BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79920_g1_i1 len=685 path=[1:0-684]

Length=685
                                                                      Score     E

ref|XP_004240614.2|  PREDICTED: non-specific lipid-transfer prote...    126   3e-32   
ref|XP_006358720.1|  PREDICTED: non-specific lipid-transfer prote...    120   2e-30   
ref|XP_004242229.1|  PREDICTED: non-specific lipid-transfer prote...    117   1e-29   
emb|CDP12680.1|  unnamed protein product                                116   5e-29   
ref|XP_006353709.1|  PREDICTED: non-specific lipid-transfer prote...    116   2e-28   
ref|XP_009778825.1|  PREDICTED: non-specific lipid-transfer prote...    113   7e-28   
ref|XP_009631015.1|  PREDICTED: non-specific lipid-transfer prote...    110   4e-27   
emb|CDP15101.1|  unnamed protein product                                109   2e-26   
ref|XP_009594799.1|  PREDICTED: non-specific lipid-transfer prote...    109   2e-26   
ref|XP_009781151.1|  PREDICTED: non-specific lipid-transfer prote...    106   4e-25   
gb|AAY84146.1|  lipid transfer protein                                  105   7e-25   Catharanthus roseus [chatas]
ref|XP_009631889.1|  PREDICTED: non-specific lipid-transfer prote...    105   8e-25   
ref|XP_006663743.1|  PREDICTED: non-specific lipid-transfer prote...    105   1e-24   
ref|XP_006662671.1|  PREDICTED: non-specific lipid-transfer prote...    104   1e-24   
gb|AAA74624.1|  lipid transfer protein precursor                        102   1e-23   Oryza sativa Indica Group [Indian rice]
sp|P07597.1|NLTP1_HORVU  RecName: Full=Non-specific lipid-transfe...    101   3e-23   Hordeum vulgare [barley]
ref|XP_009760676.1|  PREDICTED: non-specific lipid-transfer prote...    101   3e-23   
dbj|BAK05317.1|  predicted protein                                      100   3e-23   
ref|XP_009770883.1|  PREDICTED: non-specific lipid-transfer prote...    100   4e-23   
ref|NP_001176316.1|  Os11g0115466                                       100   5e-23   
emb|CAA42832.1|  LTP 1                                                  100   6e-23   Hordeum vulgare [barley]
ref|XP_006367904.1|  PREDICTED: non-specific lipid-transfer prote...    100   7e-23   
sp|Q2QYL2.1|NLT2B_ORYSJ  RecName: Full=Non-specific lipid-transfe...  99.8    1e-22   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001065986.1|  Os12g0115000                                     99.4    1e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAB70539.1|  lipid transfer protein LPT II                         98.6    3e-22   Oryza sativa Indica Group [Indian rice]
gb|AAX84944.1|  non-specific lipid transfer protein-like antimicr...  98.2    4e-22   Leonurus japonicus [Chinese motherwort]
pdb|1MID|A  Chain A, Non-Specific Lipid Transfer Protein 1 From B...  97.4    4e-22   
ref|XP_004151695.1|  PREDICTED: non-specific lipid-transfer prote...  98.2    5e-22   
pdb|1BE2|A  Chain A, Lipid Transfer Protein Complexed With Palmit...  97.1    5e-22   
gb|AGV40204.1|  nonspecific lipid-transfer protein 3                  98.2    6e-22   
emb|CAA69949.1|  lipid transfer protein                               97.1    1e-21   Oryza sativa Indica Group [Indian rice]
gb|AGH32496.1|  non-specific lipid transfer protein                   96.7    1e-21   
ref|XP_009593826.1|  PREDICTED: non-specific lipid-transfer prote...  97.1    1e-21   
pir||EPRZ  phospholipid transfer protein homolog - rice               95.5    2e-21
sp|A0AT31.1|NLTP5_LENCU  RecName: Full=Non-specific lipid-transfe...  95.9    3e-21   Lens culinaris
ref|NP_001065987.1|  Os12g0115100                                     95.9    3e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010683515.1|  PREDICTED: non-specific lipid-transfer prote...  95.5    3e-21   
sp|A0AT30.1|NLTP3_LENCU  RecName: Full=Non-specific lipid-transfe...  95.5    4e-21   Lens culinaris
ref|XP_011095133.1|  PREDICTED: non-specific lipid-transfer prote...  95.1    6e-21   
gb|AGV40203.1|  nonspecific lipid-transfer protein 2                  94.7    7e-21   
emb|CAA80809.1|  lipid transfer protein                               94.7    8e-21   Oryza sativa Indica Group [Indian rice]
gb|ABA91221.2|  Nonspecific lipid-transfer protein 1 precursor, p...  94.7    8e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004245223.1|  PREDICTED: non-specific lipid-transfer prote...  94.7    9e-21   
ref|NP_001065583.1|  Os11g0115400                                     94.4    1e-20   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001067782.1|  Os11g0427800                                     94.4    1e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008463259.1|  PREDICTED: non-specific lipid-transfer prote...  94.4    1e-20   
gb|AGV40202.1|  nonspecific lipid-transfer protein 1                  94.0    2e-20   
sp|A0AT29.1|NLTP2_LENCU  RecName: Full=Non-specific lipid-transfe...  93.6    2e-20   Lens culinaris
dbj|BAO51648.1|  lipid transfer protein                               93.6    2e-20   
ref|XP_011091590.1|  PREDICTED: non-specific lipid-transfer prote...  93.6    2e-20   
gb|AAP92127.1|  lipid transfer protein LPT1                           93.6    2e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002442775.1|  hypothetical protein SORBIDRAFT_08g002680        93.2    3e-20   Sorghum bicolor [broomcorn]
gb|EYU41040.1|  hypothetical protein MIMGU_mgv1a016547mg              93.2    3e-20   
sp|Q43194.1|NLTP2_SORBI  RecName: Full=Non-specific lipid-transfe...  93.2    3e-20   Sorghum bicolor [broomcorn]
ref|XP_010252074.1|  PREDICTED: non-specific lipid-transfer prote...  92.8    4e-20   
ref|XP_006429571.1|  hypothetical protein CICLE_v10013114mg           92.8    4e-20   
ref|XP_011091591.1|  PREDICTED: non-specific lipid-transfer prote...  92.4    5e-20   
ref|XP_004245407.1|  PREDICTED: non-specific lipid-transfer prote...  92.4    5e-20   
ref|XP_009618455.1|  PREDICTED: non-specific lipid-transfer prote...  92.8    5e-20   
gb|AAB70541.1|  lipid transfer protein LPT IV                         92.4    6e-20   Oryza sativa [red rice]
ref|XP_011091603.1|  PREDICTED: non-specific lipid-transfer prote...  92.4    6e-20   
gb|AGH32497.1|  non-specific lipid transfer protein                   92.4    6e-20   
ref|XP_007134705.1|  hypothetical protein PHAVU_010G069500g           92.4    7e-20   
gb|AAN75627.1|  lipid transfer protein 1 precursor                    92.0    8e-20   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006367725.1|  PREDICTED: non-specific lipid-transfer prote...  92.0    8e-20   
sp|P24296.2|NLTP1_WHEAT  RecName: Full=Non-specific lipid-transfe...  91.7    9e-20   Triticum aestivum [Canadian hard winter wheat]
gb|EYU41041.1|  hypothetical protein MIMGU_mgv1a016543mg              91.7    1e-19   
gb|AAB70538.1|  lipid transfer protein                                91.3    1e-19   Oryza sativa [red rice]
gb|EYU42013.1|  hypothetical protein MIMGU_mgv1a016621mg              91.3    1e-19   
gb|AAL27855.1|  lipid transfer protein precursor                      91.3    1e-19   Davidia involucrata
sp|A0AT33.1|NLTP4_LENCU  RecName: Full=Non-specific lipid-transfe...  90.9    2e-19   Lens culinaris
ref|XP_004249048.1|  PREDICTED: non-specific lipid-transfer prote...  90.9    2e-19   
ref|XP_006662672.1|  PREDICTED: non-specific lipid-transfer prote...  90.9    2e-19   
ref|XP_009757307.1|  PREDICTED: non-specific lipid-transfer prote...  90.9    2e-19   
sp|A0AT32.1|NLTP6_LENCU  RecName: Full=Non-specific lipid-transfe...  90.5    3e-19   Lens culinaris
ref|XP_004245408.1|  PREDICTED: non-specific lipid-transfer prote...  90.1    4e-19   
gb|ACQ42221.1|  lipid transfer protein                                90.1    4e-19   Chimonanthus praecox [wintersweet]
dbj|BAC77694.1|  lipid transfer protein                               89.7    5e-19   Atriplex nummularia
gb|AAK01293.1|AF331710_1  lipid transfer protein                      89.7    6e-19   Avicennia marina
ref|XP_011091596.1|  PREDICTED: non-specific lipid-transfer prote...  89.7    6e-19   
ref|XP_010683516.1|  PREDICTED: non-specific lipid-transfer protein   89.4    6e-19   
ref|XP_009761744.1|  PREDICTED: non-specific lipid-transfer prote...  89.4    8e-19   
ref|XP_004245221.1|  PREDICTED: non-specific lipid-transfer prote...  89.4    8e-19   
gb|ACZ06858.1|  lipid transfer protein                                89.4    8e-19   
ref|XP_009778826.1|  PREDICTED: uncharacterized protein LOC104228120  91.7    9e-19   
ref|XP_004245220.1|  PREDICTED: non-specific lipid-transfer prote...  89.4    9e-19   
sp|Q43748.1|NLTP_BETVU  RecName: Full=Non-specific lipid-transfer...  89.0    1e-18   Beta vulgaris [beet]
ref|NP_001240073.1|  uncharacterized protein LOC100815185 precursor   89.0    1e-18   
pdb|2MAL|A  Chain A, Solution Structure Of Lipid Transfer Protein...  88.2    1e-18   
dbj|BAI94496.1|  lipid transfer protein                               89.0    1e-18   
emb|CAH69197.1|  type 1 non specific lipid transfer protein precu...  89.0    1e-18   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003579022.1|  PREDICTED: non-specific lipid-transfer prote...  88.6    1e-18   
emb|CAH04985.1|  type 1 non-specific lipid transfer protein precu...  88.6    1e-18   Triticum aestivum [Canadian hard winter wheat]
dbj|BAI94498.1|  lipid transfer protein                               88.6    1e-18   
dbj|BAP11219.1|  hypothetical protein                                 88.2    1e-18   
sp|Q3YMR2.1|NLTP2_SOLCI  RecName: Full=Non-specific lipid-transfe...  88.2    2e-18   Solanum chilense
emb|CAH69196.1|  type 1 non specific lipid transfer protein precu...  88.6    2e-18   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011091597.1|  PREDICTED: non-specific lipid-transfer prote...  88.6    2e-18   
dbj|BAP11220.1|  hypothetical protein                                 88.2    2e-18   
gb|ADK36632.1|  lipid transfer-like protein                           87.4    2e-18   
gb|ABY21307.1|  pollen allergen Pla o 3                               88.2    2e-18   Platanus orientalis
gb|ADV02773.1|  lipid transfer protein 1b                             87.4    2e-18   
dbj|BAI94497.1|  lipid transfer protein                               87.8    2e-18   
gb|ABH03042.1|  non-specific lipid transfer protein                   87.8    3e-18   Solanum sogarandinum
emb|CAH69198.1|  type 1 non specific lipid transfer protein precu...  87.8    3e-18   Triticum aestivum [Canadian hard winter wheat]
dbj|BAP11226.1|  hypothetical protein                                 87.4    3e-18   
pdb|1BWO|A  Chain A, The Crystal Structure Of Wheat Non-Specific ...  87.0    3e-18   
gb|AAF23460.1|AF208834_1  non-specific lipid transfer protein pre...  87.4    3e-18   Capsicum annuum
sp|Q43871.1|NLTP8_HORVU  RecName: Full=Non-specific lipid-transfe...  87.4    4e-18   Hordeum vulgare [barley]
ref|XP_010922736.1|  PREDICTED: non-specific lipid-transfer prote...  87.4    4e-18   
dbj|BAP11221.1|  hypothetical protein                                 87.0    4e-18   
gb|ABP01769.1|  lipid transfer protein 2                              87.0    4e-18   Salvia miltiorrhiza [Chinese salvia]
sp|O24038.1|NLTP2_SOLPN  RecName: Full=Non-specific lipid-transfe...  87.0    5e-18   Solanum pennellii
dbj|BAP11218.1|  hypothetical protein                                 87.0    5e-18   
gb|ABA33867.1|  phospholipid transfer protein 1                       87.0    5e-18   Zea diploperennis [chapule]
ref|XP_003564507.1|  PREDICTED: non-specific lipid-transfer prote...  87.4    5e-18   
gb|KEH29195.1|  Lipid transfer protein                                88.6    5e-18   
ref|NP_001234735.1|  non-specific lipid transfer protein precursor    87.0    5e-18   
ref|XP_006355281.1|  PREDICTED: non-specific lipid-transfer prote...  87.0    5e-18   
ref|XP_009757306.1|  PREDICTED: non-specific lipid-transfer prote...  87.0    5e-18   
gb|AAF14232.1|AF109195_1  lipid transfer protein                      87.0    5e-18   Hordeum vulgare [barley]
emb|CAL07989.1|  lipid transfer protein                               87.0    6e-18   Platanus x hispanica [London plane tree]
ref|NP_001241144.1|  uncharacterized protein LOC100817318 precursor   87.0    6e-18   
pdb|1CZ2|A  Chain A, Solution Structure Of Wheat Ns-Ltp Complexed...  85.9    6e-18   
ref|XP_009396871.1|  PREDICTED: non-specific lipid-transfer prote...  86.7    7e-18   
ref|XP_011091601.1|  PREDICTED: non-specific lipid-transfer prote...  86.7    7e-18   
gb|AAX08122.1|  lipid transfer protein III                            86.7    7e-18   Capsicum annuum
ref|XP_011091599.1|  PREDICTED: non-specific lipid-transfer prote...  86.7    7e-18   
gb|ABA33846.1|  phospholipid transfer protein 1                       86.7    7e-18   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_004516173.1|  PREDICTED: non-specific lipid-transfer prote...  86.7    7e-18   
gb|ABA33848.1|  phospholipid transfer protein 1                       86.3    7e-18   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACB05670.1|  putative non-specific lipid transfer protein          86.3    8e-18   Capsicum annuum
emb|CAH04989.1|  type 1 non-specific lipid transfer protein precu...  86.3    9e-18   Triticum aestivum [Canadian hard winter wheat]
gb|AEI70828.1|  non-specific lipid-transfer protein                   86.3    9e-18   
gb|AFX66972.1|  non-specific lipid transfer protein 2                 86.3    9e-18   
dbj|BAJ91878.1|  predicted protein                                    86.3    1e-17   
ref|XP_006355279.1|  PREDICTED: non-specific lipid-transfer prote...  85.9    1e-17   
gb|ABA33853.1|  phospholipid transfer protein 1                       85.5    1e-17   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AFK44274.1|  unknown                                               85.9    2e-17   
gb|ABA33859.1|  phospholipid transfer protein 1                       85.9    2e-17   Zea diploperennis [chapule]
gb|AES87466.2|  Lipid transfer protein                                86.3    2e-17   
gb|ABA33860.1|  phospholipid transfer protein 1                       85.5    2e-17   Zea diploperennis [chapule]
gb|ABA33849.1|  phospholipid transfer protein 1                       85.9    2e-17   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABA33850.1|  phospholipid transfer protein 1                       85.9    2e-17   Zea mays subsp. parviglumis [Balsas teosinte]
sp|O23758.1|NLTP_CICAR  RecName: Full=Non-specific lipid-transfer...  85.5    2e-17   Cicer arietinum [garbanzo]
gb|ABA33858.1|  phospholipid transfer protein 1                       85.5    2e-17   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABA33847.1|  phospholipid transfer protein 1                       85.9    2e-17   Zea mays subsp. parviglumis [Balsas teosinte]
ref|NP_001105311.1|  non-specific lipid-transfer protein precursor    85.9    2e-17   Zea mays [maize]
ref|XP_008798551.1|  PREDICTED: non-specific lipid-transfer prote...  85.5    2e-17   
gb|ABA33866.1|  phospholipid transfer protein 1                       85.5    2e-17   Zea diploperennis [chapule]
ref|XP_006662670.1|  PREDICTED: non-specific lipid-transfer prote...  85.5    2e-17   
ref|XP_003605266.1|  Non-specific lipid-transfer protein              85.5    2e-17   
gb|ABK96813.1|  lipid transfer protein isoform 1.1 precursor          85.5    2e-17   Lactuca sativa [cultivated lettuce]
ref|XP_009631888.1|  PREDICTED: non-specific lipid-transfer prote...  85.5    2e-17   
gb|ABE11609.1|  lipid-transfer protein precursor                      85.5    2e-17   Solanum chacoense
ref|XP_006355280.1|  PREDICTED: non-specific lipid-transfer prote...  85.1    2e-17   
sp|Q39950.1|NLTP_HELAN  RecName: Full=Non-specific lipid-transfer...  85.1    2e-17   Helianthus annuus
ref|XP_004308147.1|  PREDICTED: non-specific lipid-transfer prote...  85.5    2e-17   
gb|AFK38461.1|  unknown                                               85.1    2e-17   
ref|XP_006367395.1|  PREDICTED: non-specific lipid-transfer prote...  85.1    2e-17   
gb|AFM35695.1|  nonspecific lipid transfer protein                    85.1    2e-17   
ref|XP_002305878.2|  lipid transfer family protein                    85.1    2e-17   Populus trichocarpa [western balsam poplar]
ref|XP_006362360.1|  PREDICTED: non-specific lipid-transfer prote...  85.1    2e-17   
emb|CAH69210.1|  type 1 non specific lipid transfer protein precu...  85.1    2e-17   Triticum aestivum [Canadian hard winter wheat]
gb|AFK36168.1|  unknown                                               85.1    3e-17   
ref|XP_004506429.1|  PREDICTED: non-specific lipid-transfer prote...  85.1    3e-17   
ref|NP_001234074.1|  non-specific lipid-transfer protein 1 precursor  84.7    3e-17   
sp|O24037.1|NLTP1_SOLPN  RecName: Full=Non-specific lipid-transfe...  84.7    3e-17   Solanum pennellii
gb|AFK46170.1|  unknown                                               85.1    3e-17   
ref|XP_006367394.1|  PREDICTED: non-specific lipid-transfer prote...  84.7    3e-17   
ref|XP_009626829.1|  PREDICTED: non-specific lipid-transfer prote...  84.7    3e-17   
gb|AAT68264.1|  lipid transfer protein                                84.7    4e-17   Nicotiana glauca [glaucous tobacco]
gb|EPS73761.1|  non-specific lipid-transfer protein                   84.7    4e-17   
ref|XP_010690793.1|  PREDICTED: non-specific lipid-transfer prote...  84.7    4e-17   
ref|XP_009797052.1|  PREDICTED: non-specific lipid-transfer prote...  84.3    4e-17   
ref|XP_009757911.1|  PREDICTED: non-specific lipid-transfer prote...  84.3    5e-17   
ref|XP_011007237.1|  PREDICTED: non-specific lipid-transfer prote...  84.3    5e-17   
ref|XP_006355283.1|  PREDICTED: non-specific lipid-transfer prote...  84.3    5e-17   
gb|AAR83849.1|  nonspecific lipid transfer protein 2 precursor        84.3    5e-17   Capsicum annuum
sp|A0AT28.1|NLTP1_LENCU  RecName: Full=Non-specific lipid-transfe...  84.3    5e-17   Lens culinaris
ref|XP_011095132.1|  PREDICTED: non-specific lipid-transfer prote...  84.3    5e-17   
ref|XP_009141745.1|  PREDICTED: non-specific lipid-transfer prote...  84.3    5e-17   
gb|ACM78614.1|  lipid transfer protein 2                              84.3    6e-17   Tamarix hispida
gb|ABU49732.1|  putative non-specific lipid transfer protein b3       84.0    6e-17   Solanum tuberosum [potatoes]
ref|XP_006367397.1|  PREDICTED: non-specific lipid-transfer prote...  84.0    6e-17   
gb|ACQ42222.1|  lipid transfer protein 1                              84.0    6e-17   Chimonanthus praecox [wintersweet]
ref|NP_001065988.1|  Os12g0115300                                     84.0    6e-17   Oryza sativa Japonica Group [Japonica rice]
gb|ACM78617.1|  non-specific lipid-transfer protein type 1 subfam...  84.0    6e-17   Tamarix hispida
gb|AII99870.1|  protease inhibitor/seed storage/ltp family            84.3    6e-17   
ref|XP_010253094.1|  PREDICTED: non-specific lipid-transfer prote...  84.0    6e-17   
gb|ACJ62320.1|  lipid-transfer protein                                84.0    6e-17   Zea mays subsp. parviglumis [Balsas teosinte]
ref|NP_001275027.1|  non-specific lipid transfer protein a7 precu...  84.0    6e-17   
gb|ABA33862.1|  phospholipid transfer protein 1                       84.0    7e-17   Zea diploperennis [chapule]
ref|XP_009797053.1|  PREDICTED: non-specific lipid-transfer prote...  84.0    7e-17   
ref|NP_001065585.1|  Os11g0116000                                     84.0    7e-17   Oryza sativa Japonica Group [Japonica rice]
gb|EAY79716.1|  hypothetical protein OsI_34868                        84.0    7e-17   Oryza sativa Indica Group [Indian rice]
gb|ACJ62316.1|  lipid-transfer protein                                84.0    7e-17   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_002442774.1|  hypothetical protein SORBIDRAFT_08g002670        84.0    7e-17   Sorghum bicolor [broomcorn]
ref|NP_001233953.1|  non-specific lipid-transfer protein 2 precursor  84.0    7e-17   
ref|XP_009764784.1|  PREDICTED: non-specific lipid-transfer prote...  84.0    7e-17   
gb|AAY83345.1|  non-specific lipid transfer protein precursor         84.0    7e-17   Fragaria x ananassa
gb|AAB70540.1|  lipid transfer protein LPT III                        83.6    7e-17   Oryza sativa Indica Group [Indian rice]
gb|AFI61838.1|  harmalin                                              84.0    7e-17   
gb|AEI70827.1|  non-specific lipid-transfer protein                   84.0    8e-17   
gb|ACJ62381.1|  lipid-transfer protein                                84.0    8e-17   Zea mays subsp. parviglumis [Balsas teosinte]
ref|NP_001105392.1|  phospholipid transfer protein precursor          84.0    8e-17   Zea mays [maize]
sp|Q03461.1|NLTP2_TOBAC  RecName: Full=Non-specific lipid-transfe...  83.6    8e-17   Nicotiana tabacum [American tobacco]
gb|ABU49730.1|  putative non-specific lipid transfer protein b1       83.6    8e-17   Solanum tuberosum [potatoes]
gb|AAY83343.1|  non-specific lipid transfer protein precursor         83.6    8e-17   Fragaria x ananassa
gb|ACG29829.1|  nonspecific lipid-transfer protein 1 precursor        84.0    9e-17   Zea mays [maize]
gb|ACJ62387.1|  lipid-transfer protein                                83.6    9e-17   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AHB19226.1|  non specific lipid transfer protein 1B                83.6    9e-17   
ref|XP_006644921.1|  PREDICTED: non-specific lipid-transfer prote...  83.6    9e-17   
ref|XP_006362359.1|  PREDICTED: non-specific lipid-transfer prote...  83.6    9e-17   
gb|AAT68262.1|  lipid transfer protein                                83.6    9e-17   Nicotiana glauca [glaucous tobacco]
emb|CCD33109.1|  lipid transfer protein                               83.6    1e-16   
gb|AAX20049.1|  putative non-specific lipid transfer protein          83.6    1e-16   Capsicum annuum
ref|XP_002442776.1|  hypothetical protein SORBIDRAFT_08g002690        83.6    1e-16   Sorghum bicolor [broomcorn]
gb|ABY54820.1|  lipid transfer protein                                83.2    1e-16   
gb|ADK60918.1|  lipid transfer protein                                83.2    1e-16   
emb|CBW38498.1|  lipid transfer protein                               82.8    1e-16   
pdb|1T12|A  Chain A, Solution Structure Of A New Ltp1                 82.4    1e-16   
ref|XP_008662435.1|  PREDICTED: non-specific lipid-transfer protein   83.2    1e-16   
dbj|BAK04894.1|  predicted protein                                    83.2    1e-16   
gb|AAC63372.1|  lipid transfer protein                                83.2    1e-16   Brassica oleracea
ref|XP_004302622.1|  PREDICTED: non-specific lipid-transfer prote...  83.2    1e-16   
gb|ABA33857.1|  phospholipid transfer protein 1                       83.2    1e-16   Zea mays subsp. parviglumis [Balsas teosinte]
gb|KFK36745.1|  hypothetical protein AALP_AA4G164400                  82.8    2e-16   
ref|XP_003605269.1|  Non-specific lipid-transfer protein              84.3    2e-16   
ref|XP_004249042.1|  PREDICTED: non-specific lipid-transfer prote...  82.8    2e-16   
gb|ABA34089.1|  phospholipid transfer protein 2                       82.8    2e-16   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACE80968.1|  putative allergen Pru du 3.03                         82.8    2e-16   Prunus dulcis x Prunus persica
ref|XP_010683514.1|  PREDICTED: non-specific lipid-transfer prote...  82.8    2e-16   
pdb|1FK0|A  Chain A, Structural Basis Of Non-Specific Lipid Bindi...  82.0    2e-16   
gb|ABA33854.1|  phospholipid transfer protein 1                       82.8    2e-16   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_003605309.1|  Non-specific lipid-transfer protein              87.8    2e-16   
gb|ABA96286.1|  Nonspecific lipid-transfer protein 3 precursor, p...  82.4    2e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009615065.1|  PREDICTED: non-specific lipid-transfer prote...  82.8    2e-16   
gb|AAA03283.1|  CW18=non-specific lipid transfer protein              81.6    2e-16   
emb|CDM80963.1|  unnamed protein product                              82.4    2e-16   
gb|AAQ74628.1|  lipid tranfer protein II                              82.4    2e-16   Vigna radiata [mung bean]
gb|ABU49731.1|  putative non-specific lipid transfer protein a1       82.4    2e-16   Solanum tuberosum [potatoes]
gb|ABA34092.1|  phospholipid transfer protein 2                       82.4    2e-16   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62326.1|  lipid-transfer protein                                82.4    2e-16   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AAL32039.1|AF439280_1  lipid transfer protein-like protein         82.4    2e-16   Retama raetam [retem]
ref|XP_007033544.1|  Non-specific lipid-transfer protein 3, putative  82.4    2e-16   
ref|XP_008391369.1|  PREDICTED: non-specific lipid-transfer protein   82.4    3e-16   
ref|XP_011095135.1|  PREDICTED: non-specific lipid-transfer prote...  82.4    3e-16   
emb|CDP14199.1|  unnamed protein product                              82.4    3e-16   
ref|XP_011007240.1|  PREDICTED: non-specific lipid-transfer prote...  82.4    3e-16   
gb|ACE80969.1|  putative allergen Pru p 3.03                          82.4    3e-16   Prunus dulcis x Prunus persica
gb|ACG30522.1|  nonspecific lipid-transfer protein 1 precursor        82.4    3e-16   Zea mays [maize]
ref|XP_007140136.1|  hypothetical protein PHAVU_008G087000g           82.0    3e-16   
emb|CCK33472.1|  lipid transfer protein precursor                     81.6    3e-16   
ref|XP_010252072.1|  PREDICTED: non-specific lipid-transfer prote...  82.4    3e-16   
emb|CAG28937.1|  lipid transfer protein                               82.0    3e-16   Oryza sativa Japonica Group [Japonica rice]
gb|ABQ53932.1|  lipid transfer protein                                82.0    3e-16   Sesamum indicum [beniseed]
gb|ABA33855.1|  phospholipid transfer protein 1                       82.4    3e-16   Zea mays subsp. parviglumis [Balsas teosinte]
gb|AEI70829.1|  non-specific lipid-transfer protein                   82.0    3e-16   
emb|CAH69207.1|  type 1 non specific lipid transfer protein precu...  82.0    3e-16   Triticum aestivum [Canadian hard winter wheat]
gb|ABA33856.1|  phospholipid transfer protein 1                       82.0    3e-16   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_006367396.1|  PREDICTED: non-specific lipid-transfer prote...  82.0    3e-16   
ref|NP_001275802.1|  lipid-transfer protein precursor                 82.0    3e-16   
emb|CAQ86909.1|  lipid transfer protein                               82.0    4e-16   Vigna radiata [mung bean]
ref|XP_006362358.1|  PREDICTED: non-specific lipid-transfer prote...  82.0    4e-16   
ref|XP_007206160.1|  hypothetical protein PRUPE_ppa013558mg           81.6    4e-16   
gb|AAF23459.1|AF208833_1  non-specific lipid transfer protein pre...  81.6    4e-16   Capsicum annuum
sp|Q43766.1|NLTP3_HORVU  RecName: Full=Non-specific lipid-transfe...  81.6    4e-16   Hordeum vulgare [barley]
gb|ACL01093.1|  lipid transfer protein                                81.6    4e-16   Castanea mollissima
gb|AGH13363.1|  lipid transfer protein                                81.3    4e-16   
ref|NP_001238176.1|  uncharacterized protein LOC100305883 precursor   81.6    5e-16   
ref|XP_006429570.1|  hypothetical protein CICLE_v10013139mg           81.6    5e-16   
emb|CDY18379.1|  BnaA04g22080D                                        81.6    5e-16   
pir||JH0379  phospholipid transfer protein 6B6 - maize (fragment)     80.9    5e-16
emb|CBW38501.1|  lipid transfer protein                               81.3    5e-16   
emb|CBW38499.1|  lipid transfer protein                               81.3    5e-16   
gb|ABO28527.1|  lipid transfer protein                                81.3    5e-16   Triticum aestivum [Canadian hard winter wheat]
gb|ABF06565.1|  non-specific lipid transfer-like protein              81.3    6e-16   Prosopis juliflora [algorrobo]
gb|AEI70830.1|  non-specific lipid-transfer protein                   81.3    6e-16   
gb|EAY79718.1|  hypothetical protein OsI_34870                        81.3    6e-16   
gb|EYU41036.1|  hypothetical protein MIMGU_mgv1a016508mg              81.3    6e-16   
ref|NP_181387.1|  non-specific lipid-transfer protein 2               81.3    6e-16   
emb|CAH04990.1|  type 1 non-specific lipid transfer protein precu...  80.9    6e-16   
emb|CAH04988.1|  type 1 non-specific lipid transfer protein precu...  81.3    6e-16   
gb|ACJ62323.1|  lipid-transfer protein                                81.3    6e-16   
gb|ACJ62315.1|  lipid-transfer protein                                81.3    6e-16   
emb|CBW38497.1|  lipid transfer protein                               80.9    7e-16   
ref|XP_004302624.1|  PREDICTED: non-specific lipid-transfer prote...  81.3    7e-16   
ref|XP_009608991.1|  PREDICTED: non-specific lipid-transfer prote...  80.9    7e-16   
emb|CBW38502.1|  lipid transfer protein                               80.9    7e-16   
emb|CDY00655.1|  BnaC03g36390D                                        80.9    7e-16   
gb|ACP43542.1|  lipid transfer protein                                81.3    8e-16   
ref|XP_009135090.1|  PREDICTED: non-specific lipid-transfer prote...  80.9    8e-16   
gb|ACJ62339.1|  lipid-transfer protein                                81.3    8e-16   
ref|XP_004245406.1|  PREDICTED: non-specific lipid-transfer prote...  81.3    8e-16   
gb|ACJ62355.1|  lipid-transfer protein                                80.9    8e-16   
gb|AAY83344.1|  non-specific lipid transfer protein precursor         80.9    8e-16   
gb|AAT68263.1|  lipid transfer protein                                80.9    8e-16   
gb|AHG99490.1|  lipid-transfer protein                                80.9    8e-16   
gb|ACJ62319.1|  lipid-transfer protein                                80.9    8e-16   
gb|ACJ62318.1|  lipid-transfer protein                                80.9    8e-16   
ref|XP_006369490.1|  hypothetical protein POPTR_0001s23920g           80.5    8e-16   
gb|ACJ62361.1|  lipid-transfer protein                                80.9    8e-16   
ref|XP_009346912.1|  PREDICTED: non-specific lipid-transfer protein   80.9    9e-16   
gb|ABK94706.1|  unknown                                               80.9    9e-16   
gb|ABA34094.1|  phospholipid transfer protein 2                       80.5    9e-16   
gb|ACJ62342.1|  lipid-transfer protein                                80.9    9e-16   
ref|XP_010505484.1|  PREDICTED: non-specific lipid-transfer prote...  80.9    9e-16   
sp|Q9M5X6.1|NLTP_PYRCO  RecName: Full=Non-specific lipid-transfer...  80.9    9e-16   
gb|ABK96515.1|  unknown                                               80.9    9e-16   
gb|AAS13435.1|  lipid-transfer protein                                80.9    9e-16   
ref|XP_008792224.1|  PREDICTED: non-specific lipid-transfer prote...  80.9    9e-16   
ref|XP_009608993.1|  PREDICTED: non-specific lipid-transfer prote...  80.9    9e-16   
gb|KDO64078.1|  hypothetical protein CISIN_1g033544mg                 80.9    9e-16   
gb|ABF14722.1|  non-specific lipid transfer protein 1 precursor       80.9    1e-15   
ref|NP_001065586.1|  Os11g0116200                                     81.3    1e-15   
gb|ABA34096.1|  phospholipid transfer protein 2                       80.5    1e-15   
gb|AAQ54611.1|  Gly d Mal d 3-like protein                            80.5    1e-15   
ref|XP_004978532.1|  PREDICTED: non-specific lipid-transfer prote...  80.5    1e-15   
emb|CAH69206.1|  type 1 non specific lipid transfer protein precu...  80.5    1e-15   
ref|XP_009596391.1|  PREDICTED: non-specific lipid-transfer prote...  81.3    1e-15   
ref|NP_001268120.1|  lipid transfer protein precursor                 80.5    1e-15   
ref|XP_008778991.1|  PREDICTED: non-specific lipid-transfer prote...  80.5    1e-15   
gb|ABG54494.1|  putative allergen Rub i 3                             80.5    1e-15   
emb|CBW38504.1|  lipid transfer protein                               80.1    1e-15   
ref|XP_006295253.1|  hypothetical protein CARUB_v10024341mg           80.5    1e-15   
gb|ABX75045.1|  LTP isoallergen 2                                     79.7    1e-15   
ref|XP_011005034.1|  PREDICTED: non-specific lipid-transfer prote...  80.1    1e-15   
ref|XP_002532869.1|  Nonspecific lipid-transfer protein precursor...  80.5    1e-15   
gb|KHN29530.1|  Non-specific lipid-transfer protein 3                 80.1    1e-15   
ref|XP_010517149.1|  PREDICTED: non-specific lipid-transfer prote...  80.1    1e-15   
ref|XP_011095131.1|  PREDICTED: non-specific lipid-transfer prote...  80.1    2e-15   
emb|CBW38503.1|  lipid transfer protein                               79.7    2e-15   
gb|KHG21711.1|  Non-specific lipid-transfer                           80.1    2e-15   
sp|Q43193.1|NLTP1_SORBI  RecName: Full=Non-specific lipid-transfe...  80.1    2e-15   
gb|ABA34083.1|  phospholipid transfer protein 2                       80.1    2e-15   
ref|NP_001044654.1|  Os01g0822900                                     80.1    2e-15   
gb|AAR22488.1|  allergen Mal d 3                                      80.1    2e-15   
sp|P85894.1|LTP1_MORNI  RecName: Full=Non-specific lipid-transfer...  79.3    2e-15   
gb|EYU42014.1|  hypothetical protein MIMGU_mgv1a016509mg              80.1    2e-15   
ref|XP_008388341.1|  PREDICTED: non-specific lipid-transfer prote...  79.7    2e-15   
gb|ABA34080.1|  phospholipid transfer protein 2                       80.1    2e-15   
gb|AAT80649.1|  lipid transfer protein precursor                      79.7    2e-15   
ref|XP_009372014.1|  PREDICTED: non-specific lipid-transfer prote...  79.7    2e-15   
gb|AAF28385.1|AF151214_1  lipid-transfer protein                      80.1    2e-15   
emb|CDX93316.1|  BnaC04g45800D                                        79.7    2e-15   
ref|XP_002879751.1|  hypothetical protein ARALYDRAFT_482863           79.7    2e-15   
ref|XP_008350568.1|  PREDICTED: non-specific lipid-transfer prote...  80.1    2e-15   
gb|ABB90546.1|  lipid transfer protein                                79.7    2e-15   
ref|XP_008350569.1|  PREDICTED: non-specific lipid-transfer prote...  79.7    2e-15   
ref|XP_010931358.1|  PREDICTED: non-specific lipid-transfer prote...  79.7    2e-15   
ref|XP_008461223.1|  PREDICTED: non-specific lipid-transfer prote...  79.7    2e-15   
emb|CDM80997.1|  unnamed protein product                              79.7    2e-15   
ref|XP_007017081.1|  Non-specific lipid-transfer protein, putative    79.7    2e-15   
gb|AFK45186.1|  unknown                                               79.3    2e-15   
ref|XP_010558406.1|  PREDICTED: non-specific lipid-transfer prote...  79.7    2e-15   
ref|XP_007140137.1|  hypothetical protein PHAVU_008G087100g           81.6    3e-15   
ref|XP_010091033.1|  Non-specific lipid-transfer protein 1            79.7    3e-15   
gb|AHB19225.1|  non specific lipid transfer protein 1C                79.7    3e-15   
gb|ADV02772.1|  lipid transfer protein 1a                             79.7    3e-15   
ref|XP_010509136.1|  PREDICTED: non-specific lipid-transfer prote...  79.3    3e-15   
ref|XP_004302608.1|  PREDICTED: non-specific lipid-transfer prote...  79.3    3e-15   
gb|ABA34098.1|  phospholipid transfer protein 2                       79.3    3e-15   
ref|XP_010517150.1|  PREDICTED: non-specific lipid-transfer prote...  79.3    3e-15   
gb|AFR54362.1|  nonspecific lipid transfer protein 5                  79.3    3e-15   
emb|CAY54133.1|  lipid transfer protein precursor                     78.6    3e-15   
ref|XP_007134674.1|  hypothetical protein PHAVU_010G066400g           79.3    3e-15   
gb|EMT30256.1|  Non-specific lipid-transfer protein 4.3               79.3    3e-15   
gb|AFR43294.1|  lipid transfer protein precursor                      79.3    3e-15   
gb|AAF35185.1|AF195864_1  lipid transfer protein precursor            79.3    3e-15   
gb|AET05730.1|  lipid transfer protein isoform a                      78.6    3e-15   
gb|AFR43276.1|  lipid transfer protein precursor                      79.3    3e-15   
gb|ADD13588.1|  non-specific lipid transfer protein 1                 79.3    3e-15   
gb|ABP01768.1|  lipid transfer protein 1                              79.3    4e-15   
ref|XP_010253092.1|  PREDICTED: non-specific lipid-transfer prote...  79.0    4e-15   
gb|AFX65219.1|  lipid transfer precursor protein                      79.3    4e-15   
ref|XP_010505480.1|  PREDICTED: non-specific lipid-transfer prote...  79.3    4e-15   
ref|XP_008798560.1|  PREDICTED: non-specific lipid-transfer prote...  79.0    4e-15   
gb|KHN40180.1|  Non-specific lipid-transfer protein 8                 79.0    4e-15   
ref|NP_001235162.1|  uncharacterized protein LOC100499726 precursor   79.0    4e-15   
ref|XP_008244937.1|  PREDICTED: non-specific lipid-transfer prote...  79.0    4e-15   
gb|AGW21333.1|  lipid transfer protein                                79.0    4e-15   
ref|XP_006411069.1|  hypothetical protein EUTSA_v10017438mg           79.0    4e-15   
ref|XP_010683517.1|  PREDICTED: non-specific lipid-transfer prote...  79.0    5e-15   
gb|AAT80650.1|  lipid transfer protein precursor                      79.0    5e-15   
ref|XP_010931360.1|  PREDICTED: non-specific lipid-transfer prote...  79.0    5e-15   
gb|AFR43289.1|  lipid transfer protein precursor                      79.0    5e-15   
emb|CAY54131.1|  lipid transfer protein precursor                     78.2    5e-15   
prf||2115353B  lipid transfer protein                                 78.6    5e-15
gb|AAF35186.1|AF195865_1  lipid transfer protein precursor            79.0    5e-15   
ref|XP_011091598.1|  PREDICTED: non-specific lipid-transfer prote...  79.0    5e-15   
emb|CDX73941.1|  BnaA03g31060D                                        78.6    5e-15   
gb|AFR43288.1|  lipid transfer protein precursor                      78.6    5e-15   
gb|KFK36763.1|  lipid transfer protein                                78.6    5e-15   
gb|AAT80652.1|  lipid transfer protein precursor                      78.6    6e-15   
gb|AET05733.1|  lipid transfer protein isoform d                      77.8    6e-15   
ref|NP_001281295.1|  non-specific lipid-transfer protein precursor    78.6    6e-15   
ref|XP_010035997.1|  PREDICTED: non-specific lipid-transfer prote...  78.6    6e-15   
ref|XP_010922738.1|  PREDICTED: non-specific lipid-transfer prote...  78.6    6e-15   
gb|AET05731.1|  lipid transfer protein isoform b                      77.8    6e-15   
ref|XP_002528683.1|  Nonspecific lipid-transfer protein precursor...  78.2    7e-15   
emb|CDM80964.1|  unnamed protein product                              78.2    7e-15   
ref|XP_010091032.1|  Non-specific lipid-transfer protein              79.3    7e-15   
gb|ABB96481.1|  non-specific lipid transfer protein precursor         78.2    7e-15   
ref|XP_009396874.1|  PREDICTED: non-specific lipid-transfer prote...  78.2    7e-15   
gb|AAT45202.1|  lipid transfer protein 1 precursor                    78.6    7e-15   
gb|AGH27864.1|  lipid transfer protein precursor                      78.2    7e-15   
emb|CAY54132.1|  lipid transfer protein precursor                     77.4    7e-15   
ref|XP_007149145.1|  hypothetical protein PHAVU_005G045100g           78.2    7e-15   
dbj|BAH03575.1|  nonspecific lipid transfer protein                   78.2    8e-15   
ref|XP_010035998.1|  PREDICTED: non-specific lipid-transfer prote...  78.2    8e-15   
ref|XP_009800887.1|  PREDICTED: non-specific lipid-transfer prote...  78.2    8e-15   
gb|KHN21357.1|  Non-specific lipid-transfer protein 8                 78.6    9e-15   
sp|Q42641.1|NLTPA_BRAOT  RecName: Full=Non-specific lipid-transfe...  78.2    9e-15   
ref|XP_009384323.1|  PREDICTED: non-specific lipid-transfer prote...  78.2    9e-15   
ref|XP_004488587.1|  PREDICTED: non-specific lipid-transfer prote...  78.2    9e-15   
gb|ACE07188.1|  Art v 3.0301 allergen precursor                       78.2    9e-15   
ref|XP_002323667.1|  putative lipid transfer family protein           78.2    9e-15   
ref|NP_001236847.1|  uncharacterized protein LOC100306055             78.6    9e-15   
sp|Q9M5X8.1|NLTP_PRUAV  RecName: Full=Non-specific lipid-transfer...  78.2    9e-15   
ref|NP_001268074.1|  lipid transfer protein precursor                 78.2    9e-15   
ref|XP_003546844.1|  PREDICTED: LOW QUALITY PROTEIN: non-specific...  78.6    1e-14   
ref|XP_008370253.1|  PREDICTED: non-specific lipid-transfer prote...  78.2    1e-14   
ref|XP_009757912.1|  PREDICTED: uncharacterized protein LOC104210662  80.1    1e-14   
gb|EMS62142.1|  Non-specific lipid-transfer protein 4.3               77.4    1e-14   
ref|XP_006359128.1|  PREDICTED: non-specific lipid-transfer prote...  77.8    1e-14   
ref|XP_002458690.1|  hypothetical protein SORBIDRAFT_03g038280        78.2    1e-14   
dbj|BAK05751.1|  predicted protein                                    77.8    1e-14   
gb|ABI26087.1|  lipid transfer protein precursor                      77.8    1e-14   
gb|AAF71695.1|AF198168_1  phospholipid transfer protein               77.8    1e-14   
gb|EMT04675.1|  Non-specific lipid-transfer protein 4.3               77.8    1e-14   
gb|EMS55040.1|  Non-specific lipid-transfer protein 4.1               79.3    1e-14   
ref|XP_010509135.1|  PREDICTED: non-specific lipid-transfer prote...  77.8    1e-14   
gb|KHN40624.1|  Non-specific lipid-transfer protein 3                 81.6    1e-14   
ref|XP_011095136.1|  PREDICTED: non-specific lipid-transfer prote...  77.8    1e-14   
emb|CAH04986.1|  type 1 non-specific lipid transfer protein precu...  77.4    1e-14   
ref|XP_010931359.1|  PREDICTED: non-specific lipid-transfer prote...  77.4    1e-14   
gb|KDP27368.1|  hypothetical protein JCGZ_20192                       77.4    1e-14   
gb|ADR66948.1|  non-specific lipid transfer protein                   77.4    1e-14   
ref|XP_008388344.1|  PREDICTED: non-specific lipid-transfer prote...  77.4    1e-14   
gb|ADR66943.1|  non-specific lipid transfer protein                   77.4    2e-14   
gb|ADR66942.1|  non-specific lipid transfer protein                   77.4    2e-14   
gb|ACM78613.1|  lipid transfer protein 1                              77.4    2e-14   
gb|AAG29777.1|  lipid transfer protein 3 precursor                    77.4    2e-14   
gb|ABK28789.1|  lipid transfer protein                                77.0    2e-14   
gb|AAC18567.1|  lipid transfer protein                                77.4    2e-14   
gb|AGC08428.1|  lipid transfer protein                                77.4    2e-14   
ref|XP_006429567.1|  hypothetical protein CICLE_v10012953mg           77.4    2e-14   
gb|ABX56711.1|  LTP isoallergen 1 precursor                           77.4    2e-14   
gb|AAA86694.1|  phospholipid transfer protein precursor               77.0    2e-14   
emb|CAB96874.1|  mal d 3                                              76.6    2e-14   
gb|ACM78619.1|  non-specific lipid-transfer protein type 1            77.0    2e-14   
gb|AGH27863.1|  lipid transfer protein precursor                      77.0    2e-14   
ref|XP_004249706.1|  PREDICTED: non-specific lipid-transfer prote...  77.0    2e-14   
sp|E6Y8S8.1|NLTP1_APIGR  RecName: Full=Non-specific lipid-transfe...  77.0    2e-14   
gb|AEN70936.1|  lipid transfer protein                                77.0    2e-14   
gb|ABK96812.1|  lipid transfer protein isoform 1.2                    76.3    2e-14   
gb|AAT80665.1|  lipid transfer protein precursor                      77.0    2e-14   
gb|AAA73947.1|  lipid transfer protein                                77.0    2e-14   
gb|AEN70918.1|  lipid transfer protein                                77.0    2e-14   
gb|ABG27026.1|  phosophlipid protein                                  77.0    2e-14   
prf||2115353A  lipid transfer protein                                 76.6    2e-14
ref|XP_010043171.1|  PREDICTED: non-specific lipid-transfer prote...  76.6    3e-14   
ref|NP_195807.1|  pathogenesis-related lipid transfer protein         76.6    3e-14   
gb|AAM00272.1|AF363505_1  lipid transfer protein 1                    77.0    3e-14   
gb|AAQ96338.1|  lipid transfer protein                                76.6    3e-14   
gb|KEH29225.1|  Lipid transfer protein                                76.6    3e-14   
emb|CDM80995.1|  unnamed protein product                              76.6    3e-14   
ref|XP_002283359.2|  PREDICTED: non-specific lipid-transfer prote...  76.6    3e-14   
gb|AAM22768.1|  lipid transfer protein                                75.9    3e-14   
sp|Q43767.1|NLT41_HORVU  RecName: Full=Non-specific lipid-transfe...  76.6    3e-14   
emb|CDP14198.1|  unnamed protein product                              76.6    3e-14   
gb|AEN70935.1|  lipid transfer protein                                76.6    3e-14   
gb|AEN70919.1|  lipid transfer protein                                76.6    3e-14   
ref|XP_006281297.1|  hypothetical protein CARUB_v10027347mg           77.0    3e-14   
gb|KDP21874.1|  hypothetical protein JCGZ_00661                       76.6    3e-14   
gb|KHG30577.1|  Non-specific lipid-transfer                           76.6    3e-14   
gb|AEN70915.1|  lipid transfer protein                                76.6    3e-14   
gb|AET05732.1|  lipid transfer protein isoform c                      75.9    3e-14   
sp|Q43017.1|NLTP1_PRUDU  RecName: Full=Non-specific lipid-transfe...  76.3    3e-14   
gb|AAG27707.1|AF302788_1  lipid transfer protein precursor            76.3    3e-14   
gb|AFR43295.1|  lipid transfer protein precursor                      76.6    3e-14   
gb|AGH27866.1|  lipid transfer protein precursor                      76.3    4e-14   
ref|NP_001241103.1|  uncharacterized protein LOC100798112 precursor   76.3    4e-14   
ref|XP_009346911.1|  PREDICTED: non-specific lipid-transfer prote...  76.6    4e-14   
ref|NP_001055844.2|  Os05g0477900                                     76.6    4e-14   
gb|AEN70916.1|  lipid transfer protein                                76.3    4e-14   
ref|XP_010043282.1|  PREDICTED: non-specific lipid-transfer prote...  76.6    4e-14   
ref|XP_011098616.1|  PREDICTED: non-specific lipid-transfer prote...  76.3    4e-14   
ref|XP_010025406.1|  PREDICTED: non-specific lipid-transfer prote...  76.3    4e-14   
gb|ABA29446.1|  non-specific lipid transfer protein                   76.3    4e-14   
gb|ADR66953.1|  non-specific lipid transfer protein                   76.3    4e-14   
gb|AEN70917.1|  lipid transfer protein                                76.3    4e-14   
ref|XP_006367906.1|  PREDICTED: non-specific lipid-transfer prote...  76.3    4e-14   
gb|KCW47519.1|  hypothetical protein EUGRSUZ_K01282                   76.3    4e-14   
ref|NP_001147136.1|  LOC100280743 precursor                           76.3    4e-14   
gb|AAL25839.1|  lipid transfer precursor protein                      76.3    4e-14   
gb|ADR66947.1|  non-specific lipid transfer protein                   76.3    4e-14   
gb|ACE07187.1|  Art v 3 allergen precursor                            76.3    4e-14   
ref|XP_010547844.1|  PREDICTED: non-specific lipid-transfer prote...  75.9    4e-14   



