BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79860_g1_i1 len=795 path=[1:0-794]

Length=795
                                                                      Score     E

ref|XP_009618462.1|  PREDICTED: uncharacterized protein LOC104110640    214   7e-66   
ref|XP_009757265.1|  PREDICTED: uncharacterized protein LOC104210145    212   5e-65   
emb|CDP12275.1|  unnamed protein product                                206   2e-62   
ref|XP_003635591.1|  PREDICTED: uncharacterized protein LOC100854331    204   7e-62   
ref|XP_011071692.1|  PREDICTED: uncharacterized protein LOC105157094    204   7e-62   
ref|XP_006354995.1|  PREDICTED: uncharacterized protein LOC102584...    200   2e-60   
ref|XP_006354996.1|  PREDICTED: uncharacterized protein LOC102584...    200   3e-60   
ref|XP_010314185.1|  PREDICTED: uncharacterized protein LOC101254...    199   8e-60   
ref|XP_010257998.1|  PREDICTED: uncharacterized protein LOC104597911    197   4e-59   
ref|XP_004138173.1|  PREDICTED: uncharacterized protein LOC101223170    197   6e-59   
ref|XP_008453213.1|  PREDICTED: uncharacterized protein LOC103494001    196   1e-58   
ref|XP_004252225.1|  PREDICTED: uncharacterized protein LOC101254...    194   3e-58   
ref|XP_008239924.1|  PREDICTED: uncharacterized protein LOC103338491    195   5e-58   
ref|XP_002514738.1|  conserved hypothetical protein                     194   5e-58   Ricinus communis
ref|XP_008393172.1|  PREDICTED: uncharacterized protein LOC103455365    194   7e-58   
gb|EYU24358.1|  hypothetical protein MIMGU_mgv1a014456mg                194   1e-57   
ref|XP_010678485.1|  PREDICTED: uncharacterized protein LOC104894025    191   8e-57   
gb|KDP31270.1|  hypothetical protein JCGZ_11646                         191   1e-56   
ref|XP_004299342.1|  PREDICTED: uncharacterized protein LOC101299765    191   2e-56   
ref|XP_009339018.1|  PREDICTED: uncharacterized protein LOC103931297    191   2e-56   
ref|XP_007209644.1|  hypothetical protein PRUPE_ppa011948mg             190   4e-56   
ref|XP_008374560.1|  PREDICTED: uncharacterized protein LOC103437832    187   3e-55   
ref|XP_011014023.1|  PREDICTED: uncharacterized protein LOC105117914    183   1e-53   
ref|XP_002317978.2|  hypothetical protein POPTR_0012s07040g             181   8e-53   Populus trichocarpa [western balsam poplar]
ref|XP_004514960.1|  PREDICTED: uncharacterized protein LOC101502854    177   3e-51   
gb|KHG10650.1|  Hydroxyacylglutathione hydrolase                        177   3e-51   
ref|XP_009339040.1|  PREDICTED: uncharacterized protein LOC103931316    177   5e-51   
ref|XP_010037178.1|  PREDICTED: uncharacterized protein LOC104425984    175   9e-51   
emb|CAN77176.1|  hypothetical protein VITISV_038217                     176   1e-50   Vitis vinifera
ref|XP_009410046.1|  PREDICTED: uncharacterized protein LOC103992165    172   2e-49   
ref|XP_010093598.1|  hypothetical protein L484_006486                   172   2e-49   
ref|XP_007037396.1|  NDH dependent flow 6 isoform 1                     172   3e-49   
gb|KCW48850.1|  hypothetical protein EUGRSUZ_K02485                     171   2e-48   
gb|KCW48851.1|  hypothetical protein EUGRSUZ_K02485                     169   4e-48   
gb|KCW48856.1|  hypothetical protein EUGRSUZ_K02487                     167   4e-48   
ref|XP_007138171.1|  hypothetical protein PHAVU_009G186200g             169   6e-48   
gb|AFK40335.1|  unknown                                                 168   1e-47   
gb|ACJ86002.1|  unknown                                                 168   1e-47   Medicago truncatula
gb|AFK38809.1|  unknown                                                 165   1e-46   
ref|XP_003523013.1|  PREDICTED: uncharacterized protein LOC100801331    164   2e-46   
ref|XP_006827302.1|  hypothetical protein AMTR_s00010p00265920          164   3e-46   
ref|XP_010532212.1|  PREDICTED: uncharacterized protein LOC104808...    163   4e-46   
ref|XP_010532211.1|  PREDICTED: uncharacterized protein LOC104808...    163   4e-46   
ref|XP_010532210.1|  PREDICTED: uncharacterized protein LOC104808...    163   5e-46   
gb|ACU23914.1|  unknown                                                 163   8e-46   Glycine max [soybeans]
gb|KHN01878.1|  hypothetical protein glysoja_038973                     163   9e-46   
gb|KHN26257.1|  hypothetical protein glysoja_032827                     163   1e-45   
ref|XP_003527090.1|  PREDICTED: uncharacterized protein LOC100800656    162   1e-45   
ref|XP_010937192.1|  PREDICTED: uncharacterized protein LOC105056629    161   5e-45   
ref|XP_010477072.1|  PREDICTED: uncharacterized protein LOC104756220    158   7e-44   
ref|NP_173308.2|  NDH dependent flow 6 protein                          157   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006477472.1|  PREDICTED: uncharacterized protein LOC102607245    157   1e-43   
ref|NP_001117306.1|  NDH dependent flow 6 protein                       157   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305702.1|  hypothetical protein CARUB_v10010440mg             156   2e-43   
ref|XP_002890298.1|  hypothetical protein ARALYDRAFT_472098             156   3e-43   
emb|CDY64872.1|  BnaC05g50170D                                          156   3e-43   
gb|KFK44026.1|  hypothetical protein AALP_AA1G205800                    155   6e-43   
ref|XP_010498284.1|  PREDICTED: uncharacterized protein LOC104775994    155   6e-43   
ref|XP_010459515.1|  PREDICTED: uncharacterized protein LOC104740...    154   1e-42   
ref|XP_009149360.1|  PREDICTED: uncharacterized protein LOC103872680    154   2e-42   
ref|XP_006416571.1|  hypothetical protein EUTSA_v10008902mg             151   2e-41   
ref|XP_009117591.1|  PREDICTED: uncharacterized protein LOC103842...    152   3e-41   
ref|XP_008783642.1|  PREDICTED: uncharacterized protein LOC103702836    151   3e-41   
ref|XP_010459516.1|  PREDICTED: uncharacterized protein LOC104740...    150   4e-41   
emb|CDY66602.1|  BnaAnng22540D                                          150   7e-41   
ref|XP_009117595.1|  PREDICTED: uncharacterized protein LOC103842...    150   8e-41   
emb|CDY58996.1|  BnaC08g49490D                                          149   8e-41   
ref|XP_009117594.1|  PREDICTED: uncharacterized protein LOC103842...    150   2e-40   
ref|XP_009117596.1|  PREDICTED: uncharacterized protein LOC103842...    150   2e-40   
dbj|BAJ84825.1|  predicted protein                                      146   2e-39   
ref|XP_009117593.1|  PREDICTED: uncharacterized protein LOC103842...    147   2e-39   
ref|NP_001143837.1|  uncharacterized protein LOC100276619               144   9e-39   Zea mays [maize]
gb|AFW73389.1|  hypothetical protein ZEAMMB73_467288                    144   1e-38   
gb|KCW48854.1|  hypothetical protein EUGRSUZ_K02487                     142   4e-38   
gb|AAF27106.1|AC011809_15  Unknown protein                              140   8e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010236123.1|  PREDICTED: uncharacterized protein LOC100837...    142   8e-38   
gb|EEC73996.1|  hypothetical protein OsI_08911                          141   2e-37   Oryza sativa Indica Group [Indian rice]
ref|XP_003570664.1|  PREDICTED: uncharacterized protein LOC100837...    140   4e-37   
ref|NP_001048099.1|  Os02g0744000                                       140   5e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002454291.1|  hypothetical protein SORBIDRAFT_04g028110          139   9e-37   Sorghum bicolor [broomcorn]
ref|NP_001077559.2|  NDH dependent flow 6 protein                       137   2e-36   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001117307.1|  NDH dependent flow 6 protein                       137   3e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004953875.1|  PREDICTED: uncharacterized protein LOC101752...    139   3e-36   
ref|XP_006647878.1|  PREDICTED: uncharacterized protein LOC102721335    136   2e-35   
ref|XP_004953876.1|  PREDICTED: uncharacterized protein LOC101752...    136   2e-35   
gb|KDO55534.1|  hypothetical protein CISIN_1g0309741mg                  133   3e-35   
ref|XP_002447940.1|  hypothetical protein SORBIDRAFT_06g018500          134   1e-34   Sorghum bicolor [broomcorn]
ref|XP_006416572.1|  hypothetical protein EUTSA_v10008902mg             132   2e-34   
gb|ACG44895.1|  hypothetical protein                                    127   5e-33   Zea mays [maize]
ref|XP_006440620.1|  hypothetical protein CICLE_v10022880mg             119   6e-30   
ref|XP_006440621.1|  hypothetical protein CICLE_v10022880mg             116   1e-28   
gb|EMT12134.1|  hypothetical protein F775_30843                         105   6e-24   
ref|XP_007037397.1|  NDH dependent flow 6 isoform 2                     102   3e-23   
gb|AFW73390.1|  hypothetical protein ZEAMMB73_467288                  93.6    5e-20   
gb|EMS58957.1|  hypothetical protein TRIUR3_28502                     84.0    7e-17   
emb|CCI55390.1|  NDH subunit PnsB4                                    84.7    3e-16   
ref|XP_001770631.1|  predicted protein                                63.2    2e-09   
ref|XP_008681641.1|  PREDICTED: uncharacterized protein LOC100276...  55.1    6e-06   



>ref|XP_009618462.1| PREDICTED: uncharacterized protein LOC104110640 [Nicotiana tomentosiformis]
Length=183

 Score =   214 bits (546),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 135/169 (80%), Gaps = 5/169 (3%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRI--HNPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKSRRGCRT  575
            MAEAVMSFTIIKP +  H   L       K L QC +SAF     +QI+ G KS+R    
Sbjct  1    MAEAVMSFTIIKPTVQCHATKLDL-HPFTKSLRQCSSSAFGK-GRHQIQAG-KSKRNSGL  57

Query  574  RVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTK  395
            RV A P   LMAV+VEH++GQRDL+THKSVWHLSD A+KNVY+FYIMFT+WGCCFFGSTK
Sbjct  58   RVKALPDWPLMAVLVEHMEGQRDLITHKSVWHLSDEAMKNVYTFYIMFTVWGCCFFGSTK  117

Query  394  DPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            DPYYDSEQYRGDGGDGTGHW+Y+KQEDIEE +RA+LWREELIEEIEQKV
Sbjct  118  DPYYDSEQYRGDGGDGTGHWVYEKQEDIEEEARAKLWREELIEEIEQKV  166



>ref|XP_009757265.1| PREDICTED: uncharacterized protein LOC104210145 [Nicotiana sylvestris]
Length=183

 Score =   212 bits (540),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 134/168 (80%), Gaps = 3/168 (2%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIH-NPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKSRRGCRTR  572
            MAEAVM FT+IKP +  + +        K L  C +SAF     +QI+ G KS+R C  R
Sbjct  1    MAEAVMRFTVIKPNVQCHATKLVLHPFTKSLRHCSSSAFGN-GRHQIQSG-KSKRNCGLR  58

Query  571  VNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKD  392
            V A P   LMAV+VEH++GQRDL+THKSVWHLSD A+KNVY+FYIMFT+WGCCFFGSTKD
Sbjct  59   VKALPDWPLMAVLVEHMEGQRDLITHKSVWHLSDEAMKNVYTFYIMFTVWGCCFFGSTKD  118

Query  391  PYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            PYYDSEQYRGDGGDGTGHW+Y+KQEDIEE +RA+LWREELIEEIEQKV
Sbjct  119  PYYDSEQYRGDGGDGTGHWVYEKQEDIEEEARAKLWREELIEEIEQKV  166



>emb|CDP12275.1| unnamed protein product [Coffea canephora]
Length=186

 Score =   206 bits (524),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 130/171 (76%), Gaps = 6/171 (4%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCP----SKLPKPLGQCLNSAFSPCSSYQIEGGGKSRRGC  581
            MAEAVMSFTI KP   + S+       +   K L  C  +     + + + GG  S+R  
Sbjct  1    MAEAVMSFTIAKPNFQSTSVQTTIVDLNPFSKSLRLCPTAGLH--NGWNLIGGINSKRAS  58

Query  580  RTRVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGS  401
              + NAFP   LMAV+VEH +GQRDL+THKS+WHLSD AIKNVY+FYIMFT WGCCFFGS
Sbjct  59   TCKANAFPDWPLMAVLVEHAEGQRDLITHKSIWHLSDQAIKNVYTFYIMFTCWGCCFFGS  118

Query  400  TKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            TKDPYYDSE+YRGDGGDGTGHW+Y+KQEDIEER+RA+LWREELIEEIEQKV
Sbjct  119  TKDPYYDSEEYRGDGGDGTGHWVYEKQEDIEERARAQLWREELIEEIEQKV  169



>ref|XP_003635591.1| PREDICTED: uncharacterized protein LOC100854331 [Vitis vinifera]
 ref|XP_003635595.1| PREDICTED: uncharacterized protein LOC100854601 [Vitis vinifera]
 emb|CBI33296.3| unnamed protein product [Vitis vinifera]
 emb|CBI38523.3| unnamed protein product [Vitis vinifera]
Length=181

 Score =   204 bits (520),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 133/172 (77%), Gaps = 8/172 (5%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPSKL-----PKPLGQCLNSAFSPCSSYQIEGGGKSRRG  584
            MAEA+M FTI+KP  HN S   P+K+      + L QC +S F+  + +      KS+R 
Sbjct  1    MAEAIMGFTIMKPNFHN-SYAQPTKMDISPCSRLLRQCSSSRFN--NGWHQTESSKSKRA  57

Query  583  CRTRVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFG  404
               RVNA P   LMAV+VEH++GQRDL+THKS+WHL+D  IKNVY+FYIMFT WGCCFFG
Sbjct  58   SLCRVNALPDWPLMAVLVEHVEGQRDLITHKSIWHLNDETIKNVYTFYIMFTCWGCCFFG  117

Query  403  STKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            STKDPYYDSEQYR DGGDGTGHW+Y+KQEDIEE +RAELWREELIEEIEQKV
Sbjct  118  STKDPYYDSEQYRKDGGDGTGHWVYEKQEDIEEAARAELWREELIEEIEQKV  169



>ref|XP_011071692.1| PREDICTED: uncharacterized protein LOC105157094 [Sesamum indicum]
Length=183

