BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79839_g1_i1 len=878 path=[1:0-877]

Length=878
                                                                      Score     E

emb|CDO99427.1|  unnamed protein product                                437   8e-142   
emb|CDY00872.1|  BnaCnng00720D                                          402   8e-137   
gb|KFK31081.1|  hypothetical protein AALP_AA6G065900                    424   9e-137   
ref|XP_010069060.1|  PREDICTED: cellulose synthase-like protein D1      424   1e-136   
dbj|BAD43631.1|  putative cellulose synthase                            417   2e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010509927.1|  PREDICTED: cellulose synthase-like protein D1      423   2e-136   
ref|XP_002881261.1|  hypothetical protein ARALYDRAFT_482247             422   5e-136   
emb|CDY23769.1|  BnaC04g43530D                                          422   5e-136   
ref|XP_009141287.1|  PREDICTED: cellulose synthase-like protein D1      422   5e-136   
ref|XP_006293609.1|  hypothetical protein CARUB_v10022555mg             421   9e-136   
ref|XP_010413915.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    421   1e-135   
ref|XP_006410449.1|  hypothetical protein EUTSA_v10016169mg             421   2e-135   
ref|XP_010469517.1|  PREDICTED: cellulose synthase-like protein D1      421   2e-135   
ref|NP_180869.1|  cellulose synthase-like protein D1                    419   5e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011091410.1|  PREDICTED: cellulose synthase-like protein D1      419   7e-135   
ref|XP_010258715.1|  PREDICTED: cellulose synthase-like protein D1      418   4e-134   
ref|XP_004239868.1|  PREDICTED: cellulose synthase-like protein D1      416   1e-133   
gb|KEH37378.1|  cellulose synthase-like protein                         416   1e-133   
gb|EPS66341.1|  hypothetical protein M569_08434                         416   1e-133   
gb|AFZ78592.1|  cellulose synthase-like protein                         415   2e-133   
ref|XP_002304709.1|  cellulose synthase family protein                  415   2e-133   Populus trichocarpa [western balsam poplar]
ref|XP_006349527.1|  PREDICTED: cellulose synthase-like protein D...    415   3e-133   
ref|XP_010673439.1|  PREDICTED: cellulose synthase-like protein D1      414   3e-133   
gb|EYU31744.1|  hypothetical protein MIMGU_mgv1a020208mg                411   1e-131   
ref|XP_008438379.1|  PREDICTED: cellulose synthase-like protein D1      409   4e-131   
ref|XP_009601450.1|  PREDICTED: cellulose synthase-like protein D1      408   2e-130   
ref|XP_004134379.1|  PREDICTED: cellulose synthase-like protein D...    408   2e-130   
ref|XP_010109052.1|  Cellulose synthase-like protein D1                 405   1e-129   
ref|NP_001169669.1|  uncharacterized protein LOC100383550               392   1e-129   Zea mays [maize]
ref|XP_009779529.1|  PREDICTED: cellulose synthase-like protein D1      404   5e-129   
ref|XP_006845742.1|  hypothetical protein AMTR_s00019p00246190          404   9e-129   
ref|XP_007034422.1|  Cellulose synthase-like D1                         403   1e-128   
gb|KDO49384.1|  hypothetical protein CISIN_1g0360642mg                  399   2e-128   
ref|XP_010522413.1|  PREDICTED: cellulose synthase-like protein D1      402   2e-128   
emb|CDY17138.1|  BnaA05g10500D                                          399   9e-128   
ref|XP_006489806.1|  PREDICTED: cellulose synthase-like protein D...    400   1e-127   
ref|XP_011020671.1|  PREDICTED: cellulose synthase-like protein D1      400   1e-127   
emb|CDY19449.1|  BnaC04g11500D                                          399   1e-127   
ref|XP_007225503.1|  hypothetical protein PRUPE_ppa000644mg             400   1e-127   
ref|XP_004296630.1|  PREDICTED: cellulose synthase-like protein D...    400   2e-127   
ref|XP_008224588.1|  PREDICTED: cellulose synthase-like protein D1      399   4e-127   
ref|XP_002518122.1|  Cellulose synthase A catalytic subunit 1 [UD...    399   4e-127   Ricinus communis
ref|XP_009143896.1|  PREDICTED: cellulose synthase-like protein D1      398   5e-127   
gb|EMT24169.1|  Cellulose synthase-like protein D2                      395   6e-127   
ref|XP_011006034.1|  PREDICTED: cellulose synthase-like protein D2      400   1e-126   
ref|XP_004162892.1|  PREDICTED: cellulose synthase-like protein D...    387   1e-126   
ref|XP_002274474.1|  PREDICTED: cellulose synthase-like protein D1      396   4e-126   Vitis vinifera
ref|XP_003557145.1|  PREDICTED: cellulose synthase-like protein D2      399   4e-126   
gb|AFM37967.1|  cellulose synthase-like protein D                       398   4e-126   
ref|XP_009608734.1|  PREDICTED: cellulose synthase-like protein D3      398   7e-126   
ref|XP_006854073.1|  hypothetical protein AMTR_s00048p00116140          398   7e-126   
gb|EMS48924.1|  Cellulose synthase-like protein D2                      393   7e-126   
ref|XP_009788168.1|  PREDICTED: cellulose synthase-like protein D3      397   8e-126   
ref|XP_010558640.1|  PREDICTED: cellulose synthase-like protein D3      397   1e-125   
ref|XP_009415293.1|  PREDICTED: cellulose synthase-like protein D2      397   2e-125   
gb|KHG15890.1|  Cellulose synthase-like protein D3                      397   2e-125   
ref|XP_009386238.1|  PREDICTED: cellulose synthase-like protein D2      397   2e-125   
ref|XP_008354283.1|  PREDICTED: cellulose synthase-like protein D3      396   2e-125   
ref|XP_009130327.1|  PREDICTED: cellulose synthase-like protein D3      396   3e-125   
gb|KHG15286.1|  Cellulose synthase-like protein D3                      396   3e-125   
ref|XP_009351828.1|  PREDICTED: cellulose synthase-like protein D3      396   3e-125   
ref|XP_008786432.1|  PREDICTED: cellulose synthase-like protein D2      396   3e-125   
ref|XP_006656561.1|  PREDICTED: cellulose synthase-like protein D...    390   4e-125   
ref|XP_009119010.1|  PREDICTED: cellulose synthase-like protein D3      396   4e-125   
ref|XP_006296860.1|  hypothetical protein CARUB_v10012847mg             395   8e-125   
ref|XP_006400233.1|  hypothetical protein EUTSA_v10012495mg             394   1e-124   
ref|XP_004235281.1|  PREDICTED: cellulose synthase-like protein D3      394   1e-124   
ref|XP_006286350.1|  hypothetical protein CARUB_v10000079mg             394   2e-124   
ref|XP_010485639.1|  PREDICTED: cellulose synthase-like protein D3      394   2e-124   
gb|KHN34145.1|  Cellulose synthase-like protein D1                      392   2e-124   
ref|XP_010549830.1|  PREDICTED: cellulose synthase-like protein D3      394   2e-124   
ref|XP_010463749.1|  PREDICTED: cellulose synthase-like protein D3      394   3e-124   
ref|XP_004964325.1|  PREDICTED: cellulose synthase-like protein D...    394   3e-124   
ref|XP_008459144.1|  PREDICTED: cellulose synthase-like protein D3      394   3e-124   
ref|XP_009361165.1|  PREDICTED: cellulose synthase-like protein D3      394   3e-124   
ref|NP_197193.1|  cellulose synthase-like protein D2                    393   3e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010925919.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    387   4e-124   
ref|XP_004307862.1|  PREDICTED: cellulose synthase-like protein D...    393   4e-124   
dbj|BAJ93918.1|  predicted protein                                      394   4e-124   
ref|NP_186955.1|  cellulose synthase-like protein D3                    393   4e-124   Arabidopsis thaliana [mouse-ear cress]
gb|KHN35142.1|  Cellulose synthase-like protein D3                      392   4e-124   