>ref|XP_004240614.2| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=158

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 85/130 (65%), Gaps = 2/130 (2%)
 Frame = +1

Query  4    QQYLQYTYTAMAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGI  183
            Q++L    T   V +K +L  F  LL+    +P    A +TCDTV  DL PC +YVL+G 
Sbjct  31   QKFLPSPKTMANVLSKKFLLSF--LLICLVLSPPQARAVITCDTVFNDLKPCLNYVLVGG  88

Query  184  GPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTI  363
               ++CCNGLKSL+  A T  DRQ++CSCLKSLA++  D Q+ RAAS+P KC   +PF I
Sbjct  89   NVPAECCNGLKSLIVKAITTADRQSICSCLKSLATTATDEQVDRAASLPGKCGVKVPFKI  148

Query  364  SRDVDCSAVQ  393
            SRDVDC+ V+
Sbjct  149  SRDVDCTKVK  158



>ref|XP_006358720.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=119

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 82/119 (69%), Gaps = 2/119 (2%)
 Frame = +1

Query  37   AVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLK  216
            +V +K +L  F  LL+    +P    A +TCDTV +DL PC SYVL+G    ++CCNGLK
Sbjct  3    SVLSKTFLLSF--LLICLVLSPPQTRAVITCDTVFSDLKPCLSYVLVGGNVPTECCNGLK  60

Query  217  SLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            SL++ A+T  DRQ  CSC+K+LA++  D Q+ RAAS+P KC   +PF ISRDVDC+ V+
Sbjct  61   SLITNATTTEDRQMACSCVKNLATAATDEQVDRAASLPGKCGVNVPFKISRDVDCTKVK  119



>ref|XP_004242229.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=119

 Score =   117 bits (294),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 85/120 (71%), Gaps = 1/120 (1%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            MA S ++ L +F +L++    AP   +A +TCDTV   + PC +YVL G   S+DCCNGL
Sbjct  1    MATSPRVMLLLF-ILIIYMVAAPPPAKAVITCDTVYDGVKPCLNYVLFGGIVSTDCCNGL  59

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            +S++++A+T  D Q+ CSC+KSLAS   D +L+RAASIP +C ATIPF IS +VDCS V+
Sbjct  60   ESVIASATTIADHQSTCSCIKSLASQATDDELSRAASIPGQCGATIPFEISPNVDCSKVK  119



>emb|CDP12680.1| unnamed protein product [Coffea canephora]
Length=122

 Score =   116 bits (291),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 78/112 (70%), Gaps = 2/112 (2%)
 Frame = +1

Query  58   LTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAAS  237
            L +F  +L+   +  +G +AQ++CDTV+ DL PC S+VL G   +  CC+G+K+LLS A 
Sbjct  13   LVIFVSMLIMSFS--HGGQAQISCDTVDNDLLPCLSFVLNGGKVAPACCSGIKTLLSLAK  70

Query  238  TQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            TQTDRQ+VCSCLKS+A S  + QL  AA IP  C   +PF ISR++DCS V+
Sbjct  71   TQTDRQSVCSCLKSVAQSATNGQLKNAAQIPHLCGVNVPFQISRNIDCSKVK  122



>ref|XP_006353709.1| PREDICTED: non-specific lipid-transfer protein-like [Solanum 
tuberosum]
Length=162

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 81/117 (69%), Gaps = 1/117 (1%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            MA S +L L  F +L++    AP   +A +TCDTV   + PC +YVL G     DCCNGL
Sbjct  1    MATSPRLMLLSF-ILIIYMVVAPPPAKAVITCDTVYDGVKPCLNYVLFGGSVPIDCCNGL  59

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCS  384
            +SL+++A+T  DRQ+ CSC+KSLAS   D +L+RAASIP +C A++PF IS +VDCS
Sbjct  60   ESLIASATTTADRQSACSCVKSLASHATDEELSRAASIPGQCGASVPFEISPNVDCS  116



>ref|XP_009778825.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=115

 Score =   113 bits (282),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 79/118 (67%), Gaps = 4/118 (3%)
 Frame = +1

Query  40   VSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKS  219
            +S K    +F  ++VA   A    +A++TCDTV ++L PC +YVL G    SDCC+G+KS
Sbjct  2    LSMKFLSFLFICMMVAAPPA----KAELTCDTVYSNLQPCLTYVLFGFSLPSDCCDGVKS  57

Query  220  LLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            L+S A+T  DRQ+ CSC+KSLAS     +L+RAA IP KC A +PF IS +VDCS V 
Sbjct  58   LISTATTTADRQSACSCVKSLASRATGDELSRAAGIPGKCGANVPFDISPNVDCSKVN  115



>ref|XP_009631015.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
Length=102

 Score =   110 bits (276),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = +1

Query  109  VEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLAS  288
            V+A++TCDTV ++L PC +YVL G    SDCC+G+KSL+++A+T  DRQ  CSC+KSLAS
Sbjct  8    VKAELTCDTVYSNLQPCLTYVLFGFSLPSDCCDGVKSLIASATTTADRQIACSCVKSLAS  67

Query  289  SVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
                 +L+RAA IP KC A +PF IS DVDCS V 
Sbjct  68   RATGDELSRAAGIPGKCGANVPFDISPDVDCSKVN  102



>emb|CDP15101.1| unnamed protein product [Coffea canephora]
 emb|CDP12375.1| unnamed protein product [Coffea canephora]
Length=124

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 75/121 (62%), Gaps = 1/121 (1%)
 Frame = +1

Query  25   YTAMAVSAKLYLTVFALLLVAGATAPY-GVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDC  201
            +T MA ++ L   VF L +     + +   +AQ++CDTV  DL PC  +++ G      C
Sbjct  3    FTTMAKASSLKPLVFVLFVSMLIMSFFRSGQAQISCDTVKNDLSPCIGFIMNGGKVPPAC  62

Query  202  CNGLKSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDC  381
            C+GL +LLS A T+TDRQ+ CSCLKS+A S  D QL  AA IP  C   +PF ISRDVDC
Sbjct  63   CSGLNTLLSLAKTRTDRQSACSCLKSVAESATDDQLKNAAQIPHSCGVNLPFKISRDVDC  122

Query  382  S  384
            S
Sbjct  123  S  123



>ref|XP_009594799.1| PREDICTED: non-specific lipid-transfer protein 4-like [Nicotiana 
tomentosiformis]
Length=123

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 71/99 (72%), Gaps = 0/99 (0%)
 Frame = +1

Query  97   APYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLK  276
            AP    A +TCDTV  DL PC SYVLIG   S++CC+GLKSLL++A+T  D Q+ CSC+K
Sbjct  25   APPPAMAAITCDTVYNDLQPCLSYVLIGGSVSTECCSGLKSLLASATTTPDHQSACSCVK  84

Query  277  SLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            +LAS+    +++RAA IP +C A +PF IS DVDCS V 
Sbjct  85   NLASAATGEEVSRAARIPGQCGANVPFKISPDVDCSKVN  123



>ref|XP_009781151.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=123

 Score =   106 bits (264),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 69/99 (70%), Gaps = 0/99 (0%)
 Frame = +1

Query  97   APYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLK  276
            AP    A +TCDTV  DL PC SYVL+G     +CC+GLKSLL+ A+T  DRQ+ CSC+K
Sbjct  25   APPPAMAGITCDTVYNDLQPCLSYVLVGGSVPEECCSGLKSLLANATTTPDRQSACSCVK  84

Query  277  SLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            +LAS+    +++RAASI  +C A +PF IS DVDCS V 
Sbjct  85   NLASAATGEEVSRAASITGQCGANVPFKISPDVDCSKVN  123



>gb|AAY84146.1| lipid transfer protein [Catharanthus roseus]
Length=122

 Score =   105 bits (262),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 70/109 (64%), Gaps = 1/109 (1%)
 Frame = +1

Query  67   FALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQT  246
              +L+   A  P   EA +TCD VN +L  C SYV  G    + CC+G+K+LLS A T+ 
Sbjct  15   LVILIWMLAYNPRPSEA-LTCDDVNNNLISCLSYVAGGGKVPTSCCSGVKNLLSLAKTRN  73

Query  247  DRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            DRQT CSCLKSLA   N+ QL RA ++P  C  TIPF ISRDVDCS V+
Sbjct  74   DRQTACSCLKSLAVEANNDQLKRAQTVPKSCSLTIPFPISRDVDCSKVK  122



>ref|XP_009631889.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
Length=118

