALYVAAE  72

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  +V E++   DL  A I + NGYDA HIAAKQG L+V+K L+   P L MT D SN
Sbjct  73    YGYYQLVREMIYYYDLVAAGIKARNGYDALHIAAKQGDLDVVKVLMEAHPELSMTVDVSN  132

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH++VV+ LLE +S+LA IA++NGKT LH+AAR GH++V+K+L++K+P I
Sbjct  133   TTALHTAANQGHIEVVNYLLEEESSLATIAKSNGKTALHSAARNGHVQVLKALLSKEPGI  192

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               R DKKGQTALHMAVKGQN+++V ELI+ DPS++ + DNKGNTALHIA RKGR Q+V+ 
Sbjct  193   ATRMDKKGQTALHMAVKGQNLEVVEELIRADPSLINMVDNKGNTALHIAARKGRDQIVKL  252

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSA--AKQLKQ  1933
             L+     +   VN+  ETALD AEK G  ++ T+L+E G   S    KP +   A++LKQ
Sbjct  253   LLVQNETDTTVVNRTNETALDTAEKLGQAELGTILQEHG-VQSARSIKPQATNPARELKQ  311

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH V  QL+ +R T  +++ IAK+V K+H  GLNNAINS TVVAVLIATVAF AI
Sbjct  312   TVSDIKHGVHYQLETTRLTRRRIQDIAKRVYKMHAEGLNNAINSTTVVAVLIATVAFGAI  371

Query  2114  ftvPGQYV---EKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             F + GQ+V   +      +LGEAN+    AF+VFF+FDS++LFI++AVVVVQT++VVIE 
Sbjct  372   FQINGQWVDDPDDIPPDHSLGEANIGPNPAFLVFFVFDSISLFIALAVVVVQTTIVVIES  431

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             +AKK+M+ IINKLMW ACLF+S+A++SL+YVVVG    W+ I  +++G  IM TTIG+MC
Sbjct  432   RAKKKMMSIINKLMWVACLFVSVAYLSLSYVVVGDDNLWMPILVSIIGASIMATTIGTMC  491

Query  2465  YCVVRHRLEESRMRNIRK-AETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             Y VV +R+  S  R+IR+ +         + V SDS+  N  YK++YA+
Sbjct  492   YWVVMNRIRSSNKRSIRRNSLASRSRSWSASVLSDSDALNNEYKKIYAI  540



>ref|XP_009596873.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Nicotiana 
tomentosiformis]
 ref|XP_009596874.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Nicotiana 
tomentosiformis]
 ref|XP_009596876.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Nicotiana 
tomentosiformis]
Length=540

 Score =   471 bits (1212),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 283/534 (53%), Positives = 380/534 (71%), Gaps = 7/534 (1%)
 Frame = +2

Query  1025  SFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETAL  1204
             S    +K  K   GKR D+ +H AARAGN+  +REIL++ + + + + + KQN  GETAL
Sbjct  8     SVAPRKKMTKQLTGKRDDSSMHAAARAGNIVAIREILEKTEEEELAELIIKQNSAGETAL  67

Query  1205  YVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMT  1384
             YVAAE G+   V E++   DL  A I + NGYDA HIAAKQG L+V+K L+   P L MT
Sbjct  68    YVAAEYGYYQSVREMIHYYDLVAAGIKARNGYDALHIAAKQGDLDVVKVLMEAHPELSMT  127

Query  1385  TDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVN  1564
              D SN+TALHT A QGH++VV+ LLE +S+LA IA++NGKT LH+AAR GH++V+K+L++
Sbjct  128   VDVSNTTALHTTANQGHIEVVNYLLEAESSLATIAKSNGKTALHSAARNGHVQVLKALLS  187

Query  1565  KDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRP  1744
             K+P I  R DKKGQTALHMAVKGQN+++V ELI+ DPS++ + DNKGNTALHIA RKGR 
Sbjct  188   KEPGIATRMDKKGQTALHMAVKGQNLEVVEELIRADPSLINMVDNKGNTALHIAARKGRD  247

Query  1745  QMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSA--A  1918
             Q+V+ L+     +   VN+  ET LD AEK G  ++VT+ +E G   S    KP +   A
Sbjct  248   QIVKLLLVQNETDTRVVNRTNETVLDTAEKLGQAEIVTIFQEHG-VQSARSIKPQATNPA  306

