BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79895_g1_i1 len=480 path=[458:0-479]

Length=480
                                                                      Score     E

ref|YP_001468360.1|  cytochrome c biogenesis protein                    287   3e-94   Ipomoea purpurea
gb|AGW97492.1|  cytochrome c heme attachment protein                    287   3e-94   
gb|AGW97322.1|  cytochrome c heme attachment protein                    287   3e-94   
gb|AGW98085.1|  cytochrome c heme attachment protein                    287   4e-94   
gb|AGW96388.1|  cytochrome c heme attachment protein                    287   4e-94   
gb|AGW98425.1|  cytochrome c heme attachment protein                    287   5e-94   
gb|AGW98001.1|  cytochrome c heme attachment protein                    287   5e-94   
gb|AGW96642.1|  cytochrome c heme attachment protein                    287   5e-94   
gb|AGW97067.1|  cytochrome c heme attachment protein                    286   9e-94   
gb|AGW98255.1|  cytochrome c heme attachment protein                    285   2e-93   
gb|AGW97152.1|  cytochrome c heme attachment protein                    285   2e-93   
gb|AGW96982.1|  cytochrome c heme attachment protein                    285   2e-93   
gb|AGW98510.1|  cytochrome c heme attachment protein                    284   5e-93   
gb|AGW98596.1|  cytochrome c heme attachment protein                    280   3e-91   
gb|AGW98766.1|  cytochrome c heme attachment protein                    280   3e-91   
gb|AGW98681.1|  cytochrome c heme attachment protein                    280   4e-91   
gb|AGW99020.1|  cytochrome c heme attachment protein                    279   7e-91   
gb|AGW96725.1|  cytochrome c heme attachment protein                    278   1e-90   
gb|AGW98850.1|  cytochrome c heme attachment protein                    278   1e-90   
gb|AGW98936.1|  cytochrome c heme attachment protein                    278   1e-90   
gb|AGW97662.1|  cytochrome c heme attachment protein                    277   4e-90   
gb|AGW97745.1|  cytochrome c heme attachment protein                    276   7e-90   
gb|AGW97407.1|  cytochrome c heme attachment protein                    276   1e-89   
gb|AGW98170.1|  cytochrome c heme attachment protein                    275   2e-89   
gb|AGW97237.1|  cytochrome c heme attachment protein                    263   7e-85   
gb|AEQ36987.1|  cytochrome c biogenesis protein                         234   2e-73   
ref|YP_006503841.1|  cytochrome c biogenesis protein                    234   2e-73   
ref|YP_004891665.1|  ccsA gene product                                  233   7e-73   
ref|NP_054556.1|  cytochrome c biogenesis protein                       233   7e-73   Nicotiana tabacum [American tobacco]
ref|YP_008563138.1|  cytochrome c heme attachment protein               231   3e-72   
ref|YP_538899.1|  cytochrome c biogenesis protein                       231   4e-72   Solanum bulbocastanum [ornamental nightshade]
ref|YP_006666079.1|  cytochrome c heme attachment protein               231   5e-72   
ref|YP_398922.1|  cytochrome c biogenesis protein                       230   6e-72   Nicotiana tomentosiformis
gb|ADD30951.1|  cytochrome c heme attachment protein                    230   9e-72   Aucuba japonica
ref|YP_009040371.1|  cytochrome c heme attachment protein               227   1e-70   
ref|NP_783281.1|  cytochrome c biogenesis protein                       227   2e-70   Atropa belladonna [deadly nightshade]
gb|AIW05228.1|  cytochrome c biogenesis protein                         226   3e-70   
gb|AIW05991.1|  cytochrome c biogenesis protein                         226   4e-70   
gb|ADD30955.1|  cytochrome c heme attachment protein                    226   5e-70   Lonicera japonica [Japanese honeysuckle]
gb|ADM92648.1|  cytochrome c heme attachment protein                    225   6e-70   
gb|ADD30953.1|  cytochrome c heme attachment protein                    224   3e-69   Ehretia acuminata
ref|YP_008815080.1|  cytochrome c heme attachment protein               223   7e-69   
gb|AIW05482.1|  cytochrome c biogenesis protein                         223   8e-69   
ref|YP_004935602.1|  cytochrome c biogenesis protein                    221   3e-68   
ref|YP_008815167.1|  cytochrome c heme attachment protein               221   3e-68   
ref|YP_008814993.1|  cytochrome c heme attachment protein               221   3e-68   
gb|AGJ51296.1|  cytochrome c biogenesis protein                         221   4e-68   
gb|AIW05398.1|  cytochrome c biogenesis protein                         221   4e-68   
ref|YP_009108723.1|  cytochrome c biogenesis protein                    221   4e-68   
gb|AII18502.1|  cytochrome c heme attachment protein                    220   6e-68   
gb|AII18495.1|  cytochrome c heme attachment protein                    220   6e-68   
gb|AII18490.1|  cytochrome c heme attachment protein                    220   6e-68   
ref|YP_008815254.1|  cytochrome c heme attachment protein               220   7e-68   
gb|AII18493.1|  cytochrome c heme attachment protein                    220   8e-68   
ref|YP_008814906.1|  cytochrome c heme attachment protein               220   8e-68   
gb|AII18489.1|  cytochrome c heme attachment protein                    219   1e-67   
ref|YP_009108892.1|  cytochrome c biogenesis protein                    219   1e-67   
gb|AII18497.1|  cytochrome c heme attachment protein                    219   1e-67   
gb|AII18499.1|  cytochrome c heme attachment protein                    219   1e-67   
gb|AII18494.1|  cytochrome c heme attachment protein                    219   1e-67   
gb|AII18498.1|  cytochrome c heme attachment protein                    219   1e-67   
gb|AII18504.1|  cytochrome c heme attachment protein                    219   2e-67   
ref|YP_008578588.1|  cytochrome c biogenesis protein (chloroplast)      219   2e-67   
gb|AER52625.1|  cytochrome c biogenesis protein                         219   2e-67   
gb|AII18505.1|  cytochrome c heme attachment protein                    218   4e-67   
gb|AII18510.1|  cytochrome c heme attachment protein                    218   4e-67   
gb|ADD30964.1|  cytochrome c heme attachment protein                    218   5e-67   Cornus florida [flowering dogwood]
gb|AII18507.1|  cytochrome c heme attachment protein                    218   5e-67   
gb|ADD30962.1|  cytochrome c heme attachment protein                    218   6e-67   Berberidopsis corallina
ref|YP_009108808.1|  cytochrome c biogenesis protein                    218   6e-67   
gb|AII18500.1|  cytochrome c heme attachment protein                    218   8e-67   
gb|AII18508.1|  cytochrome c heme attachment protein                    218   8e-67   
gb|AII18503.1|  cytochrome c heme attachment protein                    218   8e-67   
gb|AER53110.1|  cytochrome c biogenesis protein                         217   1e-66   
gb|AER52461.1|  cytochrome c biogenesis protein                         217   1e-66   
gb|AIW05821.1|  cytochrome c biogenesis protein                         216   2e-66   
gb|AER52707.1|  cytochrome c biogenesis protein                         216   3e-66   
ref|YP_087015.1|  cytochrome c biogenesis protein                       216   3e-66   Panax ginseng [Asiatic ginseng]
gb|ADD30954.1|  cytochrome c heme attachment protein                    216   3e-66   Ilex cornuta [Chinese holly]
gb|ADZ36402.1|  c-type cytochrome synthesis protein                     216   4e-66   
gb|AGW04868.1|  cytochrome c biogenesis protein                         215   7e-66   
gb|AII18506.1|  cytochrome c heme attachment protein                    214   1e-65   
ref|YP_008815986.1|  cytochrome c biogenesis protein                    214   1e-65   
gb|AGW04334.1|  cytochrome c biogenesis protein                         214   1e-65   
ref|YP_007353964.1|  cytochrome c biogenesis protein                    214   1e-65   
gb|AGW04637.1|  cytochrome c biogenesis protein                         214   1e-65   
gb|AIW05906.1|  cytochrome c biogenesis protein                         214   2e-65   
gb|AGW05022.1|  cytochrome c biogenesis protein                         214   3e-65   
ref|YP_008578671.1|  cytochrome c biogenesis protein (chloroplast)      213   3e-65   
gb|AGW04791.1|  cytochrome c biogenesis protein                         213   4e-65   
gb|AGW04563.1|  cytochrome c biogenesis protein                         213   6e-65   
ref|YP_567127.1|  cytochrome c biogenesis protein                       213   8e-65   Vitis vinifera
gb|AGW04488.1|  cytochrome c biogenesis protein                         212   8e-65   
ref|YP_008081315.1|  cytochrome c biogenetis protein (chloroplast)      212   1e-64   
gb|ADZ36578.1|  c-type cytochrome synthesis protein                     211   2e-64   
ref|YP_008964413.1|  cytochrome c heme attachment protein               211   2e-64   
ref|YP_008964498.1|  cytochrome c heme attachment protein               211   2e-64   
ref|YP_009041136.1|  cytochrome c biogenesis protein                    211   3e-64   
ref|YP_008963741.1|  cytochrome c heme attachment protein               211   3e-64   
gb|ADD30969.1|  cytochrome c heme attachment protein                    211   4e-64   Liquidambar styraciflua [American sweet gum]
gb|AGW04411.1|  cytochrome c biogenesis protein                         210   4e-64   
gb|ADM92649.1|  cytochrome c heme attachment protein                    210   5e-64   
ref|YP_009019840.1|  cytochrome c biogenesis protein                    210   5e-64   
ref|YP_740166.1|  cytochrome c heme attachment protein                  210   5e-64   Daucus carota [carrots]
ref|YP_817531.1|  cytochrome c heme attachment protein                  210   5e-64   Coffea arabica [arabica coffee]
ref|YP_003359408.1|  Ycf5                                               210   6e-64   Olea europaea
ref|YP_004564053.1|  Ycf5 protein                                       210   6e-64   
ref|YP_588174.1|  cytochrome c biogenesis protein                       210   6e-64   Helianthus annuus
emb|CBR23788.1|  Ycf5 protein                                           210   6e-64   
emb|CBR23880.1|  Ycf5 protein                                           210   7e-64   
gb|ADZ36574.1|  c-type cytochrome synthesis protein                     210   7e-64   
ref|YP_009108638.1|  cytochrome c biogenesis protein                    209   1e-63   
ref|YP_009110651.1|  Ycf5 protein                                       209   2e-63   
gb|AGW04714.1|  cytochrome c biogenesis protein                         209   2e-63   
ref|YP_762309.1|  cytochrome c biogenesis/heme attachment protein       208   2e-63   Morus indica
gb|ADX99040.1|  cytochrome c heme attachment protein                    207   3e-63   
ref|YP_004465244.1|  cytochrome c heme attachment protein               208   3e-63   
gb|ADZ36398.1|  c-type cytochrome synthesis protein                     208   4e-63   
ref|YP_009109421.1|  cytochrome c biogenesis protein                    208   5e-63   
ref|YP_001837416.1|  cytochrome c biogenesis protein                    207   6e-63   Guizotia abyssinica [niger]
ref|YP_008081415.1|  cytochrome c biogenesis protein                    207   6e-63   
gb|AJD00776.1|  cytochrome c biogenesis protein                         207   6e-63   
gb|AHF72025.1|  cytochrome c biogenesis protein                         207   7e-63   
gb|ADZ36412.1|  c-type cytochrome synthesis protein                     207   7e-63   
ref|YP_001671731.1|  cytochrome c biogenesis protein                    207   1e-62   Carica papaya [mamon]
gb|ADZ36425.1|  c-type cytochrome synthesis protein                     207   1e-62   
gb|ADD30950.1|  cytochrome c heme attachment protein                    207   1e-62   Antirrhinum majus [garden snapdragon]
emb|CCQ71671.1|  cytochrome c biogenesis protein                        207   1e-62   
gb|ADX99037.1|  cytochrome c heme attachment protein                    206   2e-62   
gb|AJC00320.1|  cytochrome c biogenesis protein                         206   2e-62   
gb|ADZ36486.1|  c-type cytochrome synthesis protein                     205   2e-62   
gb|ADX99015.1|  cytochrome c heme attachment protein                    205   2e-62   
gb|ADZ36476.1|  c-type cytochrome synthesis protein                     205   4e-62   
ref|YP_008081506.1|  cytochrome c biogenesis protein                    205   4e-62   
gb|AGC57591.1|  cytochrome c biogenesis protein                         205   4e-62   
gb|ADZ36553.1|  c-type cytochrome synthesis protein                     205   4e-62   
ref|YP_004222695.1|  cytochrome c heme attachment protein               205   4e-62   
ref|YP_003934007.1|  cytochrome c heme attachment protein               205   4e-62   
ref|YP_008576352.1|  cytochrome c biogenesis protein                    205   5e-62   
gb|AFQ39650.1|  cytochrome c heme attachment protein                    204   5e-62   
gb|AFQ39608.1|  cytochrome c heme attachment protein                    204   6e-62   
gb|ADX99022.1|  cytochrome c heme attachment protein                    204   6e-62   
gb|AFQ39602.1|  cytochrome c heme attachment protein                    204   6e-62   
ref|YP_008576097.1|  cytochrome c biogenesis protein                    205   6e-62   
ref|YP_004286151.1|  cytochrome c heme attachment protein               205   6e-62   
gb|ADX99020.1|  cytochrome c heme attachment protein                    204   6e-62   
ref|YP_008576607.1|  cytochrome c biogenesis protein                    205   6e-62   
ref|YP_008577287.1|  cytochrome c biogenesis protein                    205   7e-62   
gb|ADH94392.1|  cytochrome c heme attachment protein                    204   7e-62   
gb|ADD30967.1|  cytochrome c heme attachment protein                    205   7e-62   Gunnera manicata
gb|ADX99017.1|  cytochrome c heme attachment protein                    202   7e-62   
gb|ADZ36463.1|  c-type cytochrome synthesis protein                     204   7e-62   
ref|YP_008577627.1|  cytochrome c biogenesis protein                    204   7e-62   
gb|AGN72014.1|  cytochrome c heme attachment protein                    204   7e-62   
gb|ADX99027.1|  cytochrome c heme attachment protein                    204   7e-62   
gb|ADX99014.1|  cytochrome c heme attachment protein                    204   7e-62   
gb|ADZ36456.1|  c-type cytochrome synthesis protein                     204   8e-62   
gb|ADX99036.1|  cytochrome c heme attachment protein                    204   9e-62   
ref|YP_004564428.1|  cytochrome c heme attachment protein               204   9e-62   
gb|ABU85229.1|  cytochrome c heme attachment protein                    204   9e-62   Anethum graveolens
ref|YP_008577712.1|  cytochrome c biogenesis protein                    204   1e-61   
gb|ADX99033.1|  cytochrome c heme attachment protein                    202   1e-61   
ref|YP_008576267.1|  cytochrome c biogenesis protein                    204   1e-61   
ref|YP_009114283.1|  cytochrome c biogenesis protein                    204   1e-61   
ref|YP_008575417.1|  cytochrome c biogenesis protein                    204   1e-61   
ref|YP_008575162.1|  cytochrome c biogenesis protein                    204   1e-61   
ref|YP_008577372.1|  cytochrome c biogenesis protein                    204   1e-61   
gb|ADZ36441.1|  c-type cytochrome synthesis protein                     204   1e-61   
ref|YP_008575502.1|  cytochrome c biogenesis protein                    204   1e-61   
gb|AGC57931.1|  cytochrome c biogenesis protein                         204   2e-61   
ref|YP_004072510.1|  cytochrome c biogenesis protein                    204   2e-61   
ref|YP_636348.1|  cytochrome c biogenesis protein                       204   2e-61   Eucalyptus globulus subsp. globulus
ref|YP_008963444.1|  cytochrome c heme attachment protein               204   2e-61   
ref|YP_008576777.1|  cytochrome c biogenesis protein                    204   2e-61   
ref|YP_008592545.1|  cytochrome c biogenesis protein                    204   2e-61   
gb|ADX99038.1|  cytochrome c heme attachment protein                    202   2e-61   
ref|YP_008576692.1|  cytochrome c biogenesis protein                    203   2e-61   
ref|YP_007507161.1|  cytochrome c biogenesis protein                    203   2e-61   
ref|YP_001430150.1|  cytochrome c biogenesis protein                    203   2e-61   Cuscuta reflexa [giant dodder]
ref|YP_009050639.1|  cytochrome c heme attachment protein               203   3e-61   
gb|ADD30968.1|  cytochrome c heme attachment protein                    203   3e-61   Heuchera sanguinea
ref|YP_008577882.1|  cytochrome c biogenesis protein                    203   3e-61   
ref|YP_008577202.1|  cytochrome c biogenesis protein                    203   3e-61   
ref|YP_008577542.1|  cytochrome c biogenesis protein                    203   3e-61   
ref|YP_008964918.1|  cytochrome c heme attachment protein               204   4e-61   
ref|YP_008577032.1|  cytochrome c biogenesis protein                    202   4e-61   
gb|ADZ36450.1|  c-type cytochrome synthesis protein                     202   4e-61   
gb|ADZ36470.1|  c-type cytochrome synthesis protein                     202   5e-61   
gb|ADD30966.1|  cytochrome c heme attachment protein                    202   5e-61   Ficus sp. Moore 315
ref|YP_008578222.1|  cytochrome c biogenesis protein                    202   5e-61   
gb|AEX99570.1|  cytochrome c biogenesis protein                         202   5e-61   
ref|YP_007474784.1|  cytochrome c biogenesis protein                    202   5e-61   
ref|YP_001542573.1|  cytochrome c heme attachment protein               202   5e-61   Cuscuta exaltata
gb|ADX99011.1|  cytochrome c heme attachment protein                    201   6e-61   
gb|ADZ36446.1|  c-type cytochrome synthesis protein                     202   6e-61   
ref|YP_008520190.1|  cytochrome c biogenesis protein ycf5               202   7e-61   
ref|YP_007317298.1|  cytochrome c biogenesis protein                    202   7e-61   
ref|YP_007890423.1|  cytochrome c biogenesis protein                    202   7e-61   
ref|YP_008592808.1|  cytochrome c biogenesis protein ycf5               202   7e-61   
gb|ADX99041.1|  cytochrome c heme attachment protein                    201   7e-61   
gb|ADZ36430.1|  c-type cytochrome synthesis protein                     202   7e-61   
ref|YP_009040852.1|  cytochrome c heme attachment protein (chloro...    202   8e-61   
gb|ADX99032.1|  cytochrome c heme attachment protein                    201   8e-61   
ref|YP_008578137.1|  cytochrome c biogenesis protein                    202   9e-61   
gb|AFQ39601.1|  cytochrome c heme attachment protein                    201   9e-61   
ref|YP_001687499.1|  cytochrome c biogenesis protein                    202   9e-61   Oenothera parviflora
ref|YP_008577457.1|  cytochrome c biogenesis protein                    202   1e-60   
gb|ADD30973.1|  cytochrome c heme attachment protein                    201   1e-60   Staphylea colchica
ref|YP_009050987.1|  cytochrome c heme attachment protein               201   1e-60   
gb|ADZ36379.1|  c-type cytochrome synthesis protein                     201   1e-60   
gb|AFQ39620.1|  cytochrome c heme attachment protein                    201   1e-60   
ref|YP_004021370.1|  cytochrome c heme attachment protein               201   2e-60   
ref|YP_740614.1|  cytochrome c heme attachment protein                  201   2e-60   Platanus occidentalis [American sycamore]
ref|YP_007353822.1|  cytochrome c biogenesis protein                    201   2e-60   
gb|ADX99034.1|  cytochrome c heme attachment protein                    200   2e-60   
ref|YP_001687185.1|  cytochrome c biogenesis protein                    201   2e-60   Oenothera argillicola
ref|YP_009020269.1|  cytochrome c heme attachment protein               201   2e-60   
gb|ADO64938.2|  cytochrome c heme attachment protein                    201   2e-60   
ref|YP_008592894.1|  cytochrome c biogenesis protein ycf5               201   2e-60   
ref|YP_009002301.1|  cytochrome c biogenesis protein                    201   3e-60   
gb|ADX99012.1|  cytochrome c heme attachment protein                    200   3e-60   
ref|YP_009020799.1|  cytochrome c heme attachment protein               200   4e-60   
ref|YP_009027826.1|  cytochrome c heme attachment protein               200   4e-60   
ref|YP_007889909.1|  cytochrome c heme attachment protein               200   4e-60   
gb|ADZ36407.1|  c-type cytochrome synthesis protein                     199   5e-60   
ref|NP_084751.1|  cytochrome c biogenesis protein                       200   5e-60   Oenothera elata subsp. hookeri [Hooker's evening primrose]
gb|AEX58502.1|  cytochrome c heme attachment protein                    200   6e-60   
ref|YP_001687331.1|  cytochrome c biogenesis protein                    200   6e-60   Oenothera glazioviana
gb|ADX99013.1|  cytochrome c heme attachment protein                    199   6e-60   
gb|AEX57773.1|  cytochrome c heme attachment protein                    199   8e-60   
ref|YP_319812.1|  cytochrome c biogenesis protein                       199   8e-60   Acorus calamus [flagroot]
gb|AAZ03811.1|  cytochrome c biogenesis protein                         199   9e-60   Acorus americanus [sweetflag]
gb|AGR66232.1|  c-type cytochrome synthesis protein                     199   9e-60   
ref|YP_009024840.1|  cytochrome c heme attachment protein               199   9e-60   
ref|YP_007475668.1|  cytochrome c heme attachment protein               199   1e-59   
ref|YP_004021197.1|  cytochrome c heme attachment protein               199   1e-59   
gb|AEX96155.1|  cytochrome c heme attachment protein                    199   1e-59   
gb|AGV55576.1|  cytochrome c biogenesis protein                         199   1e-59   
ref|YP_398377.1|  cytochrome c biogenesis protein                       199   2e-59   Lactuca sativa [cultivated lettuce]
ref|YP_008964082.1|  cytochrome c biogenesis protein                    199   2e-59   
gb|AEZ01478.1|  cytochrome c heme attachment protein                    198   2e-59   
ref|YP_004935716.1|  ccsA gene product                                  198   2e-59   
ref|YP_009059568.1|  cytochrome c heme attachment protein               198   3e-59   
gb|ADZ36416.1|  c-type cytochrome synthesis protein                     198   3e-59   
gb|AEX96150.1|  cytochrome c heme attachment protein                    198   3e-59   
gb|AEZ48945.1|  cytochrome c heme attachment protein                    198   3e-59   
gb|ADX99035.1|  cytochrome c heme attachment protein                    197   3e-59   
gb|AFQ39590.1|  cytochrome c heme attachment protein                    197   3e-59   
ref|YP_005296148.1|  ccsA gene product                                  198   3e-59   
ref|YP_004842286.1|  cytochrome c heme attachment protein               198   3e-59   
gb|AFQ39668.1|  cytochrome c heme attachment protein                    197   3e-59   
gb|ABU85475.1|  cytochrome c heme attachment protein                    198   4e-59   Musa acuminata [banana]
gb|AEX96135.1|  cytochrome c heme attachment protein                    197   4e-59   
gb|ADX99016.1|  cytochrome c heme attachment protein                    197   4e-59   
gb|AEX96152.1|  cytochrome c heme attachment protein                    197   5e-59   
ref|YP_009092353.1|  cytochrome c heme attachment protein               197   5e-59   
ref|YP_009019937.1|  cytochrome c heme attachment protein               197   5e-59   
ref|YP_008993655.1|  cytochrome c heme attachment protein               197   6e-59   
ref|YP_008082781.1|  cytochrome c heme attachment protein               197   6e-59   
ref|YP_007375095.1|  cytochrome c heme attachment protein               197   6e-59   
ref|YP_008993397.1|  cytochrome c heme attachment protein               197   6e-59   
ref|YP_008993913.1|  cytochrome c heme attachment protein               197   6e-59   
ref|YP_008993225.1|  cytochrome c heme attachment protein               197   7e-59   
ref|YP_006576163.1|  CcsA                                               197   7e-59   
ref|YP_007474500.1|  cytochrome c biogenesis protein                    197   7e-59   
ref|YP_009027326.1|  cytochrome c heme attachment protein               197   7e-59   
ref|YP_007474417.1|  cytochrome c biogenesis protein                    197   7e-59   
ref|YP_008993569.1|  cytochrome c heme attachment protein               197   7e-59   
ref|YP_004769762.1|  cytochrome c heme attachment protein               197   7e-59   
ref|YP_009026930.1|  cytochrome c biogenesis protein                    197   8e-59   
ref|YP_009115469.1|  CcsA; cytochrome c biogenesis protein              197   8e-59   
gb|AEX96139.1|  cytochrome c heme attachment protein                    197   8e-59   
gb|ADX99024.1|  cytochrome c heme attachment protein                    195   9e-59   
ref|YP_003434024.1|  cytochrome c heme attachment protein               197   9e-59   Typha latifolia [common cattail]
ref|YP_009004090.1|  cytochrome c heme attachment protein               196   1e-58   
gb|ADZ36393.1|  c-type cytochrome synthesis protein                     196   1e-58   
ref|YP_008854474.1|  cytochrome c heme attachment protein               196   1e-58   
gb|ADO33495.1|  cytochrome c heme attachment protein                    196   1e-58   
gb|AEX96132.1|  cytochrome c heme attachment protein                    196   1e-58   
ref|YP_004841834.1|  cytochrome c heme attachment protein               196   2e-58   
ref|YP_008592697.1|  cytochrome c heme attachment protein               196   2e-58   
gb|AEX96157.1|  cytochrome c heme attachment protein                    196   2e-58   
ref|YP_740251.1|  cytochrome c heme attachment protein                  196   2e-58   
ref|YP_007475838.1|  cytochrome c heme attachment protein               196   2e-58   
gb|AEX96118.1|  cytochrome c heme attachment protein                    196   2e-58   
gb|AEX96151.1|  cytochrome c heme attachment protein                    196   2e-58   
ref|YP_007475924.1|  cytochrome c heme attachment protein               196   2e-58   
gb|AHF21130.1|  cytochrome c heme attachment protein                    195   3e-58   
ref|YP_008578334.1|  cytochrome c heme attachment protein               195   3e-58   
gb|ADX99023.1|  cytochrome c heme attachment protein                    194   4e-58   
ref|YP_007476097.1|  cytochrome c heme attachment protein               195   4e-58   
gb|AGE93505.1|  cytochrome c heme attachment protein                    195   4e-58   
gb|ADX99039.1|  cytochrome c heme attachment protein                    192   5e-58   
ref|YP_008994337.1|  cytochrome c heme attachment protein               195   5e-58   
gb|AEX96137.1|  cytochrome c heme attachment protein                    195   5e-58   
ref|YP_008854558.1|  cytochrome c heme attachment protein               195   5e-58   
gb|ADD30956.1|  cytochrome c heme attachment protein                    195   5e-58   
ref|YP_778540.1|  cytochrome c biogenesis protein                       195   6e-58   
gb|AFB70487.1|  cytochrome c biogenesis protein                         194   7e-58   
ref|YP_001294234.1|  cytochrome c heme attachment protein               194   7e-58   
gb|AHG24666.1|  cytochrome c heme attachment protein                    194   8e-58   
gb|AFB70488.1|  cytochrome c biogenesis protein                         194   8e-58   
ref|YP_008963527.1|  cytochrome c heme attachment protein               193   9e-58   
gb|ADX99018.1|  cytochrome c heme attachment protein                    193   1e-57   
ref|YP_247649.1|  cytochrome c biogenesis protein                       194   1e-57   
ref|YP_538991.1|  cytochrome c biogenesis protein                       194   1e-57   
ref|YP_005088334.1|  cytochrome c biogenesis protein'                   194   1e-57   
ref|YP_008146009.1|  cytochrome c heme attachment protein               194   1e-57   
ref|YP_913235.1|  c-type cytochrome synthesis                           194   1e-57   
ref|YP_008145397.1|  cytochrome c heme attachment protein               194   1e-57   
ref|YP_006503331.1|  cytochrome c biogenesis protein                    194   1e-57   
ref|YP_008992858.1|  cytochrome c heme attachment protein               194   1e-57   
ref|YP_006503497.1|  cytochrome c biogenesis protein                    194   1e-57   
ref|YP_004221976.1|  cytochrome c heme attachment protein               193   1e-57   
gb|ADX99019.1|  cytochrome c heme attachment protein                    192   1e-57   
gb|AEX96154.1|  cytochrome c heme attachment protein                    193   1e-57   
gb|AEZ48963.1|  cytochrome c heme attachment protein                    194   2e-57   
ref|YP_003540982.1|  cytochrome c biogenesis protein                    193   2e-57   
ref|YP_004021713.1|  cytochrome c heme attachment protein               193   2e-57   
gb|AEX96156.1|  cytochrome c heme attachment protein                    193   2e-57   
gb|AEZ48950.1|  cytochrome c heme attachment protein                    193   2e-57   
gb|AEX96153.1|  cytochrome c heme attachment protein                    193   2e-57   
gb|ADX99026.1|  cytochrome c heme attachment protein                    192   2e-57   
gb|AEX96122.1|  cytochrome c heme attachment protein                    193   2e-57   
gb|AGQ55720.1|  cytochrome c heme attachment protein                    193   2e-57   
gb|AGV52550.1|  cytochrome c biogenesis protein                         193   2e-57   
ref|YP_009092815.1|  cytochrome c heme attachment protein               193   2e-57   
ref|YP_009020087.1|  cytochrome c heme attachment protein               193   2e-57   
gb|AEX96119.1|  cytochrome c heme attachment protein                    193   2e-57   
gb|AEX96133.1|  cytochrome c heme attachment protein                    193   3e-57   
ref|YP_004940559.1|  ccsA gene product                                  193   3e-57   
ref|YP_008992686.1|  cytochrome c heme attachment protein               193   3e-57   
gb|ADZ36388.1|  c-type cytochrome synthesis protein                     192   3e-57   
gb|AFB70491.1|  cytochrome c biogenesis protein                         193   3e-57   
gb|AHA12804.1|  cytochrome c heme attachment protein                    193   3e-57   
ref|YP_005087747.1|  cytochrome c biogenesis protein'                   192   3e-57   
gb|AEX96126.1|  cytochrome c heme attachment protein                    192   3e-57   
ref|YP_004563916.1|  cytochrome c heme attachment protein               192   3e-57   
ref|YP_009114495.1|  cytochrome c heme attachment protein               192   4e-57   
gb|AEX96123.1|  cytochrome c heme attachment protein                    192   4e-57   
ref|YP_008378830.1|  heme attachment to plastid cytochrome c            192   4e-57   
ref|YP_009051607.1|  cytochrome c biogenesis protein                    192   4e-57   
ref|YP_006883201.1|  cytochrome c heme attachment protein               192   4e-57   
ref|YP_008816300.1|  cytochrome c heme attachment protein               192   5e-57   
ref|YP_003933944.1|  cytochrome c heme attachment protein               192   5e-57   
gb|AEX96138.1|  cytochrome c heme attachment protein                    192   6e-57   
gb|ADD30960.1|  cytochrome c heme attachment protein                    192   6e-57   
ref|YP_538819.1|  cytochrome c biogenesis protein                       192   6e-57   
ref|YP_001294409.1|  cytochrome c biogenesis protein                    192   6e-57   
ref|YP_008146091.1|  cytochrome c heme attachment protein               192   7e-57   
gb|AHF21205.1|  cytochrome c heme attachment protein                    192   7e-57   
ref|YP_008145927.1|  cytochrome c heme attachment protein               192   7e-57   
ref|YP_001542496.1|  cytochrome c heme attachment protein               192   7e-57   
ref|YP_008145845.1|  cytochrome c heme attachment protein               192   7e-57   
gb|AHA12726.1|  cytochrome c heme attachment protein                    192   8e-57   
gb|AEZ48967.1|  cytochrome c heme attachment protein                    192   8e-57   
ref|YP_008994539.1|  cytochrome c heme attachment protein (chloro...    191   8e-57   
gb|ADX99030.1|  cytochrome c heme attachment protein                    189   8e-57   
gb|AIJ28088.1|  cytochrome c heme attachment protein                    192   9e-57   
gb|AGE93247.1|  cytochrome c heme attachment protein                    191   9e-57   
gb|ADD30970.1|  cytochrome c heme attachment protein                    191   1e-56   
gb|ACF33399.1|  cytochrome c heme attachment protein                    191   1e-56   
dbj|BAQ19691.1|  cytochrome c heme attachment protein                   191   1e-56   
ref|YP_009093998.1|  cytochrome c heme attachment protein               191   1e-56   
gb|AIZ66387.1|  cytochrome c biogenesis protein                         190   1e-56   
gb|AEZ48960.1|  cytochrome c heme attachment protein                    191   1e-56   
gb|AFB70493.1|  cytochrome c biogenesis protein                         191   1e-56   
gb|AIZ66381.1|  cytochrome c biogenesis protein                         189   1e-56   
ref|YP_009111550.1|  cytochrome c heme attachment protein               191   1e-56   
ref|YP_001381673.1|  cytochrome c heme attachment protein               191   1e-56   
ref|YP_005089463.1|  ccsA gene product                                  191   1e-56   
gb|AEX96136.1|  cytochrome c heme attachment protein                    191   1e-56   
ref|YP_008994121.1|  cytochrome c biogenesis protein                    191   2e-56   
gb|AEZ48964.1|  cytochrome c heme attachment protein                    191   2e-56   
gb|AEX96110.1|  cytochrome c heme attachment protein                    191   2e-56   
gb|AGQ55805.1|  cytochrome c heme attachment protein                    191   2e-56   
ref|YP_740700.1|  cytochrome c heme attachment protein                  191   2e-56   
gb|AEX96121.1|  cytochrome c heme attachment protein                    191   2e-56   
gb|AEZ48969.1|  cytochrome c heme attachment protein                    191   2e-56   
gb|AEX96125.1|  cytochrome c heme attachment protein                    191   2e-56   
gb|AHG24591.1|  cytochrome c heme attachment protein                    190   2e-56   
ref|YP_008992600.1|  cytochrome c heme attachment protein               190   3e-56   
ref|YP_006503663.1|  cytochrome c biogenesis protein                    190   3e-56   
gb|AEX96112.1|  cytochrome c heme attachment protein                    190   3e-56   
ref|YP_001718485.1|  cytochrome c biogenesis protein                    190   3e-56   
ref|YP_008963655.1|  cytochrome c biogenesis protein                    190   3e-56   
gb|AHF71496.1|  cytochrome c biogenesis protein                         190   3e-56   
gb|AIJ28260.1|  cytochrome c heme attachment protein                    190   4e-56   
gb|AHA13059.1|  cytochrome c heme attachment protein                    190   4e-56   
gb|AEX96127.1|  cytochrome c heme attachment protein                    190   4e-56   
ref|YP_007476010.1|  cytochrome c heme attachment protein               190   4e-56   
ref|YP_006665829.1|  cytochrome c heme attachment protein               189   4e-56   
gb|AIZ66383.1|  cytochrome c biogenesis protein                         188   5e-56   
ref|YP_784436.1|  cytochrome c heme attachment protein                  189   5e-56   
gb|AEX96140.1|  cytochrome c heme attachment protein                    190   5e-56   
ref|YP_009093848.1|  cytochrome c heme attachment protein               189   5e-56   
ref|YP_665605.1|  cytochrome c biogenesis protein                       189   6e-56   
gb|AIZ66386.1|  cytochrome c biogenesis protein                         188   6e-56   
ref|YP_007475753.1|  cytochrome c heme attachment protein               189   6e-56   
gb|AFB70485.1|  cytochrome c biogenesis protein                         189   7e-56   
gb|AGS43950.1|  cytochrome c heme attachment protein                    189   7e-56   
gb|AEX96148.1|  cytochrome c heme attachment protein                    189   7e-56   
gb|AGW45955.1|  cytochrome c heme attachment protein                    189   8e-56   
gb|AIZ66382.1|  cytochrome c biogenesis protein                         187   9e-56   
ref|YP_008999981.1|  cytochrome c heme attachment protein (chloro...    189   9e-56   
gb|AFB70495.1|  cytochrome c biogenesis protein                         189   9e-56   
ref|YP_004327710.1|  cytochrome c biogenesis protein                    189   9e-56   
ref|YP_008146173.1|  cytochrome c heme attachment protein               189   1e-55   
gb|AEX96109.1|  cytochrome c heme attachment protein                    189   1e-55   
gb|AJD00883.1|  cytochrome c biogenesis protein                         189   1e-55   
ref|YP_009050176.1|  cytochrome c heme attachment protein               189   1e-55   
gb|AEX96144.1|  cytochrome c heme attachment protein                    189   1e-55   
gb|AGN74027.1|  cytochrome c biogenesis protein (chloroplast)           189   1e-55   
ref|YP_005089380.1|  ccsA gene product                                  188   1e-55   
gb|EPS74132.1|  hypothetical protein M569_00621                         188   1e-55   
gb|AEX96120.1|  cytochrome c heme attachment protein                    188   2e-55   
ref|YP_008758236.1|  cytochrome c biogenesis protein                    188   2e-55   
gb|AEZ48946.1|  cytochrome c heme attachment protein                    188   2e-55   
ref|YP_005089623.1|  ccsA gene product                                  188   2e-55   
gb|AEX96128.1|  cytochrome c heme attachment protein                    188   2e-55   
gb|AEX96114.1|  cytochrome c heme attachment protein                    188   2e-55   
ref|YP_003587792.1|  cytochrome c biogenesis protein                    188   2e-55   
gb|AEX96134.1|  cytochrome c heme attachment protein                    188   2e-55   
ref|YP_001109556.1|  cytochrome c biogenesis protein                    188   3e-55   
ref|YP_009033941.1|  cytochrome c biogenesis protein                    188   3e-55   
gb|AEZ48947.1|  cytochrome c heme attachment protein                    187   3e-55   
ref|YP_009109901.1|  cytochrome c heme attachment protein               188   3e-55   
gb|AIZ66385.1|  cytochrome c biogenesis protein                         186   3e-55   
gb|AEX96131.1|  cytochrome c heme attachment protein                    187   3e-55   
gb|AIJ28442.1|  cytochrome c heme attachment protein                    187   3e-55   
ref|YP_008145763.1|  cytochrome c heme attachment protein               187   3e-55   
gb|AEX96129.1|  cytochrome c heme attachment protein                    187   3e-55   
gb|AIZ66384.1|  cytochrome c biogenesis protein                         186   3e-55   
ref|YP_008854643.1|  cytochrome c heme attachment protein               187   3e-55   
gb|AEX96124.1|  cytochrome c heme attachment protein                    187   3e-55   
ref|YP_009033546.1|  cytochrome c heme attachment protein               187   3e-55   
gb|AEX10231.1|  cytochrome c heme attachment protein                    187   4e-55   
ref|YP_004286052.1|  cytochrome c heme attachment protein               187   4e-55   
ref|YP_005090227.1|  ccsA gene product                                  187   4e-55   
gb|AHA12973.1|  cytochrome c heme attachment protein                    187   4e-55   
ref|YP_009000143.1|  cytochrome c heme attachment protein (chloro...    187   4e-55   
ref|YP_002720161.1|  ccsA                                               187   4e-55   
ref|NP_054987.1|  cytochrome c biogenesis protein                       187   4e-55   
gb|AIJ27972.1|  cytochrome c heme attachment protein                    187   4e-55   
ref|XP_003606021.1|  Cytochrome c biogenesis protein ccsA               195   4e-55   
gb|AEX96111.1|  cytochrome c heme attachment protein                    187   4e-55   
ref|YP_001294154.1|  cytochrome c heme attachment protein               187   5e-55   
ref|NP_084844.1|  cytochrome c biogenesis protein                       187   7e-55   
gb|AAZ03816.1|  cytochrome c biogenesis protein                         186   7e-55   
gb|AEX96149.1|  cytochrome c heme attachment protein                    186   9e-55   
gb|AEX96142.1|  cytochrome c heme attachment protein                    186   9e-55   
ref|YP_001718708.1|  cytochrome c heme attachment protein               186   9e-55   
gb|AEX96147.1|  cytochrome c heme attachment protein                    186   9e-55   
gb|AHI87577.1|  cytochrome c biogenesis protein                         186   9e-55   
ref|YP_009027163.1|  cytochrome c heme attachment protein               186   9e-55   
ref|NP_862804.1|  cytochrome c biogenesis protein                       186   9e-55   
gb|AEZ48958.1|  cytochrome c heme attachment protein                    186   1e-54   
gb|AEX96116.1|  cytochrome c heme attachment protein                    186   1e-54   
gb|AEX96146.1|  cytochrome c heme attachment protein                    186   1e-54   
ref|YP_005097923.1|  cytochrome c biogenesis protein                    186   2e-54   
gb|AFB70494.1|  cytochrome c biogenesis protein                         185   2e-54   
gb|AHY80591.1|  cytochrome c heme attachment protein                    185   2e-54   
ref|YP_009107025.1|  cytochrome c heme attachment protein               186   2e-54   
gb|AEX96141.1|  cytochrome c heme attachment protein                    185   2e-54   
gb|AFB70492.1|  cytochrome c biogenesis protein                         185   3e-54   
gb|AEX96143.1|  cytochrome c heme attachment protein                    185   3e-54   
ref|YP_002456489.1|  cytochrome c heme attachment protein               185   3e-54   
ref|YP_009048623.1|  cytochrome c biogenesis protein                    185   3e-54   
gb|ADD30971.1|  cytochrome c heme attachment protein                    185   3e-54   
gb|ABU85382.1|  cytochrome c heme attachment protein                    185   3e-54   
ref|YP_009111703.1|  cytochrome c heme attachment protein               185   4e-54   
ref|YP_006073153.1|  cytochrome c heme attachment protein               185   4e-54   
gb|AEZ48959.1|  cytochrome c heme attachment protein                    184   4e-54   
gb|AEZ48966.1|  cytochrome c heme attachment protein                    184   4e-54   
ref|YP_002149786.1|  hypothetical chloroplast RF52                      184   4e-54   
ref|YP_002836139.1|  cytochrome c heme attachment protein               184   4e-54   
gb|AEZ48968.1|  cytochrome c heme attachment protein                    184   5e-54   
ref|YP_009045614.1|  cytochrome c biogenesis protein                    184   5e-54   
ref|YP_053205.1|  cytochrome c biogenesis protein                       184   5e-54   
gb|ADD30952.1|  cytochrome c heme attachment protein                    184   5e-54   
ref|YP_009000062.1|  cytochrome c heme attachment protein (chloro...    184   5e-54   
gb|AIJ28331.1|  cytochrome c heme attachment protein                    184   6e-54   
ref|YP_009048160.1|  cytochrome c biogenesis protein                    184   6e-54   
gb|AHC94633.1|  cytochrome c heme attachment protein                    184   6e-54   
gb|AGE93419.1|  cytochrome c heme attachment protein                    184   7e-54   
gb|AHA12887.1|  cytochrome c heme attachment protein                    184   7e-54   
ref|YP_009057199.1|  cytochrome c heme attachment protein               184   7e-54   
gb|AEX96145.1|  cytochrome c heme attachment protein                    184   8e-54   
gb|AIJ28233.1|  cytochrome c heme attachment protein                    184   8e-54   
ref|YP_005089543.1|  ccsA gene product                                  184   8e-54   
gb|ADX99029.1|  cytochrome c heme attachment protein                    182   9e-54   
gb|AIZ66389.1|  cytochrome c biogenesis protein                         182   1e-53   
gb|AFB70489.1|  cytochrome c biogenesis protein                         184   1e-53   
ref|YP_008994624.1|  cytochrome c heme attachment protein (chloro...    183   1e-53   
gb|AEX96130.1|  cytochrome c heme attachment protein                    184   1e-53   
ref|YP_009000221.1|  cytochrome c heme attachment protein (chloro...    183   1e-53   
ref|YP_009059401.1|  cytochrome c heme attachment protein               183   1e-53   
ref|YP_784529.1|  cytochrome c heme attachment protein                  183   1e-53   
gb|AEK70908.1|  cytochrome c biogenesis protein                         182   2e-53   
gb|AEK70909.1|  cytochrome c biogenesis protein                         181   2e-53   