 Score =   105 bits (262),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 75/120 (63%), Gaps = 2/120 (2%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            MA  A L +   A +L+A        EA VTC TV TDL PC  YV +G    + CCNG+
Sbjct  1    MAKVASLAVVCIAAMLIA--IVASHAEAVVTCGTVATDLSPCLDYVRMGGAIPAMCCNGI  58

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            +SL SAAST  DRQTVC+C+KS A +++   L  AA++P+KC   IP+ IS  +DC+ VQ
Sbjct  59   RSLFSAASTTQDRQTVCNCMKSAAGAISGVNLNLAAALPNKCGVNIPYKISPSIDCAKVQ  118



>ref|XP_006663743.1| PREDICTED: non-specific lipid-transfer protein 2B-like isoform 
X1 [Oryza brachyantha]
Length=117

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 66/98 (67%), Gaps = 0/98 (0%)
 Frame = +1

Query  100  PYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKS  279
            P+   A ++C  VN+ +GPC SY   G GPSS CC+G++SL SAAST  DR+T C+CLK+
Sbjct  20   PHATMAAISCGQVNSAVGPCLSYARGGAGPSSACCSGVRSLSSAASTTADRRTACNCLKN  79

Query  280  LASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             A S++      AASIP KC  +IP+TIS  +DCS V 
Sbjct  80   AAGSISGLNAGNAASIPSKCGVSIPYTISTSIDCSRVS  117



>ref|XP_006662671.1| PREDICTED: non-specific lipid-transfer protein 2B-like [Oryza 
brachyantha]
Length=117

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 66/97 (68%), Gaps = 0/97 (0%)
 Frame = +1

Query  100  PYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKS  279
            P+   A ++C  VN+ +GPC SY   G GPSS CC+G++SL SAAST  DR+T C+CLK+
Sbjct  20   PHATMAAISCGQVNSAVGPCLSYARGGAGPSSACCSGVRSLSSAASTTADRRTACNCLKN  79

Query  280  LASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAV  390
             A S++      AASIP KC  +IP+TIS  +DCS V
Sbjct  80   AAGSISGLNAGNAASIPSKCGVSIPYTISTSIDCSRV  116



>gb|AAA74624.1| lipid transfer protein precursor [Oryza sativa]
Length=118

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 67/99 (68%), Gaps = 0/99 (0%)
 Frame = +1

Query  97   APYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLK  276
             P+   A ++C  VN+ + PC SY   G GPS+ CC+G++SL SAAST  DR+T C+CLK
Sbjct  20   GPHTTMAAISCGQVNSAVSPCLSYARGGSGPSAACCSGVRSLNSAASTTADRRTACNCLK  79

Query  277  SLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            ++A S++      AASIP KC  TIP+TIS  +DCS+V 
Sbjct  80   NVAGSISGLNAGNAASIPSKCGVTIPYTISPSIDCSSVN  118



>sp|P07597.1|NLTP1_HORVU RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Probable amylase/protease inhibitor; Flags: 
Precursor [Hordeum vulgare]
 emb|CAA41946.1| lipid transfer protein [Hordeum vulgare subsp. vulgare]
 emb|CAA28805.1| unnamed protein product [Hordeum vulgare]
 gb|AAA32970.1| amylase/protease inhibitor [Hordeum vulgare]
 emb|CAP16136.1| non-specific lipid transport protein 1 precursor [Hordeum vulgare]
Length=117

 Score =   101 bits (251),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 75/115 (65%), Gaps = 2/115 (2%)
 Frame = +1

Query  46   AKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLL  225
            A++ L   AL+L+  A AP    A + C  V++ + PC +YV  G GPS +CCNG++ L 
Sbjct  4    AQVLLMAAALVLMLTA-APRAAVA-LNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLH  61

Query  226  SAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAV  390
            + A +  DRQTVC+CLK +A  +++  L  AASIP KC+  +P+TIS D+DCS +
Sbjct  62   NQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRI  116



>ref|XP_009760676.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=118

 Score =   101 bits (251),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 73/120 (61%), Gaps = 2/120 (2%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            MA  A L +   A +++A        EA VTC TV TDL PC  YV +G    + CCNG+
Sbjct  1    MAKFASLSVMFIAAMVIA--IVASHAEAVVTCGTVATDLSPCLDYVRMGGAIPTMCCNGI  58

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            ++L SAAST  DRQTVC+C+KS A  ++   L  AA++P KC   IP+ IS  +DC+ VQ
Sbjct  59   RNLFSAASTTQDRQTVCNCMKSAARVISGVNLNLAAALPSKCGVIIPYKISPSIDCAKVQ  118



>dbj|BAK05317.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=117

 Score =   100 bits (250),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 75/115 (65%), Gaps = 2/115 (2%)
 Frame = +1

Query  46   AKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLL  225
            A++ L   AL+L+  A AP    A + C  V++ + PC +YV  G GPS +CCNG++ L 
Sbjct  4    AQVLLMAAALVLMLMA-APRAAVA-LNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLH  61

Query  226  SAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAV  390
            + A +  DRQTVC+CLK +A  +++  L  AASIP KC+  +P+TIS D+DCS +
Sbjct  62   NQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRI  116



>ref|XP_009770883.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=121

 Score =   100 bits (250),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            VTC+TV   L PC  YVL G     +CC+GLKSLL AA T+TDRQ+ C C+KS+ASS   
Sbjct  31   VTCNTVYDSLEPCLGYVLGGASVPPECCSGLKSLLGAARTRTDRQSACQCVKSVASSATG  90

Query  301  AQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             Q++RAASIP  C A +PF IS +VDCS ++
Sbjct  91   DQISRAASIPGICKAKLPFKISANVDCSKIK  121



>ref|NP_001176316.1| Os11g0115466 [Oryza sativa Japonica Group]
 sp|A2ZAT0.1|NLTP2_ORYSI RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP 
2; Flags: Precursor [Oryza sativa Indica Group]
 sp|Q7XJ39.2|NLT2A_ORYSJ RecName: Full=Non-specific lipid-transfer protein 2A; Short=LTP 
2A; Flags: Precursor [Oryza sativa Japonica Group]
 gb|ABA91217.1| Nonspecific lipid-transfer protein 1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAY79714.1| hypothetical protein OsI_34863 [Oryza sativa Indica Group]
 gb|EAY82034.1| hypothetical protein OsI_37220 [Oryza sativa Indica Group]
 gb|EAZ17206.1| hypothetical protein OsJ_32715 [Oryza sativa Japonica Group]
 dbj|BAH95044.1| Os11g0115466 [Oryza sativa Japonica Group]
 gb|AGT42306.1| lipid transfer protein [Oryza sativa Japonica Group]
Length=118

 Score =   100 bits (249),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 67/99 (68%), Gaps = 0/99 (0%)
 Frame = +1

Query  97   APYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLK  276
             P+   A ++C  VN+ + PC SY   G GPS+ CC+G++SL SAAST  DR+T C+CLK
Sbjct  20   GPHTTMAAISCGQVNSAVSPCLSYARGGSGPSAACCSGVRSLNSAASTTADRRTACNCLK  79

Query  277  SLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            ++A S++      AASIP KC  +IP+TIS  +DCS+V 
Sbjct  80   NVAGSISGLNAGNAASIPSKCGVSIPYTISPSIDCSSVN  118



>emb|CAA42832.1| LTP 1 [Hordeum vulgare]
Length=134

 Score =   100 bits (250),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 74/113 (65%), Gaps = 2/113 (2%)
 Frame = +1

Query  46   AKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLL  225
            A++ L   AL+L+  A AP    A + C  V++ + PC +YV  G GPS +CCNG++ L 
Sbjct  4    AQVLLMAAALVLMLTA-APRAAVA-LNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLH  61

Query  226  SAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCS  384
            + A +  DRQTVC+CLK +A  +++  L  AASIP KC+  +P+TIS D+DCS
Sbjct  62   NQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCS  114



>ref|XP_006367904.1| PREDICTED: non-specific lipid-transfer protein-like [Solanum 
tuberosum]
Length=116

 Score =   100 bits (248),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 76/111 (68%), Gaps = 3/111 (3%)
 Frame = +1

Query  64   VFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPS--SDCCNGLKSLLSAAS  237
            +F LLL+  A A    +A V+C+TV ++L PC  +VL G GP+  S CC+GLKSLL AA 
Sbjct  6    LFPLLLICIALAATATDAAVSCNTVYSNLEPCLGFVLNG-GPTVPSACCSGLKSLLVAAG  64

Query  238  TQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAV  390
            T  DRQ+ C C+KSLASS N  Q+ RA+ +P  C+A IP+ IS +VDCS +
Sbjct  65   TTADRQSACKCIKSLASSANGVQIGRASQLPGICNAHIPYQISPNVDCSKI  115



>sp|Q2QYL2.1|NLT2B_ORYSJ RecName: Full=Non-specific lipid-transfer protein 2B; Short=LTP 
2B; AltName: Full=LTP B1; Flags: Precursor [Oryza sativa 
Japonica Group]
 gb|ABA96283.1| Nonspecific lipid-transfer protein 2 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAZ19434.1| hypothetical protein OsJ_34995 [Oryza sativa Japonica Group]
 gb|AGT42307.1| lipid transfer protein [Oryza sativa Japonica Group]
Length=117

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 67/99 (68%), Gaps = 0/99 (0%)
 Frame = +1

Query  97   APYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLK  276
             P+   A ++C  VN+ + PC SY   G GPS+ CC+G++SL SAA+T  DR+T C+CLK
Sbjct  19   GPHTTMAAISCGQVNSAVSPCLSYARGGSGPSAACCSGVRSLNSAATTTADRRTACNCLK  78

Query  277  SLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            ++A S++      AASIP KC  +IP+TIS  +DCS+V 
Sbjct  79   NVAGSISGLNAGNAASIPSKCGVSIPYTISPSIDCSSVN  117



>ref|NP_001065986.1| Os12g0115000 [Oryza sativa Japonica Group]
 dbj|BAF29005.1| Os12g0115000, partial [Oryza sativa Japonica Group]
Length=110

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 67/99 (68%), Gaps = 0/99 (0%)
 Frame = +1

Query  97   APYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLK  276
             P+   A ++C  VN+ + PC SY   G GPS+ CC+G++SL SAA+T  DR+T C+CLK
Sbjct  12   GPHTTMAAISCGQVNSAVSPCLSYARGGSGPSAACCSGVRSLNSAATTTADRRTACNCLK  71

Query  277  SLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            ++A S++      AASIP KC  +IP+TIS  +DCS+V 
Sbjct  72   NVAGSISGLNAGNAASIPSKCGVSIPYTISPSIDCSSVN  110



>gb|AAB70539.1| lipid transfer protein LPT II [Oryza sativa Indica Group]
Length=118

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 67/99 (68%), Gaps = 0/99 (0%)
 Frame = +1

Query  97   APYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLK  276
             P+   A ++C  VN+ + PC SY   G GPS+ CC+G+++L SAAST  DR+T C+CLK
Sbjct  20   GPHTTMAAISCGQVNSAVSPCLSYPRGGSGPSAACCSGVRNLNSAASTTADRRTACNCLK  79

Query  277  SLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            ++A S++      AASIP KC  +IP+TIS  +DCS+V 
Sbjct  80   NVAGSISGLNAGNAASIPSKCGVSIPYTISPSIDCSSVN  118



>gb|AAX84944.1| non-specific lipid transfer protein-like antimicrobial protein 
[Leonurus japonicus]
Length=115

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 70/120 (58%), Gaps = 5/120 (4%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            MA   KL  T   +L+VA   AP   EA + C+TV + + PC  YV  G GP   CC G+
Sbjct  1    MAALIKLMCT---MLIVAAVVAPL-AEAAIGCNTVASKMAPCLPYV-TGKGPLGGCCGGV  55

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            K L+ AA T  DRQ VC+CLK+LA S +   L  AA +P KC  +IP+ IS + DCS V 
Sbjct  56   KGLIDAARTTPDRQAVCNCLKTLAKSYSGINLGNAAGLPGKCGVSIPYQISPNTDCSKVH  115



>pdb|1MID|A Chain A, Non-Specific Lipid Transfer Protein 1 From Barley In 
Complex With L-Alfa-Lysophosphatidylcholine, Laudoyl
 pdb|3GSH|A Chain A, Three-Dimensional Structure Of A Post Translational 
Modified Barley Ltp1
 pdb|3GSH|B Chain B, Three-Dimensional Structure Of A Post Translational 
Modified Barley Ltp1
Length=91

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 62/90 (69%), Gaps = 0/90 (0%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            + C  V++ + PC +YV  G GPS +CCNG++ L + A +  DRQTVC+CLK +A  +++
Sbjct  1    LNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHN  60

Query  301  AQLARAASIPDKCDATIPFTISRDVDCSAV  390
              L  AASIP KC+  +P+TIS D+DCS +
Sbjct  61   LNLNNAASIPSKCNVNVPYTISPDIDCSRI  90



>ref|XP_004151695.1| PREDICTED: non-specific lipid-transfer protein 3-like isoform 
1 [Cucumis sativus]
 ref|XP_004167529.1| PREDICTED: non-specific lipid-transfer protein 3-like isoform 
1 [Cucumis sativus]
 gb|KGN54448.1| Non-specific lipid-transfer protein [Cucumis sativus]
Length=125

 Score = 98.2 bits (243),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 75/117 (64%), Gaps = 4/117 (3%)
 Frame = +1

Query  49   KLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLS  228
            KL LTV  L  V G       EA V+C+ V T+L PC SYV  G  PSS+CC+G+K L +
Sbjct  10   KLGLTVTFLYAVIGGGVT--TEAVVSCNQVITNLRPCVSYVTGGGYPSSNCCSGVKQLST  67

Query  229  AASTQTDRQTVCSCLKSLASSV--NDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            AA T  DRQ VC CLKSL + V  N   +A AA++P KC  T+P++I+ +VDC+ ++
Sbjct  68   AARTTPDRQAVCRCLKSLVNGVKYNGQNVANAAALPTKCGVTLPYSINPNVDCNTIK  124



>pdb|1BE2|A Chain A, Lipid Transfer Protein Complexed With Palmitate, Nmr, 
10 Structures
 pdb|1JTB|A Chain A, Lipid Transfer Protein Complexed With Palmitoyl Coenzyme 
A, Nmr, 16 Structures
 pdb|1LIP|A Chain A, Barley Lipid Transfer Protein (Nmr, 4 Structures)
Length=91

 Score = 97.1 bits (240),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 62/90 (69%), Gaps = 0/90 (0%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            + C  V++ + PC +YV  G GPS +CCNG++ L + A +  DRQTVC+CLK +A  +++
Sbjct  1    LNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHN  60

Query  301  AQLARAASIPDKCDATIPFTISRDVDCSAV  390
              L  AASIP KC+  +P+TIS D+DCS +
Sbjct  61   LNLNNAASIPSKCNVNVPYTISPDIDCSRI  90



>gb|AGV40204.1| nonspecific lipid-transfer protein 3, partial [Oryza sativa]
Length=126

 Score = 98.2 bits (243),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 65/96 (68%), Gaps = 0/96 (0%)
 Frame = +1

Query  97   APYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLK  276
             P+   A ++C  VN+ + PC SY   G GPS+ CC+G++SL SAAST  DR+T C+CLK
Sbjct  31   GPHTTMAAISCGQVNSAVSPCLSYARGGSGPSAACCSGVRSLNSAASTTADRRTACNCLK  90

Query  277  SLASSVNDAQLARAASIPDKCDATIPFTISRDVDCS  384
            ++A S++      AASIP KC  +IP+TIS  ++CS
Sbjct  91   NVAGSISGLNAGNAASIPSKCGVSIPYTISPSIECS  126



>emb|CAA69949.1| lipid transfer protein [Oryza sativa]
 gb|AAB18815.1| lipid transfer protein [Oryza sativa Indica Group]
Length=116

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 61/91 (67%), Gaps = 0/91 (0%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            +TC  VN+ +GPC +Y   G GPS+ CC+G++SL +AAST  DR+T C+CLK+ A  +  
Sbjct  26   ITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLFAAASTTADRRTACNCLKNAARGIKG  85

Query  301  AQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
                 AASIP KC  ++P+TIS  +DCS V 
Sbjct  86   LNAGNAASIPSKCGVSVPYTISASIDCSRVS  116



>gb|AGH32496.1| non-specific lipid transfer protein [Papaver somniferum]
Length=117

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 74/121 (61%), Gaps = 5/121 (4%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGP-SSDCCNG  210
            MA   KL   V A ++V     P+  E  ++C TV + L PC  Y L G+G   ++CC G
Sbjct  1    MATLFKLACVVLACMVV---IVPFVAEGAISCGTVVSKLSPCVGY-LTGLGSLPANCCTG  56

Query  211  LKSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAV  390
            +KSL  AA T +DRQTVC CLK+ A S+ + +++ AAS+P KC  +IP+T S  +DCS V
Sbjct  57   VKSLYQAAQTTSDRQTVCGCLKNAAKSMTNIKMSNAASLPGKCGVSIPYTFSTSIDCSKV  116

Query  391  Q  393
             
Sbjct  117  N  117



>ref|XP_009593826.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
tomentosiformis]
Length=128

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +1

Query  127  CDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVNDAQ  306
            C+TV   L PC  YVL G     +CC+GLKSLLSAA T+ DRQ+ C C+K++ASS    Q
Sbjct  40   CNTVYDSLEPCLGYVLGGASVPPECCSGLKSLLSAARTRMDRQSACQCVKTVASSATGDQ  99

Query  307  LARAASIPDKCDATIPFTISRDVDCSAVQ  393
            ++RAASIP  C A +PF IS +VDCS ++
Sbjct  100  ISRAASIPGICKAKVPFKISANVDCSKIK  128



>pir||EPRZ phospholipid transfer protein homolog - rice
 pdb|1UVA|A Chain A, Lipid Binding In Rice Nonspecific Lipid Transfer Protein-1 
Complexes From Oryza Sativa
 pdb|1UVB|A Chain A, Lipid Binding In Rice Nonspecific Lipid Transfer Protein-1 
Complexes From Oryza Sativa
 pdb|1UVC|A Chain A, Lipid Binding In Rice Nonspecific Lipid Transfer Protein-1 
Complexes From Oryza Sativa
 pdb|1UVC|B Chain B, Lipid Binding In Rice Nonspecific Lipid Transfer Protein-1 
Complexes From Oryza Sativa
 pdb|1BV2|A Chain A, Lipid Transfer Protein From Rice Seeds, Nmr, 14 Structures
 pdb|1RZL|A Chain A, Rice Nonspecific Lipid Transfer Protein
Length=91

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 61/91 (67%), Gaps = 0/91 (0%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            +TC  VN+ +GPC +Y   G GPS+ CC+G++SL +AAST  DR+T C+CLK+ A  +  
Sbjct  1    ITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASTTADRRTACNCLKNAARGIKG  60

Query  301  AQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
                 AASIP KC  ++P+TIS  +DCS V 
Sbjct  61   LNAGNAASIPSKCGVSVPYTISASIDCSRVS  91



>sp|A0AT31.1|NLTP5_LENCU RecName: Full=Non-specific lipid-transfer protein 5; Short=LTP5; 
Flags: Precursor [Lens culinaris]
 gb|AAX35809.1| lipid transfer protein 5 precursor [Lens culinaris subsp. culinaris]
Length=116

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 68/120 (57%), Gaps = 4/120 (3%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            MA S KL   V  + ++    A    E  ++C  V  DL PC +Y+  G GPS  CC G+
Sbjct  1    MARSMKLACVVLVMCMIVAPMA----EGAISCGAVTGDLSPCLTYLTGGPGPSPQCCGGV  56

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            K LL+AA+T  DRQ  C+C+KS ASS+       AA++P KC   IP+ IS   +C+ V+
Sbjct  57   KKLLAAANTTPDRQAACNCMKSAASSITKLNTNNAAALPGKCGVNIPYKISTSTNCNTVK  116



>ref|NP_001065987.1| Os12g0115100 [Oryza sativa Japonica Group]
 sp|Q0IQK9.1|NLTP1_ORYSJ RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; Short=PAPI; Flags: Precursor [Oryza sativa Japonica Group]
 sp|A2ZHF1.1|NLTP1_ORYSI RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; Short=PAPI; Flags: Precursor [Oryza sativa Indica Group]
 gb|ABA96284.1| Nonspecific lipid-transfer protein 1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF29006.1| Os12g0115100 [Oryza sativa Japonica Group]
 gb|EAY82035.1| hypothetical protein OsI_37221 [Oryza sativa Indica Group]
 gb|EAZ19435.1| hypothetical protein OsJ_34996 [Oryza sativa Japonica Group]
 gb|ACA50499.1| lipid transfer protein 1 [Oryza sativa Japonica Group]
Length=116

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 61/91 (67%), Gaps = 0/91 (0%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            +TC  VN+ +GPC +Y   G GPS+ CC+G++SL +AAST  DR+T C+CLK+ A  +  
Sbjct  26   ITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASTTADRRTACNCLKNAARGIKG  85

Query  301  AQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
                 AASIP KC  ++P+TIS  +DCS V 
Sbjct  86   LNAGNAASIPSKCGVSVPYTISASIDCSRVS  116



>ref|XP_010683515.1| PREDICTED: non-specific lipid-transfer protein-like [Beta vulgaris 
subsp. vulgaris]
Length=116

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 69/120 (58%), Gaps = 4/120 (3%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            MA+  KL       +LV    AP+  EA VTC  V + L PC  Y+  G  PS  CC G+
Sbjct  1    MAILMKLACATLMCMLV---VAPH-AEAAVTCGQVTSSLLPCLGYLQGGASPSPACCGGI  56

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            KSL S AST  DR+T C CLKS A+SV    ++ A+ +P KCD +IP+ IS   DCS V 
Sbjct  57   KSLNSMASTPADRKTACGCLKSAAASVKGIDMSAASGLPGKCDVSIPYPISTSTDCSKVN  116



>sp|A0AT30.1|NLTP3_LENCU RecName: Full=Non-specific lipid-transfer protein 3; Short=LTP3; 
Flags: Precursor [Lens culinaris]
 gb|AAX35808.1| lipid transfer protein 3 precursor [Lens culinaris]
Length=118

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 68/114 (60%), Gaps = 1/114 (1%)
 Frame = +1

Query  52   LYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSA  231
            + L   AL++     AP   EA V+C TV  DL PC  Y+  G GP+  CC G+K LL+A
Sbjct  5    MNLACVALVMCMVVIAPM-AEAAVSCGTVTGDLAPCIPYLTGGAGPTDSCCAGVKKLLAA  63

Query  232  ASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            A T  DRQ  C+CLK+ A ++N+     AA++P KC+  IP+ IS   +C+ ++
Sbjct  64   APTTADRQAACNCLKTAAGNINNLNPGNAAALPGKCNVNIPYKISTTTNCNTIK  117



>ref|XP_011095133.1| PREDICTED: non-specific lipid-transfer protein 1-like [Sesamum 
indicum]
 gb|ABQ53931.1| lipid transfer protein [Sesamum indicum]
Length=119

 Score = 95.1 bits (235),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 67/112 (60%), Gaps = 2/112 (2%)
 Frame = +1

Query  64   VFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIG--PSSDCCNGLKSLLSAAS  237
            V A+ +V  A AP   EA ++C TV  DL PC +YV+ G    P   CC G+K+L + AS
Sbjct  8    VLAVTMVVVALAPPQAEAAISCGTVANDLSPCINYVMYGGAGTPPVPCCTGIKTLYNQAS  67

Query  238  TQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            +  DRQ VC CLKS+A   + A +  AA++P KC  +IP+ IS   DCS V 
Sbjct  68   STADRQAVCGCLKSVAGQASPAIIGTAAALPGKCGVSIPYEISPSTDCSKVH  119



>gb|AGV40203.1| nonspecific lipid-transfer protein 2, partial [Oryza sativa]
Length=117

 Score = 94.7 bits (234),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 60/88 (68%), Gaps = 0/88 (0%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            +TC  VN+ +GPC +Y   G GPS+ CC+G++SL +AAST  DR+T C+CLK+ A  +  
Sbjct  29   ITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASTTADRRTACNCLKNAARGIKG  88

Query  301  AQLARAASIPDKCDATIPFTISRDVDCS  384
                 AASIP KC  ++P+TIS  +DCS
Sbjct  89   LNAGNAASIPSKCGVSVPYTISASIDCS  116



>emb|CAA80809.1| lipid transfer protein [Oryza sativa Indica Group]
Length=117

 Score = 94.7 bits (234),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = +1

Query  100  PYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKS  279
            P+   A ++C  VN+ + PC SY   G+ PS+ CC+G++SL SAAST  DR+T C+CLK+
Sbjct  21   PHTTMAAISCGQVNSAVSPCLSYAR-GLRPSAACCSGVRSLNSAASTTADRRTACNCLKN  79

Query  280  LASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            +A S++      AASIP KC  +IP+TIS  +DCS V 
Sbjct  80   VAGSISGLNAGNAASIPSKCGVSIPYTISPSIDCSRVN  117



>gb|ABA91221.2| Nonspecific lipid-transfer protein 1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
Length=120

 Score = 94.7 bits (234),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 61/90 (68%), Gaps = 0/90 (0%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            +TC  VN+ +GPC +Y   G GPS+ CC+G++SL +AAS+  DR+T C+CLK+ A  +  
Sbjct  30   ITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASSTADRRTACNCLKNAARGIKG  89

Query  301  AQLARAASIPDKCDATIPFTISRDVDCSAV  390
                 AASIP KC  ++P+TIS  +DCS V
Sbjct  90   LNAGNAASIPSKCGVSVPYTISASIDCSRV  119



>ref|XP_004245223.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=128

 Score = 94.7 bits (234),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 71/116 (61%), Gaps = 7/116 (6%)
 Frame = +1

Query  67   FALLLV------AGATAPYGVEAQVTCDTVNTDLGPCGSYVLIG-IGPSSDCCNGLKSLL  225
            F +LL+      A  TA    +A +TC+TV T L PC SYVL G +   S+CCNG+KS+L
Sbjct  13   FPMLLICIAVVMATITATTSQDATLTCNTVFTTLEPCLSYVLGGGLSVPSECCNGIKSML  72

Query  226  SAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            + A T  DRQ+ C C+KS+ SS     ++RAA +P  C A +PF IS  VDCS  +
Sbjct  73   NGAYTIADRQSACKCIKSVVSSAAPGPVSRAAKVPGICKANVPFKISPHVDCSKTK  128



>ref|NP_001065583.1| Os11g0115400 [Oryza sativa Japonica Group]
 gb|AAP97429.1| lipid transfer protein LT1 [Oryza sativa]
 dbj|BAF27428.1| Os11g0115400 [Oryza sativa Japonica Group]
 gb|EAY79715.1| hypothetical protein OsI_34866 [Oryza sativa Indica Group]
 gb|EAZ17208.1| hypothetical protein OsJ_32719 [Oryza sativa Japonica Group]
Length=116

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 61/91 (67%), Gaps = 0/91 (0%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            +TC  VN+ +GPC +Y   G GPS+ CC+G++SL +AAS+  DR+T C+CLK+ A  +  
Sbjct  26   ITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASSTADRRTACNCLKNAARGIKG  85

Query  301  AQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
                 AASIP KC  ++P+TIS  +DCS V 
Sbjct  86   LNAGNAASIPSKCGVSVPYTISASIDCSRVS  116



>ref|NP_001067782.1| Os11g0427800 [Oryza sativa Japonica Group]
 gb|AAX96637.1| Protease inhibitor/seed storage/LTP family, putative [Oryza sativa 
Japonica Group]
 gb|ABA93211.1| Nonspecific lipid-transfer protein 1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF28145.1| Os11g0427800 [Oryza sativa Japonica Group]
 gb|EAY80752.1| hypothetical protein OsI_35929 [Oryza sativa Indica Group]
 gb|EAZ18211.1| hypothetical protein OsJ_33751 [Oryza sativa Japonica Group]
 dbj|BAG87838.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92398.1| unnamed protein product [Oryza sativa Japonica Group]
Length=117

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 61/92 (66%), Gaps = 1/92 (1%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIG-IGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVN  297
            +TC  VN+ +GPC +Y   G  GPS+ CCNG++SL SAA T  DR+T C+CLK+ A  + 
Sbjct  26   ITCGQVNSAVGPCLTYARGGGAGPSAACCNGVRSLKSAARTTADRRTACNCLKNAARGIK  85

Query  298  DAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
                  AASIP KC  ++P+TIS  +DCS V+
Sbjct  86   GLNAGNAASIPSKCGVSVPYTISASIDCSRVR  117



>ref|XP_008463259.1| PREDICTED: non-specific lipid-transfer protein 1-like [Cucumis 
melo]
Length=125

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 71/117 (61%), Gaps = 4/117 (3%)
 Frame = +1

Query  49   KLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLS  228
            KL LTV  L  V G       EA VTC+ V ++L PC SYV  G  PS +CC+G++ L  
Sbjct  10   KLGLTVTLLYAVIGGGVT--TEATVTCNQVVSNLSPCISYVTGGGSPSFNCCSGVRQLNK  67

Query  229  AASTQTDRQTVCSCLKSLASSV--NDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            AA T  DRQ VC CLKSL + V  N   +A AA++P KC   +P+TI+ + DCS ++
Sbjct  68   AAQTTPDRQDVCRCLKSLINGVTYNGQNVANAAALPTKCGVNLPYTINPNADCSTIK  124



>gb|AGV40202.1| nonspecific lipid-transfer protein 1, partial [Oryza sativa]
Length=123

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 60/88 (68%), Gaps = 0/88 (0%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            +TC  VN+ +GPC +Y   G GPS+ CC+G++SL +AAS+  DR+T C+CLK+ A  +  
Sbjct  29   ITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASSTADRRTACNCLKNAARGIKG  88