 Score =   204 bits (520),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 130/168 (77%), Gaps = 3/168 (2%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKSRRGCRT-R  572
            MAE + +FT++KP I  P+    S   K L QC +++      +QIE G KSRR  R  +
Sbjct  1    MAETITTFTLLKPSIQTPN-PLFSSFSKSLRQCSSASRVSVGRHQIEDG-KSRRASRVVK  58

Query  571  VNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKD  392
            V A P   LMAVMVEH++GQRDL+THKS+WHLSD A+KNVY+FYIMFT WGCCFFGSTKD
Sbjct  59   VKALPDWPLMAVMVEHMEGQRDLITHKSIWHLSDQAMKNVYTFYIMFTCWGCCFFGSTKD  118

Query  391  PYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            PYYDSE YR DGGDGTGHW+Y+KQEDIEE +RAEL REELIEEIEQKV
Sbjct  119  PYYDSEAYRKDGGDGTGHWVYEKQEDIEESARAELLREELIEEIEQKV  166



>ref|XP_006354995.1| PREDICTED: uncharacterized protein LOC102584759 isoform X1 [Solanum 
tuberosum]
Length=174

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 125/163 (77%), Gaps = 7/163 (4%)
 Frame = -3

Query  733  MSFTIIKPRIHNPSLHCPSKLPKPLGQCLNSAFSPCSS-YQIEGGGKSRRGCRTRVNAFP  557
            MSFT+ KP I +P+L         L  C  S F   S  +QI+      R C  RV A P
Sbjct  1    MSFTVTKPSIPSPTLELHPFTKSQLRHCSTSPFGNASRRHQIQ------RNCGIRVKALP  54

Query  556  GLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKDPYYDS  377
               LMAV+VEH++GQRDL+THKSVWHLSD A+KNVY+FYIMFT+WGCCFFGSTKDPYYDS
Sbjct  55   DWPLMAVLVEHMEGQRDLITHKSVWHLSDEAMKNVYTFYIMFTVWGCCFFGSTKDPYYDS  114

Query  376  EQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            EQYRGDGGDGTGHW+Y+KQEDIEE +RAELWR+ELIEEIEQKV
Sbjct  115  EQYRGDGGDGTGHWVYEKQEDIEEEARAELWRDELIEEIEQKV  157



>ref|XP_006354996.1| PREDICTED: uncharacterized protein LOC102584759 isoform X2 [Solanum 
tuberosum]
Length=173

 Score =   200 bits (508),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 126/163 (77%), Gaps = 8/163 (5%)
 Frame = -3

Query  733  MSFTIIKPRIHNPSLHCPSKLPKPLGQCLNSAFSPCSS-YQIEGGGKSRRGCRTRVNAFP  557
            MSFT+ KP I +P+L       K L  C  S F   S  +QI+      R C  RV A P
Sbjct  1    MSFTVTKPSIPSPTLEL-HPFTKSLRHCSTSPFGNASRRHQIQ------RNCGIRVKALP  53

Query  556  GLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKDPYYDS  377
               LMAV+VEH++GQRDL+THKSVWHLSD A+KNVY+FYIMFT+WGCCFFGSTKDPYYDS
Sbjct  54   DWPLMAVLVEHMEGQRDLITHKSVWHLSDEAMKNVYTFYIMFTVWGCCFFGSTKDPYYDS  113

Query  376  EQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            EQYRGDGGDGTGHW+Y+KQEDIEE +RAELWR+ELIEEIEQKV
Sbjct  114  EQYRGDGGDGTGHWVYEKQEDIEEEARAELWRDELIEEIEQKV  156



>ref|XP_010314185.1| PREDICTED: uncharacterized protein LOC101254767 isoform X2 [Solanum 
lycopersicum]
Length=172

 Score =   199 bits (505),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 122/162 (75%), Gaps = 7/162 (4%)
 Frame = -3

Query  733  MSFTIIKPRIHNPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKSRRGCRTRVNAFPG  554
            MSFT IKP I +P+        K L  C  S F           G+  +  R RV A P 
Sbjct  1    MSFTFIKPSIPSPTSELLHPFSKSLRHCPTSPFG-------NNAGRRHQIERNRVKALPD  53

Query  553  LQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKDPYYDSE  374
              LMAV+VEH++GQRDL+THKSVWHLSD A+KNVY+FYIMFT+WGCCFFGSTKDPYYDSE
Sbjct  54   WPLMAVLVEHMEGQRDLITHKSVWHLSDEAMKNVYTFYIMFTVWGCCFFGSTKDPYYDSE  113

Query  373  QYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            QYRGDGGDGTGHW+Y+KQEDIEE +RAELWR+ELIEEIEQKV
Sbjct  114  QYRGDGGDGTGHWVYEKQEDIEEEARAELWRDELIEEIEQKV  155



>ref|XP_010257998.1| PREDICTED: uncharacterized protein LOC104597911 [Nelumbo nucifera]
Length=186

 Score =   197 bits (501),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 129/171 (75%), Gaps = 6/171 (4%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPS----KLPKPLGQCLNSAFSPCSSYQIEGGGKSRRGC  581
            MAEA M F++ KP+IH+PS           P  L QC +S F+    +Q EG  + +RG 
Sbjct  1    MAEAFMGFSMPKPQIHSPSYQTAKFDAYPHPNSLKQCSSSRFTN-GWFQSEGS-RRKRGH  58

Query  580  RTRVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGS  401
              + NAFP   LMAVMVEH++GQRD++THKS+WHLSD  IK +Y+ YIMFT WGCCFFGS
Sbjct  59   LCKANAFPDWPLMAVMVEHMEGQRDMITHKSIWHLSDETIKTIYTIYIMFTCWGCCFFGS  118

Query  400  TKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            TKDPYYD EQYR DGGDGTGHW+Y+KQEDIEE +RAELWREELIEEIEQKV
Sbjct  119  TKDPYYDGEQYRKDGGDGTGHWVYEKQEDIEESARAELWREELIEEIEQKV  169



>ref|XP_004138173.1| PREDICTED: uncharacterized protein LOC101223170 [Cucumis sativus]
 ref|XP_004154966.1| PREDICTED: uncharacterized protein LOC101226186 [Cucumis sativus]
 gb|KGN63679.1| hypothetical protein Csa_1G009830 [Cucumis sativus]
Length=177

 Score =   197 bits (500),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 132/167 (79%), Gaps = 2/167 (1%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKSRRGCRTRV  569
            MA+A+  F+IIKP +H+ +LH  S L  P  + L+++    S  ++    K +RG  ++V
Sbjct  1    MAKAIAGFSIIKPTLHSSNLHPKSALI-PHSKLLSNS-GGFSHQELPKVVKPKRGSLSKV  58

Query  568  NAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKDP  389
            NAFP  QLMAV+V+HLDGQRDLVTHKS+ HLSDAAIKNVYS YIMFT WGC FFGS KDP
Sbjct  59   NAFPDWQLMAVLVDHLDGQRDLVTHKSIVHLSDAAIKNVYSLYIMFTCWGCLFFGSMKDP  118

Query  388  YYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            YYDSE YR DGGDGTGHW+Y+KQEDIEE +RA+LWREELIEEIEQKV
Sbjct  119  YYDSEVYRKDGGDGTGHWVYEKQEDIEEAARADLWREELIEEIEQKV  165



>ref|XP_008453213.1| PREDICTED: uncharacterized protein LOC103494001 [Cucumis melo]
Length=177

 Score =   196 bits (498),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 131/167 (78%), Gaps = 2/167 (1%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKSRRGCRTRV  569
            MA+A+  F+IIKP +H+ +LH  S L  P  + L+++    S  ++    K +RG  ++V
Sbjct  1    MAKAIAGFSIIKPTLHSSNLHPKSALI-PHSKLLSNS-GGFSHQELPKVAKPKRGSLSKV  58

Query  568  NAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKDP  389
            NAFP  QLMAV+V+HLDGQRDLVTHKS+ HLSD AIKNVYS YIMFT WGC FFGS KDP
Sbjct  59   NAFPDWQLMAVLVDHLDGQRDLVTHKSIVHLSDEAIKNVYSLYIMFTCWGCLFFGSMKDP  118

Query  388  YYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            YYDSE YR DGGDGTGHW+Y+KQEDIEE +RA+LWREELIEEIEQKV
Sbjct  119  YYDSEVYRKDGGDGTGHWVYEKQEDIEEAARADLWREELIEEIEQKV  165



>ref|XP_004252225.1| PREDICTED: uncharacterized protein LOC101254767 isoform X1 [Solanum 
lycopersicum]
Length=173

 Score =   194 bits (494),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 125/165 (76%), Gaps = 12/165 (7%)
 Frame = -3

Query  733  MSFTIIKPRIHNPS---LHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKSRRGCRTRVNA  563
            MSFT IKP I +P+   LH  SK    L  C  S F           G+  +  R RV A
Sbjct  1    MSFTFIKPSIPSPTSELLHPFSK--SRLRHCPTSPFG-------NNAGRRHQIERNRVKA  51

Query  562  FPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKDPYY  383
             P   LMAV+VEH++GQRDL+THKSVWHLSD A+KNVY+FYIMFT+WGCCFFGSTKDPYY
Sbjct  52   LPDWPLMAVLVEHMEGQRDLITHKSVWHLSDEAMKNVYTFYIMFTVWGCCFFGSTKDPYY  111

Query  382  DSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            DSEQYRGDGGDGTGHW+Y+KQEDIEE +RAELWR+ELIEEIEQKV
Sbjct  112  DSEQYRGDGGDGTGHWVYEKQEDIEEEARAELWRDELIEEIEQKV  156



>ref|XP_008239924.1| PREDICTED: uncharacterized protein LOC103338491 [Prunus mume]
Length=190

 Score =   195 bits (495),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 129/175 (74%), Gaps = 10/175 (6%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCP-------SKLPKPLGQCLNSA-FSPCSSYQIEGGGKS  593
            MAEA+M FTII P IH+ S+          S   + L Q  +S  FS C   Q+ GG KS
Sbjct  1    MAEAIMGFTIISPHIHSSSMQTTKLDMTHTSSCTRLLRQSSSSELFSGCR--QLVGGKKS  58

Query  592  RRGCRTRVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCC  413
            +R    + NAFP   LMAV+VEH++GQRDL+THKS+ HLSD +IKNVY+FYIMFT WGC 
Sbjct  59   KRASLCKTNAFPDWPLMAVLVEHIEGQRDLITHKSIVHLSDESIKNVYTFYIMFTCWGCL  118

Query  412  FFGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            FFGS KDPYYDSE YR DGGDGTGHWIY+KQ DIEE +RAELWREELIEEIEQKV
Sbjct  119  FFGSMKDPYYDSETYRKDGGDGTGHWIYEKQADIEESARAELWREELIEEIEQKV  173



>ref|XP_002514738.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47844.1| conserved hypothetical protein [Ricinus communis]
Length=182

 Score =   194 bits (494),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 133/173 (77%), Gaps = 12/173 (7%)
 Frame = -3

Query  745  AEAVMSFTIIKPRIHNP------SLHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKSR-R  587
            AEA+M FTI K  +HN        L+  S+L K   QC +S F   + +Q   G KS+ R
Sbjct  3    AEAIMGFTITKSHLHNSFSPTKLDLNPSSRLHK---QCSSSRF--FNGWQQAEGSKSKSR  57

Query  586  GCRTRVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFF  407
            G  ++VNAFP L LMAV+VEH++GQRDL+T+K++WHLSD AIKNVY FY+MFT WGC FF
Sbjct  58   GSLSKVNAFPDLTLMAVLVEHMEGQRDLITNKTIWHLSDRAIKNVYVFYLMFTCWGCLFF  117

Query  406  GSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            GS KDP+YDSE+YR DGGDGTGHWIY+KQEDIEE +RAELWREELIEEIEQKV
Sbjct  118  GSMKDPFYDSEEYRKDGGDGTGHWIYEKQEDIEESARAELWREELIEEIEQKV  170



>ref|XP_008393172.1| PREDICTED: uncharacterized protein LOC103455365 [Malus domestica]
Length=188

 Score =   194 bits (493),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 128/173 (74%), Gaps = 8/173 (5%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCP-----SKLPKPLGQCLNSA-FSPCSSYQIEGGGKSRR  587
            MA+A+M FTI  P IH+ SL        S   + L Q  +S  FS C   Q+E G KS+R
Sbjct  1    MAKAIMGFTITTPHIHSSSLQTTKLDISSSSTRLLRQSSSSEPFSGCK--QVELGKKSKR  58

Query  586  GCRTRVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFF  407
                R NAFP   LMAV+VEH++GQRDL+THKS+ HLSD  IKNVY+FYIMFT WGC FF
Sbjct  59   TSFCRTNAFPDWPLMAVLVEHIEGQRDLITHKSIVHLSDENIKNVYTFYIMFTCWGCLFF  118

Query  406  GSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            GS KDPYYDSE YRGDGGDGTG WIY+KQEDIEE +RAELWREELIEEIEQKV
Sbjct  119  GSMKDPYYDSETYRGDGGDGTGFWIYEKQEDIEESARAELWREELIEEIEQKV  171



>gb|EYU24358.1| hypothetical protein MIMGU_mgv1a014456mg [Erythranthe guttata]
Length=189

 Score =   194 bits (492),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 130/172 (76%), Gaps = 7/172 (4%)
 Frame = -3

Query  748  MAEAVMSFTIIKP---RIHNPSLHCPS--KLPKPLGQCLNSAFSPCSSYQIEGGGKSRRG  584
            MAE + +FT++KP   + ++P           + L Q   S F+    +QIE   K+RR 
Sbjct  1    MAETITTFTLLKPCSIKYNSPRATKAEFGSFSRSLRQNSCSRFNN-GRHQIEDR-KNRRA  58

Query  583  CRTRVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFG  404
               RV A P LQLMAVM+EHLDGQRD++THKS+WHLSD A+KNVY+FY+MFT WGCCFFG
Sbjct  59   SGVRVEALPDLQLMAVMIEHLDGQRDIITHKSIWHLSDQAMKNVYTFYVMFTCWGCCFFG  118

Query  403  STKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            STKDP+YDSE YR DGGDGTGHWIY+KQEDIEE +RAELWREELIEEIEQKV
Sbjct  119  STKDPFYDSETYRKDGGDGTGHWIYEKQEDIEESARAELWREELIEEIEQKV  170



>ref|XP_010678485.1| PREDICTED: uncharacterized protein LOC104894025 [Beta vulgaris 
subsp. vulgaris]
Length=186

 Score =   191 bits (486),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 128/172 (74%), Gaps = 8/172 (5%)
 Frame = -3