>ref|YP_001468360.1| cytochrome c biogenesis protein [Ipomoea purpurea]
 sp|A7Y3L0.1|CCSA_IPOPU RecName: Full=Cytochrome c biogenesis protein CcsA (chloroplast) 
[Ipomoea purpurea]
 gb|ABV02400.1| cytochrome c heme attachment protein [Ipomoea purpurea]
 gb|AGW96812.1| cytochrome c heme attachment protein (chloroplast) [Ipomoea amnicola]
 gb|AGW96897.1| cytochrome c heme attachment protein (chloroplast) [Ipomoea argillicola]
 gb|AGW97577.1| cytochrome c heme attachment protein (chloroplast) [Ipomoea nil]
 gb|AGW97830.1| cytochrome c heme attachment protein (chloroplast) [Ipomoea pes-caprae]
 gb|AGW97916.1| cytochrome c heme attachment protein (chloroplast) [Ipomoea polpha]
Length=317

 Score =   287 bits (735),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 159/159 (100%), Positives = 159/159 (100%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI
Sbjct  196  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI
Sbjct  256  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  294



>gb|AGW97492.1| cytochrome c heme attachment protein (chloroplast) [Ipomoea murucoides]
Length=309

 Score =   287 bits (735),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 159/159 (100%), Positives = 159/159 (100%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF
Sbjct  128  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  187

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI
Sbjct  188  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  247

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI
Sbjct  248  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  286



>gb|AGW97322.1| cytochrome c heme attachment protein (chloroplast) [Ipomoea hederifolia]
Length=317

 Score =   287 bits (735),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 159/159 (100%), Positives = 159/159 (100%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI
Sbjct  196  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI
Sbjct  256  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  294



>gb|AGW98085.1| cytochrome c heme attachment protein (chloroplast) [Ipomoea splendor-sylvae]
Length=317

 Score =   287 bits (735),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 159/159 (100%), Positives = 159/159 (100%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI
Sbjct  196  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI
Sbjct  256  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  294



>gb|AGW96388.1| cytochrome c heme attachment protein (chloroplast) [Ipomoea batatas]
 gb|AGW96471.1| cytochrome c heme attachment protein (chloroplast) [Ipomoea batatas]
 gb|AGW96558.1| cytochrome c heme attachment protein (chloroplast) [Ipomoea batatas]
 gb|AGW98340.1| cytochrome c heme attachment protein (chloroplast) [Ipomoea trifida]
Length=317

 Score =   287 bits (735),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 159/159 (100%), Positives = 159/159 (100%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI
Sbjct  196  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI
Sbjct  256  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  294



>gb|AGW98425.1| cytochrome c heme attachment protein (chloroplast) [Ipomoea cordatotriloba]
Length=317

 Score =   287 bits (734),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 159/159 (100%), Positives = 159/159 (100%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI
Sbjct  196  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI
Sbjct  256  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  294



>gb|AGW98001.1| cytochrome c heme attachment protein (chloroplast) [Ipomoea setosa]
Length=317

 Score =   287 bits (734),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 159/159 (100%), Positives = 159/159 (100%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI
Sbjct  196  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI
Sbjct  256  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  294



>gb|AGW96642.1| cytochrome c heme attachment protein (chloroplast) [Ipomoea trifida]
Length=317

 Score =   287 bits (734),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 159/159 (100%), Positives = 159/159 (100%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI
Sbjct  196  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI
Sbjct  256  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  294



>gb|AGW97067.1| cytochrome c heme attachment protein (chloroplast) [Ipomoea diamantinensis]
Length=317

 Score =   286 bits (732),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 158/159 (99%), Positives = 159/159 (100%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSGGNDFLTESFLFGEN+FQKTSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSGGNDFLTESFLFGENIFQKTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI
Sbjct  196  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI
Sbjct  256  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  294



>gb|AGW98255.1| cytochrome c heme attachment protein (chloroplast) [Ipomoea tricolor]
Length=317

 Score =   285 bits (730),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 158/159 (99%), Positives = 158/159 (99%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI
Sbjct  196  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAIFLHTRTNLNLQ VNSAIVASIVASIGFLIIWI
Sbjct  256  TWIVFAIFLHTRTNLNLQRVNSAIVASIVASIGFLIIWI  294



>gb|AGW97152.1| cytochrome c heme attachment protein (chloroplast) [Ipomoea dumetorum]
Length=317

 Score =   285 bits (730),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 158/159 (99%), Positives = 158/159 (99%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSA NYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI
Sbjct  196  FSATNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI
Sbjct  256  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  294



>gb|AGW96982.1| cytochrome c heme attachment protein (chloroplast) [Ipomoea cairica]
Length=317

 Score =   285 bits (730),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 158/159 (99%), Positives = 158/159 (99%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI
Sbjct  196  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGF IIWI
Sbjct  256  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFFIIWI  294



>gb|AGW98510.1| cytochrome c heme attachment protein (chloroplast) [Ipomoea minutiflora]
Length=317

 Score =   284 bits (727),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 157/159 (99%), Positives = 158/159 (99%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSGGNDFLTESF FGEN+FQKTSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSGGNDFLTESFFFGENIFQKTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI
Sbjct  196  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI
Sbjct  256  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  294



>gb|AGW98596.1| cytochrome c heme attachment protein (chloroplast) [Ipomoea obscura]
Length=317

 Score =   280 bits (716),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 155/159 (97%), Positives = 157/159 (99%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFS GNDFL ESFLFGENLFQKTSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSRGNDFLNESFLFGENLFQKTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI
Sbjct  196  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAIFLHTRTN+N+QSVNSAIVASIVASIGFLIIWI
Sbjct  256  TWIVFAIFLHTRTNINVQSVNSAIVASIVASIGFLIIWI  294



>gb|AGW98766.1| cytochrome c heme attachment protein (chloroplast) [Merremia 
quinquefolia]
Length=317

 Score =   280 bits (715),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 156/159 (98%), Positives = 157/159 (99%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSGGNDFL ESFLFGENLFQKTSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSGGNDFLNESFLFGENLFQKTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI
Sbjct  196  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAIFLHTRTN+NLQS NSAIVASIVASIGFLIIWI
Sbjct  256  TWIVFAIFLHTRTNINLQSGNSAIVASIVASIGFLIIWI  294



>gb|AGW98681.1| cytochrome c heme attachment protein (chloroplast) [Ipomoea pes-tigridis]
Length=317

 Score =   280 bits (715),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 155/159 (97%), Positives = 157/159 (99%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRK GKLFS GNDFLTESFLFGENLFQKTSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKTGKLFSRGNDFLTESFLFGENLFQKTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI
Sbjct  196  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAIFLHTRTN+NLQ+VNSAIVASIVASIGFLIIWI
Sbjct  256  TWIVFAIFLHTRTNINLQNVNSAIVASIVASIGFLIIWI  294



>gb|AGW99020.1| cytochrome c heme attachment protein (chloroplast) [Turbina corymbosa]
Length=317

 Score =   279 bits (713),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 155/159 (97%), Positives = 156/159 (98%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFS GNDFL ESFLFGENLFQKTSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSRGNDFLNESFLFGENLFQKTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSA NYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI
Sbjct  196  FSATNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAIFLHTRTN+NLQSVNSAIVASIVASIGFLIIWI
Sbjct  256  TWIVFAIFLHTRTNINLQSVNSAIVASIVASIGFLIIWI  294



>gb|AGW96725.1| cytochrome c heme attachment protein (chloroplast) [Argyreia 
nervosa]
Length=317

 Score =   278 bits (712),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 154/159 (97%), Positives = 157/159 (99%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFS GNDFLTESFLFGE+LFQKTSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSRGNDFLTESFLFGESLFQKTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI
Sbjct  196  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAIFLHTRTN+NLQ+VN AIVASIVASIGFLIIWI
Sbjct  256  TWIVFAIFLHTRTNINLQNVNPAIVASIVASIGFLIIWI  294



>gb|AGW98850.1| cytochrome c heme attachment protein (chloroplast) [Operculina 
macrocarpa]
Length=313

 Score =   278 bits (711),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 155/159 (97%), Positives = 156/159 (98%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFS  NDFL ESFLFGENLFQKTSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSKANDFLNESFLFGENLFQKTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI
Sbjct  196  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAIFLHTRTN+NLQSVNSAIVASIVASIGFLIIWI
Sbjct  256  TWIVFAIFLHTRTNINLQSVNSAIVASIVASIGFLIIWI  294



>gb|AGW98936.1| cytochrome c heme attachment protein (chloroplast) [Stictocardia 
macalusoi]
Length=317

 Score =   278 bits (711),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 153/159 (96%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSV LLV+TFRKNGKLFS GNDFL ESFLFGENLFQKTSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVGLLVVTFRKNGKLFSRGNDFLNESFLFGENLFQKTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FS KNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI
Sbjct  196  FSVKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAIFLHTRTN+NLQSVNSAIVASIVASIGFLIIWI
Sbjct  256  TWIVFAIFLHTRTNINLQSVNSAIVASIVASIGFLIIWI  294



>gb|AGW97662.1| cytochrome c heme attachment protein (chloroplast) [Ipomoea orizabensis]
Length=317

 Score =   277 bits (708),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 155/159 (97%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKN KLFSGGN FLTESFLFGENLFQKTSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNEKLFSGGNGFLTESFLFGENLFQKTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI
Sbjct  196  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAIFLH RTNLN QSVNSAIVASIVASIGFLIIWI
Sbjct  256  TWIVFAIFLHIRTNLNFQSVNSAIVASIVASIGFLIIWI  294



>gb|AGW97745.1| cytochrome c heme attachment protein (chloroplast) [Ipomoea pedicellaris]
Length=317

 Score =   276 bits (707),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 153/159 (96%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFS GNDFL ESF  GENLFQKTSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSRGNDFLNESFFLGENLFQKTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI
Sbjct  196  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAIFLHTRTN+NL+SVNSAIVASIVASIGFLIIWI
Sbjct  256  TWIVFAIFLHTRTNINLESVNSAIVASIVASIGFLIIWI  294



>gb|AGW97407.1| cytochrome c heme attachment protein (chloroplast) [Ipomoea involucrata]
Length=317

 Score =   276 bits (705),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 153/159 (96%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFS GNDFL ESF  GENLFQKTSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSRGNDFLNESFFLGENLFQKTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI
Sbjct  196  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAIFLHTRTN+NL SVNSAIVASIVASIGFLIIWI
Sbjct  256  TWIVFAIFLHTRTNINLHSVNSAIVASIVASIGFLIIWI  294



>gb|AGW98170.1| cytochrome c heme attachment protein (chloroplast) [Ipomoea ternifolia]
Length=313

 Score =   275 bits (703),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 155/159 (97%), Positives = 155/159 (97%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI
Sbjct  196  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAIFLHTRTNLNLQSVNSA    IVASIGFLIIWI
Sbjct  256  TWIVFAIFLHTRTNLNLQSVNSA----IVASIGFLIIWI  290



>gb|AGW97237.1| cytochrome c heme attachment protein (chloroplast) [Ipomoea eriocarpa]
Length=313

 Score =   263 bits (673),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 149/159 (94%), Positives = 150/159 (94%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFS GNDFL ESF  GENLFQKTSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKLFSRGNDFLNESFFLGENLFQKTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI
Sbjct  196  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAIFLHTRTN+NL SVNSA    IVASIGFLIIWI
Sbjct  256  TWIVFAIFLHTRTNINLHSVNSA----IVASIGFLIIWI  290



>gb|AEQ36987.1| cytochrome c biogenesis protein (chloroplast) [Datura stramonium]
Length=313

 Score =   234 bits (597),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 141/159 (89%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKN KLF   N FL ESF  GEN+F+ TSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNRKLFYKSNGFLNESFFLGENVFENTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSAKNYYR+Q IQQLD+WSYRVISLGF FLTIGILSGAVWANEAWGSYW+WDPKETWAFI
Sbjct  196  FSAKNYYRSQLIQQLDYWSYRVISLGFTFLTIGILSGAVWANEAWGSYWNWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAI+LHTRTN NL+  NSA    IVASIGFLIIWI
Sbjct  256  TWIVFAIYLHTRTNRNLRGANSA----IVASIGFLIIWI  290



>ref|YP_006503841.1| cytochrome c biogenesis protein (chloroplast) [Datura stramonium]
 gb|AEQ37073.1| cytochrome c biogenesis protein [Datura stramonium]
Length=313

 Score =   234 bits (597),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 141/159 (89%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKN KLF   N FL ESF  GEN+F+ TSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNRKLFYKSNGFLNESFFLGENVFENTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSAKNYYR+Q IQQLD+WSYRVISLGF FLTIGILSGAVWANEAWGSYW+WDPKETWAFI
Sbjct  196  FSAKNYYRSQLIQQLDYWSYRVISLGFTFLTIGILSGAVWANEAWGSYWNWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAI+LHTRTN NL+  NSA    IVASIGFLIIWI
Sbjct  256  TWIVFAIYLHTRTNRNLRGANSA----IVASIGFLIIWI  290



>ref|YP_004891665.1| ccsA gene product (chloroplast) [Nicotiana undulata]
 gb|AEO95623.1| cytochrome c heme attachment protein (chloroplast) [Nicotiana 
undulata]
 gb|AEO95732.1| cytochrome c heme attachment protein [synthetic construct]
Length=313

 Score =   233 bits (593),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 140/159 (88%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKN +LF   N FL ESF  GEN+ Q TSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNRQLFYKSNGFLNESFFLGENVLQNTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSAKNYYR+Q IQQLD+WSYRVISLGF FLTIGILSGAVWANEAWGSYW+WDPKETWAFI
Sbjct  196  FSAKNYYRSQLIQQLDYWSYRVISLGFAFLTIGILSGAVWANEAWGSYWNWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAI+LHTRTN NL+  NSA    IVASIGFLIIWI
Sbjct  256  TWIVFAIYLHTRTNRNLRGANSA----IVASIGFLIIWI  290



>ref|NP_054556.1| cytochrome c biogenesis protein [Nicotiana tabacum]
 ref|YP_358736.1| cytochrome c biogenesis protein [Nicotiana sylvestris]
 sp|P12216.1|CCSA_TOBAC RecName: Full=Cytochrome c biogenesis protein CcsA (chloroplast) 
[Nicotiana tabacum]
 sp|Q3C1Q5.1|CCSA_NICSY RecName: Full=Cytochrome c biogenesis protein CcsA (chloroplast) 
[Nicotiana sylvestris]
 emb|CAA77395.1| c-type cytochrome synthesis protein [Nicotiana tabacum]
 dbj|BAE46713.1| c-type cytochrome synthesis protein [Nicotiana sylvestris]
 prf||1211235CN ORF 313
Length=313

 Score =   233 bits (593),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 140/159 (88%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKN +LF   N FL ESF  GEN+ Q TSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNRQLFYKSNGFLNESFFLGENVLQNTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSAKNYYR+Q IQQLD+WSYRVISLGF FLTIGILSGAVWANEAWGSYW+WDPKETWAFI
Sbjct  196  FSAKNYYRSQLIQQLDYWSYRVISLGFTFLTIGILSGAVWANEAWGSYWNWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAI+LHTRTN NL+  NSA    IVASIGFLIIWI
Sbjct  256  TWIVFAIYLHTRTNRNLRGANSA----IVASIGFLIIWI  290



>ref|YP_008563138.1| cytochrome c heme attachment protein (chloroplast) [Solanum lycopersicum]
 ref|AP_004978.1| cytochrome c biogenesis protein (chloroplast) [Solanum lycopersicum]
 sp|Q2MI51.1|CCSA_SOLLC RecName: Full=Cytochrome c biogenesis protein CcsA (chloroplast) 
[Solanum lycopersicum]
 gb|ABC56350.1| cytochrome c heme attachment protein (chloroplast) [Solanum lycopersicum]
 emb|CAJ32444.1| cytochrome c biogenesis protein [Solanum lycopersicum]
Length=313

 Score =   231 bits (589),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 139/159 (87%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKN KLFS  N FL ESF  GEN+ + TSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNRKLFSKSNVFLNESFFLGENVVENTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            F  KNYYR+Q IQQLD+WSYRVISLGF FLTIGILSGAVWANEAWGSYW+WDPKETWAFI
Sbjct  196  FCTKNYYRSQLIQQLDYWSYRVISLGFTFLTIGILSGAVWANEAWGSYWNWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAI+LHTRTN NL+  NSA    IVASIGFLIIWI
Sbjct  256  TWIVFAIYLHTRTNRNLRGPNSA----IVASIGFLIIWI  290



>ref|YP_538899.1| cytochrome c biogenesis protein [Solanum bulbocastanum]
 ref|YP_635688.1| cytochrome c biogenesis protein [Solanum tuberosum]
 sp|Q2MID8.1|CCSA_SOLBU RecName: Full=Cytochrome c biogenesis protein CcsA (chloroplast) 
[Solanum bulbocastanum]
 sp|Q2VED1.1|CCSA_SOLTU RecName: Full=Cytochrome c biogenesis protein CcsA (chloroplast) 
[Solanum tuberosum]
 gb|ABB90087.1| cytochrome c biogenesis protein [Solanum tuberosum]
 gb|ABC56263.1| cytochrome c heme attachment protein [Solanum bulbocastanum]
 gb|ABD47106.1| cytochrome c heme attachment protein [Solanum tuberosum]
 gb|AEB72188.1| cytochrome c heme attachment protein (chloroplast) [Solanum tuberosum]
 gb|AEB72274.1| cytochrome c heme attachment protein (chloroplast) [Solanum tuberosum]
Length=313

 Score =   231 bits (588),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 139/159 (87%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKN KLF   N FL ESF  GEN+ + TSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNRKLFYKSNGFLNESFFLGENVVENTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            F AKNYYR+Q IQQLD+WSYRVISLGF FLTIGILSGAVWANEAWGSYW+WDPKETWAFI
Sbjct  196  FCAKNYYRSQLIQQLDYWSYRVISLGFTFLTIGILSGAVWANEAWGSYWNWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAI+LHTRTN NL+  NSA    IVASIGFLIIWI
Sbjct  256  TWIVFAIYLHTRTNRNLRGPNSA----IVASIGFLIIWI  290



>ref|YP_006666079.1| cytochrome c heme attachment protein (chloroplast) [Capsicum 
annuum]
 gb|AFP90825.1| cytochrome c heme attachment protein (chloroplast) [Capsicum 
annuum]
 gb|AIA77010.1| cytochrome c heme attachment protein (chloroplast) (chloroplast) 
[Capsicum annuum var. glabriusculum]
Length=313

 Score =   231 bits (588),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 140/159 (88%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKN KLF   N FL ESF  GEN+ + TSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNRKLFYKSNGFLNESFFLGENVLENTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSAKNYYR+Q IQQLD+WSYRVISLGF FLTIGILSGAVWANEAWGSYW+WDPKETWAFI
Sbjct  196  FSAKNYYRSQLIQQLDYWSYRVISLGFTFLTIGILSGAVWANEAWGSYWNWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAI+LHTRT+ NL+  NSA    IVASIGFLIIWI
Sbjct  256  TWIVFAIYLHTRTHRNLRGANSA----IVASIGFLIIWI  290



>ref|YP_398922.1| cytochrome c biogenesis protein [Nicotiana tomentosiformis]
 sp|Q33BX3.1|CCSA_NICTO RecName: Full=Cytochrome c biogenesis protein CcsA (chloroplast) 
[Nicotiana tomentosiformis]
 dbj|BAE48062.1| c-type cytochrome synthesis protein [Nicotiana tomentosiformis]
Length=313

 Score =   230 bits (587),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 139/159 (87%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKN +LF   N FL ESF  GEN+ Q T F
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNRQLFYKSNGFLNESFFLGENVLQNTYF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSAKNYYR+Q IQQLD+WSYRVISLGF FLTIGILSGAVWANEAWGSYW+WDPKETWAFI
Sbjct  196  FSAKNYYRSQLIQQLDYWSYRVISLGFTFLTIGILSGAVWANEAWGSYWNWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAI+LHTRTN NL+  NSA    IVASIGFLIIWI
Sbjct  256  TWIVFAIYLHTRTNRNLRGANSA----IVASIGFLIIWI  290



>gb|ADD30951.1| cytochrome c heme attachment protein (chloroplast) [Aucuba japonica]
Length=321

 Score =   230 bits (587),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 141/167 (84%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGK+F   N  L ESF FGE        
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNGKIFCKSNRLLNESFFFGEIEYMNERD  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ + TSFFSAKNYYR+Q IQQLD+WSYRVISLGFLFLTIGILSGA+WANEAWGSYW+WD
Sbjct  196  NVLRNTSFFSAKNYYRSQLIQQLDYWSYRVISLGFLFLTIGILSGAIWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITWIVFAI+LHTRTN NLQ  NSA    IVASIGF IIWI
Sbjct  256  PKETWAFITWIVFAIYLHTRTNKNLQGANSA----IVASIGFFIIWI  298



>ref|YP_009040371.1| cytochrome c heme attachment protein [Hyoscyamus niger]
 gb|AGU46519.1| cytochrome c heme attachment protein [Hyoscyamus niger]
Length=313

 Score =   227 bits (579),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 139/159 (87%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKN KLF   N F+ ESF   EN+ + TSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNRKLFYKSNGFVNESFFLVENVLENTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSAKNYYR+Q IQQLD+WSYRVISLGF FLTIGILSGAVWANEAWGSYW+WDPKETWAFI
Sbjct  196  FSAKNYYRSQLIQQLDYWSYRVISLGFTFLTIGILSGAVWANEAWGSYWNWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAI+LHTRTN NL+  NSA    IVA+IGFLIIWI
Sbjct  256  TWIVFAIYLHTRTNRNLRGANSA----IVAAIGFLIIWI  290



>ref|NP_783281.1| cytochrome c biogenesis protein [Atropa belladonna]
 sp|Q8S8U8.1|CCSA_ATRBE RecName: Full=Cytochrome c biogenesis protein CcsA (chloroplast) 
[Atropa belladonna]
 emb|CAC88095.1| ccsA protein [Atropa belladonna]
Length=312

 Score =   227 bits (578),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 141/159 (89%), Gaps = 5/159 (3%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKN KLF   N F+ ESFL GEN+ + TSF
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNRKLFYKSNGFVNESFLLGENVLENTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
             SAKNYYR+Q IQQLD+WSYRVISLGF FLTIGILSGAVWANEAWGSYW+WDPKETWAFI
Sbjct  196  -SAKNYYRSQLIQQLDYWSYRVISLGFTFLTIGILSGAVWANEAWGSYWNWDPKETWAFI  254

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAI+LHTRTN+NL+  NSA    I+A+IGFLIIWI
Sbjct  255  TWIVFAIYLHTRTNINLRGANSA----IIATIGFLIIWI  289



>gb|AIW05228.1| cytochrome c biogenesis protein [Aganosma cymosa]
Length=327

 Score =   226 bits (577),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 141/168 (84%), Gaps = 9/168 (5%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHV+MMILGYA+LLCGSLLSVAL+VITFRKN K+       L ESF  GE        
Sbjct  137  LIMHVTMMILGYASLLCGSLLSVALVVITFRKNRKILCKSTLLLKESFFVGEIEYMNKRS  196

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            NL Q TSFFS+KNYYR+Q IQQLD+WSYR+ISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  197  NLLQTTSFFSSKNYYRSQLIQQLDYWSYRIISLGFLFLTIGILSGAVWANEAWGSYWNWD  256

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVAS-IVASIGFLIIWI  478
            PKETWAFIT IVFAI+LHTRTNLN Q  NSAIVAS IVASIGFLIIWI
Sbjct  257  PKETWAFITLIVFAIYLHTRTNLNPQGANSAIVASAIVASIGFLIIWI  304



>gb|AIW05991.1| cytochrome c biogenesis protein [Wrightia natalensis]
Length=322

 Score =   226 bits (576),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 139/167 (83%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHV+MMILGYA+LLCGSLLSVAL+VITFRKN K+    N  L ESF  GE        
Sbjct  137  LIMHVTMMILGYASLLCGSLLSVALVVITFRKNRKILCKSNLLLKESFFVGEIEYMNKRS  196

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            NL Q TSFFS KNYYR+Q IQQLD+WSYRVISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  197  NLLQTTSFFSGKNYYRSQLIQQLDYWSYRVISLGFLFLTIGILSGAVWANEAWGSYWNWD  256

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITWIVFAI+LHTRTN+NLQ  NSA    IVASIGFLIIWI
Sbjct  257  PKETWAFITWIVFAIYLHTRTNINLQGANSA----IVASIGFLIIWI  299