Query  301  AQLARAASIPDKCDATIPFTISRDVDCS  384
                 AASIP KC  ++P+TIS  +DCS
Sbjct  89   LNAGNAASIPSKCGVSVPYTISASIDCS  116



>sp|A0AT29.1|NLTP2_LENCU RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP2; 
Contains: RecName: Full=Non-specific lipid-transfer protein 
7; Short=LTP7; Flags: Precursor [Lens culinaris]
 gb|AAX35807.1| lipid transfer protein 2 precursor [Lens culinaris]
Length=118

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 68/120 (57%), Gaps = 3/120 (3%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            MA   KL   V  + +V    AP   E  ++C  V +DL PC +Y+  G GPS  CC G+
Sbjct  1    MARGMKLACVVLVICMVV--IAPM-AEGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGV  57

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            K LL+AA+T  DRQ  C+CLKS A S+       AA++P KC   IP+ IS   +C+ V+
Sbjct  58   KKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK  117



>dbj|BAO51648.1| lipid transfer protein [Suaeda japonica]
Length=118

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 72/120 (60%), Gaps = 2/120 (2%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            MA SA + +    L+ +  AT P+  EA +TC  V + L PC  Y+  G  P++ CC G+
Sbjct  1    MASSAMMKIVCATLMCMLVAT-PF-AEAAITCGQVTSKLAPCMGYLKSGGAPTAACCGGV  58

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            KSL S AST  DR+  C CLKS A+S++    A A+S+P KC  +IP+ IS  VDC+ V 
Sbjct  59   KSLNSMASTPADRKAACGCLKSAAASISGMNTAAASSLPSKCGVSIPYPISTSVDCAKVN  118



>ref|XP_011091590.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
Length=118

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 69/113 (61%), Gaps = 3/113 (3%)
 Frame = +1

Query  58   LTVFALLLV-AGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAA  234
            L++F +  V A A AP   EA +TC TV +DL  C SY L   GP   CC+G+K L  AA
Sbjct  8    LSIFLIAAVLAMAVAPRS-EAAITCGTVVSDLDSCLSY-LTNKGPLGSCCSGVKGLYGAA  65

Query  235  STQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             T  DRQ+VC+CLKSLA S  D  L++AA +P +C   IP+ IS   DCS V 
Sbjct  66   KTTQDRQSVCNCLKSLADSYTDVDLSKAAGLPGQCGVNIPYKISPSTDCSTVH  118



>gb|AAP92127.1| lipid transfer protein LPT1 [Oryza sativa]
Length=118

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = +1

Query  100  PYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKS  279
            P+   A ++C  VN+ + PC SY   G+ PS+ CC+G++SL SAAST  DR+T C+CLK+
Sbjct  21   PHTTMAAISCGQVNSAVSPCLSYAR-GLRPSAACCSGVRSLNSAASTTADRRTACNCLKN  79

Query  280  LASSVNDAQLARAASIPDKCDATIPFTISRDVDCS  384
            +A S++      AASIP KC  +IP+TIS  +DCS
Sbjct  80   VAGSISGLNAGNAASIPSKCGVSIPYTISPSIDCS  114



>ref|XP_002442775.1| hypothetical protein SORBIDRAFT_08g002680 [Sorghum bicolor]
 gb|EES16613.1| hypothetical protein SORBIDRAFT_08g002680 [Sorghum bicolor]
Length=119

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 62/94 (66%), Gaps = 1/94 (1%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLAS  288
            EA VTC  V++ +GPC SY    G GPS+ CC+G++SL SAA T  DR+  C+CLK+ A 
Sbjct  25   EAAVTCGQVSSAIGPCLSYARGQGSGPSAGCCSGVRSLNSAARTTADRRAACNCLKNAAR  84

Query  289  SVNDAQLARAASIPDKCDATIPFTISRDVDCSAV  390
             +    + +AASIP KC  +IP+TIS   DCS V
Sbjct  85   GIRGLNVGKAASIPSKCGVSIPYTISTSTDCSRV  118



>gb|EYU41040.1| hypothetical protein MIMGU_mgv1a016547mg [Erythranthe guttata]
Length=117

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 68/112 (61%), Gaps = 5/112 (4%)
 Frame = +1

Query  58   LTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAAS  237
            L V A+L+   A  P G EA + C TV + + PC  YV  G GP   CC G+K L SAA 
Sbjct  11   LFVAAVLVTMVAVVPRG-EAAIGCGTVVSYMKPCLPYV-TGSGPLGGCCGGIKGLNSAAK  68

Query  238  TQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            T  DRQ+VC+CLKSLA  VN   L +AA++P +C   IP+ IS   DCS V+
Sbjct  69   TTPDRQSVCACLKSLAGGVN---LGKAAALPGQCGVNIPYKISPSTDCSKVK  117



>sp|Q43194.1|NLTP2_SORBI RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP 
2; Flags: Precursor [Sorghum bicolor]
 emb|CAA50661.1| lipid transfer protein [Sorghum bicolor]
Length=122

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 62/94 (66%), Gaps = 1/94 (1%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLAS  288
            EA VTC  V++ +GPC SY    G GPS+ CC+G++SL SAA T  DR+  C+CLK+ A 
Sbjct  28   EAAVTCGQVSSAIGPCLSYARGQGSGPSAGCCSGVRSLNSAARTTADRRAACNCLKNAAR  87

Query  289  SVNDAQLARAASIPDKCDATIPFTISRDVDCSAV  390
             +    + +AASIP KC  +IP+TIS   DCS V
Sbjct  88   GIRGLNVGKAASIPSKCGVSIPYTISTSTDCSRV  121



>ref|XP_010252074.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=120

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 66/110 (60%), Gaps = 4/110 (4%)
 Frame = +1

Query  64   VFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQ  243
            V A ++VA   A    EA +TC  V T + PC +Y+  G    + CCNG+K+L  AA T 
Sbjct  15   VLAFMVVAAPNA----EAAITCGMVATQMTPCVNYLQNGGPVPAACCNGVKTLYGAAKTT  70

Query  244  TDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             DRQT CSC+KS A+ V   ++  AAS+P KC  TIP+ IS   DCS V+
Sbjct  71   PDRQTTCSCMKSAATQVPTIKVGNAASLPGKCGITIPYKISPTTDCSKVK  120



>ref|XP_006429571.1| hypothetical protein CICLE_v10013114mg [Citrus clementina]
 ref|XP_006481184.1| PREDICTED: non-specific lipid-transfer protein 3-like [Citrus 
sinensis]
 gb|ESR42811.1| hypothetical protein CICLE_v10013114mg [Citrus clementina]
Length=125

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 69/117 (59%), Gaps = 2/117 (2%)
 Frame = +1

Query  49   KLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLS  228
            KL      +L+    +A    +AQVTC TV  DL PC SYV  G   +++CCNG+++L +
Sbjct  9    KLVTGCILVLVCLMGSAFVSTKAQVTCRTVVNDLSPCISYVSYGGAVTTNCCNGVRTLYN  68

Query  229  AASTQTDRQTVCSCLKSLASSVN--DAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            AA +  DRQTVC+CLK   S ++    QL  AA +P KC   IP+ IS   DCS VQ
Sbjct  69   AARSTADRQTVCTCLKQAVSGISYTRYQLGLAAGLPGKCGLNIPYQISPSTDCSRVQ  125



>ref|XP_011091591.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
 ref|XP_011091594.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
 ref|XP_011091595.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
 gb|ABQ53933.1| lipid transfer protein [Sesamum indicum]
Length=118

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 62/105 (59%), Gaps = 2/105 (2%)
 Frame = +1

Query  79   LVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQT  258
            ++A A AP G EA + C TV + L PC  YV    GP   CC G+K L  AA T  DRQ+
Sbjct  16   VLAMAVAPRG-EAAIGCGTVVSYLNPCLPYV-TNKGPLGSCCGGVKGLYGAAQTAQDRQS  73

Query  259  VCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            VCSCLKSLA S  D  L +AA +P +C   IP+ IS   DCS V 
Sbjct  74   VCSCLKSLAGSYKDVDLNKAAGLPGQCGVNIPYKISPSTDCSKVN  118



>ref|XP_004245407.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=117

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 68/107 (64%), Gaps = 1/107 (1%)
 Frame = +1

Query  73   LLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIG-IGPSSDCCNGLKSLLSAASTQTD  249
            LLL+  A A    +A VTC+TV TDL PC  +VL G +   S CC GLKSLL AA T  D
Sbjct  10   LLLICVAVAATATDAAVTCNTVYTDLEPCLGFVLNGGLTVPSACCGGLKSLLVAAGTTAD  69

Query  250  RQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAV  390
            RQ+ C C+KSLASS N  Q+ RA  +P  C   +P+ IS +VDCS +
Sbjct  70   RQSACKCIKSLASSANGVQIGRATQLPRICKVNVPYQISPNVDCSKI  116



>ref|XP_009618455.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
 gb|AHB86570.1| non-specific lipid-transfer protein LTP1.1 [Nicotiana tabacum]
Length=129

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 58/94 (62%), Gaps = 0/94 (0%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASS  291
            +  VTCDTV   L  C  YV+ G    S+CCNGLKSLL  A T  D Q+ C CLKS+ S 
Sbjct  36   DETVTCDTVINSLRSCLGYVIGGGIVPSECCNGLKSLLIVARTTADHQSACKCLKSIDSG  95

Query  292  VNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            V   + +R ASIP  C A +PF IS DVDCS ++
Sbjct  96   VTREEFSRVASIPRICKAKVPFKISPDVDCSKIK  129



>gb|AAB70541.1| lipid transfer protein LPT IV [Oryza sativa Indica Group]
Length=116

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 59/90 (66%), Gaps = 0/90 (0%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            +TC  VN+ +GPC +Y   G GPS+ CC+G++SL +AAS   DR+T C+CLK+ A  +  
Sbjct  26   ITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASNTADRRTACNCLKNAARGIKG  85

Query  301  AQLARAASIPDKCDATIPFTISRDVDCSAV  390
                 AASIP KC  ++P+TIS  + CS V
Sbjct  86   LNAGNAASIPSKCGVSVPYTISASIHCSRV  115



>ref|XP_011091603.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
Length=118

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 69/120 (58%), Gaps = 2/120 (2%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            M  S KL  TV    ++  A  P G EA + C  V + L  C  YV    GP   CC G+
Sbjct  1    MTASIKLTSTVLVAAMLVFAIVP-GTEATIGCGAVLSTLSSCLPYV-TDQGPLGACCGGV  58

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            KSL  AA T TD+Q+VC CL+SLA SV +  LA+AA +P +C   IP+ IS  VDCS V+
Sbjct  59   KSLYVAAKTTTDKQSVCGCLESLAGSVPNVDLAKAAGLPGQCGVNIPYKISPSVDCSKVK  118



>gb|AGH32497.1| non-specific lipid transfer protein [Papaver somniferum]
Length=116

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 67/120 (56%), Gaps = 4/120 (3%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            MA   KL   V A ++   A APY  E  ++C  V + + PC  Y+  G  P++ CC G+
Sbjct  1    MAAMLKLACVVLACMV---AVAPYAAEGAISCGMVTSKMAPCLGYLTGGTLPAT-CCAGV  56

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            KSLL++A T  DRQ  CSCLKS +  +       AAS+P KC   IP+ IS   DC+ VQ
Sbjct  57   KSLLASAQTTPDRQAACSCLKSASGGIAGLNYGNAASLPSKCGVNIPYKISPSTDCTKVQ  116



>ref|XP_007134705.1| hypothetical protein PHAVU_010G069500g [Phaseolus vulgaris]
 gb|ESW06699.1| hypothetical protein PHAVU_010G069500g [Phaseolus vulgaris]
Length=125

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 69/110 (63%), Gaps = 5/110 (5%)
 Frame = +1

Query  79   LVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIG-IGPSSDCCNGLKSLLSAASTQTDRQ  255
            LV GAT     +AQ+TC  V  +L PC SYV+ G +   + CCNG+K+L   A T+TDRQ
Sbjct  16   LVLGATTSPKAQAQMTCGQVVNNLSPCISYVMYGGVNVPAQCCNGIKNLYGQAQTKTDRQ  75

Query  256  TVCSCLKSLAS----SVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             +CSC+K+  S    + + + L  AA++P KC   IP+ IS + DC++VQ
Sbjct  76   AICSCIKNAVSNSGFNYSRSNLNNAANLPKKCGVNIPYQISPNTDCNSVQ  125



>gb|AAN75627.1| lipid transfer protein 1 precursor [Triticum aestivum]
 emb|CAH69187.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
Length=116

 Score = 92.0 bits (227),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 71/115 (62%), Gaps = 2/115 (2%)
 Frame = +1

Query  46   AKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLL  225
            A++ L   AL+L+  A     V   + C  V++ + PC SYV  G GPS  CC+G+K+L 
Sbjct  4    AQVMLMAVALVLMLAAVPRAAVA--IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLH  61

Query  226  SAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAV  390
            + A +Q+DRQ+ C+CLK +A  +++     A SIP KC   +P+TIS ++DCS V
Sbjct  62   NQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV  116



>ref|XP_006367725.1| PREDICTED: non-specific lipid-transfer protein 4-like [Solanum 
tuberosum]
Length=123

 Score = 92.0 bits (227),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 78/124 (63%), Gaps = 5/124 (4%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSS---DCC  204
            MA S     + F  LL     +P   EA ++C+TV + L PC SY++ G   S+    CC
Sbjct  1    MAFSQMQKNSAFCFLLCIVIISPQA-EAAISCNTVYSKLMPCLSYLMGGSNKSAAPAGCC  59

Query  205  NGLKSLLSAASTQTDRQTVCSCLKSLASSV-NDAQLARAASIPDKCDATIPFTISRDVDC  381
            +G++SL +AAST TDRQ VCSCLKS A+S+ N    ++AA++  KC  T+P+ IS D+DC
Sbjct  60   SGIQSLYTAASTTTDRQGVCSCLKSGAASLGNSIDTSKAATLLSKCGVTVPYKISPDIDC  119

Query  382  SAVQ  393
            S VQ
Sbjct  120  SKVQ  123



>sp|P24296.2|NLTP1_WHEAT RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Full=Phospholipid transfer protein; Short=PLTP; AltName: 
Full=ns-LTP1; Flags: Precursor, partial [Triticum aestivum]
 pir||S22528 lipid transfer protein precursor - durum wheat (fragment)
 emb|CAA45210.1| lipid transfer protein [Triticum turgidum subsp. durum]
Length=113

 Score = 91.7 bits (226),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 71/115 (62%), Gaps = 2/115 (2%)
 Frame = +1

Query  46   AKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLL  225
            A++ L   AL+L+  A     V   + C  V++ + PC SYV  G GPS  CC+G+K+L 
Sbjct  1    AQVMLMAVALVLMLAAVPRAAVA--IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLH  58

Query  226  SAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAV  390
            + A +Q+DRQ+ C+CLK +A  +++     A SIP KC   +P+TIS ++DCS V
Sbjct  59   NQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV  113



>gb|EYU41041.1| hypothetical protein MIMGU_mgv1a016543mg [Erythranthe guttata]
Length=117

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 67/112 (60%), Gaps = 5/112 (4%)
 Frame = +1

Query  58   LTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAAS  237
            L + A+L+   A  P G EA + C TV + + PC  YV  G GP   CC G+K L SAA 
Sbjct  11   LFIAAVLVTMVAVVPLG-EAAIGCGTVVSYIKPCLPYV-TGSGPLGGCCGGIKGLNSAAK  68

Query  238  TQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            T  DRQ+ CSCLKSLA  VN   L +AA++P +C   IP+ IS   DCS V+
Sbjct  69   TTPDRQSACSCLKSLAGGVN---LGKAAALPGQCGVNIPYKISPSTDCSKVK  117



>gb|AAB70538.1| lipid transfer protein [Oryza sativa Indica Group]
Length=115

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 63/91 (69%), Gaps = 0/91 (0%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            ++C  VN+ + PC SY   G GPS+ CC+G+++L SAA+T  DR+T C+CLK++A S++ 
Sbjct  25   ISCGQVNSAVSPCLSYARGGSGPSAACCSGVRNLNSAATTTADRRTACNCLKNVAGSISG  84

Query  301  AQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
                 AASIP KC  +IP+TIS  V CS+V 
Sbjct  85   LNAGNAASIPSKCGVSIPYTISPSVYCSSVN  115



>gb|EYU42013.1| hypothetical protein MIMGU_mgv1a016621mg [Erythranthe guttata]
Length=114

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 64/99 (65%), Gaps = 1/99 (1%)
 Frame = +1

Query  100  PYGVEAQVTCDTVNTDLGPCGSYVLIG-IGPSSDCCNGLKSLLSAASTQTDRQTVCSCLK  276
            P   EA ++C TV + L PC ++VL G   P + CC G+K+L + A+   DRQ VCSCLK
Sbjct  16   PPQAEAAISCGTVASTLSPCINFVLYGGPTPPTSCCEGIKTLYNEATATADRQAVCSCLK  75

Query  277  SLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            S+ASS   A ++ AA++P KC  +IP+ IS   DCS+V 
Sbjct  76   SVASSATPAIISNAAALPGKCGVSIPYKISPSTDCSSVH  114



>gb|AAL27855.1| lipid transfer protein precursor [Davidia involucrata]
Length=120

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 69/114 (61%), Gaps = 1/114 (1%)
 Frame = +1

Query  52   LYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSA  231
            + + + A+L+    +AP+  EA +TC TV   L PC +Y+  G      CCNG+KSL +A
Sbjct  8    IKVGIVAVLMCMVVSAPHA-EAAITCGTVTVSLAPCLNYLKKGGPVPPACCNGIKSLNAA  66

Query  232  ASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            A T  DRQ  C+CLK+ ++S+    L+ A+S+P KC   +P+ IS   DCS VQ
Sbjct  67   AKTTADRQAACNCLKTASTSIAGINLSYASSLPGKCGVNVPYKISPSTDCSKVQ  120



>sp|A0AT33.1|NLTP4_LENCU RecName: Full=Non-specific lipid-transfer protein 4; Short=LTP4; 
Contains: RecName: Full=Non-specific lipid-transfer protein 
8; Short=LTP8; Flags: Precursor, partial [Lens culinaris]
 gb|AAX35811.1| lipid transfer protein 4 precursor, partial [Lens culinaris subsp. 
culinaris]
Length=110

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 58/94 (62%), Gaps = 0/94 (0%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASS  291
            E  ++C  V +DL PC +Y+  G GPS  CC G+K LL+AA+T  DRQ  C+CLKS A S
Sbjct  16   EGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGS  75

Query  292  VNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            +       AA++P KC   IP+ IS   +C+ V+
Sbjct  76   ITKLNTNNAAALPGKCGVNIPYKISTSTNCNTVK  109



>ref|XP_004249048.1| PREDICTED: non-specific lipid-transfer protein 2 [Solanum lycopersicum]
Length=114

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 71/120 (59%), Gaps = 6/120 (5%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            M +S+K+   +   ++V    AP+G EA ++C  V + L PC  Y L G GP   CC G+
Sbjct  1    MEMSSKIACFIVLCMIV---VAPHG-EA-LSCGQVESGLAPCLPY-LQGKGPLGGCCRGV  54

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            K LL AA T  DR+T C+CLKS A+++    L +AA IP  C  +IP+ IS   DCS VQ
Sbjct  55   KGLLGAAKTPADRKTACTCLKSAANAIKGLNLGKAAGIPSACGVSIPYKISPFTDCSKVQ  114



>ref|XP_006662672.1| PREDICTED: non-specific lipid-transfer protein 1-like [Oryza 
brachyantha]
Length=117

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 58/91 (64%), Gaps = 0/91 (0%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            +TC  V++ + PC +Y   G GPSS CC G+KSL +AA T  DR+T C+CLK+ A  +  
Sbjct  27   ITCGQVSSAISPCLAYARGGAGPSSACCTGVKSLNAAARTTADRRTACNCLKNAARGIRG  86

Query  301  AQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
                 AASIP KC  ++P+TIS  +DCS V 
Sbjct  87   LNAGNAASIPSKCGVSVPYTISASIDCSRVS  117



>ref|XP_009757307.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=123

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 73/123 (59%), Gaps = 3/123 (2%)
 Frame = +1

Query  34   MAVSAKLY--LTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCN  207
            MA+S KL   L++  L +V  A +P   EA +TC TV   L PC SYV+ G      CC 
Sbjct  1    MAISRKLVKPLSLLLLYMVLLAESPPRAEAAITCSTVVNSLIPCLSYVMNGGKVPPTCCQ  60

Query  208  GLKSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCD-ATIPFTISRDVDCS  384
            G+KSL  AA T  DR++VCSCLK+ ASSV+      AA++P KC    IPF IS   DCS
Sbjct  61   GIKSLYGAAKTAADRRSVCSCLKTAASSVSGINFKNAAALPGKCGVKNIPFKISPKADCS  120

Query  385  AVQ  393
             V+
Sbjct  121  KVK  123



>sp|A0AT32.1|NLTP6_LENCU RecName: Full=Non-specific lipid-transfer protein 6; Short=LTP6; 
Flags: Precursor [Lens culinaris]
 gb|AAX35810.1| lipid transfer protein 6 precursor [Lens culinaris subsp. culinaris]
Length=118

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 58/94 (62%), Gaps = 0/94 (0%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASS  291
            E  ++C  V +DL PC +Y+  G GPS  CC G+K LL+AA+T  DRQ  C+CLKS A S
Sbjct  24   EGAISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGS  83

Query  292  VNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            +       AA++P KC   IP+ IS   +C+ V+
Sbjct  84   ITKLNTNNAAALPGKCGVDIPYKISTSTNCNTVK  117



>ref|XP_004245408.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=120

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 59/92 (64%), Gaps = 1/92 (1%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIG-IGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVN  297
            VTC+ V + L PC  YVL G +   S+CC G KSLLS   T  DRQ+ C C+KS  S+ N
Sbjct  29   VTCNMVYSSLEPCLGYVLGGGLSVPSECCGGSKSLLSMGCTIDDRQSACKCIKSAGSNAN  88

Query  298  DAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            +AQL+RAA++P  C   +PF IS  VDCS V 
Sbjct  89   EAQLSRAATLPRICKTNVPFKISPHVDCSKVN  120



>gb|ACQ42221.1| lipid transfer protein [Chimonanthus praecox]
Length=119

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 68/109 (62%), Gaps = 3/109 (3%)
 Frame = +1

Query  73   LLLVAGA--TAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQT  246
            +++V GA    PY VEA +TC TV + L PC +YV  G    + CC G+ +L SAA T  
Sbjct  12   VVMVTGALMVTPY-VEAALTCGTVTSALSPCITYVRNGGSVPASCCQGVAALNSAAKTTA  70

Query  247  DRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            DRQ  CSCLKS  SSV+  Q + A+S+P KC  +IP+ IS   DCS V+
Sbjct  71   DRQAACSCLKSALSSVSGIQPSLASSLPGKCGVSIPYQISPSTDCSKVK  119



>dbj|BAC77694.1| lipid transfer protein [Atriplex nummularia]
Length=117

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 68/115 (59%), Gaps = 5/115 (4%)
 Frame = +1

Query  49   KLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLS  228
            KL   VF  +LVA   AP+  EA +TC  V + + PC SY+  G  P+  CC G+KSL S
Sbjct  8    KLACAVFMCMLVA---APH-AEA-LTCGQVTSSMTPCMSYLTGGGSPTPACCGGVKSLNS  62

Query  229  AASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             AST  DR+  C CLKS A ++ +  +  AAS+P KC  ++P+ IS   DCS V 
Sbjct  63   MASTPADRKAACGCLKSAAGAMTNLNMGNAASLPGKCGISLPYPISTSTDCSKVN  117



>gb|AAK01293.1|AF331710_1 lipid transfer protein [Avicennia marina]
Length=117

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 59/98 (60%), Gaps = 3/98 (3%)
 Frame = +1

Query  100  PYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKS  279
            P+G EA ++C TV + L PC  YV    GP   CC G+KSL   A T  DRQ+VC CLKS
Sbjct  23   PHG-EAAISCGTVASKLAPCIPYV-TNRGPLGGCCGGVKSLYGLARTTPDRQSVCGCLKS  80

Query  280  LASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            LASS N   L +AA +P +C   IP+ IS   DCS V 
Sbjct  81   LASSYN-VNLGKAAGLPGQCGVNIPYKISPSTDCSKVH  117



>ref|XP_011091596.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
Length=118

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASS  291
            EA + C TV + L PC  YV    GP   CC G+K L  AA T  DRQ+VCSCLKSLASS
Sbjct  26   EAAIGCGTVVSYLNPCLPYV-TNKGPLGSCCGGVKGLYGAAQTTQDRQSVCSCLKSLASS  84

Query  292  VNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
              D  L +AA +P +C   IP+ IS   DCS V 
Sbjct  85   YKDVDLNKAAGLPGQCGVNIPYKISPSTDCSKVN  118



>ref|XP_010683516.1| PREDICTED: non-specific lipid-transfer protein [Beta vulgaris 
subsp. vulgaris]
Length=117

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 73/120 (61%), Gaps = 3/120 (3%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            MA SA +  T  AL++     AP  +   +TC  V + L PC  Y+    GPS+ CC G+
Sbjct  1    MASSAFVKFTC-ALVMCMMVAAP--LAEAITCGLVASKLAPCIGYLQGAPGPSAGCCGGI  57

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            KSL SAA++  DR+T C+CLKS A+S+      +AAS+P +C  ++P+ IS + +C+A+ 
Sbjct  58   KSLNSAAASPADRKTACTCLKSAATSIKGINYGKAASLPRQCGVSVPYAISPNTNCNAIH  117



>ref|XP_009761744.1| PREDICTED: non-specific lipid-transfer protein 1 [Nicotiana sylvestris]
Length=114

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 71/120 (59%), Gaps = 6/120 (5%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            M ++ K+   V   +LVA   AP+  EA +TC  V ++L PC  Y L   GP   CC+G+
Sbjct  1    MEMAGKIACFVVLCMLVA---APH-AEA-LTCGQVTSNLAPCLPY-LRNKGPLGRCCSGV  54

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            K LL+AA T  DRQT C+CLKS A +++   L +AA +P  C   IP+ IS   DCS VQ
Sbjct  55   KGLLNAARTTQDRQTACTCLKSAAGAISGINLRKAAGLPSTCGVNIPYNISPSTDCSKVQ  114



>ref|XP_004245221.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=123

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 78/124 (63%), Gaps = 5/124 (4%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSS---DCC  204
            M  S    ++ F  LL     +P   EA ++C+TV + L PC SY++ G   ++    CC
Sbjct  1    MTFSKMQKISAFCFLLCIVIISPQ-TEAAISCNTVYSKLMPCLSYLMGGSNRAAAPAGCC  59

Query  205  NGLKSLLSAASTQTDRQTVCSCLKSLASSV-NDAQLARAASIPDKCDATIPFTISRDVDC  381
            +G++SL +AAST TDRQ VCSCLKS A+S+ N    ++AA++  KC  T+P+ IS ++DC
Sbjct  60   SGIQSLYTAASTTTDRQGVCSCLKSGAASLGNSIDTSKAATLLSKCGVTVPYKISPNIDC  119

Query  382  SAVQ  393
            S VQ
Sbjct  120  SQVQ  123



>gb|ACZ06858.1| lipid transfer protein [Glycine soja]
Length=122

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = +1

Query  109  VEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLAS  288
             +A +TC  V  D+ PC SY+  G  PS  CCNG+KSL SAA T  DRQ  CSCLK+LA+
Sbjct  26   AQAAITCGQVAGDMSPCFSYLRSGGKPSQACCNGVKSLSSAAKTTADRQGACSCLKNLAN  85

Query  289  SVNDA-QLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            ++  +     AAS+P KC  +IP+ IS   +C+ ++
Sbjct  86   NMGQSLNAGNAASLPGKCGVSIPYKISTSTNCATIK  121



>ref|XP_009778826.1| PREDICTED: uncharacterized protein LOC104228120 [Nicotiana sylvestris]
Length=226

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASS  291
            EA ++ DTV + L PC  YVL G     +CC+GLKSL+S A T+ DRQ+ CSC K  ASS
Sbjct  50   EALLSSDTVYSSLQPCIGYVLGGGTLPPECCSGLKSLISIAKTRPDRQSFCSCAKGAASS  109

Query  292  VNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ*LF--HRIAHPQ  423
                +LARA  +  +C A +PF IS D+DCS  Q L      +HP+
Sbjct  110  TTPEELARANGLAGRCHARVPFKISPDMDCSKAQQLTIAQMQSHPK  155



>ref|XP_004245220.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=122

 Score = 89.4 bits (220),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 71/123 (58%), Gaps = 4/123 (3%)
 Frame = +1

Query  34   MAVSAKLY--LTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCN  207
            MA+S  L   L++  L+ +  A +P  V+A +TC +V   L PC SYV+ G      CC 
Sbjct  1    MAISKDLVKPLSLLFLIYIVIAASPR-VDAAITCSSVFNGLIPCLSYVVKGGKVPPTCCR  59

Query  208  GLKSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDA-TIPFTISRDVDCS  384
            G+KSL S A T  D Q VCSCLK  ASSV+      AA++P KC    IPF IS  VDCS
Sbjct  60   GIKSLYSIAKTTADHQGVCSCLKMAASSVSGIDFKNAAALPGKCGVKNIPFKISPKVDCS  119

Query  385  AVQ  393
             V+
Sbjct  120  KVR  122



>sp|Q43748.1|NLTP_BETVU RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
Flags: Precursor [Beta vulgaris]
 emb|CAA63407.1| IWF1' [Beta vulgaris subsp. vulgaris]
Length=117