ref|XP_002871742.1|  hypothetical protein ARALYDRAFT_488554             393   4e-124   
gb|KDO47249.1|  hypothetical protein CISIN_1g001213mg                   392   4e-124   
ref|XP_004156753.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    393   4e-124   
ref|XP_008805561.1|  PREDICTED: cellulose synthase-like protein D1      386   4e-124   
ref|XP_007131523.1|  hypothetical protein PHAVU_011G020100g             393   5e-124   
ref|XP_007029578.1|  Cellulose synthase-like D3                         394   5e-124   
ref|XP_006347576.1|  PREDICTED: cellulose synthase-like protein D...    392   6e-124   
ref|XP_006443224.1|  hypothetical protein CICLE_v10023400mg             392   6e-124   
ref|XP_007157068.1|  hypothetical protein PHAVU_002G040200g             392   7e-124   
ref|XP_008451182.1|  PREDICTED: cellulose synthase-like protein D4      392   7e-124   
gb|AFK35232.1|  unknown                                                 368   7e-124   
ref|XP_004148100.1|  PREDICTED: cellulose synthase-like protein D...    392   9e-124   
ref|XP_003517548.1|  PREDICTED: cellulose synthase-like protein D...    392   9e-124   
ref|XP_003537778.1|  PREDICTED: cellulose synthase-like protein D...    392   9e-124   
ref|XP_002436356.1|  hypothetical protein SORBIDRAFT_10g000980          392   1e-123   Sorghum bicolor [broomcorn]
ref|XP_010087475.1|  Cellulose synthase-like protein D3                 392   1e-123   
ref|XP_002882269.1|  hypothetical protein ARALYDRAFT_477551             392   1e-123   
ref|XP_008789902.1|  PREDICTED: cellulose synthase-like protein D...    391   1e-123   
gb|ABK93618.1|  unknown                                                 367   2e-123   Populus trichocarpa [western balsam poplar]
ref|XP_008658883.1|  PREDICTED: uncharacterized protein LOC100383...    392   2e-123   
ref|XP_010267650.1|  PREDICTED: cellulose synthase-like protein D3      392   2e-123   
ref|XP_008376925.1|  PREDICTED: cellulose synthase-like protein D3      391   2e-123   
ref|XP_009126147.1|  PREDICTED: cellulose synthase-like protein D...    391   2e-123   
gb|AFZ78593.1|  cellulose synthase-like protein                         389   2e-123   
ref|XP_008789900.1|  PREDICTED: cellulose synthase-like protein D...    391   2e-123   
ref|XP_006408348.1|  hypothetical protein EUTSA_v10019935mg             391   2e-123   
ref|XP_001769140.1|  cellulose synthase-like D3, glycosyltransfer...    391   4e-123   
gb|KDP21765.1|  hypothetical protein JCGZ_00552                         390   4e-123   
ref|XP_009376356.1|  PREDICTED: cellulose synthase-like protein D1      389   5e-123   
sp|A2YU42.1|CSLD2_ORYSI  RecName: Full=Cellulose synthase-like pr...    390   5e-123   Oryza sativa Indica Group [Indian rice]
ref|NP_001056589.1|  Os06g0111800                                       390   6e-123   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009374628.1|  PREDICTED: cellulose synthase-like protein D1      388   7e-123   
ref|XP_002274896.1|  PREDICTED: cellulose synthase-like protein D3      390   8e-123   Vitis vinifera
emb|CDO97026.1|  unnamed protein product                                389   8e-123   
gb|KHN36420.1|  Cellulose synthase-like protein D1                      385   8e-123   
ref|XP_010671117.1|  PREDICTED: cellulose synthase-like protein D3      389   8e-123   
ref|XP_008380666.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    388   9e-123   
ref|XP_008805451.1|  PREDICTED: cellulose synthase-like protein D4      389   1e-122   
ref|XP_008800063.1|  PREDICTED: cellulose synthase-like protein D2      389   2e-122   
ref|XP_002297815.1|  cellulose synthase family protein                  386   2e-122   Populus trichocarpa [western balsam poplar]
ref|XP_004148102.1|  PREDICTED: cellulose synthase-like protein D...    389   2e-122   
ref|XP_008459143.1|  PREDICTED: cellulose synthase-like protein D3      389   2e-122   
ref|XP_006588165.1|  PREDICTED: cellulose synthase-like protein D...    385   2e-122   
gb|KDO57192.1|  hypothetical protein CISIN_1g003243mg                   381   3e-122   
gb|EMT31463.1|  Cellulose synthase-like protein D1                      388   3e-122   
ref|XP_003572134.1|  PREDICTED: cellulose synthase-like protein D1      388   3e-122   
ref|XP_010940784.1|  PREDICTED: cellulose synthase-like protein D2      388   3e-122   
ref|XP_003607427.1|  Cellulose synthase-like protein                    388   3e-122   
ref|XP_009387033.1|  PREDICTED: cellulose synthase-like protein D4      388   3e-122   
ref|XP_011070338.1|  PREDICTED: cellulose synthase-like protein D...    388   5e-122   
ref|XP_004144564.1|  PREDICTED: cellulose synthase-like protein D...    387   5e-122   
ref|XP_011070339.1|  PREDICTED: cellulose synthase-like protein D...    387   5e-122   
gb|EYU45377.1|  hypothetical protein MIMGU_mgv1a000447mg                387   5e-122   
ref|XP_011034477.1|  PREDICTED: cellulose synthase-like protein D...    385   6e-122   
ref|XP_010417413.1|  PREDICTED: cellulose synthase-like protein D3      387   6e-122   
gb|KDP20319.1|  hypothetical protein JCGZ_06405                         385   6e-122   
ref|XP_011034478.1|  PREDICTED: cellulose synthase-like protein D...    385   7e-122   
ref|XP_010053642.1|  PREDICTED: cellulose synthase-like protein D3      386   8e-122   
ref|XP_009771399.1|  PREDICTED: cellulose synthase-like protein D3      387   9e-122   
gb|ABI75157.1|  cellulose synthase-like D7                              387   1e-121   Physcomitrella patens
sp|Q8W3F9.1|CSLD1_ORYSJ  RecName: Full=Cellulose synthase-like pr...    386   1e-121   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004505600.1|  PREDICTED: cellulose synthase-like protein D...    387   1e-121   
ref|XP_010492624.1|  PREDICTED: cellulose synthase-like protein D2      387   1e-121   
ref|XP_001778678.1|  cellulose synthase-like D7, glycosyltransfer...    387   1e-121   
ref|XP_010420398.1|  PREDICTED: cellulose synthase-like protein D2      386   1e-121   
ref|XP_009625984.1|  PREDICTED: cellulose synthase-like protein D3      386   1e-121   
gb|ABI75153.1|  cellulose synthase-like D3                              387   2e-121   Physcomitrella patens
ref|XP_002467425.1|  hypothetical protein SORBIDRAFT_01g027880          386   2e-121   Sorghum bicolor [broomcorn]
ref|XP_004983532.1|  PREDICTED: cellulose synthase-like protein D...    386   2e-121   
ref|XP_008658791.1|  PREDICTED: cellulose synthase-like protein D1      386   2e-121   
ref|XP_007043112.1|  Cellulose synthase like D4                         385   3e-121   
ref|XP_010914015.1|  PREDICTED: cellulose synthase-like protein D4      385   4e-121   
ref|XP_006361262.1|  PREDICTED: cellulose synthase-like protein D...    385   4e-121   
gb|AFZ78588.1|  cellulose synthase-like protein                         380   8e-121   
gb|EYU45259.1|  hypothetical protein MIMGU_mgv1a000454mg                384   8e-121   
ref|XP_007201219.1|  hypothetical protein PRUPE_ppa000490mg             384   9e-121   
ref|XP_004244666.1|  PREDICTED: cellulose synthase-like protein D3      384   9e-121   
gb|KHN46458.1|  Cellulose synthase-like protein D3                      382   9e-121   
ref|XP_002325817.2|  cellulase synthase 3 family protein                384   1e-120   Populus trichocarpa [western balsam poplar]
gb|ABI75158.1|  cellulose synthase-like D8                              384   1e-120   Physcomitrella patens
emb|CDP14480.1|  unnamed protein product                                384   1e-120   