Query  1919  KQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatv  2098
             ++LKQTVSDIKH V  QL+ +R T  +++ IAK+V K+H  GLNNAINS TVVAVLIATV
Sbjct  307   RELKQTVSDIKHGVHYQLETTRLTRRRIQDIAKRVYKMHAEGLNNAINSTTVVAVLIATV  366

Query  2099  afaaiftvPGQYV---EKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsv  2269
             AF AIF + GQ+V   +      +LGEAN+    AF+VFF+FDS++LFI++AVVVVQT++
Sbjct  367   AFGAIFQINGQWVDDPDDIPPDHSLGEANIGPNPAFLVFFVFDSISLFIALAVVVVQTTI  426

Query  2270  vvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTT  2449
             VVIE +AKK+M+ IINKLMW ACLF+S+A++SL+YVVVG    W+ I  +++G  IM TT
Sbjct  427   VVIESRAKKKMMSIINKLMWVACLFVSVAYLSLSYVVVGDDNLWMPILVSIIGASIMATT  486

Query  2450  IGSMCYCVVRHRLEESRMRNIRK-AETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             IG+MCY VV +R+  S  R+IR+ +         + V SDS+  N  YK++YA+
Sbjct  487   IGTMCYWVVMNRIRSSNKRSIRRNSLASRSRSWSASVLSDSDALNNEYKKIYAI  540



>ref|XP_003554338.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Glycine 
max]
 gb|KHN02399.1| Ankyrin repeat-containing protein [Glycine soja]
Length=521

 Score =   470 bits (1209),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 274/492 (56%), Positives = 366/492 (74%), Gaps = 5/492 (1%)
 Frame = +2

Query  1052  KDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHT  1231
             K   G RGD+PL  A R GNL  V EI+ +     +K+ LSKQN   ETALYVAAENGH 
Sbjct  4     KQLTGIRGDSPLQSAIRVGNLELVLEIISQSPEDELKELLSKQNNSFETALYVAAENGHL  63

Query  1232  LVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTAL  1411
              ++ E+++  D+  AS  + NG+D FHIAAK GHLE++K L+  FP + MT D SN+T L
Sbjct  64    DILKELIRYHDIGLASFKARNGFDPFHIAAKNGHLEIVKVLMEAFPEISMTVDLSNTTGL  123

Query  1412  HTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRT  1591
             HTAA QGH++VV+ LLE  S+L  IA++NGKTVLH+AAR G++EVVK+L++K+P I  R 
Sbjct  124   HTAAAQGHIEVVNFLLEKGSSLITIAKSNGKTVLHSAARNGYVEVVKALLSKEPEIAMRI  183

Query  1592  DKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISI  1771
             DKKGQTALHMAVKGQN+++V EL+K +PS+  + D KGNTALHIATRKGR Q+VQ+L+  
Sbjct  184   DKKGQTALHMAVKGQNLELVDELVKLNPSLANMVDAKGNTALHIATRKGRLQVVQKLLDC  243

Query  1772  EGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPS-AAKQLKQTVSDI  1948
               I+ + +NK+GETALD AEK G  ++   L+  GA  +K    P +  A +LK+TVSDI
Sbjct  244   REIDTDVINKSGETALDTAEKNGRLEIANFLQHRGAQSAKSIKSPTTNTALELKRTVSDI  303

Query  1949  KHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPG  2128
             K  V +QL+ + +T  +++ IAK++ K+H  GLNNAINS TVVAVLIATVAFAAIF VPG
Sbjct  304   KSGVHNQLEHTIKTQRRMQGIAKRINKMHTEGLNNAINSNTVVAVLIATVAFAAIFNVPG  363

Query  2129  QYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQ  2299
             QY EK+ +   G + GEA +A    F +F +FDS ALFIS+AVV+VQTSVVVIE+KAK+Q
Sbjct  364   QYPEKQNELSPGMSPGEAYIAPDIGFKIFIIFDSTALFISLAVVIVQTSVVVIERKAKRQ  423

Query  2300  MVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVR  2479
             M+ +INKLMW AC+ IS+AFI+++Y++VG  ++ LAI +TV+G VIM  T+G++CY V+ 
Sbjct  424   MMAVINKLMWVACVLISVAFIAMSYIIVGDHKE-LAIAATVLGTVIMAATLGTLCYWVIT  482

Query  2480  HRLEESRMRNIR  2515
             H LE SR+R++R
Sbjct  483   HHLEASRLRSLR  494



>gb|AFK36069.1| unknown [Medicago truncatula]
Length=520

 Score =   469 bits (1208),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 277/524 (53%), Positives = 378/524 (72%), Gaps = 11/524 (2%)
 Frame = +2