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 73/120 (61%), Gaps = 3/120 (3%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            MA SA +  T  AL++     AP  +   +TC  V + L PC  Y+    GPS+ CC G+
Sbjct  1    MASSAFVKFTC-ALVMCMMVAAP--LAEAITCGLVASKLAPCIGYLQGAPGPSAACCGGI  57

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            KSL SAA++  DR+T C+CLKS A+S+      +AAS+P +C  ++P+ IS + +C+A+ 
Sbjct  58   KSLNSAAASPADRKTACTCLKSAATSIKGINYGKAASLPRQCGVSVPYAISPNTNCNAIH  117



>ref|NP_001240073.1| uncharacterized protein LOC100815185 precursor [Glycine max]
 gb|ACU20651.1| unknown [Glycine max]
Length=122

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 60/96 (63%), Gaps = 1/96 (1%)
 Frame = +1

Query  109  VEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLAS  288
             +A +TC  V  D+ PC SY+  G  PS  CCNG+KSL SAA T  DRQ  CSCLK+LA+
Sbjct  26   AQAAITCGQVAGDMSPCFSYLRSGGKPSQACCNGVKSLSSAAKTTADRQGACSCLKNLAN  85

Query  289  SVNDA-QLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            ++  +     AAS+P KC   IP+ IS   +C+ ++
Sbjct  86   NMGQSLNAGNAASLPGKCGVNIPYKISTSTNCATIK  121



>pdb|2MAL|A Chain A, Solution Structure Of Lipid Transfer Protein From Lentil 
Lens Culinaris
Length=93

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 57/91 (63%), Gaps = 0/91 (0%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            ++C  V +DL PC +Y+  G GPS  CC G+K LL+AA+T  DRQ  C+CLKS A S+  
Sbjct  2    ISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITK  61

Query  301  AQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
                 AA++P KC   IP+ IS   +C+ V+
Sbjct  62   LNTNNAAALPGKCGVNIPYKISTTTNCNTVK  92



>dbj|BAI94496.1| lipid transfer protein [Dianthus caryophyllus]
Length=119

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 69/120 (58%), Gaps = 1/120 (1%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            MA S+ +     A++L    TAPY   A +TC  V+ +LGPC +Y+    GPS+ CC G+
Sbjct  1    MASSSAMKKVACAVILCIVMTAPY-ATAAMTCGQVSGNLGPCITYLKGAPGPSALCCAGI  59

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            K L   A T  DR+T C CLKS A++++      A+ +P KC  +IP+ IS   DCS V 
Sbjct  60   KRLNGMAQTPPDRKTACGCLKSAAAAISGLNYGLASGLPGKCGVSIPYPISPSTDCSKVN  119



>emb|CAH69197.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
 gb|EMT00342.1| Non-specific lipid-transfer protein 2 [Aegilops tauschii]
Length=121

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 70/112 (63%), Gaps = 2/112 (2%)
 Frame = +1

Query  64   VFALLLVAGATAPYG-VEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAAST  240
            V A++L A   AP   V A ++C TV + L PC  YV  G  P+  CC G+++LL+ A+ 
Sbjct  10   VLAMVLAAMVVAPPATVHAAISCSTVYSTLMPCLQYVQQGGSPARGCCTGIQNLLAEANN  69

Query  241  QTDRQTVCSCLKSLASSVNDAQ-LARAASIPDKCDATIPFTISRDVDCSAVQ  393
              DR+T+C CLK++A+  +    + RAA++P KC+  +P+ IS  VDC+++ 
Sbjct  70   SPDRRTICGCLKNVANGASGGPYITRAAALPSKCNVALPYKISPSVDCNSIH  121



>ref|XP_003579022.1| PREDICTED: non-specific lipid-transfer protein 1-like [Brachypodium 
distachyon]
Length=116

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 61/91 (67%), Gaps = 1/91 (1%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVN  297
            +TC  VN+ +GPC +YV   G GPS  CC+G++SL S A +  D++T C+CLK+ A  V 
Sbjct  26   LTCGQVNSAVGPCIAYVRGTGAGPSGACCSGVRSLNSQARSTADKRTACNCLKTAARGVK  85

Query  298  DAQLARAASIPDKCDATIPFTISRDVDCSAV  390
               + +A+SIP KC   IP+TIS ++DCS V
Sbjct  86   GLDVGKASSIPSKCGVNIPYTISPNIDCSRV  116



>emb|CAH04985.1| type 1 non-specific lipid transfer protein precursor [Triticum 
aestivum]
Length=120

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 68/111 (61%), Gaps = 1/111 (1%)
 Frame = +1

Query  64   VFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQ  243
            V A++L A   AP      ++C TV + L PC  YV  G  P+  CC G+++LL+ A+  
Sbjct  10   VLAMVLAAMLVAPPATVHAISCSTVYSTLMPCPQYVQQGGSPARGCCTGIQNLLAEANNS  69

Query  244  TDRQTVCSCLKSLASSVNDAQ-LARAASIPDKCDATIPFTISRDVDCSAVQ  393
             DR+T+C CLK++A+  +    + RAA++P KC+  +P+ IS  VDC+++ 
Sbjct  70   PDRRTICGCLKNVANGASGGPYITRAAALPSKCNVALPYKISPSVDCNSIH  120



>dbj|BAI94498.1| lipid transfer protein [Dianthus caryophyllus]
Length=118

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 62/95 (65%), Gaps = 1/95 (1%)
 Frame = +1

Query  109  VEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLAS  288
            VEA VTC  V ++LG C  Y+  G GPS  CC G+K+L   A T  DRQT C+CLKS ++
Sbjct  25   VEA-VTCGQVASNLGSCIPYLKGGPGPSGQCCGGIKTLNGLAKTTPDRQTACNCLKSESA  83

Query  289  SVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            S++    A A+ +P KC  ++P+TIS  VDCS V+
Sbjct  84   SISGINYALASGLPSKCGVSVPYTISPSVDCSKVR  118



>dbj|BAP11219.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
 dbj|BAP11225.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
Length=108

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 61/108 (56%), Gaps = 2/108 (2%)
 Frame = +1

Query  76   LLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQ  255
            LL   A A  G  AQVTC  V  DL PC SYV  G     +CCNG+++L +AA T  DRQ
Sbjct  1    LLCLMANAFMGTRAQVTCSVVVNDLSPCISYVSAGGAVPVNCCNGVRTLNNAAQTTADRQ  60

Query  256  TVCSCLKSLASSVN--DAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             VC CLK   + ++     L  AA +PDKC  +IP+ IS   DC  VQ
Sbjct  61   NVCKCLKQAVNGISYTGYNLRLAAGLPDKCGISIPYKISPSTDCDKVQ  108



>sp|Q3YMR2.1|NLTP2_SOLCI RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP 
2; Flags: Precursor [Solanum chilense]
 gb|AAZ22829.1| lipid transfer protein [Solanum chilense]
Length=114

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 62/107 (58%), Gaps = 3/107 (3%)
 Frame = +1

Query  73   LLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDR  252
            +LL     AP+  EA +TC  V + L PC  Y L+  GP   CC G+K LL  A T  DR
Sbjct  11   VLLCMVVVAPHA-EA-LTCGQVTSTLAPCLPY-LMNRGPLGGCCGGVKGLLGQAQTTVDR  67

Query  253  QTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            Q  C+CLKS ASS  D  L +AAS+P  C+  IP+ IS   DCS VQ
Sbjct  68   QAACACLKSAASSFTDLDLGKAASLPSTCNVNIPYKISPSTDCSKVQ  114



>emb|CAH69196.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
Length=120

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 68/111 (61%), Gaps = 1/111 (1%)
 Frame = +1

Query  64   VFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQ  243
            V A++L A   AP      ++C TV + L PC  YV  G  P+  CC G+++LL+ A+  
Sbjct  10   VLAMVLAAMVVAPPATVHAISCSTVYSTLMPCLQYVQQGGSPARGCCTGIQNLLAEANNS  69

Query  244  TDRQTVCSCLKSLASSVNDAQ-LARAASIPDKCDATIPFTISRDVDCSAVQ  393
             DR+T+C CLK++A+  +    + RAA++P KC+  +P+ IS  VDC+++ 
Sbjct  70   PDRRTICGCLKNVANGASGGPYITRAAALPSKCNVALPYKISPSVDCNSIH  120



>ref|XP_011091597.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
Length=118

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 55/94 (59%), Gaps = 1/94 (1%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASS  291
            EA + C TV + L PC  YV    GP   CC G+K L  AA T  DRQ+VCSCLKSLA S
Sbjct  26   EAAIGCGTVVSYLNPCLPYV-TNKGPLGSCCGGVKGLYGAAQTAQDRQSVCSCLKSLAGS  84

Query  292  VNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
              D  L +AA +P +C   IP+ IS   DCS V 
Sbjct  85   YKDVDLNKAAGLPGQCGVNIPYKISPSTDCSKVN  118



>dbj|BAP11220.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
Length=108

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 61/108 (56%), Gaps = 2/108 (2%)
 Frame = +1

Query  76   LLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQ  255
            LL   A A  G  AQVTC  V  DL PC SYV  G     +CCNG+++L +AA T  DRQ
Sbjct  1    LLCLMANAFMGTRAQVTCGVVVNDLSPCISYVSAGGAVPVNCCNGVRTLNNAAQTTADRQ  60

Query  256  TVCSCLKSLASSVN--DAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             VC CLK   + ++     L  AA +PDKC  +IP+ IS   DC  VQ
Sbjct  61   NVCKCLKQAVNGISYTGYNLRLAAGLPDKCGISIPYKISPSTDCDKVQ  108



>gb|ADK36632.1| lipid transfer-like protein [Solanum lycopersicum var. cerasiforme]
Length=94

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 55/91 (60%), Gaps = 1/91 (1%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            +TC  V + L PC  Y L G GP   CC G+K LL AA T  DR+T C+CLKS A+++  
Sbjct  2    LTCGQVESGLAPCLPY-LQGKGPLGGCCRGVKGLLGAAETPADRKTACTCLKSAANAIKG  60

Query  301  AQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
              L +AA IP  C  +IP+ IS   DCS VQ
Sbjct  61   LNLGKAAGIPSACGVSIPYKISPFTDCSKVQ  91



>gb|ABY21307.1| pollen allergen Pla o 3 [Platanus orientalis]
Length=118

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 71/116 (61%), Gaps = 4/116 (3%)
 Frame = +1

Query  46   AKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLL  225
            AKL   + A ++   ATAP+  EA +TC TV T L PC +Y+  G   +  CCNG+K+L 
Sbjct  7    AKLACLLLACMV---ATAPH-AEAAITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALN  62

Query  226  SAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            + A T  DRQ  C CLK+ ++S++  QL  AAS+  KC   +P+ IS  +DCS V+
Sbjct  63   NDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK  118



>gb|ADV02773.1| lipid transfer protein 1b, partial [Ipomoea batatas]
Length=93

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 59/91 (65%), Gaps = 0/91 (0%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            ++C TV TDL PC  YV  G     DCC G++SL ++A+T  DRQTVC+C+K+ ASSV  
Sbjct  3    MSCSTVVTDLYPCLDYVENGGAVPMDCCEGIRSLYTSAATTADRQTVCNCMKNAASSVTG  62

Query  301  AQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
              L  AA +P KC  +IP+ IS  VDC+ V 
Sbjct  63   LNLDLAAGLPQKCGVSIPYQISPSVDCATVH  93



>dbj|BAI94497.1| lipid transfer protein [Dianthus caryophyllus]
Length=119

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 67/120 (56%), Gaps = 1/120 (1%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            MA S+ +     A++L    TAPY  EA +TC  V+  L  C SY+    GPS  CC G+
Sbjct  1    MASSSAMRKVACAMILCIVMTAPYATEA-LTCGQVSGSLASCISYLKGAPGPSGACCGGI  59

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            K L   A T  DR+T C CLKS A++++      A ++P KC  +IP+ IS + DCS V 
Sbjct  60   KRLNGMAQTPPDRKTACGCLKSAAAAISGINYGLANALPGKCGVSIPYPISPNTDCSRVH  119



>gb|ABH03042.1| non-specific lipid transfer protein [Solanum sogarandinum]
Length=114

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 61/107 (57%), Gaps = 3/107 (3%)
 Frame = +1

Query  73   LLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDR  252
            +LL     AP+  EA +TC  V + L PC  Y L+  GP   CC G+KSLL  A T  DR
Sbjct  11   VLLCMVVVAPH-AEA-LTCGQVTSSLAPCFPY-LMNRGPLGGCCGGVKSLLGQAQTTADR  67

Query  253  QTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            QT C+CLKS ASS     L +AA +P  C   IP+ IS   DCS VQ
Sbjct  68   QTACTCLKSAASSFTGLDLGKAAGLPSACSVNIPYKISPSTDCSKVQ  114



>emb|CAH69198.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
 emb|CAH69211.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
 gb|ABE99813.1| lipid transfer protein [Triticum aestivum]
Length=120

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 68/111 (61%), Gaps = 1/111 (1%)
 Frame = +1

Query  64   VFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQ  243
            V A++L A   AP      ++C TV + L PC  YV  G  P+  CC G+++LL+ A+  
Sbjct  10   VLAMVLAAMLVAPPATVHAISCSTVYSTLMPCLQYVQQGGSPARGCCTGIQNLLAEANNS  69

Query  244  TDRQTVCSCLKSLASSVNDAQ-LARAASIPDKCDATIPFTISRDVDCSAVQ  393
             DR+T+C CLK++A+  +    + RAA++P KC+  +P+ IS  VDC+++ 
Sbjct  70   PDRRTICGCLKNVANGASGGPYITRAAALPSKCNVALPYKISPSVDCNSIH  120



>dbj|BAP11226.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
Length=108

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 61/108 (56%), Gaps = 2/108 (2%)
 Frame = +1

Query  76   LLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQ  255
            LL   A A  G  AQVTC  V  DL PC SYV  G     +CCNG+++L +AA T  DRQ
Sbjct  1    LLCLMANAFMGTRAQVTCSVVVNDLSPCISYVSGGGAVPVNCCNGVRTLNNAAQTTADRQ  60

Query  256  TVCSCLKSLASSVN--DAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             VC CLK   + ++     L  AA +PDKC  +IP+ IS   DC  VQ
Sbjct  61   NVCKCLKQAVNGISYTGYNLRLAAGLPDKCGISIPYKISPSTDCDKVQ  108



>pdb|1BWO|A Chain A, The Crystal Structure Of Wheat Non-Specific Transfer 
Protein Complexed With Two Molecules Of Phospholipid At 2.1 
A Resolution
 pdb|1BWO|B Chain B, The Crystal Structure Of Wheat Non-Specific Transfer 
Protein Complexed With Two Molecules Of Phospholipid At 2.1 
A Resolution
 pdb|1GH1|A Chain A, Nmr Structures Of Wheat Nonspecific Lipid Transfer Protein
 gb|AAB22334.1| non-specific phospholipid transfer protein, nsPLTP [Tricum aestivum=wheat, 
var. Camp Remy, seeds, Peptide, 90 aa]
 prf||1814270A phospholipid transfer protein
Length=90

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 60/90 (67%), Gaps = 0/90 (0%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            + C  V++ + PC SYV  G GPS  CC+G+K+L + A +Q+DRQ+ C+CLK +A  +++
Sbjct  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN  60

Query  301  AQLARAASIPDKCDATIPFTISRDVDCSAV  390
                 A SIP KC   +P+TIS ++DCS V
Sbjct  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV  90



>gb|AAF23460.1|AF208834_1 non-specific lipid transfer protein precursor [Capsicum annuum]
Length=114

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 55/91 (60%), Gaps = 1/91 (1%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            +TC  V + + PC  Y L G GP   CC G+K LL AA T  DR+TVCSCLKS A S+  
Sbjct  25   LTCGQVQSRMTPCLPY-LTGSGPLGRCCGGVKGLLGAAKTPADRKTVCSCLKSAAGSIGG  83

Query  301  AQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
              + +AA +P+ C   IP+ IS   DC+ VQ
Sbjct  84   INVRKAAGLPNMCGVNIPYQISPSTDCTKVQ  114



>sp|Q43871.1|NLTP8_HORVU RecName: Full=Non-specific lipid-transfer protein Cw18; Short=LTP 
Cw-18; AltName: Full=PKG2316; Flags: Precursor [Hordeum 
vulgare]
 emb|CAA48622.1| Cw-18 peptide,non specific lipid transfer protein [Hordeum vulgare 
subsp. vulgare]
 emb|CAA85483.1| lipid transfer protein precursor [Hordeum vulgare subsp. vulgare]
 dbj|BAK01310.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=115

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 66/115 (57%), Gaps = 11/115 (10%)
 Frame = +1

Query  52   LYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLS  228
            L   V A+LLVA        +A +TC  V++ LGPC +Y    G  PS+ CC+G+K L  
Sbjct  11   LVALVAAMLLVA-------ADAAITCGQVSSALGPCAAYAKGSGTSPSAGCCSGVKRLAG  63

Query  229  AASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             A +  D+Q  C CLKS+A + N     RAA IP +C  ++P+TIS  VDCS + 
Sbjct  64   LARSTADKQATCRCLKSVAGAYNA---GRAAGIPSRCGVSVPYTISASVDCSKIH  115



>ref|XP_010922736.1| PREDICTED: non-specific lipid-transfer protein 1-like [Elaeis 
guineensis]
Length=120

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 69/110 (63%), Gaps = 4/110 (4%)
 Frame = +1

Query  64   VFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQ  243
            V A++L+A   +P G +A +TC  V  DL PC  Y+  G   +  CC+G++SLL+AA T 
Sbjct  15   VLAMVLLA---SPRGTKA-ITCPQVYGDLNPCIQYLRSGGAVAPQCCSGVRSLLAAARTV  70

Query  244  TDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            TDR+T C C+K+ A+ ++   + RA ++P KC  +IP+ IS   DCS + 
Sbjct  71   TDRRTACRCIKTAAAGLSGLDIGRARALPGKCGVSIPYKISASTDCSKIN  120



>dbj|BAP11221.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
 dbj|BAP11224.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
Length=108

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 61/108 (56%), Gaps = 2/108 (2%)
 Frame = +1

Query  76   LLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQ  255
            LL   A A  G  AQVTC  V  DL PC SYV  G     +CCNG+++L +AA T  DRQ
Sbjct  1    LLCLMANAFMGTRAQVTCSVVVNDLSPCISYVSAGGAVPVNCCNGVRTLNNAAQTTADRQ  60

Query  256  TVCSCLKSLASSVN--DAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             VC CLK   + ++     L  AA +P+KC  +IP+ IS   DC  VQ
Sbjct  61   NVCKCLKQAVNGISYTGYNLRLAAGLPEKCGISIPYKISPSTDCDKVQ  108



>gb|ABP01769.1| lipid transfer protein 2 [Salvia miltiorrhiza]
Length=114

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 56/94 (60%), Gaps = 1/94 (1%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASS  291
            EA + C  V + L PC  YV    GP   CC G+K L  AA T  DRQ+VC+CLK+LASS
Sbjct  22   EAAIGCGAVVSYLNPCLPYV-TNKGPLGGCCGGIKGLYGAAKTTPDRQSVCNCLKTLASS  80

Query  292  VNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
                 L +AA +P +C  +IP+ IS   DCS V+
Sbjct  81   YKGVNLGKAAGLPGQCGVSIPYKISPSTDCSKVK  114



>sp|O24038.1|NLTP2_SOLPN RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP 
2; AltName: Full=LpLTP2; Flags: Precursor [Solanum pennellii]
 gb|AAB07487.1| lipid transfer protein 2 [Solanum pennellii]
Length=114

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 61/107 (57%), Gaps = 3/107 (3%)
 Frame = +1

Query  73   LLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDR  252
            +LL     AP+  EA +TC  V + L PC  Y L+  GP   CC G+K LL  A T  DR
Sbjct  11   VLLCMVVVAPHA-EA-LTCGQVTSTLAPCLPY-LMNRGPLGGCCGGVKGLLGQAQTTVDR  67

Query  253  QTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            QT C+CLKS ASS     L +AAS+P  C   IP+ IS   DCS VQ
Sbjct  68   QTACTCLKSAASSFTGLDLGKAASLPSTCSVNIPYKISPSTDCSKVQ  114



>dbj|BAP11218.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
 dbj|BAP11222.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
 dbj|BAP11223.1| hypothetical protein, partial [Zanthoxylum ailanthoides]
Length=108

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 61/108 (56%), Gaps = 2/108 (2%)
 Frame = +1

Query  76   LLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQ  255
            LL   A A  G  AQVTC  V  DL PC SYV  G     +CCNG+++L +AA T  DRQ
Sbjct  1    LLCLMANAFMGTRAQVTCGVVVNDLSPCISYVSAGGAVPVNCCNGVRTLNNAAQTTADRQ  60

Query  256  TVCSCLKSLASSVN--DAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             VC CLK   + ++     L  AA +P+KC  +IP+ IS   DC  VQ
Sbjct  61   NVCKCLKQAVNGISYTGYNLRLAAGLPEKCGISIPYKISPSTDCDKVQ  108



>gb|ABA33867.1| phospholipid transfer protein 1 [Zea diploperennis]
Length=118

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLAS  288
            EA ++C  V + + PC SY    G GPS+ CC+G++SL +AA T  DR+  CSCLK+ A+
Sbjct  24   EAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACSCLKNAAA  83

Query  289  SVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             V+      AASIP KC  +IP+TIS   DCS V 
Sbjct  84   GVSGLNAGNAASIPSKCSVSIPYTISTSTDCSRVN  118



>ref|XP_003564507.1| PREDICTED: non-specific lipid-transfer protein 2B-like [Brachypodium 
distachyon]
Length=121

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 70/112 (63%), Gaps = 2/112 (2%)
 Frame = +1

Query  64   VFALLLVAGATAPYG-VEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAAST  240
            V A++L A   AP   V A ++C  V + L PC  +V  G  PS  CC+G++SLL+ A+ 
Sbjct  10   VLAMVLAATVLAPPAMVRAAISCSAVYSTLMPCLQFVQGGGAPSRGCCSGIQSLLAEANN  69

Query  241  QTDRQTVCSCLKSLASSVNDAQ-LARAASIPDKCDATIPFTISRDVDCSAVQ  393
              DR+T+C CLK++A+  +    + RAA++P KC+  +P+ IS DV+C ++ 
Sbjct  70   TPDRRTICGCLKNVANGASGGPYITRAAALPSKCNVALPYKISPDVNCDSIH  121



>gb|KEH29195.1| Lipid transfer protein, partial [Medicago truncatula]
Length=173

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 63/107 (59%), Gaps = 1/107 (1%)
 Frame = +1

Query  73   LLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDR  252
            LL++    AP   EA +TC TV   L PC  Y+  G GPS+ CC G+K L SAA+T  DR
Sbjct  67   LLMMCIIVAPM-AEAAITCGTVTGSLAPCIGYLKGGSGPSAACCGGVKRLNSAATTTPDR  125

Query  253  QTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            Q  C+CLKS A +++      AA +P KC   IP+ IS   +C+ ++
Sbjct  126  QAACNCLKSAAGAISGLNPNIAAGLPGKCGVNIPYKISTSTNCATIR  172



>ref|NP_001234735.1| non-specific lipid transfer protein precursor [Solanum lycopersicum]
 emb|CAJ19705.1| non-specific lipid transfer protein [Solanum lycopersicum]
Length=114

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 63/107 (59%), Gaps = 3/107 (3%)
 Frame = +1

Query  73   LLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDR  252
            +LL     AP+  EA +TC  V + L PC  Y L+  GP  +CC+G+K LL  A T  DR
Sbjct  11   VLLCMVVVAPHA-EA-LTCGQVTSTLAPCLPY-LMNRGPLRNCCDGVKGLLGQAKTTVDR  67

Query  253  QTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            Q  C+CLKS ASS     L +AA++P+ C   IP+ IS   DCS VQ
Sbjct  68   QAACTCLKSAASSFTGLNLGKAAALPNTCSVNIPYKISPSTDCSKVQ  114



>ref|XP_006355281.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=116

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 60/101 (59%), Gaps = 3/101 (3%)
 Frame = +1

Query  91   ATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSC  270
            A AP+  EA ++C  V + L PC  Y L G GP   CC G+K LL AA T  DR+T C+C
Sbjct  19   ALAPH-AEA-LSCGQVTSGLAPCLPY-LQGRGPLGGCCGGVKGLLGAAKTPADRKTACTC  75

Query  271  LKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            LKS AS++    + +AA IP  C   IP+ IS   DCS VQ
Sbjct  76   LKSAASAIKGIDVGKAAGIPSACGVNIPYKISPSTDCSKVQ  116



>ref|XP_009757306.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=125

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 83/125 (66%), Gaps = 5/125 (4%)
 Frame = +1

Query  34   MAVSA--KLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPS--SDC  201
            MA+S   K+   +F L +V  + +    EA ++C TV ++L PC SY++ G   +  + C
Sbjct  1    MAISKMQKVSACLFLLCMVVISFSSPHAEAAISCSTVYSNLAPCLSYLIGGSKQAVPAGC  60

Query  202  CNGLKSLLSAASTQTDRQTVCSCLKSLASSVNDAQLA-RAASIPDKCDATIPFTISRDVD  378
            C+G++SL +AAST  DRQ+VCSCLK+ A+S+  +  A +AA++ +KC  T+P+ IS ++D
Sbjct  61   CSGIQSLYTAASTTVDRQSVCSCLKAGAASLGSSIDANKAATLLNKCGVTVPYKISPNID  120

Query  379  CSAVQ  393
            CS VQ
Sbjct  121  CSKVQ  125



>gb|AAF14232.1|AF109195_1 lipid transfer protein [Hordeum vulgare]
 dbj|BAJ87805.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=121

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 71/112 (63%), Gaps = 2/112 (2%)
 Frame = +1

Query  64   VFALLLVAGATAP-YGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAAST  240
            V A++L A   AP   V A ++C  V + L PC  YV  G  P+  CC G+++LL+ A+ 
Sbjct  10   VLAMVLAAMVVAPPVTVRAAISCSAVYSTLMPCLQYVQQGGTPARGCCAGIQNLLAEANN  69

Query  241  QTDRQTVCSCLKSLASSV-NDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
              DR+T+C CLK++A++    +++ RAA++P KC+  +P+ IS  VDC+++ 
Sbjct  70   SPDRRTICGCLKNVANAAPGGSEITRAAALPSKCNVNLPYKISPSVDCNSIH  121



>emb|CAL07989.1| lipid transfer protein [Platanus x acerifolia]
Length=118

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 71/116 (61%), Gaps = 4/116 (3%)
 Frame = +1

Query  46   AKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLL  225
            AKL   + A ++   ATAP+  EA +TC TV T L PC +++  G   +  CCNG+K+L 
Sbjct  7    AKLACLLLACMV---ATAPH-AEAAITCGTVVTRLTPCLTFLRSGGAVAPACCNGVKALN  62

Query  226  SAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            + A T  DRQ  C CLK+ ++S++  QL  AAS+  KC   +P+ IS  +DCS V+
Sbjct  63   NDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK  118



>ref|NP_001241144.1| uncharacterized protein LOC100817318 precursor [Glycine max]
 gb|ACU20523.1| unknown [Glycine max]
Length=122

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 68/121 (56%), Gaps = 1/121 (1%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            M  S K+   V  + +V   +     +A +TC  V  D+ PC SY+  G  PS  CCNG+
Sbjct  1    MMTSFKVACVVAMMCMVVAMSVTPMAQAAITCGQVAGDVSPCLSYLRSGGKPSDACCNGV  60

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDA-QLARAASIPDKCDATIPFTISRDVDCSAV  390
            KSL  AA T  DRQ  C+CLK+LA+++  +     AAS+P KC   IP+ IS   +C+ +
Sbjct  61   KSLSGAAKTTADRQAACNCLKNLANNMGQSLNAGNAASLPGKCGVNIPYKISTSTNCATI  120

Query  391  Q  393
            +
Sbjct  121  K  121



>pdb|1CZ2|A Chain A, Solution Structure Of Wheat Ns-Ltp Complexed With Prostaglandin 
B2.
Length=90

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 59/88 (67%), Gaps = 0/88 (0%)
 Frame = +1

Query  127  CDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVNDAQ  306
            C  V++ + PC SYV  G GPS  CC+G+K+L + A +Q+DRQ+ C+CLK +A  +++  
Sbjct  3    CGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLN  62

Query  307  LARAASIPDKCDATIPFTISRDVDCSAV  390
               A SIP KC   +P+TIS ++DCS V
Sbjct  63   EDNARSIPPKCGVNLPYTISLNIDCSRV  90



>ref|XP_009396871.1| PREDICTED: non-specific lipid-transfer protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=116

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 60/101 (59%), Gaps = 1/101 (1%)
 Frame = +1

Query  91   ATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSC  270
             TAP+  +A +TC  V +DL PC  Y       +S CCNG+KSL SAA T  DR+T C+C
Sbjct  17   GTAPHVTQA-ITCGQVTSDLSPCIPYATGKGSLTSGCCNGVKSLNSAAKTSADRKTACTC  75

Query  271  LKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            +KSL S  + A     + IP KC  +IP+TIS   DCS V 
Sbjct  76   IKSLVSRFSSANTGVVSGIPGKCGVSIPYTISPSTDCSKVN  116



>ref|XP_011091601.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
Length=118

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 65/120 (54%), Gaps = 2/120 (2%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            MA + K    V   ++   +  P G EA + C TV + L PC  YV  G G    CC G+
Sbjct  1    MAGTIKPMFVVLIAVVSIMSVVPEG-EAAIGCGTVVSYLNPCLPYV-TGTGALGGCCKGI  58