>gb|ADD30955.1| cytochrome c heme attachment protein (chloroplast) [Lonicera 
japonica]
Length=319

 Score =   226 bits (575),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 140/167 (84%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKN K+F   N FL ESF FGE        
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNRKIFCKSNYFLNESFSFGEIQYMNERG  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ +KTSFFSAKNYYR Q IQQLD+WSYR+ISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLRKTSFFSAKNYYRCQLIQQLDYWSYRIISLGFLFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW VFAI+LHTRTN  L+  NSA    IVASIGFLIIWI
Sbjct  256  PKETWAFITWTVFAIYLHTRTNKKLRGTNSA----IVASIGFLIIWI  298



>gb|ADM92648.1| cytochrome c heme attachment protein [Davidia involucrata]
Length=313

 Score =   225 bits (574),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 138/159 (87%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMM+LGYAALLCGSLLSVALLVITFRK+  +F   N  L ESF FGEN+ + TSF
Sbjct  136  LIMHVSMMVLGYAALLCGSLLSVALLVITFRKDINIFCKSNHLLNESFSFGENVLRNTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSA+NYYR+Q IQQLD WSYRVISLGF+FLTIGILSGAVWANEAWGSYW+WDPKETWAFI
Sbjct  196  FSARNYYRSQLIQQLDHWSYRVISLGFIFLTIGILSGAVWANEAWGSYWNWDPKETWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TW +FAI+LHTRTN NLQ  NSA    I+ASIGFLIIWI
Sbjct  256  TWTIFAIYLHTRTNTNLQGANSA----IMASIGFLIIWI  290



>gb|ADD30953.1| cytochrome c heme attachment protein (chloroplast) [Ehretia acuminata]
Length=321

 Score =   224 bits (570),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 140/167 (84%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMMILGYAALLCGSLLSVALLVITFRK  K+F   +  L +SF FGE        
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKRRKIFCKSDHLLNQSFFFGEIEYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ Q TSFFSAKNYYR+Q I QLD+WSYR+ISLGF+FLT+GILSGAVWANEAWGSYW+WD
Sbjct  196  NVLQNTSFFSAKNYYRSQLIHQLDYWSYRIISLGFIFLTVGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITWIVFAI+LHTRTN+NLQ  NSA    IVASIGFLIIWI
Sbjct  256  PKETWAFITWIVFAIYLHTRTNINLQGANSA----IVASIGFLIIWI  298



>ref|YP_008815080.1| cytochrome c heme attachment protein (chloroplast) [Metapanax 
delavayi]
 gb|AGG39180.1| cytochrome c heme attachment protein (chloroplast) [Metapanax 
delavayi]
Length=321

 Score =   223 bits (567),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 139/167 (83%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMMIL YAALLCGSLLSVALLVITFRKN  LF   N  L ESF FGE        
Sbjct  136  LIMHVSMMILSYAALLCGSLLSVALLVITFRKNINLFCKRNPLLNESFSFGEIQYMNERN  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSFFSAKNYYR+Q IQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLGTTSFFSAKNYYRSQLIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITWIVFAI+LHTRTN+NL+  NSA    IVASIGFLIIWI
Sbjct  256  PKETWAFITWIVFAIYLHTRTNINLRGANSA----IVASIGFLIIWI  298



>gb|AIW05482.1| cytochrome c biogenesis protein [Neobracea bahamensis]
Length=322

 Score =   223 bits (567),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 138/167 (83%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHV+MMILGYA+LLCGSLLSVAL+VITFRKN K+F      L ESF  GE        
Sbjct  137  LIMHVTMMILGYASLLCGSLLSVALVVITFRKNRKIFCKSTLLLKESFFIGEIEYMNKRS  196

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            NL Q TSFFS KNYYR+Q IQQLD+WSYR+ISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  197  NLLQTTSFFSGKNYYRSQLIQQLDYWSYRIISLGFLFLTIGILSGAVWANEAWGSYWNWD  256

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITWIVFAI+LHTRTN+N Q  NSA    IVASIGFLIIWI
Sbjct  257  PKETWAFITWIVFAIYLHTRTNINPQGANSA----IVASIGFLIIWI  299



>ref|YP_004935602.1| cytochrome c biogenesis protein (chloroplast) [Eleutherococcus 
senticosus]
 gb|AEO92668.1| cytochrome c biogenesis protein (chloroplast) [Eleutherococcus 
senticosus]
Length=321

 Score =   221 bits (563),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 138/167 (83%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMMIL YAALLCGSLLSVALLVITFRK   LF   N  L ESF FGE        
Sbjct  136  LIMHVSMMILSYAALLCGSLLSVALLVITFRKKRNLFCKRNPLLNESFSFGEIQYMNERN  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSFFSAKNYYR+Q IQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLGTTSFFSAKNYYRSQLIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITWIVFAI+LHTRTN+NL+  NSA    IVASIGFLIIWI
Sbjct  256  PKETWAFITWIVFAIYLHTRTNINLRGANSA----IVASIGFLIIWI  298



>ref|YP_008815167.1| cytochrome c heme attachment protein (chloroplast) [Schefflera 
delavayi]
 gb|AGG39267.1| cytochrome c heme attachment protein (chloroplast) [Schefflera 
delavayi]
Length=321

 Score =   221 bits (563),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 139/167 (83%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMMIL YAALLCGSLLSVALLVITFRKN  LF   N  L +SF FGE        
Sbjct  136  LIMHVSMMILSYAALLCGSLLSVALLVITFRKNINLFCKRNPLLNDSFSFGEIQYMNERN  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSFFSAKNYYR+Q IQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLGTTSFFSAKNYYRSQLIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITWIVFAI+LHTRTN+NL+  NSA    IVASIGFLIIWI
Sbjct  256  PKETWAFITWIVFAIYLHTRTNINLRGTNSA----IVASIGFLIIWI  298



>ref|YP_008814993.1| cytochrome c heme attachment protein (chloroplast) [Brassaiopsis 
hainla]
 gb|AGG39093.1| cytochrome c heme attachment protein (chloroplast) [Brassaiopsis 
hainla]
Length=321

 Score =   221 bits (563),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 139/167 (83%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMMIL YAALLCGSLLSVALLVITFRKN  +F   N  L ESF FGE        
Sbjct  136  LIMHVSMMILSYAALLCGSLLSVALLVITFRKNINIFCKRNPLLNESFSFGEIQYMNERN  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSFFSAKNYYR+Q IQQLD+WSYR+ISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLGTTSFFSAKNYYRSQLIQQLDYWSYRIISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITWIVFAI+LHTRTN+NL+  NSA    IVASIGFLIIWI
Sbjct  256  PKETWAFITWIVFAIYLHTRTNINLRGANSA----IVASIGFLIIWI  298



>gb|AGJ51296.1| cytochrome c biogenesis protein (chloroplast) [Solanum carolinense]
Length=315

 Score =   221 bits (562),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 138/161 (86%), Gaps = 6/161 (4%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFS--GGNDFLTESFLFGENLFQKT  175
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKN KLF     N FL ESF  GEN+ + T
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNRKLFYIYKSNGFLNESFFLGENVLENT  195

Query  176  SFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWA  355
            SFFSAKNYYR + + QLD+WSYRVISLGF FLTIGILSGAVWANEAWGSYW+WDPKETWA
Sbjct  196  SFFSAKNYYRFRLLNQLDYWSYRVISLGFTFLTIGILSGAVWANEAWGSYWNWDPKETWA  255

Query  356  FITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            FITWIVFAI+LHTRTN NL+  NSA    IVASIGFLIIWI
Sbjct  256  FITWIVFAIYLHTRTNSNLRGTNSA----IVASIGFLIIWI  292



>gb|AIW05398.1| cytochrome c biogenesis protein [Epigynum auritum]
Length=322

 Score =   221 bits (562),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 138/167 (83%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHV+MMILGYA+LLCGSLLSVAL+VITFRKN ++       L ESF  GE        
Sbjct  137  LIMHVTMMILGYASLLCGSLLSVALVVITFRKNREILCKSTLLLKESFFVGEIEYMNKRS  196

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            NL Q TSFFS+KNYYR+Q IQQLD+WSYR+ISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  197  NLLQTTSFFSSKNYYRSQLIQQLDYWSYRIISLGFLFLTIGILSGAVWANEAWGSYWNWD  256

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITWIVFAI+LHTRTNLN Q  NSA    IVASIGFLIIWI
Sbjct  257  PKETWAFITWIVFAIYLHTRTNLNPQGANSA----IVASIGFLIIWI  299



>ref|YP_009108723.1| cytochrome c biogenesis protein [Nerium oleander]
 gb|ADD30958.1| cytochrome c heme attachment protein (chloroplast) [Nerium oleander]
 gb|AIW05567.1| cytochrome c biogenesis protein [Nerium oleander]
Length=322

 Score =   221 bits (562),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 138/167 (83%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHV+MMILGYA+LLCGSLLSVAL+VITFRKN K+       L ESF  GE        
Sbjct  137  LIMHVTMMILGYASLLCGSLLSVALVVITFRKNRKILCKSTFLLKESFFVGEIEYMNKRS  196

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            NL Q TSFFS KNYYR+Q IQQLD+WSY++ISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  197  NLLQTTSFFSGKNYYRSQLIQQLDYWSYQIISLGFLFLTIGILSGAVWANEAWGSYWNWD  256

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITWIVFAI+LHTRTN+NLQ  NSA    IVASIGFLIIWI
Sbjct  257  PKETWAFITWIVFAIYLHTRTNINLQGANSA----IVASIGFLIIWI  299



>gb|AII18502.1| cytochrome c heme attachment protein, partial (chloroplast) [Viburnum 
molle]
Length=321

 Score =   220 bits (561),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 137/167 (82%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKN  LF   N  LTESF FGE        
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNKNLFCQSNHLLTESFSFGEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ + TSFFSAKNYY+ Q IQQLD+WSYRVISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLRNTSFFSAKNYYKCQLIQQLDYWSYRVISLGFLFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW+VFAI+LH R N  LQ  NSA    IVASIGFLIIWI
Sbjct  256  PKETWAFITWMVFAIYLHIRQNKILQGANSA----IVASIGFLIIWI  298



>gb|AII18495.1| cytochrome c heme attachment protein, partial (chloroplast) [Viburnum 
dentatum]
 gb|AII18509.1| cytochrome c heme attachment protein, partial (chloroplast) [Viburnum 
triphyllum]
Length=321

 Score =   220 bits (561),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 137/167 (82%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKN  LF   N  LTESF FGE        
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNKNLFCQSNHLLTESFSFGEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ + TSFFSAKNYY+ Q IQQLD+WSYRVISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLRNTSFFSAKNYYKCQLIQQLDYWSYRVISLGFLFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW+VFAI+LH R N  LQ  NSA    IVASIGFLIIWI
Sbjct  256  PKETWAFITWMVFAIYLHIRQNKILQGANSA----IVASIGFLIIWI  298



>gb|AII18490.1| cytochrome c heme attachment protein, partial (chloroplast) [Viburnum 
amplificatum]
Length=321

 Score =   220 bits (561),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 137/167 (82%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKN  LF   N  LTESF FGE        
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNKNLFCKSNHLLTESFSFGEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ + TSFFSAKNYY+ Q IQQLD+WSYRVISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLRNTSFFSAKNYYKCQLIQQLDYWSYRVISLGFLFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW+VFAI+LH R N  LQ  NSA    IVASIGFLIIWI
Sbjct  256  PKETWAFITWMVFAIYLHIRQNKILQGANSA----IVASIGFLIIWI  298



>ref|YP_008815254.1| cytochrome c heme attachment protein (chloroplast) [Kalopanax 
septemlobus]
 gb|AGG39354.1| cytochrome c heme attachment protein (chloroplast) [Kalopanax 
septemlobus]
Length=321

 Score =   220 bits (561),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 138/167 (83%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMMIL YAALLCGSLLSVALLVITFRKN  LF   N  L ESF FGE        
Sbjct  136  LIMHVSMMILSYAALLCGSLLSVALLVITFRKNRNLFCKRNPLLNESFSFGEIQYMNERN  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSFFSAKNYYR+Q IQ LD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLGTTSFFSAKNYYRSQLIQLLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITWIVFAI+LHTRTN+NL+  NSA    IVASIGFLIIWI
Sbjct  256  PKETWAFITWIVFAIYLHTRTNINLRGANSA----IVASIGFLIIWI  298



>gb|AII18493.1| cytochrome c heme attachment protein, partial (chloroplast) [Viburnum 
clemensae]
Length=321

 Score =   220 bits (560),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 137/167 (82%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKN  +F   N  LTESF FGE        
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNKNIFCKSNHLLTESFSFGEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ + TSFFSAKNYY+ Q IQQLD+WSYRVISLGFLFLTIGI+SGAVWANEAWGSYW+WD
Sbjct  196  NVLRNTSFFSAKNYYKCQLIQQLDYWSYRVISLGFLFLTIGIISGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW+VFAI+LH R N N Q  NSA    IVASIGFLIIWI
Sbjct  256  PKETWAFITWMVFAIYLHIRKNKNFQGANSA----IVASIGFLIIWI  298



>ref|YP_008814906.1| cytochrome c heme attachment protein (chloroplast) [Aralia undulata]
 gb|AGG39006.1| cytochrome c heme attachment protein (chloroplast) [Aralia undulata]
Length=321

 Score =   220 bits (560),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 138/167 (83%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMMIL YAALLCGSLLSVALLVITFRKN   F   N  L ESF FGE        
Sbjct  136  LIMHVSMMILSYAALLCGSLLSVALLVITFRKNRNRFCKRNPLLNESFSFGEIQYMNERN  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSFFSAKNYYR+Q IQQLD+WSYRVISLGF+FLT+GILSGAVWANEAWGSYW+WD
Sbjct  196  NVLGTTSFFSAKNYYRSQLIQQLDYWSYRVISLGFIFLTLGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITWIVFAI+LHTRTN+NL+  NSA    IVASIGFLIIWI
Sbjct  256  PKETWAFITWIVFAIYLHTRTNINLRGANSA----IVASIGFLIIWI  298



>gb|AII18489.1| cytochrome c heme attachment protein, partial (chloroplast) [Viburnum 
acerifolium]
 gb|AII18491.1| cytochrome c heme attachment protein, partial (chloroplast) [Viburnum 
carlesii]
 gb|AII18492.1| cytochrome c heme attachment protein, partial (chloroplast) [Viburnum 
cassinoides]
 gb|AII18496.1| cytochrome c heme attachment protein, partial (chloroplast) [Viburnum 
dilatatum]
Length=321

 Score =   219 bits (559),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 137/167 (82%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKN  +F   N  LTESF FGE        
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNKNIFCKSNHLLTESFSFGEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ + TSFFSAKNYY+ Q IQQLD+WSYRVISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLRNTSFFSAKNYYKCQLIQQLDYWSYRVISLGFLFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW+VFAI+LH R N  LQ  NSA    IVASIGFLIIWI
Sbjct  256  PKETWAFITWMVFAIYLHIRQNKILQGANSA----IVASIGFLIIWI  298



>ref|YP_009108892.1| cytochrome c biogenesis protein [Pentalinon luteum]
 gb|AIW05736.1| cytochrome c biogenesis protein [Pentalinon luteum]
Length=322

 Score =   219 bits (559),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 137/167 (82%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHV+MMILGYA+LLCGSLLSVAL+VITFRKN K+       L E F  GE        
Sbjct  137  LIMHVTMMILGYASLLCGSLLSVALVVITFRKNRKILCKSTLLLKEYFFVGEIEYMNKRN  196

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            NL Q TSFFS KNYYR+Q IQQLD+WSYR+ISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  197  NLLQTTSFFSDKNYYRSQLIQQLDYWSYRIISLGFLFLTIGILSGAVWANEAWGSYWNWD  256

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITWIVFAI+LHTRTN+NLQ  NSA    IVASIGFLIIWI
Sbjct  257  PKETWAFITWIVFAIYLHTRTNVNLQGANSA----IVASIGFLIIWI  299



>gb|AII18497.1| cytochrome c heme attachment protein, partial (chloroplast) [Viburnum 
erubescens]
Length=321

 Score =   219 bits (559),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 137/167 (82%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKN  +F   N  LTESF FGE        
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNKNIFCKSNHLLTESFSFGEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ + TSFFSAKNYY+ Q IQQLD+WSYRVISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLRNTSFFSAKNYYKCQLIQQLDYWSYRVISLGFLFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW+VFAI+LH R N  LQ  NSA    IVASIGFLIIWI
Sbjct  256  PKETWAFITWMVFAIYLHIRQNKILQGANSA----IVASIGFLIIWI  298



>gb|AII18499.1| cytochrome c heme attachment protein, partial (chloroplast) [Viburnum 
lantanoides]
Length=321

 Score =   219 bits (559),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 137/167 (82%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKN  +F   N  LTESF FGE        
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNKNIFCKSNHLLTESFSFGEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ + TSFFSAKNYY+ Q IQQLD+WSYRVISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLRNTSFFSAKNYYKCQLIQQLDYWSYRVISLGFLFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW+VFAI+LH R N  LQ  NSA    IVASIGFLIIWI
Sbjct  256  PKETWAFITWMVFAIYLHIRQNKILQGANSA----IVASIGFLIIWI  298



>gb|AII18494.1| cytochrome c heme attachment protein, partial (chloroplast) [Viburnum 
cylindricum]
Length=321

 Score =   219 bits (559),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 137/167 (82%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKN  +F   N  LTESF FGE        
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNKNIFCKSNHLLTESFSFGEIQYMNERN  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ + TSFFSAKNYY+ Q IQQLD+WSYRVISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLRNTSFFSAKNYYKCQLIQQLDYWSYRVISLGFLFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW+VFAI+LH R N  LQ  NSA    IVASIGFLIIWI
Sbjct  256  PKETWAFITWMVFAIYLHIRQNKILQGANSA----IVASIGFLIIWI  298



>gb|AII18498.1| cytochrome c heme attachment protein, partial (chloroplast) [Viburnum 
grandiflorum]
 gb|AII18501.1| cytochrome c heme attachment protein, partial (chloroplast) [Viburnum 
lutescens]
Length=321

 Score =   219 bits (559),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 137/167 (82%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKN  +F   N  LTESF FGE        
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNKNIFCKSNHLLTESFSFGEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ + TSFFSAKNYY+ Q IQQLD+WSYRVISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLRNTSFFSAKNYYKCQLIQQLDYWSYRVISLGFLFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW+VFAI+LH R N  LQ  NSA    IVASIGFLIIWI
Sbjct  256  PKETWAFITWMVFAIYLHIRQNKILQGANSA----IVASIGFLIIWI  298



>gb|AII18504.1| cytochrome c heme attachment protein, partial (chloroplast) [Viburnum 
plicatum]
Length=321

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 137/167 (82%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKN  +F   N  LTESF FGE        
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNKNIFCKSNHLLTESFSFGEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ + TSFFSAKNYY+ Q IQQLD+WSYRVISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLRNTSFFSAKNYYKCQLIQQLDYWSYRVISLGFLFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW+VFAI+LH R N  LQ  NSA    IVASIGFLIIWI
Sbjct  256  PKETWAFITWMVFAIYLHIRQNKILQGANSA----IVASIGFLIIWI  298



>ref|YP_008578588.1| cytochrome c biogenesis protein (chloroplast) (chloroplast) [Asclepias 
nivea]
 gb|AGW05067.1| cytochrome c biogenesis protein (chloroplast) (chloroplast) [Asclepias 
nivea]
Length=322

 Score =   219 bits (557),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 137/167 (82%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHV+MMILGYA+LLCGSLLSVAL+VITFRKNGK+       + ESF  GE        
Sbjct  137  LLMHVTMMILGYASLLCGSLLSVALVVITFRKNGKILGKSTLLIKESFFVGEIEYMNKRS  196

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            NL + TSFFS KNYYR+Q IQQLD+WSYR+ISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  197  NLLETTSFFSGKNYYRSQLIQQLDYWSYRIISLGFLFLTIGILSGAVWANEAWGSYWNWD  256

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITWIVFAI+LHTRTN+N Q  NSA    IVA IGFLIIWI
Sbjct  257  PKETWAFITWIVFAIYLHTRTNINPQGKNSA----IVACIGFLIIWI  299



>gb|AER52625.1| cytochrome c biogenesis protein [Asclepias coulteri]
 gb|AER52870.1| cytochrome c biogenesis protein [Asclepias leptopus]
 gb|AER52951.1| cytochrome c biogenesis protein [Asclepias macrotis]
 gb|AER53029.1| cytochrome c biogenesis protein [Asclepias macrotis]
Length=322

 Score =   219 bits (557),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 137/167 (82%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHV+MMILGYA+LLCGSLLSVAL+VITFRKNGK+       + ESF  GE        
Sbjct  137  LLMHVTMMILGYASLLCGSLLSVALVVITFRKNGKILGKSTLLIKESFFVGEIEYMNKRS  196

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            NL + TSFFS KNYYR+Q IQQLD+WSYR+ISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  197  NLLETTSFFSGKNYYRSQLIQQLDYWSYRIISLGFLFLTIGILSGAVWANEAWGSYWNWD  256

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITWIVFAI+LHTRTN+N Q  NSA    IVA IGFLIIWI
Sbjct  257  PKETWAFITWIVFAIYLHTRTNINPQGENSA----IVACIGFLIIWI  299



>gb|AII18505.1| cytochrome c heme attachment protein, partial (chloroplast) [Viburnum 
punctatum]
Length=321

 Score =   218 bits (556),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKN  LF   N  L ESF FGE        
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNKNLFCKSNHLLNESFSFGEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ + TSFFSAKNYY+ Q IQQLD+WSYRVISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLRNTSFFSAKNYYKCQLIQQLDYWSYRVISLGFLFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW+VFAI+LH R N  LQ  NSA    IVASIGFLIIWI
Sbjct  256  PKETWAFITWMVFAIYLHIRQNKILQGANSA----IVASIGFLIIWI  298



>gb|AII18510.1| cytochrome c heme attachment protein, partial (chloroplast) [Viburnum 
vernicosum]
Length=321

 Score =   218 bits (556),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 137/167 (82%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKN  +F   N  LTESF FGE        
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNKNIFCKSNHLLTESFSFGEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ + TSFFSAKNYY+ Q IQQLD+WSYR+ISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLRNTSFFSAKNYYKCQLIQQLDYWSYRLISLGFLFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW+VFAI+LH R N  LQ  NSA    IVASIGFLIIWI
Sbjct  256  PKETWAFITWMVFAIYLHIRQNKILQGANSA----IVASIGFLIIWI  298



>gb|ADD30964.1| cytochrome c heme attachment protein (chloroplast) [Cornus florida]
Length=321

 Score =   218 bits (555),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 137/167 (82%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMM+LGYAALLCGSLLSVALLVITFRK+ K+F   N  L ESF FGE        
Sbjct  136  LIMHVSMMVLGYAALLCGSLLSVALLVITFRKDIKIFCKSNHLLNESFSFGEIQYINKKS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSFFSA NYYR+Q IQQLD WSYRVISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLGNTSFFSAGNYYRSQLIQQLDHWSYRVISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN NLQ  NSA    IVASIGFLIIWI
Sbjct  256  PKETWAFITWTIFAIYLHTRTNKNLQGANSA----IVASIGFLIIWI  298



>gb|AII18507.1| cytochrome c heme attachment protein, partial (chloroplast) [Viburnum 
taiwanianum]
Length=321

 Score =   218 bits (555),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 137/167 (82%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKN  +F   N  +TESF FGE        
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNKNIFCKSNHLVTESFSFGEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ + TSFFSAKNYY+ Q IQQLD+WSYRVISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLRNTSFFSAKNYYKCQLIQQLDYWSYRVISLGFLFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW+VFAI+LH R N  LQ  NSA    IVASIGFLIIWI
Sbjct  256  PKETWAFITWMVFAIYLHIRQNKILQGANSA----IVASIGFLIIWI  298



>gb|ADD30962.1| cytochrome c heme attachment protein (chloroplast) [Berberidopsis 
corallina]
Length=321

 Score =   218 bits (555),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 138/167 (83%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+LGYAALLCGSLLSVALLVITFRKN ++F   N  L ESF  GE        
Sbjct  136  LMMHVSMMVLGYAALLCGSLLSVALLVITFRKNIRIFGKSNHLLNESFSCGEIQYMDERN  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ Q TSFFS +NYYR+Q IQQLD WSYRVISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLQNTSFFSVRNYYRSQLIQQLDRWSYRVISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN NLQ VNSA    IVAS+GFLIIWI
Sbjct  256  PKETWAFITWTIFAIYLHTRTNTNLQGVNSA----IVASLGFLIIWI  298



>ref|YP_009108808.1| cytochrome c biogenesis protein [Oncinotis tenuiloba]
 gb|AIW05652.1| cytochrome c biogenesis protein [Oncinotis tenuiloba]
Length=322

 Score =   218 bits (554),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 135/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHV+MMILGYA+LLCGSLLSVAL+VITFRKN K+       L ES   GE        
Sbjct  137  LIMHVTMMILGYASLLCGSLLSVALVVITFRKNRKILCKSTLLLKESLFVGEIEYMNKRS  196

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            NL Q TSFFS KNYYR+Q IQQ D+WSYR+ISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  197  NLLQTTSFFSGKNYYRSQLIQQFDYWSYRIISLGFLFLTIGILSGAVWANEAWGSYWNWD  256

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITWIVFAI+LHTRTNLN Q  NSA    IVASIGFLIIWI
Sbjct  257  PKETWAFITWIVFAIYLHTRTNLNPQGPNSA----IVASIGFLIIWI  299



>gb|AII18500.1| cytochrome c heme attachment protein, partial (chloroplast) [Viburnum 
lentago]
Length=321

 Score =   218 bits (554),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKN  +F   N  LTESF FGE        
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNKNIFCKSNHLLTESFSFGEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ + TSFFSAKNYY+ Q IQQLD+W YRVISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLRNTSFFSAKNYYKCQLIQQLDYWGYRVISLGFLFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW+VFAI+LH R N  LQ  NSA    IVASIGFLIIWI
Sbjct  256  PKETWAFITWMVFAIYLHIRQNKILQGANSA----IVASIGFLIIWI  298



>gb|AII18508.1| cytochrome c heme attachment protein, partial (chloroplast) [Viburnum 
tinus]
Length=321

 Score =   218 bits (554),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKN  +F   N  LTESF FGE        
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNKNIFCKSNHLLTESFSFGEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ + TSFFSAKNYY+ Q IQQLD+WSYRVISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLRNTSFFSAKNYYKCQLIQQLDYWSYRVISLGFLFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW+VFAI+LH R N  LQ  NSA    IVASIGF IIWI
Sbjct  256  PKETWAFITWMVFAIYLHIRQNKILQGANSA----IVASIGFFIIWI  298



>gb|AII18503.1| cytochrome c heme attachment protein, partial (chloroplast) [Viburnum 
opulus]
Length=321

 Score =   218 bits (554),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKN  +F   N  LTESF FGE        
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNKNIFCKSNHLLTESFSFGEIQSMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ + TSFFSAKNYY+ Q IQQLD+WSYRVISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLRNTSFFSAKNYYKCQLIQQLDYWSYRVISLGFLFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW+VFAI+LH R    LQ  NSA    IVASIGFLIIWI
Sbjct  256  PKETWAFITWMVFAIYLHIRQKKILQGANSA----IVASIGFLIIWI  298



>gb|AER53110.1| cytochrome c biogenesis protein [Asclepias masonii]
Length=322

 Score =   217 bits (553),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHV+MMILGYA+LLCGSLLSVAL+VITFRKNGK+       + ESF  GE        
Sbjct  137  LLMHVTMMILGYASLLCGSLLSVALVVITFRKNGKILGKSTLLIKESFFVGEIEYMNKRS  196

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            NL + TSFFS KNYYR+Q IQQLD+WSYR+ISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  197  NLLETTSFFSGKNYYRSQLIQQLDYWSYRIISLGFLFLTIGILSGAVWANEAWGSYWNWD  256

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITWIVFAI+LHTRTN N Q  NSA    IVA IGFLIIWI
Sbjct  257  PKETWAFITWIVFAIYLHTRTNRNPQGENSA----IVACIGFLIIWI  299



>gb|AER52461.1| cytochrome c biogenesis protein [Asclepias albicans]
 gb|AER52543.1| cytochrome c biogenesis protein [Asclepias albicans]
 gb|AER53192.1| cytochrome c biogenesis protein [Asclepias subaphylla]
 gb|AER53270.1| cytochrome c biogenesis protein [Asclepias subaphylla]
 gb|AER53352.1| cytochrome c biogenesis protein [Asclepias subulata]
 gb|AER53434.1| cytochrome c biogenesis protein [Asclepias subulata]
 gb|AER53514.1| cytochrome c biogenesis protein [Asclepias albicans x Asclepias 
subulata]
Length=322

 Score =   217 bits (553),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHV+MMILGYA+LLCGSLLSVAL+VITFRKNGK+       + ESF  GE        
Sbjct  137  LLMHVTMMILGYASLLCGSLLSVALVVITFRKNGKILGKSTLLIKESFFVGEIEYMNKRS  196

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            NL + TSFFS KNYYR+Q IQQLD+WSYR+ISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  197  NLLETTSFFSGKNYYRSQLIQQLDYWSYRIISLGFLFLTIGILSGAVWANEAWGSYWNWD  256

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITWIVFAI+LHTRTN N Q  NSA    IVA IGFLIIWI
Sbjct  257  PKETWAFITWIVFAIYLHTRTNRNPQGENSA----IVACIGFLIIWI  299



>gb|AIW05821.1| cytochrome c biogenesis protein [Periploca sepium]
Length=322

 Score =   216 bits (551),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 137/167 (82%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHV+MMILGYA+LLCGSLLSVAL+VI FRKN K+       L ESF  GE        
Sbjct  137  LIMHVTMMILGYASLLCGSLLSVALVVIIFRKNRKILCKSTLLLKESFFVGEIEYINKRN  196

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            +L Q TSFFS KNYYR+Q I+QLD+WSYR+ISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  197  HLLQTTSFFSGKNYYRSQLIKQLDYWSYRIISLGFLFLTIGILSGAVWANEAWGSYWNWD  256

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITWI+FAI+LHTRTN+N QS NSA    IVASIGFLIIWI
Sbjct  257  PKETWAFITWIIFAIYLHTRTNINPQSANSA----IVASIGFLIIWI  299



>gb|AER52707.1| cytochrome c biogenesis protein [Asclepias cutleri]
 gb|AER52789.1| cytochrome c biogenesis protein [Asclepias cutleri]
Length=322

 Score =   216 bits (550),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHV+MMILGYA+LLCGSLLSVAL+VITFRKNGK+       + E F  GE        
Sbjct  137  LLMHVTMMILGYASLLCGSLLSVALVVITFRKNGKILGKSTLLIKELFFVGEIEYMNKRS  196

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            NL + TSFFS KNYYR+Q IQQLD+WSYR+ISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  197  NLLETTSFFSGKNYYRSQLIQQLDYWSYRIISLGFLFLTIGILSGAVWANEAWGSYWNWD  256

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITWIVFAI+LHTRTN+N Q  NSA    IVA IGFLIIWI
Sbjct  257  PKETWAFITWIVFAIYLHTRTNINPQGENSA----IVACIGFLIIWI  299



>ref|YP_087015.1| cytochrome c biogenesis protein [Panax ginseng]
 sp|Q68RV7.1|CCSA_PANGI RecName: Full=Cytochrome c biogenesis protein CcsA (chloroplast) 
[Panax ginseng]
 gb|AAT98559.1| unknown [Panax ginseng]
 gb|AGM14959.1| cytochrome c biogenesis protein (chloroplast) [Panax ginseng]
 gb|AGM15045.1| cytochrome c biogenesis protein (chloroplast) [Panax ginseng]
 gb|AGM15131.1| cytochrome c biogenesis protein (chloroplast) [Panax ginseng]
 gb|AGW31892.1| cytochrome c biogenesis protein (chloroplast) [Panax ginseng]
Length=320

 Score =   216 bits (550),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 137/166 (83%), Gaps = 11/166 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE-------N  160
            LIMHVSMMIL YAALLCGSLLSVALLVITFRKN  +F   N  L E F FGE       N
Sbjct  136  LIMHVSMMILSYAALLCGSLLSVALLVITFRKNRNIFCKRNPLLNELFSFGEIQYMNERN  195

Query  161  LFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDP  340
               +T+FFSAKNYYR+Q IQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYW+WDP
Sbjct  196  NVLRTTFFSAKNYYRSQLIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWNWDP  255

Query  341  KETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            KETWAFITWIVFAI+LHTRTN+ L+  NSA    IVASIGFLIIWI
Sbjct  256  KETWAFITWIVFAIYLHTRTNIKLRGANSA----IVASIGFLIIWI  297



>gb|ADD30954.1| cytochrome c heme attachment protein (chloroplast) [Ilex cornuta]
Length=321

 Score =   216 bits (550),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 137/167 (82%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMMILGYAALLCGSLLSVALL+ITFRKN K+    N FL E   FG+        
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLIITFRKNRKILCKSNRFLNELVTFGKIQYMNERN  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            ++ Q TSFFS KNYYR+Q IQQL +WSYRVISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  DVLQNTSFFSDKNYYRSQLIQQLGYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAF+TWIVFAI+LHTRTN NLQ  NSA    IVASIGFLIIWI
Sbjct  256  PKETWAFVTWIVFAIYLHTRTNKNLQDTNSA----IVASIGFLIIWI  298



>gb|ADZ36402.1| c-type cytochrome synthesis protein [Diospyros rhombifolia]
Length=321

 Score =   216 bits (549),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 137/167 (82%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMM+LGYAALLCGSLLSVALLVITFRK+ K+FS  N  LTESF F +        
Sbjct  136  LIMHVSMMVLGYAALLCGSLLSVALLVITFRKDIKIFSKSNHLLTESFSFDKIQYINERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            NLF  TSFFSAKNYYR+Q IQQLD WSYRVIS+GF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NLFGNTSFFSAKNYYRSQLIQQLDHWSYRVISIGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKE WAFITW VFAI+LHTRTN  L   NSA    IVASIGFLIIWI
Sbjct  256  PKEIWAFITWTVFAIYLHTRTNRKLTPANSA----IVASIGFLIIWI  298