Query  1052  KDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAENGHT  1231
             K   G RGD+ LH A R GNL  V EI+     + +K+  SKQN   ETALY+AAENGH 
Sbjct  3     KQLTGLRGDSHLHSAIRVGNLELVLEIISENQGEELKELFSKQNNSSETALYIAAENGHL  62

Query  1232  LVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSNSTAL  1411
              +V E++K  D+  AS+ + NG+DAFH+AAK G+LE+LK L   FP + MT D +N+TAL
Sbjct  63    DIVKELIKYHDIGLASLKARNGFDAFHVAAKNGNLEILKVLTEAFPEISMTVDLTNTTAL  122

Query  1412  HTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSIGFRT  1591
             HTA  QGH+++V+ LLE  S++  IA++NGKT  H+AAR GH+EV+K+L+  +P I  R 
Sbjct  123   HTAVSQGHIEIVNFLLEKSSSVVTIAKSNGKTAFHSAARNGHVEVIKALLGSEPEIAMRV  182

Query  1592  DKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQRLISI  1771
             DKKGQTALHMAVKGQN+++V EL+K +PS   + D KGNTALHI TRKGR Q+VQ+L+  
Sbjct  183   DKKGQTALHMAVKGQNLEVVDELLKLNPSFANMVDAKGNTALHITTRKGRLQIVQKLLEC  242

Query  1772  EGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPP-SAAKQLKQTVSDI  1948
             + I+ + ++K+GETALDIAE+ G  D+   L++ GA +++    P  + A +LKQTVSDI
Sbjct  243   KEIDTDVIDKSGETALDIAERTGRLDIAKFLQDRGAQNARSVKSPSKNRALELKQTVSDI  302

Query  1949  KHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaaiftvPG  2128
             K  V +QL+ + +T  +++ IAK++ K+   GLNNAINS TVVAVLIATVAFAAIFTVPG
Sbjct  303   KSGVHNQLEHTFKTQRRMKGIAKRINKMQAEGLNNAINSNTVVAVLIATVAFAAIFTVPG  362

Query  2129  QYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQKAKKQ  2299
             QY +  K    G + GEAN+A    F +F +FDS ALFIS+AVV+VQTSVVVIE++AKKQ
Sbjct  363   QYPQNTKNLAPGMSPGEANIAPNIEFPIFVIFDSTALFISLAVVIVQTSVVVIEREAKKQ  422

Query  2300  MVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMCYCVVR  2479
             M  +INKLMW AC+ IS+AF++++Y+VVG +++ LAI +T +G VIM  T+G++CY V+ 
Sbjct  423   MTAVINKLMWIACVLISVAFLAMSYIVVGNQKE-LAIAATALGTVIMAATLGTLCYWVIA  481

Query  2480  HRLEESRMRNIRKAETLSRSFSMS-MVPSDSELYNESYKRMYAV  2608
             HRLE SR+R+ R   +   S +MS M  S++E     YK +YA+
Sbjct  482   HRLEASRLRSQRTMTSSRHSLTMSGMSASENE-----YKTVYAI  520



>ref|XP_006363351.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Solanum 
tuberosum]
Length=536

 Score =   469 bits (1208),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 279/529 (53%), Positives = 382/529 (72%), Gaps = 11/529 (2%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAAE  1219
             +K  K   GKR D+ LH AARAGNL  ++  ++  D + + + L KQN  GET LYVAAE
Sbjct  13    KKMTKQLTGKRDDSALHSAARAGNLVAIKNTIEDTDEEELAELLIKQNSAGETPLYVAAE  72

Query  1220  NGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSSN  1399
              G+  VV E++   DL  A I + NG+DA HIAAKQG L+V+K L+   P L MT D  N
Sbjct  73    YGYYEVVREMIMYYDLVAAGIKARNGFDALHIAAKQGDLDVVKVLMEAHPELAMTVDVVN  132

Query  1400  STALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPSI  1579
             +TALHTAA QGH+++V+ LLE  S+LA IA++NGKT LH++AR GHL+V+K+L++K+P I
Sbjct  133   TTALHTAANQGHIEMVNYLLEEQSSLATIAKSNGKTALHSSARNGHLQVLKALLSKEPGI  192