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
              L +AA T  DRQ+VC CLK LA+S +   L +AA +P +C   IP+ IS   DCS VQ
Sbjct  59   NDLYAAAQTTADRQSVCGCLKDLAASTSGVNLGKAAGLPSQCGLNIPYKISPSTDCSKVQ  118



>gb|AAX08122.1| lipid transfer protein III [Capsicum annuum]
Length=114

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 55/91 (60%), Gaps = 1/91 (1%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            +TC  V + + PC  Y L G GP   CC G+K LL AA T  DR+TVC+CLKS A S+  
Sbjct  25   LTCGQVQSRMTPCLPY-LTGSGPLGRCCGGVKGLLGAAKTPADRKTVCTCLKSAAGSIGG  83

Query  301  AQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
              + +AA +P+ C   IP+ IS   DC+ VQ
Sbjct  84   INVRKAAGLPNMCGVNIPYQISPSADCTKVQ  114



>ref|XP_011091599.1| PREDICTED: non-specific lipid-transfer protein 1-like [Sesamum 
indicum]
Length=118

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 68/120 (57%), Gaps = 2/120 (2%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            MA + K  L V   ++   +  P G EA + C TV + L PC  YV  G G    CC G+
Sbjct  1    MAGTIKSMLVVLIAVVSIMSVVPEG-EAAIGCGTVVSKLSPCIPYV-TGKGALGGCCKGI  58

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            K L   A +  DRQ+VC+CLK LA+S +   L +AA++P +C  +IP+ IS   DCS V+
Sbjct  59   KGLYDLAKSTGDRQSVCNCLKFLAASTSGVNLGKAAALPGQCGVSIPYKISPSTDCSKVK  118



>gb|ABA33846.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=120

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLAS  288
            EA ++C  V + + PC SY    G GPS+ CC+G+KSL +AA T  DR+  C+CLK+ A+
Sbjct  26   EAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVKSLNNAARTTADRRAACNCLKNAAA  85

Query  289  SVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             V+      AASIP KC  +IP+TIS   DCS V 
Sbjct  86   GVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  120



>ref|XP_004516173.1| PREDICTED: non-specific lipid-transfer protein 1-like [Cicer 
arietinum]
Length=118

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 68/110 (62%), Gaps = 1/110 (1%)
 Frame = +1

Query  64   VFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQ  243
            V AL+ +   +AP   EA V+C ++ + L PC SY+  G GPSS CC G+K + +AA+T 
Sbjct  9    VVALMCMVVVSAPM-AEAAVSCGSITSALVPCISYLKGGPGPSSSCCGGVKRVNAAAATT  67

Query  244  TDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             DR+  C+CLK+ A S++  +   AA++P KC   IP+  S   +C+++ 
Sbjct  68   PDRRAACNCLKNAAGSISGLKAGNAAALPSKCGVNIPYKFSTSTNCNSIN  117



>gb|ABA33848.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=110

 Score = 86.3 bits (212),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLAS  288
            EA ++C  V + + PC SY    G GPS+ CC+G+KSL +AA T  DR+  C+CLK+ A+
Sbjct  16   EAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVKSLNNAARTTADRRAACNCLKNAAA  75

Query  289  SVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             V+      AASIP KC  +IP+TIS   DCS V 
Sbjct  76   GVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  110



>gb|ACB05670.1| putative non-specific lipid transfer protein [Capsicum annuum]
Length=112

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 55/91 (60%), Gaps = 1/91 (1%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            +TC  V + + PC  Y L G GP   CC G+K LL AA T  DR+TVC+CLKS A S+  
Sbjct  23   LTCGQVQSRMTPCLPY-LTGSGPLGRCCGGVKGLLGAAKTPADRKTVCTCLKSAAGSIGG  81

Query  301  AQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
              + +AA +P+ C   IP+ IS   DC+ VQ
Sbjct  82   INVRKAAGLPNMCGVNIPYQISPSTDCTKVQ  112



>emb|CAH04989.1| type 1 non-specific lipid transfer protein precursor [Triticum 
aestivum]
Length=116

 Score = 86.3 bits (212),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 69/115 (60%), Gaps = 2/115 (2%)
 Frame = +1

Query  46   AKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLL  225
            A++ L   AL+L+  A     V   + C  V++ + PC SYV  G GPS  CC+G+K+L 
Sbjct  4    AQVMLMAVALVLMLAAVPRAAVA--IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLH  61

Query  226  SAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAV  390
            + A +Q+DRQ+ C+CL+ +A  +++     A   P KC   +P+TIS ++DCS V
Sbjct  62   NQARSQSDRQSACNCLRGIARGIHNLNEDNARGTPLKCGVNLPYTISLNIDCSRV  116



>gb|AEI70828.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=116

 Score = 86.3 bits (212),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 66/117 (56%), Gaps = 3/117 (3%)
 Frame = +1

Query  46   AKLYLTVF-ALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSL  222
            AK+ + V  A++      APY  EA +TC  V++ L PC  Y+  G      CCNG+KSL
Sbjct  2    AKMAMMVLCAVVTCMVVVAPY-AEA-LTCGQVSSSLAPCIGYLTKGGAVPPACCNGVKSL  59

Query  223  LSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             SAA T  DRQ  C CLKS  SS++      AAS+P KC   IP+ IS   DCS VQ
Sbjct  60   NSAAKTTPDRQAACGCLKSAYSSISGINEGNAASLPGKCGVNIPYKISPGTDCSKVQ  116



>gb|AFX66972.1| non-specific lipid transfer protein 2 [Solanum tuberosum]
Length=114

 Score = 86.3 bits (212),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 66/112 (59%), Gaps = 7/112 (6%)
 Frame = +1

Query  58   LTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAAS  237
            L V  +++VA    P+  EA ++C  V + L PC  Y L G GP   CC+G+K LL AA 
Sbjct  10   LVVLCMIVVA----PH-AEA-LSCGQVTSGLAPCLPY-LQGRGPLGGCCSGVKGLLGAAR  62

Query  238  TQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            T  DR+T C+CLKS AS++    + +AA IP  C   IP+ IS   DCS VQ
Sbjct  63   TPADRKTACTCLKSAASAIKGIDVGKAAGIPSVCGVNIPYKISPSTDCSKVQ  114



>dbj|BAJ91878.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=115

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 66/115 (57%), Gaps = 11/115 (10%)
 Frame = +1

Query  52   LYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLS  228
            L   V A+LLVA        +A +TC  V++ LGPC +Y    G  PS+ CC+G+K L  
Sbjct  11   LVALVAAMLLVA-------ADAAITCGQVSSALGPCAAYAKGSGTSPSAGCCSGVKRLAG  63

Query  229  AASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             A +  D+Q  C CLKS+A + N     RAA IP +C  ++P+TIS  VDC+ + 
Sbjct  64   LARSTADKQATCRCLKSVAGAYNA---GRAAGIPSRCGVSVPYTISASVDCTKIH  115



>ref|XP_006355279.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=114

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 65/112 (58%), Gaps = 7/112 (6%)
 Frame = +1

Query  58   LTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAAS  237
            L V  +++VA    P+  EA ++C  V + L PC  Y L G GP   CC G+K LL AA 
Sbjct  10   LVVLCMIVVA----PH-AEA-LSCSQVTSGLAPCLPY-LQGRGPLGGCCGGVKGLLGAAK  62

Query  238  TQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            T  DR+T C+CLKS A+++    + +AA IP  C   IP+ IS   DCS VQ
Sbjct  63   TPADRKTACTCLKSAATAIKGIDVGKAAGIPSACGVNIPYKISPSTDCSKVQ  114



>gb|ABA33853.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=109

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLAS  288
            EA ++C  V + + PC SY    G GPS+ CC+G++SL +AA T  DR+  C+CLK+ A+
Sbjct  15   EAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAA  74

Query  289  SVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             V+      AASIP KC  +IP+TIS   DCS V 
Sbjct  75   GVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  109



>gb|AFK44274.1| unknown [Medicago truncatula]
Length=116

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 67/117 (57%), Gaps = 4/117 (3%)
 Frame = +1

Query  43   SAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSL  222
            S K+   V  + ++    AP   +A ++C TV + LGPC  Y+  G GPS  CC G+K L
Sbjct  3    SMKVACVVLMMCMI---VAPM-ADAAISCGTVTSALGPCIGYLKGGPGPSPACCGGVKRL  58

Query  223  LSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
              AA+T  DRQ  C+CLK  A +++    A A+++P KC   IP+ IS   +C+ ++
Sbjct  59   NGAAATTPDRQAACNCLKQAAGAISGLNTAAASALPGKCGVNIPYKISTSTNCATIR  115



>gb|ABA33859.1| phospholipid transfer protein 1 [Zea diploperennis]
 gb|ABA33861.1| phospholipid transfer protein 1 [Zea diploperennis]
 gb|ABA33864.1| phospholipid transfer protein 1 [Zea diploperennis]
 gb|ABA33865.1| phospholipid transfer protein 1 [Zea diploperennis]
Length=118

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLAS  288
            EA ++C  V + + PC SY    G GPS+ CC+G++SL +AA T  DR+  C+CLK+ A+
Sbjct  24   EAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAA  83

Query  289  SVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             V+      AASIP KC  +IP+TIS   DCS V 
Sbjct  84   GVSGLNAGNAASIPSKCSVSIPYTISTSTDCSRVN  118



>gb|AES87466.2| Lipid transfer protein [Medicago truncatula]
Length=139

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 58/94 (62%), Gaps = 0/94 (0%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASS  291
            +A ++C TV + LGPC  Y+  G GPS  CC G+K L  AA+T  DRQ  C+CLK  A +
Sbjct  22   DAAISCGTVTSALGPCIGYLKGGPGPSPACCGGVKRLNGAAATTPDRQAACNCLKQAAGA  81

Query  292  VNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            ++    A A+++P KC   IP+ IS   +C+ V+
Sbjct  82   ISGLNTAAASALPGKCGVNIPYKISTSTNCATVR  115



>gb|ABA33860.1| phospholipid transfer protein 1 [Zea diploperennis]
Length=109

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLAS  288
            EA ++C  V + + PC SY    G GPS+ CC+G++SL +AA T  DR+  C+CLK+ A+
Sbjct  15   EAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAA  74

Query  289  SVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             V+      AASIP KC  +IP+TIS   DCS V 
Sbjct  75   GVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  109



>gb|ABA33849.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=119

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLAS  288
            EA ++C  V + + PC SY    G GPS+ CC+G++SL +AA T  DR+  C+CLK+ A+
Sbjct  25   EAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAA  84

Query  289  SVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             V+      AASIP KC  +IP+TIS   DCS V 
Sbjct  85   GVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  119



>gb|ABA33850.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=120

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLAS  288
            EA ++C  V + + PC SY    G GPS+ CC+G++SL +AA T  DR+  C+CLK+ A+
Sbjct  26   EAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAA  85

Query  289  SVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             V+      AASIP KC  +IP+TIS   DCS V 
Sbjct  86   GVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  120



>sp|O23758.1|NLTP_CICAR RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
Flags: Precursor [Cicer arietinum]
 emb|CAA05771.1| lipid transfer protein [Cicer arietinum]
Length=116

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 59/94 (63%), Gaps = 0/94 (0%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASS  291
            E+ +TC  V+T L PC  Y+  G GPS+ CC G+++L SAA T  DRQ  C+CLKS A S
Sbjct  22   ESAITCGRVDTALAPCLGYLQGGPGPSAQCCGGVRNLNSAAVTTPDRQAACNCLKSAAGS  81

Query  292  VNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            ++      AA++P KC   IP+ IS   +C+ ++
Sbjct  82   ISRLNANNAAALPGKCVVNIPYKISTSTNCATIR  115



>gb|ABA33858.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=116

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLAS  288
            EA ++C  V + + PC SY    G GPS+ CC+G++SL +AA T  DR+  C+CLK+ A+
Sbjct  22   EAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAA  81

Query  289  SVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             V+      AASIP KC  +IP+TIS   DCS V 
Sbjct  82   GVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  116



>gb|ABA33847.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=120

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLAS  288
            EA ++C  V + + PC SY    G GPS+ CC+G++SL +AA T  DR+  C+CLK+ A+
Sbjct  26   EAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAA  85

Query  289  SVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             V+      AASIP KC  +IP+TIS   DCS V 
Sbjct  86   GVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  120



>ref|NP_001105311.1| non-specific lipid-transfer protein precursor [Zea mays]
 sp|P19656.1|NLTP_MAIZE RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Full=Phospholipid transfer protein; Short=PLTP; AltName: 
Allergen=Zea m 14; Flags: Precursor [Zea mays]
 gb|AAA33493.1| phospholipid transfer protein precursor [Zea mays]
 gb|ABA33851.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
 gb|ABA33852.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=120

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLAS  288
            EA ++C  V + + PC SY    G GPS+ CC+G++SL +AA T  DR+  C+CLK+ A+
Sbjct  26   EAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAA  85

Query  289  SVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             V+      AASIP KC  +IP+TIS   DCS V 
Sbjct  86   GVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  120



>ref|XP_008798551.1| PREDICTED: non-specific lipid-transfer protein 1-like [Phoenix 
dactylifera]
Length=118

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 69/109 (63%), Gaps = 4/109 (4%)
 Frame = +1

Query  67   FALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQT  246
             A++L+A   +P G +A +TC  V  DL PC  Y+  G   +  CC+G++SLL+AA T T
Sbjct  14   LAMVLLA---SPRGTKA-ITCPQVYGDLTPCIQYLRSGGAVAPQCCSGVRSLLAAARTVT  69

Query  247  DRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            DR+T C C+K+ A+ ++   + RA+++P KC  +IP+ IS   DCS + 
Sbjct  70   DRRTACRCIKTAAAGLSGLDIGRASALPGKCGVSIPYKISPSTDCSKIN  118



>gb|ABA33866.1| phospholipid transfer protein 1 [Zea diploperennis]
Length=114

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLAS  288
            EA ++C  V + + PC SY    G GPS+ CC+G++SL +AA T  DR+  C+CLK+ A+
Sbjct  20   EAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAA  79

Query  289  SVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             V+      AASIP KC  +IP+TIS   DCS V 
Sbjct  80   GVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  114



>ref|XP_006662670.1| PREDICTED: non-specific lipid-transfer protein 3-like [Oryza 
brachyantha]
 ref|XP_006663742.1| PREDICTED: non-specific lipid-transfer protein 3-like [Oryza 
brachyantha]
Length=119

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVLIGI-GPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLAS  288
             A V+C  V + + PC SYV   +  PSS CC+G+K+L   AS+  DR+T CSCLKS+A 
Sbjct  25   SAAVSCGDVTSAIAPCLSYVTGRMSAPSSSCCSGVKTLNGKASSSADRRTACSCLKSMAG  84

Query  289  SVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            SV +  +  AA+IP KC  ++ F IS  VDCS + 
Sbjct  85   SVRNLNMGNAATIPSKCGVSVAFPISTSVDCSKIN  119



>ref|XP_003605266.1| Non-specific lipid-transfer protein [Medicago truncatula]
 gb|AES87463.1| Lipid transfer protein [Medicago truncatula]
Length=116

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 58/94 (62%), Gaps = 0/94 (0%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASS  291
            +A ++C TV + LGPC  Y+  G GPS  CC G+K L  AA+T  DRQ  C+CLK  A +
Sbjct  22   DAAISCGTVTSALGPCIGYLKGGPGPSPACCGGVKRLNGAAATTPDRQAACNCLKQAAGA  81

Query  292  VNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            ++    A A+++P KC   IP+ IS   +C+ ++
Sbjct  82   ISGLNTAAASALPGKCGVNIPYKISTSTNCATIR  115



>gb|ABK96813.1| lipid transfer protein isoform 1.1 precursor [Lactuca sativa]
Length=114

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 65/114 (57%), Gaps = 7/114 (6%)
 Frame = +1

Query  52   LYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSA  231
            ++  V   ++VA   APY  EA +TC  V + L  C SY+  G      CC+G+KSL SA
Sbjct  8    VFCVVVTCMVVA---APYA-EAAITCGQVVSSLSQCASYLRNGGAVPPACCSGVKSLNSA  63

Query  232  ASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            A T  DRQTVC CLK  +  VN +    AAS+P KC   IP+ IS   DCS VQ
Sbjct  64   ARTTPDRQTVCGCLKRASGGVNASN---AASLPGKCGVNIPYKISPSTDCSKVQ  114



>ref|XP_009631888.1| PREDICTED: non-specific lipid-transfer protein 1 [Nicotiana tomentosiformis]
 sp|Q42952.1|NLTP1_TOBAC RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=Pathogenesis-related protein 14; Short=PR-14; 
Flags: Precursor [Nicotiana tabacum]
 emb|CAA44267.1| lipid transferase [Nicotiana tabacum]
Length=114

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 69/120 (58%), Gaps = 6/120 (5%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            M ++ K+   V   ++VA   A    EA +TC  V ++L PC +Y L   GP   CC G+
Sbjct  1    MEIAGKIACFVVLCMVVAAPCA----EA-ITCGQVTSNLAPCLAY-LRNTGPLGRCCGGV  54

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            K+L+++A T  DRQ  C+CLKS A +++   L +AA +P  C   IP+ IS   DCS VQ
Sbjct  55   KALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTDCSKVQ  114



>gb|ABE11609.1| lipid-transfer protein precursor [Solanum chacoense]
Length=115

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 65/120 (54%), Gaps = 5/120 (4%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            M + +K+   V   ++V    AP+  EA +TC  V + L  C  Y L   GP  DCC+G+
Sbjct  1    MEIVSKIACFVLLCMVV---VAPHA-EAALTCGQVTSSLFSCLPY-LRNTGPLGDCCSGV  55

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            K L   A T  DRQT C+CLKS A S+      +AAS+P  C   IP+ IS   DCS VQ
Sbjct  56   KKLKGQAQTTADRQTACNCLKSTAGSIKGLNFGKAASLPSTCSVNIPYEISPSTDCSKVQ  115



>ref|XP_006355280.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=114

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 54/91 (59%), Gaps = 1/91 (1%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            ++C  V + L PC  Y L G GP   CC G+K LL AA T  DR+T C+CLKS A+++  
Sbjct  25   LSCGQVTSGLAPCLPY-LQGRGPLGGCCGGVKGLLGAAKTPADRKTACTCLKSAATAIKG  83

Query  301  AQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
              + +AA IP  C   IP+ IS   DCS VQ
Sbjct  84   IDVGKAAGIPSACGVNIPYKISPSTDCSKVQ  114



>sp|Q39950.1|NLTP_HELAN RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
Short=NsLTP; AltName: Full=SDI-9; Flags: Precursor [Helianthus 
annuus]
 emb|CAA63340.1| lipid transfer protein [Helianthus annuus]
Length=116

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 67/120 (56%), Gaps = 4/120 (3%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            MA  A + L      +V GA  PY  EA ++C  V++ L PC SY+  G      CC+G+
Sbjct  1    MAKMAMMVLCAGVTCMVVGA--PY-TEA-LSCGQVSSSLAPCISYLTKGGAVPPACCSGV  56

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            KSL SAA T  DRQ  C CLKS  +S++      AAS P KC  +IP+ IS   DCS VQ
Sbjct  57   KSLNSAAKTTPDRQAACGCLKSAYNSISGVNAGNAASFPGKCGVSIPYKISPSTDCSKVQ  116



>ref|XP_004308147.1| PREDICTED: non-specific lipid-transfer protein 3-like [Fragaria 
vesca subsp. vesca]
Length=122

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 67/122 (55%), Gaps = 2/122 (2%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            MA S    +    +L +A A +  G EA +TC  V   L PC SY+  G  P+++CC G+
Sbjct  1    MAFSGVQKVVFLVMLSMAAALSFGGAEAALTCGQVVNKLTPCASYIQNGGTPAANCCGGI  60

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSV--NDAQLARAASIPDKCDATIPFTISRDVDCSA  387
            ++L   A T  DRQ+VC+CLK   + +    A+   AA +P KC   IP+ I+   DC +
Sbjct  61   RALYGMAQTTPDRQSVCNCLKQAIAGIPYTGAKAGLAAGLPGKCGVNIPYKINPSTDCKS  120

Query  388  VQ  393
            ++
Sbjct  121  IK  122



>gb|AFK38461.1| unknown [Lotus japonicus]
Length=115

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 66/110 (60%), Gaps = 1/110 (1%)
 Frame = +1

Query  64   VFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQ  243
            V AL++++   AP   EA +TC  + + L PC +Y+  G GPS  CC G++ + SAAS+ 
Sbjct  7    VCALVVLSMVVAPM-AEAAITCGAIVSALIPCTAYIQGGAGPSPPCCAGVRRVNSAASST  65

Query  244  TDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             DR+  C+CLKS A S +      AAS+P KC   IP+ IS   +C+ ++
Sbjct  66   ADRRAACNCLKSAAGSFSRFNAGNAASLPGKCGVNIPYKISTSTNCANIK  115



>ref|XP_006367395.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=114

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 67/120 (56%), Gaps = 6/120 (5%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            M +  K+   V   ++V    AP+  EA ++C  V + L PC  Y L G GP   CC G+
Sbjct  1    MEIFGKIACFVLLCMVV---VAPH-AEA-LSCGEVTSGLAPCLPY-LQGSGPIGGCCGGV  54

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            K LL AA T  DR+T C+CLKS A+S+      +AA +P  C  +IP+ IS   DCS VQ
Sbjct  55   KGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVSIPYKISPSTDCSKVQ  114



>gb|AFM35695.1| nonspecific lipid transfer protein [Vitis pseudoreticulata]
Length=119

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 64/114 (56%), Gaps = 3/114 (3%)
 Frame = +1

Query  49   KLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLS  228
            KL   +   ++VA    P  VEA +TC  V + L PC +Y+  G      CC+G+K+L S
Sbjct  8    KLACVMVICMVVA---VPASVEAAITCGQVTSSLSPCLNYLKSGGPVPPGCCSGIKNLNS  64

Query  229  AASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAV  390
            AA T  DRQT C CLKSL+ S+       A+ +P KC  ++P+ IS   DCS V
Sbjct  65   AAQTTADRQTACKCLKSLSGSIPGINYGLASGLPGKCGVSVPYKISPSTDCSKV  118



>ref|XP_002305878.2| lipid transfer family protein [Populus trichocarpa]
 gb|EEE86389.2| lipid transfer family protein [Populus trichocarpa]
Length=118

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 70/120 (58%), Gaps = 2/120 (2%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            MA S  L LT +A+L+    +AP   EA ++C  V++ L  C  Y+  G    + CC+GL
Sbjct  1    MASSMGLKLT-YAMLIAMVVSAPL-AEAAISCGQVSSSLAQCIGYLQKGGAVPAACCSGL  58

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            K L SAA+T  DRQ VC+CLKSLA  ++      AA +P KC  +I + IS   DC +V+
Sbjct  59   KGLNSAATTTADRQGVCNCLKSLAGKISGINYGVAAGLPSKCGVSISYKISPSTDCKSVK  118



>ref|XP_006362360.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=114

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 63/112 (56%), Gaps = 4/112 (4%)
 Frame = +1

Query  58   LTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAAS  237
            +  F LL +    AP+  EA +TC  V + L PC  Y L G GP   CC G+K LL AA 
Sbjct  7    IACFVLLCMV-VVAPH-AEA-LTCGQVTSGLAPCLPY-LQGRGPIGGCCGGVKGLLGAAK  62

Query  238  TQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            T  DR+T C+CLKS A+S+      +AA +P  C   IP+ IS   DCS +Q
Sbjct  63   TPADRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSKIQ  114



>emb|CAH69210.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
Length=120

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 67/111 (60%), Gaps = 1/111 (1%)
 Frame = +1

Query  64   VFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQ  243
            V A++L A   AP      ++C TV + L PC  YV  G  P+  CC G+++LL  A+  
Sbjct  10   VLAMVLAAMLVAPPATVHAISCSTVYSTLMPCLQYVQQGGSPARGCCTGIQNLLVEANNS  69

Query  244  TDRQTVCSCLKSLASSVNDAQ-LARAASIPDKCDATIPFTISRDVDCSAVQ  393
             DR+T+C CL+++A+  +    + RAA++P KC+  +P+ IS  VDC+++ 
Sbjct  70   PDRRTICGCLENVANGASGGPYITRAAALPSKCNVALPYKISPSVDCNSIH  120



>gb|AFK36168.1| unknown [Lotus japonicus]
Length=115

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 65/110 (59%), Gaps = 1/110 (1%)
 Frame = +1

Query  64   VFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQ  243
            V AL++++   AP   EA +TC  + + L PC +Y+  G GPS  CC G++ + SAAS+ 
Sbjct  7    VCALVVLSMVVAPM-AEAAITCGAIASALIPCTAYIQGGAGPSPPCCAGVRRVNSAASST  65

Query  244  TDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             DR+  C+CLKS A S        AAS+P KC   IP+ IS   +C+ ++
Sbjct  66   ADRRAACNCLKSAAGSFPRFNAGNAASLPGKCGVNIPYKISTSTNCANIK  115



>ref|XP_004506429.1| PREDICTED: non-specific lipid-transfer protein-like [Cicer arietinum]
Length=116

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 58/94 (62%), Gaps = 0/94 (0%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASS  291
            E+ +TC  V+  L PC  Y+  G GPS+ CC G+++L SAA T  DRQ  C+CLKS A S
Sbjct  22   ESAITCGRVSAALAPCLGYLQGGPGPSAQCCGGVRNLNSAAVTTPDRQAACNCLKSAAGS  81

Query  292  VNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            ++      AA++P KC   IP+ IS   +C+ ++
Sbjct  82   ISRLNANNAAALPGKCGVNIPYKISTSTNCATIR  115



>ref|NP_001234074.1| non-specific lipid-transfer protein 1 precursor [Solanum lycopersicum]
 sp|P27056.1|NLTP1_SOLLC RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; Flags: Precursor [Solanum lycopersicum]
 emb|CAA39512.1| TSW12 [Solanum lycopersicum]
Length=114

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 62/107 (58%), Gaps = 3/107 (3%)
 Frame = +1

Query  73   LLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDR  252
            +LL     AP+  EA +TC  V   L PC  Y L G GP   CC G+K+LL +A T  DR
Sbjct  11   VLLCMVVVAPH-AEA-LTCGQVTAGLAPCLPY-LQGRGPLGGCCGGVKNLLGSAKTTADR  67

Query  253  QTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            +T C+CLKS A+++    L +AA IP  C   IP+ IS   DCS VQ
Sbjct  68   KTACTCLKSAANAIKGIDLNKAAGIPSVCKVNIPYKISPSTDCSTVQ  114



>sp|O24037.1|NLTP1_SOLPN RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Full=LpLTP1; Flags: Precursor [Solanum pennellii]
 gb|AAB07486.1| lipid transfer protein 1 [Solanum pennellii]
Length=114

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 61/107 (57%), Gaps = 3/107 (3%)
 Frame = +1

Query  73   LLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDR  252
            +LL     AP+  EA +TC  V   L PC  Y L G GP   CC G+K LL +A T  DR
Sbjct  11   VLLCMVVVAPH-AEA-LTCGQVTAGLAPCLPY-LQGRGPLGGCCGGVKGLLGSAKTTADR  67

Query  253  QTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            +T C+CLKS A+++    L +AA IP  C   IP+ IS   DCS VQ
Sbjct  68   KTACTCLKSAANAIKGIDLNKAAGIPSVCKVNIPYKISPSTDCSTVQ  114



>gb|AFK46170.1| unknown [Lotus japonicus]
Length=119

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 68/120 (57%), Gaps = 2/120 (2%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            MA S K    V A+ + A   AP   EA ++C +V   L PC  Y+  G  PS  CC G+
Sbjct  1    MATSVKFSCMVVAICM-ALVAAPM-AEAAISCGSVIGALTPCMPYLTGGPAPSPQCCAGV  58

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            K+L +AAST  DR+T C CLK+ A S+ +     AA++P KC   IP+ IS   +C+ ++
Sbjct  59   KNLNAAASTTPDRKTACGCLKNAAGSMPNLNAGNAAALPGKCGVNIPYKISTSTNCNTIK  118



>ref|XP_006367394.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=114

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 64/112 (57%), Gaps = 4/112 (4%)
 Frame = +1

Query  58   LTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAAS  237
            +  F LL +    AP+  EA ++C  V + L PC  Y L G GP   CC G+K LL AA 
Sbjct  7    IACFVLLCMV-VVAPH-AEA-LSCGEVTSGLAPCLPY-LQGSGPIGGCCGGVKGLLGAAK  62

Query  238  TQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            T  DR+T C+CLKS A+S+      +AA +P  C  +IP+ IS   DCS VQ
Sbjct  63   TPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVSIPYKISPSTDCSKVQ  114



>ref|XP_009626829.1| PREDICTED: non-specific lipid-transfer protein 2 [Nicotiana tomentosiformis]
 gb|AAM74206.1|AF519812_1 non-specific lipid transfer protein [Nicotiana tabacum]
 dbj|BAK19150.1| lipid transfer protein [Nicotiana tabacum]
Length=114

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 53/91 (58%), Gaps = 1/91 (1%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            +TC  V + L PC  Y L+G GP   CC G+K LL AA T  DR+T C+CLKS A++   
Sbjct  25   LTCGQVQSSLAPCVPY-LLGRGPLGGCCGGVKRLLGAARTPADRKTACNCLKSAANTFKG  83

Query  301  AQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
              +  AA +P  C   IP+ IS   DCS VQ
Sbjct  84   IDMGNAARLPGTCGVNIPYKISPSTDCSKVQ  114