ref|XP_009792052.1|  PREDICTED: cellulose synthase-like protein D3      383   2e-120   
ref|XP_010025659.1|  PREDICTED: cellulose synthase-like protein D4      382   2e-120   
ref|XP_003625939.1|  Cellulose synthase-like protein D5                 370   3e-120   
ref|XP_003540119.1|  PREDICTED: cellulose synthase-like protein D...    383   3e-120   
ref|XP_006662106.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    382   3e-120   
ref|XP_007153296.1|  hypothetical protein PHAVU_003G023000g             379   3e-120   
ref|XP_001764498.1|  cellulose synthase-like D8, glycosyltransfer...    383   3e-120   
gb|EMS51869.1|  Cellulose synthase-like protein D1                      383   3e-120   
ref|XP_004245916.1|  PREDICTED: cellulose synthase-like protein D3      382   3e-120   
ref|XP_001779999.1|  cellulose synthase-like D5, glycosyltransfer...    382   4e-120   
gb|KHN04843.1|  Cellulose synthase-like protein D3                      382   4e-120   
ref|XP_002520032.1|  Cellulose synthase A catalytic subunit 3 [UD...    382   5e-120   Ricinus communis
ref|XP_003517664.1|  PREDICTED: cellulose synthase-like protein D...    382   5e-120   
ref|XP_007153294.1|  hypothetical protein PHAVU_003G023000g             379   5e-120   
ref|XP_009607206.1|  PREDICTED: cellulose synthase-like protein D3      382   5e-120   
ref|XP_007158244.1|  hypothetical protein PHAVU_002G136300g             382   5e-120   
ref|XP_003612797.1|  Cellulose synthase-like protein                    382   6e-120   
ref|XP_006656942.1|  PREDICTED: putative cellulose synthase-like ...    375   6e-120   
ref|XP_007153295.1|  hypothetical protein PHAVU_003G023000g             379   7e-120   
ref|XP_006376007.1|  cellulase synthase 3 family protein                382   7e-120   
ref|XP_010276804.1|  PREDICTED: cellulose synthase-like protein D3      382   8e-120   
ref|XP_002280032.1|  PREDICTED: cellulose synthase-like protein D4      381   9e-120   Vitis vinifera
ref|XP_006432701.1|  hypothetical protein CICLE_v10000098mg             380   1e-119   
ref|XP_003589804.1|  Cellulose synthase D-like protein                  380   2e-119   
ref|XP_006471487.1|  PREDICTED: cellulose synthase-like protein D...    380   2e-119   
ref|XP_011077183.1|  PREDICTED: cellulose synthase-like protein D4      380   2e-119   
ref|XP_011007166.1|  PREDICTED: cellulose synthase-like protein D3      380   2e-119   
ref|XP_004487933.1|  PREDICTED: cellulose synthase-like protein D...    379   2e-119   
ref|XP_001781718.1|  cellulose synthase-like D6, glycosyltransfer...    381   2e-119   
ref|XP_008235918.1|  PREDICTED: cellulose synthase-like protein D4      380   2e-119   
ref|XP_002313568.1|  cellulose synthase family protein                  380   2e-119   Populus trichocarpa [western balsam poplar]
ref|XP_001769175.1|  cellulose synthase-like D4, glycosyltransfer...    381   2e-119   
gb|ACM89779.1|  truncated cellulose synthase                            362   2e-119   Gossypium hirsutum [American cotton]
gb|AFZ78591.1|  cellulose synthase-like protein                         380   2e-119   
gb|AES60055.2|  cellulose synthase-like protein                         380   2e-119   
ref|XP_011075792.1|  PREDICTED: cellulose synthase-like protein D3      380   5e-119   
ref|XP_004512470.1|  PREDICTED: cellulose synthase-like protein D...    379   5e-119   
ref|XP_006352916.1|  PREDICTED: cellulose synthase-like protein D...    379   5e-119   
ref|XP_004511422.1|  PREDICTED: cellulose synthase-like protein D...    379   5e-119   
gb|KHN38323.1|  Cellulose synthase-like protein D4                      377   6e-119   
ref|XP_001778677.1|  cellulose synthase-like D1, glycosyltransfer...    380   6e-119   
gb|ABI75154.1|  cellulose synthase-like D4                              380   7e-119   Physcomitrella patens
ref|XP_002966771.1|  cellulose synthase-like D3-1, glycosyltransf...    379   8e-119   
ref|XP_002977978.1|  cellulose synthase-like D3-2, glycosyltransf...    379   8e-119   
ref|XP_011000846.1|  PREDICTED: cellulose synthase-like protein D4      379   8e-119   
ref|XP_004301655.1|  PREDICTED: cellulose synthase-like protein D...    378   1e-118   
ref|XP_004292316.1|  PREDICTED: cellulose synthase-like protein D...    378   2e-118   
gb|ABI75151.1|  cellulose synthase-like D1                              379   2e-118   Physcomitrella patens
emb|CAN70317.1|  hypothetical protein VITISV_038092                     377   2e-118   Vitis vinifera
ref|XP_006411601.1|  hypothetical protein EUTSA_v10024267mg             377   2e-118   
ref|XP_002868836.1|  hypothetical protein ARALYDRAFT_490578             377   3e-118   
emb|CDY61894.1|  BnaAnng17960D                                          376   3e-118   
ref|XP_003533446.1|  PREDICTED: cellulose synthase-like protein D...    377   3e-118   
ref|XP_007210976.1|  hypothetical protein PRUPE_ppa021772mg             377   3e-118   
ref|XP_004494401.1|  PREDICTED: cellulose synthase-like protein D...    377   3e-118   
gb|KEH40956.1|  cellulose synthase-like protein                         377   3e-118   
ref|XP_008238167.1|  PREDICTED: cellulose synthase-like protein D3      377   4e-118   
ref|XP_003519547.1|  PREDICTED: cellulose synthase-like protein D...    377   4e-118   
gb|AAO03579.1|  cellulose synthase-like protein D4                      376   4e-118   Populus tremuloides
ref|XP_002518991.1|  cellulose synthase, putative                       376   5e-118   Ricinus communis
ref|XP_002514401.1|  cellulose synthase, putative                       376   5e-118   Ricinus communis
ref|XP_010663029.1|  PREDICTED: cellulose synthase-like protein D2      376   6e-118   
ref|XP_004494400.1|  PREDICTED: cellulose synthase-like protein D...    377   6e-118   
ref|XP_010055254.1|  PREDICTED: cellulose synthase-like protein D2      376   6e-118   
gb|KHN11971.1|  Cellulose synthase-like protein D4                      375   7e-118   
gb|EYU19742.1|  hypothetical protein MIMGU_mgv1a017980mg                376   9e-118   
ref|XP_006422380.1|  hypothetical protein CICLE_v10029850mg             375   1e-117   
ref|XP_010446321.1|  PREDICTED: cellulose synthase-like protein D4      375   1e-117   
dbj|BAO02532.1|  predicted cellulose synthase D-like                    365   2e-117   
ref|XP_006282906.1|  hypothetical protein CARUB_v10007301mg             375   2e-117   
ref|XP_010496636.1|  PREDICTED: cellulose synthase-like protein D4      375   2e-117   
ref|XP_007141409.1|  hypothetical protein PHAVU_008G193000g             375   2e-117   
ref|XP_009121428.1|  PREDICTED: cellulose synthase-like protein D2      375   3e-117   
ref|XP_010677380.1|  PREDICTED: cellulose synthase-like protein D...    374   3e-117   
ref|XP_010677379.1|  PREDICTED: cellulose synthase-like protein D...    375   3e-117   
gb|KFK30429.1|  hypothetical protein AALP_AA7G260000                    374   4e-117   
ref|XP_010088647.1|  Cellulose synthase-like protein D3                 375   4e-117   
ref|NP_171773.1|  cellulose synthase-like protein D5                    375   4e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006384874.1|  cellulose synthase family protein                  374   4e-117   
ref|XP_011042830.1|  PREDICTED: cellulose synthase-like protein D5      367   4e-117   
gb|AFZ78590.1|  cellulose synthase-like protein                         374   6e-117   
ref|XP_010259829.1|  PREDICTED: cellulose synthase-like protein D4      374   6e-117   
dbj|BAK08214.1|  predicted protein                                      371   7e-117   