>gb|AGW04868.1| cytochrome c biogenesis protein [Sisyranthus trichostomus]
Length=325

 Score =   215 bits (548),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 135/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHV+MMILGYA+LLCGSLLSVAL+VITFRK  K+       L ESF  GE        
Sbjct  140  LLMHVTMMILGYASLLCGSLLSVALVVITFRKTRKILCKSTLLLKESFFVGEIEYMNKSS  199

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            NL Q TSFFS+KNYYR Q IQQLD+W YR+ISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  200  NLLQTTSFFSSKNYYRFQLIQQLDYWGYRIISLGFLFLTIGILSGAVWANEAWGSYWNWD  259

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITWIVFAI+LHTRTN+N Q  NSA    IVASIGFLIIWI
Sbjct  260  PKETWAFITWIVFAIYLHTRTNINPQGANSA----IVASIGFLIIWI  302



>gb|AII18506.1| cytochrome c heme attachment protein, partial (chloroplast) [Viburnum 
sieboldii]
Length=323

 Score =   214 bits (546),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 137/169 (81%), Gaps = 14/169 (8%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLF--GE------  157
            LIMHVSMMILGYAALLCGSLLSVALLVITFRKN  +F   N  LTESF F  GE      
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVITFRKNKNIFCKSNHLLTESFSFSFGEIQYMNE  195

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+ + TSFFSAKNYY+ Q IQQLD+WSYRVISLGFLFLTIGILSGAVWANEAWGSYW+
Sbjct  196  RSNVLRNTSFFSAKNYYKCQLIQQLDYWSYRVISLGFLFLTIGILSGAVWANEAWGSYWN  255

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            WDPKETWAFITW+VFAI+LH R N  LQ  NSA    IVASIGFLIIWI
Sbjct  256  WDPKETWAFITWMVFAIYLHIRQNKILQGANSA----IVASIGFLIIWI  300



>ref|YP_008815986.1| cytochrome c biogenesis protein (chloroplast) [Lindenbergia philippensis]
 emb|CDI43967.1| cytochrome c biogenesis protein (chloroplast) [Lindenbergia philippensis]
Length=321

 Score =   214 bits (546),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 140/169 (83%), Gaps = 14/169 (8%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLT--ESFLFGE------  157
            LIMHVSMMILGYAALLCGSLLSV+LLVI+ RK  K FS  N FL   ESF FGE      
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVSLLVISVRKKRKFFSTRNHFLNLNESFFFGELEYMNE  195

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+F+ TSFFS++NYYR Q IQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYWS
Sbjct  196  RSNVFETTSFFSSRNYYRLQLIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWS  255

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            WDPKETWAFITWIVFAI+LHTRTN+  + +NSA    IVASIGFLIIWI
Sbjct  256  WDPKETWAFITWIVFAIYLHTRTNIKWKGINSA----IVASIGFLIIWI  300



>gb|AGW04334.1| cytochrome c biogenesis protein [Secamone afzelii]
Length=323

 Score =   214 bits (546),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 136/168 (81%), Gaps = 13/168 (8%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGK-LFSGGNDFLTESFLFGE-------  157
            LIMHV+MMILGYA+LLCGSLLSVAL+VITFRKN K L       + ESF   E       
Sbjct  137  LIMHVTMMILGYASLLCGSLLSVALVVITFRKNRKILLCKSTLLIKESFFVSEIEYMNKR  196

Query  158  -NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSW  334
             NL Q TSFFS KNYYR+Q IQQLD+WSYR+ISLGFLFLTIGILSGAVWANEAWGSYW+W
Sbjct  197  SNLLQTTSFFSGKNYYRSQLIQQLDYWSYRIISLGFLFLTIGILSGAVWANEAWGSYWNW  256

Query  335  DPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            DPKETWAFITWIVFAI+LHTRTN+N Q  NSA    IVASIGFLIIWI
Sbjct  257  DPKETWAFITWIVFAIYLHTRTNINPQGANSA----IVASIGFLIIWI  300



>ref|YP_007353964.1| cytochrome c biogenesis protein (chloroplast) [Tectona grandis]
 emb|CCP47182.1| cytochrome c biogenesis protein (chloroplast) [Tectona grandis]
 emb|CCP47271.1| cytochrome c biogenesis protein (chloroplast) [Tectona grandis]
 emb|CCP47360.1| cytochrome c biogenesis protein (chloroplast) [Tectona grandis]
Length=323

 Score =   214 bits (545),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 138/169 (82%), Gaps = 14/169 (8%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLT--ESFLFGE------  157
            LIMHVSMMILGYAALLCGSLLSV+LLVIT +K  KLFS  N  L    SF  GE      
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVSLLVITVKKRRKLFSTSNHLLNLNGSFFLGEIEYMNE  195

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+ QKTSFFS +NYYR+Q IQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYWS
Sbjct  196  RRNVLQKTSFFSPRNYYRSQLIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWS  255

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            WDPKETWAFITWI+FAI+LHTRTN+ L+  NSA    IVASIGFLIIWI
Sbjct  256  WDPKETWAFITWIIFAIYLHTRTNIKLKGTNSA----IVASIGFLIIWI  300



>gb|AGW04637.1| cytochrome c biogenesis protein [Marsdenia astephanoides]
Length=322

 Score =   214 bits (545),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 135/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHV+MMILGYA+LLCGSLLSVAL+VITFRKN K+       + ESF  GE        
Sbjct  137  LLMHVTMMILGYASLLCGSLLSVALVVITFRKNRKILCKSTLLIKESFFVGEIEYMNKRS  196

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            NL Q TSFFS KNYYR+Q IQQLD+WSYR+ISLGF FLTIGILSGAVWANEAWGSYW+WD
Sbjct  197  NLLQTTSFFSGKNYYRSQLIQQLDYWSYRIISLGFFFLTIGILSGAVWANEAWGSYWNWD  256

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITWIVFAI+LHTR N+N +  NSA    IVASIGFLIIWI
Sbjct  257  PKETWAFITWIVFAIYLHTRANINPKGANSA----IVASIGFLIIWI  299



>gb|AIW05906.1| cytochrome c biogenesis protein [Rhabdadenia biflora]
Length=322

 Score =   214 bits (544),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHV+MMILGYA+LLCGSLLSVAL+VITFRKN K+       L ESF  GE        
Sbjct  137  LIMHVTMMILGYASLLCGSLLSVALVVITFRKNRKILCKSTLLLKESFFVGEIKYMNKRS  196

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            NL Q TSFF  KNYYR+Q IQQLD+WSYR+ISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  197  NLLQTTSFFFDKNYYRSQLIQQLDYWSYRIISLGFLFLTIGILSGAVWANEAWGSYWNWD  256

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITWI+FAI+LHTRTN+N +  NSA    IVAS+GFLIIWI
Sbjct  257  PKETWAFITWIIFAIYLHTRTNINPRGANSA----IVASLGFLIIWI  299



>gb|AGW05022.1| cytochrome c biogenesis protein [Vincetoxicum rossicum]
Length=322

 Score =   214 bits (544),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHV+MMILGYA+LLCGSLLSVAL+VITFRK  K+       + ESF  GE        
Sbjct  137  LLMHVTMMILGYASLLCGSLLSVALVVITFRKKRKILGKSTLLIKESFFVGEIEYMNKKS  196

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            NL Q TSFFS KNYY++Q IQQLD+WSYR+ISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  197  NLLQTTSFFSGKNYYKSQLIQQLDYWSYRIISLGFLFLTIGILSGAVWANEAWGSYWNWD  256

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW+VFAI+LHTRTN+N Q  NSA    IVASIGFLIIWI
Sbjct  257  PKETWAFITWLVFAIYLHTRTNINPQGENSA----IVASIGFLIIWI  299



>ref|YP_008578671.1| cytochrome c biogenesis protein (chloroplast) (chloroplast) [Asclepias 
syriaca]
 gb|ADZ52367.1| cytochrome c biogenesis protein (chloroplast) [Asclepias syriaca]
 gb|AGW05185.1| cytochrome c biogenesis protein (chloroplast) (chloroplast) [Asclepias 
syriaca]
Length=322

 Score =   213 bits (543),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 135/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHV+MMILGYA+LLCGSLLSVAL+VITFRKN K+       + E F  GE        
Sbjct  137  LLMHVTMMILGYASLLCGSLLSVALVVITFRKNEKILGKSTLLIKEVFFVGEIEYMNKRS  196

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            NL + TSFFS KNYYR+Q IQQLD+WSYR+ISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  197  NLLETTSFFSGKNYYRSQLIQQLDYWSYRIISLGFVFLTIGILSGAVWANEAWGSYWNWD  256

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITWIVFAI+LHTRTN+N Q  NSA    IVA IGFLIIWI
Sbjct  257  PKETWAFITWIVFAIYLHTRTNINPQGTNSA----IVACIGFLIIWI  299



>gb|AGW04791.1| cytochrome c biogenesis protein [Orthosia scoparia]
Length=322

 Score =   213 bits (542),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 135/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHV+ MILGYA+LLCGSLLSV L+VITFRKN K+       + ESF  GE        
Sbjct  137  LLMHVTTMILGYASLLCGSLLSVGLVVITFRKNRKILGKSTLLIKESFFVGETEYMNKRS  196

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            NL + TSFFS KNYYR+Q IQQLD+WSYR+ISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  197  NLLETTSFFSGKNYYRSQLIQQLDYWSYRIISLGFLFLTIGILSGAVWANEAWGSYWNWD  256

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITWIVFAI+LHTRTN+N Q  NSA    I+ASIGFLIIWI
Sbjct  257  PKETWAFITWIVFAIYLHTRTNINPQGENSA----IIASIGFLIIWI  299



>gb|AGW04563.1| cytochrome c biogenesis protein [Eustegia minuta]
Length=322

 Score =   213 bits (541),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 135/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHV+MMILGYA+LLCGSL+SVAL+VITFRKN K+    +  + ESF  GE        
Sbjct  137  LLMHVTMMILGYASLLCGSLVSVALVVITFRKNRKILGKSSFLIKESFFVGEIEYMNKRS  196

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            NL Q TSFFS KNYYR+Q IQQLD+WSYR ISLGF FLTIGILSGAVWANEAWGSYW+WD
Sbjct  197  NLLQTTSFFSGKNYYRSQLIQQLDYWSYRSISLGFFFLTIGILSGAVWANEAWGSYWNWD  256

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITWIVFAI+LHTRTN+N Q  NSA    IVA IGFLIIWI
Sbjct  257  PKETWAFITWIVFAIYLHTRTNINPQGENSA----IVACIGFLIIWI  299



>ref|YP_567127.1| cytochrome c biogenesis protein [Vitis vinifera]
 sp|Q0ZIW9.1|CCSA_VITVI RecName: Full=Cytochrome c biogenesis protein CcsA (chloroplast) 
[Vitis vinifera]
 gb|ABE47584.1| cytochrome c heme attachment protein [Vitis vinifera]
 dbj|BAO01542.1| cytochrome c biogenesis protein (chloroplast) [Vitis vinifera 
subsp. caucasica]
 dbj|BAO01626.1| cytochrome c biogenesis protein (chloroplast) [Vitis vinifera 
subsp. caucasica]
 dbj|BAO01710.1| cytochrome c biogenesis protein (chloroplast) [Vitis vinifera 
subsp. caucasica]
Length=322

 Score =   213 bits (541),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLF--------GE  157
            L+MHVSMM+LGYAALLCGSLLSVALLVITFR++ ++    N FL +SF F        G 
Sbjct  136  LMMHVSMMVLGYAALLCGSLLSVALLVITFRQDIRILCKNNHFLNKSFSFDEIQYMNKGN  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ Q TSF S +NYYR QFIQQLD WSYRVISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLQNTSFLSVRNYYRAQFIQQLDHWSYRVISLGFLFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN NLQ  NSA    IVAS+GFLIIWI
Sbjct  256  PKETWAFITWTIFAIYLHTRTNKNLQVANSA----IVASMGFLIIWI  298



>gb|AGW04488.1| cytochrome c biogenesis protein [Astephanus triflorus]
Length=322

 Score =   212 bits (540),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 134/167 (80%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHV+MMIL YA+LLCGSLLSVAL+VITFRKN K+       + ESF  GE        
Sbjct  137  LLMHVTMMILSYASLLCGSLLSVALVVITFRKNRKILGKSTLLIKESFFVGEKKYMNKRS  196

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            NL Q TSFFS  NYYR+Q IQQLD+WSYR+ISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  197  NLLQTTSFFSGNNYYRSQLIQQLDYWSYRIISLGFLFLTIGILSGAVWANEAWGSYWNWD  256

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITWIVFAI+LHTRTN N Q  NSA    IVASIGFLIIWI
Sbjct  257  PKETWAFITWIVFAIYLHTRTNRNPQGENSA----IVASIGFLIIWI  299



>ref|YP_008081315.1| cytochrome c biogenetis protein (chloroplast) (chloroplast) [Catharanthus 
roseus]
 gb|AGI51194.1| cytochrome c biogenetis protein (chloroplast) (chloroplast) [Catharanthus 
roseus]
Length=326

 Score =   212 bits (540),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 137/171 (80%), Gaps = 16/171 (9%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGND----FLTESFLFGE----  157
            LIMHV+MMI+GYA+LLCGSLLSVAL+VITFRKN K+F          L ES    E    
Sbjct  137  LIMHVTMMIVGYASLLCGSLLSVALVVITFRKNRKIFCITKSNLLLKLKESVFVDEIEYM  196

Query  158  ----NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSY  325
                NLFQ TSFFS KNYYR+Q IQQLD+WSYRVISLGF FLTIGILSGAVWANEAWGSY
Sbjct  197  NKRSNLFQTTSFFSDKNYYRSQLIQQLDYWSYRVISLGFFFLTIGILSGAVWANEAWGSY  256

Query  326  WSWDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            W+WDPKETWAFITWIVFAI+LHTRTN+NLQ  NSA    IVASIGFLIIWI
Sbjct  257  WNWDPKETWAFITWIVFAIYLHTRTNINLQGANSA----IVASIGFLIIWI  303



>gb|ADZ36578.1| c-type cytochrome synthesis protein [Ternstroemia gymnanthera]
Length=321

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 135/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMM+LGYAALLCGSLLSVALLVITFRK+ K+F   N  L ESF F E        
Sbjct  136  LIMHVSMMVLGYAALLCGSLLSVALLVITFRKDIKIFYKSNHLLNESFSFDEIQYINERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+F  TSFFSAKNYYR+Q IQQLD WSYRVIS+GF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVFGNTSFFSAKNYYRSQLIQQLDHWSYRVISIGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKE WAFITW +FAI+LHTRTN  L   NSA    IVASIGFLIIWI
Sbjct  256  PKEIWAFITWTIFAIYLHTRTNTKLPPANSA----IVASIGFLIIWI  298



>ref|YP_008964413.1| cytochrome c heme attachment protein [Helianthus divaricatus]
 gb|AHB15024.1| cytochrome c heme attachment protein [Helianthus divaricatus]
Length=322

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 141/171 (82%), Gaps = 19/171 (11%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLF--SGGNDFL--TESFLFGE----  157
            LIMHVSMMIL YAALLCGSLLSVALLVITFRK   +F  S  N+ L   ESF FGE    
Sbjct  136  LIMHVSMMILSYAALLCGSLLSVALLVITFRK---IFYSSKSNNLLKLNESFSFGEIQYK  192

Query  158  ----NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSY  325
                N+FQKTSFFS KNYY+ QFIQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSY
Sbjct  193  NERNNIFQKTSFFSDKNYYKAQFIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSY  252

Query  326  WSWDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            WSWDPKETWAFITWIVFAI+LHTRTN NLQ  NSA    IVA++GFLIIWI
Sbjct  253  WSWDPKETWAFITWIVFAIYLHTRTNKNLQGANSA----IVATLGFLIIWI  299



>ref|YP_008964498.1| cytochrome c heme attachment protein [Helianthus decapetalus]
 ref|YP_008964753.1| cytochrome c heme attachment protein [Helianthus strumosus]
 ref|YP_008964838.1| cytochrome c heme attachment protein [Helianthus maximiliani]
 ref|YP_008964243.1| cytochrome c heme attachment protein [Helianthus giganteus]
 ref|YP_008964328.1| cytochrome c heme attachment protein [Helianthus grosseserratus]
 ref|YP_008964583.1| cytochrome c heme attachment protein [Helianthus hirsutus]
 ref|YP_008964668.1| cytochrome c heme attachment protein [Helianthus tuberosus]
 gb|AHB14513.1| cytochrome c heme attachment protein [Helianthus giganteus]
 gb|AHB14599.1| cytochrome c heme attachment protein [Helianthus giganteus]
 gb|AHB14684.1| cytochrome c heme attachment protein [Helianthus giganteus]
 gb|AHB14769.1| cytochrome c heme attachment protein [Helianthus giganteus]
 gb|AHB14854.1| cytochrome c heme attachment protein [Helianthus grosseserratus]
 gb|AHB14939.1| cytochrome c heme attachment protein [Helianthus grosseserratus]
 gb|AHB15109.1| cytochrome c heme attachment protein [Helianthus divaricatus]
 gb|AHB15194.1| cytochrome c heme attachment protein [Helianthus divaricatus]
 gb|AHB15279.1| cytochrome c heme attachment protein [Helianthus divaricatus]
 gb|AHB15364.1| cytochrome c heme attachment protein [Helianthus decapetalus]
 gb|AHB15449.1| cytochrome c heme attachment protein [Helianthus decapetalus]
 gb|AHB15534.1| cytochrome c heme attachment protein [Helianthus decapetalus]
 gb|AHB15619.1| cytochrome c heme attachment protein [Helianthus hirsutus]
 gb|AHB15704.1| cytochrome c heme attachment protein [Helianthus hirsutus]
 gb|AHB15789.1| cytochrome c heme attachment protein [Helianthus tuberosus]
 gb|AHB15874.1| cytochrome c heme attachment protein [Helianthus tuberosus]
 gb|AHB15959.1| cytochrome c heme attachment protein [Helianthus tuberosus]
 gb|AHB16044.1| cytochrome c heme attachment protein [Helianthus divaricatus]
 gb|AHB16129.1| cytochrome c heme attachment protein [Helianthus giganteus]
 gb|AHB16214.1| cytochrome c heme attachment protein [Helianthus giganteus]
 gb|AHB16299.1| cytochrome c heme attachment protein [Helianthus grosseserratus]
 gb|AHB16384.1| cytochrome c heme attachment protein [Helianthus grosseserratus]
 gb|AHB16469.1| cytochrome c heme attachment protein [Helianthus grosseserratus]
 gb|AHB16554.1| cytochrome c heme attachment protein [Helianthus grosseserratus]
 gb|AHB16639.1| cytochrome c heme attachment protein [Helianthus decapetalus]
 gb|AHB16724.1| cytochrome c heme attachment protein [Helianthus decapetalus]
 gb|AHB16809.1| cytochrome c heme attachment protein [Helianthus decapetalus]
 gb|AHB16894.1| cytochrome c heme attachment protein [Helianthus hirsutus]
 gb|AHB16979.1| cytochrome c heme attachment protein [Helianthus hirsutus]
 gb|AHB17064.1| cytochrome c heme attachment protein [Helianthus strumosus]
 gb|AHB17149.1| cytochrome c heme attachment protein [Helianthus tuberosus]
 gb|AHB17234.1| cytochrome c heme attachment protein [Helianthus tuberosus]
 gb|AHB17319.1| cytochrome c heme attachment protein [Helianthus tuberosus]
 gb|AHB17404.1| cytochrome c heme attachment protein [Helianthus maximiliani]
 gb|AHB17489.1| cytochrome c heme attachment protein [Helianthus maximiliani]
 gb|AHB17574.1| cytochrome c heme attachment protein [Helianthus maximiliani]
 gb|AHB17659.1| cytochrome c heme attachment protein [Helianthus maximiliani]
Length=322

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 141/171 (82%), Gaps = 19/171 (11%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLF--SGGNDFL--TESFLFGE----  157
            LIMHVSMMIL YAALLCGSLLSVALLVITFRK   +F  S  N+ L   ESF FGE    
Sbjct  136  LIMHVSMMILSYAALLCGSLLSVALLVITFRK---IFYSSKSNNLLKLNESFSFGEIQYK  192

Query  158  ----NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSY  325
                N+FQKTSFFS KNYY+ QFIQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSY
Sbjct  193  NERNNIFQKTSFFSDKNYYKAQFIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSY  252

Query  326  WSWDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            WSWDPKETWAFITWIVFAI+LHTRTN NLQ  NSA    IVA++GFLIIWI
Sbjct  253  WSWDPKETWAFITWIVFAIYLHTRTNKNLQGANSA----IVATLGFLIIWI  299



>ref|YP_009041136.1| cytochrome c biogenesis protein [Rhazya stricta]
 gb|AHW52233.1| cytochrome c heme attachment protein (chloroplast) [Rhazya stricta]
 gb|AIB08783.1| cytochrome c biogenesis protein [Rhazya stricta]
Length=319

 Score =   211 bits (536),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 136/167 (81%), Gaps = 15/167 (9%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHV+MMILGYA+LLCGSLLSVAL+VIT RK   +    N  L ESF  GE        
Sbjct  137  LIMHVTMMILGYASLLCGSLLSVALVVITLRK---ISYKSNLLLKESFFVGEIEDMNKRS  193

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            NL Q TSFFS KNYYR+Q IQQLD+WSYRVISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  194  NLLQTTSFFSDKNYYRSQLIQQLDYWSYRVISLGFLFLTIGILSGAVWANEAWGSYWNWD  253

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITWIVFAI+LHTRTN+NLQ  NSA    IVASIGFLIIWI
Sbjct  254  PKETWAFITWIVFAIYLHTRTNINLQGANSA----IVASIGFLIIWI  296



>ref|YP_008963741.1| cytochrome c heme attachment protein (chloroplast) [Liquidambar 
formosana]
 gb|AGL13480.1| cytochrome c heme attachment protein (chloroplast) [Liquidambar 
formosana]
Length=318

 Score =   211 bits (536),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 136/164 (83%), Gaps = 9/164 (5%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE-----NLF  166
            L+MHVSMM++GYAALLCGSLLSVALLVITFRK+ ++F   N  L   F FGE     N+ 
Sbjct  136  LMMHVSMMVVGYAALLCGSLLSVALLVITFRKDIRIFGKSNHLLNALFSFGEINKRINVL  195

Query  167  QKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKE  346
            QKTSF S +NYY++Q IQQLD WSYRVISLGF+FLTIGILSGAVWANEAWGSYW+WDPKE
Sbjct  196  QKTSFLSTRNYYKSQLIQQLDHWSYRVISLGFIFLTIGILSGAVWANEAWGSYWNWDPKE  255

Query  347  TWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWAFITW VFAI+LHTRTN NL+  NSA    IVAS+GFL+IWI
Sbjct  256  TWAFITWTVFAIYLHTRTNTNLKGANSA----IVASMGFLVIWI  295



>gb|ADD30969.1| cytochrome c heme attachment protein (chloroplast) [Liquidambar 
styraciflua]
Length=318

 Score =   211 bits (536),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 135/164 (82%), Gaps = 9/164 (5%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE-----NLF  166
            L+MHVSMM++GYAALLCGSLLSVALLVITFRK+  +F   N  L   F FGE     NL 
Sbjct  136  LMMHVSMMVVGYAALLCGSLLSVALLVITFRKDISIFGKSNHLLNTLFSFGEINKRINLL  195

Query  167  QKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKE  346
            QKTSF S +NYY++Q IQQLD WSYRVISLGF+FLTIGILSGAVWANEAWGSYW+WDPKE
Sbjct  196  QKTSFLSTRNYYKSQLIQQLDHWSYRVISLGFIFLTIGILSGAVWANEAWGSYWNWDPKE  255

Query  347  TWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWAFITW VFAI+LHTRTN NL+  NSA    IVAS+GFL+IWI
Sbjct  256  TWAFITWTVFAIYLHTRTNTNLKGANSA----IVASMGFLVIWI  295



>gb|AGW04411.1| cytochrome c biogenesis protein [Araujia sericifera]
Length=322

 Score =   210 bits (535),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 134/167 (80%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHV+ MILGYA+LLCGSLLSV L+VITFRKN K+       L E F  GE        
Sbjct  137  LLMHVTXMILGYASLLCGSLLSVGLVVITFRKNRKIIGKSTLLLKEYFFVGETEYMNKRS  196

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            NL + TSFFS KNYYR+Q IQQLD+WSYR+ISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  197  NLLETTSFFSGKNYYRSQLIQQLDYWSYRIISLGFLFLTIGILSGAVWANEAWGSYWNWD  256

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITWIVFAI+LHTRTN+N Q  NSA    IVAS+GFLIIWI
Sbjct  257  PKETWAFITWIVFAIYLHTRTNINPQGENSA----IVASLGFLIIWI  299



>gb|ADM92649.1| cytochrome c heme attachment protein [Franklinia alatamaha]
Length=313

 Score =   210 bits (534),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 131/159 (82%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMM+LGYAALLCGSLLSVALLVITFRK+  +F   N    ESF F EN+F  TSF
Sbjct  136  LIMHVSMMVLGYAALLCGSLLSVALLVITFRKDINIFYKSNHLFNESFSFDENVFGNTSF  195

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FS KNYYR Q IQQLD WSYRVIS+GF+FLTIGILSGAVWANEAWGSYW+WDPKE WAFI
Sbjct  196  FSTKNYYRFQLIQQLDHWSYRVISIGFIFLTIGILSGAVWANEAWGSYWNWDPKEIWAFI  255

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TW +FAI+LHTRTN  L   NSA    IVAS+GFLIIWI
Sbjct  256  TWTIFAIYLHTRTNKKLPPANSA----IVASMGFLIIWI  290



>ref|YP_009019840.1| cytochrome c biogenesis protein (chloroplast) [Vitis rotundifolia]
 gb|AHJ91259.1| cytochrome c biogenesis protein (chloroplast) [Vitis rotundifolia]
Length=322

 Score =   210 bits (535),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 135/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLF--------GE  157
            L+MHVSMM+LGYAALLCGSLLSVALLVITFR++ ++    N FL +SF F        G 
Sbjct  136  LMMHVSMMVLGYAALLCGSLLSVALLVITFRQDIRILCKNNHFLNKSFSFDEIQYMNKGN  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ Q TSF S +NYYR QFIQQLD WSYRVISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLQNTSFLSVRNYYRAQFIQQLDHWSYRVISLGFLFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN N Q  NSA    IVAS+GFLIIWI
Sbjct  256  PKETWAFITWTIFAIYLHTRTNKNFQVANSA----IVASMGFLIIWI  298



>ref|YP_740166.1| cytochrome c heme attachment protein [Daucus carota]
 sp|Q0G9R3.1|CCSA_DAUCA RecName: Full=Cytochrome c biogenesis protein CcsA (chloroplast) 
[Daucus carota]
 gb|ABI32473.1| cytochrome c heme attachment protein [Daucus carota]
Length=324

 Score =   210 bits (535),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 136/170 (80%), Gaps = 15/170 (9%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFL---TESFLFGE-----  157
            LIMHVSMMILGYAALLCGSLLSVALLV+TFRKN  L    N  L   TE F FGE     
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVLTFRKNRNLLCKKNPLLLKLTEEFSFGEIQYIN  195

Query  158  ---NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYW  328
               N+F   SFFS  NYYR+Q IQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYW
Sbjct  196  EINNIFGNASFFSDNNYYRSQLIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYW  255

Query  329  SWDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            +WDPKETWAFITWIVFA++LHTRTN NLQ  NSA    IVAS+GFLIIWI
Sbjct  256  NWDPKETWAFITWIVFAVYLHTRTNTNLQVENSA----IVASMGFLIIWI  301



>ref|YP_817531.1| cytochrome c heme attachment protein [Coffea arabica]
 sp|A0A384.1|CCSA_COFAR RecName: Full=Cytochrome c biogenesis protein CcsA (chloroplast) 
[Coffea arabica]
 gb|ABJ89728.1| cytochrome c heme attachment protein [Coffea arabica]
Length=322

 Score =   210 bits (535),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 135/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHV+MMILGYA+LLCGSLLS+ALLVITFRKN K+    N  L ESF F E        
Sbjct  137  LIMHVTMMILGYASLLCGSLLSIALLVITFRKNKKILYRNNLLLNESFFFVEIEYMNERS  196

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            NL Q TSFFSAKNYYR+Q IQQLD+WS R ISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  197  NLLQNTSFFSAKNYYRSQLIQQLDYWSSRGISLGFIFLTIGILSGAVWANEAWGSYWNWD  256

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITWI+FAI+LHTRT  N +  NSA    IVASIGFLIIWI
Sbjct  257  PKETWAFITWIIFAIYLHTRTTRNPKCANSA----IVASIGFLIIWI  299



>ref|YP_003359408.1| Ycf5 (chloroplast) [Olea europaea]
 ref|YP_004376470.1| Ycf5 protein [Olea europaea subsp. europaea]
 ref|YP_004563830.1| Ycf5 protein [Olea europaea subsp. cuspidata]
 ref|YP_004564546.1| Ycf5 protein [Olea europaea subsp. maroccana]
 gb|ADA69975.1| Ycf5 (chloroplast) [Olea europaea]
 gb|ADD72139.1| cytochrome c heme attachment protein [Olea europaea]
 emb|CBR30364.1| Ycf5 protein [Olea europaea subsp. europaea]
 emb|CBR24674.1| Ycf5 protein [Olea europaea subsp. europaea]
 emb|CBR30457.1| Ycf5 protein [Olea europaea subsp. europaea]
 emb|CBS29298.1| Ycf5 protein [Olea europaea subsp. maroccana]
 emb|CBJ04347.1| Ycf5 protein [Olea europaea subsp. cuspidata]
 emb|CCQ09151.1| cytochrome c biogenesis protein (chloroplast) [Olea europaea 
subsp. europaea]
Length=323

 Score =   210 bits (535),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 136/169 (80%), Gaps = 14/169 (8%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLT--ESFLFGE------  157
            LIMHVSMMILGYAALLCGSLLSVALLVI  RKN K F   N  L    SF FGE      
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVIAVRKNRKFFFTSNHLLNLNGSFFFGEIEYMNE  195

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+ Q TSFFS KNYYR+QFIQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYWS
Sbjct  196  RSNVLQNTSFFSPKNYYRSQFIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWS  255

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            WDPKETWAFITWIVFAI+LH RTN+  + +NSA    IVASIGFLIIWI
Sbjct  256  WDPKETWAFITWIVFAIYLHIRTNIKWKGINSA----IVASIGFLIIWI  300



>ref|YP_004564053.1| Ycf5 protein [Olea woodiana subsp. woodiana]
 emb|CBS29402.1| Ycf5 protein [Olea woodiana subsp. woodiana]
Length=323

 Score =   210 bits (535),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 136/169 (80%), Gaps = 14/169 (8%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLT--ESFLFGE------  157
            LIMHVSMMILGYAALLCGSLLSVALLVI  RKN K F   N  L    SF FGE      
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVIAVRKNRKFFFTSNHLLNLNGSFFFGEIEYMNE  195

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+ Q TSFFS KNYYR+QFIQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYWS
Sbjct  196  RSNVLQNTSFFSPKNYYRSQFIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWS  255

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            WDPKETWAFITWIVFAI+LH RTN+  + +NSA    IVASIGFLIIWI
Sbjct  256  WDPKETWAFITWIVFAIYLHIRTNIKWKGINSA----IVASIGFLIIWI  300



>ref|YP_588174.1| cytochrome c biogenesis protein (chloroplast) [Helianthus annuus]
 sp|Q1KXQ2.1|CCSA_HELAN RecName: Full=Cytochrome c biogenesis protein CcsA (chloroplast) 
[Helianthus annuus]
 gb|ABD47202.1| cytochrome c heme attachment protein (chloroplast) [Helianthus 
annuus]
Length=322

 Score =   210 bits (535),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 139/169 (82%), Gaps = 15/169 (9%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFL--TESFLFGE------  157
            LIMHVSMMIL YAALLCGSLLSVALLVITFR N    S  N+ L   ESF FGE      
Sbjct  136  LIMHVSMMILSYAALLCGSLLSVALLVITFR-NIFYSSKSNNLLKLNESFSFGEIQYKNE  194

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+FQKTSFFS KNYY+ QFIQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYWS
Sbjct  195  RNNIFQKTSFFSDKNYYKAQFIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWS  254

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            WDPKETWAFITWIVFAI+LHTRTN NLQ  NSA    IVA++GFLIIWI
Sbjct  255  WDPKETWAFITWIVFAIYLHTRTNKNLQGANSA----IVATLGFLIIWI  299



>emb|CBR23788.1| Ycf5 protein [Olea europaea subsp. cuspidata]
Length=323

 Score =   210 bits (534),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 136/169 (80%), Gaps = 14/169 (8%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLT--ESFLFGE------  157
            LIMHVSMMILGYAALLCGSLLSVALLVI  RKN K F   N  L    SF FGE      
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVIAVRKNRKFFFTSNHLLNLNGSFFFGEIEYMNE  195

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+ Q TSFFS KNYYR+QFIQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYWS
Sbjct  196  RSNVLQNTSFFSTKNYYRSQFIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWS  255

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            WDPKETWAFITWIVFAI+LH RTN+  + +NSA    IVASIGFLIIWI
Sbjct  256  WDPKETWAFITWIVFAIYLHIRTNIKWKGINSA----IVASIGFLIIWI  300



>emb|CBR23880.1| Ycf5 protein [Olea europaea subsp. cuspidata]
Length=323

 Score =   210 bits (534),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 136/169 (80%), Gaps = 14/169 (8%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLT--ESFLFGE------  157
            LIMHVSMMILGYAALLCGSLLSVALLVI  RKN K F   N  L    SF FGE      
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVIAVRKNRKFFFTSNHLLNLNGSFFFGEIEYMNE  195

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+ Q TSFFS KNYYR+QFIQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYWS
Sbjct  196  RSNVLQNTSFFSPKNYYRSQFIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWS  255

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            WDPKETWAFITWIVFAI+LH RTN+  + +NSA    IVASIGFLIIWI
Sbjct  256  WDPKETWAFITWIVFAIYLHIRTNIKWKGINSA----IVASIGFLIIWI  300