>gb|AAT68264.1| lipid transfer protein [Nicotiana glauca]
Length=117

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 59/94 (63%), Gaps = 0/94 (0%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASS  291
            +A + C  V + L PC +YV+ G    + CCNG+KSL + A++  DRQT C+C+KS A+S
Sbjct  24   DAAIFCGRVVSSLIPCINYVIKGGAIPAPCCNGIKSLNNQATSTPDRQTACNCIKSAAAS  83

Query  292  VNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            +     + A S+P KC   +P+ IS  +DCS VQ
Sbjct  84   IKGINFSHAGSLPGKCGVNLPYKISPSIDCSTVQ  117



>gb|EPS73761.1| non-specific lipid-transfer protein, partial [Genlisea aurea]
Length=116

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 58/115 (50%), Gaps = 0/115 (0%)
 Frame = +1

Query  46   AKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLL  225
            A +   V   L  A   AP      + C  V T L PC ++V+ G   +  CC G+  L 
Sbjct  2    ASILKAVCVFLFAALVIAPPAAVTAIQCGDVITKLAPCLNFVMAGGPITPQCCAGVNGLN  61

Query  226  SAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAV  390
             AA T  DR+ VC CLK+LA   NDA +  AA +P  C   +P+ I RDVDC  V
Sbjct  62   RAAGTTPDRRIVCGCLKTLAGRYNDAAIGNAARLPGSCGVRLPYPIRRDVDCGKV  116



>ref|XP_010690793.1| PREDICTED: non-specific lipid-transfer protein-like [Beta vulgaris 
subsp. vulgaris]
Length=118

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 71/120 (59%), Gaps = 2/120 (2%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            MA SA L     A + +    AP+  EA ++C TV  ++  C +Y+  G  PS  CC+G+
Sbjct  1    MASSAFLKFVCLAFMCMV-VVAPH-AEAAMSCGTVTKNIAQCITYLKGGDSPSKGCCDGV  58

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             +L + AST  D++T C+CLKS A+S+      +AA +PDKC  +I ++IS + DCS V 
Sbjct  59   TTLKNLASTPADKKTACACLKSAAASIKGLDEKKAAGLPDKCGVSISYSISPNTDCSKVN  118



>ref|XP_009797052.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
sylvestris]
Length=114

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 67/120 (56%), Gaps = 6/120 (5%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            M +  K+   V   ++V    AP+  EA ++C  V + L PC  Y L G GP   CC G+
Sbjct  1    MEIVGKIACFVVLCMVV---VAPH-AEA-LSCGQVQSGLAPCLPY-LQGRGPLGGCCGGV  54

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            K LL AA +  DR+T C+CLKS A+++    + +AA +P  C   IP+ IS   DCS VQ
Sbjct  55   KGLLGAAKSPADRKTACTCLKSAANAIKGIDMGKAAGLPSACGVNIPYKISPSTDCSKVQ  114



>ref|XP_009757911.1| PREDICTED: non-specific lipid-transfer protein 2 [Nicotiana sylvestris]
 dbj|BAK19151.1| lipid transfer protein [Nicotiana tabacum]
Length=114

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 68/120 (57%), Gaps = 6/120 (5%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            M +  K+   V   ++V    AP+  EA ++C  V + L PC  Y L G GP   CC G+
Sbjct  1    MEMVGKIACFVVLCMVV---VAPH-AEA-LSCGQVQSGLAPCLPY-LQGRGPLGSCCGGV  54

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            K LL AA + +DR+T C+CLKS A+++    + +AA +P  C   IP+ IS   DCS VQ
Sbjct  55   KGLLGAAKSPSDRKTACTCLKSAANAIKGIDMGKAAGLPGACGVNIPYKISPSTDCSKVQ  114



>ref|XP_011007237.1| PREDICTED: non-specific lipid-transfer protein 1-like [Populus 
euphratica]
Length=118

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 67/120 (56%), Gaps = 2/120 (2%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            MA S  L L   A+L+    +AP   EA +TC  V++ L  C  Y+  G      CC+GL
Sbjct  1    MASSMSLKLAC-AMLVAMVVSAPL-AEAAITCGQVSSSLAQCIGYLQKGGALPPACCSGL  58

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            KSL SAA T  DRQ VC+CLKSLA  ++      AA +P KC  +IP+ IS   DC  V+
Sbjct  59   KSLNSAAKTTPDRQGVCNCLKSLAGKISGLNYGLAAGLPSKCGVSIPYKISPATDCKTVK  118



>ref|XP_006355283.1| PREDICTED: non-specific lipid-transfer protein 2 isoform X2 [Solanum 
tuberosum]
Length=114

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 63/112 (56%), Gaps = 4/112 (4%)
 Frame = +1

Query  58   LTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAAS  237
            +  F LL +    AP+  EA ++C  V + L PC  Y L G GP   CC G+K LL AA 
Sbjct  7    IACFVLLCMV-VVAPH-AEA-LSCGEVTSGLAPCLPY-LQGSGPIGGCCGGVKGLLGAAK  62

Query  238  TQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            T  DR+T C+CLKS A+S+      +AA +P  C   IP+ IS   DCS VQ
Sbjct  63   TPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSKVQ  114



>gb|AAR83849.1| nonspecific lipid transfer protein 2 precursor [Capsicum annuum]
Length=114

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 70/120 (58%), Gaps = 6/120 (5%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            M + +K+   V   ++VA   AP+  EA +TC  V  DL  C  Y L G GP   CC G+
Sbjct  1    MEMVSKIACLVVLCMVVA---APH-AEA-LTCGQVAGDLAACLPY-LQGSGPLGSCCGGV  54

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            ++LL AA T  DR+T C+CLKS A+++    L++AA +P  C   IP+ IS   DCS VQ
Sbjct  55   RALLGAAKTPADRKTACTCLKSAANAIKGINLSKAAGLPTACGVNIPYKISPSTDCSTVQ  114



>sp|A0AT28.1|NLTP1_LENCU RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP1; 
Flags: Precursor [Lens culinaris]
 gb|AAX35806.1| lipid transfer protein 1 precursor [Lens culinaris]
Length=118

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 66/110 (60%), Gaps = 1/110 (1%)
 Frame = +1

Query  64   VFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQ  243
            + AL+ +   +AP   EA ++C TV+  L PC +Y+  G GPS  CC G+K L  AA T 
Sbjct  9    LVALMCMVVISAPM-AEAAISCGTVSGALVPCLTYLKGGPGPSPQCCGGVKRLNGAARTT  67

Query  244  TDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             DR+  C+CLKS A S++  +    A++P KC   +P+TIS   +C+ ++
Sbjct  68   IDRRAACNCLKSSAGSISGLKPGNVATLPGKCGVRLPYTISTSTNCNTIR  117



>ref|XP_011095132.1| PREDICTED: non-specific lipid-transfer protein 1-like [Sesamum 
indicum]
Length=123

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 69/125 (55%), Gaps = 7/125 (6%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAG-----ATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSD  198
            MA S  +  T   L+ VA      A AP     +++C  V + L PC  YVL G    + 
Sbjct  1    MARSGMIKATFIVLIAVAAVVSTEAAAPP--PPKISCGKVTSTLAPCFEYVLNGGKVPNS  58

Query  199  CCNGLKSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVD  378
            CC+G+KSL   AST  DR+ VC CLKS+ SS +   +  A S+P KC  +IP+ I+  +D
Sbjct  59   CCDGVKSLYKEASTTADRREVCVCLKSVTSSASPGVINNAKSLPGKCGVSIPYEITPAID  118

Query  379  CSAVQ  393
            C+ V+
Sbjct  119  CNKVK  123



>ref|XP_009141745.1| PREDICTED: non-specific lipid-transfer protein A [Brassica rapa]
Length=118

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 69/122 (57%), Gaps = 6/122 (5%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGP-SSDCCNG  210
            MA   KL   V A ++VAG   P    A +TC TVN+++ PC  Y+  G GP    CC G
Sbjct  1    MAGVMKLVCLVLACMIVAG---PITANAALTCGTVNSNVAPCIGYITQG-GPLPGACCTG  56

Query  211  LKSLLSAASTQTDRQTVCSCLKSLASSVNDA-QLARAASIPDKCDATIPFTISRDVDCSA  387
            +  L S A T  DRQ  C CLK+ AS++  +    RAA IP  C  ++PF IS + +C++
Sbjct  57   VSKLNSMARTTPDRQQACRCLKTAASALGPSLNAGRAAGIPKACGVSVPFPISTNTNCNS  116

Query  388  VQ  393
            V+
Sbjct  117  VK  118



>gb|ACM78614.1| lipid transfer protein 2 [Tamarix hispida]
Length=116

 Score = 84.3 bits (207),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 68/115 (59%), Gaps = 7/115 (6%)
 Frame = +1

Query  49   KLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLS  228
            KL   V A ++V   +AP+  EA ++C TV + L PC  ++  G  P   CC+G+++L S
Sbjct  9    KLACLVAAFMIV---SAPH-AEAAISCGTVVSKLAPCLGFLRGGGSPPPACCSGIRNLQS  64

Query  229  AASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             A +  DRQ  C CLKS ++ VN   +  AA++P KC   I + ISR VDCS V+
Sbjct  65   MARSTPDRQAACGCLKSASAGVN---MRNAAALPGKCGVNIGYPISRSVDCSRVK  116



>gb|ABU49732.1| putative non-specific lipid transfer protein b3 [Solanum tuberosum]
 gb|AFW90593.1| putative non-specific lipid transfer protein b3 mRNA [Solanum 
tuberosum]
 gb|AFX66993.1| non-specific lipid transfer protein 2 [Solanum tuberosum]
Length=114

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 54/91 (59%), Gaps = 1/91 (1%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            ++C  V + L PC  Y L G GP   CC G+K LL AA T  DR+T C+CLKS A+S+  
Sbjct  25   LSCGEVTSGLAPCLPY-LQGRGPIGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKG  83

Query  301  AQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
                +AA +P  C  +IP+ IS   DCS VQ
Sbjct  84   IDTGKAAGLPGVCGVSIPYKISPSTDCSKVQ  114



>ref|XP_006367397.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
tuberosum]
Length=114

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 53/91 (58%), Gaps = 1/91 (1%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            +TC  V   L PC  Y L G GP   CC G+K LL +A T  DR+T C+CLKS A+++  
Sbjct  25   LTCGQVTAGLAPCLPY-LQGRGPLGGCCGGVKGLLGSAKTTADRKTACTCLKSAANAIKG  83

Query  301  AQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
              L +AA IP  C   IP+ IS   DCS VQ
Sbjct  84   IDLNKAAGIPSVCGVNIPYKISPSTDCSTVQ  114



>gb|ACQ42222.1| lipid transfer protein 1 [Chimonanthus praecox]
Length=116

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +1

Query  109  VEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLAS  288
            VEA +TC  V + L PC +Y+  G    S+CC G++SL +AA + TDRQT C CLKS AS
Sbjct  23   VEA-ITCGQVASALSPCITYLRSGGALQSNCCAGVRSLNNAAKSTTDRQTACGCLKSAAS  81

Query  289  SVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            S++  Q   A S+P KC  +IP+  S   DCS V+
Sbjct  82   SISGIQYGLAGSLPSKCGVSIPYKTSPSTDCSKVK  116



>ref|NP_001065988.1| Os12g0115300 [Oryza sativa Japonica Group]
 gb|ABA96285.1| Nonspecific lipid-transfer protein precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF29007.1| Os12g0115300 [Oryza sativa Japonica Group]
 gb|EAY82036.1| hypothetical protein OsI_37222 [Oryza sativa Indica Group]
 gb|EAZ19436.1| hypothetical protein OsJ_34997 [Oryza sativa Japonica Group]
 dbj|BAG88412.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87093.1| unnamed protein product [Oryza sativa Japonica Group]
Length=118

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 53/95 (56%), Gaps = 0/95 (0%)
 Frame = +1

Query  106  GVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLA  285
            G  A +TC  V + + PC SYV    G +  CCNG+K L +AA T  DRQ  C CLK+LA
Sbjct  23   GASAAITCGQVGSAIAPCISYVTGRGGLTQGCCNGVKGLNNAARTTADRQAACRCLKTLA  82

Query  286  SSVNDAQLARAASIPDKCDATIPFTISRDVDCSAV  390
             ++    L  AA IP KC   + F IS   DCS V
Sbjct  83   GTIKSLNLGAAAGIPGKCGVNVGFPISLSTDCSKV  117



>gb|ACM78617.1| non-specific lipid-transfer protein type 1 subfamily protein 
[Tamarix hispida]
Length=118

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 56/91 (62%), Gaps = 0/91 (0%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            +TC T+   L PC  Y+  G  P++ CC G+K+L S A++  DRQ  C CLKS A+S+  
Sbjct  28   LTCGTITQKLAPCLPYLKSGGSPAAGCCGGVKTLHSMATSTADRQAACGCLKSSATSIPG  87

Query  301  AQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             ++  AA++P KC   I F +S  VDCS V+
Sbjct  88   VKMGNAAALPGKCGVNIGFPVSTKVDCSKVK  118



>gb|AII99870.1| protease inhibitor/seed storage/ltp family [Cicer arietinum]
Length=130

 Score = 84.3 bits (207),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 56/91 (62%), Gaps = 0/91 (0%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASS  291
            E+ +TC  V+  L PC  Y+  G GPS+ CC G+++L SAA T  DRQ  C+CLKS A S
Sbjct  22   ESAITCGRVSAALAPCLGYLQGGPGPSAQCCGGVRNLNSAAVTTPDRQAACNCLKSAAGS  81

Query  292  VNDAQLARAASIPDKCDATIPFTISRDVDCS  384
            ++      AA++P KC   IP+ IS   +C+
Sbjct  82   ISRLNANNAAALPGKCGVNIPYKISTSTNCA  112



>ref|XP_010253094.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nelumbo 
nucifera]
Length=119

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 67/115 (58%), Gaps = 3/115 (3%)
 Frame = +1

Query  49   KLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLS  228
            K+   V A++++A   AP+   A +TC  V + + PC +Y+  G      CC+G+KSL S
Sbjct  8    KVACLVVAVMVIA---APHQEVAAITCGQVVSSIAPCLNYLQKGGAVPPACCSGVKSLNS  64

Query  229  AASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            AA T  DRQT C+CLKS A S    Q   A+S+P KC   +P+ IS   DCS V+
Sbjct  65   AAKTTPDRQTACNCLKSAAVSNPSIQAGLASSLPAKCGVNVPYKISPSTDCSKVK  119



>gb|ACJ62320.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62321.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62322.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62327.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62334.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62336.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62359.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62360.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62386.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=121

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 58/92 (63%), Gaps = 1/92 (1%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVN  297
            +TC  V++ + PC SY    G  PS+ CC+G+++L SAAST  DR+  C+CLK+ A  V+
Sbjct  30   ITCGQVSSAIAPCLSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVS  89

Query  298  DAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
                  AASIP KC  +IP+TIS   DCS V 
Sbjct  90   GLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  121



>ref|NP_001275027.1| non-specific lipid transfer protein a7 precursor [Solanum tuberosum]
 gb|ABU49727.1| non-specific lipid transfer protein a7 [Solanum tuberosum]
 gb|ABU49729.1| putative non-specific lipid transfer protein f10 [Solanum tuberosum]
Length=114

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 63/112 (56%), Gaps = 4/112 (4%)
 Frame = +1

Query  58   LTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAAS  237
            +  F LL +    AP+  EA ++C  V + L PC  Y L G GP   CC G+K LL AA 
Sbjct  7    IACFVLLCMV-VVAPH-AEA-LSCGQVTSGLAPCLPY-LQGSGPLGGCCGGVKGLLGAAK  62

Query  238  TQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            T  DR+T C+CLKS A+S+      +AA +P  C   IP+ IS   DCS VQ
Sbjct  63   TPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGVNIPYKISPSTDCSKVQ  114



>gb|ABA33862.1| phospholipid transfer protein 1 [Zea diploperennis]
 gb|ABA33863.1| phospholipid transfer protein 1 [Zea diploperennis]
Length=111

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 59/95 (62%), Gaps = 1/95 (1%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLAS  288
            EA ++C  V + + PC SY    G  PS+ CC+G+KSL +AA T  DR+  C+CLK+ A+
Sbjct  17   EAAISCGQVASAIAPCISYARGQGSAPSAGCCSGVKSLNNAARTTADRRAACNCLKNAAA  76

Query  289  SVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             V+      AASIP KC  +IP+TIS   DCS V 
Sbjct  77   GVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  111



>ref|XP_009797053.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
sylvestris]
Length=114

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 62/107 (58%), Gaps = 3/107 (3%)
 Frame = +1

Query  73   LLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDR  252
            L+L     AP+  EA ++C  V + L PC  Y L G GP   CC G+K LL AA +  DR
Sbjct  11   LVLCVVVIAPH-AEA-LSCGQVQSGLAPCLPY-LQGRGPLGGCCGGVKGLLGAAKSPADR  67

Query  253  QTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            +T C+CLKS A+++    + +AA +P  C   IP+ IS   DCS VQ
Sbjct  68   KTACTCLKSAANAIKGIDMGKAAGLPSACGVNIPYKISPSTDCSKVQ  114



>ref|NP_001065585.1| Os11g0116000 [Oryza sativa Japonica Group]
 gb|ABA91223.1| Nonspecific lipid-transfer protein precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF27430.1| Os11g0116000 [Oryza sativa Japonica Group]
 gb|EAZ17209.1| hypothetical protein OsJ_32721 [Oryza sativa Japonica Group]
 dbj|BAG87779.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93418.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87082.1| unnamed protein product [Oryza sativa Japonica Group]
Length=118

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 53/95 (56%), Gaps = 0/95 (0%)
 Frame = +1

Query  106  GVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLA  285
            G  A +TC  V + + PC SYV    G +  CCNG+K L +AA T  DRQ  C CLK+LA
Sbjct  23   GASAAITCGQVGSAIAPCISYVTGRGGLTQGCCNGVKGLNNAARTTADRQAACRCLKTLA  82

Query  286  SSVNDAQLARAASIPDKCDATIPFTISRDVDCSAV  390
             ++    L  AA IP KC   + F IS   DCS V
Sbjct  83   GTIKSLNLGAAAGIPGKCGVNVGFPISLSTDCSKV  117



>gb|EAY79716.1| hypothetical protein OsI_34868 [Oryza sativa Indica Group]
Length=118

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 53/95 (56%), Gaps = 0/95 (0%)
 Frame = +1

Query  106  GVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLA  285
            G  A +TC  V + + PC SYV    G +  CCNG+K L +AA T  DRQ  C CLK+LA
Sbjct  23   GASAAITCGQVGSAIAPCISYVTGRGGLTQGCCNGVKGLNNAARTTADRQAACRCLKTLA  82

Query  286  SSVNDAQLARAASIPDKCDATIPFTISRDVDCSAV  390
             ++    L  AA IP KC   + F IS   DCS V
Sbjct  83   GTIKSLNLGAAAGIPGKCGVNVGFPISLSTDCSKV  117



>gb|ACJ62316.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62332.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62333.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62337.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62380.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62382.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62383.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62384.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 gb|ACJ62385.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=116

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 58/92 (63%), Gaps = 1/92 (1%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVN  297
            +TC  V++ + PC SY    G  PS+ CC+G+++L SAAST  DR+  C+CLK+ A  V+
Sbjct  25   ITCGQVSSAIAPCLSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVS  84

Query  298  DAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
                  AASIP KC  +IP+TIS   DCS V 
Sbjct  85   GLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  116



>ref|XP_002442774.1| hypothetical protein SORBIDRAFT_08g002670 [Sorghum bicolor]
 gb|EES16612.1| hypothetical protein SORBIDRAFT_08g002670 [Sorghum bicolor]
Length=123

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 57/90 (63%), Gaps = 1/90 (1%)
 Frame = +1

Query  127  CDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVNDA  303
            C  VN+ + PC +Y    G  PS+ CC+G++SL SAAS+  D++T C+CLKS A  V+  
Sbjct  34   CGQVNSAISPCLAYARGTGTAPSAACCSGVRSLNSAASSTADKRTACNCLKSAAGRVSGL  93

Query  304  QLARAASIPDKCDATIPFTISRDVDCSAVQ  393
                AASIP KC   IP+TIS  +DCS V 
Sbjct  94   NAGNAASIPSKCGVNIPYTISASIDCSRVN  123



>ref|NP_001233953.1| non-specific lipid-transfer protein 2 precursor [Solanum lycopersicum]
 sp|P93224.1|NLTP2_SOLLC RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP 
2; Flags: Precursor [Solanum lycopersicum]
 gb|AAB42069.1| non specific lipid transfer protein [Solanum lycopersicum]
 emb|CAJ19706.1| non-specific lipid transfer protein [Solanum lycopersicum]
Length=114

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 53/91 (58%), Gaps = 1/91 (1%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            ++C  V + L PC  Y L G GP   CC G+K LL AA T  DR+T C+CLKS A+S+  
Sbjct  25   LSCGEVTSGLAPCLPY-LEGRGPLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKG  83

Query  301  AQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
                +AA +P  C   IP+ IS   DCS VQ
Sbjct  84   IDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ  114



>ref|XP_009764784.1| PREDICTED: non-specific lipid-transfer protein 2-like [Nicotiana 
sylvestris]
Length=114

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 54/91 (59%), Gaps = 1/91 (1%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            ++C  V + L PC  Y L G GP   CC G+K LL AA +  DR+T C+CLKS A+++  
Sbjct  25   LSCGQVQSGLAPCLPY-LQGRGPLGGCCGGVKGLLGAAKSPADRKTACTCLKSAANAIKG  83

Query  301  AQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
              + +AA +P  C   IP+ IS   DCS VQ
Sbjct  84   IDMGKAAGLPSACGVNIPYKISPSTDCSKVQ  114



>gb|AAY83345.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 68/120 (57%), Gaps = 3/120 (3%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            MA+S  + L++ ALL +  A     +   +TC  V + + PC +YV  G    + CCNG+
Sbjct  1    MAISTAMKLSLVALLCIVVA---LPIAQAITCGQVASSISPCVNYVKSGGAVPAACCNGI  57

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            +SL SAA T  DRQT C+CLK  + ++       AA +P KC   +P+ IS   +C+AV+
Sbjct  58   RSLNSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKCGVNVPYKISTSTNCAAVK  117



>gb|AAB70540.1| lipid transfer protein LPT III [Oryza sativa Indica Group]
Length=114

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 52/78 (67%), Gaps = 0/78 (0%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            +TC  VN+ +GPC +Y   G GPS+ CCNG++SL +AAST  DR+T C+CLK+ A  +  
Sbjct  26   ITCGQVNSAVGPCLTYARGGAGPSAACCNGVRSLKAAASTTADRRTACNCLKNAARGIKG  85

Query  301  AQLARAASIPDKCDATIP  354
                 AASIP KC  ++P
Sbjct  86   LNAGNAASIPSKCGVSVP  103



>gb|AFI61838.1| harmalin [Peganum harmala]
Length=115

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 64/115 (56%), Gaps = 4/115 (3%)
 Frame = +1

Query  49   KLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLS  228
            KL   + A +LVA   AP   EA + C TV + L PC  Y+  G  P   CCNG+++L +
Sbjct  5    KLVCALVACMLVA---APL-TEAAIACGTVVSALSPCIGYLRAGGSPPLACCNGVRALNN  60

Query  229  AASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            AA T  DRQ  C CL++ A S+     A A S+P KC   IP+ IS   +CS V+
Sbjct  61   AARTTPDRQEACRCLQNAARSMGGLNEANAGSLPGKCGVNIPYKISTSTNCSTVK  115



>gb|AEI70827.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=116

 Score = 84.0 bits (206),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 66/117 (56%), Gaps = 3/117 (3%)
 Frame = +1

Query  46   AKLYLTVF-ALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSL  222
            AK+ + V  A++      APY  EA +TC  V++ L PC  Y+  G      CCNG+K L
Sbjct  2    AKMAMMVLCAVVTCMVVAAPY-AEA-LTCGQVSSSLAPCIGYLTKGGAVPPACCNGVKGL  59

Query  223  LSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             +AA T  DRQ  C CLKS  +S++      AAS+P KC  +IP+ IS   DCS VQ
Sbjct  60   NNAAKTTPDRQAACGCLKSAYNSISGVNAGNAASLPGKCGVSIPYKISPGTDCSKVQ  116



>gb|ACJ62381.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=121

 Score = 84.0 bits (206),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 58/92 (63%), Gaps = 1/92 (1%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVN  297
            +TC  V++ + PC SY      GPS+ CC+G+++L SAAST  DR+  C+CLK+ A  V+
Sbjct  30   ITCGQVSSAIAPCLSYARGTASGPSTSCCSGVRNLQSAASTAADRRAACNCLKNAARGVS  89

Query  298  DAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
                  AASIP KC  +IP+TIS   DCS V 
Sbjct  90   GLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  121



>ref|NP_001105392.1| phospholipid transfer protein precursor [Zea mays]
 gb|AAB06443.1| phospholipid transfer protein [Zea mays]
 gb|ACF86016.1| unknown [Zea mays]
 gb|ACJ62344.1| lipid-transfer protein [Zea mays subsp. parviglumis]
 tpg|DAA59231.1| TPA: phospholipid transfer protein-like protein [Zea mays]
Length=121

 Score = 84.0 bits (206),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 57/90 (63%), Gaps = 1/90 (1%)
 Frame = +1

Query  127  CDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVNDA  303
            C  V++ + PC SY    G GPS+ CC+G+++L SAAST  DR+  C+CLK+ A  V+  
Sbjct  32   CGQVSSAIAPCLSYARGTGSGPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGL  91

Query  304  QLARAASIPDKCDATIPFTISRDVDCSAVQ  393
                AASIP KC  +IP+TIS   DCS V 
Sbjct  92   NAGNAASIPSKCGVSIPYTISTSTDCSRVN  121



>sp|Q03461.1|NLTP2_TOBAC RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP 
2; Flags: Precursor [Nicotiana tabacum]
 dbj|BAA03044.1| lipid transfer protein [Nicotiana tabacum]
Length=114

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 55/91 (60%), Gaps = 1/91 (1%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            ++C  V + L PC  Y L G GP   CC G+K LL AA + +DR+T C+CLKS A+++  
Sbjct  25   LSCGQVQSGLAPCLPY-LQGRGPLGSCCGGVKGLLGAAKSLSDRKTACTCLKSAANAIKG  83

Query  301  AQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
              + +AA +P  C   IP+ IS   DCS VQ
Sbjct  84   IDMGKAAGLPGACGVNIPYKISPSTDCSKVQ  114



>gb|ABU49730.1| putative non-specific lipid transfer protein b1 [Solanum tuberosum]
Length=114

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 53/91 (58%), Gaps = 1/91 (1%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            ++C  V + L PC  Y L G GP   CC G+K LL AA T  DR+T C+CLKS A+S+  
Sbjct  25   LSCGEVTSGLAPCLPY-LQGRGPIGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKG  83

Query  301  AQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
                +AA +P  C   IP+ IS   DCS VQ
Sbjct  84   IDTGKAAGLPGVCGVNIPYKISPSTDCSKVQ  114



>gb|AAY83343.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 83.6 bits (205),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 68/120 (57%), Gaps = 3/120 (3%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            MA+S  + L++ ALL +  A     +   +TC  V + + PC +YV  G    + CCNG+
Sbjct  1    MAISTAMKLSLVALLCIVVA---LPIAQAITCGQVASSIAPCVNYVKSGGAVPAACCNGV  57

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            +SL SAA T  DRQT C+CLK  + ++       AA +P KC   +P+ IS   +C+AV+
Sbjct  58   RSLNSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKCGVNVPYKISTSTNCAAVK  117



>gb|ACG29829.1| nonspecific lipid-transfer protein 1 precursor [Zea mays]
Length=123

 Score = 84.0 bits (206),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 59/96 (61%), Gaps = 6/96 (6%)
 Frame = +1

Query  127  CDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVNDA  303
            C  V++ + PC SY    G GPS+ CC+G+++L SAAST  DR+  C+CLK+ A  V+  
Sbjct  32   CGQVSSAIAPCLSYARGTGSGPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGL  91

Query  304  QLARAASIPDKCDATIPFTISRDVDCSAVQ*LFHRI  411
                AASIP KC  +IP+TIS   DCS      HR+
Sbjct  92   NAGNAASIPSKCGVSIPYTISTSTDCS-----RHRV  122



>gb|ACJ62387.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=116

 Score = 83.6 bits (205),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 58/92 (63%), Gaps = 1/92 (1%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVN  297
            +TC  V++ + PC SY      GPS+ CC+G+++L SAAST  DR+  C+CLK+ A  V+
Sbjct  25   ITCGQVSSAIAPCLSYARGTASGPSTSCCSGVRNLQSAASTAADRRAACNCLKNAARGVS  84

Query  298  DAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
                  AASIP KC  +IP+TIS   DCS V 
Sbjct  85   GLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  116



>gb|AHB19226.1| non specific lipid transfer protein 1B [Punica granatum]
Length=120

 Score = 83.6 bits (205),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 66/116 (57%), Gaps = 5/116 (4%)
 Frame = +1

Query  49   KLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLL  225
             L   +F  ++VA +     VE+ VTC  V + L PC  Y   +   PS+ CC+G++SL 
Sbjct  9    NLVPALFLCMVVAASV----VESAVTCGQVTSSLTPCIPYARGVVAAPSAACCSGVRSLN  64

Query  226  SAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            +AA T  DRQT C+CLK +A S+      R  ++P KC  +IP+ IS   DCS V+
Sbjct  65   NAAKTTPDRQTACNCLKVIARSITGINYGRVGALPGKCGVSIPYKISPSTDCSRVK  120