Query  748  MAEAVMSFTIIKP---RIHNPSLHCPSKLPKPL--GQCLNSAFSPCSSYQIEGGGKSRRG  584
            M E + SFT+ KP   R +  S++  +     L   QC  S F    S+Q+E   K  RG
Sbjct  1    MVETIASFTLCKPIYSRFNPLSINTINNNSANLLLKQCSISKFGNGLSHQVE---KRERG  57

Query  583  CRTRVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFG  404
               +VNA P   LMAV+VEH++GQRDL+THKS+WHLSD AIK VY+FY+MFT WGCCFFG
Sbjct  58   HVEKVNALPDWPLMAVLVEHIEGQRDLITHKSIWHLSDDAIKKVYTFYVMFTCWGCCFFG  117

Query  403  STKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            +TKDPYYDSE+YRGDGGDGTGHW+Y+KQEDIEE +RA LWREELIEEIEQKV
Sbjct  118  ATKDPYYDSEEYRGDGGDGTGHWVYEKQEDIEESARAALWREELIEEIEQKV  169



>gb|KDP31270.1| hypothetical protein JCGZ_11646 [Jatropha curcas]
Length=180

 Score =   191 bits (484),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 125/169 (74%), Gaps = 3/169 (2%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPSKLPKPLGQCLN--SAFSPCSSYQIEGGGKSRRGCRT  575
            MAEA+M+F I +P IHN S   P     P  + L   S+ +    +Q     KS+RG   
Sbjct  1    MAEAIMTFNITRPHIHN-SFQSPKSDCNPSSRMLRQFSSSTLFRGWQQLQISKSKRGSLN  59

Query  574  RVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTK  395
            +VNA P   LMAV+VEH++GQRDL+THKS+WHLSD AIKNVY FY+ FT WGC FFGS K
Sbjct  60   KVNALPDWPLMAVLVEHMEGQRDLITHKSIWHLSDQAIKNVYVFYLFFTCWGCLFFGSMK  119

Query  394  DPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            DPYYDS+ YR DGGDG+GHWIY+KQEDIEE +RAELWREELIEEIEQKV
Sbjct  120  DPYYDSDAYRKDGGDGSGHWIYEKQEDIEESARAELWREELIEEIEQKV  168



>ref|XP_004299342.1| PREDICTED: uncharacterized protein LOC101299765 [Fragaria vesca 
subsp. vesca]
Length=191

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 129/175 (74%), Gaps = 10/175 (6%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCP-------SKLPKPLGQCLNSA-FSPCSSYQIEGGGKS  593
            MAEA+M FTI  P IH+ SL          +   + L QC +S  F  C   Q+E G KS
Sbjct  1    MAEAIMGFTITSPHIHSSSLQTTKVDITHMTSSTRLLRQCSSSELFGGCK--QLEVGKKS  58

Query  592  RRGCRTRVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCC  413
            +R   +R NAFP   LMAV+VEH++GQRD +THKS+ HLSD +IK+VY+ YIMFT+WGC 
Sbjct  59   KRSPLSRTNAFPDWPLMAVLVEHIEGQRDFITHKSIVHLSDDSIKSVYTAYIMFTVWGCL  118

Query  412  FFGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            FFGS KDPYYDSE YR DGGDGTGHWIY+KQEDIEE +R+ELWREELIEEIEQKV
Sbjct  119  FFGSMKDPYYDSEVYREDGGDGTGHWIYEKQEDIEESARSELWREELIEEIEQKV  173



>ref|XP_009339018.1| PREDICTED: uncharacterized protein LOC103931297 [Pyrus x bretschneideri]
Length=188

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 127/173 (73%), Gaps = 8/173 (5%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCP-----SKLPKPLGQCLNSA-FSPCSSYQIEGGGKSRR  587
            MA+A+M FT   P IH+ SL        S   + LGQ  +S  FS C   QIE G KS+ 
Sbjct  1    MAKAIMGFTNTTPHIHSSSLQTTRLDISSSSTRLLGQSSSSELFSGCK--QIELGKKSKI  58

Query  586  GCRTRVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFF  407
                R NAFP   LMAV++EH++GQRDL+THKS+ HLSD  IKNVY+FYIMFT WGC FF
Sbjct  59   ASFCRTNAFPDWPLMAVLIEHIEGQRDLITHKSIVHLSDENIKNVYTFYIMFTCWGCLFF  118

Query  406  GSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            GS KDPYY+SE YRGDGGDGTG WIY+KQEDIEE +RAELWREELIEEIEQKV
Sbjct  119  GSMKDPYYNSETYRGDGGDGTGFWIYEKQEDIEESARAELWREELIEEIEQKV  171



>ref|XP_007209644.1| hypothetical protein PRUPE_ppa011948mg [Prunus persica]
 gb|EMJ10843.1| hypothetical protein PRUPE_ppa011948mg [Prunus persica]
Length=190

 Score =   190 bits (482),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 124/174 (71%), Gaps = 8/174 (5%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGK-------SR  590
            MAEA+M FTII P IH+ SL   +KL               SS ++  G K       S+
Sbjct  1    MAEAIMGFTIISPHIHSSSLQ-TAKLDMTHTSSCTRLLRQSSSSELFSGAKQLVVGKNSK  59

Query  589  RGCRTRVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCF  410
            R    + NAFP   LMAV+VEH++GQRDL+THKS+ HLSD +IKNVY+FYIMFT WGC F
Sbjct  60   RASLCKTNAFPDWPLMAVLVEHIEGQRDLITHKSIVHLSDESIKNVYTFYIMFTCWGCLF  119

Query  409  FGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            FGS KDPYYDSE YR DGGDGTGHWIY+KQ DIEE +RAELWREELIEEIEQKV
Sbjct  120  FGSMKDPYYDSETYRKDGGDGTGHWIYEKQADIEESARAELWREELIEEIEQKV  173



>ref|XP_008374560.1| PREDICTED: uncharacterized protein LOC103437832 [Malus domestica]
Length=187

 Score =   187 bits (476),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 127/174 (73%), Gaps = 11/174 (6%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPSKL------PKPLGQCLNSA-FSPCSSYQIEGGGKSR  590
            MA+A+M FTI  P IH+ SL   +KL       + L Q  +S  FS C       G KS+
Sbjct  1    MAKAIMGFTITTPHIHSSSLQ-TTKLDMSCSSTRFLRQSSSSELFSGCKQIV---GKKSK  56

Query  589  RGCRTRVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCF  410
            R    R NAFP   LMAV+VEH++GQRDL+THKS+ HLSD  IKNVY+FYIMFT WGC F
Sbjct  57   RASFCRTNAFPDWPLMAVLVEHIEGQRDLITHKSIVHLSDENIKNVYTFYIMFTCWGCLF  116

Query  409  FGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            FGS KDPYYDSE YRGDGGDGTG WIY+KQEDIEE +RAELWREELIEEIEQKV
Sbjct  117  FGSMKDPYYDSETYRGDGGDGTGFWIYEKQEDIEESARAELWREELIEEIEQKV  170



>ref|XP_011014023.1| PREDICTED: uncharacterized protein LOC105117914 [Populus euphratica]
Length=180

 Score =   183 bits (465),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 122/173 (71%), Gaps = 11/173 (6%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGG------GKSRR  587
            MA+A+  FTI KP +    L    K    L  C +     CSS  +  G         +R
Sbjct  1    MAKAIAGFTITKPHM----LSSLQKTKLDLKPC-SEGLWQCSSNGLLSGWLQHKRSNQKR  55

Query  586  GCRTRVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFF  407
               ++VNAFP   LMAVMVEH++GQRDL+THKS+WHLSD AIKNVY FY+MFT WGC FF
Sbjct  56   ASLSKVNAFPDWPLMAVMVEHIEGQRDLITHKSIWHLSDRAIKNVYVFYLMFTCWGCLFF  115

Query  406  GSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            GS KDPYYDSE YR DGGDG+GHW+YDKQEDIEE +RAELWREELIEEIEQKV
Sbjct  116  GSMKDPYYDSEAYRKDGGDGSGHWVYDKQEDIEESARAELWREELIEEIEQKV  168



>ref|XP_002317978.2| hypothetical protein POPTR_0012s07040g [Populus trichocarpa]
 gb|ABK95263.1| unknown [Populus trichocarpa]
 gb|EEE96198.2| hypothetical protein POPTR_0012s07040g [Populus trichocarpa]
Length=180

 Score =   181 bits (459),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 122/173 (71%), Gaps = 11/173 (6%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGG------GKSRR  587
            MA+A+  FTI KP +    L    K    L  C +     CSS  +  G         +R
Sbjct  1    MAKAITGFTITKPHM----LSSLQKTKLDLKPC-SGGLWQCSSDGLLSGWLQHKRSNKKR  55

Query  586  GCRTRVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFF  407
               ++VNAFP   LMAVMVEH++GQRDL+THKS+WHLSD AIKNVY FY+MFT WGC FF
Sbjct  56   ASLSKVNAFPDWPLMAVMVEHIEGQRDLITHKSIWHLSDRAIKNVYVFYLMFTCWGCLFF  115

Query  406  GSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            GS KDPYYDSE YR DGGDG+GHW+YDKQ+DIEE +RAELWREELIEEIEQKV
Sbjct  116  GSMKDPYYDSEAYRKDGGDGSGHWVYDKQDDIEESARAELWREELIEEIEQKV  168



>ref|XP_004514960.1| PREDICTED: uncharacterized protein LOC101502854 [Cicer arietinum]
Length=186

 Score =   177 bits (449),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 124/174 (71%), Gaps = 12/174 (7%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCP-------SKLPKPLGQCLNSAFSPCSSYQIEGGGKSR  590
            MAEA++ FT++K  IH+  LH         S+ PK      NS     SS+ +EG  K +
Sbjct  1    MAEAIIGFTVVKSHIHSSCLHTKRFEVNSSSRWPK---HPSNSTLFHRSSHVLEG--KKK  55

Query  589  RGCRTRVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCF  410
            R   ++VN  P   LMA++VE ++GQRD++T K++WHLSD  IKNVYS+YIMFT+WGC F
Sbjct  56   RTSLSKVNGLPDWPLMAIIVEQMEGQRDIITEKTIWHLSDQQIKNVYSWYIMFTVWGCLF  115

Query  409  FGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            FG+ KDPYYDSE YRGDGGDGTG+WIY+KQE +E  +R  LWREELIEEIEQKV
Sbjct  116  FGAMKDPYYDSETYRGDGGDGTGNWIYEKQEIMEAEAREALWREELIEEIEQKV  169



>gb|KHG10650.1| Hydroxyacylglutathione hydrolase [Gossypium arboreum]
Length=176

 Score =   177 bits (448),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 122/167 (73%), Gaps = 8/167 (5%)
 Frame = -3

Query  733  MSFTIIKPRIHNPSLHCPSKLPK-PLGQCLNSAFSPCSSYQIEGGGKS-RRGCRTRVNAF  560
            MSFTI+KP IH   L  P+K    P         + C   QI+ G KS RRG   +VNA 
Sbjct  1    MSFTILKPWIHCSYLQ-PTKFGNYPFSSSTRLFNNGCQ--QIDEGNKSKRRGAFVKVNAL  57

Query  559  PGLQLMAVMVEH---LDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKDP  389
            P   LMAV+V H   LD QR+++T+KS+WHLSD AIK VY+FYIMFT WGC FFGSTKDP
Sbjct  58   PDWPLMAVLVHHVQQLDAQREIITNKSIWHLSDEAIKKVYAFYIMFTCWGCLFFGSTKDP  117

Query  388  YYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            YYDSE YR DGGDGTGHW+Y+KQEDIEE +RAELWREELIEEIEQKV
Sbjct  118  YYDSEVYRKDGGDGTGHWVYEKQEDIEESARAELWREELIEEIEQKV  164



>ref|XP_009339040.1| PREDICTED: uncharacterized protein LOC103931316, partial [Pyrus 
x bretschneideri]
Length=220

 Score =   177 bits (450),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 120/167 (72%), Gaps = 8/167 (5%)
 Frame = -3

Query  730  SFTIIKPRIHNPS-----LHCPSKLPKPLGQCLNSA-FSPCSSYQIEGGGKSRRGCRTRV  569
            +F    P IH+ S     L   S     L Q  +S  FS C   QIE G KS+R    R 
Sbjct  39   NFPCTTPHIHSSSFQTTKLDISSSSTILLRQSSSSELFSGCK--QIESGKKSKRASFCRT  96

Query  568  NAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKDP  389
            NAFP   LMAV+VEH++GQRDL+THKS+ HLSD  IKNVY+FYIMFT WGC FFGS KDP
Sbjct  97   NAFPDWPLMAVLVEHIEGQRDLITHKSIVHLSDENIKNVYTFYIMFTCWGCLFFGSMKDP  156

Query  388  YYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            YY+SE YRGDGGDGTG WIY+KQEDIEE +RAELWREELIEEIEQKV
Sbjct  157  YYNSETYRGDGGDGTGFWIYEKQEDIEESARAELWREELIEEIEQKV  203



>ref|XP_010037178.1| PREDICTED: uncharacterized protein LOC104425984 [Eucalyptus grandis]
 gb|KCW48855.1| hypothetical protein EUGRSUZ_K02487 [Eucalyptus grandis]
Length=166

 Score =   175 bits (444),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 124/168 (74%), Gaps = 15/168 (9%)
 Frame = -3

Query  748  MAEAVMSFTIIKP-RIHNPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKSRRGCRTR  572
            MA+A+ SFTI  P R+H    H P +             +P S  ++    +S+R    +
Sbjct  1    MADAIRSFTIANPTRVHG---HIPKR---------RLDMNPSS--RLLEMRRSKRASLCK  46

Query  571  VNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKD  392
            VNAFP   LMAV+VE ++GQR+ +T+KS+WHLSD A+K+VY+FYIMFT WGC FFGSTKD
Sbjct  47   VNAFPDWTLMAVLVEQVEGQREFITNKSIWHLSDKALKSVYTFYIMFTCWGCLFFGSTKD  106

Query  391  PYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            PYYDSE+YR DGGDGTGHW+Y+KQEDIEE +RAELWREELIEEIEQKV
Sbjct  107  PYYDSEEYRKDGGDGTGHWVYEKQEDIEESARAELWREELIEEIEQKV  154



>emb|CAN77176.1| hypothetical protein VITISV_038217 [Vitis vinifera]
Length=209

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 108/129 (84%), Gaps = 2/129 (2%)
 Frame = -3

Query  634  SPCSSYQIEGGGKSRRGCRTRVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKN  455
            S CSS  +   G +  G   RVNA P   LMAV+VEH++GQRDL+THKS+WHL+D  IKN
Sbjct  71   SFCSSGNVPALGLTMAG--IRVNALPDWPLMAVLVEHVEGQRDLITHKSIWHLNDETIKN  128