>gb|ADZ36574.1| c-type cytochrome synthesis protein [Eurya muricata]
Length=321

 Score =   210 bits (534),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 134/167 (80%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMM+LGYAALLCGSLLSVALLVITFRK+ K+F   N  L ESF F E        
Sbjct  136  LIMHVSMMVLGYAALLCGSLLSVALLVITFRKDIKIFYKSNHLLNESFSFDEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+F  TSFFSAKNYYR Q IQQLD WSYRVIS+GF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVFGNTSFFSAKNYYRFQLIQQLDHWSYRVISIGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKE WAFITW VFAI+LHTRTN  L   NSA    IVASIGFLIIWI
Sbjct  256  PKEIWAFITWTVFAIYLHTRTNKKLPPANSA----IVASIGFLIIWI  298



>ref|YP_009108638.1| cytochrome c biogenesis protein [Echites umbellatus]
 gb|AIW05313.1| cytochrome c biogenesis protein [Echites umbellatus]
Length=324

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 136/169 (80%), Gaps = 14/169 (8%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHV+MMILGYA+LLCGSLLSVAL+VITFRKN K+       + ESF   E        
Sbjct  137  LIMHVTMMILGYASLLCGSLLSVALVVITFRKNRKILCKSILLIKESFFVREIEYMNKRN  196

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            NL Q TSFFS KNYYR+Q IQQLD+WSYR+ISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  197  NLLQTTSFFSGKNYYRSQLIQQLDYWSYRIISLGFLFLTIGILSGAVWANEAWGSYWNWD  256

Query  338  PKETWAFITWIVFAIFLHTRTNLNL--QSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITWIVFAI+ HTRTN+N+  Q  NSA    IVASIGFLIIWI
Sbjct  257  PKETWAFITWIVFAIYFHTRTNININPQGTNSA----IVASIGFLIIWI  301



>ref|YP_009110651.1| Ycf5 protein (chloroplast) [Hesperelaea palmeri]
 emb|CED79811.1| Ycf5 protein (chloroplast) [Hesperelaea palmeri]
Length=323

 Score =   209 bits (532),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 136/169 (80%), Gaps = 14/169 (8%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLT--ESFLFGE------  157
            LIMHVSMMILGYAALLCGSLLSVALLVI  RKN K F   N  L    SF FGE      
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVIAVRKNRKFFFTSNHLLNLNGSFFFGEIEYMNE  195

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+ Q TSFFS KNYYR+QFIQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYWS
Sbjct  196  RSNVLQNTSFFSPKNYYRSQFIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWS  255

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            WDPKETWAFITWIVFAI+LH RTN+  + +NSA    IVASIGFLIIWI
Sbjct  256  WDPKETWAFITWIVFAIYLHIRTNIKWKGLNSA----IVASIGFLIIWI  300



>gb|AGW04714.1| cytochrome c biogenesis protein [Matelea biflora]
Length=324

 Score =   209 bits (532),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 135/169 (80%), Gaps = 14/169 (8%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLF--GE------  157
            L+MHV+ MILGYA+LLCGSLLSV  +VITFRKN ++       + E FLF  GE      
Sbjct  137  LLMHVTTMILGYASLLCGSLLSVGRVVITFRKNRRILGKSTLLIKEYFLFFVGETEYMNK  196

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              NL + TSFFS KNYYR+Q IQQLD+WSYR+ISLGFLFLTIGILSGAVWANEAWGSYW+
Sbjct  197  RSNLLETTSFFSGKNYYRSQLIQQLDYWSYRIISLGFLFLTIGILSGAVWANEAWGSYWN  256

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            WDPKETWAFITWIVFAI+LHTRTN+N Q  NSA    IVASIGFLIIWI
Sbjct  257  WDPKETWAFITWIVFAIYLHTRTNINPQGENSA----IVASIGFLIIWI  301



>ref|YP_762309.1| cytochrome c biogenesis/heme attachment protein [Morus indica]
 ref|YP_009110384.1| cytochrome c heme attachment protein (chloroplast) [Morus mongolica]
 sp|Q09WW9.1|CCSA_MORIN RecName: Full=Cytochrome c biogenesis protein CcsA (chloroplast) 
[Morus indica]
 gb|ABB21005.1| cytochrome c biogenesis/heme attachment protein [Morus indica]
 gb|AIX11709.1| cytochrome c heme attachment protein (chloroplast) [Morus mongolica]
Length=321

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 137/167 (82%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+LGYAALLCGSLLS+ALLVITFRK   +FS  N+F+ ESF  GE        
Sbjct  136  LMMHVSMMVLGYAALLCGSLLSLALLVITFRKFISIFSKSNNFVNESFSLGEIQYVREKN  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            NL   TSF S++NYYR Q IQQLD WSYR+ISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NLLPNTSFLSSRNYYRFQLIQQLDLWSYRIISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +F+I+LHTRTN N +SVNSA    IVAS+GFLIIWI
Sbjct  256  PKETWAFITWTLFSIYLHTRTNKNFESVNSA----IVASMGFLIIWI  298



>gb|ADX99040.1| cytochrome c heme attachment protein [Recordia boliviana]
Length=292

 Score =   207 bits (528),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 130/157 (83%), Gaps = 10/157 (6%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDF--LTESFLFGE------  157
            LIMHVSMMILGYAALLCGSLLSV+LLVIT RK  K FS  N    L ESF FGE      
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVSLLVITVRKKRKFFSTSNHLVNLNESFFFGEIEYMNE  195

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+ Q TSFFSAKNYYR+Q IQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYWS
Sbjct  196  RSNVLQNTSFFSAKNYYRSQLIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWS  255

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVAS  442
            WDPKETWAFITWIVFAI+LHTRTN+  +  NSAIVAS
Sbjct  256  WDPKETWAFITWIVFAIYLHTRTNIKWKGTNSAIVAS  292



>ref|YP_004465244.1| cytochrome c heme attachment protein [Jacobaea vulgaris]
 gb|ADO15468.1| cytochrome c heme attachment protein [Jacobaea vulgaris]
Length=319

 Score =   208 bits (530),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 138/166 (83%), Gaps = 12/166 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFL--TESFLFGE-----N  160
            LIMHVSMMIL YAALLCGSLLSVALLVITFR N    S  ND L   ESF FGE     +
Sbjct  136  LIMHVSMMILSYAALLCGSLLSVALLVITFR-NIFYSSKSNDLLKLNESFSFGEIQYRND  194

Query  161  LFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDP  340
            +F++ SFFSAKNYY+ Q IQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYWSWDP
Sbjct  195  IFKRASFFSAKNYYKAQLIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWSWDP  254

Query  341  KETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            KETWAFITWIVFAI+LHTRTN NLQ  NSA    IVA++GFLIIWI
Sbjct  255  KETWAFITWIVFAIYLHTRTNQNLQGANSA----IVATLGFLIIWI  296



>gb|ADZ36398.1| c-type cytochrome synthesis protein [Enkianthus perulatus]
Length=320

 Score =   208 bits (529),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 133/167 (80%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMM+LGYAALLCGSLLSV+LLVITFRK+ K+F   N  + ESF F E        
Sbjct  135  LIMHVSMMLLGYAALLCGSLLSVSLLVITFRKDRKIFDKNNRLVNESFSFDEIEYMNEKS  194

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+F  TSFFSAKNYYR Q IQQLD WS RVIS+GFLFLT+GILSGAVWANEAWGSYW+WD
Sbjct  195  NVFGNTSFFSAKNYYRCQLIQQLDHWSSRVISIGFLFLTLGILSGAVWANEAWGSYWNWD  254

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKE WAFITW VFAI+LHTRTN  L   NSA    IVASIGFLIIWI
Sbjct  255  PKEIWAFITWTVFAIYLHTRTNKKLPPANSA----IVASIGFLIIWI  297



>ref|YP_009109421.1| cytochrome c biogenesis protein (chloroplast) [Lasthenia burkei]
 gb|AIW51893.1| cytochrome c biogenesis protein (chloroplast) [Lasthenia burkei]
Length=322

 Score =   208 bits (529),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 138/169 (82%), Gaps = 15/169 (9%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFL--TESFLFGE------  157
            LIMHVSMMIL YAALLCGSLLSVALLVITFR N    S  N+ L   ESF FGE      
Sbjct  136  LIMHVSMMILSYAALLCGSLLSVALLVITFR-NIFYNSKSNNLLKLNESFSFGEIQYKNE  194

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+FQKTSFFS KNYY+ QFIQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYWS
Sbjct  195  RNNIFQKTSFFSDKNYYKAQFIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWS  254

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            WDPKETWAFITWIVFAI+LHTRT  NLQ  NSA    IVA++GFLIIWI
Sbjct  255  WDPKETWAFITWIVFAIYLHTRTKKNLQGANSA----IVATLGFLIIWI  299



>ref|YP_001837416.1| cytochrome c biogenesis protein [Guizotia abyssinica]
 sp|B2LMP9.1|CCSA_GUIAB RecName: Full=Cytochrome c biogenesis protein CcsA (chloroplast) 
[Guizotia abyssinica]
 gb|ACB86582.1| cytochrome c heme attachment protein [Guizotia abyssinica]
Length=322

 Score =   207 bits (528),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 138/169 (82%), Gaps = 15/169 (9%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFL--TESFLFGE------  157
            LIMHVSMMIL YAALLCGSLLSVALLVITFR N    S  N+FL   ESF FGE      
Sbjct  136  LIMHVSMMILSYAALLCGSLLSVALLVITFR-NIFYSSKSNNFLKLNESFSFGEIQYKNE  194

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+FQKT FFS KNYY+ QFIQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYWS
Sbjct  195  RNNIFQKTYFFSDKNYYKAQFIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWS  254

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            WDPKETWAFITWIVFAI+LHTRT  NLQ  NSA    IVA++GFLIIWI
Sbjct  255  WDPKETWAFITWIVFAIYLHTRTKKNLQGANSA----IVATLGFLIIWI  299



>ref|YP_008081415.1| cytochrome c biogenesis protein (chloroplast) [Tetracentron sinense]
 gb|AGJ72106.1| cytochrome c biogenesis protein (chloroplast) [Tetracentron sinense]
Length=321

 Score =   207 bits (528),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 135/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+L YAALLCGSLLSVALLVITFRKN ++F   N  L  SF F E        
Sbjct  136  LMMHVSMMVLSYAALLCGSLLSVALLVITFRKNIEIFGKSNHLLIGSFSFCEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ +KTSF S +NY+R Q IQQLD WSYRVISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLRKTSFLSVRNYHRYQLIQQLDHWSYRVISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN NLQ VNSA    IVAS+GFLIIWI
Sbjct  256  PKETWAFITWTIFAIYLHTRTNKNLQGVNSA----IVASMGFLIIWI  298



>gb|AJD00776.1| cytochrome c biogenesis protein [Scrophularia takesimensis]
Length=326

 Score =   207 bits (528),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 136/172 (79%), Gaps = 17/172 (10%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDF-----LTESFLFGE---  157
            LIMHVSMMILGYAALLCGSLLSV+LLVIT RK  K FS  N       L +SF FGE   
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVSLLVITVRKKRKFFSMSNIRNHYLNLNQSFFFGEIEY  195

Query  158  -----NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGS  322
                 N+ Q TSFFS KNYYR+Q IQQLD+WSYRV+SLGF+FLTIGILSGAVWANEAWGS
Sbjct  196  MNERSNVLQNTSFFSTKNYYRSQLIQQLDYWSYRVVSLGFIFLTIGILSGAVWANEAWGS  255

Query  323  YWSWDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            YWSWDPKETWAFITWIVFAI+LHTRTN   +  NSA    IVASIGFLIIWI
Sbjct  256  YWSWDPKETWAFITWIVFAIYLHTRTNKKWKGTNSA----IVASIGFLIIWI  303



>gb|AHF72025.1| cytochrome c biogenesis protein (chloroplast) [Rosa odorata var. 
gigantea]
Length=321

 Score =   207 bits (527),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 137/167 (82%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+LGYAALLCGSLLS+ALLVITFRK  ++FS  N+ LTESF FGE        
Sbjct  136  LMMHVSMMVLGYAALLCGSLLSLALLVITFRKFIRIFSKSNNLLTESFSFGEIQYVNERN  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ Q TS  S++NYYR Q IQQLD WSYR+ISLGF+ LTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLQNTSLISSQNYYRYQLIQQLDRWSYRIISLGFILLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LH RTN N +SVNSA    IVAS+GFLIIWI
Sbjct  256  PKETWAFITWTIFAIYLHIRTNKNYESVNSA----IVASMGFLIIWI  298



>gb|ADZ36412.1| c-type cytochrome synthesis protein [Styrax obassia]
Length=323

 Score =   207 bits (527),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 136/169 (80%), Gaps = 14/169 (8%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLF--SGGNDFLTESFLFGE------  157
            LIMHVSMM+LGYAALLCGSLLSVALLVITFRKN K+F  +  N FL ESF F E      
Sbjct  136  LIMHVSMMVLGYAALLCGSLLSVALLVITFRKNIKIFYKNKSNLFLNESFSFDEIQYINE  195

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+F  TSFF AKNYYR+Q IQQLD WSYRVIS+GF+FLTIGILSGAVWANEAWGSYW+
Sbjct  196  KSNVFGTTSFFYAKNYYRSQLIQQLDHWSYRVISIGFIFLTIGILSGAVWANEAWGSYWN  255

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            WDPKE WAFITW VFAI+LHTRTN  L   NSA    IVASIGFLIIW+
Sbjct  256  WDPKEIWAFITWTVFAIYLHTRTNKKLPPANSA----IVASIGFLIIWV  300



>ref|YP_001671731.1| cytochrome c biogenesis protein [Carica papaya]
 sp|B1A983.1|CCSA_CARPA RecName: Full=Cytochrome c biogenesis protein CcsA (chloroplast) 
[Carica papaya]
 gb|ABY86838.1| cytochrome c biogenesis protein [Carica papaya]
Length=320

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 137/167 (82%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+LGYAALLCGSLLSVALLVITFRK  ++F   N+FL ESF FG+        
Sbjct  137  LMMHVSMMVLGYAALLCGSLLSVALLVITFRKVIRIFGKSNNFLNESFSFGKIQYMNERS  196

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSF S++NYYR Q IQQLD WSYR+ISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  197  NILLNTSFLSSRNYYRYQLIQQLDHWSYRIISLGFIFLTIGILSGAVWANEAWGSYWNWD  256

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LH RTN+NL  +NSA    IVAS+GFLIIWI
Sbjct  257  PKETWAFITWTIFAIYLHIRTNINLGGINSA----IVASMGFLIIWI  299



>gb|ADZ36425.1| c-type cytochrome synthesis protein [Clethra alnifolia]
Length=321

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 134/167 (80%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMM+LGYAALLCGSLLSVALLVITFRK+  +F   N  + ESF F E        
Sbjct  136  LIMHVSMMVLGYAALLCGSLLSVALLVITFRKDITIFYKSNRLVNESFSFDEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+F  T FFSAKNYYR+Q IQQLD WSYRVIS+GF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVFGNTYFFSAKNYYRSQLIQQLDRWSYRVISIGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKE WAFITW VFAI+LHTRTN  L S NSA    IVASIGFLIIWI
Sbjct  256  PKEIWAFITWTVFAIYLHTRTNKKLPSANSA----IVASIGFLIIWI  298



>gb|ADD30950.1| cytochrome c heme attachment protein (chloroplast) [Antirrhinum 
majus]
Length=323

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 135/169 (80%), Gaps = 14/169 (8%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLT--ESFLFGE------  157
            LIMHVSMMILGYAALLCGSLLSV+LLVIT RK  K FS  N  L   ES  FGE      
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVSLLVITVRKKRKFFSTSNHLLNFNESLFFGEIESMNE  195

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+ + T+FFS KNYYR+Q IQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYWS
Sbjct  196  QSNVVENTAFFSTKNYYRSQLIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWS  255

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            WDPKETWAFITWI+FAI+LHTRTN   +  NSA    IVASIGFLIIWI
Sbjct  256  WDPKETWAFITWIIFAIYLHTRTNKKWKGPNSA----IVASIGFLIIWI  300



>emb|CCQ71671.1| cytochrome c biogenesis protein (chloroplast) [Salvia miltiorrhiza]
Length=325

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 136/171 (80%), Gaps = 16/171 (9%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLT--ESFLFGE------  157
            LIMHVSMMILGY ALLCGSLLSV+LLVIT RKN + FS  N  L   ESFL G+      
Sbjct  136  LIMHVSMMILGYVALLCGSLLSVSLLVITVRKNRRFFSTNNRLLNLNESFLLGKVKYMNE  195

Query  158  ----NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSY  325
                N+ QKTSFFS  NYY++Q IQQLD+WSYRVISLGFLFLTIGILSGAVWANEAWGSY
Sbjct  196  GKGKNVLQKTSFFSPINYYKSQLIQQLDYWSYRVISLGFLFLTIGILSGAVWANEAWGSY  255

Query  326  WSWDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            WSWDPKETWAFITWI+FAI+LHT+TN+  +  NSA    IVA IGFLIIWI
Sbjct  256  WSWDPKETWAFITWIIFAIYLHTQTNIKWKGTNSA----IVAFIGFLIIWI  302



>gb|ADX99037.1| cytochrome c heme attachment protein [Bouchea fluminensis]
Length=294

 Score =   206 bits (523),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 129/158 (82%), Gaps = 10/158 (6%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDF--LTESFLFGE------  157
            LIMHVSMMILGYAALLCGSLLSV+LLVIT RK  K FS  N    L ESF FGE      
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVSLLVITVRKKRKFFSTNNHLVNLNESFFFGEIEYMNE  195

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+ Q TS FS KNYYR+Q IQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYWS
Sbjct  196  RSNILQNTSLFSPKNYYRSQLIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWS  255

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASI  445
            WDPKETWAFITWIVFAI+LHTRTN+  +  NSAIVASI
Sbjct  256  WDPKETWAFITWIVFAIYLHTRTNIKWKGTNSAIVASI  293



>gb|AJC00320.1| cytochrome c biogenesis protein [Lysimachia coreana]
Length=326

 Score =   206 bits (525),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 136/169 (80%), Gaps = 14/169 (8%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFL--TESFLFGE------  157
            LIMHVSMM+LGYAALLCGSLLSVALLVITFRK+  LF   N  L  TESF FGE      
Sbjct  136  LIMHVSMMVLGYAALLCGSLLSVALLVITFRKDITLFYNKNHVLNFTESFAFGEIQYMNK  195

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+F  TSFFSAKNYYR+QFIQQLD WSYRVIS+GF+FLTIGILSGAVWANEAWGSYW+
Sbjct  196  KSNVFGNTSFFSAKNYYRSQFIQQLDHWSYRVISIGFIFLTIGILSGAVWANEAWGSYWN  255

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            WDPKE WAFITW VFAI+LH+RT    +  NSA    +VASIGFLIIWI
Sbjct  256  WDPKEIWAFITWTVFAIYLHSRTTKKARPANSA----VVASIGFLIIWI  300



>gb|ADZ36486.1| c-type cytochrome synthesis protein [Stewartia malacodendron]
Length=302

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 132/167 (79%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMM+LGYAALLCGSLLSVALLVITFRK+ K+F   N    ESF F E        
Sbjct  136  LIMHVSMMVLGYAALLCGSLLSVALLVITFRKDIKIFYKSNHLFNESFSFDEIQYINERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+F  TSFFS KNYYR Q IQQLD WSYRVIS+GF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVFGNTSFFSTKNYYRFQLIQQLDHWSYRVISIGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKE WAFITW +FAI+LHTRTN  L   NSA    IVAS+GFLIIWI
Sbjct  256  PKEIWAFITWTIFAIYLHTRTNKKLPPANSA----IVASMGFLIIWI  298



>gb|ADX99015.1| cytochrome c heme attachment protein [Aloysia virgata]
Length=294

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 129/158 (82%), Gaps = 10/158 (6%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLT--ESFLFGE------  157
            LIMHVSMMILGYAALL GSLLSV+LLVIT RK  K F+  N  +   ESF FGE      
Sbjct  136  LIMHVSMMILGYAALLFGSLLSVSLLVITVRKKKKFFATSNRVVNFNESFFFGEMEYMNE  195

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+FQ TSFFS KNYYR+Q IQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYWS
Sbjct  196  QSNVFQNTSFFSTKNYYRSQLIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWS  255

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASI  445
            WDPKETWAFITWIVFAI+LHTRTN   +  NSAIVASI
Sbjct  256  WDPKETWAFITWIVFAIYLHTRTNRKWKGTNSAIVASI  293



>gb|ADZ36476.1| c-type cytochrome synthesis protein [Stewartia malacodendron]
 gb|ADZ36481.1| c-type cytochrome synthesis protein [Stewartia malacodendron]
 gb|ADZ36493.1| c-type cytochrome synthesis protein [Stewartia rubiginosa]
 gb|ADZ36499.1| c-type cytochrome synthesis protein [Stewartia pseudocamellia]
 gb|ADZ36505.1| c-type cytochrome synthesis protein [Stewartia serrata]
 gb|ADZ36512.1| c-type cytochrome synthesis protein [Stewartia monadelpha]
 gb|ADZ36517.1| c-type cytochrome synthesis protein [Stewartia sinensis]
 gb|ADZ36523.1| c-type cytochrome synthesis protein [Stewartia rostrata]
 gb|ADZ36529.1| c-type cytochrome synthesis protein [Stewartia sinensis]
 gb|ADZ36534.1| c-type cytochrome synthesis protein [Stewartia ovata]
 gb|ADZ36539.1| c-type cytochrome synthesis protein [Stewartia ovata]
 gb|ADZ36544.1| c-type cytochrome synthesis protein [Stewartia ovata var. grandiflora]
 gb|ADZ36548.1| c-type cytochrome synthesis protein [Stewartia ovata]
 gb|ADZ36558.1| c-type cytochrome synthesis protein [Stewartia pteropetiolata]
 gb|ADZ36562.1| c-type cytochrome synthesis protein [Stewartia villosa]
 gb|ADZ36568.1| c-type cytochrome synthesis protein [Stewartia crassifolia]
Length=321

 Score =   205 bits (522),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 132/167 (79%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMM+LGYAALLCGSLLSVALLVITFRK+ K+F   N    ESF F E        
Sbjct  136  LIMHVSMMVLGYAALLCGSLLSVALLVITFRKDIKIFYKSNHLFNESFSFDEIQYINERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+F  TSFFS KNYYR Q IQQLD WSYRVIS+GF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVFGNTSFFSTKNYYRFQLIQQLDHWSYRVISIGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKE WAFITW +FAI+LHTRTN  L   NSA    IVAS+GFLIIWI
Sbjct  256  PKEIWAFITWTIFAIYLHTRTNKKLPPANSA----IVASMGFLIIWI  298



>ref|YP_008081506.1| cytochrome c biogenesis protein (chloroplast) [Trochodendron 
aralioides]
 gb|ADD30974.1| cytochrome c heme attachment protein (chloroplast) [Trochodendron 
aralioides]
 gb|AGJ72198.1| cytochrome c biogenesis protein (chloroplast) [Trochodendron 
aralioides]
Length=321

 Score =   205 bits (522),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 134/167 (80%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+L YAALLCGSLLSVALLVITFRKN ++F   N  L  SF F E        
Sbjct  136  LMMHVSMMVLSYAALLCGSLLSVALLVITFRKNIEIFGKSNHLLIGSFSFCEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ +KTS  S +NY+R Q IQQLD WSYRVISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLRKTSLLSVRNYHRYQLIQQLDHWSYRVISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN NLQ VNSA    IVAS+GFLIIWI
Sbjct  256  PKETWAFITWTIFAIYLHTRTNKNLQGVNSA----IVASMGFLIIWI  298



>gb|AGC57591.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus melliodora]
Length=319

 Score =   205 bits (522),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMMILGYAALLCGSLLSVALLVIT RK  ++FS  N+FL ESF F E        
Sbjct  136  LMMHVSMMILGYAALLCGSLLSVALLVITLRKAIRVFSKKNNFLNESFSFVEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSF S++NYYR Q IQQLD WSYR+ISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLTTSFCSSRNYYRAQLIQQLDQWSYRIISLGFLFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN N +S+N A    IVASIGFLIIWI
Sbjct  256  PKETWAFITWTLFAIYLHTRTNKNWESLNCA----IVASIGFLIIWI  298



>gb|ADZ36553.1| c-type cytochrome synthesis protein [Stewartia sinii]
Length=321

 Score =   205 bits (522),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 132/167 (79%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMM+LGYAALLCGSLLSVALLVITFRK+ K+F   N    ESF F E        
Sbjct  136  LIMHVSMMVLGYAALLCGSLLSVALLVITFRKDIKIFYKSNHLFNESFSFDEIQYINEKS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+F  TSFFS KNYYR Q IQQLD WSYRVIS+GF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVFGNTSFFSTKNYYRFQLIQQLDHWSYRVISIGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKE WAFITW +FAI+LHTRTN  L   NSA    IVAS+GFLIIWI
Sbjct  256  PKEIWAFITWTIFAIYLHTRTNKKLPPANSA----IVASMGFLIIWI  298



>ref|YP_004222695.1| cytochrome c heme attachment protein [Anthriscus cerefolium]
 gb|ADD13687.1| cytochrome c heme attachment protein [Anthriscus cerefolium]
Length=324

 Score =   205 bits (522),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 134/170 (79%), Gaps = 15/170 (9%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFL---TESFLFGE-----  157
            LIMHVSMMILGYAALLCGSLLSVALLV+TFRK   L    N  L    E F FGE     
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVLTFRKKRNLLCKKNPPLLKLNEEFSFGEIQYLN  195

Query  158  ---NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYW  328
               N+    SFFSA NYYR+Q IQQLD+WSYRVISLGFLFLTIGILSGAVWANEAWGSYW
Sbjct  196  ERNNILGNASFFSANNYYRSQLIQQLDYWSYRVISLGFLFLTIGILSGAVWANEAWGSYW  255

Query  329  SWDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            +WDPKETWAFITWIVFA++LHTRTN NLQ  NSA    IVAS+GFLIIWI
Sbjct  256  NWDPKETWAFITWIVFAVYLHTRTNTNLQVENSA----IVASMGFLIIWI  301



>ref|YP_003934007.1| cytochrome c heme attachment protein [Eucalyptus grandis]
 gb|ADO23636.1| cytochrome c heme attachment protein [Eucalyptus grandis]
Length=319

 Score =   205 bits (522),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMMILGYAALLCGSLLSVALLVIT RK  ++FS  N+FL ESF F E        
Sbjct  136  LMMHVSMMILGYAALLCGSLLSVALLVITLRKAIRVFSKKNNFLNESFSFVEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSF S++NYYR Q IQQLD WSYR+ISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLTTSFCSSRNYYRAQLIQQLDQWSYRIISLGFLFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN N +S+N A    IVASIGFLIIWI
Sbjct  256  PKETWAFITWTLFAIYLHTRTNKNWESLNCA----IVASIGFLIIWI  298



>ref|YP_008576352.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus melliodora]
 ref|YP_008576437.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus polybractea]
 ref|YP_008576522.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus cladocalyx]
 gb|AGC57676.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus melliodora]
 gb|AGC57761.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus polybractea]
 gb|AGC57846.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus cladocalyx]
Length=319

 Score =   205 bits (521),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMMILGYAALLCGSLLSVALLVIT RK  ++FS  N+FL ESF F E        
Sbjct  136  LMMHVSMMILGYAALLCGSLLSVALLVITLRKAIRVFSKKNNFLNESFSFVEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSF S++NYYR Q IQQLD WSYR+ISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLTTSFCSSRNYYRAQLIQQLDQWSYRIISLGFLFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN N +S+N A    IVASIGFLIIWI
Sbjct  256  PKETWAFITWTLFAIYLHTRTNKNWESLNCA----IVASIGFLIIWI  298



>gb|AFQ39650.1| cytochrome c heme attachment protein [Fragaria tibetica]
Length=310

 Score =   204 bits (520),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+LGYAALLCGSLLS+ALLVITFRK  ++FS  N+ LT+SF FGE        
Sbjct  125  LMMHVSMMVLGYAALLCGSLLSLALLVITFRKFIRIFSKSNNLLTQSFSFGEIQYVNERN  184

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N  Q TS  S++NYYR Q IQQLD WSYR+ISLGF+ LTIGILSGAVWANEAWGSYW+WD
Sbjct  185  NALQSTSLISSQNYYRYQLIQQLDRWSYRIISLGFILLTIGILSGAVWANEAWGSYWNWD  244

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW VFAI+LH RTN N ++VNSA    IVAS+GFLIIWI
Sbjct  245  PKETWAFITWTVFAIYLHIRTNKNYETVNSA----IVASMGFLIIWI  287



>gb|AFQ39608.1| cytochrome c heme attachment protein [Fragaria x ananassa subsp. 
cuneifolia]
 gb|AFQ39614.1| cytochrome c heme attachment protein [Fragaria virginiana]
 gb|AFQ39626.1| cytochrome c heme attachment protein [Fragaria viridis]
 gb|AFQ39632.1| cytochrome c heme attachment protein [Fragaria nilgerrensis]
 gb|AFQ39638.1| cytochrome c heme attachment protein [Fragaria nipponica]
 gb|AFQ39644.1| cytochrome c heme attachment protein [Fragaria chinensis]
 gb|AFQ39656.1| cytochrome c heme attachment protein [Fragaria corymbosa]
 gb|AFQ39662.1| cytochrome c heme attachment protein [Fragaria gracilis]
Length=310

 Score =   204 bits (520),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+LGYAALLCGSLLS+ALLVITFRK  ++FS  N+ LT+SF FGE        
Sbjct  125  LMMHVSMMVLGYAALLCGSLLSLALLVITFRKFIRIFSKSNNLLTQSFSFGEIQYVNERN  184

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N  Q TS  S++NYYR Q IQQLD WSYR+ISLGF+ LTIGILSGAVWANEAWGSYW+WD
Sbjct  185  NALQSTSLISSQNYYRYQLIQQLDRWSYRIISLGFILLTIGILSGAVWANEAWGSYWNWD  244

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW VFAI+LH RTN N ++VNSA    IVAS+GFLIIWI
Sbjct  245  PKETWAFITWTVFAIYLHIRTNKNYETVNSA----IVASMGFLIIWI  287



>gb|ADX99022.1| cytochrome c heme attachment protein [Mulguraea aspera]
Length=294

 Score =   204 bits (519),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 129/158 (82%), Gaps = 10/158 (6%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDF--LTESFLFGE------  157
            LIMHVSMMILGYAALLCGSLLSV+LLVIT RK  K F+  N    L +SF FGE      
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVSLLVITVRKKRKFFATSNRVVNLNQSFFFGEMEYMNE  195

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+ Q TSFFS KNYYR+Q IQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYWS
Sbjct  196  KKNVLQNTSFFSPKNYYRSQLIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWS  255

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASI  445
            WDPKETWAFITWIVFAI+LHTRTN   +  NSAIVASI
Sbjct  256  WDPKETWAFITWIVFAIYLHTRTNRKWKGTNSAIVASI  293



>gb|AFQ39602.1| cytochrome c heme attachment protein [Fragaria iturupensis]
Length=310

 Score =   204 bits (520),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+LGYAALLCGSLLS+ALLVITFRK  ++FS  N+ LT+SF FGE        
Sbjct  125  LMMHVSMMVLGYAALLCGSLLSLALLVITFRKFIRIFSKSNNLLTQSFSFGEIQYVNERN  184

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N  Q TS  S++NYYR Q IQQLD WSYR+ISLGF+ LTIGILSGAVWANEAWGSYW+WD
Sbjct  185  NALQSTSLISSQNYYRYQLIQQLDRWSYRIISLGFILLTIGILSGAVWANEAWGSYWNWD  244

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW VFAI+LH RTN N ++VNSA    IVAS+GFLIIWI
Sbjct  245  PKETWAFITWTVFAIYLHIRTNKNYETVNSA----IVASMGFLIIWI  287



>ref|YP_008576097.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus patens]
 gb|AGC57336.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus patens]
Length=319

 Score =   205 bits (521),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMMILGYAALLCGSLLSVALLVIT RK  ++FS  N+FL ESF F E        
Sbjct  136  LMMHVSMMILGYAALLCGSLLSVALLVITLRKAIRVFSKKNNFLNESFSFVEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSF S++NYYR Q IQQLD WSYR+ISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLTTSFCSSRNYYRAQLIQQLDQWSYRIISLGFLFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN N +S+N A    IVASIGFLIIWI
Sbjct  256  PKETWAFITWTLFAIYLHTRTNKNWESLNCA----IVASIGFLIIWI  298



>ref|YP_004286151.1| cytochrome c heme attachment protein [Fragaria vesca subsp. vesca]
 ref|YP_006883311.1| cytochrome c heme attachment protein (chloroplast) [Fragaria 
vesca subsp. bracteata]
 ref|YP_006883385.1| cytochrome c heme attachment protein [Fragaria mandshurica]
 ref|YP_007025432.1| cytochrome c heme attachment protein (chloroplast) [Fragaria 
chiloensis]
 ref|YP_007025517.1| cytochrome c heme attachment protein (chloroplast) [Fragaria 
virginiana]
 ref|YP_009040256.1| cytochrome c heme attachment protein [Fragaria iinumae]
 gb|ADY15400.1| cytochrome c heme attachment protein [Fragaria vesca subsp. vesca]
 gb|AET62704.1| cytochrome c heme attachment protein (chloroplast) [Fragaria 
chiloensis]
 gb|AET62789.1| cytochrome c heme attachment protein (chloroplast) [Fragaria 
virginiana]
 gb|AFC17690.1| cytochrome c heme attachment protein (chloroplast) [Fragaria 
vesca subsp. bracteata]
 gb|AFC17764.1| cytochrome c heme attachment protein [Fragaria mandshurica]
 gb|AFS89599.1| cytochrome c heme attachment protein (chloroplast) [Fragaria 
chiloensis]
 gb|AGN71759.1| cytochrome c heme attachment protein [Fragaria vesca subsp. bracteata]
 gb|AGN71844.1| cytochrome c heme attachment protein [Fragaria vesca subsp. bracteata]
 gb|AGN71929.1| cytochrome c heme attachment protein [Fragaria vesca subsp. bracteata]
 gb|AGN72099.1| cytochrome c heme attachment protein [Fragaria iinumae]
 gb|AGN72184.1| cytochrome c heme attachment protein [Fragaria mandshurica]
Length=321