Query  1580  GFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQR  1759
               R D KGQTALHMAVKGQN+++V EL   DPS++ + DNKGNT LHIA+RKGR ++V+ 
Sbjct  193   ATRMDNKGQTALHMAVKGQNLEVVEELTNADPSLVNMVDNKGNTPLHIASRKGRAEVVKL  252

Query  1760  LISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKDHGKPPSA--AKQLKQ  1933
             L+S    ++  +N++ ETALD AEK    D V +L+E G   S    KP +   A++LKQ
Sbjct  253   LLSQNETDVKVINRSHETALDTAEKMSQADTVAILQEYG-VQSARVLKPQATNPARELKQ  311

Query  1934  TVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafaai  2113
             TVSDIKH+V  QL+ ++QT  +++ IAK++ K+H  GLNNAINS TVVAVLIATVAFA I
Sbjct  312   TVSDIKHEVHDQLKHTKQTRKRIQGIAKRLHKMHREGLNNAINSTTVVAVLIATVAFAGI  371

Query  2114  ftvPGQYV---EKEKKGFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvIEQ  2284
             F VPGQY    +   +G  +GEAN++N   F+VFF+FDS+ALFIS+AVVVVQT+VVVIE 
Sbjct  372   FQVPGQYYMDPDNLPEGHIIGEANISNHPGFLVFFVFDSIALFISLAVVVVQTTVVVIES  431

Query  2285  KAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGSMC  2464
             KAKK+++ IINKLMW AC+F+S+A+++L++VVVGTR   +A+  TV+G  IM +TIG M 
Sbjct  432   KAKKKLMSIINKLMWIACVFVSVAYLALSFVVVGTRYWVMAVIVTVLGATIMASTIGVML  491

Query  2465  YCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYK-RMYAV  2608
             Y V++HR+E S  +++RK    S+    SM  SDS L +++ + ++YA+
Sbjct  492   YWVIKHRIESSNKKSMRKNSMASK----SMDYSDSALSDDNNEFKIYAL  536



>ref|XP_011031101.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Populus 
euphratica]
 ref|XP_011031102.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Populus 
euphratica]
 ref|XP_011031103.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Populus 
euphratica]
 ref|XP_011031104.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Populus 
euphratica]
 ref|XP_011031105.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Populus 
euphratica]
Length=541

 Score =   469 bits (1207),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 302/531 (57%), Positives = 391/531 (74%), Gaps = 9/531 (2%)
 Frame = +2

Query  1037  ERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGETALYVAA  1216
             ++K  K    K+ D PL  AARAGNL  V EIL     + +K+ L KQNQ GETALYVA 
Sbjct  13    QKKMAKQLIRKKDDTPLLFAARAGNLGAVMEILTGTGEEELKELLEKQNQSGETALYVAV  72

Query  1217  ENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLVMTTDSS  1396
             E G+  VV E++K  DL  A I + NG+DAFH+AAK+G LE+L+ L+ V P L MT D +
Sbjct  73    EYGNVDVVREMIKYYDLAGAGIKARNGFDAFHVAAKRGDLEILRVLMEVHPELSMTVDLT  132

Query  1397  NSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSLVNKDPS  1576
             N+TALHTAA +GH+++V+ LL+  S+LA IA++NGKT LH+AAR GHLEVV++L+  +  
Sbjct  133   NTTALHTAATRGHIEIVNFLLDSGSSLATIAKSNGKTALHSAARNGHLEVVRALLTIERG  192

Query  1577  IGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRPQMVQ  1756
             I  R DKKGQTALHMAVKGQNV +V ELI  +PS + + D KGN+ALHIATRKGR Q+V 
Sbjct  193   IATRKDKKGQTALHMAVKGQNVVVVEELIHAEPSSINIVDTKGNSALHIATRKGRAQIVT  252

Query  1757  RLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHSKD---HGKPPSAAKQL  1927
              L+     ++  VN+ GETALD AEK G P++  +L+E G   +K      K P  A+ L
Sbjct  253   LLLQHGETDMMVVNRTGETALDTAEKTGHPEIRVILQEHGCQSAKIIKLQEKNP--ARGL  310

Query  1928  KQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavliatvafa  2107
             KQTVSDIKH+V  QL+ +RQT   V+ IAK V K+H  GLNNAINS TVV VLIATV FA
Sbjct  311   KQTVSDIKHEVHYQLEHTRQTTKHVQGIAKYVNKMHAEGLNNAINSTTVVGVLIATVTFA  370