ref|NP_001065498.1|  Os10g0578200                                       348   7e-117   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002303441.1|  cellulose synthase-like D1 family protein          373   8e-117   Populus trichocarpa [western balsam poplar]
ref|XP_010474851.1|  PREDICTED: cellulose synthase-like protein D5      374   8e-117   
gb|AAO64152.1|  unknown protein                                         372   8e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011084614.1|  PREDICTED: cellulose synthase-like protein D3      374   9e-117   
ref|XP_006849943.1|  hypothetical protein AMTR_s00022p00129900          374   1e-116   
ref|XP_010943429.1|  PREDICTED: cellulose synthase-like protein D...    373   1e-116   
ref|XP_010457257.1|  PREDICTED: cellulose synthase-like protein D...    374   1e-116   
ref|XP_007220589.1|  hypothetical protein PRUPE_ppa000473mg             373   1e-116   
ref|NP_195532.1|  cellulose synthase-like protein D4                    372   1e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008234563.1|  PREDICTED: cellulose synthase-like protein D3      373   1e-116   
ref|XP_010457258.1|  PREDICTED: cellulose synthase-like protein D...    374   2e-116   
ref|XP_009101962.1|  PREDICTED: cellulose synthase-like protein D4      372   2e-116   
gb|AFZ78587.1|  cellulose synthase-like protein                         371   3e-116   
ref|XP_010457259.1|  PREDICTED: cellulose synthase-like protein D...    373   3e-116   
ref|XP_002964575.1|  cellulose synthase-like D1-2, glycosyltransf...    372   3e-116   
emb|CDY15261.1|  BnaC05g01400D                                          371   3e-116   
ref|XP_002988822.1|  cellulose synthase-like D1-2, glycosyltransf...    372   3e-116   
ref|XP_009358904.1|  PREDICTED: cellulose synthase-like protein D4      372   3e-116   
ref|XP_001762809.1|  cellulose synthase-like D2, glycosyltransfer...    372   3e-116   
ref|XP_010481208.1|  PREDICTED: cellulose synthase-like protein D...    373   4e-116   
ref|XP_010481214.1|  PREDICTED: cellulose synthase-like protein D...    372   4e-116   
ref|XP_006306607.1|  hypothetical protein CARUB_v10008123mg             372   5e-116   
ref|XP_011040936.1|  PREDICTED: cellulose synthase-like protein D4      371   5e-116   
emb|CDX89946.1|  BnaA10g01360D                                          370   5e-116   
ref|XP_006418311.1|  hypothetical protein EUTSA_v10006597mg             372   7e-116   
ref|XP_010931704.1|  PREDICTED: cellulose synthase-like protein D5      371   7e-116   
gb|KDP28213.1|  hypothetical protein JCGZ_13984                         371   7e-116   
ref|XP_002444169.1|  hypothetical protein SORBIDRAFT_07g011890          371   8e-116   Sorghum bicolor [broomcorn]
ref|XP_006660069.1|  PREDICTED: cellulose synthase-like protein D...    367   8e-116   
ref|XP_006368349.1|  cellulose synthase-like D1 family protein          370   9e-116   
ref|XP_008382513.1|  PREDICTED: cellulose synthase-like protein D4      370   9e-116   
ref|XP_004498092.1|  PREDICTED: cellulose synthase-like protein D...    370   1e-115   
ref|XP_004498091.1|  PREDICTED: cellulose synthase-like protein D...    370   1e-115   
gb|KFK42626.1|  hypothetical protein AALP_AA1G019700                    371   1e-115   
ref|XP_010693734.1|  PREDICTED: cellulose synthase-like protein D4      370   1e-115   
ref|XP_004973258.1|  PREDICTED: cellulose synthase-like protein D...    370   2e-115   
ref|XP_003521583.1|  PREDICTED: cellulose synthase-like protein D...    370   2e-115   
ref|XP_009384732.1|  PREDICTED: cellulose synthase-like protein D2      370   2e-115   
ref|XP_009119615.1|  PREDICTED: cellulose synthase-like protein D5      370   2e-115   
ref|XP_010555163.1|  PREDICTED: cellulose synthase-like protein D4      369   2e-115   
gb|AES82157.2|  cellulose synthase-like protein                         370   2e-115   
ref|XP_010920010.1|  PREDICTED: cellulose synthase-like protein D2      370   2e-115   
ref|XP_011018474.1|  PREDICTED: cellulose synthase-like protein D3      369   2e-115   
ref|XP_010034946.1|  PREDICTED: cellulose synthase-like protein D3      369   3e-115   
ref|XP_007051035.1|  Cellulose synthase-like D5                         370   4e-115   
ref|XP_008664736.1|  PREDICTED: cellulose synthase-like protein D3      369   4e-115   
ref|XP_010522811.1|  PREDICTED: cellulose synthase-like protein D5      370   4e-115   
gb|EPS73788.1|  hypothetical protein M569_00966                         369   5e-115   
ref|XP_007209073.1|  hypothetical protein PRUPE_ppa000493mg             368   8e-115   
ref|XP_002523143.1|  Cellulose synthase A catalytic subunit 3 [UD...    368   1e-114   
gb|ABI75152.1|  cellulose synthase-like D2                              368   1e-114   
ref|XP_008454309.1|  PREDICTED: cellulose synthase-like protein D5      368   2e-114   
emb|CDY35551.1|  BnaA05g16350D                                          362   2e-114   
ref|XP_004152235.1|  PREDICTED: cellulose synthase-like protein D...    367   2e-114   
ref|XP_011007807.1|  PREDICTED: cellulose synthase-like protein D5      367   2e-114   
ref|XP_008238164.1|  PREDICTED: cellulose synthase-like protein D3      367   2e-114   
ref|XP_009767792.1|  PREDICTED: cellulose synthase-like protein D4      367   3e-114   
ref|XP_002274010.1|  PREDICTED: cellulose synthase-like protein D5      367   5e-114   
ref|XP_009114461.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    366   5e-114   
ref|XP_010518918.1|  PREDICTED: putative cellulose synthase-like ...    363   5e-114   
ref|XP_002301494.1|  cellulose synthase family protein                  366   6e-114   
ref|XP_002892121.1|  hypothetical protein ARALYDRAFT_887416             367   6e-114   
ref|XP_002320989.1|  cellulose synthase family protein                  366   6e-114   
ref|XP_009145201.1|  PREDICTED: putative cellulose synthase-like ...    362   9e-114   
ref|XP_011041770.1|  PREDICTED: cellulose synthase-like protein D5      366   9e-114   
gb|AFZ78586.1|  cellulose synthase-like protein                         366   9e-114   
gb|KHG01931.1|  Cellulose synthase-like protein D3                      364   1e-113   
gb|EPS73002.1|  hypothetical protein M569_01753                         365   2e-113   
ref|XP_009622336.1|  PREDICTED: cellulose synthase-like protein D4      364   2e-113   
ref|XP_007040720.1|  Cellulose synthase-like D3                         364   2e-113   
ref|XP_010103399.1|  Cellulose synthase-like protein D5                 365   2e-113   
gb|ACN35607.1|  unknown                                                 348   4e-113   
ref|XP_007163156.1|  hypothetical protein PHAVU_001G211000g             363   6e-113   
gb|KDP47036.1|  hypothetical protein JCGZ_10763                         363   6e-113   
sp|Q7EZW6.2|CSLD3_ORYSJ  RecName: Full=Cellulose synthase-like pr...    363   7e-113   
tpg|DAA01756.1|  TPA: cellulose synthase-like D3                        363   7e-113   
ref|XP_003573792.1|  PREDICTED: cellulose synthase-like protein D3      362   1e-112   
ref|XP_011069707.1|  PREDICTED: cellulose synthase-like protein D2      363   1e-112   
gb|KHG03916.1|  Cellulose synthase-like protein D5                      363   1e-112   
gb|AAK49455.1|AF304375_1  cellulose synthase D-like protein             362   2e-112   
emb|CDY43013.1|  BnaC05g28920D                                          357   2e-112   
ref|XP_006444438.1|  hypothetical protein CICLE_v10018574mg             362   2e-112   
ref|XP_009358902.1|  PREDICTED: cellulose synthase-like protein D4      361   3e-112   