Query  454  VYSFYIMFTIWGCCFFGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwree  275
            VY+FYIMFT WGCCFFGSTKDPYYDSEQYR DGGDGTGHW+Y+KQEDIEE +RAELWREE
Sbjct  129  VYTFYIMFTCWGCCFFGSTKDPYYDSEQYRKDGGDGTGHWVYEKQEDIEEAARAELWREE  188

Query  274  lieeiEQKV  248
            LIEEIEQKV
Sbjct  189  LIEEIEQKV  197



>ref|XP_009410046.1| PREDICTED: uncharacterized protein LOC103992165 [Musa acuminata 
subsp. malaccensis]
Length=186

 Score =   172 bits (437),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 117/169 (69%), Gaps = 5/169 (3%)
 Frame = -3

Query  742  EAVMSFTIIKPRIHNPSLHCPSK----LPKPLGQCLNSAFSPCSSYQIEGGGKSRRGCRT  575
            EA M F+  KP +  P++H  +     LPK       S ++   S Q   G +  R    
Sbjct  2    EAAMGFSAPKPHVRRPAIHSTTGNLCLLPKAFRSFPASRWTTGLS-QCNEGKRQGRSSSW  60

Query  574  RVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTK  395
            + NA P   LMAVM+EH+  QRD V HKS+WHLSD A+KNVY+ YIMFT WGCCFFGSTK
Sbjct  61   KSNALPDWPLMAVMIEHVANQRDFVVHKSIWHLSDEAMKNVYTMYIMFTCWGCCFFGSTK  120

Query  394  DPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            DP+YD E+YR DGGDGT HW+Y+KQEDIEE +RAELWREELIEEIEQKV
Sbjct  121  DPFYDGEEYRKDGGDGTVHWVYEKQEDIEEAARAELWREELIEEIEQKV  169



>ref|XP_010093598.1| hypothetical protein L484_006486 [Morus notabilis]
 gb|EXB54326.1| hypothetical protein L484_006486 [Morus notabilis]
Length=172

 Score =   172 bits (435),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 119/167 (71%), Gaps = 7/167 (4%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKSRRGCRTRV  569
            MA+AV+ FTI+KPRIH  +    +   K L Q  +S     S +Q E G   +RG  ++ 
Sbjct  1    MAKAVIGFTIVKPRIHCSTFQ--TTCSKSLRQFSSSGL--FSEWQREKG---KRGRLSKA  53

Query  568  NAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKDP  389
            NA P L LMAV+VE L GQ D V HK++WHLSD  IKNVY  YI FT WGC  FGS KDP
Sbjct  54   NALPDLPLMAVLVEKLGGQMDYVMHKTIWHLSDDTIKNVYVGYIFFTCWGCLVFGSMKDP  113

Query  388  YYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            YYDSE YR DGGDGTGHWIY+KQEDIEE +R+ELWREELIEEIEQKV
Sbjct  114  YYDSEAYRKDGGDGTGHWIYEKQEDIEETARSELWREELIEEIEQKV  160



>ref|XP_007037396.1| NDH dependent flow 6 isoform 1 [Theobroma cacao]
 gb|EOY21897.1| NDH dependent flow 6 isoform 1 [Theobroma cacao]
Length=185

 Score =   172 bits (436),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 124/174 (71%), Gaps = 8/174 (5%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPSKLPKPLGQCLNSAFSPCS---SYQIEGGGKSRRGCR  578
            MAEA++SFT+ KP I N  LH       P  + L    S        Q   G  SRRG  
Sbjct  1    MAEAIVSFTLTKPCI-NSYLHAAKSDSCPSSRLLRRRSSTRLFNYGKQQTEGSNSRRGVA  59

Query  577  T-RVNAFPGLQLMAVMV---EHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCF  410
            + + NAFP   LMAV+V   + LD QR+++T+KS+WHLS+ AIKNVY+FYIMFT WGC F
Sbjct  60   SVKANAFPDWPLMAVLVHNVQQLDAQREIITNKSIWHLSEEAIKNVYTFYIMFTCWGCLF  119

Query  409  FGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            FGSTKDPYYDSE YR DGGDGTGHW+Y+KQEDIEE +RAELWREELIEEIEQKV
Sbjct  120  FGSTKDPYYDSEVYRKDGGDGTGHWVYEKQEDIEESARAELWREELIEEIEQKV  173



>gb|KCW48850.1| hypothetical protein EUGRSUZ_K02485 [Eucalyptus grandis]
Length=239

 Score =   171 bits (434),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 103/153 (67%), Gaps = 13/153 (8%)
 Frame = -3

Query  751  KMAEAVMSFTIIKPRIHNPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKSRRGCRTR  572
            KMA+A+ SF I  P      LH         G  L        S ++    +S+R    +
Sbjct  70   KMADAIRSFIIANP----THLH---------GHILKRRLDMNPSSRLLEMRRSKRASLCK  116

Query  571  VNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKD  392
            VNAFP   LMAV+VE  +GQR+ +T+KS+WHLSD A+K+VY+FYIMFT WGC FFGSTKD
Sbjct  117  VNAFPDWTLMAVLVEQAEGQREFITNKSIWHLSDKALKSVYTFYIMFTCWGCLFFGSTKD  176

Query  391  PYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRA  293
            PYYD E+YR DGGDGTGHW+Y+KQEDIEE +RA
Sbjct  177  PYYDLEEYRKDGGDGTGHWVYEKQEDIEESTRA  209



>gb|KCW48851.1| hypothetical protein EUGRSUZ_K02485 [Eucalyptus grandis]
 gb|KCW48852.1| hypothetical protein EUGRSUZ_K02485 [Eucalyptus grandis]
Length=169

 Score =   169 bits (427),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 102/152 (67%), Gaps = 13/152 (9%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKSRRGCRTRV  569
            MA+A+ SF I  P      LH         G  L        S ++    +S+R    +V
Sbjct  1    MADAIRSFIIANP----THLH---------GHILKRRLDMNPSSRLLEMRRSKRASLCKV  47

Query  568  NAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKDP  389
            NAFP   LMAV+VE  +GQR+ +T+KS+WHLSD A+K+VY+FYIMFT WGC FFGSTKDP
Sbjct  48   NAFPDWTLMAVLVEQAEGQREFITNKSIWHLSDKALKSVYTFYIMFTCWGCLFFGSTKDP  107

Query  388  YYDSEQYRGDGGDGTGHWIYDKQEDIEERSRA  293
            YYD E+YR DGGDGTGHW+Y+KQEDIEE +RA
Sbjct  108  YYDLEEYRKDGGDGTGHWVYEKQEDIEESTRA  139



>gb|KCW48856.1| hypothetical protein EUGRSUZ_K02487 [Eucalyptus grandis]
Length=131

 Score =   167 bits (423),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -3

Query  598  KSRRGCRTRVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWG  419
            +S+R    +VNAFP   LMAV+VE ++GQR+ +T+KS+WHLSD A+K+VY+FYIMFT WG
Sbjct  3    RSKRASLCKVNAFPDWTLMAVLVEQVEGQREFITNKSIWHLSDKALKSVYTFYIMFTCWG  62

Query  418  CCFFGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            C FFGSTKDPYYDSE+YR DGGDGTGHW+Y+KQEDIEE +RAELWREELIEEIEQKV
Sbjct  63   CLFFGSTKDPYYDSEEYRKDGGDGTGHWVYEKQEDIEESARAELWREELIEEIEQKV  119



>ref|XP_007138171.1| hypothetical protein PHAVU_009G186200g [Phaseolus vulgaris]
 gb|ESW10165.1| hypothetical protein PHAVU_009G186200g [Phaseolus vulgaris]
Length=186

 Score =   169 bits (427),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 103/155 (66%), Gaps = 6/155 (4%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPS----KLPKPLGQCLNSAFSPCSSYQIEGGGKSRRGC  581
            MAEAVM FT+ K      SL   S         L Q  NS+        +EG  KS+R  
Sbjct  1    MAEAVMGFTLFKSHHFGSSLQTRSFQMNHSSSLLKQHANSSLFNRPWQVLEG--KSKRAS  58

Query  580  RTRVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGS  401
              +VN  P   LMA+MVEH++GQRDL+T KSV HLSD AIKNVY++YIMFT+WG  FFGS
Sbjct  59   LCKVNGLPDWPLMAIMVEHMEGQRDLITEKSVTHLSDQAIKNVYTWYIMFTVWGGLFFGS  118

Query  400  TKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSR  296
             KDPYYDSE YRGDGGDGTG+WIY+KQE +E  +R
Sbjct  119  MKDPYYDSETYRGDGGDGTGNWIYEKQEKMEAEAR  153



>gb|AFK40335.1| unknown [Lotus japonicus]
Length=186

 Score =   168 bits (425),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 117/174 (67%), Gaps = 12/174 (7%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCP-------SKLPKPLGQCLNSAFSPCSSYQIEGGGKSR  590
            MAEA+M FT+ K  IH   L          S+LPK      NS     S    E   K +
Sbjct  1    MAEAIMGFTVFKSHIHCSCLQTKRFDVNPSSRLPKLHS---NSTLFHRSWQVFES--KCK  55

Query  589  RGCRTRVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCF  410
            R    +VNA P   LMA++VE ++GQRD++T K++WHLSD  IKNVYS+YIMFT+WGC  
Sbjct  56   RASLRKVNALPDWPLMAILVEQMEGQRDMITEKTIWHLSDGQIKNVYSWYIMFTVWGCLV  115

Query  409  FGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            FGS KDPYYDSE YRGDGGDGTG+WIY+KQE +E  +R  LWREEL+EEIEQKV
Sbjct  116  FGSMKDPYYDSETYRGDGGDGTGNWIYEKQEIMEAEAREALWREELVEEIEQKV  169



>gb|ACJ86002.1| unknown [Medicago truncatula]
 gb|AFK41597.1| unknown [Medicago truncatula]
 gb|KEH33308.1| NDH-dependent flow 6 protein [Medicago truncatula]
Length=182

 Score =   168 bits (425),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 119/169 (70%), Gaps = 7/169 (4%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCP--SKLPKPLGQCLNSAFSPCSSYQIEGGGKSRRGCRT  575
            MAEA++ FT+    IH+  L     S+LP+      NS     S   ++G  K +R    
Sbjct  1    MAEAIIGFTVFNSYIHSSCLQTKRFSRLPR---HPSNSTLFHRSLQVLDG--KIKRASMC  55

Query  574  RVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTK  395
            +VN  P + LMA++VE L+GQRDL+T K++WHLSD  IKNVY++YIMFT+WG  FFGS K
Sbjct  56   KVNGLPDIPLMAILVEQLEGQRDLITEKTIWHLSDQQIKNVYAWYIMFTVWGVLFFGSMK  115

Query  394  DPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            DPYYDSE YRGDGGDGTG+WIY+KQE +E  +R  LWREELIEEIEQKV
Sbjct  116  DPYYDSETYRGDGGDGTGNWIYEKQEVMEAEAREALWREELIEEIEQKV  164



>gb|AFK38809.1| unknown [Lotus japonicus]
Length=186

 Score =   165 bits (417),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 116/174 (67%), Gaps = 12/174 (7%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCP-------SKLPKPLGQCLNSAFSPCSSYQIEGGGKSR  590
            MAEA+M FT+ K  IH   L          S+LPK      NS     S    E   K +
Sbjct  1    MAEAIMGFTVFKSHIHCSCLQTKRFDVNPSSRLPKLHS---NSTLFHRSWQVFES--KCK  55

Query  589  RGCRTRVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCF  410
            R    +VNA P   LMA++VE ++GQRD++T K++WHLSD  IKNVYS+YIMFT+WGC  
Sbjct  56   RASLCKVNALPDWPLMAILVEQMEGQRDMITEKTIWHLSDGQIKNVYSWYIMFTVWGCLV  115

Query  409  FGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            FGS KDPYYDSE YRGDGGD TG+WIY+KQE +E  +R  LWREELIEEIEQKV
Sbjct  116  FGSMKDPYYDSETYRGDGGDDTGNWIYEKQEIMEAEAREALWREELIEEIEQKV  169



>ref|XP_003523013.1| PREDICTED: uncharacterized protein LOC100801331 [Glycine max]
Length=183

 Score =   164 bits (416),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 119/174 (68%), Gaps = 11/174 (6%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHC-------PSKLPKPLGQCLNSAFSPCSSYQIEGGGKSR  590
            MAEA+M FT  K    +  L          S+LPK   Q  NS+      +Q+  G   +
Sbjct  1    MAEAIMGFTPFKSHTLSSCLQTNKFQVNQSSRLPK---QHSNSSLIN-RPWQVLEGKSKK  56

Query  589  RGCRTRVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCF  410
            RG   +VN  P   LMA++VE ++GQRDL+T K+V HLSD AIKNVYS+YIMFT+WGC F
Sbjct  57   RGSLCKVNGLPDWPLMAIIVEQMEGQRDLITEKTVSHLSDQAIKNVYSWYIMFTVWGCLF  116

Query  409  FGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            FG+ KDPYYDSE YRGDGGDGTG+WIY+KQ+ +E  +R  LWREELIEEIEQKV
Sbjct  117  FGAMKDPYYDSETYRGDGGDGTGNWIYEKQDAMEAEAREALWREELIEEIEQKV  170



>ref|XP_006827302.1| hypothetical protein AMTR_s00010p00265920 [Amborella trichopoda]
 gb|ERM94539.1| hypothetical protein AMTR_s00010p00265920 [Amborella trichopoda]
Length=193

 Score =   164 bits (416),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 123/177 (69%), Gaps = 12/177 (7%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPSKLPKPLGQCL---NSAFS--PCSSYQIEGGGKSRRG  584
            MA  +M FT+ +  +H+  LH                +S+FS      +Q+E   K R  
Sbjct  1    MANTIMGFTMPRTGLHHMPLHNGISYANDFPDMSFHGSSSFSWGNMGGFQVEMKKKKREL  60

Query  583  CRTRVNAFPG---LQLMAVMVEHLDGQRDL--VTHKSVWHLSDAAIKNVYSFYIMFTIWG  419
              T  +AFP    L L+AV+V+H+D QRD+  +T+K++WHLSD AIKNVY+FYIMFT+WG
Sbjct  61   VMT--HAFPDWPHLNLIAVLVQHVDSQRDIEFITNKTIWHLSDTAIKNVYAFYIMFTVWG  118

Query  418  CCFFGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            CC FGSTKDP+YD EQYR DGGDGTGHWIYDKQED+E  +RAELWREELIEEIEQKV
Sbjct  119  CCVFGSTKDPFYDGEQYRKDGGDGTGHWIYDKQEDMEAEARAELWREELIEEIEQKV  175



>ref|XP_010532212.1| PREDICTED: uncharacterized protein LOC104808257 isoform X3 [Tarenaya 
hassleriana]
Length=156