 Score =   205 bits (521),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+LGYAALLCGSLLS+ALLVITFRK  ++FS  N+ LT+SF FGE        
Sbjct  136  LMMHVSMMVLGYAALLCGSLLSLALLVITFRKFIRIFSKSNNLLTQSFSFGEIQYVNERN  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N  Q TS  S++NYYR Q IQQLD WSYR+ISLGF+ LTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NALQSTSLISSQNYYRYQLIQQLDRWSYRIISLGFILLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW VFAI+LH RTN N ++VNSA    IVAS+GFLIIWI
Sbjct  256  PKETWAFITWTVFAIYLHIRTNKNYETVNSA----IVASMGFLIIWI  298



>gb|ADX99020.1| cytochrome c heme attachment protein [Glandularia microphylla]
Length=294

 Score =   204 bits (519),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 129/158 (82%), Gaps = 10/158 (6%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDF--LTESFLFGE------  157
            LIMHVSMMILGYAALLCGSLLSV+LLVIT RK  K F+  N    L +SF FGE      
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVSLLVITVRKKRKFFATSNRVVNLNQSFFFGEMEYMNE  195

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+ Q TSFFS KNYYR+Q IQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYWS
Sbjct  196  KINVLQNTSFFSTKNYYRSQLIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWS  255

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASI  445
            WDPKETWAFITWIVFAI+LHTRTN   +  NSAIVASI
Sbjct  256  WDPKETWAFITWIVFAIYLHTRTNRKWKGTNSAIVASI  293



>ref|YP_008576607.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus nitens]
 ref|YP_008576862.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus camaldulensis]
 ref|YP_008576947.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus deglupta]
 ref|YP_008577117.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus torquata]
 gb|AGC58016.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus nitens]
 gb|AGC58271.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus camaldulensis]
 gb|AGC58356.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus deglupta]
 gb|AGC58526.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus torquata]
Length=319

 Score =   205 bits (521),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMMILGYAALLCGSLLSVALLVIT RK  ++FS  N+FL ESF F E        
Sbjct  136  LMMHVSMMILGYAALLCGSLLSVALLVITLRKAIRVFSKKNNFLNESFSFVEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSF S++NYYR Q IQQLD WSYR+ISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLTTSFCSSRNYYRAQLIQQLDQWSYRIISLGFLFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN N +S+N A    IVASIGFLIIWI
Sbjct  256  PKETWAFITWTLFAIYLHTRTNKNWESLNCA----IVASIGFLIIWI  298



>ref|YP_008577287.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus salmonophloia]
 gb|AGC58696.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus salmonophloia]
Length=319

 Score =   205 bits (521),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMMILGYAALLCGSLLSVALLVIT RK  ++FS  N+FL ESF F E        
Sbjct  136  LMMHVSMMILGYAALLCGSLLSVALLVITLRKAIRVFSKKNNFLNESFSFVEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSF S++NYYR Q IQQLD WSYR+ISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLTTSFCSSRNYYRAQLIQQLDQWSYRIISLGFLFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN N +S+N A    IVASIGFLIIWI
Sbjct  256  PKETWAFITWTLFAIYLHTRTNKNWESLNCA----IVASIGFLIIWI  298



>gb|ADH94392.1| cytochrome c heme attachment protein [Syzygium cumini]
Length=319

 Score =   204 bits (520),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMMILGYAALL GSLLSVALLVIT RK  ++FS  N+FL ESF F E        
Sbjct  136  LMMHVSMMILGYAALLWGSLLSVALLVITLRKAIRIFSKKNNFLNESFSFVEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSFFS++NYYR Q IQQLD WSYR+ISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLTTSFFSSRNYYRAQLIQQLDQWSYRIISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN N +S+N A    IVASIGFLIIWI
Sbjct  256  PKETWAFITWTLFAIYLHTRTNKNWESLNCA----IVASIGFLIIWI  298



>gb|ADD30967.1| cytochrome c heme attachment protein (chloroplast) [Gunnera manicata]
Length=321

 Score =   205 bits (521),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 134/167 (80%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+L YAALLCGSLLSVALLVITFRK+  +F   N  L + F FGE        
Sbjct  136  LMMHVSMMVLSYAALLCGSLLSVALLVITFRKDIMIFCKSNHLLNDYFYFGETQYMNEGN  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ + TSFFSA+NYYR+Q IQQLD WSYRVIS+GF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NILRNTSFFSARNYYRSQLIQQLDHWSYRVISIGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN   Q  NSA    IVAS+GFLIIWI
Sbjct  256  PKETWAFITWTIFAIYLHTRTNKKFQGPNSA----IVASMGFLIIWI  298



>gb|ADX99017.1| cytochrome c heme attachment protein [Aloysia citrodora]
Length=228

 Score =   202 bits (513),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 130/158 (82%), Gaps = 10/158 (6%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLT--ESFLFGE------  157
            LIMHVSMMILGYAALLCGSLLSV+LLVIT +K  K F+  N  +   ESF FGE      
Sbjct  70   LIMHVSMMILGYAALLCGSLLSVSLLVITVQKKKKFFATSNRVVNFNESFFFGEMEYMNE  129

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+F+ TSFFS KNYYR+Q IQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYWS
Sbjct  130  QSNVFENTSFFSPKNYYRSQLIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWS  189

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASI  445
            WDPKETWAFITWIVFAI+LHTRTN   +  NSAIVASI
Sbjct  190  WDPKETWAFITWIVFAIYLHTRTNRKWKGTNSAIVASI  227



>gb|ADZ36463.1| c-type cytochrome synthesis protein [Gordonia lasianthus]
Length=320

 Score =   204 bits (520),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 132/167 (79%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMM+LGYAALLCGSLLSVALLVITFRK+ K+F   N    ESF F E        
Sbjct  135  LIMHVSMMVLGYAALLCGSLLSVALLVITFRKDIKIFYKSNHLFNESFSFDEIQYINERS  194

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+F  TSFFS KNYYR Q IQQLD WSYRVIS+GF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  195  NVFGNTSFFSTKNYYRFQLIQQLDHWSYRVISIGFIFLTIGILSGAVWANEAWGSYWNWD  254

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKE WAFITW +FAI+LHTRTN  L   NSA    IVAS+GFLIIWI
Sbjct  255  PKEIWAFITWTIFAIYLHTRTNKKLPPANSA----IVASMGFLIIWI  297



>ref|YP_008577627.1| cytochrome c biogenesis protein (chloroplast) [Corymbia gummifera]
 gb|AGC59036.1| cytochrome c biogenesis protein (chloroplast) [Corymbia gummifera]
Length=319

 Score =   204 bits (520),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMMILGYAALLCGSLLSVALLVIT RK  ++FS  N+FL ESF F E        
Sbjct  136  LMMHVSMMILGYAALLCGSLLSVALLVITLRKAIRIFSKKNNFLNESFSFVEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSF S++NYYR Q IQQLD WSYR+ISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLNTSFCSSRNYYRAQLIQQLDQWSYRIISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN N +S+N A    IVASIGFLIIWI
Sbjct  256  PKETWAFITWTLFAIYLHTRTNKNGESLNCA----IVASIGFLIIWI  298



>gb|AGN72014.1| cytochrome c heme attachment protein [Dasiphora fruticosa subsp. 
floribunda]
Length=321

 Score =   204 bits (520),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+LGYAALLCGSLLS+ALLVITFRK  ++FS  N+ LTESF FGE        
Sbjct  136  LMMHVSMMVLGYAALLCGSLLSLALLVITFRKFIRIFSKSNNLLTESFSFGEIQYVNERN  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ Q TS   ++NYYR Q IQQLD WSYR+ISLGF+ LTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLQSTSLIFSQNYYRYQLIQQLDRWSYRIISLGFILLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW VFAI+LH RTN N ++VNSA    IVAS+GFLIIWI
Sbjct  256  PKETWAFITWTVFAIYLHIRTNKNYETVNSA----IVASVGFLIIWI  298



>gb|ADX99027.1| cytochrome c heme attachment protein [Rhaphithamnus venustus]
Length=294

 Score =   204 bits (518),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 128/158 (81%), Gaps = 10/158 (6%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDF--LTESFLFGE------  157
            LIMHVSMMILGYAALLCGSLLSV+LLVIT RK  K F+  N    L ESF FGE      
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVSLLVITVRKKRKFFATSNHVVNLNESFFFGEMEYMNE  195

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+ Q TSFFS KNYYR+Q IQQLD WSYRVISLGF+FLTIGILSGAVWANEAWGSYWS
Sbjct  196  QSNVLQNTSFFSPKNYYRSQLIQQLDCWSYRVISLGFIFLTIGILSGAVWANEAWGSYWS  255

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASI  445
            WDPKETWAFITWIVFAI+LHTRTN   +  NSAIVASI
Sbjct  256  WDPKETWAFITWIVFAIYLHTRTNRKWKGTNSAIVASI  293



>gb|ADX99014.1| cytochrome c heme attachment protein [Xeroaloysia ovatifolia]
Length=294

 Score =   204 bits (518),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 129/158 (82%), Gaps = 10/158 (6%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLT--ESFLFGE------  157
            LIMHVSMMILGYAALLCGSLLSV+LLVIT RK  K F+  N  +   ESF FGE      
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVSLLVITVRKKKKFFATSNRVINFNESFFFGEMEYMNE  195

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+FQ  SFFS KNYYR+Q IQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYWS
Sbjct  196  QSNVFQNISFFSPKNYYRSQLIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWS  255

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASI  445
            WDPKETWAFITWIVFAI+LHTRTN   +  NSAIVASI
Sbjct  256  WDPKETWAFITWIVFAIYLHTRTNRKWKGTNSAIVASI  293



>gb|ADZ36456.1| c-type cytochrome synthesis protein [Schima khasiana]
Length=320

 Score =   204 bits (520),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 133/167 (80%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMM+LGYAALLCGSLLSVALLVITFRK+ K+F   N F  ESF F E        
Sbjct  135  LIMHVSMMVLGYAALLCGSLLSVALLVITFRKDIKIFYKSNHFFNESFSFDEIQYINERS  194

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+F  TSFFS KNYYR Q IQQL+ WSYRVIS+GF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  195  NVFGNTSFFSTKNYYRFQLIQQLNHWSYRVISIGFIFLTIGILSGAVWANEAWGSYWNWD  254

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKE WAFITW +FAI+LHTRTN  L   NSA    IVAS+GFLIIWI
Sbjct  255  PKEIWAFITWTIFAIYLHTRTNKKLPPANSA----IVASMGFLIIWI  297



>gb|ADX99036.1| cytochrome c heme attachment protein [Parodianthus ilicifolius]
Length=296

 Score =   204 bits (518),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 128/160 (80%), Gaps = 12/160 (8%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDF--LTESFLFGE------  157
            LIMHVSMMILGYAALL GSLLSV+LLVIT RK  K FS  N    L ESF FGE      
Sbjct  136  LIMHVSMMILGYAALLVGSLLSVSLLVITVRKKKKFFSTSNYLGNLNESFFFGEIEYDYM  195

Query  158  ----NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSY  325
                N+ Q TSFFS KNYYR+Q IQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSY
Sbjct  196  NEQMNVLQNTSFFSPKNYYRSQLIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSY  255

Query  326  WSWDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASI  445
            WSWDPKETWAFITW+VFAI+LHTRTN   +  NSAIVASI
Sbjct  256  WSWDPKETWAFITWMVFAIYLHTRTNRKWKGTNSAIVASI  295



>ref|YP_004564428.1| cytochrome c heme attachment protein (chloroplast) [Ageratina 
adenophora]
 gb|AEG64614.1| cytochrome c heme attachment protein (chloroplast) [Ageratina 
adenophora]
Length=322

 Score =   204 bits (520),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 137/169 (81%), Gaps = 15/169 (9%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFL--TESFLFGE------  157
            LIMHVSMMIL YAALLCGSLLSVALLVITFR N    S  N+ L   ESF FGE      
Sbjct  136  LIMHVSMMILSYAALLCGSLLSVALLVITFR-NIFYSSKSNNLLKLNESFYFGEIQYKNE  194

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+F+KTSFF  KNYY+ QFIQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYWS
Sbjct  195  RNNIFKKTSFFYDKNYYKAQFIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWS  254

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            WDPKETWAFITWIVFAI+LHTRT  NLQ  NSA    IVA++GFLIIWI
Sbjct  255  WDPKETWAFITWIVFAIYLHTRTKKNLQGANSA----IVATLGFLIIWI  299



>gb|ABU85229.1| cytochrome c heme attachment protein [Anethum graveolens]
Length=324

 Score =   204 bits (520),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 135/170 (79%), Gaps = 15/170 (9%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFL---TESFLFGE-----  157
            LIMHVSMMILGYAALLCGSLLSVALLV+TFRKN   F   N FL    E F FGE     
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVALLVLTFRKNINFFCKRNPFLLKLNEGFSFGEIQYIN  195

Query  158  ---NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYW  328
               N     SFFSA NYYR+Q IQQLD+WSYRVISLGFLFLTIGILSGAVWANEAWGSYW
Sbjct  196  ERNNFLGNASFFSANNYYRSQLIQQLDYWSYRVISLGFLFLTIGILSGAVWANEAWGSYW  255

Query  329  SWDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            +WDPKETWAFITWIVFA++LHTRTN NLQ      +++IVAS+GFLIIWI
Sbjct  256  NWDPKETWAFITWIVFAVYLHTRTNRNLQ----VEISAIVASMGFLIIWI  301



>ref|YP_008577712.1| cytochrome c biogenesis protein (chloroplast) [Corymbia maculata]
 ref|YP_008577797.1| cytochrome c biogenesis protein (chloroplast) [Corymbia eximia]
 ref|YP_008577967.1| cytochrome c biogenesis protein (chloroplast) [Angophora floribunda]
 ref|YP_008578052.1| cytochrome c biogenesis protein (chloroplast) [Angophora costata]
 gb|AGC59121.1| cytochrome c biogenesis protein (chloroplast) [Corymbia maculata]
 gb|AGC59206.1| cytochrome c biogenesis protein (chloroplast) [Corymbia eximia]
 gb|AGC59376.1| cytochrome c biogenesis protein (chloroplast) [Angophora floribunda]
 gb|AGC59461.1| cytochrome c biogenesis protein (chloroplast) [Angophora costata]
Length=319

 Score =   204 bits (519),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMMILGYAALLCGSLLSVALLVIT RK  ++FS  N+FL ESF F E        
Sbjct  136  LMMHVSMMILGYAALLCGSLLSVALLVITLRKAIRIFSKKNNFLNESFSFVEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSF S++NYYR Q IQQLD WSYR+ISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLNTSFCSSRNYYRAQLIQQLDQWSYRIISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN N +S+N A    IVASIGFLIIWI
Sbjct  256  PKETWAFITWTLFAIYLHTRTNKNWESLNCA----IVASIGFLIIWI  298



>gb|ADX99033.1| cytochrome c heme attachment protein [Rehdera trinervis]
Length=273

 Score =   202 bits (515),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 127/158 (80%), Gaps = 10/158 (6%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDF--LTESFLFGE------  157
            LIMHVSMMILGYA+LLCGSL SV+LLVIT RK  K FS       L ES  FGE      
Sbjct  115  LIMHVSMMILGYASLLCGSLFSVSLLVITVRKKRKFFSTSKHLVNLNESLFFGEIEYMNE  174

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+ Q TSFFS KNYYR+Q IQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYWS
Sbjct  175  RSNVLQNTSFFSPKNYYRSQLIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWS  234

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASI  445
            WDPKETWAFITWIVFAI+LHTRTN+  +  NSAIVASI
Sbjct  235  WDPKETWAFITWIVFAIYLHTRTNIKWKGTNSAIVASI  272



>ref|YP_008576267.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus curtisii]
 gb|AGC57506.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus curtisii]
Length=319

 Score =   204 bits (519),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMMILGYAALLCGSLLSVALLVIT RK  ++FS  N+FL ESF F E        
Sbjct  136  LMMHVSMMILGYAALLCGSLLSVALLVITLRKGIRVFSKKNNFLNESFSFVEIQYMNEIS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSF S++NYYR Q IQQLD WSYR+ISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLTTSFCSSRNYYRAQLIQQLDQWSYRIISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN N +S+N A    IVASIGFLIIWI
Sbjct  256  PKETWAFITWTLFAIYLHTRTNKNWESLNCA----IVASIGFLIIWI  298



>ref|YP_009114283.1| cytochrome c biogenesis protein (chloroplast) [Sedum takesimense]
 gb|AHJ61280.1| cytochrome c biogenesis protein (chloroplast) [Sedum takesimense]
Length=319

 Score =   204 bits (519),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 137/167 (82%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+LGYAALLCGSLLSV+LLVITFRK+ ++F+  + F TE F FG+        
Sbjct  134  LMMHVSMMLLGYAALLCGSLLSVSLLVITFRKDIEIFANSHFFFTELFYFGQIQYMNKRR  193

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ Q  SF SAKNYYR+Q IQQLD WSYRVISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  194  NVLQSISFDSAKNYYRSQLIQQLDHWSYRVISLGFIFLTIGILSGAVWANEAWGSYWNWD  253

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN N +  NSA    IVAS+GF+IIW+
Sbjct  254  PKETWAFITWTIFAIYLHTRTNTNRKVANSA----IVASMGFIIIWV  296



>ref|YP_008575417.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus verrucata]
 gb|AGC56656.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus verrucata]
Length=319

 Score =   204 bits (519),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMMILGYAALLCGSLLSVALLVIT RK  ++FS  N+FL ESF F E        
Sbjct  136  LMMHVSMMILGYAALLCGSLLSVALLVITLRKAIRVFSKKNNFLNESFSFVEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSF S++NYYR Q IQQLD WSYR+ISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLNTSFCSSRNYYRAQLIQQLDQWSYRIISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN N +S+N A    IVASIGFLIIWI
Sbjct  256  PKETWAFITWTLFAIYLHTRTNKNWESLNCA----IVASIGFLIIWI  298



>ref|YP_008575162.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus obliqua]
 ref|YP_008575247.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus radiata]
 ref|YP_008575332.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus delegatensis]
 ref|YP_008575672.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus sieberi]
 ref|YP_008575757.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus elata]
 ref|YP_008575842.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus regnans]
 ref|YP_008575927.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus umbra]
 ref|YP_008576012.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus cloeziana]
 ref|YP_008576182.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus marginata]
 gb|AGC56401.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus obliqua]
 gb|AGC56486.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus radiata]
 gb|AGC56571.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus delegatensis]
 gb|AGC56911.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus sieberi]
 gb|AGC56996.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus elata]
 gb|AGC57081.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus regnans]
 gb|AGC57166.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus umbra]
 gb|AGC57251.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus cloeziana]
 gb|AGC57421.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus marginata]
Length=319

 Score =   204 bits (519),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMMILGYAALLCGSLLSVALLVIT RK  ++FS  N+FL ESF F E        
Sbjct  136  LMMHVSMMILGYAALLCGSLLSVALLVITLRKAIRVFSKKNNFLNESFSFVEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSF S++NYYR Q IQQLD WSYR+ISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLTTSFCSSRNYYRAQLIQQLDQWSYRIISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN N +S+N A    IVASIGFLIIWI
Sbjct  256  PKETWAFITWTLFAIYLHTRTNKNWESLNCA----IVASIGFLIIWI  298



>ref|YP_008577372.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus microcorys]
 gb|AGC58781.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus microcorys]
Length=319

 Score =   204 bits (519),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMMILGYAALLCGSLLSVALLVIT RK  ++FS  N+FL ESF F E        
Sbjct  136  LMMHVSMMILGYAALLCGSLLSVALLVITLRKAIRVFSKKNNFLNESFSFVEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSF S++NYYR Q IQQLD WSYR+ISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLTTSFCSSRNYYRAQLIQQLDQWSYRIISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN N +S+N A    IVASIGFLIIWI
Sbjct  256  PKETWAFITWTLFAIYLHTRTNKNWESLNCA----IVASIGFLIIWI  298



>gb|ADZ36441.1| c-type cytochrome synthesis protein [Polyspora chrysandra]
Length=321

 Score =   204 bits (519),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 131/167 (78%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMM+LGYAALLCGSLLSVALLVITFRK+  LF   N    ESF FGE        
Sbjct  136  LIMHVSMMVLGYAALLCGSLLSVALLVITFRKDINLFYKSNHLFNESFSFGEFQYINERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+F  TSFFS KNYYR Q IQQLD WSYRVIS+GF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVFGNTSFFSTKNYYRFQLIQQLDHWSYRVISIGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKE WAFITW +FAI+LHTRTN  +   NSA    IVAS GFLIIWI
Sbjct  256  PKEIWAFITWTIFAIYLHTRTNKKIPPANSA----IVASTGFLIIWI  298



>ref|YP_008575502.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus baxteri]
 ref|YP_008575587.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus diversifolia]
 gb|AGC56741.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus baxteri]
 gb|AGC56826.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus diversifolia]
Length=319

 Score =   204 bits (518),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMMILGYAALLCGSLLSVALLVIT RK  ++FS  N+FL ESF F E        
Sbjct  136  LMMHVSMMILGYAALLCGSLLSVALLVITLRKAIRVFSKKNNFLNESFSFVEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSF S++NYYR Q IQQLD WSYR+ISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLTTSFCSSRNYYRAQLIQQLDQWSYRIISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN N +S+N A    IVASIGFLIIWI
Sbjct  256  PKETWAFITWTLFAIYLHTRTNKNWESLNCA----IVASIGFLIIWI  298



>gb|AGC57931.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus globulus]
Length=319

 Score =   204 bits (518),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 135/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMMILGYAALLCGSLLSVALLVIT RK  ++FS  N+FL ESF F E        
Sbjct  136  LMMHVSMMILGYAALLCGSLLSVALLVITLRKAIRVFSKKNNFLNESFSFVEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSF S++NYYR Q IQQLD WSYR+ISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLTTSFCSSRNYYRAQLIQQLDQWSYRIISLGFLFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN N +S N A    IVASIGFLIIWI
Sbjct  256  PKETWAFITWTLFAIYLHTRTNKNWESFNCA----IVASIGFLIIWI  298



>ref|YP_004072510.1| cytochrome c biogenesis protein [Corynocarpus laevigata]
 gb|ADO60358.1| cytochrome c biogenesis protein [Corynocarpus laevigata]
Length=327

 Score =   204 bits (519),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 136/167 (81%), Gaps = 8/167 (5%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+LGYAALLCGSL SVAL+VITFRK  ++    N+FL +SF FGE        
Sbjct  138  LMMHVSMMVLGYAALLCGSLFSVALIVITFRKVLRIIGKNNNFLKKSFSFGEIQYMNERN  197

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ + TSFF +KNYY++Q IQQLD+WSYR+ISLGFLFL+IGILSGAVWANEAWGSYW+WD
Sbjct  198  NVLRNTSFFYSKNYYKSQLIQQLDYWSYRIISLGFLFLSIGILSGAVWANEAWGSYWNWD  257

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW VFAI+LHTRTN N       + ++IVAS+GFLIIWI
Sbjct  258  PKETWAFITWTVFAIYLHTRTNTNFNKNWEGVNSAIVASMGFLIIWI  304



>ref|YP_636348.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus globulus 
subsp. globulus]
 sp|Q49KU9.1|CCSA_EUCGG RecName: Full=Cytochrome c biogenesis protein CcsA (chloroplast) 
[Eucalyptus globulus subsp. globulus]
 gb|AAX21077.1| cytochrome c heme attachment protein (chloroplast) [Eucalyptus 
globulus subsp. globulus]
Length=319

 Score =   204 bits (518),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 135/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMMILGYAALLCGSLLSVALLVIT RK  ++FS  N+FL ESF F E        
Sbjct  136  LMMHVSMMILGYAALLCGSLLSVALLVITLRKAIRVFSKKNNFLNESFSFVEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSF S++NYYR Q IQQLD WSYR+ISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLTTSFCSSRNYYRAQLIQQLDQWSYRIISLGFLFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN N +S N A    IVASIGFLIIWI
Sbjct  256  PKETWAFITWTLFAIYLHTRTNKNWESFNCA----IVASIGFLIIWI  298



>ref|YP_008963444.1| cytochrome c heme attachment protein (chloroplast) [Sedum sarmentosum]
 gb|AFQ99111.1| cytochrome c heme attachment protein (chloroplast) [Sedum sarmentosum]
Length=319

 Score =   204 bits (518),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 137/167 (82%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+LGYAALLCGSLLSV+LLV+TFRK+ ++F+  + F TE F FG+        
Sbjct  134  LMMHVSMMLLGYAALLCGSLLSVSLLVVTFRKDIQIFANSHFFFTELFYFGQIQYMNKRR  193

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSF SAKNYYR+Q IQQLD WSYRVISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  194  NVLHSTSFDSAKNYYRSQLIQQLDHWSYRVISLGFLFLTIGILSGAVWANEAWGSYWNWD  253

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +F I+LHTRTN NL+  NSA    IVAS+GF+IIWI
Sbjct  254  PKETWAFITWTIFVIYLHTRTNTNLKVANSA----IVASMGFIIIWI  296



>ref|YP_008576777.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus saligna]
 gb|AGC58186.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus saligna]
Length=319

 Score =   204 bits (518),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMMILGYAALLCGSLLSVALLVIT RK  ++FS  N+FL ESF F E        
Sbjct  136  LMMHVSMMILGYAALLCGSLLSVALLVITLRKAIRVFSKKNNFLNESFSFVEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   T+F S++NYYR Q IQQLD WSYR+ISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLTTAFCSSRNYYRAQLIQQLDQWSYRIISLGFLFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN N +S+N A    IVASIGFLIIWI
Sbjct  256  PKETWAFITWTLFAIYLHTRTNKNWESLNCA----IVASIGFLIIWI  298



>ref|YP_008592545.1| cytochrome c biogenesis protein (chloroplast) [Andrographis paniculata]
 gb|AGT79903.1| cytochrome c biogenesis protein (chloroplast) [Andrographis paniculata]
Length=323

 Score =   204 bits (518),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 136/169 (80%), Gaps = 14/169 (8%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLT--ESFLFGE------  157
            LIMHVSMMILGYAALLCGSLLSV+LLVIT RK  + F   N  L   ESF  GE      
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVSLLVITVRKKRQFFYTSNYLLNLNESFFVGEIKYMSE  195

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+F+ +SFFSA NYYR++ IQ+LD+WSYRVISLGFLFLTIG+LSGAVWANEAWGSYWS
Sbjct  196  GNNVFKNSSFFSATNYYRSRLIQELDYWSYRVISLGFLFLTIGMLSGAVWANEAWGSYWS  255

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            WDPKETWAFITWI+FA +LHTRTN+  QS NSA    IVASIGFL+IWI
Sbjct  256  WDPKETWAFITWIIFASYLHTRTNIKFQSTNSA----IVASIGFLLIWI  300



>gb|ADX99038.1| cytochrome c heme attachment protein [Stachytarpheta cayennensis]
Length=292

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 127/157 (81%), Gaps = 10/157 (6%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDF--LTESFLFGE------  157
            LIMHVSMMILGYAALLCGSLLSV+LLVIT RK  K FS  N    L ESF FGE      
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVSLLVITVRKKRKFFSTSNHLVNLNESFFFGEIESMNE  195

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+ Q TS FS KNYYR+Q IQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYWS
Sbjct  196  RSNVLQNTSLFSTKNYYRSQLIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWS  255

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVAS  442
            WDPKETWAFITWIVFAI+LHTRTN   +  NSAIVAS
Sbjct  256  WDPKETWAFITWIVFAIYLHTRTNKKWKGTNSAIVAS  292



>ref|YP_008576692.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus aromaphloia]
 gb|AGC58101.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus aromaphloia]
Length=319

 Score =   203 bits (517),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMMILGYAALLCGSLLSVALLVIT RK  ++FS  N+FL ESF F E        
Sbjct  136  LMMHVSMMILGYAALLCGSLLSVALLVITLRKAIRVFSKKNNFLNESFSFVEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSF S++NYY+ Q IQQLD WSYR+ISLGFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLTTSFCSSRNYYKAQLIQQLDQWSYRIISLGFLFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN N +S+N A    IVASIGFLIIWI
Sbjct  256  PKETWAFITWTLFAIYLHTRTNKNWESLNCA----IVASIGFLIIWI  298



>ref|YP_007507161.1| cytochrome c biogenesis protein (chloroplast) [Salvia miltiorrhiza]
 gb|AFQ30979.1| cytochrome c biogenesis protein (chloroplast) [Salvia miltiorrhiza]
Length=325

 Score =   203 bits (517),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 135/171 (79%), Gaps = 16/171 (9%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLT--ESFLFGE------  157
            LIMHVSMMILGY ALLCGSLLSV+LLVIT RKN + FS  N  L   ESFL G+      
Sbjct  136  LIMHVSMMILGYVALLCGSLLSVSLLVITVRKNRRFFSTNNRLLNLNESFLLGKVKYMNE  195

Query  158  ----NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSY  325
                N+ QKTSFF   NYY++Q IQQLD+WSYRVISLGFLFLTIGILSGAVWANEAWGSY
Sbjct  196  GKGKNVLQKTSFFFPINYYKSQLIQQLDYWSYRVISLGFLFLTIGILSGAVWANEAWGSY  255

Query  326  WSWDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            WSWDPKETWAFITWI+FAI+LHT+TN+  +  NSA    IVA IGFLIIWI
Sbjct  256  WSWDPKETWAFITWIIFAIYLHTQTNIKWKGTNSA----IVAFIGFLIIWI  302



>ref|YP_001430150.1| cytochrome c biogenesis protein [Cuscuta reflexa]
 sp|A7M9A9.1|CCSA_CUSRE RecName: Full=Cytochrome c biogenesis protein CcsA [Cuscuta reflexa]
 emb|CAM98437.1| cytochrome c biogenesis protein [Cuscuta reflexa]
Length=308

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 135/159 (85%), Gaps = 9/159 (6%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVS+MILGYAALLCGSLLSVAL+VIT R +GK F     F + +FLF E  +Q  +F
Sbjct  136  LIMHVSLMILGYAALLCGSLLSVALMVITVRNDGKFF-----FKSNNFLFREISYQNKNF  190

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            F A NYY+TQ I++LDFWSY+VISLGF+FLTIGILSGAVWANEAWGSYWSWDPKETWAFI
Sbjct  191  FYAINYYKTQLIKELDFWSYQVISLGFIFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  250

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAI+LHTR N+NLQS NSA    IVAS+GF+IIWI
Sbjct  251  TWIVFAIYLHTRININLQSTNSA----IVASLGFIIIWI  285



>ref|YP_009050639.1| cytochrome c heme attachment protein (chloroplast) [Camellia 
grandibracteata]
 ref|YP_009050900.1| cytochrome c heme attachment protein (chloroplast) [Camellia 
pubicosta]
 gb|AFK81349.1| cytochrome c heme attachment protein [Camellia sinensis var. 
assamica]
 gb|AIG61303.1| cytochrome c heme attachment protein (chloroplast) [Camellia 
grandibracteata]
 gb|AIG61564.1| cytochrome c heme attachment protein (chloroplast) [Camellia 
pubicosta]
Length=321

 Score =   203 bits (517),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 130/167 (78%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMM+LGYAALLCGSLLSVALLVITFRK+  +F   N    ESF FGE        
Sbjct  136  LIMHVSMMVLGYAALLCGSLLSVALLVITFRKDINIFYKSNHLFNESFSFGEFQYINERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+F  TSFFS KNYYR Q IQQLD WSYRVIS+GFLFLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVFGNTSFFSTKNYYRFQLIQQLDHWSYRVISIGFLFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKE WAFITW +FAI+LHTRTN      NSA    IVAS GFLIIWI
Sbjct  256  PKEIWAFITWTIFAIYLHTRTNKKFPPANSA----IVASTGFLIIWI  298



>gb|ADD30968.1| cytochrome c heme attachment protein (chloroplast) [Heuchera 
sanguinea]
Length=318

 Score =   203 bits (517),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 133/167 (80%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+LGYAALLCGSLLSVALLVITFRK+ ++F   N  L E F F E        
Sbjct  136  LMMHVSMMVLGYAALLCGSLLSVALLVITFRKDIRIFGKSNHLLNELFSFDEIQYINKRS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ + TSF S +NYY+ Q IQQLD W YRVISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLRTTSFLSDRNYYKYQLIQQLDHWGYRVISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN NLQ  NSA    IVAS+GFLIIWI
Sbjct  256  PKETWAFITWTIFAIYLHTRTNTNLQGANSA----IVASMGFLIIWI  298



>ref|YP_008577882.1| cytochrome c biogenesis protein (chloroplast) [Corymbia tessellaris]
 gb|AGC59291.1| cytochrome c biogenesis protein (chloroplast) [Corymbia tessellaris]
Length=319

 Score =   203 bits (516),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMMILGYAALLCGSLLSVALLVIT RK  ++FS  N+F+ ESF F E        
Sbjct  136  LMMHVSMMILGYAALLCGSLLSVALLVITLRKAIRIFSKKNNFVNESFSFVEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSF S++NYYR Q IQQLD WSYR+ISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLNTSFCSSRNYYRAQLIQQLDQWSYRIISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN N +S+N A    IVASIGFLIIWI
Sbjct  256  PKETWAFITWTLFAIYLHTRTNKNWESLNCA----IVASIGFLIIWI  298



>ref|YP_008577202.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus diversicolor]
 gb|AGC58611.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus diversicolor]
Length=319

 Score =   203 bits (516),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 135/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMMILGYAALLCGSLLSVALLVIT RK  + FS  N+FL ESF F E        
Sbjct  136  LMMHVSMMILGYAALLCGSLLSVALLVITLRKAIRFFSKKNNFLNESFSFVEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSF S++NYYR Q IQQLD WSYR+ISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLTTSFCSSRNYYRAQLIQQLDQWSYRIISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN N +S+N A    IVASIGFLIIWI
Sbjct  256  PKETWAFITWTLFAIYLHTRTNKNWESLNCA----IVASIGFLIIWI  298