ref|NP_001136615.1|  uncharacterized protein LOC100216739               345   4e-112   
ref|XP_006855362.1|  hypothetical protein AMTR_s00057p00116410          347   9e-112   
ref|XP_002965783.1|  cellulose synthase-like D2-1, glycosyltransf...    360   9e-112   
dbj|BAK06393.1|  predicted protein                                      361   9e-112   
ref|XP_002984435.1|  cellulose synthase-like D2-2, glycosyltransf...    360   1e-111   
ref|XP_010684591.1|  PREDICTED: cellulose synthase-like protein D...    356   1e-111   
gb|ADQ28096.1|  celullose synthase-like D protein                       360   2e-111   
ref|XP_004249009.1|  PREDICTED: cellulose synthase-like protein D4      359   2e-111   
ref|XP_006365312.1|  PREDICTED: cellulose synthase-like protein D...    358   2e-111   
gb|EMT24879.1|  Cellulose synthase-like protein D4                      363   3e-111   
ref|NP_001057557.1|  Os06g0336500                                       356   3e-111   
sp|A2YCI3.1|CSLD5_ORYSI  RecName: Full=Putative cellulose synthas...    356   3e-111   
ref|XP_002438429.1|  hypothetical protein SORBIDRAFT_10g019350          357   4e-111   
ref|XP_008659557.1|  PREDICTED: cellulose synthase-like protein D5      355   4e-111   
ref|XP_010461034.1|  PREDICTED: putative cellulose synthase-like ...    355   5e-111   
gb|AFW86609.1|  putative cellulose synthase-like family protein         356   5e-111   
ref|XP_004300194.1|  PREDICTED: cellulose synthase-like protein D...    357   6e-111   
ref|XP_004967030.1|  PREDICTED: putative cellulose synthase-like ...    355   1e-110   
ref|XP_006415242.1|  hypothetical protein EUTSA_v10006703mg             353   2e-110   
ref|XP_010499763.1|  PREDICTED: putative cellulose synthase-like ...    353   3e-110   
ref|XP_011079605.1|  PREDICTED: cellulose synthase-like protein D5      356   3e-110   
ref|XP_010684590.1|  PREDICTED: cellulose synthase-like protein D...    356   4e-110   
emb|CDP19094.1|  unnamed protein product                                355   7e-110   
ref|NP_174497.1|  putative cellulose synthase-like protein D6           350   2e-109   
ref|XP_010556710.1|  PREDICTED: cellulose synthase-like protein D5      354   3e-109   
ref|XP_003568676.1|  PREDICTED: putative cellulose synthase-like ...    351   3e-109   
ref|XP_009800583.1|  PREDICTED: cellulose synthase-like protein D5      353   5e-109   
gb|EMS54438.1|  Putative cellulose synthase-like protein D5             345   5e-109   
ref|XP_002893707.1|  hypothetical protein ARALYDRAFT_473399             349   8e-109   
ref|XP_009619151.1|  PREDICTED: cellulose synthase-like protein D5      352   1e-108   
ref|XP_010478639.1|  PREDICTED: putative cellulose synthase-like ...    348   2e-108   
ref|XP_009393194.1|  PREDICTED: cellulose synthase-like protein D5      351   4e-108   
ref|XP_004247387.1|  PREDICTED: cellulose synthase-like protein D5      350   6e-108   
ref|XP_006370719.1|  hypothetical protein POPTR_0001s45340g             342   1e-107   
ref|XP_006359883.1|  PREDICTED: cellulose synthase-like protein D...    349   1e-107   
emb|CDY23470.1|  BnaC04g49980D                                          345   1e-106   
gb|EPS68367.1|  hypothetical protein M569_06402                         347   1e-106   
ref|XP_006420625.1|  hypothetical protein CICLE_v10006476mg             343   2e-106   
ref|XP_008661490.1|  PREDICTED: uncharacterized protein LOC100216...    347   3e-106   
emb|CDY43156.1|  BnaA05g32300D                                          344   6e-106   
ref|XP_008797401.1|  PREDICTED: cellulose synthase-like protein D5      344   1e-105   
ref|XP_003589803.1|  Cellulose synthase D-like protein                  343   2e-105   
emb|CAN83176.1|  hypothetical protein VITISV_042740                     318   2e-105   
emb|CDY28732.1|  BnaCnng06180D                                          342   3e-105   
ref|XP_003575482.1|  PREDICTED: cellulose synthase-like protein D4      343   4e-105   
ref|XP_004962788.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    343   4e-105   
ref|XP_006342834.1|  PREDICTED: cellulose synthase-like protein D...    340   1e-104   
ref|XP_002443339.1|  hypothetical protein SORBIDRAFT_08g017750          341   3e-104   
ref|XP_006304580.1|  hypothetical protein CARUB_v10011620mg             333   1e-102   
gb|AIS92558.1|  putative cellulose synthase-like D1                     334   2e-101   
ref|XP_006664633.1|  PREDICTED: cellulose synthase-like protein D...    324   2e-101   
gb|EMS53885.1|  Cellulose synthase-like protein D4                      328   4e-101   
ref|XP_004229303.1|  PREDICTED: cellulose synthase-like protein D4      328   6e-100   
gb|EAY83477.1|  hypothetical protein OsI_38690                          315   3e-99    
emb|CDY16969.1|  BnaC09g40960D                                          325   5e-99    
gb|AIS92559.1|  putative cellulose synthase-like D2                     326   1e-98    
emb|CDX69410.1|  BnaA10g17590D                                          324   2e-98    
emb|CDY49919.1|  BnaCnng18290D                                          321   4e-98    
ref|NP_001066999.1|  Os12g0555600                                       303   2e-97    
gb|AAL38529.1|AF435644_1  CSLD4                                         304   3e-97    
gb|EAZ20837.1|  hypothetical protein OsJ_36472                          317   9e-96    
gb|EYU46772.1|  hypothetical protein MIMGU_mgv1a000415mg                317   1e-95    
sp|Q2QNS6.1|CSLD4_ORYSJ  RecName: Full=Cellulose synthase-like pr...    317   2e-95    
emb|CAN62994.1|  hypothetical protein VITISV_021619                     300   2e-95    
gb|ADG38380.1|  AT3G03050-like protein                                  283   5e-92    
gb|EEC83430.1|  hypothetical protein OsI_28899                          298   3e-89    
ref|NP_001175529.1|  Os08g0345500                                       297   9e-89    
gb|KGN52834.1|  hypothetical protein Csa_4G002510                       283   4e-84    
gb|KGN63377.1|  hypothetical protein Csa_2G433920                       282   7e-84    
gb|ACN34304.1|  unknown                                                 268   1e-83    
ref|XP_010491045.1|  PREDICTED: cellulose synthase A catalytic su...    266   2e-83    
gb|ACF80398.1|  unknown                                                 263   6e-83    
ref|XP_004164987.1|  PREDICTED: cellulose synthase-like protein D...    271   3e-82    
dbj|BAF01916.1|  cellulose synthase catalytic subunit                   266   3e-82    
gb|EPS57792.1|  cellulose synthase                                      265   4e-82    
gb|ACF83181.1|  unknown                                                 260   4e-81    
dbj|BAD95078.1|  cellulose synthase catalytic subunit                   261   4e-81    
ref|XP_004152358.1|  PREDICTED: cellulose synthase-like protein D...    272   1e-80    
gb|AAQ63930.1|  cellulose synthase                                      259   1e-80    
gb|AAR29966.1|  putative cellulose synthase catalytic subunit           265   1e-80    
gb|KGN52835.1|  hypothetical protein Csa_4G002520                       273   2e-80    
ref|XP_004164986.1|  PREDICTED: cellulose synthase-like protein D...    273   2e-80    
ref|XP_009396579.1|  PREDICTED: cellulose synthase-like protein D2      272   2e-80    
ref|XP_007025330.1|  Cellulose synthase family protein isoform 2        268   2e-80    
dbj|BAJ85785.1|  predicted protein                                      265   4e-80    