 Score =   163 bits (412),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 97/152 (64%), Gaps = 23/152 (15%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKSRRGCRTRV  569
            MAEA  SFT+   R+ +PS+   +K                         + RRG   + 
Sbjct  1    MAEAFTSFTLSNIRVPSPSMPTEAK-----------------------ATRGRRGSLCKA  37

Query  568  NAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKDP  389
              F  + LMAVMV+ ++G RD+VT K VWHLSD AIKNVY FYIMFT WGC FFGSTKDP
Sbjct  38   VPFEDVPLMAVMVQQIEGMRDIVTEKHVWHLSDQAIKNVYMFYIMFTCWGCLFFGSTKDP  97

Query  388  YYDSEQYRGDGGDGTGHWIYDKQEDIEERSRA  293
            +YDSE YRGDGGDGTG W+Y+ QEDIEE++RA
Sbjct  98   FYDSEAYRGDGGDGTGFWVYETQEDIEEKARA  129



>ref|XP_010532211.1| PREDICTED: uncharacterized protein LOC104808257 isoform X2 [Tarenaya 
hassleriana]
Length=170

 Score =   163 bits (413),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 103/152 (68%), Gaps = 9/152 (6%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKSRRGCRTRV  569
            MAEA  SFT+   R+ +PS+      PK     L+  +  C+  +   G   RRG   + 
Sbjct  1    MAEAFTSFTLSNIRVPSPSMP-----PKRHSNRLDLGWL-CTEAKATRG---RRGSLCKA  51

Query  568  NAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKDP  389
              F  + LMAVMV+ ++G RD+VT K VWHLSD AIKNVY FYIMFT WGC FFGSTKDP
Sbjct  52   VPFEDVPLMAVMVQQIEGMRDIVTEKHVWHLSDQAIKNVYMFYIMFTCWGCLFFGSTKDP  111

Query  388  YYDSEQYRGDGGDGTGHWIYDKQEDIEERSRA  293
            +YDSE YRGDGGDGTG W+Y+ QEDIEE++RA
Sbjct  112  FYDSEAYRGDGGDGTGFWVYETQEDIEEKARA  143



>ref|XP_010532210.1| PREDICTED: uncharacterized protein LOC104808257 isoform X1 [Tarenaya 
hassleriana]
Length=183

 Score =   163 bits (413),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 105/160 (66%), Gaps = 12/160 (8%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPSKLPKPLGQ---CL-----NSAFSPCSSYQIEGGGKS  593
            MAEA  SFT+   R+ +PS+  P +    L     C+     NS    C+  +   G   
Sbjct  1    MAEAFTSFTLSNIRVPSPSMP-PKRHSNRLDLGWLCVSILSNNSIIILCTEAKATRG---  56

Query  592  RRGCRTRVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCC  413
            RRG   +   F  + LMAVMV+ ++G RD+VT K VWHLSD AIKNVY FYIMFT WGC 
Sbjct  57   RRGSLCKAVPFEDVPLMAVMVQQIEGMRDIVTEKHVWHLSDQAIKNVYMFYIMFTCWGCL  116

Query  412  FFGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRA  293
            FFGSTKDP+YDSE YRGDGGDGTG W+Y+ QEDIEE++RA
Sbjct  117  FFGSTKDPFYDSEAYRGDGGDGTGFWVYETQEDIEEKARA  156



>gb|ACU23914.1| unknown [Glycine max]
Length=183

 Score =   163 bits (412),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 121/174 (70%), Gaps = 11/174 (6%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCP-------SKLPKPLGQCLNSAFSPCSSYQIEGGGKSR  590
            MAE+++ FT+ K    +  L          S+LPK   +  ++ F+    +Q+  G   +
Sbjct  1    MAESILGFTLFKSHTLSSCLQTKKFQVNHSSRLPKQHSK--STLFN--RPWQVLEGKSEK  56

Query  589  RGCRTRVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCF  410
            RG   +VN  P   LMA++VE ++GQRDL+T K+V HLSD AIKNVYS+YIMFT+WGC F
Sbjct  57   RGSLCKVNGLPDWPLMAIIVEQMEGQRDLITEKTVSHLSDQAIKNVYSWYIMFTVWGCLF  116

Query  409  FGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            FG+ KDPYYDSE YRGDGGDGTG+WIY+KQ+ +E  +R  LWREELIEEIEQKV
Sbjct  117  FGAMKDPYYDSETYRGDGGDGTGNWIYEKQDAMEAEAREALWREELIEEIEQKV  170



>gb|KHN01878.1| hypothetical protein glysoja_038973 [Glycine soja]
Length=183

 Score =   163 bits (412),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 118/174 (68%), Gaps = 11/174 (6%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHC-------PSKLPKPLGQCLNSAFSPCSSYQIEGGGKSR  590
            MAEA+M FT  K    +  L          S LPK   Q  NS+      +Q+  G   +
Sbjct  1    MAEAIMGFTPFKSHTLSSCLQTNKFQVNQSSILPK---QHSNSSLIN-RPWQVLEGKSKK  56

Query  589  RGCRTRVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCF  410
            RG   +VN  P   LMA++VE ++GQRDL+T K+V HLSD AIKNVYS+YIMFT+WGC F
Sbjct  57   RGSLCKVNGLPDWPLMAIIVEQMEGQRDLITEKTVSHLSDQAIKNVYSWYIMFTVWGCLF  116

Query  409  FGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            FG+ KDPYYDSE YRGDGGDGTG+WIY+KQ+ +E  +R  LWREELIEEIEQKV
Sbjct  117  FGAMKDPYYDSETYRGDGGDGTGNWIYEKQDAMEAEAREALWREELIEEIEQKV  170



>gb|KHN26257.1| hypothetical protein glysoja_032827 [Glycine soja]
Length=183

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 121/174 (70%), Gaps = 11/174 (6%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCP-------SKLPKPLGQCLNSAFSPCSSYQIEGGGKSR  590
            MAE+++ FT+ K    +  L          S+LPK   +  ++ F+    +Q+  G   +
Sbjct  1    MAESILGFTLFKSHTLSSCLQTKKFQVNHSSRLPKQHSK--STLFN--RPWQVLEGKSEK  56

Query  589  RGCRTRVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCF  410
            RG   +VN  P   LMA++VE ++GQRDL+T K+V HLSD AIKNVYS+YIMFT+WGC F
Sbjct  57   RGSLCKVNGLPDWPLMAIIVEQMEGQRDLITEKTVSHLSDRAIKNVYSWYIMFTVWGCLF  116

Query  409  FGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            FG+ KDPYYDSE YRGDGGDGTG+WIY+KQ+ +E  +R  LWREE+IEEIEQKV
Sbjct  117  FGAMKDPYYDSETYRGDGGDGTGNWIYEKQDAMEAEAREALWREEVIEEIEQKV  170



>ref|XP_003527090.1| PREDICTED: uncharacterized protein LOC100800656 [Glycine max]
Length=183

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 121/174 (70%), Gaps = 11/174 (6%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCP-------SKLPKPLGQCLNSAFSPCSSYQIEGGGKSR  590
            MAE+++ FT+ K    +  L          S+LPK   +  ++ F+    +Q+  G   +
Sbjct  1    MAESILGFTLFKSHTLSSCLQTKKFQVNHSSRLPKQHSK--STLFN--RPWQVLEGKSEK  56

Query  589  RGCRTRVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCF  410
            RG   +VN  P   LMA++VE ++GQRDL+T K+V HLSD AIKNVYS+YIMFT+WGC F
Sbjct  57   RGSLCKVNGLPDWPLMAIIVEQMEGQRDLITEKTVSHLSDRAIKNVYSWYIMFTVWGCLF  116

Query  409  FGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            FG+ KDPYYDSE YRGDGGDGTG+WIY+KQ+ +E  +R  LWREELIEEIEQKV
Sbjct  117  FGAMKDPYYDSETYRGDGGDGTGNWIYEKQDAMEAEAREALWREELIEEIEQKV  170



>ref|XP_010937192.1| PREDICTED: uncharacterized protein LOC105056629 [Elaeis guineensis]
Length=185

 Score =   161 bits (407),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 100/145 (69%), Gaps = 6/145 (4%)
 Frame = -3

Query  742  EAVMSFTIIKPRIHNPSLHCPS----KLPKPLGQCLNSAFSPCSSYQIEGGGKSRRGCRT  575
            +A M F++++P+IH+P+LH        LP+ L +  NS ++  +S+      + R     
Sbjct  2    QATMGFSVLRPQIHSPALHSTKADLFSLPRALNKLQNSWWN--TSWSQSERKRGRGTASW  59

Query  574  RVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTK  395
            +VNAFP   LMA+M+EH+   RD + HKSVWHL+D  +KNVY+ YIMFT WGCCFFGSTK
Sbjct  60   KVNAFPDWPLMAIMMEHVPYSRDYIVHKSVWHLNDETMKNVYTMYIMFTCWGCCFFGSTK  119

Query  394  DPYYDSEQYRGDGGDGTGHWIYDKQ  320
            DP+YD E+YR +GGDG+ HW YDKQ
Sbjct  120  DPFYDGEEYRKEGGDGSVHWYYDKQ  144



>ref|XP_010477072.1| PREDICTED: uncharacterized protein LOC104756220 [Camelina sativa]
Length=176

 Score =   158 bits (399),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 115/169 (68%), Gaps = 7/169 (4%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPSKLPKPL-GQCLNSAFSPCSSYQIEGGGKSRRGCRTR  572
            MAEA  S T     I + S H P ++  P+ G  L+   +      +       RG    
Sbjct  1    MAEAFTSSTFTNLHIPSSSNHSPKQISGPIHGYWLSRKVNEKREKNL-----MIRGSLCV  55

Query  571  VNAFP-GLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTK  395
              A P  L LMAVMV+ ++G RD++T K VWHLSD AIKNVY FYIMFT WGC +FGS K
Sbjct  56   RKALPHDLPLMAVMVQQIEGMRDIITEKHVWHLSDKAIKNVYMFYIMFTCWGCLYFGSAK  115

Query  394  DPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            DP+YDSE+YRGDGGDGTG+W+Y+ QEDIEE++RAELWREELIEEIEQKV
Sbjct  116  DPFYDSEEYRGDGGDGTGYWVYETQEDIEEKARAELWREELIEEIEQKV  164



>ref|NP_173308.2| NDH dependent flow 6 protein [Arabidopsis thaliana]
 gb|AAL85020.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51240.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE98638.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29753.1| NDH dependent flow 6 protein [Arabidopsis thaliana]
Length=175

 Score =   157 bits (397),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 112/168 (67%), Gaps = 6/168 (4%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKSRRGCRTRV  569
            MAEA  SFT     I +   H P +   P     N  +    +   +      RG     
Sbjct  1    MAEAFTSFTFTNLHIPSSYNHSPKQNSGP-----NHGYWLSKNVNEKRERNLMRGSLCVR  55

Query  568  NAFP-GLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKD  392
             A P  L LMAVMV+ ++G RD++T K VWHLSD AIKNVY FYIMFT WGC +FGS KD
Sbjct  56   KALPHDLPLMAVMVQQIEGMRDIITEKHVWHLSDKAIKNVYMFYIMFTCWGCLYFGSAKD  115

Query  391  PYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            P+YDSE+YRGDGGDGTG+W+Y+ QEDIEE++RAELWREELIEEIEQKV
Sbjct  116  PFYDSEEYRGDGGDGTGYWVYETQEDIEEKARAELWREELIEEIEQKV  163



>ref|XP_006477472.1| PREDICTED: uncharacterized protein LOC102607245 [Citrus sinensis]
Length=175

 Score =   157 bits (396),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 93/140 (66%), Gaps = 3/140 (2%)
 Frame = -3

Query  733  MSFTIIKPRIHNPSLHCPSKLPKPLGQCLN--SAFSPCSSYQIEGGGKSRRGCRTRVNAF  560
            MSFTI  P + + SL        P  + L   S     + +Q   G K  R C +RV +F
Sbjct  1    MSFTITTPNVQS-SLQSTKFDTHPCSKSLKQGSRTKLFNGWQQLEGSKKGRACLSRVKSF  59

Query  559  PGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKDPYYD  380
            P   L+A++VEH +GQRDL+T KS+WHLSD AIKNVY FYIMFT WGC FF +TKDPYYD
Sbjct  60   PDWPLIAILVEHAEGQRDLITEKSIWHLSDQAIKNVYLFYIMFTCWGCMFFSATKDPYYD  119

Query  379  SEQYRGDGGDGTGHWIYDKQ  320
            S+ YR DGGDGTGHW Y+KQ
Sbjct  120  SDAYREDGGDGTGHWFYEKQ  139



>ref|NP_001117306.1| NDH dependent flow 6 protein [Arabidopsis thaliana]
 gb|AEE29755.1| NDH dependent flow 6 protein [Arabidopsis thaliana]
Length=174

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 114/173 (66%), Gaps = 17/173 (10%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKSR-----RG  584
            MAEA  SFT     I +   H P +         NS   P   Y +    + R     RG
Sbjct  1    MAEAFTSFTFTNLHIPSSYNHSPKQ---------NSG--PNHGYWLSNVNEKRERNLMRG  49

Query  583  CRTRVNAFP-GLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFF  407
                  A P  L LMAVMV+ ++G RD++T K VWHLSD AIKNVY FYIMFT WGC +F
Sbjct  50   SLCVRKALPHDLPLMAVMVQQIEGMRDIITEKHVWHLSDKAIKNVYMFYIMFTCWGCLYF  109

Query  406  GSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            GS KDP+YDSE+YRGDGGDGTG+W+Y+ QEDIEE++RAELWREELIEEIEQKV
Sbjct  110  GSAKDPFYDSEEYRGDGGDGTGYWVYETQEDIEEKARAELWREELIEEIEQKV  162



>ref|XP_006305702.1| hypothetical protein CARUB_v10010440mg [Capsella rubella]
 gb|EOA38600.1| hypothetical protein CARUB_v10010440mg [Capsella rubella]
Length=176

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 114/169 (67%), Gaps = 7/169 (4%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKS-RRGCRTR  572
            MAEA  S T     I + S H P ++  P     +  +        E   K+  RG    
Sbjct  1    MAEAFTSSTFTNLHIPSSSNHSPKQIAAP-----SHGYWLSRKLMNEKREKNLMRGSLCV  55

Query  571  VNAFP-GLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTK  395
              A P  L LMAVMV+ ++G RD++T K VWHLSD AIKNVY FYIMFT WGC +FGS K
Sbjct  56   RKALPHDLPLMAVMVQQIEGMRDIITEKHVWHLSDKAIKNVYMFYIMFTCWGCLYFGSAK  115

Query  394  DPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            DP+YDSE+YRGDGGDGTG+W+Y+ QEDIEE++RAELWREELIEEIEQKV
Sbjct  116  DPFYDSEEYRGDGGDGTGYWVYETQEDIEEKARAELWREELIEEIEQKV  164