Query  2108  aiftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqtsvvvI  2278
             AIFTVPGQYV+   +   G +LGEAN+AN+A FI+FF+FDS+ALFIS+AVVVVQTSVVVI
Sbjct  371   AIFTVPGQYVDDPSEIPPGQSLGEANIANRAPFIIFFIFDSIALFISLAVVVVQTSVVVI  430

Query  2279  EQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIMLTTIGS  2458
             E KAKKQ++ IINKLMW AC  +S+AF++L+Y+VVG  E+WLAI  T++G  IM+TT+G+
Sbjct  431   ENKAKKQLMAIINKLMWIACALVSVAFLALSYIVVGEHEKWLAIGVTIIGATIMVTTLGT  490

Query  2459  MCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVP-SDSELYNESYKRMYAV  2608
             MCY VV+HR+E S MR+IR++   SRS S S+   SD+E++++  K+MYA+
Sbjct  491   MCYWVVKHRIESSNMRSIRRSSLGSRSRSFSVSVMSDAEIFDKECKKMYAI  541



>ref|XP_002306279.1| ankyrin repeat family protein [Populus trichocarpa]
 gb|EEE93275.1| ankyrin repeat family protein [Populus trichocarpa]
Length=541

 Score =   468 bits (1205),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 303/537 (56%), Positives = 391/537 (73%), Gaps = 9/537 (2%)
 Frame = +2

Query  1019  QLSFGGERKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRFDSKAIKDTLSKQNQEGET  1198
             Q S   ++K  +    K+ D PL  AARAGNL  V EIL     + +K+ L KQNQ GET
Sbjct  7     QPSSMSQKKMTRQLIRKKDDTPLLFAARAGNLGAVMEILTGTGEEELKELLEKQNQSGET  66

Query  1199  ALYVAAENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNVFPNLV  1378
             ALYVA E G+  VV E++K  DL  A I + NG+DAFH+AAK+G LE+L+ L+ V P L 
Sbjct  67    ALYVAVEYGNVDVVREMIKYYDLAGAGIKARNGFDAFHVAAKRGDLEILRVLMEVHPELS  126

Query  1379  MTTDSSNSTALHTAAGQGHVDVVDLLLEIDSNLAKIARNNGKTVLHTAARMGHLEVVKSL  1558
             MT D +N+TALHTAA QGH+++V+ LL+  S+LA IA++NGKT LH+AAR GHLEVV++L
Sbjct  127   MTVDLTNTTALHTAATQGHIEIVNFLLDSGSSLATIAKSNGKTALHSAARNGHLEVVRAL  186

Query  1559  VNKDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKG  1738
             +  +  I  R DKKGQTALHMAVKGQNV +V ELI  +PS + + D KGN+ALHIATRKG
Sbjct  187   LTIERGIATRKDKKGQTALHMAVKGQNVVVVEELIHAEPSSINIVDTKGNSALHIATRKG  246

Query  1739  RPQMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAGATHS---KDHGKPP  1909
             R Q+V  L+     ++  VN+ GETALD AEK G P++  +L+E G   +   K   K P
Sbjct  247   RAQIVTLLLQHGETDMMAVNRTGETALDTAEKTGHPEIRVILREHGCQSAKIIKPQEKNP  306

Query  1910  SAAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavli  2089
               A++LKQTVSDIKH+V  QL+ +RQT   V+ IAK V K+H  GLNNAINS TVV VLI
Sbjct  307   --ARELKQTVSDIKHEVHYQLEHTRQTTKHVQGIAKYVNKMHAEGLNNAINSTTVVGVLI  364

Query  2090  atvafaaiftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvq  2260
             ATV FAAIFTVPGQYV+   +   G +LGEAN+A +A FI+FF+FDS+ALFIS+AVVVVQ
Sbjct  365   ATVTFAAIFTVPGQYVDDPSEIPPGQSLGEANIATRAPFIIFFIFDSIALFISLAVVVVQ  424

Query  2261  tsvvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIM  2440
             TSVVVIE KAKKQ++ IINKLMW AC  +S+AF++L+Y+VVG  E+WLAI  T++G  IM
Sbjct  425   TSVVVIENKAKKQLMAIINKLMWIACALVSVAFLALSYIVVGEHEKWLAIGVTIIGATIM  484