>ref|XP_006644921.1| PREDICTED: non-specific lipid-transfer protein 6-like [Oryza 
brachyantha]
Length=120

 Score = 83.6 bits (205),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 62/99 (63%), Gaps = 1/99 (1%)
 Frame = +1

Query  100  PYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKS  279
            P GV A ++C  V   L PC  YV  G      CC G++SLL+AA+   DR+T+C CLKS
Sbjct  22   PGGVRAAISCSAVYNTLMPCLPYVQAGGTVPRACCGGIQSLLAAANNTPDRRTICGCLKS  81

Query  280  LASSVNDAQ-LARAASIPDKCDATIPFTISRDVDCSAVQ  393
            +A+  +    + RAA++P KC+ ++P+ IS  V+C+A+ 
Sbjct  82   VANGASGGPYITRAAALPSKCNVSLPYKISTSVNCNAIN  120



>ref|XP_006362359.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=115

 Score = 83.6 bits (205),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 69/117 (59%), Gaps = 6/117 (5%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            M + +K+   VF  ++V    AP+  EA ++C  V++ L PC  Y L G GP   CC G+
Sbjct  1    MEMVSKIVCFVFLCMVV---VAPHA-EA-MSCSQVSSSLAPCVPY-LQGRGPLGGCCGGV  54

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCS  384
            KSL+ A  T  DR+T C+C+KS+A++V      RAA +P  C   IP+ IS  VDCS
Sbjct  55   KSLVGAIKTPADRRTACTCIKSVANAVKGLDTGRAAGLPSTCGVNIPYDISPSVDCS  111



>gb|AAT68262.1| lipid transfer protein [Nicotiana glauca]
Length=117

 Score = 83.6 bits (205),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 66/112 (59%), Gaps = 1/112 (1%)
 Frame = +1

Query  58   LTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAAS  237
            L V  +  V+    P+  +A ++C  V + L PC SYV  G    + CCNG++SL + A+
Sbjct  7    LVVVCMAAVSVMLTPHA-DAAISCGQVVSSLTPCISYVTKGGAIPAPCCNGIESLNNQAT  65

Query  238  TQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            +  DRQT C+C+KS A+S+     + A S+P KC   +P+ IS  +DCS VQ
Sbjct  66   STPDRQTACNCIKSAAASIKGINFSLAGSLPGKCGVNLPYKISPSIDCSTVQ  117



>emb|CCD33109.1| lipid transfer protein [Vigna radiata]
Length=116

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 58/91 (64%), Gaps = 0/91 (0%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            +TC  V + L PC SY+  G  PS+ CC+G+K+L SAAST  DR+T C+CLK+LA   + 
Sbjct  26   ITCGQVASSLAPCISYLQKGGVPSASCCSGVKALNSAASTTADRKTACNCLKNLAGPKSG  85

Query  301  AQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
                 AAS+P KC   +P+ IS   +C+ ++
Sbjct  86   INEGNAASLPGKCKVNVPYKISTSTNCANIK  116



>gb|AAX20049.1| putative non-specific lipid transfer protein [Capsicum annuum]
Length=114

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 63/112 (56%), Gaps = 4/112 (4%)
 Frame = +1

Query  58   LTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAAS  237
            +  F LL +    AP+  EA + C  V + + PC  Y L+G GP   CC G+K L+ AA 
Sbjct  7    IACFVLLCMV-VVAPH-AEA-LNCGQVTSAMAPCVPY-LMGRGPLGGCCGGVKGLMGAAK  62

Query  238  TQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            T  DR+T C+CLKS A+S+      +AA +P  C   IP+ IS   DCS VQ
Sbjct  63   TPADRKTACTCLKSAANSMKGIDAGKAAGLPAACGVNIPYKISPSTDCSKVQ  114



>ref|XP_002442776.1| hypothetical protein SORBIDRAFT_08g002690 [Sorghum bicolor]
 gb|EES16614.1| hypothetical protein SORBIDRAFT_08g002690 [Sorghum bicolor]
Length=119

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 59/95 (62%), Gaps = 1/95 (1%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLAS  288
            EA ++C  V++ + PC SY    G  PS+ CC+G++SL SAA T  DR+  C+CLK+ A 
Sbjct  25   EAAISCGQVSSAIAPCLSYARGQGSAPSAGCCSGVRSLNSAARTTADRRAACNCLKNAAR  84

Query  289  SVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             ++      AASIP KC  ++P+TIS   DCS V 
Sbjct  85   GISGLNAGNAASIPSKCGVSVPYTISTSTDCSRVN  119



>gb|ABY54820.1| lipid transfer protein [Arachis diogoi]
Length=116

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 67/116 (58%), Gaps = 2/116 (2%)
 Frame = +1

Query  46   AKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLL  225
            A L      L+ +A   AP  V A ++C  VN+ L PC +++  G  PS  CC+G++ LL
Sbjct  2    AGLKFAFVMLVCMAMVGAPM-VNA-LSCGQVNSALAPCITFLTKGGAPSPPCCSGVRGLL  59

Query  226  SAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             AA T  DRQ  C+CLK+ A SV+      AA++P +C  +IP+ IS   +C+ ++
Sbjct  60   GAAKTTADRQAACNCLKAAAGSVHGLNQGNAAALPGRCGVSIPYKISTSTNCATIK  115



>gb|ADK60918.1| lipid transfer protein [Castanea sativa]
Length=118

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 68/121 (56%), Gaps = 4/121 (3%)
 Frame = +1

Query  34   MAVSAKLYLTVFALL-LVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNG  210
            MA S  L LT  A++ +V GA      +A ++C  V + L  C  Y+  G  P+  CCNG
Sbjct  1    MASSLVLKLTCLAVMCMVIGAPV---AQAAISCGQVQSSLVACIPYLRSGGSPTQACCNG  57

Query  211  LKSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAV  390
            +KSL +AA T  DRQ  C CLK+ A S++    A AAS+P KC   +P+ IS   +C  V
Sbjct  58   VKSLNNAAKTTADRQAACECLKTAAGSISGLSPANAASLPGKCGVNVPYKISTSTNCKNV  117

Query  391  Q  393
            +
Sbjct  118  K  118



>emb|CBW38498.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 60/99 (61%), Gaps = 2/99 (2%)
 Frame = +1

Query  97   APYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLK  276
            APY  EA ++C  V++ L PC SY+  G      CC+G+KSL SAA T  DRQ  C CLK
Sbjct  6    APY-TEA-LSCGQVSSSLAPCISYLTKGGAVPPACCSGVKSLNSAAKTTPDRQAACGCLK  63

Query  277  SLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            S  +S++      AAS+P KC  +IP+ IS   DCS VQ
Sbjct  64   SAYNSISGVNAGNAASLPGKCGVSIPYKISPSTDCSKVQ  102



>pdb|1T12|A Chain A, Solution Structure Of A New Ltp1
Length=91

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 56/91 (62%), Gaps = 1/91 (1%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            +TC  V ++L PC +Y L   GP   CC G+K+L+++A T  DRQ  C+CLKS A +++ 
Sbjct  2    ITCGQVTSNLAPCLAY-LRNTGPLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISG  60

Query  301  AQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
              L +AA +P  C   IP+ IS   DCS VQ
Sbjct  61   INLGKAAGLPSTCGVNIPYKISPSTDCSKVQ  91



>ref|XP_008662435.1| PREDICTED: non-specific lipid-transfer protein [Zea mays]
 gb|ACG24030.1| nonspecific lipid-transfer protein 2 precursor [Zea mays]
 gb|AFW55967.1| phospholipid transfer protein-like protein [Zea mays]
Length=121

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 58/92 (63%), Gaps = 1/92 (1%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVN  297
            ++C  V + + PC SY    G GPS+ CC+G+KSL +AA T  DR+  C+CLK+ A+ V+
Sbjct  30   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVKSLNNAARTTADRRAACNCLKNAAAGVS  89

Query  298  DAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
                  AASIP KC  +IP+TIS   DCS V 
Sbjct  90   GLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  121



>dbj|BAK04894.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=120

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 56/96 (58%), Gaps = 0/96 (0%)
 Frame = +1

Query  103  YGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSL  282
            +  +A ++C  VN+ L PC +Y   G GPS+ CC+G+K L +A  T  DR+  CSCLK  
Sbjct  24   HTADATISCGQVNSALAPCLTYARGGTGPSAACCSGVKRLAAATQTTVDRRAACSCLKMA  83

Query  283  ASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAV  390
               ++  +    ASIP KC  +IP+ +   VDCS V
Sbjct  84   TGRISGLKAGNIASIPSKCGVSIPYAVGASVDCSRV  119



>gb|AAC63372.1| lipid transfer protein [Brassica oleracea]
Length=118

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 68/122 (56%), Gaps = 6/122 (5%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGP-SSDCCNG  210
            MA   KL   V A ++VAG   P    A +TC TVN+++ PC  Y+  G GP    CC G
Sbjct  1    MAGVMKLACLVLACMIVAG---PITANAALTCGTVNSNVAPCIGYITQG-GPLPRACCTG  56

Query  211  LKSLLSAASTQTDRQTVCSCLKSLASSVN-DAQLARAASIPDKCDATIPFTISRDVDCSA  387
            +  L S A T  DRQ  C CLK+ AS++  +    RAA IP  C  ++PF IS + +C+ 
Sbjct  57   VSKLNSMARTTPDRQQACRCLKTAASALGPNLNAGRAAGIPKACGVSVPFPISTNTNCNN  116

Query  388  VQ  393
            V+
Sbjct  117  VK  118



>ref|XP_004302622.1| PREDICTED: non-specific lipid-transfer protein 3-like [Fragaria 
vesca subsp. vesca]
Length=122

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 66/122 (54%), Gaps = 2/122 (2%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            MA S    +    +L +A A +  G EA +TC  V   L PC SYV  G  P+++CC G+
Sbjct  1    MAFSGVQKVVFLVVLSMAAALSIGGAEAALTCGQVVNKLMPCVSYVQNGGTPAANCCGGI  60

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSV--NDAQLARAASIPDKCDATIPFTISRDVDCSA  387
            ++L   A T  DRQ+VC+CLK   + +    A    AA +P KC   IP+ I+   DC +
Sbjct  61   RALYGMAQTTPDRQSVCNCLKQAIAGIPYTGANAGLAAGLPGKCGVNIPYKINPSTDCKS  120

Query  388  VQ  393
            ++
Sbjct  121  IK  122



>gb|ABA33857.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=120

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 59/95 (62%), Gaps = 1/95 (1%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLAS  288
            EA ++C  V + + PC SY    G  PS+ CC+G++SL +AA T  DR+  C+CLK+ A+
Sbjct  26   EAAISCGQVASAIAPCISYARGQGSAPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAA  85

Query  289  SVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             V+      AASIP KC  +IP+TIS   DCS V 
Sbjct  86   GVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  120



>gb|KFK36745.1| hypothetical protein AALP_AA4G164400 [Arabis alpina]
Length=118

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 66/121 (55%), Gaps = 4/121 (3%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            MA   KL   VFA ++VAG   P    A + C  VN+ + PC  Y+L G   +  CCNG+
Sbjct  1    MAGLMKLACLVFACMIVAG---PITSNAALGCGQVNSAVAPCIGYILQGGAVTPGCCNGI  57

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDA-QLARAASIPDKCDATIPFTISRDVDCSAV  390
            + L  AA T  DR+  C CLK+ A+++       RAA +P  C  ++PF IS   +C+ V
Sbjct  58   RRLNGAARTTPDRKAACQCLKNAAAALGPGLNAGRAAGLPRACGVSVPFPISTSTNCNNV  117

Query  391  Q  393
            +
Sbjct  118  K  118



>ref|XP_003605269.1| Non-specific lipid-transfer protein [Medicago truncatula]
Length=166

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 56/91 (62%), Gaps = 0/91 (0%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASS  291
            +A ++C TV + LGPC  Y+  G GPS  CC G+K L  AA+T  DRQ  C+CLK  A +
Sbjct  22   DAAISCGTVTSALGPCIGYLKGGPGPSPACCGGVKRLNGAAATTPDRQAACNCLKQAAGA  81

Query  292  VNDAQLARAASIPDKCDATIPFTISRDVDCS  384
            ++    A A+++P KC   IP+ IS   +C+
Sbjct  82   ISGLNTAAASALPGKCGVNIPYKISTSTNCA  112



>ref|XP_004249042.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
lycopersicum]
Length=116

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 61/110 (55%), Gaps = 3/110 (3%)
 Frame = +1

Query  64   VFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQ  243
            +  L +V    AP+  EA VTC  V + + PC  Y L G GP   CC G+K LL AA T 
Sbjct  10   IVVLCMVVTLVAPH-AEA-VTCGQVTSGVAPCLPY-LTGRGPLGGCCGGIKGLLGAARTP  66

Query  244  TDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             DR+  C+CLKS A+++      +AA +P  C   IP+ IS   DC+ VQ
Sbjct  67   ADRKMACNCLKSAATAIKGIDAGKAAGLPSVCGVNIPYKISPSTDCNRVQ  116



>gb|ABA34089.1| phospholipid transfer protein 2 [Zea mays subsp. parviglumis]
 gb|ABA34091.1| phospholipid transfer protein 2 [Zea mays subsp. parviglumis]
Length=119

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVN  297
            +TC  V++ + PC SY    G  PS+ CC+G+++L SAAST  DR+  C+CLK+ A  V+
Sbjct  30   ITCGQVSSAIAPCLSYARGTGSAPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVS  89

Query  298  DAQLARAASIPDKCDATIPFTISRDVDCS  384
                  AASIP KC  +IP+TIS   DCS
Sbjct  90   GLNAGNAASIPSKCGVSIPYTISTSTDCS  118



>gb|ACE80968.1| putative allergen Pru du 3.03 [Prunus dulcis x Prunus persica]
Length=116

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 65/117 (56%), Gaps = 3/117 (3%)
 Frame = +1

Query  43   SAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSL  222
            S K+   +F  ++VA   AP   EA +TC  +   L PC  Y+  G  P+  CC G+K L
Sbjct  3    SLKVVCALFMCMVVA---APLITEAALTCPQIQAGLAPCLGYLQRGGVPAGGCCPGIKRL  59

Query  223  LSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            + +A+T  DRQ  C CLK++A +V       AA++P  C   IP+ IS   +C++V+
Sbjct  60   VGSATTTADRQNACKCLKTVAGAVKGINTGYAAALPSLCGVKIPYKISASTNCNSVK  116



>ref|XP_010683514.1| PREDICTED: non-specific lipid-transfer protein-like [Beta vulgaris 
subsp. vulgaris]
Length=119

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 67/112 (60%), Gaps = 7/112 (6%)
 Frame = +1

Query  64   VFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIG--PSSDCCNGLKSLLSAAS  237
            +F  ++VA   AP+  EA + C  V +++ PC SY L+G    P S CC G+K L + AS
Sbjct  13   IFLCMVVA---APH-AEAAMNCGMVASNVAPCLSY-LMGSAKQPPSGCCAGIKKLKNMAS  67

Query  238  TQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            T  DR+T C CLKS A+++ +    +AA +P +C  +IP+ IS   DCS V 
Sbjct  68   TPMDRRTACGCLKSAATAMKNMNYGKAAGLPKQCGVSIPYAISPKTDCSRVN  119



>pdb|1FK0|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Capric Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1FK1|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Lauric Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1FK2|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Myristic Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1FK3|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Palmitoleic Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1FK4|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Stearic Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1FK5|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Oleic Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1FK6|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Alpha-Linolenic Acid 
Revealed By High-Resolution X-Ray Crystallography
 pdb|1FK7|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize 
Lipid-Transfer Protein Complexes With Ricinoleic Acid Revealed 
By High-Resolution X-Ray Crystallography
 pdb|1AFH|A Chain A, Lipid Transfer Protein From Maize Seedlings, Nmr, 15 
Structures
 pdb|1MZL|A Chain A, Maize Nonspecific Lipid Transfer Protein
 pdb|1MZM|A Chain A, Maize Nonspecific Lipid Transfer Protein Complexed With 
Palmitate
Length=93

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 58/92 (63%), Gaps = 1/92 (1%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVN  297
            ++C  V + + PC SY    G GPS+ CC+G++SL +AA T  DR+  C+CLK+ A+ V+
Sbjct  2    ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS  61

Query  298  DAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
                  AASIP KC  +IP+TIS   DCS V 
Sbjct  62   GLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  93



>gb|ABA33854.1| phospholipid transfer protein 1 [Zea mays subsp. parviglumis]
Length=121

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 58/92 (63%), Gaps = 1/92 (1%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVN  297
            ++C  V + + PC SY    G GPS+ CC+G++SL +AA T  DR+  C+CLK+ A+ V+
Sbjct  30   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLKNAARTTADRRAACNCLKNAAAGVS  89

Query  298  DAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
                  AASIP KC  +IP+TIS   DCS V 
Sbjct  90   GLNAGNAASIPSKCGVSIPYTISTSTDCSRVN  121



>ref|XP_003605309.1| Non-specific lipid-transfer protein [Medicago truncatula]
Length=545

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 63/107 (59%), Gaps = 1/107 (1%)
 Frame = +1

Query  73   LLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDR  252
            LL++    AP   EA +TC TV   L PC  Y+  G GPS+ CC G+K L SAA+T  DR
Sbjct  439  LLMMCIIVAPM-AEAAITCGTVTGSLAPCIGYLKGGSGPSAACCGGVKRLNSAATTTPDR  497

Query  253  QTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            Q  C+CLKS A +++      AA +P KC   IP+ IS   +C+ ++
Sbjct  498  QAACNCLKSAAGAISGLNPNIAAGLPGKCGVNIPYKISTSTNCATIR  544


 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 55/90 (61%), Gaps = 0/90 (0%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASS  291
            +A ++C TV + LGPC  Y+  G GPS  CC G+K L  AA+T  DRQ  C+CLK  A +
Sbjct  22   DAAISCGTVTSALGPCIGYLKGGPGPSPACCGGVKRLNGAAATTPDRQAACNCLKQAAGA  81

Query  292  VNDAQLARAASIPDKCDATIPFTISRDVDC  381
            ++    A A+++P KC   IP+ IS   +C
Sbjct  82   ISGLNTAAASALPGKCGVNIPYKISTSTNC  111



>gb|ABA96286.1| Nonspecific lipid-transfer protein 3 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAY82041.1| hypothetical protein OsI_37228 [Oryza sativa Indica Group]
 gb|EAZ19437.1| hypothetical protein OsJ_34998 [Oryza sativa Japonica Group]
Length=118

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 52/95 (55%), Gaps = 0/95 (0%)
 Frame = +1

Query  106  GVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLA  285
            G  A +TC  V + + PC SYV    G +  CCNG+K L +AA T  DRQ  C CLKSLA
Sbjct  23   GASAAITCGQVGSAIAPCISYVTGRSGLTQGCCNGVKGLNNAARTTADRQAACRCLKSLA  82

Query  286  SSVNDAQLARAASIPDKCDATIPFTISRDVDCSAV  390
             S+    L   A +P KC   + F IS   DC+ V
Sbjct  83   GSIKSLNLGTVAGVPGKCGVNVGFPISLSTDCNKV  117



>ref|XP_009615065.1| PREDICTED: non-specific lipid-transfer protein 1 {ECO:0000303|PubMed:19958316}-like 
[Nicotiana tomentosiformis]
Length=125

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 79/128 (62%), Gaps = 11/128 (9%)
 Frame = +1

Query  34   MAVSA--KLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSD---  198
            MA+S   K+   +F L +V  + +    EA ++C TV ++L PC SY++   G S     
Sbjct  1    MAISKMQKVSACLFLLCMVVISFSSPHAEAAISCSTVYSNLAPCLSYLM---GSSKQAAP  57

Query  199  --CCNGLKSLLSAASTQTDRQTVCSCLKSLASSVNDA-QLARAASIPDKCDATIPFTISR  369
              CC+G++SL +AAST  DRQ+VCSCLK+ A+S+  +    +AA++  KC  T+P+ IS 
Sbjct  58   AGCCSGIQSLYTAASTTADRQSVCSCLKAGAASLGSSIDTNKAATLLSKCGVTVPYKISP  117

Query  370  DVDCSAVQ  393
            ++DCS V 
Sbjct  118  NIDCSKVH  125



>gb|AAA03283.1| CW18=non-specific lipid transfer protein [barley, cv. Bomi, leaves, 
Peptide, 90 aa]
Length=90

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 56/92 (61%), Gaps = 4/92 (4%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVN  297
            +TC  V++ LGPC +Y    G  PS+ CC+G+K L   A +  D+Q  C CLKS+A + N
Sbjct  2    ITCGQVSSALGPCAAYAKGSGTSPSAGCCSGVKRLAGLARSTADKQATCRCLKSVAGAYN  61

Query  298  DAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
                 RAA IP +C  ++P+TIS  VDCS + 
Sbjct  62   ---AGRAAGIPSRCGVSVPYTISASVDCSKIH  90



>emb|CDM80963.1| unnamed protein product [Triticum aestivum]
 emb|CDM80970.1| unnamed protein product [Triticum aestivum]
Length=115

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 61/95 (64%), Gaps = 4/95 (4%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLAS  288
            EA V+C  V++ L PC SY    G  PS+ CC+G++SL S+A +  D+Q  C C+KS A+
Sbjct  24   EAAVSCGQVSSALSPCISYARGNGANPSAACCSGVRSLASSARSTADKQAACKCIKSAAA  83

Query  289  SVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
             +N     +AA IP KC  ++P+TIS  VDCS ++
Sbjct  84   GLN---AGKAAGIPTKCGVSVPYTISSSVDCSKIR  115



>gb|AAQ74628.1| lipid tranfer protein II [Vigna radiata]
 emb|CCF23017.1| lipid transfer protein [Vigna radiata]
 emb|CCF23314.1| lipid transfer protein [Vigna radiata]
Length=116

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 58/91 (64%), Gaps = 0/91 (0%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            +TC  V + L PC SY+  G  PS+ CC+G+K+L SAAST  DR+T C+CLK+LA   + 
Sbjct  26   ITCGQVASSLAPCISYLQKGGVPSASCCSGVKALNSAASTTADRKTACNCLKNLAGPKSG  85

Query  301  AQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
                 AAS+P KC   +P+ IS   +C+ ++
Sbjct  86   INEGNAASLPGKCKVNVPYKISTFTNCANIK  116



>gb|ABU49731.1| putative non-specific lipid transfer protein a1 [Solanum tuberosum]
Length=114

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 53/91 (58%), Gaps = 1/91 (1%)
 Frame = +1

Query  121  VTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVND  300
            ++C  V + L PC  Y L G GP   CC G+K LL AA T  DR+T C+CLKS A+S+  
Sbjct  25   LSCGEVTSGLAPCLPY-LQGRGPIGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKG  83

Query  301  AQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
                +A  +P  C  +IP+ IS   DCS VQ
Sbjct  84   IDTGKAVGLPGVCGVSIPYKISPSTDCSKVQ  114



>gb|ABA34092.1| phospholipid transfer protein 2 [Zea mays subsp. parviglumis]
 gb|ABA34093.1| phospholipid transfer protein 2 [Zea mays subsp. parviglumis]
 tpg|DAA59230.1| TPA: phospholipid transfer protein-like protein [Zea mays]
Length=119

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = +1

Query  127  CDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVNDA  303
            C  V++ + PC SY    G GPS+ CC+G+++L SAAST  DR+  C+CLK+ A  V+  
Sbjct  32   CGQVSSAIAPCLSYARGTGSGPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGL  91

Query  304  QLARAASIPDKCDATIPFTISRDVDCS  384
                AASIP KC  +IP+TIS   DCS
Sbjct  92   NAGNAASIPSKCGVSIPYTISTSTDCS  118



>gb|ACJ62326.1| lipid-transfer protein [Zea mays subsp. parviglumis]
Length=121

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 56/90 (62%), Gaps = 1/90 (1%)
 Frame = +1

Query  127  CDTVNTDLGPCGSYVL-IGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASSVNDA  303
            C  V++ + PC SY    G  PS+ CC+G++SL SAAST  DR+  C+CLK+ A  V+  
Sbjct  32   CGQVSSAIAPCLSYARGTGSAPSASCCSGVRSLKSAASTAADRRAACNCLKNAARGVSGL  91

Query  304  QLARAASIPDKCDATIPFTISRDVDCSAVQ  393
                AASIP KC  +IP+TIS   DCS V 
Sbjct  92   NAGNAASIPSKCGVSIPYTISTSTDCSRVN  121



>gb|AAL32039.1|AF439280_1 lipid transfer protein-like protein [Retama raetam]
Length=117

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 70/117 (60%), Gaps = 3/117 (3%)
 Frame = +1

Query  43   SAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSL  222
            S K+   V   +++ GA AP  +   +TC  V ++L PC +Y+  G      CCNG+K+L
Sbjct  3    SIKVACVVLICMVMVGA-AP--IAQAITCGQVVSNLTPCITYLQRGGAVPGQCCNGVKTL  59

Query  223  LSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            +S+A T  D+QT C+CLKS A+++ +     A S+P KC   +P+ IS   +C++++
Sbjct  60   VSSAQTTADKQTACNCLKSTAATIPNINFGNAGSLPGKCGVNLPYKISPSTNCASIK  116



>ref|XP_007033544.1| Non-specific lipid-transfer protein 3, putative [Theobroma cacao]
 gb|EOY04470.1| Non-specific lipid-transfer protein 3, putative [Theobroma cacao]
Length=122

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 66/123 (54%), Gaps = 4/123 (3%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSD-CCNG  210
            MA S  L L    L++    +A     A VTC  V   L PC SYV  G GP  D CCNG
Sbjct  1    MASSGVLKLASLMLVVCMVVSATLQARAAVTCGDVVRTLTPCISYVQYG-GPLPDNCCNG  59

Query  211  LKSLLSAASTQTDRQTVCSCLKSLAS--SVNDAQLARAASIPDKCDATIPFTISRDVDCS  384
            +K+L   A T  DRQ VC C+KS  +  S ++  L  AA +P KC   +P+TIS   DC+
Sbjct  60   VKTLYGEAQTSADRQNVCKCIKSAVNGFSYSNFNLGLAAGLPGKCGLHLPYTISPSTDCN  119

Query  385  AVQ  393
             VQ
Sbjct  120  KVQ  122



>ref|XP_008391369.1| PREDICTED: non-specific lipid-transfer protein [Malus domestica]
Length=113

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 67/118 (57%), Gaps = 7/118 (6%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGP-SSDCCNG  210
            MA SA + L +   L +A       V   +TC  V+++L PC  Y L G GP    CCNG
Sbjct  1    MASSAVIKLALVVALCMA-----VSVAHAITCGQVSSNLAPCIGY-LRGGGPVPPACCNG  54

Query  211  LKSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCS  384
            ++++ S A T  DRQ VC+CLKSLASSV+      A S+P KC   +P+ IS   +C+
Sbjct  55   IRTINSLAETTPDRQAVCNCLKSLASSVSGVNPGNAESLPGKCGVNVPYKISTSTNCT  112



>ref|XP_011095135.1| PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum 
indicum]
 gb|ABQ53934.1| lipid transfer protein [Sesamum indicum]
Length=118

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 55/93 (59%), Gaps = 1/93 (1%)
 Frame = +1

Query  112  EAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGLKSLLSAASTQTDRQTVCSCLKSLASS  291
            EA + C +V + LG C  YV    GP   CC+G+K L  AA T  DRQ  CSCLK+LAS+
Sbjct  26   EAALGCGSVISYLGSCRPYV-TDKGPLGGCCSGVKGLYKAAKTTADRQATCSCLKTLAST  84

Query  292  VNDAQLARAASIPDKCDATIPFTISRDVDCSAV  390
                 L++AA +P +C   IP+ IS   DCS V
Sbjct  85   YKGVNLSKAAGLPQQCGVNIPYKISPSTDCSKV  117



>emb|CDP14199.1| unnamed protein product [Coffea canephora]
Length=117

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 69/120 (58%), Gaps = 3/120 (3%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            MA  A +   V   +LVA + AP+  EA +TC+TV  DLG C  Y+  G    + CC G+
Sbjct  1    MAKFAGVACLVLMCMLVAVSLAPH-AEA-ITCNTVAGDLGACLGYLQKGGAVPAGCCTGI  58

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            +SL S A T  DR+T CSCLKSLA  V   Q   AA +P KC   + + IS   +C++VQ
Sbjct  59   RSLNSQAKTTVDRRTACSCLKSLAGRVRVNQ-GLAAGLPGKCGVNVGYPISTSTNCNSVQ  117



>ref|XP_011007240.1| PREDICTED: non-specific lipid-transfer protein 1-like [Populus 
euphratica]
Length=118

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 68/120 (57%), Gaps = 2/120 (2%)
 Frame = +1

Query  34   MAVSAKLYLTVFALLLVAGATAPYGVEAQVTCDTVNTDLGPCGSYVLIGIGPSSDCCNGL  213
            MA S  L L   A+L+    +AP   EA +TC  V++ L  C  Y+  G    + CC+GL
Sbjct  1    MASSMSLKLAC-AMLVAMVVSAPL-AEAAITCGQVSSSLAQCIGYLQKGGAVPAACCSGL  58

Query  214  KSLLSAASTQTDRQTVCSCLKSLASSVNDAQLARAASIPDKCDATIPFTISRDVDCSAVQ  393
            KSL SAA+T  DRQ VC+CLKSLA  ++      AA +P KC  +I + IS   DC  V+
Sbjct  59   KSLNSAAATTPDRQGVCNCLKSLAGKISGLNYGLAAGLPSKCGVSISYKISPSTDCKTVK  118



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1067077997832