>ref|XP_002890298.1| hypothetical protein ARALYDRAFT_472098 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66557.1| hypothetical protein ARALYDRAFT_472098 [Arabidopsis lyrata subsp. 
lyrata]
Length=175

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 113/168 (67%), Gaps = 6/168 (4%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKSRRGCRTRV  569
            MAEA  SFT     I + S H P ++  P        +S       +      RG     
Sbjct  1    MAEAFTSFTFTNLHIPSSSSHSPKQISGP-----KHGYSLSMKVNEKREKNLMRGSLCVR  55

Query  568  NAFP-GLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKD  392
             A P  L LMAVMV+ ++G RD++T K VWHLSD AIKNVY FYIMFT WGC +FGS KD
Sbjct  56   KALPHDLPLMAVMVQQIEGMRDIITEKHVWHLSDKAIKNVYMFYIMFTCWGCLYFGSAKD  115

Query  391  PYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            P+YDSE+YRGDGGDGTG+W+Y+ QEDIEE++RAELWREELIEEIEQKV
Sbjct  116  PFYDSEEYRGDGGDGTGYWVYETQEDIEEKARAELWREELIEEIEQKV  163



>emb|CDY64872.1| BnaC05g50170D [Brassica napus]
Length=175

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 115/169 (68%), Gaps = 8/169 (5%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKS-RRGCRTR  572
            MA A  SFT     I + S + P ++  P   C        S  + E   K+  RG    
Sbjct  1    MASAFKSFTFTNLHIPSSSSYSPKQISGPNHGCW------LSMKKNEKREKNLMRGSLCV  54

Query  571  VNAFP-GLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTK  395
              A P  L LMAVMV+ ++G RD++T K VWHLSD AIKNVY FYIMFT WGC +FGS K
Sbjct  55   RKALPHDLPLMAVMVQQIEGMRDIITEKHVWHLSDKAIKNVYLFYIMFTCWGCLYFGSAK  114

Query  394  DPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            DP+YDSE+YRGDGGDGTG+W+Y+ QEDIEE++RAELWREELIEEIEQKV
Sbjct  115  DPFYDSEEYRGDGGDGTGYWVYETQEDIEEKARAELWREELIEEIEQKV  163



>gb|KFK44026.1| hypothetical protein AALP_AA1G205800 [Arabis alpina]
Length=172

 Score =   155 bits (392),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 117/169 (69%), Gaps = 11/169 (7%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKSR-RGCRTR  572
            MAEA  SFT     I + S + P + P       N   S   + + +     R R C T+
Sbjct  1    MAEAFTSFTFTNLHIPSSSNYSPKQGP-------NHWLSMKVNEKKKKNNMMRGRLCVTK  53

Query  571  VNAFP-GLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTK  395
              A P  L LMAVMV+ ++G RD++T K +WHLSD AIKNVY FYIMFT WGC +FGS K
Sbjct  54   --ALPHDLPLMAVMVQQIEGMRDIITEKHIWHLSDKAIKNVYMFYIMFTCWGCLYFGSAK  111

Query  394  DPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            DP+YDSE+YRGDGGDGTG+W+Y+ QEDIEE++RAELWREELIEEIEQKV
Sbjct  112  DPFYDSEEYRGDGGDGTGYWLYETQEDIEEKARAELWREELIEEIEQKV  160



>ref|XP_010498284.1| PREDICTED: uncharacterized protein LOC104775994 [Camelina sativa]
Length=176

 Score =   155 bits (392),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 114/169 (67%), Gaps = 7/169 (4%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPSKLPKP-LGQCLNSAFSPCSSYQIEGGGKSRRGCRTR  572
            MAEA  S T     I + S H P ++  P  G  L+   +      +       RG    
Sbjct  1    MAEAFTSSTFTNLHIPSFSNHSPKQISGPNHGYWLSRKVNEKREKNL-----MMRGSLCV  55

Query  571  VNAFP-GLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTK  395
              A P  L LMAVMV+ ++G RD++T K VWHLSD AIKNVY FYIMFT WGC +FGS K
Sbjct  56   RKALPHDLPLMAVMVQQIEGMRDIITEKHVWHLSDKAIKNVYMFYIMFTCWGCLYFGSAK  115

Query  394  DPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            DP+YDSE+YRGDGGDGTG+W+Y+ QEDIEE++RAELWREELIEEIEQKV
Sbjct  116  DPFYDSEEYRGDGGDGTGYWVYETQEDIEEKARAELWREELIEEIEQKV  164



>ref|XP_010459515.1| PREDICTED: uncharacterized protein LOC104740574 isoform X1 [Camelina 
sativa]
Length=175

 Score =   154 bits (390),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 113/169 (67%), Gaps = 8/169 (5%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPSKLPKP-LGQCLNSAFSPCSSYQIEGGGKSRRGCRTR  572
            MAEA  S T     I + S   P ++  P  G  L+   +      +       RG    
Sbjct  1    MAEAFTSSTFTNLHIPSSSNRSPKQISGPSYGYWLSRKVNEKREKNL------MRGSLCV  54

Query  571  VNAFP-GLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTK  395
              A P  L LMAVMV+ ++G RD++T K VWHLSD AIKNVY FYIMFT WGC +FGS K
Sbjct  55   RKALPHDLPLMAVMVQQIEGMRDIITEKHVWHLSDKAIKNVYMFYIMFTCWGCLYFGSAK  114

Query  394  DPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            DP+YDSE+YRGDGGDGTG+W+Y+ QEDIEE++RAELWREELIEEIEQKV
Sbjct  115  DPFYDSEEYRGDGGDGTGYWVYETQEDIEEKARAELWREELIEEIEQKV  163



>ref|XP_009149360.1| PREDICTED: uncharacterized protein LOC103872680 [Brassica rapa]
 emb|CDY71434.1| BnaAnng37450D [Brassica napus]
 emb|CDY26734.1| BnaA06g12880D [Brassica napus]
Length=175

 Score =   154 bits (388),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 112/168 (67%), Gaps = 6/168 (4%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKSRRGCRTRV  569
            MA A  SFT     I + S +   ++  P   C  S        ++       RG     
Sbjct  1    MASAFKSFTFTNLHIPSSSSYSTKQISGPNHGCWFSMKKNEKREKV-----LMRGSLCVR  55

Query  568  NAFP-GLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKD  392
             A P  L LMAVMV+ ++G RD++T K VWHLSD AIKNVY FYIMFT WGC +FGS KD
Sbjct  56   KALPHDLPLMAVMVQQIEGMRDIITEKHVWHLSDKAIKNVYLFYIMFTCWGCLYFGSAKD  115

Query  391  PYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            P+YDSE+YRGDGGDGTG+W+Y+ QEDIEE++RAELWREELIEEIEQKV
Sbjct  116  PFYDSEEYRGDGGDGTGYWVYETQEDIEEKARAELWREELIEEIEQKV  163



>ref|XP_006416571.1| hypothetical protein EUTSA_v10008902mg [Eutrema salsugineum]
 gb|ESQ34924.1| hypothetical protein EUTSA_v10008902mg [Eutrema salsugineum]
Length=175

 Score =   151 bits (382),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 111/168 (66%), Gaps = 6/168 (4%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKSRRGCRTRV  569
            MA+A  S T     I + S   P ++  P     N  +        +      RG     
Sbjct  1    MAKAFTSSTFTNLHIPSSSNFPPKQISGP-----NHGYWLSMKVNEKREKNLMRGSLCVR  55

Query  568  NAFP-GLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKD  392
             A P  L LMAVMV+ ++G RD++T K VWHLSD AIKNVY FYIMFT WGC +FGS KD
Sbjct  56   KALPHDLPLMAVMVQQIEGMRDIITEKHVWHLSDKAIKNVYMFYIMFTCWGCLYFGSAKD  115

Query  391  PYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            P+YDSE+YRGDGGDGTG+W+Y+ QEDIEE++RAELWREELIEEIEQKV
Sbjct  116  PFYDSEEYRGDGGDGTGYWVYETQEDIEEKARAELWREELIEEIEQKV  163



>ref|XP_009117591.1| PREDICTED: uncharacterized protein LOC103842686 isoform X1 [Brassica 
rapa]
Length=209

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 117/175 (67%), Gaps = 12/175 (7%)
 Frame = -3

Query  766  LSQHGKMAEAVMSFTIIKPRIHNPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKS-R  590
            L +   MAEA  +FT         +LH P        Q   +A    S  Q E  GKS  
Sbjct  33   LIKEVSMAEA-FTFT---------NLHVPFYSSYSPKQFSGTAHGWQSMKQNEKRGKSVM  82

Query  589  RGCRTRVNAFP-GLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCC  413
            RG      A P  L LMAVMV+ ++G R+++T K VWHLSD AIKNVY FYIMFT WGC 
Sbjct  83   RGSLCVRKALPHDLPLMAVMVQQIEGMREIITEKHVWHLSDKAIKNVYLFYIMFTCWGCL  142

Query  412  FFGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            +FGS KDP+YDSE+YRGDGGDGTG+W+Y+ QEDIEE++RAELWREELIEEIEQKV
Sbjct  143  YFGSAKDPFYDSEEYRGDGGDGTGYWVYETQEDIEEKARAELWREELIEEIEQKV  197



>ref|XP_008783642.1| PREDICTED: uncharacterized protein LOC103702836 [Phoenix dactylifera]
Length=181

 Score =   151 bits (381),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 96/142 (68%), Gaps = 6/142 (4%)
 Frame = -3

Query  733  MSFTIIKPRIHNPSLHCPS----KLPKPLGQCLNSAFSPCSSYQIEGGGKSRRGCRTRVN  566
            M F+++KP+IH+P+L         LPK L +  +S ++  +S+    G + R     +++
Sbjct  1    MGFSVLKPQIHSPALPRTRADLFSLPKALNKFQDSRWN--TSWSQSEGKRGRGTSSWKIH  58

Query  565  AFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKDPY  386
            AFP   LMA+M EH+   RD V HKS WHL+D  +KNVY+ YIMFT WGCCFFGSTKDP+
Sbjct  59   AFPDWPLMAIMTEHVPYSRDYVVHKSAWHLNDETMKNVYTMYIMFTCWGCCFFGSTKDPF  118

Query  385  YDSEQYRGDGGDGTGHWIYDKQ  320
            YD E+YR +GGDG+ HW YDKQ
Sbjct  119  YDGEEYRKEGGDGSVHWYYDKQ  140



>ref|XP_010459516.1| PREDICTED: uncharacterized protein LOC104740574 isoform X2 [Camelina 
sativa]
Length=172

 Score =   150 bits (380),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 95/115 (83%), Gaps = 1/115 (1%)
 Frame = -3

Query  589  RGCRTRVNAFP-GLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCC  413
            RG      A P  L LMAVMV+ ++G RD++T K VWHLSD AIKNVY FYIMFT WGC 
Sbjct  46   RGSLCVRKALPHDLPLMAVMVQQIEGMRDIITEKHVWHLSDKAIKNVYMFYIMFTCWGCL  105

Query  412  FFGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            +FGS KDP+YDSE+YRGDGGDGTG+W+Y+ QEDIEE++RAELWREELIEEIEQKV
Sbjct  106  YFGSAKDPFYDSEEYRGDGGDGTGYWVYETQEDIEEKARAELWREELIEEIEQKV  160



>emb|CDY66602.1| BnaAnng22540D [Brassica napus]
Length=168

 Score =   150 bits (378),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 95/115 (83%), Gaps = 1/115 (1%)
 Frame = -3

Query  589  RGCRTRVNAFP-GLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCC  413
            RG      A P  L LMAVMV+ ++G RD++T K VWHLSD AIKNVY FYIMFT WGC 
Sbjct  42   RGSLCVRKALPHDLPLMAVMVQQIEGMRDIITEKHVWHLSDKAIKNVYLFYIMFTCWGCL  101

Query  412  FFGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            +FGS KDP+YDSE+YRGDGGDGTG+W+Y+ QEDIEE++RAELWREELIEEIEQKV
Sbjct  102  YFGSAKDPFYDSEEYRGDGGDGTGYWVYETQEDIEEKARAELWREELIEEIEQKV  156



>ref|XP_009117595.1| PREDICTED: uncharacterized protein LOC103842686 isoform X4 [Brassica 
rapa]
Length=206

 Score =   150 bits (380),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 101/128 (79%), Gaps = 2/128 (2%)
 Frame = -3

Query  625  SSYQIEGGGKS-RRGCRTRVNAFP-GLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNV  452
            S  Q E  GKS  RG      A P  L LMAVMV+ ++G R+++T K VWHLSD AIKNV
Sbjct  67   SMKQNEKRGKSVMRGSLCVRKALPHDLPLMAVMVQQIEGMREIITEKHVWHLSDKAIKNV  126

Query  451  YSFYIMFTIWGCCFFGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreel  272
            Y FYIMFT WGC +FGS KDP+YDSE+YRGDGGDGTG+W+Y+ QEDIEE++RAELWREEL
Sbjct  127  YLFYIMFTCWGCLYFGSAKDPFYDSEEYRGDGGDGTGYWVYETQEDIEEKARAELWREEL  186

Query  271  ieeiEQKV  248
            IEEIEQKV
Sbjct  187  IEEIEQKV  194



>emb|CDY58996.1| BnaC08g49490D [Brassica napus]
Length=168

 Score =   149 bits (377),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 95/115 (83%), Gaps = 1/115 (1%)
 Frame = -3

Query  589  RGCRTRVNAFP-GLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCC  413
            RG      A P  L LMAVMV+ ++G RD++T K VWHLSD AIKNVY FYIMFT WGC 
Sbjct  42   RGSLCVRKALPHDLPLMAVMVQQIEGMRDIITEKHVWHLSDKAIKNVYLFYIMFTCWGCL  101

Query  412  FFGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            +FGS KDP+YDSE+YRGDGGDGTG+W+Y+ QEDIEE++RAELWREELIEEIEQKV
Sbjct  102  YFGSAKDPFYDSEEYRGDGGDGTGYWVYETQEDIEEKARAELWREELIEEIEQKV  156



>ref|XP_009117594.1| PREDICTED: uncharacterized protein LOC103842686 isoform X3 [Brassica 
rapa]
Length=206

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 99/123 (80%), Gaps = 2/123 (2%)
 Frame = -3

Query  610  EGGGKS-RRGCRTRVNAFP-GLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYI  437
            E  GKS  RG      A P  L LMAVMV+ ++G R+++T K VWHLSD AIKNVY FYI
Sbjct  72   EKRGKSVMRGSLCVRKALPHDLPLMAVMVQQIEGMREIITEKHVWHLSDKAIKNVYLFYI  131