gb|AFJ12112.1|  cellulose synthase                                      260   4e-80    
gb|AFJ12110.1|  cellulose synthase                                      259   5e-80    
tpg|DAA39507.1|  TPA: hypothetical protein ZEAMMB73_844715              265   5e-80    
ref|XP_010686462.1|  PREDICTED: cellulose synthase A catalytic su...    274   1e-79    
ref|XP_010687624.1|  PREDICTED: cellulose synthase A catalytic su...    271   2e-79    
gb|AAM97089.1|  cellulose synthase catalytic subunit                    256   3e-79    
ref|XP_009399755.1|  PREDICTED: probable cellulose synthase A cat...    270   3e-79    
ref|XP_004233024.1|  PREDICTED: cellulose synthase A catalytic su...    270   3e-79    
ref|XP_008225322.1|  PREDICTED: cellulose synthase A catalytic su...    269   4e-79    
gb|AFV94634.1|  cellulose synthase                                      269   4e-79    
ref|XP_007214446.1|  hypothetical protein PRUPE_ppa024725mg             269   4e-79    
gb|AEE60894.1|  cellulose synthase                                      269   4e-79    
gb|AFW69155.1|  putative cellulose synthase family protein              269   5e-79    
ref|XP_002455101.1|  hypothetical protein SORBIDRAFT_03g004320          260   5e-79    
ref|XP_010999776.1|  PREDICTED: cellulose synthase A catalytic su...    269   5e-79    
dbj|BAJ98234.1|  predicted protein                                      264   6e-79    
dbj|BAJ96282.1|  predicted protein                                      269   7e-79    
ref|XP_009389939.1|  PREDICTED: probable cellulose synthase A cat...    269   7e-79    
gb|AAK53023.1|AF375439_1  AT5g64740/MVP7_7                              255   8e-79    
ref|XP_004956855.1|  PREDICTED: cellulose synthase A catalytic su...    269   9e-79    
ref|XP_010228019.1|  PREDICTED: probable cellulose synthase A cat...    268   9e-79    
emb|CBI30712.3|  unnamed protein product                                268   1e-78    
ref|XP_008670200.1|  PREDICTED: cellulose synthase A catalytic su...    269   1e-78    
gb|KFK28549.1|  hypothetical protein AALP_AA7G010900                    268   1e-78    
ref|XP_008383612.1|  PREDICTED: cellulose synthase A catalytic su...    268   1e-78    
ref|XP_008383611.1|  PREDICTED: cellulose synthase A catalytic su...    268   1e-78    
ref|XP_002460229.1|  hypothetical protein SORBIDRAFT_02g025020          269   1e-78    
ref|XP_007136980.1|  hypothetical protein PHAVU_009G090100g             268   1e-78    
ref|XP_006283112.1|  hypothetical protein CARUB_v10004131mg             266   1e-78    
ref|XP_009766951.1|  PREDICTED: cellulose synthase A catalytic su...    268   1e-78    
dbj|BAJ85783.1|  predicted protein                                      268   1e-78    
gb|EMT23140.1|  Cellulose synthase A catalytic subunit 4 (UDP-for...    268   1e-78    
gb|AAT09897.1|  cellulose synthase                                      268   1e-78    
gb|AFZ78566.1|  cellulose synthase                                      268   1e-78    
ref|XP_003526279.1|  PREDICTED: cellulose synthase A catalytic su...    268   2e-78    
gb|EMT30130.1|  Cellulose synthase A catalytic subunit 9 (UDP-for...    268   2e-78    
ref|XP_006414059.1|  hypothetical protein EUTSA_v10024314mg             268   2e-78    
ref|XP_006358142.1|  PREDICTED: cellulose synthase A catalytic su...    270   2e-78    
ref|XP_009351521.1|  PREDICTED: cellulose synthase A catalytic su...    268   2e-78    
ref|XP_010434497.1|  PREDICTED: cellulose synthase A catalytic su...    268   2e-78    
ref|XP_009351513.1|  PREDICTED: cellulose synthase A catalytic su...    268   2e-78    
gb|AAT09896.2|  cellulose synthase                                      268   2e-78    
ref|XP_010439812.1|  PREDICTED: cellulose synthase A catalytic su...    268   2e-78    
gb|AEE60893.1|  cellulose synthase                                      267   2e-78    
ref|XP_010449470.1|  PREDICTED: cellulose synthase A catalytic su...    268   2e-78    
ref|XP_009352735.1|  PREDICTED: cellulose synthase A catalytic su...    268   2e-78    
ref|XP_003578137.1|  PREDICTED: cellulose synthase A catalytic su...    268   2e-78    
gb|KHN48007.1|  Cellulose synthase A catalytic subunit 8 [UDP-for...    267   2e-78    
ref|XP_002305060.1|  cellulose synthase family protein                  268   2e-78    
ref|XP_007025329.1|  Cellulose synthase family protein isoform 1        267   2e-78    
gb|AFZ78552.1|  cellulose synthase                                      267   2e-78    
ref|NP_001105532.1|  cellulose synthase catalytic subunit 12            268   2e-78    
emb|CBH32503.1|  cellulose synthase, expressed                          267   2e-78    
emb|CDM84183.1|  unnamed protein product                                267   2e-78    
tpg|DAA61529.1|  TPA: putative cellulose synthase family protein        268   3e-78    
ref|XP_008651867.1|  PREDICTED: cellulose synthase-4 isoform X1         266   3e-78    
gb|AAR29963.1|  putative cellulose synthase catalytic subunit           268   3e-78    
dbj|BAJ96780.1|  predicted protein                                      267   3e-78    
ref|XP_010274921.1|  PREDICTED: cellulose synthase A catalytic su...    267   3e-78    
ref|XP_011039392.1|  PREDICTED: cellulose synthase A catalytic su...    267   3e-78    
ref|XP_006578126.1|  PREDICTED: cellulose synthase A catalytic su...    266   4e-78    
gb|AEN70824.1|  cellulose synthase                                      266   4e-78    
gb|AET04269.2|  cellulose synthase-like protein                         267   4e-78    
gb|EMT00418.1|  Putative cellulose synthase A catalytic subunit 2...    268   4e-78    
ref|XP_010228012.1|  PREDICTED: probable cellulose synthase A cat...    267   4e-78    
ref|XP_011039391.1|  PREDICTED: cellulose synthase A catalytic su...    267   4e-78    
gb|ACD56646.1|  cellulose synthase                                      266   4e-78    
gb|ACS68198.1|  cellulose synthase 8.1 catalytic subunit                266   4e-78    
gb|AEN70827.1|  cellulose synthase                                      266   4e-78    
gb|AEN70825.1|  cellulose synthase                                      266   4e-78    
gb|ADY68800.1|  cellulose synthase A1                                   266   4e-78    
gb|ACD56660.1|  cellulose synthase                                      266   5e-78    
gb|AEN70826.1|  cellulose synthase                                      266   5e-78    
ref|XP_006660635.1|  PREDICTED: cellulose synthase A catalytic su...    267   5e-78    
gb|ADY68796.1|  cellulose synthase A1                                   266   5e-78    
gb|AEN70830.1|  cellulose synthase                                      266   5e-78    
ref|XP_010655790.1|  PREDICTED: cellulose synthase A catalytic su...    269   5e-78    
gb|AGE09572.1|  cellulose synthase-like protein                         266   5e-78    
gb|KGN65611.1|  hypothetical protein Csa_1G470270                       266   5e-78    
gb|AEN70837.1|  cellulose synthase                                      266   5e-78    
gb|AAB37766.1|  cellulose synthase                                      266   5e-78    
gb|AEN70819.1|  cellulose synthase                                      266   5e-78    
ref|XP_008790154.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    267   5e-78    
gb|AEN70839.1|  cellulose synthase                                      266   5e-78    
gb|AAL37718.1|AF413210_1  cellulose synthase A4                         266   5e-78    
ref|XP_010228016.1|  PREDICTED: probable cellulose synthase A cat...    267   5e-78    