>ref|YP_008577542.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus erythrocorys]
 gb|AGC58951.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus erythrocorys]
Length=319

 Score =   203 bits (516),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 135/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMMILGYAALLCGSLLSVALLVIT RK  + FS  N+FL ESF F E        
Sbjct  136  LMMHVSMMILGYAALLCGSLLSVALLVITLRKAIRFFSKKNNFLNESFSFVEIQYMNARS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSF S++NYYR Q IQQLD WSYR+ISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLTTSFCSSRNYYRAQLIQQLDQWSYRIISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN N +S+N A    IVASIGFLIIWI
Sbjct  256  PKETWAFITWTLFAIYLHTRTNKNWESLNCA----IVASIGFLIIWI  298



>ref|YP_008964918.1| cytochrome c heme attachment protein (chloroplast) [Schwalbea 
americana]
 emb|CDJ38692.1| cytochrome c heme attachment protein (chloroplast) [Schwalbea 
americana]
Length=345

 Score =   204 bits (518),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 136/169 (80%), Gaps = 14/169 (8%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLT--ESFLFGE------  157
            LIMHVSMMI GYAALLCGSLLS++LLVI  RK  K FS  N FL   ESF FGE      
Sbjct  160  LIMHVSMMIFGYAALLCGSLLSISLLVIRVRKKIKFFSTSNHFLNFNESFFFGEIKYMNK  219

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+FQ  SFF  +NYY++Q+IQQLD+WSYRVISLGF+FLT+GILSGAVWANEAWGSYWS
Sbjct  220  RNNVFQDPSFFFPRNYYKSQWIQQLDYWSYRVISLGFIFLTVGILSGAVWANEAWGSYWS  279

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            WDPKETWAFITWIVFAI+LHTRTN+  +  NSA    IVA+IGFLIIWI
Sbjct  280  WDPKETWAFITWIVFAIYLHTRTNIKWKGTNSA----IVAAIGFLIIWI  324



>ref|YP_008577032.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus spathulata]
 gb|AGC58441.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus spathulata]
Length=319

 Score =   202 bits (515),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMMILGYAALLCGSLLSVALLVIT RK  ++FS  N+FL ESF F E        
Sbjct  136  LMMHVSMMILGYAALLCGSLLSVALLVITLRKAIRVFSKKNNFLNESFSFVEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSF S++NYYR Q IQQLD WSYR+ISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLTTSFCSSRNYYRAQLIQQLDQWSYRIISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN N +S+N A    IVAS+GFLIIWI
Sbjct  256  PKETWAFITWTLFAIYLHTRTNKNWESLNCA----IVASMGFLIIWI  298



>gb|ADZ36450.1| c-type cytochrome synthesis protein [Schima argentea]
Length=320

 Score =   202 bits (515),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 132/167 (79%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMM+LGYAALLCGSLLSVALLVITFRK+ K+F   N    ESF F E        
Sbjct  135  LIMHVSMMVLGYAALLCGSLLSVALLVITFRKDIKIFYKSNHLFNESFSFDEIQYINERS  194

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+F  TSFFS KNYYR Q IQQL+ WSYRVIS+GF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  195  NVFGNTSFFSTKNYYRFQLIQQLNHWSYRVISIGFIFLTIGILSGAVWANEAWGSYWNWD  254

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKE WAFITW +FAI+LHTRTN  L   NSA    IVAS+GFLIIWI
Sbjct  255  PKEIWAFITWTIFAIYLHTRTNKKLPPANSA----IVASMGFLIIWI  297



>gb|ADZ36470.1| c-type cytochrome synthesis protein [Franklinia alatamaha]
Length=321

 Score =   202 bits (515),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 131/167 (78%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMM+LGYAALLCGSLLSVALLVITFRK+  +F   N    ESF F E        
Sbjct  136  LIMHVSMMVLGYAALLCGSLLSVALLVITFRKDINIFYKSNHLFNESFSFDEIQYINERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+F  TSFFS KNYYR Q IQQLD WSYRVIS+GF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVFGNTSFFSTKNYYRFQLIQQLDHWSYRVISIGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKE WAFITW +FAI+LHTRTN  L   NSA    IVAS+GFLIIWI
Sbjct  256  PKEIWAFITWTIFAIYLHTRTNKKLPPANSA----IVASMGFLIIWI  298



>gb|ADD30966.1| cytochrome c heme attachment protein (chloroplast) [Ficus sp. 
Moore 315]
Length=323

 Score =   202 bits (515),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+LGYAALLCGSLLS+ALLVITFRK  ++FS  N+ + ESF  GE        
Sbjct  138  LMMHVSMMVLGYAALLCGSLLSLALLVITFRKFLRIFSKINNLVNESFSLGEIQYVREKN  197

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            NL   T F S++NYYR Q IQQLD WSYR+ISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  198  NLLPNTFFLSSRNYYRFQLIQQLDLWSYRIISLGFIFLTIGILSGAVWANEAWGSYWNWD  257

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +F+I+LHTRTN N++SVNSA    IVAS+GF IIWI
Sbjct  258  PKETWAFITWTLFSIYLHTRTNKNIESVNSA----IVASMGFFIIWI  300



>ref|YP_008578222.1| cytochrome c biogenesis protein (chloroplast) [Stockwellia quadrifida]
 gb|AGC59631.1| cytochrome c biogenesis protein (chloroplast) [Stockwellia quadrifida]
Length=319

 Score =   202 bits (515),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 135/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMMILGYA LLCGSLLSVALLVIT RK  ++FS  N+FL ESF F E        
Sbjct  136  LMMHVSMMILGYAGLLCGSLLSVALLVITLRKAIRIFSKKNNFLNESFSFVEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSF S++NYYR Q IQQLD WSYR+ISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLNTSFCSSRNYYRAQLIQQLDQWSYRIISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN N +S+N A    IVAS+GFLIIWI
Sbjct  256  PKETWAFITWTLFAIYLHTRTNKNWESLNCA----IVASMGFLIIWI  298



>gb|AEX99570.1| cytochrome c biogenesis protein (chloroplast) [Chrysanthemum 
indicum]
Length=324

 Score =   202 bits (515),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 136/171 (80%), Gaps = 19/171 (11%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLF--SGGNDFL--TESFLFGE----  157
            LIMHVSMMIL YAALLCGSLLSVALLVITFRK   LF  S  N+ L    SF FGE    
Sbjct  138  LIMHVSMMILSYAALLCGSLLSVALLVITFRK---LFYSSKSNNLLKLNGSFSFGEIQYK  194

Query  158  ----NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSY  325
                N+FQK +FF   NYY+ Q IQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSY
Sbjct  195  NERNNIFQKKTFFPVNNYYKAQLIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSY  254

Query  326  WSWDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            WSWDPKETWAFITWIVFAI+LHTRTN NLQ  NSA    IVA+IGFLIIWI
Sbjct  255  WSWDPKETWAFITWIVFAIYLHTRTNKNLQGTNSA----IVATIGFLIIWI  301



>ref|YP_007474784.1| cytochrome c biogenesis protein (chloroplast) [Chrysanthemum 
indicum]
 gb|AEX99333.1| cytochrome c biogenesis protein (chloroplast) [Chrysanthemum 
indicum]
Length=324

 Score =   202 bits (515),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 136/171 (80%), Gaps = 19/171 (11%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLF--SGGNDFL--TESFLFGE----  157
            LIMHVSMMIL YAALLCGSLLSVALLVITFRK   LF  S  N+ L    SF FGE    
Sbjct  138  LIMHVSMMILSYAALLCGSLLSVALLVITFRK---LFYSSKSNNLLKLNGSFSFGEIQYK  194

Query  158  ----NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSY  325
                N+FQK +FF   NYY+ Q IQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSY
Sbjct  195  NERNNIFQKKAFFPVNNYYKAQLIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSY  254

Query  326  WSWDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            WSWDPKETWAFITWIVFAI+LHTRTN NLQ  NSA    IVA+IGFLIIWI
Sbjct  255  WSWDPKETWAFITWIVFAIYLHTRTNKNLQGTNSA----IVATIGFLIIWI  301



>ref|YP_001542573.1| cytochrome c heme attachment protein [Cuscuta exaltata]
 sp|A8W3G6.1|CCSA_CUSEX RecName: Full=Cytochrome c biogenesis protein CcsA [Cuscuta exaltata]
 gb|ABW83737.1| cytochrome c heme attachment protein [Cuscuta exaltata]
Length=308

 Score =   202 bits (514),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 131/159 (82%), Gaps = 9/159 (6%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVS+MILGYAALLCGSLLSVAL+VITFRK+GK FS   DFL     F E  ++K   
Sbjct  136  LIMHVSLMILGYAALLCGSLLSVALMVITFRKDGKFFSKSKDFL-----FTEIFYKKIFV  190

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            F+  NYY+TQ IQ+LDFWSY+VI LGF+FLTIGILSGAVWANEAWGSYWSWDPKETWAFI
Sbjct  191  FNYNNYYKTQLIQELDFWSYQVIGLGFIFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  250

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TWIVFAI+LHTR   +LQ  NSA    IVASIGFLIIWI
Sbjct  251  TWIVFAIYLHTRKKRSLQGTNSA----IVASIGFLIIWI  285



>gb|ADX99011.1| cytochrome c heme attachment protein [Lantana camara]
Length=294

 Score =   201 bits (512),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 128/158 (81%), Gaps = 10/158 (6%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLT--ESFLFGE------  157
            LIMHVSMMILGYAALLCGSLLSV+LLVIT RK  K F+  N  +   ESF FGE      
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVSLLVITVRKKKKFFATSNRVVNFNESFFFGEMEYVNH  195

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
                FQ TSFFS KNYYR+Q IQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYWS
Sbjct  196  RSTGFQNTSFFSPKNYYRSQLIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWS  255

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASI  445
            WDPKETWAFITWIVFAI+LHTRTN   +  NSAIVASI
Sbjct  256  WDPKETWAFITWIVFAIYLHTRTNRKWKGTNSAIVASI  293



>gb|ADZ36446.1| c-type cytochrome synthesis protein [Schima wallichii]
Length=320

 Score =   202 bits (514),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 132/167 (79%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMM+LGYAALLCGSLLSVALLVITFRK+ K+F   N    ESF F E        
Sbjct  135  LIMHVSMMVLGYAALLCGSLLSVALLVITFRKDIKIFYKSNHLFNESFSFDEIQYINERS  194

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+F  TSFFS KNYYR Q IQQL+ WSYRVIS+GF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  195  NVFGNTSFFSTKNYYRFQLIQQLNHWSYRVISIGFIFLTIGILSGAVWANEAWGSYWNWD  254

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKE WAFITW +FAI+LHTRTN  L   NSA    IVAS+GFLIIWI
Sbjct  255  PKEIWAFITWTIFAIYLHTRTNKKLPPANSA----IVASMGFLIIWI  297



>ref|YP_008520190.1| cytochrome c biogenesis protein ycf5 (chloroplast) [Camellia 
taliensis]
 gb|AGU44508.1| cytochrome c biogenesis protein ycf5 (chloroplast) [Camellia 
taliensis]
 gb|AGU44775.1| cytochrome c biogenesis protein ycf5 (chloroplast) [Camellia 
taliensis]
Length=321

 Score =   202 bits (514),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 130/167 (78%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMM+LGYAALLCGSLLSVALLVITFRK+  +F   N    ESF FGE        
Sbjct  136  LIMHVSMMVLGYAALLCGSLLSVALLVITFRKDINIFYKSNHLFNESFSFGEFQYINERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+F  TSFFS KNYYR Q IQQLD WSYRVIS+GF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVFGNTSFFSTKNYYRFQLIQQLDHWSYRVISIGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKE WAFITW +FAI+LHTRTN      NSA    IVAS GFLIIWI
Sbjct  256  PKEIWAFITWTIFAIYLHTRTNKKFPPANSA----IVASTGFLIIWI  298



>ref|YP_007317298.1| cytochrome c biogenesis protein (chloroplast) [Camellia sinensis]
 ref|YP_008592984.1| cytochrome c biogenesis protein ycf5 (chloroplast) [Camellia 
impressinervis]
 ref|YP_008593162.1| cytochrome c biogenesis protein ycf5 (chloroplast) [Camellia 
yunnanensis]
 ref|YP_008963356.1| cytochrome c heme attachment protein [Camellia oleifera]
 ref|YP_009047983.1| cytochrome c biogenesis protein (chloroplast) [Camellia crapnelliana]
 ref|YP_009050726.1| cytochrome c heme attachment protein (chloroplast) [Camellia 
leptophylla]
 ref|YP_009050813.1| cytochrome c heme attachment protein (chloroplast) [Camellia 
petelotii]
 gb|ADZ36435.1| c-type cytochrome synthesis protein [Camellia obtusifolia]
 gb|AFK81436.1| cytochrome c heme attachment protein [Camellia oleifera]
 gb|AFK81523.1| cytochrome c heme attachment protein [Camellia taliensis]
 gb|AGA55646.1| cytochrome c biogenesis protein (chloroplast) [Camellia sinensis]
 gb|AGU44419.1| cytochrome c biogenesis protein ycf5 (chloroplast) [Camellia 
impressinervis]
 gb|AGU44686.1| cytochrome c biogenesis protein ycf5 (chloroplast) [Camellia 
yunnanensis]
 gb|AGZ19194.1| cytochrome c heme attachment protein (chloroplast) [Camellia 
sinensis]
 gb|AHF71584.1| cytochrome c biogenesis protein (chloroplast) [Camellia crapnelliana]
 gb|AIG61390.1| cytochrome c heme attachment protein (chloroplast) [Camellia 
leptophylla]
 gb|AIG61477.1| cytochrome c heme attachment protein (chloroplast) [Camellia 
petelotii]
 gb|AIG61739.1| cytochrome c heme attachment protein (chloroplast) [Camellia 
sinensis var. dehungensis]
 gb|AIG61826.1| cytochrome c heme attachment protein (chloroplast) [Camellia 
sinensis var. pubilimba]
 gb|AIG61913.1| cytochrome c heme attachment protein (chloroplast) [Camellia 
sinensis var. sinensis]
Length=321

 Score =   202 bits (514),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 130/167 (78%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMM+LGYAALLCGSLLSVALLVITFRK+  +F   N    ESF FGE        
Sbjct  136  LIMHVSMMVLGYAALLCGSLLSVALLVITFRKDINIFYKSNHLFNESFSFGEFQYINERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+F  TSFFS KNYYR Q IQQLD WSYRVIS+GF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVFGNTSFFSTKNYYRFQLIQQLDHWSYRVISIGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKE WAFITW +FAI+LHTRTN      NSA    IVAS GFLIIWI
Sbjct  256  PKEIWAFITWTIFAIYLHTRTNKKFPPANSA----IVASTGFLIIWI  298



>ref|YP_007890423.1| cytochrome c biogenesis protein (chloroplast) [Ardisia polysticta]
 gb|AGG36934.1| cytochrome c biogenesis protein (chloroplast) [Ardisia polysticta]
Length=325

 Score =   202 bits (514),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 133/169 (79%), Gaps = 14/169 (8%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLT--ESFLFGE------  157
            LIMHVSMM+LGYAALLCGSLLSVALLVITFRK+  LF   N  L   ESF FGE      
Sbjct  136  LIMHVSMMVLGYAALLCGSLLSVALLVITFRKDITLFYNKNRLLNFNESFYFGEIQCMNK  195

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+F  T FFSAKNYYR+Q IQQLD W YRVIS+GF+FLTIGILSGAVWANEAWGSYW+
Sbjct  196  KSNVFGNTYFFSAKNYYRSQLIQQLDHWGYRVISIGFIFLTIGILSGAVWANEAWGSYWN  255

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            WDPKE WAFITW VFAI+LH+RTN  L   NSA    +VASIGFLIIWI
Sbjct  256  WDPKEIWAFITWTVFAIYLHSRTNKKLTPANSA----VVASIGFLIIWI  300



>ref|YP_008592808.1| cytochrome c biogenesis protein ycf5 (chloroplast) [Camellia 
cuspidata]
 gb|AGU44243.1| cytochrome c biogenesis protein ycf5 (chloroplast) [Camellia 
cuspidata]
Length=321

 Score =   202 bits (514),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 130/167 (78%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMM+LGYAALLCGSLLSVALLVITFRK+  +F   N    ESF FGE        
Sbjct  136  LIMHVSMMVLGYAALLCGSLLSVALLVITFRKDINIFYKSNHLFNESFSFGEFQYINERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+F  TSFFS KNYYR Q IQQLD WSYRVIS+GF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVFGNTSFFSTKNYYRFQLIQQLDHWSYRVISIGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKE WAFITW +FAI+LHTRTN      NSA    IVAS GFLIIWI
Sbjct  256  PKEIWAFITWTIFAIYLHTRTNKKFPPANSA----IVASTGFLIIWI  298



>gb|ADX99041.1| cytochrome c heme attachment protein [Petrea volubilis]
Length=292

 Score =   201 bits (511),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 127/158 (80%), Gaps = 10/158 (6%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDF--LTESFLFGE------  157
            LIMHVSMMILGYA+LLCGSLLSV+LLVIT RK  K F   N    L +SF F E      
Sbjct  134  LIMHVSMMILGYASLLCGSLLSVSLLVITVRKKKKFFYTSNHLVNLNDSFFFDEIEYMNE  193

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+ QKTSFFS KNYYR+Q IQQLD+W YRVISLGFLFLTIGILSGAVWANEAWGSYWS
Sbjct  194  RSNILQKTSFFSPKNYYRSQLIQQLDYWGYRVISLGFLFLTIGILSGAVWANEAWGSYWS  253

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASI  445
            WDPKETWAFITWI+FA++LHTRTN   +  NSAIVASI
Sbjct  254  WDPKETWAFITWIIFAVYLHTRTNRKWKGTNSAIVASI  291



>gb|ADZ36430.1| c-type cytochrome synthesis protein [Pyrenaria hirta]
Length=321

 Score =   202 bits (514),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 130/167 (78%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMM+LGYAALLCGSLLSVALLVITFRK+  +F   N    ESF FGE        
Sbjct  136  LIMHVSMMVLGYAALLCGSLLSVALLVITFRKDINIFYKSNHLFNESFSFGEFQYINERR  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+F  TSFFS KNYYR Q IQQLD WSYRVIS+GF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVFGNTSFFSTKNYYRFQLIQQLDHWSYRVISIGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKE WAFITW +FAI+LHTRTN      NSA    IVAS GFLIIWI
Sbjct  256  PKEIWAFITWTIFAIYLHTRTNKKFPPANSA----IVASTGFLIIWI  298



>ref|YP_009040852.1| cytochrome c heme attachment protein (chloroplast) (chloroplast) 
[Centaurea diffusa]
 gb|AIB03807.1| cytochrome c heme attachment protein (chloroplast) (chloroplast) 
[Centaurea diffusa]
Length=320

 Score =   202 bits (514),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 134/166 (81%), Gaps = 11/166 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDF-LTESFLFGENLFQ---  169
            LIMHVSMMIL YAALLCGSLLSVALLVITFR     +   N   L  SF FGE  ++   
Sbjct  136  LIMHVSMMILSYAALLCGSLLSVALLVITFRNIFYSYKSNNLLQLNHSFSFGEIQYKNER  195

Query  170  ---KTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDP  340
               KTSFFSAKNYY+ Q IQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYWSWDP
Sbjct  196  NNIKTSFFSAKNYYKAQLIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWSWDP  255

Query  341  KETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            KETWAFITWIVFAI+LHTRTN NLQ  NSA    IVA++GFLIIWI
Sbjct  256  KETWAFITWIVFAIYLHTRTNKNLQGANSA----IVATLGFLIIWI  297



>gb|ADX99032.1| cytochrome c heme attachment protein [Citharexylum ligustrinum]
Length=294

 Score =   201 bits (511),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 127/158 (80%), Gaps = 10/158 (6%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDF--LTESFLFGE------  157
            LIMHVSMMILGYAALLCGSL SV+LLVIT +K  K FS  N    L ES  FGE      
Sbjct  136  LIMHVSMMILGYAALLCGSLFSVSLLVITVQKKRKFFSTSNHLVNLNESLFFGEIEYMNK  195

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+ Q TSFF  KNYYR+Q IQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYWS
Sbjct  196  RSNVLQNTSFFYPKNYYRSQLIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWS  255

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASI  445
            WDPKETWAFITWIVFAI+LHTRTN+  +  NSAIVASI
Sbjct  256  WDPKETWAFITWIVFAIYLHTRTNIKWKGTNSAIVASI  293



>ref|YP_008578137.1| cytochrome c biogenesis protein (chloroplast) [Allosyncarpia 
ternata]
 gb|AGC59546.1| cytochrome c biogenesis protein (chloroplast) [Allosyncarpia 
ternata]
Length=319

 Score =   202 bits (513),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 135/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMMILGYAALLCGSLLSVALLVIT RK  ++ S  N+FL ESF F E        
Sbjct  136  LMMHVSMMILGYAALLCGSLLSVALLVITLRKAIRILSKKNNFLNESFSFVEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSF S++NYYR Q IQQLD WSYR+ISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLNTSFCSSRNYYRAQLIQQLDQWSYRIISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN N +S+N A    IVAS+GFLIIWI
Sbjct  256  PKETWAFITWTLFAIYLHTRTNKNWESLNCA----IVASMGFLIIWI  298



>gb|AFQ39601.1| cytochrome c heme attachment protein, partial [Fragaria x bifera]
Length=309

 Score =   201 bits (512),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 135/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+LGYAALLCGSLLS+ALLVITFRK  ++FS  N+ LT+SF FGE        
Sbjct  124  LMMHVSMMVLGYAALLCGSLLSLALLVITFRKFIRIFSKSNNLLTQSFSFGEIQYVNERN  183

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N  Q TS  S++NYYR Q IQQLD WSYR+ISLGF+ LTIGILSGAVWANEAW SYW+WD
Sbjct  184  NALQSTSLISSQNYYRYQLIQQLDRWSYRIISLGFILLTIGILSGAVWANEAWXSYWNWD  243

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW VFAI+LH RTN N ++VNSA    IVAS+GFLIIWI
Sbjct  244  PKETWAFITWTVFAIYLHIRTNKNYETVNSA----IVASMGFLIIWI  286



>ref|YP_001687499.1| cytochrome c biogenesis protein (chloroplast) [Oenothera parviflora]
 sp|B0Z5H6.1|CCSA_OENPA RecName: Full=Cytochrome c biogenesis protein CcsA (chloroplast) 
[Oenothera parviflora]
 gb|ABX10169.1| cytochrome c biogenesis protein (chloroplast) [Oenothera parviflora]
Length=319

 Score =   202 bits (513),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 134/167 (80%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+LGYAALLCGSLLSVALLVITFRK  K+FS    FL +SF F E        
Sbjct  136  LMMHVSMMVLGYAALLCGSLLSVALLVITFRKARKIFSKKKAFLKDSFSFVEIQYRNEPS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSF S+KNYYR Q IQQLD WS R+ISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLSTSFISSKNYYRAQLIQQLDRWSSRIISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN N QSVNSA    IVA +GF+IIWI
Sbjct  256  PKETWAFITWTMFAIYLHTRTNPNFQSVNSA----IVAFLGFIIIWI  298



>ref|YP_008577457.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus guilfoylei]
 gb|AGC58866.1| cytochrome c biogenesis protein (chloroplast) [Eucalyptus guilfoylei]
Length=319

 Score =   202 bits (513),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 135/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMMILGYAALLCGSLLSVALLVIT RK  ++FS  N+ L ESF F E        
Sbjct  136  LMMHVSMMILGYAALLCGSLLSVALLVITLRKAIRVFSKKNNLLNESFSFVEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSF S++NYYR Q IQQLD WSYR+ISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLTTSFCSSRNYYRAQLIQQLDQWSYRIISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FA++LHTRTN N +S+N A    IVASIGFLIIWI
Sbjct  256  PKETWAFITWTLFAVYLHTRTNKNWESLNCA----IVASIGFLIIWI  298



>gb|ADD30973.1| cytochrome c heme attachment protein (chloroplast) [Staphylea 
colchica]
Length=319

 Score =   201 bits (512),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 135/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMM+LGYAALLCGSL SVA+LVITFRK  ++F    +FL ESF  G+        
Sbjct  136  LIMHVSMMVLGYAALLCGSLFSVAILVITFRKVLRVFGKSKNFLNESFSIGKIQYMNERR  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            NL   TSF  ++NYYR+Q IQQLD+ SYR+ISLGF+FLTIGILSG+VWANEAWGSYW+WD
Sbjct  196  NLLLNTSFMFSRNYYRSQLIQQLDYLSYRIISLGFIFLTIGILSGSVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FA++LHTRTN+NL  VNSA    IVASIGFL+IWI
Sbjct  256  PKETWAFITWTIFAVYLHTRTNINLAGVNSA----IVASIGFLLIWI  298



>ref|YP_009050987.1| cytochrome c heme attachment protein (chloroplast) [Camellia 
reticulata]
 gb|AIG61651.1| cytochrome c heme attachment protein (chloroplast) [Camellia 
reticulata]
Length=321

 Score =   201 bits (512),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 129/167 (77%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMM+LGYAALLCGSLLSVALLVITFRK+  +F   N    ESF FGE        
Sbjct  136  LIMHVSMMVLGYAALLCGSLLSVALLVITFRKDINIFYKSNHLFNESFSFGEFQYINERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N F  TSFFS KNYYR Q IQQLD WSYRVIS+GF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NFFGNTSFFSTKNYYRFQLIQQLDHWSYRVISIGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKE WAFITW +FAI+LHTRTN      NSA    IVAS GFLIIWI
Sbjct  256  PKEIWAFITWTIFAIYLHTRTNKKFPPANSA----IVASTGFLIIWI  298



>gb|ADZ36379.1| c-type cytochrome synthesis protein [Lysimachia christinae]
Length=328

 Score =   201 bits (512),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 134/171 (78%), Gaps = 16/171 (9%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLT----ESFLFGE----  157
            LIMHVSMM+LGYAALLCGSLLSVALLVITFRK+  LF   N  L     ESF FGE    
Sbjct  136  LIMHVSMMVLGYAALLCGSLLSVALLVITFRKDITLFYKKNHLLNFNFNESFAFGEIQYM  195

Query  158  ----NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSY  325
                N+F  T FFSAKNYYR+QFIQQLD W YRVIS+GF+FLTIGILSGAVWANEAWGSY
Sbjct  196  NKKSNVFGNTYFFSAKNYYRSQFIQQLDHWGYRVISIGFIFLTIGILSGAVWANEAWGSY  255

Query  326  WSWDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            W+WDPKE WAFITW VFAI+LH+RTN   +  NSA    +VASIGFLIIWI
Sbjct  256  WNWDPKEIWAFITWTVFAIYLHSRTNKKARPANSA----VVASIGFLIIWI  302



>gb|AFQ39620.1| cytochrome c heme attachment protein [Fragaria bucharica]
Length=310

 Score =   201 bits (511),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 135/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+LGYAALLCGSLLS+ALLVITFRK  ++FS  N+ LT+SF FGE        
Sbjct  125  LMMHVSMMVLGYAALLCGSLLSLALLVITFRKFIRIFSKSNNLLTQSFSFGEIQYVNERN  184

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N  Q TS  S++NYY  Q IQQLD WSYR+ISLGF+ LTIGILSGAVWANEAWGSYW+WD
Sbjct  185  NALQSTSLISSQNYYIYQLIQQLDRWSYRIISLGFILLTIGILSGAVWANEAWGSYWNWD  244

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW VFAI+LH RTN N ++VNSA    IVAS+GFLIIWI
Sbjct  245  PKETWAFITWTVFAIYLHIRTNKNYETVNSA----IVASMGFLIIWI  287



>ref|YP_004021370.1| cytochrome c heme attachment protein [Theobroma cacao]
 gb|ADO64863.1| cytochrome c heme attachment protein [Theobroma cacao]
 gb|AEX58016.1| cytochrome c heme attachment protein (chloroplast) [Theobroma 
cacao]
 gb|AEX58097.1| cytochrome c heme attachment protein (chloroplast) [Theobroma 
cacao]
Length=321

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 133/167 (80%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+LGYAALLCGSLLSVALLVITFRK  K+    N+ L +SF FGE        
Sbjct  136  LMMHVSMMVLGYAALLCGSLLSVALLVITFRKVIKIIGKNNNLLNQSFSFGEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   T F S+KNYYR Q  QQLD WSYR+ISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLNTYFLSSKNYYRYQLTQQLDRWSYRIISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW VFAIFLH RTN N++ VNSA    IVAS+GFLIIWI
Sbjct  256  PKETWAFITWTVFAIFLHIRTNKNVEGVNSA----IVASMGFLIIWI  298



>ref|YP_740614.1| cytochrome c heme attachment protein [Platanus occidentalis]
 sp|Q09FZ7.1|CCSA_PLAOC RecName: Full=Cytochrome c biogenesis protein CcsA (chloroplast) 
[Platanus occidentalis]
 gb|ABI49828.1| cytochrome c heme attachment protein [Platanus occidentalis]
Length=321

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 133/167 (80%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+L YAALLCGSLLS+ALLVI FRKN ++F   N  L  SF FGE        
Sbjct  136  LMMHVSMMVLSYAALLCGSLLSIALLVIRFRKNIEIFGKDNYLLIGSFSFGESQYVNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ + TSF S +NYYR Q IQQLD WSYRVISLGF+FLTIGILSGAVWANEAWG+YW+WD
Sbjct  196  NILRNTSFLSFRNYYRYQLIQQLDHWSYRVISLGFIFLTIGILSGAVWANEAWGAYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN +LQ  NSA    IVASIGFLIIWI
Sbjct  256  PKETWAFITWTIFAIYLHTRTNKDLQGANSA----IVASIGFLIIWI  298



>ref|YP_007353822.1| cytochrome c biogenesis protein (chloroplast) [Chrysanthemum 
x morifolium]
 ref|YP_007624845.1| cytochrome c biogenesis protein (chloroplast) [Artemisia frigida]
 ref|YP_009111787.1| cytochrome c biogenesis protein (chloroplast) [Artemisia montana]
 gb|AFA45331.1| cytochrome c biogenesis protein (chloroplast) [Chrysanthemum 
x morifolium]
 gb|AFP98872.1| cytochrome c biogenesis protein (chloroplast) [Artemisia frigida]
 gb|AHJ61195.1| cytochrome c biogenesis protein (chloroplast) [Artemisia montana]
Length=324

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 135/171 (79%), Gaps = 19/171 (11%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLF--SGGNDFL--TESFLFGE----  157
            LIMHVSMMIL YAALLCGSLLSVALLVITFRK   LF  S  N+ L    SF FGE    
Sbjct  138  LIMHVSMMILSYAALLCGSLLSVALLVITFRK---LFYSSKSNNLLKLNGSFSFGEIQYK  194

Query  158  ----NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSY  325
                N+FQK  FF   NYY+ Q IQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSY
Sbjct  195  NERNNIFQKKYFFPVNNYYKAQLIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSY  254

Query  326  WSWDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            WSWDPKETWAFITWIVFAI+LHTRTN NLQ  NSA    IVA+IGFLIIWI
Sbjct  255  WSWDPKETWAFITWIVFAIYLHTRTNKNLQGTNSA----IVATIGFLIIWI  301



>gb|ADX99034.1| cytochrome c heme attachment protein [Casselia glaziovii]
Length=294

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 128/158 (81%), Gaps = 10/158 (6%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDF--LTESFLFGE------  157
            LIMHVSMMILGYAALLCGSLLSV+LLV+T RK  K FS  N    L +S  FGE      
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVSLLVVTVRKKIKFFSTSNHLVNLNKSLFFGEIESMNE  195

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+ Q TSFFS KNYYR Q IQQLD+WSYRVISLGFLFLTIGILSGAVWANEAWGSYWS
Sbjct  196  QSNVLQNTSFFSPKNYYRLQLIQQLDYWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  255

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASI  445
            WDPKETWAFITWIVFAI+LHTRTN N +  NSAIVASI
Sbjct  256  WDPKETWAFITWIVFAIYLHTRTNRNWKGQNSAIVASI  293



>ref|YP_001687185.1| cytochrome c biogenesis protein (chloroplast) [Oenothera argillicola]
 sp|B0Z4S4.1|CCSA_OENAR RecName: Full=Cytochrome c biogenesis protein CcsA (chloroplast) 
[Oenothera argillicola]
 gb|ABW98752.1| cytochrome c biogenesis protein (chloroplast) [Oenothera argillicola]
Length=319

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 134/167 (80%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+LGYAALLCGSLLSVALLVITFRK  K+FS    FL +SF F E        
Sbjct  136  LMMHVSMMVLGYAALLCGSLLSVALLVITFRKALKIFSKKKAFLKDSFSFVEIQYRNEPS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSF S+KNYYR Q IQQLD WS R+ISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLSTSFISSKNYYRAQLIQQLDRWSSRIISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN N QSVNSA    IVA +GF+IIWI
Sbjct  256  PKETWAFITWTMFAIYLHTRTNPNFQSVNSA----IVAFLGFIIIWI  298



>ref|YP_009020269.1| cytochrome c heme attachment protein (chloroplast) [Castanopsis 
echinocarpa]
 gb|AHL16956.1| cytochrome c heme attachment protein (chloroplast) [Castanopsis 
echinocarpa]
Length=318

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 134/167 (80%), Gaps = 15/167 (9%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+LGYAALLCGSLLSVAL+VITFRK  + F   N+   ESF FGE        
Sbjct  136  LMMHVSMMVLGYAALLCGSLLSVALIVITFRKIIRTFDKSNN---ESFSFGEIQYINERN  192

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   T F S+KNYYR+Q IQQLD WSYR+ISLGF+FLT+GILSGAVWANEAWGSYW+WD
Sbjct  193  NVLCNTPFISSKNYYRSQLIQQLDHWSYRIISLGFIFLTMGILSGAVWANEAWGSYWNWD  252

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LH RTN NL+ VNSA    IVAS+GFLIIWI
Sbjct  253  PKETWAFITWTIFAIYLHIRTNTNLEGVNSA----IVASLGFLIIWI  295



>gb|ADO64938.2| cytochrome c heme attachment protein [Theobroma cacao]
 gb|AEX57854.1| cytochrome c heme attachment protein (chloroplast) [Theobroma 
cacao]
 gb|AEX58583.1| cytochrome c heme attachment protein (chloroplast) [Theobroma 
cacao]
Length=321