Query  436  MFTIWGCCFFGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiE  257
            MFT WGC +FGS KDP+YDSE+YRGDGGDGTG+W+Y+ QEDIEE++RAELWREELIEEIE
Sbjct  132  MFTCWGCLYFGSAKDPFYDSEEYRGDGGDGTGYWVYETQEDIEEKARAELWREELIEEIE  191

Query  256  QKV  248
            QKV
Sbjct  192  QKV  194



>ref|XP_009117596.1| PREDICTED: uncharacterized protein LOC103842686 isoform X5 [Brassica 
rapa]
Length=203

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 99/123 (80%), Gaps = 2/123 (2%)
 Frame = -3

Query  610  EGGGKS-RRGCRTRVNAFP-GLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYI  437
            E  GKS  RG      A P  L LMAVMV+ ++G R+++T K VWHLSD AIKNVY FYI
Sbjct  69   EKRGKSVMRGSLCVRKALPHDLPLMAVMVQQIEGMREIITEKHVWHLSDKAIKNVYLFYI  128

Query  436  MFTIWGCCFFGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiE  257
            MFT WGC +FGS KDP+YDSE+YRGDGGDGTG+W+Y+ QEDIEE++RAELWREELIEEIE
Sbjct  129  MFTCWGCLYFGSAKDPFYDSEEYRGDGGDGTGYWVYETQEDIEEKARAELWREELIEEIE  188

Query  256  QKV  248
            QKV
Sbjct  189  QKV  191



>dbj|BAJ84825.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK02877.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK02920.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92382.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=178

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 87/134 (65%), Gaps = 4/134 (3%)
 Frame = -3

Query  688  HCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKS-RRGCRTRVNAFP--GLQLMAVMVEHLD  518
            HC S LP      LN    P + + ++    + RRG   +  AFP   + LM  MVEH+D
Sbjct  11   HC-SALPSGRSSGLNGGSCPATVHVVQSSRPAGRRGDALKARAFPLDVVPLMVTMVEHVD  69

Query  517  GQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKDPYYDSEQYRGDGGDGTGH  338
             QRD V  KS+WHLSD AIK+ Y+FY MFT+WG CFF S KDP+YDSE YRG GGDGT H
Sbjct  70   NQRDWVVTKSIWHLSDTAIKSFYTFYAMFTVWGVCFFASMKDPFYDSEHYRGQGGDGTVH  129

Query  337  WIYDKQEDIEERSR  296
            W YD+QEDIE  +R
Sbjct  130  WYYDRQEDIEATAR  143



>ref|XP_009117593.1| PREDICTED: uncharacterized protein LOC103842686 isoform X2 [Brassica 
rapa]
Length=209

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 116/175 (66%), Gaps = 12/175 (7%)
 Frame = -3

Query  766  LSQHGKMAEAVMSFTIIKPRIHNPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKS-R  590
            L +   MAEA  +FT         +LH P        Q   +A    S  Q E  GKS  
Sbjct  33   LIKEVSMAEA-FTFT---------NLHVPFYSSYSPKQFSGTAHGWQSMKQNEKRGKSVM  82

Query  589  RGCRTRVNAFP-GLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCC  413
            RG      A P  L LMAVMV+ ++G R+++T K VWHLSD AIKNVY FYIMF+ WGC 
Sbjct  83   RGSLCVRKALPHDLPLMAVMVQQIEGMREIITEKHVWHLSDKAIKNVYLFYIMFSCWGCL  142

Query  412  FFGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            +FGS KDP+YDSE+YRG+ GDGTG+W+Y+ QEDIEE++RAELWREELIEEIEQKV
Sbjct  143  YFGSAKDPFYDSEEYRGESGDGTGYWVYETQEDIEEKARAELWREELIEEIEQKV  197



>ref|NP_001143837.1| uncharacterized protein LOC100276619 [Zea mays]
 gb|ACG35849.1| hypothetical protein [Zea mays]
Length=181

 Score =   144 bits (364),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 93/158 (59%), Gaps = 20/158 (13%)
 Frame = -3

Query  772  PILSQHGKMAEAVMSFTIIKPRIHNPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKS  593
            P+L  H ++A A    ++ +         CP+ L   LG+  +              G+S
Sbjct  4    PLLKSHSQLAAAAALHSVRRAD------RCPATLH--LGKFHDHGLR---------SGRS  46

Query  592  RRGCRTRVNAFPGLQ---LMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIW  422
            +R    RV AFP L    LM  MVEH+D  RD V  KS+WHLSD A+K+VY+FY MFT+W
Sbjct  47   KRSGSARVGAFPSLDVVPLMVTMVEHVDMSRDYVVTKSIWHLSDVALKSVYTFYAMFTVW  106

Query  421  GCCFFGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIE  308
            G CFF S KDP+YDSE YR  GGDGT HW YD+QED+E
Sbjct  107  GVCFFASMKDPFYDSETYRSQGGDGTVHWYYDRQEDLE  144



>gb|AFW73389.1| hypothetical protein ZEAMMB73_467288 [Zea mays]
Length=181

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 94/158 (59%), Gaps = 20/158 (13%)
 Frame = -3

Query  772  PILSQHGKMAEAVMSFTIIKPRIHNPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKS  593
            P+L  H ++A A    ++ +         CP+ +   LG+  +              G+S
Sbjct  4    PLLKSHSQLAAAAALHSVRRAD------RCPATIH--LGKFHDHGLR---------SGRS  46

Query  592  RRGCRTRVNAFPGLQ---LMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIW  422
            +R    +V AFP L    LM  MVEH+D  RD V  KS+WHLSDAA+K+VY+FY MFT+W
Sbjct  47   KRSGSAKVGAFPSLDVVPLMVTMVEHVDMSRDYVVTKSIWHLSDAALKSVYTFYAMFTVW  106

Query  421  GCCFFGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIE  308
            G CFF S KDP+YDSE YR  GGDGT HW YD+QED+E
Sbjct  107  GVCFFASMKDPFYDSETYRSQGGDGTVHWYYDRQEDLE  144



>gb|KCW48854.1| hypothetical protein EUGRSUZ_K02487 [Eucalyptus grandis]
Length=137

 Score =   142 bits (357),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 108/168 (64%), Gaps = 44/168 (26%)
 Frame = -3

Query  748  MAEAVMSFTIIKP-RIHNPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKSRRGCRTR  572
            MA+A+ SFTI  P R+H    H P +                                 R
Sbjct  1    MADAIRSFTIANPTRVHG---HIPKR---------------------------------R  24

Query  571  VNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKD  392
            ++  P  +L       ++GQR+ +T+KS+WHLSD A+K+VY+FYIMFT WGC FFGSTKD
Sbjct  25   LDMNPSSRL-------VEGQREFITNKSIWHLSDKALKSVYTFYIMFTCWGCLFFGSTKD  77

Query  391  PYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            PYYDSE+YR DGGDGTGHW+Y+KQEDIEE +RAELWREELIEEIEQKV
Sbjct  78   PYYDSEEYRKDGGDGTGHWVYEKQEDIEESARAELWREELIEEIEQKV  125



>gb|AAF27106.1|AC011809_15 Unknown protein [Arabidopsis thaliana]
Length=108

 Score =   140 bits (352),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = -3

Query  535  MVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKDPYYDSEQYRGDG  356
            MV+ ++G RD++T K VWHLSD AIKNVY FYIMFT WGC +FGS KDP+YDSE+YRGDG
Sbjct  1    MVQQIEGMRDIITEKHVWHLSDKAIKNVYMFYIMFTCWGCLYFGSAKDPFYDSEEYRGDG  60

Query  355  GDGTGHWIYDKQEDIEERSRAelwreelieeiEQKV  248
            GDGTG+W+Y+ QEDIEE++RAELWREELIEEIEQKV
Sbjct  61   GDGTGYWVYETQEDIEEKARAELWREELIEEIEQKV  96



>ref|XP_010236123.1| PREDICTED: uncharacterized protein LOC100837388 isoform X2 [Brachypodium 
distachyon]
Length=169

 Score =   142 bits (357),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 85/130 (65%), Gaps = 6/130 (5%)
 Frame = -3

Query  679  SKLPKPLGQCLNSAF---SPCSSYQIEGGGKSRRGCRTRVNAFPGLQ---LMAVMVEHLD  518
            S L KPL +C   +     P ++   +      RG   +  AFP L+   LMA MV+HL+
Sbjct  3    SPLLKPLPRCSAGSLHGGRPATTILQQRWRDGGRGTAMKARAFPSLEVVPLMATMVQHLE  62

Query  517  GQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKDPYYDSEQYRGDGGDGTGH  338
            GQRD V  KS+WHLSD AIK+ Y+FY MFT+WG CFF S KDP+YDSE YR  GGDGT H
Sbjct  63   GQRDWVVTKSIWHLSDTAIKSFYTFYAMFTVWGVCFFASMKDPFYDSEYYREQGGDGTVH  122

Query  337  WIYDKQEDIE  308
            W YD+QED+E
Sbjct  123  WYYDRQEDME  132



>gb|EEC73996.1| hypothetical protein OsI_08911 [Oryza sativa Indica Group]
Length=181

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 89/145 (61%), Gaps = 4/145 (3%)
 Frame = -3

Query  733  MSFTIIKPRIHNPSLHCPSKLPKPLGQC---LNSAFSPCSSYQIEGGGKSRRGCRTRVNA  563
            M+  ++K   H  SLH  ++  +  G+C   L     P S+         R   +   + 
Sbjct  1    MALPLLKSSPHFSSLHSANR-AQLHGRCRATLGGFHDPRSNSSRCKKSAGRGSVKANASP  59

Query  562  FPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKDPYY  383
               + LM  MVEH+D QRD V HKS+WHLSDAA+K+VY+FY  FT+WG CFF S KDP+Y
Sbjct  60   LDVVTLMVTMVEHVDLQRDYVVHKSIWHLSDAALKSVYTFYAFFTVWGICFFASMKDPFY  119

Query  382  DSEQYRGDGGDGTGHWIYDKQEDIE  308
            DSE YRG GGDGT HW YD+QED+E
Sbjct  120  DSEAYRGQGGDGTVHWYYDRQEDLE  144



>ref|XP_003570664.1| PREDICTED: uncharacterized protein LOC100837388 isoform X1 [Brachypodium 
distachyon]
Length=170

 Score =   140 bits (353),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 88/134 (66%), Gaps = 13/134 (10%)
 Frame = -3

Query  679  SKLPKPLGQCLNSAF---SPCSSYQIE----GGGKSRRGCRTRVNAFPGLQ---LMAVMV  530
            S L KPL +C   +     P ++  ++     GG   RG   +  AFP L+   LMA MV
Sbjct  3    SPLLKPLPRCSAGSLHGGRPATTQILQQRWRDGG---RGTAMKARAFPSLEVVPLMATMV  59

Query  529  EHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKDPYYDSEQYRGDGGD  350
            +HL+GQRD V  KS+WHLSD AIK+ Y+FY MFT+WG CFF S KDP+YDSE YR  GGD
Sbjct  60   QHLEGQRDWVVTKSIWHLSDTAIKSFYTFYAMFTVWGVCFFASMKDPFYDSEYYREQGGD  119

Query  349  GTGHWIYDKQEDIE  308
            GT HW YD+QED+E
Sbjct  120  GTVHWYYDRQEDME  133



>ref|NP_001048099.1| Os02g0744000 [Oryza sativa Japonica Group]
 dbj|BAD16118.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF10013.1| Os02g0744000 [Oryza sativa Japonica Group]
 dbj|BAG89269.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96980.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57798.1| hypothetical protein OsJ_08355 [Oryza sativa Japonica Group]
Length=181

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 89/145 (61%), Gaps = 4/145 (3%)
 Frame = -3

Query  733  MSFTIIKPRIHNPSLHCPSKLPKPLGQC---LNSAFSPCSSYQIEGGGKSRRGCRTRVNA  563
            M+  ++K   H  +LH  ++  +  G+C   L     P S+         R   +   + 
Sbjct  1    MALPLLKSSPHFSALHSANR-AQLHGRCRATLGGFHDPRSNSSRCKKSAGRGSVKANASP  59

Query  562  FPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKDPYY  383
               + LM  MVEH+D QRD V HKS+WHLSDAA+K+VY+FY  FT+WG CFF S KDP+Y
Sbjct  60   LDVVTLMVTMVEHVDLQRDYVVHKSIWHLSDAALKSVYTFYAFFTVWGICFFASMKDPFY  119

Query  382  DSEQYRGDGGDGTGHWIYDKQEDIE  308
            DSE YRG GGDGT HW YD+QED+E
Sbjct  120  DSEAYRGQGGDGTVHWYYDRQEDLE  144



>ref|XP_002454291.1| hypothetical protein SORBIDRAFT_04g028110 [Sorghum bicolor]
 gb|EES07267.1| hypothetical protein SORBIDRAFT_04g028110 [Sorghum bicolor]
Length=179

 Score =   139 bits (351),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 75/101 (74%), Gaps = 3/101 (3%)
 Frame = -3

Query  601  GKSRRGCRTRVNAFPGLQ---LMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMF  431
             +S+R    +V+AFP L    LM  MVEH+D  RD V  KS+WHLSDAA+K+VY+FY MF
Sbjct  47   ARSKRSGSAKVSAFPSLDVVPLMVTMVEHVDMSRDYVVTKSIWHLSDAALKSVYTFYAMF  106

Query  430  TIWGCCFFGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIE  308
            T+WG CFF S KDP+YDS+ YR  GGDGT HW YD+QED+E
Sbjct  107  TVWGVCFFASMKDPFYDSDTYRSQGGDGTVHWYYDRQEDLE  147



>ref|NP_001077559.2| NDH dependent flow 6 protein [Arabidopsis thaliana]
 gb|AEE29754.1| NDH dependent flow 6 protein [Arabidopsis thaliana]
Length=138

 Score =   137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 89/147 (61%), Gaps = 17/147 (12%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKSR-----RG  584
            MAEA  SFT     I +   H P +         NS   P   Y +    + R     RG
Sbjct  1    MAEAFTSFTFTNLHIPSSYNHSPKQ---------NSG--PNHGYWLSNVNEKRERNLMRG  49

Query  583  CRTRVNAFP-GLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFF  407
                  A P  L LMAVMV+ ++G RD++T K VWHLSD AIKNVY FYIMFT WGC +F
Sbjct  50   SLCVRKALPHDLPLMAVMVQQIEGMRDIITEKHVWHLSDKAIKNVYMFYIMFTCWGCLYF  109

Query  406  GSTKDPYYDSEQYRGDGGDGTGHWIYD  326
            GS KDP+YDSE+YRGDGGDGTG+W+Y+
Sbjct  110  GSAKDPFYDSEEYRGDGGDGTGYWVYE  136



>ref|NP_001117307.1| NDH dependent flow 6 protein [Arabidopsis thaliana]
 gb|AEE29756.1| NDH dependent flow 6 protein [Arabidopsis thaliana]
Length=161