>emb|CDO99427.1| unnamed protein product [Coffea canephora]
Length=1052

 Score =   437 bits (1125),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 225/271 (83%), Positives = 249/271 (92%), Gaps = 0/271 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALAS RLKFLQR+AYFNVGVYPFTSIF
Sbjct  776   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASPRLKFLQRVAYFNVGVYPFTSIF  835

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+  F+GQFIVQ+L+  FLCYLL+ITVTL LISLLEVKW+ IGLEELWRNEQ
Sbjct  836   LVVYCFLPALSLFSGQFIVQSLNIAFLCYLLVITVTLTLISLLEVKWSGIGLEELWRNEQ  895

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW IGGTSAHLAAVLQGLLK IAG+EISF LT+K+ AEDEDDIYADLYVVKWTSLFIMPL
Sbjct  896   FWAIGGTSAHLAAVLQGLLKAIAGVEISFKLTAKATAEDEDDIYADLYVVKWTSLFIMPL  955

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+VVN+ ALV+G SR +YSVIPQW KLFGGAFFSFWVLAH+YPFAKGLMGR+G++PTIV
Sbjct  956   TIIVVNLIALVLGISRTVYSVIPQWGKLFGGAFFSFWVLAHMYPFAKGLMGRRGRLPTIV  1015

Query  156   YVwtgllsittsllwiSVNPPQDPRAAASNE  64
             YVWTGLLSIT SLLWI+++PPQ   A+   +
Sbjct  1016  YVWTGLLSITISLLWITISPPQGATASGPRD  1046



>emb|CDY00872.1| BnaCnng00720D [Brassica napus]
Length=324

 Score =   402 bits (1032),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 211/269 (78%), Positives = 240/269 (89%), Gaps = 0/269 (0%)
 Frame = -3

Query  876  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
            FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN   A+RRLKFLQR+AY NVG+YPFTSIF
Sbjct  53   FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNAMFATRRLKFLQRVAYLNVGIYPFTSIF  112

Query  696  LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
            LVVYCF+PA+C F+G+FIVQ+LD  FL YLL I++TL+LISLLEVKW+ IGLEE WRNEQ
Sbjct  113  LVVYCFLPALCLFSGKFIVQSLDIHFLSYLLCISLTLILISLLEVKWSGIGLEEWWRNEQ  172

Query  516  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
            FWLIGG+SAHLAAV+QGLLKV+AGIEISFTLTSK++ EDEDD +ADLYVVKWT LFIMPL
Sbjct  173  FWLIGGSSAHLAAVVQGLLKVLAGIEISFTLTSKASGEDEDDAFADLYVVKWTGLFIMPL  232

Query  336  TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
            TI+VVN+ A+VIG SR IYSVIPQWNKLFGG FFS WVL H+YPF KGLMGR+GKVPTIV
Sbjct  233  TIIVVNLVAIVIGASRTIYSVIPQWNKLFGGIFFSMWVLTHMYPFCKGLMGRRGKVPTIV  292