Query  2441  LTTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVP-SDSELYNESYKRMYAV  2608
             +TT+G+MCY VV+HR+E S MR+IR++   SRS S S+   SDSE+++    +MYA+
Sbjct  485   VTTLGTMCYWVVKHRIESSNMRSIRRSSLGSRSRSFSVSVMSDSEIFDNERNKMYAI  541



>ref|XP_010541367.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Tarenaya 
hassleriana]
Length=575

 Score =   467 bits (1202),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 293/535 (55%), Positives = 381/535 (71%), Gaps = 16/535 (3%)
 Frame = +2

Query  1040  RKRGKDSPGKRGDNPLHLAARAGNLSKVREILQRF--DSKAIKDTLSKQNQEGETALYVA  1213
             +K  K   GKR D+PLH A R G+L+ V+EIL     D   +++ L KQNQ GETALY A
Sbjct  45    KKMAKQLTGKREDSPLHSAVRRGDLTAVKEILSETGEDEDRLRELLQKQNQSGETALYAA  104

Query  1214  AENGHTLVVGEILKQLDLETASIASNNGYDAFHIAAKQGHLEVLKELLNV--FPNLVMTT  1387
             AE G + VVGE++K  DL  A   + NG+D FHIAAKQG L  L    +      L MT 
Sbjct  105   AEYGDSDVVGELIKHYDLADAETKARNGFDPFHIAAKQGELGKLSSSTDPTRLCELAMTV  164

Query  1388  DSSNSTALHTAAGQGHVDVVDLLLEI-DSNLAKIARNNGKTVLHTAARMGHLEVVKSLVN  1564
             D SN+TALHTAA QGHV+VV+ L+E   S+LA IA++NGKT LH+AAR GH  VVK++V 
Sbjct  165   DPSNTTALHTAAAQGHVEVVEYLIEAAGSSLAAIAKSNGKTALHSAARNGHARVVKAVVV  224

Query  1565  KDPSIGFRTDKKGQTALHMAVKGQNVDIVLELIKPDPSVLALGDNKGNTALHIATRKGRP  1744
              +P    RTDKKGQT LHMAVKGQ++D+V+EL+K   S L + D+KGNT LH+A+RKGR 
Sbjct  225   AEPDTATRTDKKGQTPLHMAVKGQSLDVVIELMKGGRSALNMVDSKGNTPLHVASRKGRT  284

Query  1745  QMVQRLISIEGININTVNKAGETALDIAEKFGTPDVVTMLKEAG---ATHSKDHGKPPS-  1912
             Q+V+ L+  +G +   +N+AGETALD AEK G  +V  +L+  G   A   K+H    + 
Sbjct  285   QIVELLLENKGTSTRAINRAGETALDTAEKTGHEEVAVVLRNHGVPSAKSIKNHAPAANE  344

Query  1913  AAKQLKQTVSDIKHDVESQLQQSRQTGFkvrkiakkvkkLHISGLNNAINSltvvavlia  2092
             AA++LKQTVSDIKH+V  QL+ +R+T  +V+ IAK++ K+H+ GLNNAINS TVVAVLIA
Sbjct  345   AARELKQTVSDIKHEVHHQLEHARETRKRVQGIAKRINKMHVEGLNNAINSTTVVAVLIA  404

Query  2093  tvafaaiftvPGQYVEKEKK---GFTLGEANVANKAAFIVFFLFDSLALFISIAvvvvqt  2263
             TVAFAAIFTVPGQYV+       G +LGEAN+A + AF +FF+FDS+ALFIS+ VVVVQT
Sbjct  405   TVAFAAIFTVPGQYVDDPSSVLWGQSLGEANIAGRPAFTIFFVFDSIALFISLGVVVVQT  464

Query  2264  svvvIEQKAKKQMVFIINKLMWGACLFISIAFISLTYVVVGTREQWLAIYSTVVGGVIML  2443
             SVV IE  AKK M+ +INKLMW AC+ IS+AF++L +VVVG  E+WLA+  TVVG  IML
Sbjct  465   SVVAIEHNAKKNMMAVINKLMWLACVLISVAFLALAFVVVGEEERWLAVGVTVVGASIML  524

Query  2444  TTIGSMCYCVVRHRLEESRMRNIRKAETLSRSFSMSMVPSDSELYNESYKRMYAV  2608
             TT+G+M Y VVRHR+E S  RN ++ E++SRS  ++ +   S + +   KRMYA+
Sbjct  525   TTLGTMGYWVVRHRIEASNARNEQR-ESMSRSRQLTGLIEFSGILS---KRMYAI  575



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 10220617140760