 Score =   137 bits (345),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 89/147 (61%), Gaps = 17/147 (12%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKSR-----RG  584
            MAEA  SFT     I +   H P +         NS   P   Y +    + R     RG
Sbjct  1    MAEAFTSFTFTNLHIPSSYNHSPKQ---------NSG--PNHGYWLSNVNEKRERNLMRG  49

Query  583  CRTRVNAFP-GLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFF  407
                  A P  L LMAVMV+ ++G RD++T K VWHLSD AIKNVY FYIMFT WGC +F
Sbjct  50   SLCVRKALPHDLPLMAVMVQQIEGMRDIITEKHVWHLSDKAIKNVYMFYIMFTCWGCLYF  109

Query  406  GSTKDPYYDSEQYRGDGGDGTGHWIYD  326
            GS KDP+YDSE+YRGDGGDGTG+W+Y+
Sbjct  110  GSAKDPFYDSEEYRGDGGDGTGYWVYE  136



>ref|XP_004953875.1| PREDICTED: uncharacterized protein LOC101752621 isoform X1 [Setaria 
italica]
Length=209

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 98/173 (57%), Gaps = 14/173 (8%)
 Frame = -3

Query  772  PILSQHGKMAEAVMSFTIIKPRIHNP-SLHCPSKLPKPLGQCLNSA---FSPCSSYQIEG  605
            P L  H  +A A+ S          P ++H PS            +   F+   +  ++ 
Sbjct  4    PSLKSHSPVAAALHSARRADLHGRGPVTVHIPSSFTSMFQHFFQFSCRLFTCSGAVSLQL  63

Query  604  GGKSRRGCRT-------RVNAFPGLQ---LMAVMVEHLDGQRDLVTHKSVWHLSDAAIKN  455
            G    RG R+       +V+AFP L    LMA MV+H++  RD V  KS+WHLSD A+K+
Sbjct  64   GRFHDRGFRSSNSKRSAKVSAFPSLDMVPLMATMVDHVNMSRDYVVTKSIWHLSDTALKS  123

Query  454  VYSFYIMFTIWGCCFFGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSR  296
            VY+FY MFT+WG CFF S KDP+YDS+ YR  GGDGT HW YDKQED+E  +R
Sbjct  124  VYTFYAMFTVWGVCFFASMKDPFYDSDTYRSQGGDGTVHWYYDKQEDLEASAR  176



>ref|XP_006647878.1| PREDICTED: uncharacterized protein LOC102721335 [Oryza brachyantha]
Length=181

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = -3

Query  592  RRGCRTRVNAFPGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCC  413
            R   +T  + F  + LM  MVEH+D QRD V HKS+WHLSDAA+K+VY+FY MFT+WG C
Sbjct  50   RGSVKTNASPFDVVTLMVTMVEHVDMQRDYVVHKSIWHLSDAALKSVYTFYAMFTVWGIC  109

Query  412  FFGSTKDPYYDSEQYRGDGGDGTGHWIYDKQ  320
            FF S KDP+YDSE YRG GGDGT HW YD+Q
Sbjct  110  FFASMKDPFYDSEAYRGQGGDGTVHWYYDRQ  140



>ref|XP_004953876.1| PREDICTED: uncharacterized protein LOC101752621 isoform X2 [Setaria 
italica]
Length=178

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 73/97 (75%), Gaps = 3/97 (3%)
 Frame = -3

Query  577  TRVNAFPGLQ---LMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFF  407
             +V+AFP L    LMA MV+H++  RD V  KS+WHLSD A+K+VY+FY MFT+WG CFF
Sbjct  49   AKVSAFPSLDMVPLMATMVDHVNMSRDYVVTKSIWHLSDTALKSVYTFYAMFTVWGVCFF  108

Query  406  GSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSR  296
             S KDP+YDS+ YR  GGDGT HW YDKQED+E  +R
Sbjct  109  ASMKDPFYDSDTYRSQGGDGTVHWYYDKQEDLEASAR  145



>gb|KDO55534.1| hypothetical protein CISIN_1g0309741mg, partial [Citrus sinensis]
Length=114

 Score =   133 bits (335),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -3

Query  547  LMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKDPYYDSEQY  368
            L+A++VEH +GQRDL+T KS+WHLSD AIKNVY FYIMFT WGC FF +TKDPYYDS+ Y
Sbjct  3    LIAILVEHAEGQRDLITEKSIWHLSDQAIKNVYLFYIMFTCWGCMFFSATKDPYYDSDAY  62

Query  367  RGDGGDGTGHWIYDKQ  320
            R DGGDGTGHW Y+KQ
Sbjct  63   REDGGDGTGHWFYEKQ  78



>ref|XP_002447940.1| hypothetical protein SORBIDRAFT_06g018500 [Sorghum bicolor]
 gb|EES12268.1| hypothetical protein SORBIDRAFT_06g018500 [Sorghum bicolor]
Length=182

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 71/93 (76%), Gaps = 3/93 (3%)
 Frame = -3

Query  577  TRVNAFPGLQ---LMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFF  407
             +V+A P L+   LM  MVEH+D  RD V  KS+WHLSDAA+K+VY+FY MFT+WG CFF
Sbjct  58   AKVSALPSLEVVPLMVTMVEHVDMSRDYVVTKSIWHLSDAALKSVYTFYAMFTVWGVCFF  117

Query  406  GSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIE  308
             S KDP+YDS+ YR  GGDGT HW YD+QED+E
Sbjct  118  ASMKDPFYDSDTYRSAGGDGTVHWYYDRQEDLE  150



>ref|XP_006416572.1| hypothetical protein EUTSA_v10008902mg [Eutrema salsugineum]
 gb|ESQ34925.1| hypothetical protein EUTSA_v10008902mg [Eutrema salsugineum]
Length=160

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 86/142 (61%), Gaps = 6/142 (4%)
 Frame = -3

Query  748  MAEAVMSFTIIKPRIHNPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKSRRGCRTRV  569
            MA+A  S T     I + S   P ++  P     N  +        +      RG     
Sbjct  1    MAKAFTSSTFTNLHIPSSSNFPPKQISGP-----NHGYWLSMKVNEKREKNLMRGSLCVR  55

Query  568  NAFP-GLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKD  392
             A P  L LMAVMV+ ++G RD++T K VWHLSD AIKNVY FYIMFT WGC +FGS KD
Sbjct  56   KALPHDLPLMAVMVQQIEGMRDIITEKHVWHLSDKAIKNVYMFYIMFTCWGCLYFGSAKD  115

Query  391  PYYDSEQYRGDGGDGTGHWIYD  326
            P+YDSE+YRGDGGDGTG+W+Y+
Sbjct  116  PFYDSEEYRGDGGDGTGYWVYE  137



>gb|ACG44895.1| hypothetical protein [Zea mays]
Length=116

 Score =   127 bits (320),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = -3

Query  544  MAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKDPYYDSEQYR  365
            M  MVEH+D  RD V  KS+WHLSD A+K+VY+FY MFT+WG CFF S KDP+YDSE YR
Sbjct  1    MVTMVEHVDMSRDYVVTKSIWHLSDVALKSVYTFYAMFTVWGVCFFASMKDPFYDSETYR  60

Query  364  GDGGDGTGHWIYDKQEDIE  308
              GGDGT HW YD+QED+E
Sbjct  61   SQGGDGTVHWYYDRQEDLE  79



>ref|XP_006440620.1| hypothetical protein CICLE_v10022880mg [Citrus clementina]
 gb|ESR53860.1| hypothetical protein CICLE_v10022880mg [Citrus clementina]
Length=117

 Score =   119 bits (299),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 75/116 (65%), Gaps = 3/116 (3%)
 Frame = -3

Query  733  MSFTIIKPRIHNPSLHCPSKLPKPLGQCLN--SAFSPCSSYQIEGGGKSRRGCRTRVNAF  560
            MSFTI  P + + SL        P  + L   S     + +Q   G K RRGC +RVNAF
Sbjct  1    MSFTITTPNVQS-SLQSTKFDTYPCSKSLKQGSRTKLFNGWQQLEGSKKRRGCLSRVNAF  59

Query  559  PGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKD  392
            P   L+A++VEH +GQRDL+T KS+WHLSD AIKNVY FYIMFT WGC FF +TKD
Sbjct  60   PDWPLIAILVEHAEGQRDLITEKSIWHLSDQAIKNVYLFYIMFTCWGCMFFSATKD  115



>ref|XP_006440621.1| hypothetical protein CICLE_v10022880mg [Citrus clementina]
 gb|ESR53861.1| hypothetical protein CICLE_v10022880mg [Citrus clementina]
Length=123

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 74/115 (64%), Gaps = 3/115 (3%)
 Frame = -3

Query  733  MSFTIIKPRIHNPSLHCPSKLPKPLGQCLN--SAFSPCSSYQIEGGGKSRRGCRTRVNAF  560
            MSFTI  P + + SL        P  + L   S     + +Q   G K RRGC +RVNAF
Sbjct  1    MSFTITTPNVQS-SLQSTKFDTYPCSKSLKQGSRTKLFNGWQQLEGSKKRRGCLSRVNAF  59

Query  559  PGLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTK  395
            P   L+A++VEH +GQRDL+T KS+WHLSD AIKNVY FYIMFT WGC FF +TK
Sbjct  60   PDWPLIAILVEHAEGQRDLITEKSIWHLSDQAIKNVYLFYIMFTCWGCMFFSATK  114



>gb|EMT12134.1| hypothetical protein F775_30843 [Aegilops tauschii]
Length=195

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 85/167 (51%), Gaps = 28/167 (17%)
 Frame = -3

Query  733  MSFTIIKPRIHNPSLHCPSKLPKPLGQCLNSAFSPCSSYQIEGGGKSRRGCRTRVNAFP-  557
            M+ +++KP  H     C S LP      L+    P ++  ++G    RRG   +  AFP 
Sbjct  1    MASSLLKPHSH-----C-SALPSGRSGGLHGGSCPATARVVQGPA-GRRGDALKARAFPL  53

Query  556  -GLQLMAVMVEHLDGQRDLVTHKSVWHLSDAAIKN-------------------VYSFYI  437
              + LM  MVEH+D QRD V  KS+WHLSD AIK+                    Y  ++
Sbjct  54   DVVPLMVTMVEHVDNQRDWVVTKSIWHLSDTAIKSFCETSVCASCTDAASVMSETYVVFV  113

Query  436  MFTIWGCCFFGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSR  296
               +    F+    DP+YDSE YRG GGDGT HW YD+QEDIE  +R
Sbjct  114  HLFVRVDTFYAMFTDPFYDSEHYRGQGGDGTVHWYYDRQEDIEATAR  160



>ref|XP_007037397.1| NDH dependent flow 6 isoform 2 [Theobroma cacao]
 gb|EOY21898.1| NDH dependent flow 6 isoform 2 [Theobroma cacao]
Length=133

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 81/123 (66%), Gaps = 28/123 (23%)
 Frame = -3

Query  604  GGKSRRGCRT-RVNAFPGLQLMAVMV---EHLDGQRDLVTHKSVWHLSDAAIKNVYSFYI  437
            G  SRRG  + + NAFP   LMAV+V   + LD QR+++T+KS+WHLS+ AIKNVY+FYI
Sbjct  23   GSNSRRGVASVKANAFPDWPLMAVLVHNVQQLDAQREIITNKSIWHLSEEAIKNVYTFYI  82

Query  436  MFTIWGCCFFGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIEERSRAelwreelieeiE  257
            MFT WGC FFGST                        KQEDIEE +RAELWREELIEEIE
Sbjct  83   MFTCWGCLFFGST------------------------KQEDIEESARAELWREELIEEIE  118

Query  256  QKV  248
            QKV
Sbjct  119  QKV  121



>gb|AFW73390.1| hypothetical protein ZEAMMB73_467288 [Zea mays]
Length=129

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 51/73 (70%), Gaps = 3/73 (4%)
 Frame = -3

Query  604  GGKSRRGCRTRVNAFPGLQ---LMAVMVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIM  434
             G+S+R    +V AFP L    LM  MVEH+D  RD V  KS+WHLSDAA+K+VY+FY M
Sbjct  43   SGRSKRSGSAKVGAFPSLDVVPLMVTMVEHVDMSRDYVVTKSIWHLSDAALKSVYTFYAM  102

Query  433  FTIWGCCFFGSTK  395
            FT+WG CFF S K
Sbjct  103  FTVWGVCFFASMK  115



>gb|EMS58957.1| hypothetical protein TRIUR3_28502 [Triticum urartu]
Length=109

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 52/81 (64%), Gaps = 6/81 (7%)
 Frame = -3

Query  535  MVEHLDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKDPYYDSEQYRGDG  356
            MVEH+D QRD V  KS+WHLSD AIK   SF    T         + DP+YDSE YRG G
Sbjct  1    MVEHVDNQRDWVVTKSIWHLSDTAIK---SFCETST---NSSSRHSLDPFYDSEHYRGQG  54

Query  355  GDGTGHWIYDKQEDIEERSRA  293
            GDGT HW YD+QEDIE  +R 
Sbjct  55   GDGTVHWYYDRQEDIEATARG  75



>emb|CCI55390.1| NDH subunit PnsB4 [Marchantia polymorpha]
Length=208

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -3

Query  523  LDGQRDLVTHKSVWHLSDAAIKNVYSFYIMFTIWGCCFFGSTKDPYYDSEQYRGDGGDGT  344
            LD  RD+V  +S W L + AIK+ Y        WGCC FGS  D +Y+S+ YRG GG+GT
Sbjct  99   LDITRDIVDDRSTWSLGEDAIKHFYMACAFVFCWGCCVFGSMNDKFYESDTYRGAGGNGT  158

Query  343  GHWIYDKQEDIEERSR  296
            GHWIYD +E  E  +R
Sbjct  159  GHWIYDLEEREEAAAR  174



>ref|XP_001770631.1| predicted protein [Physcomitrella patens]
 gb|EDQ64614.1| predicted protein [Physcomitrella patens]
Length=90

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  436  MFTIWGCCFFGSTKDPYYDSEQYRGDGGDGTGHWIYD  326
            M   WGCC FGS  DP+Y+SE YRG GG+GT HWIYD
Sbjct  8    MVFCWGCCVFGSMTDPFYESEDYRGAGGNGTNHWIYD  44



>ref|XP_008681641.1| PREDICTED: uncharacterized protein LOC100276619 isoform X1 [Zea 
mays]
Length=185

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -3

Query  415  CFFGSTKDPYYDSEQYRGDGGDGTGHWIYDKQEDIE  308
             +  S +DP+YDSE YR  GGDGT HW YD+QED+E
Sbjct  113  AWVKSKQDPFYDSETYRSQGGDGTVHWYYDRQEDLE  148



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1497539801044