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 133/167 (80%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+LGYAALLCGSLLSVALLVITFRK  K+    N+ L +SF FGE        
Sbjct  136  LMMHVSMMVLGYAALLCGSLLSVALLVITFRKVIKIIGKNNNLLNQSFSFGEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   T F S+KNYYR Q  QQLD WSYR+ISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLNTYFLSSKNYYRYQLTQQLDRWSYRIISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW VFAI+LH RTN+N + VNSA    IVAS+GFLIIWI
Sbjct  256  PKETWAFITWTVFAIYLHIRTNINFEGVNSA----IVASMGFLIIWI  298



>ref|YP_008592894.1| cytochrome c biogenesis protein ycf5 (chloroplast) [Camellia 
danzaiensis]
 ref|YP_008593073.1| cytochrome c biogenesis protein ycf5 (chloroplast) [Camellia 
pitardii]
 gb|AGU44333.1| cytochrome c biogenesis protein ycf5 (chloroplast) [Camellia 
danzaiensis]
 gb|AGU44598.1| cytochrome c biogenesis protein ycf5 (chloroplast) [Camellia 
pitardii]
Length=319

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 129/165 (78%), Gaps = 10/165 (6%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE------NL  163
            LIMHVSMM+LGYAALLCGSLLSVALLVITFRK+  +F   N    ESF FGE       +
Sbjct  136  LIMHVSMMVLGYAALLCGSLLSVALLVITFRKDINIFYKSNHLFNESFSFGEFQYINERV  195

Query  164  FQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPK  343
            F  TSFFS KNYYR Q IQQLD WSYRVIS+GF+FLTIGILSGAVWANEAWGSYW+WDPK
Sbjct  196  FGNTSFFSTKNYYRFQLIQQLDHWSYRVISIGFIFLTIGILSGAVWANEAWGSYWNWDPK  255

Query  344  ETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            E WAFITW +FAI+LHTRTN      NSA    IVAS GFLIIWI
Sbjct  256  EIWAFITWTIFAIYLHTRTNKKFPPANSA----IVASTGFLIIWI  296



>ref|YP_009002301.1| cytochrome c biogenesis protein (chloroplast) [Pinguicula ehlersiae]
 emb|CDL78857.1| cytochrome c biogenesis protein (chloroplast) [Pinguicula ehlersiae]
Length=323

 Score =   201 bits (510),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 135/169 (80%), Gaps = 14/169 (8%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDF--LTESFLFGEN-----  160
            LIMHVSMM+LGYAALLCGSLLSV+LL IT RK  K FS   +F  L ESF+FGE+     
Sbjct  136  LIMHVSMMLLGYAALLCGSLLSVSLLAITVRKKRKFFSTSQNFFNLNESFVFGESEYINE  195

Query  161  ---LFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
               + Q TSFFS KN+YR+Q IQQLD+WSYRVISLGF+FLTIGILSGAVWANEAW SYWS
Sbjct  196  QDIVLQNTSFFSPKNFYRSQLIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWESYWS  255

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            WDPKETWAFITWIVFAI+LH RTN   +  +S    S+VASIGF+IIWI
Sbjct  256  WDPKETWAFITWIVFAIYLHIRTNTKWKGTSS----SVVASIGFIIIWI  300



>gb|ADX99012.1| cytochrome c heme attachment protein [Lippia integrifolia]
Length=294

 Score =   200 bits (508),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 127/158 (80%), Gaps = 10/158 (6%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLT--ESFLFGE------  157
            LIMHVSMMILGYAALLCGSLLSV+LLVIT RK  K F+  N  +   ESF FGE      
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVSLLVITVRKKKKFFATSNRVVNFNESFFFGEMEYMNH  195

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
                FQ TSFFS KNYYR+Q IQQLD+WSYRVISLGF+FLTIGILSG VWANEAWGSYWS
Sbjct  196  RSTGFQNTSFFSPKNYYRSQLIQQLDYWSYRVISLGFIFLTIGILSGVVWANEAWGSYWS  255

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASI  445
            WDPKETWAFITWIVFAI+LHTRTN   +  NSAIVASI
Sbjct  256  WDPKETWAFITWIVFAIYLHTRTNRKWKGTNSAIVASI  293



>ref|YP_009020799.1| cytochrome c heme attachment protein (chloroplast) [Praxelis 
clematidea]
 gb|AHM02459.1| cytochrome c heme attachment protein (chloroplast) [Praxelis 
clematidea]
Length=322

 Score =   200 bits (509),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 134/168 (80%), Gaps = 13/168 (8%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDF-LTESFLFGE-------  157
            LIMHVSMMIL YAALLCGSLLSVALLVITFR         N F L +SF F +       
Sbjct  136  LIMHVSMMILSYAALLCGSLLSVALLVITFRNIFSSSKSNNLFKLKKSFSFRKIQYKNER  195

Query  158  -NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSW  334
             N+ +KTSFFS  NYY+ QFIQQLD+WSYRVISLGFLFLTIGILSGAVWANEAWGSYWSW
Sbjct  196  NNILKKTSFFSDNNYYKAQFIQQLDYWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSW  255

Query  335  DPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            DPKETWAFITWIVFAI+LHTRTN NLQ  NSA    IVA++GFLIIW+
Sbjct  256  DPKETWAFITWIVFAIYLHTRTNKNLQGANSA----IVATLGFLIIWV  299



>ref|YP_009027826.1| cytochrome c heme attachment protein (chloroplast) [Cercis canadensis]
Length=319

 Score =   200 bits (509),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 136/167 (81%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGN--DFLTESFLFGE------  157
            L+MHVSMM+LGYA+LLCGSLLSVALLVITFRK  ++    N  DFL ESF F E      
Sbjct  136  LMMHVSMMVLGYASLLCGSLLSVALLVITFRKVIRIIGKSNNFDFLNESFFFVEILNERK  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ +KTSF S++NYYR+QFIQQLD WSYR+ISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLRKTSFLSSRNYYRSQFIQQLDRWSYRIISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTR     + VNS    SIVAS+GFLIIWI
Sbjct  256  PKETWAFITWTIFAIYLHTRKKKKWEGVNS----SIVASMGFLIIWI  298



>ref|YP_007889909.1| cytochrome c heme attachment protein [Francoa sonchifolia]
 gb|AFJ00519.1| cytochrome c heme attachment protein [Francoa sonchifolia]
Length=319

 Score =   200 bits (509),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 135/165 (82%), Gaps = 10/165 (6%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESF----LFGE--NL  163
            L+MHVSMM+LGYAALLCGSLLSVALLVITFRK  ++F   N+FL ES        E  N+
Sbjct  136  LMMHVSMMVLGYAALLCGSLLSVALLVITFRKVIRIFGKSNNFLNESVSEIQYMNERNNV  195

Query  164  FQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPK  343
               TSF S+KNYYR Q +QQLD WSYR+ISLGF+FLTIGILSGAVWANEAWGSYW+WDPK
Sbjct  196  LLNTSFRSSKNYYRYQLVQQLDQWSYRIISLGFIFLTIGILSGAVWANEAWGSYWNWDPK  255

Query  344  ETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            ETWAFITW +FAI+LHTRTN NL+ VNS    SIVAS+GFLIIWI
Sbjct  256  ETWAFITWTIFAIYLHTRTNKNLEGVNS----SIVASMGFLIIWI  296



>gb|ADZ36407.1| c-type cytochrome synthesis protein [Actinidia kolomikta]
Length=310

 Score =   199 bits (507),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 129/159 (81%), Gaps = 7/159 (4%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGENLFQKTSF  181
            LIMHVSMM+LGYAAL+CGSLLSVALLVITFRK+ K+F   N    E F    N F  T F
Sbjct  136  LIMHVSMMVLGYAALICGSLLSVALLVITFRKDIKIFYKNNHLGNEYF---SNTFGNTYF  192

Query  182  FSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWDPKETWAFI  361
            FSAKNYY++Q IQQLD WSYRVIS+GF+FLTIGILSGAVWANEAWGSYW+WDPKE WAFI
Sbjct  193  FSAKNYYKSQSIQQLDHWSYRVISIGFIFLTIGILSGAVWANEAWGSYWNWDPKEIWAFI  252

Query  362  TWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            TW VFAI+LHTRTN  L   NSA    IVASIGFLIIWI
Sbjct  253  TWTVFAIYLHTRTNTKLPPANSA----IVASIGFLIIWI  287



>ref|NP_084751.1| cytochrome c biogenesis protein [Oenothera elata subsp. hookeri]
 ref|YP_001687415.1| cytochrome c biogenesis protein (chloroplast) [Oenothera biennis]
 sp|Q9MTI2.1|CCSA_OENEH RecName: Full=Cytochrome c biogenesis protein CcsA (chloroplast) 
[Oenothera elata subsp. hookeri]
 sp|B0Z508.1|CCSA_OENBI RecName: Full=Cytochrome c biogenesis protein CcsA (chloroplast) 
[Oenothera biennis]
 emb|CAB67219.1| cytochrome c biogenesis protein (chloroplast) [Oenothera elata 
subsp. hookeri]
 gb|ABW98920.1| cytochrome c biogenesis protein (chloroplast) [Oenothera biennis]
Length=319

 Score =   200 bits (508),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 134/167 (80%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+LGYAALLCGSLLSVALLVITFRK  ++FS    FL +SF F E        
Sbjct  136  LMMHVSMMVLGYAALLCGSLLSVALLVITFRKALRIFSKKKAFLKDSFSFVEIQYRNEPS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSF S+KNYYR Q IQQLD WS R+ISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLSTSFISSKNYYRAQLIQQLDRWSSRIISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN N QSVNSA    IVA +GF+IIWI
Sbjct  256  PKETWAFITWTMFAIYLHTRTNPNFQSVNSA----IVAFLGFIIIWI  298



>gb|AEX58502.1| cytochrome c heme attachment protein (chloroplast) [Theobroma 
grandiflorum]
Length=321

 Score =   200 bits (508),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 132/167 (79%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+LGYAALLCGSLLSVALLVITFRK  K+    N+ L +SF FGE        
Sbjct  136  LMMHVSMMVLGYAALLCGSLLSVALLVITFRKVIKIIGKNNNLLNQSFSFGEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   T F S+KNYYR Q  QQLD WSYR+ISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLNTYFLSSKNYYRYQLTQQLDRWSYRIISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW VFAI+LH RTN N + VNSA    IVAS+GFLIIWI
Sbjct  256  PKETWAFITWTVFAIYLHIRTNTNFEGVNSA----IVASMGFLIIWI  298



>ref|YP_001687331.1| cytochrome c biogenesis protein (chloroplast) [Oenothera glazioviana]
 sp|B0Z592.1|CCSA_OENGL RecName: Full=Cytochrome c biogenesis protein CcsA (chloroplast) 
[Oenothera glazioviana]
 gb|ABX10085.1| cytochrome c biogenesis protein (chloroplast) [Oenothera glazioviana]
Length=319

 Score =   200 bits (508),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 134/167 (80%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+LGYAALLCGSLLSVALLVITFRK  ++FS    FL +SF F E        
Sbjct  136  LMMHVSMMVLGYAALLCGSLLSVALLVITFRKALRIFSKKKAFLKDSFSFVEIQYRNEPS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   TSF S+KNYYR Q IQQLD WS R+ISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLSTSFISSKNYYRAQLIQQLDRWSSRIISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN N QSVNSA    IVA +GF+IIWI
Sbjct  256  PKETWAFITWTMFAIYLHTRTNPNFQSVNSA----IVAFLGFIIIWI  298



>gb|ADX99013.1| cytochrome c heme attachment protein [Phyla lanceolata]
Length=294

 Score =   199 bits (505),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 127/158 (80%), Gaps = 10/158 (6%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLT--ESFLFGE------  157
            LIMHVSMMILGYAALLCGSLLSV+LLVIT RK    F+  N  +   ESF FGE      
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVSLLVITVRKKKNFFATSNRVVNFNESFFFGEMEYMNH  195

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
                FQ TSFFS KNYYR+Q IQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYWS
Sbjct  196  RSTGFQNTSFFSPKNYYRSQLIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWS  255

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASI  445
            WDPKETWAFITWIVFAI+LHTRTN   +  NSAIVASI
Sbjct  256  WDPKETWAFITWIVFAIYLHTRTNRKWKGTNSAIVASI  293



>gb|AEX57773.1| cytochrome c heme attachment protein (chloroplast) [Theobroma 
cacao]
 gb|AEX57935.1| cytochrome c heme attachment protein (chloroplast) [Theobroma 
cacao]
 gb|AEX58178.1| cytochrome c heme attachment protein (chloroplast) [Theobroma 
cacao]
 gb|AEX58259.1| cytochrome c heme attachment protein (chloroplast) [Theobroma 
cacao]
 gb|AEX58340.1| cytochrome c heme attachment protein (chloroplast) [Theobroma 
cacao]
 gb|AEX58421.1| cytochrome c heme attachment protein (chloroplast) [Theobroma 
cacao]
Length=321

 Score =   199 bits (507),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 132/167 (79%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+LGYAALLCGSLLSVALLVITFRK  K+    N+ L +SF FGE        
Sbjct  136  LMMHVSMMVLGYAALLCGSLLSVALLVITFRKVIKIIGKNNNLLNQSFSFGEIQYMNERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   T F S+KNYYR Q  QQLD WSYR+ISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVLLNTYFLSSKNYYRYQLTQQLDRWSYRIISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW VFAI+LH RTN N + VNSA    IVAS+GFLIIWI
Sbjct  256  PKETWAFITWTVFAIYLHIRTNKNFEGVNSA----IVASMGFLIIWI  298



>ref|YP_319812.1| cytochrome c biogenesis protein [Acorus calamus]
 ref|YP_001586230.1| cytochrome c biogenesis protein [Acorus americanus]
 sp|Q3V4Y5.1|CCSA_ACOCL RecName: Full=Cytochrome c biogenesis protein CcsA (chloroplast) 
[Acorus calamus]
 sp|A9LYE9.1|CCSA_ACOAM RecName: Full=Cytochrome c biogenesis protein CcsA (chloroplast) 
[Acorus americanus]
 emb|CAI53843.1| ccsA [Acorus calamus]
 gb|ABX38792.1| cytochrome c heme attachment protein [Acorus americanus]
Length=321

 Score =   199 bits (507),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 133/167 (80%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+L YAALLCGSLLSVALLVITFRKN  +F   N+FL  SF FGE        
Sbjct  136  LMMHVSMMLLSYAALLCGSLLSVALLVITFRKNSDIFDKRNNFLIRSFFFGEIEYLNEKR  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            ++ Q TSF S  NY++ Q  Q+LDFWSYRVISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  SVLQNTSFDSFTNYHKYQLTQRLDFWSYRVISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKE WAFITW +FAI+LHTRTN +LQ  NSA    IVASIGFLIIWI
Sbjct  256  PKEIWAFITWAIFAIYLHTRTNHSLQGANSA----IVASIGFLIIWI  298



>gb|AAZ03811.1| cytochrome c biogenesis protein [Acorus americanus]
Length=316

 Score =   199 bits (506),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 133/167 (80%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+L YAALLCGSLLSVALLVITFRKN  +F   N+FL  SF FGE        
Sbjct  136  LMMHVSMMLLSYAALLCGSLLSVALLVITFRKNSDIFDKRNNFLIRSFFFGEIEYLNEKR  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            ++ Q TSF S  NY++ Q  Q+LDFWSYRVISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  SVLQNTSFDSFTNYHKYQLTQRLDFWSYRVISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKE WAFITW +FAI+LHTRTN +LQ  NSA    IVASIGFLIIWI
Sbjct  256  PKEIWAFITWAIFAIYLHTRTNHSLQGANSA----IVASIGFLIIWI  298



>gb|AGR66232.1| c-type cytochrome synthesis protein (chloroplast) [Apterosperma 
oblata]
Length=321

 Score =   199 bits (506),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 129/167 (77%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMM+LGYAALLCGSLLSVALLVITFRK+  +F   N    ESF FGE        
Sbjct  136  LIMHVSMMVLGYAALLCGSLLSVALLVITFRKDINIFYKSNHLFNESFSFGEFQYINERS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+F  TSFFS KNYYR Q IQQLD WSYRVIS+GF+ LTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVFGNTSFFSTKNYYRFQLIQQLDHWSYRVISIGFISLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKE WAFITW +FAI+LHTRTN      NSA    IVAS GFLIIWI
Sbjct  256  PKEIWAFITWTIFAIYLHTRTNKKFPPANSA----IVASTGFLIIWI  298



>ref|YP_009024840.1| cytochrome c heme attachment protein (chloroplast) [Trigonobalanus 
doichangensis]
 gb|AHN16172.1| cytochrome c heme attachment protein (chloroplast) [Trigonobalanus 
doichangensis]
Length=318

 Score =   199 bits (506),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 134/167 (80%), Gaps = 15/167 (9%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+LGYAALLCGSLLSVAL+VITFRK  + F   N+   ESF FGE        
Sbjct  136  LMMHVSMMVLGYAALLCGSLLSVALIVITFRKIIRTFDKSNN---ESFSFGEIQYINERN  192

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   T F S+KNYYR+Q IQQLD WSYR+ISLGF+FLT+GILSGAVWANEAWGSYW+WD
Sbjct  193  NILWNTPFISSKNYYRSQLIQQLDHWSYRIISLGFIFLTMGILSGAVWANEAWGSYWNWD  252

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LH RTN NL+ VNSA    IVAS+GFLIIWI
Sbjct  253  PKETWAFITWTIFAIYLHIRTNPNLEGVNSA----IVASLGFLIIWI  295



>ref|YP_007475668.1| cytochrome c heme attachment protein [Heliconia collinsiana]
 gb|AGE92733.1| cytochrome c heme attachment protein [Heliconia collinsiana]
Length=323

 Score =   199 bits (506),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 135/169 (80%), Gaps = 14/169 (8%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSG--GNDFLTESFLFGE------  157
            L+MHVSMM+L YAALLCGSLLSVALLVITFRKN  +F    G +FL +SF FGE      
Sbjct  136  LMMHVSMMLLSYAALLCGSLLSVALLVITFRKNIDIFCKDKGKNFLIKSFFFGEIKYLNE  195

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              + F+KTSF S +NYY+ Q  Q+LD+WSYRVISLGF FLTIGIL GAVWANEAWGSYW+
Sbjct  196  KRSFFKKTSFLSFRNYYKYQLTQRLDYWSYRVISLGFTFLTIGILCGAVWANEAWGSYWN  255

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            WDPKETWAFITW +FAI+LHTRTN +LQ  NSA    +VASIGFLIIWI
Sbjct  256  WDPKETWAFITWTIFAIYLHTRTNQSLQGTNSA----LVASIGFLIIWI  300



>ref|YP_004021197.1| cytochrome c heme attachment protein [Castanea mollissima]
 gb|ADO65107.1| cytochrome c heme attachment protein [Castanea mollissima]
Length=318

 Score =   199 bits (506),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 134/167 (80%), Gaps = 15/167 (9%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+LGYAALLCGSLLSVAL+VITFRK  + F   N+   ESF FGE        
Sbjct  136  LMMHVSMMVLGYAALLCGSLLSVALIVITFRKIIRTFDKSNN---ESFSFGEIQYINERN  192

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+   T F S+KNYYR+Q IQQLD WSYR+ISLGF+FLT+GILSGAVWANEAWGSYW+WD
Sbjct  193  NVLWNTPFISSKNYYRSQLIQQLDHWSYRIISLGFIFLTMGILSGAVWANEAWGSYWNWD  252

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LH RTN NL+ VNSA    IVAS+GFLIIWI
Sbjct  253  PKETWAFITWTIFAIYLHIRTNPNLEGVNSA----IVASLGFLIIWI  295



>gb|AEX96155.1| cytochrome c heme attachment protein (chloroplast) [Triteleia 
hyacinthina]
Length=319

 Score =   199 bits (506),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 134/167 (80%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+L YAALLCGSLLSVA LVITFRKN  +F     FL +SFLFG+        
Sbjct  136  LMMHVSMMLLSYAALLCGSLLSVAFLVITFRKNINVFCKRKIFLIKSFLFGKIEYLKEKK  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            +LF+ TSF S +NYY+ Q  Q+LD+WSYRVISLGF FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  SLFKHTSFLSFQNYYKYQLTQRLDYWSYRVISLGFTFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN +LQ  NSA    +VASIGFLIIWI
Sbjct  256  PKETWAFITWTIFAIYLHTRTNQSLQGANSA----LVASIGFLIIWI  298



>gb|AGV55576.1| cytochrome c biogenesis protein (chloroplast) [Arbutus unedo]
 gb|AGV55577.1| cytochrome c biogenesis protein (chloroplast) [Arbutus unedo]
Length=320

 Score =   199 bits (506),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 134/167 (80%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMM+L YAALLCGSLLSVALLVITFRK+ K+F   N  + ESF F E        
Sbjct  135  LIMHVSMMVLSYAALLCGSLLSVALLVITFRKDIKIFYKSNRLVNESFSFDEIQYMNERS  194

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+F  TSFFSAKNYYR+Q IQQLD WSYRVIS+GF+FL+IG+LSGAVWANEAWGSYW+WD
Sbjct  195  NVFGNTSFFSAKNYYRSQLIQQLDHWSYRVISIGFIFLSIGLLSGAVWANEAWGSYWNWD  254

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKE+WAFITW VFAI+LH+RTN      +SA    IVASIGF+IIWI
Sbjct  255  PKESWAFITWTVFAIYLHSRTNTKGLPAHSA----IVASIGFIIIWI  297



>ref|YP_398377.1| cytochrome c biogenesis protein [Lactuca sativa]
 sp|Q332S8.1|CCSA_LACSA RecName: Full=Cytochrome c biogenesis protein CcsA (chloroplast) 
[Lactuca sativa]
 dbj|BAE47644.1| cytochrome c biogenesis protein [Lactuca sativa]
 gb|ABD47289.1| cytochrome c heme attachment protein (chloroplast) [Lactuca sativa]
Length=322

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 132/168 (79%), Gaps = 13/168 (8%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDF-LTESFLFGE-------  157
            LIMHVSMMIL YAALLCGSLLSVALLVITFRK    +   N   L ESF FGE       
Sbjct  136  LIMHVSMMILSYAALLCGSLLSVALLVITFRKIFYSYKSNNFLKLNESFSFGEIQYKNER  195

Query  158  -NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSW  334
             N+ +K  F SAKNYY+ Q IQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYWSW
Sbjct  196  NNILKKNYFLSAKNYYKAQLIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWSW  255

Query  335  DPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            DPKETWAFITWIVFAI+LH RTN N Q  NSA    IVA++GFLIIWI
Sbjct  256  DPKETWAFITWIVFAIYLHIRTNKNFQGANSA----IVATLGFLIIWI  299



>ref|YP_008964082.1| cytochrome c biogenesis protein [Ajuga reptans]
 gb|AHA84885.1| cytochrome c biogenesis protein [Ajuga reptans]
Length=323

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 130/169 (77%), Gaps = 14/169 (8%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLT--ESFLFGE------  157
            LIMHVSMMILGYAALLCGSLLSV+LLVI  RK    FS  N  L   ESF  GE      
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVSLLVIAVRKKRSFFSTSNHLLNFNESFFLGEIEYMNE  195

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
               + +KTSFF  +NYYR   IQQLD+WSYRVISLGF+FLT+GILSGAVWANEAWGSYWS
Sbjct  196  QRTVLKKTSFFPTRNYYRLHLIQQLDYWSYRVISLGFIFLTVGILSGAVWANEAWGSYWS  255

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            WDPKETWAFITW++FAI+LHTRTN+     +SA    IVASIGFLIIWI
Sbjct  256  WDPKETWAFITWVIFAIYLHTRTNIKFNYSDSA----IVASIGFLIIWI  300



>gb|AEZ01478.1| cytochrome c heme attachment protein (chloroplast) [Japonolirion 
osense]
 gb|AHH24281.1| CcsA (chloroplast) [Japonolirion osense]
Length=323

 Score =   198 bits (504),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 136/169 (80%), Gaps = 14/169 (8%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLF--SGGNDFLTESFLFGE------  157
            L+MHVSMM+L YAALLCGSLLSVALLVITFRKN  +F  S  N FL +SFLFGE      
Sbjct  136  LMMHVSMMLLSYAALLCGSLLSVALLVITFRKNIDIFCKSKSNHFLIKSFLFGEIEYFNE  195

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              ++F+ TSF S +NYY+ Q  Q+LD+WSYRVISLGF FLTIGILSGAVWANEAWGSYW+
Sbjct  196  KRSVFKNTSFLSFRNYYKYQLAQRLDYWSYRVISLGFTFLTIGILSGAVWANEAWGSYWN  255

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            WDPKETWAFITW +FAI+ HTRTN +LQ  NSA    +VASIGFLIIWI
Sbjct  256  WDPKETWAFITWTIFAIYSHTRTNPSLQGTNSA----LVASIGFLIIWI  300



>ref|YP_004935716.1| ccsA gene product (chloroplast) [Sesamum indicum]
 gb|AEO92756.1| cytochrome c biogenesis protein (chloroplast) [Sesamum indicum]
 gb|AGL45385.1| CcsA (chloroplast) [Sesamum indicum]
Length=325

 Score =   198 bits (504),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 135/171 (79%), Gaps = 16/171 (9%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLT--ESFLFGE------  157
            LIMHVSMMILGYAALLCGSLLSV+LLVIT RK  + FS     L   ESF FG+      
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVSLLVITVRKKRRFFSTSYGLLNFNESFFFGKIEYMNE  195

Query  158  --NLFQKTSFFSA--KNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSY  325
              N+ + TSFF+   KNYYR+Q IQQLD+WSYRVISLGF+FLTIGILSGAVWANEAWGSY
Sbjct  196  RSNVLENTSFFAPNPKNYYRSQLIQQLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSY  255

Query  326  WSWDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            WSWDPKETWAFITWIVFAI+LH RTN+  +  NSA    IVASIGFLIIWI
Sbjct  256  WSWDPKETWAFITWIVFAIYLHIRTNIKWEGRNSA----IVASIGFLIIWI  302



>ref|YP_009059568.1| cytochrome c heme attachment protein [Iris gatesii]
 gb|AIN79027.1| cytochrome c heme attachment protein [Iris gatesii]
Length=321

 Score =   198 bits (503),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 132/167 (79%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+L YA+LLCGSLLSVA LVITFRKN  +F   N+FL +SF FGE        
Sbjct  136  LMMHVSMMLLSYASLLCGSLLSVAFLVITFRKNIDIFCKSNNFLIKSFFFGEIHYLNEKR  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+F+  SF S +NYY+ Q  Q+LD+WSYRVISLGF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  NVFKDASFLSFRNYYKYQLTQRLDYWSYRVISLGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+ HTRTN + Q  NSA    +VASIGF IIWI
Sbjct  256  PKETWAFITWTIFAIYSHTRTNQSFQGTNSA----LVASIGFFIIWI  298



>gb|ADZ36416.1| c-type cytochrome synthesis protein [Cyrilla racemiflora]
Length=321

 Score =   198 bits (503),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 130/167 (78%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            LIMHVSMM+LGY ALLCGSLLSVALLVITFRK+ K+F   N  + ESF F +        
Sbjct  136  LIMHVSMMVLGYVALLCGSLLSVALLVITFRKDIKIFYKSNRLVNESFSFDKIQYINEKS  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            + F  T FFSA NYY +Q IQQLD WSYRVIS+GF+FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  DGFGNTYFFSANNYYSSQLIQQLDHWSYRVISIGFIFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKE WAFITW VFAI+LHTRTN  L   NSA    IVASIGFLIIWI
Sbjct  256  PKEIWAFITWTVFAIYLHTRTNTKLPPANSA----IVASIGFLIIWI  298



>gb|AEX96150.1| cytochrome c heme attachment protein (chloroplast) [Androstephium 
coeruleum]
Length=317

 Score =   198 bits (503),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 134/167 (80%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+L YAALLCGSLLSVA LVITFRKN  +F     FL +SFLFG+        
Sbjct  134  LMMHVSMMLLSYAALLCGSLLSVAFLVITFRKNIDIFYKSKIFLIKSFLFGKIEYLKEKK  193

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            ++F+ TSF S +NYY+ Q  Q+LD+WSYRVISLGF FLTIGILSGAVWANEAWGSYW+WD
Sbjct  194  SVFKHTSFLSFRNYYKYQLTQRLDYWSYRVISLGFTFLTIGILSGAVWANEAWGSYWNWD  253

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN +LQ  NSA    +VASIGFLIIWI
Sbjct  254  PKETWAFITWTIFAIYLHTRTNQSLQGANSA----LVASIGFLIIWI  296



>gb|AEZ48945.1| cytochrome c heme attachment protein [Albuca kirkii]
Length=321

 Score =   198 bits (503),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 133/167 (80%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+L YAALLCGSLLSVA LVITFRKN  +F     FL +SFLFG+        
Sbjct  136  LMMHVSMMLLSYAALLCGSLLSVAFLVITFRKNIDIFCKSKIFLIKSFLFGKIEYLNEKK  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            ++F+ TSF S +NYY+ Q  Q+LD+WSYRVISLGF FLTIGILSGAVWANEAWGSYW+WD
Sbjct  196  SVFKHTSFLSFRNYYKYQLAQRLDYWSYRVISLGFTFLTIGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LHTRTN +LQ  NSA     VASIGFLIIWI
Sbjct  256  PKETWAFITWTIFAIYLHTRTNQSLQGTNSA----FVASIGFLIIWI  298



>gb|ADX99035.1| cytochrome c heme attachment protein [Tamonea boxiana]
Length=294

 Score =   197 bits (501),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 127/158 (80%), Gaps = 10/158 (6%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDF--LTESFLFGE------  157
            LIMHVSMMILGYAALLCGSLLSV+LLV+T RK  K FS  N    L +S  FGE      
Sbjct  136  LIMHVSMMILGYAALLCGSLLSVSLLVVTVRKKRKFFSTSNHLVNLNKSLFFGEIEYMNE  195

Query  158  --NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWS  331
              N+ Q  SFFS KNYYR+Q IQQLD+WSYRVISLGFLFLTIGILSGAVWA+EAWGSYWS
Sbjct  196  RSNVLQNPSFFSPKNYYRSQLIQQLDYWSYRVISLGFLFLTIGILSGAVWADEAWGSYWS  255

Query  332  WDPKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASI  445
            WDPKETWAFITWIVFAI+LHTRTN   +  NSAIVASI
Sbjct  256  WDPKETWAFITWIVFAIYLHTRTNRKWKGTNSAIVASI  293



>gb|AFQ39590.1| cytochrome c heme attachment protein [Fragaria vesca subsp. vesca]
Length=310

 Score =   197 bits (502),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 134/167 (80%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+LGYAALLCGSLLS+ALLVITFRK  ++FS  N+ LT+SF FGE        
Sbjct  125  LMMHVSMMVLGYAALLCGSLLSLALLVITFRKFIRIFSKSNNLLTQSFSFGEIQYVNERN  184

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N  Q TS  S++NYYR Q IQQLD WSYR+ISLGF+ LTIGILSGAVWANEAWGSYW+WD
Sbjct  185  NALQSTSLISSQNYYRYQLIQQLDRWSYRIISLGFILLTIGILSGAVWANEAWGSYWNWD  244

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
              ETWAFITW VFAI+LH RTN N ++VNSA    IVAS+GFLIIWI
Sbjct  245  XXETWAFITWTVFAIYLHIRTNKNYETVNSA----IVASMGFLIIWI  287



>ref|YP_005296148.1| ccsA gene product (chloroplast) [Pentactina rupicola]
 gb|AEX31779.1| cytochrome c biogenesis/heme attachment protein (chloroplast) 
[Pentactina rupicola]
Length=321

 Score =   198 bits (503),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 134/167 (80%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+L YAALLCGSLLS+ALLVITFRK  ++FS  N  + +SF FGE        
Sbjct  136  LMMHVSMMVLSYAALLCGSLLSLALLVITFRKFLRIFSKSNTLVNQSFYFGEIQYVNDRN  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ + TS  S++NYY  Q IQQLD WSYR+ISLGF+ LT+GILSGAVWANEAWGSYW+WD
Sbjct  196  NVLRNTSVISSQNYYGYQLIQQLDRWSYRIISLGFILLTVGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW VFAI+LH RTN NL+SVNSA    IVAS+GFLIIWI
Sbjct  256  PKETWAFITWTVFAIYLHIRTNKNLESVNSA----IVASMGFLIIWI  298



>ref|YP_004842286.1| cytochrome c heme attachment protein [Pyrus pyrifolia]
 ref|YP_008965541.1| cytochrome c heme attachment protein [Pyrus spinosa]
 dbj|BAK69431.1| cytochrome c heme attachment protein [Pyrus pyrifolia]
 emb|CDI73613.1| cytochrome c heme attachment protein [Pyrus spinosa]
Length=321

 Score =   198 bits (503),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 133/167 (80%), Gaps = 12/167 (7%)
 Frame = +2

Query  2    LIMHVSMMILGYaallcgsllsvallvITFRKNGKLFSGGNDFLTESFLFGE--------  157
            L+MHVSMM+L YAALLCGSLLS+ALLVITFRK  ++FS  N+   ES  F E        
Sbjct  136  LMMHVSMMVLSYAALLCGSLLSLALLVITFRKFIRIFSKSNNLENESVYFSEIQYVNERN  195

Query  158  NLFQKTSFFSAKNYYRTQFIQQLDFWSYRVISLGFLFLTIGILSGAVWANEAWGSYWSWD  337
            N+ + TSF S++NYYR Q IQQLD WSYR+ISLGF+ LT+GILSGAVWANEAWGSYW+WD
Sbjct  196  NVLRNTSFISSQNYYRYQLIQQLDRWSYRIISLGFILLTVGILSGAVWANEAWGSYWNWD  255

Query  338  PKETWAFITWIVFAIFLHTRTNLNLQSVNSAIVASIVASIGFLIIWI  478
            PKETWAFITW +FAI+LH RTN N +SVNSA    IVAS+GFLIIWI
Sbjct  256  PKETWAFITWTIFAIYLHIRTNKNFESVNSA----IVASMGFLIIWI  298



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519922816592