Query  156  YVwtgllsittsllwiSVNPPQDPRAAAS  70
            YVW+GL+SIT SLLWI+++PP D      
Sbjct  293  YVWSGLVSITVSLLWITISPPDDVSGGGG  321



>gb|KFK31081.1| hypothetical protein AALP_AA6G065900 [Arabis alpina]
Length=1035

 Score =   424 bits (1090),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 214/263 (81%), Positives = 240/263 (91%), Gaps = 0/263 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN   A+RRLKFLQR+AY NVG+YPFTSIF
Sbjct  762   FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNAMFATRRLKFLQRVAYLNVGIYPFTSIF  821

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+C F+G+FIVQ+LD  FL YLL IT+TL LISLLEVKW+ IGLEE WRNEQ
Sbjct  822   LVVYCFLPALCLFSGKFIVQSLDIHFLSYLLCITITLTLISLLEVKWSGIGLEEWWRNEQ  881

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV+QG LKVIAGIEISFTLTSKSA EDEDD++ADLY+VKWT LFIMPL
Sbjct  882   FWLIGGTSAHLAAVVQGFLKVIAGIEISFTLTSKSAGEDEDDVFADLYIVKWTGLFIMPL  941

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+VIG SR IYSVIPQWNKLFGG FFS WVL H+YPFAKGLMGR+GKVPTIV
Sbjct  942   TIIIVNLVAIVIGASRTIYSVIPQWNKLFGGVFFSLWVLTHMYPFAKGLMGRRGKVPTIV  1001

Query  156   YVwtgllsittsllwiSVNPPQD  88
             YVW+GL+SIT SLLWI+++PP D
Sbjct  1002  YVWSGLVSITVSLLWITISPPDD  1024



>ref|XP_010069060.1| PREDICTED: cellulose synthase-like protein D1 [Eucalyptus grandis]
 gb|KCW57279.1| hypothetical protein EUGRSUZ_H00079 [Eucalyptus grandis]
Length=1051

 Score =   424 bits (1090),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 220/271 (81%), Positives = 243/271 (90%), Gaps = 0/271 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  L SRRLKFLQRIAY NVG+YPFTSIF
Sbjct  778   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNALLGSRRLKFLQRIAYLNVGIYPFTSIF  837

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L VYCF+PA+  F+GQFIVQ+L+  FL YLLIITVTL LISLLEVKW+ +GLEE WRNEQ
Sbjct  838   LSVYCFLPALSLFSGQFIVQSLNVSFLMYLLIITVTLTLISLLEVKWSGVGLEEWWRNEQ  897

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW+IGGTSAHLAAV+QGLLKV+AGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL
Sbjct  898   FWVIGGTSAHLAAVIQGLLKVVAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  957

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+V+NI A+VIG SR IYS IPQW+KL GG FFSFWVL+H+YPFAKGLMGR+G+VPTIV
Sbjct  958   TIMVINIVAVVIGFSRTIYSEIPQWSKLLGGVFFSFWVLSHMYPFAKGLMGRRGRVPTIV  1017

Query  156   YVwtgllsittsllwiSVNPPQDPRAAASNE  64
             YVWTGL+SIT SLLWIS+NPP      +  E
Sbjct  1018  YVWTGLVSITVSLLWISINPPDASSTTSGGE  1048



>dbj|BAD43631.1| putative cellulose synthase [Arabidopsis thaliana]
Length=821

 Score =   417 bits (1072),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 212/263 (81%), Positives = 239/263 (91%), Gaps = 0/263 (0%)
 Frame = -3

Query  876  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
            FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN   A+RRLKFLQR+AY NVG+YPFTSIF
Sbjct  550  FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNAMFATRRLKFLQRVAYLNVGIYPFTSIF  609

Query  696  LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
            LVVYCF+PA+C F+G+FIVQ+LD  FL YLL ITVTL LISLLEVKW+ IGLEE WRNEQ
Sbjct  610  LVVYCFLPALCLFSGKFIVQSLDIHFLSYLLCITVTLTLISLLEVKWSGIGLEEWWRNEQ  669

Query  516  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
            FWLIGGTSAHLAAV+QGLLKVIAGIEISFTLTSK++ EDEDDI+ADLY+VKWT LFIMPL
Sbjct  670  FWLIGGTSAHLAAVVQGLLKVIAGIEISFTLTSKASGEDEDDIFADLYIVKWTGLFIMPL  729

Query  336  TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
            TI++VN+ A+VIG SR IYSVIPQW KL GG FFS WVL H+YPFAKGLMG++GKVPTIV
Sbjct  730  TIIIVNLVAIVIGASRTIYSVIPQWGKLMGGIFFSLWVLTHMYPFAKGLMGQRGKVPTIV  789

Query  156  YVwtgllsittsllwiSVNPPQD  88
            YVW+GL+SIT SLLWI+++PP D
Sbjct  790  YVWSGLVSITVSLLWITISPPDD  812



>ref|XP_010509927.1| PREDICTED: cellulose synthase-like protein D1 [Camelina sativa]
Length=1039

 Score =   423 bits (1087),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 215/271 (79%), Positives = 240/271 (89%), Gaps = 0/271 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN   A+RRLKFLQR+AY NVG+YPFTSIF
Sbjct  766   FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNAMFATRRLKFLQRVAYLNVGIYPFTSIF  825

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+C F+G+FIVQ+LD  FL YLL IT+TL LISLLEVKW+ IGLEE WRNEQ
Sbjct  826   LVVYCFLPALCLFSGKFIVQSLDIHFLSYLLCITITLTLISLLEVKWSGIGLEEWWRNEQ  885

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV+QGLLKVIAGIEISFTLTSKS  EDEDDI+ADLY+VKWT LFIMPL
Sbjct  886   FWLIGGTSAHLAAVVQGLLKVIAGIEISFTLTSKSGGEDEDDIFADLYIVKWTGLFIMPL  945

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+VVN+ A+VIG SR IYSVIPQW KL GG FFS WVL H+YPFAKGLMGR+GKVPTIV
Sbjct  946   TIIVVNLVAIVIGASRTIYSVIPQWGKLLGGTFFSLWVLTHMYPFAKGLMGRRGKVPTIV  1005

Query  156   YVwtgllsittsllwiSVNPPQDPRAAASNE  64
             YVW+GL+SIT SLLWI+++PP D   +   E
Sbjct  1006  YVWSGLVSITVSLLWITISPPDDLSGSGGGE  1036



>ref|XP_002881261.1| hypothetical protein ARALYDRAFT_482247 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57520.1| hypothetical protein ARALYDRAFT_482247 [Arabidopsis lyrata subsp. 
lyrata]
Length=1036

 Score =   422 bits (1085),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 215/263 (82%), Positives = 239/263 (91%), Gaps = 0/263 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN   A+RRLKFLQR+AY NVG+YPFTSIF
Sbjct  765   FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNAMFATRRLKFLQRVAYLNVGIYPFTSIF  824

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+C F+G+FIVQ+LD  FL YLL ITVTL LISLLEVKW+ IGLEE WRNEQ
Sbjct  825   LVVYCFLPALCLFSGKFIVQSLDIHFLSYLLCITVTLTLISLLEVKWSGIGLEEWWRNEQ  884

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV+QGLLKVIAGIEISFTLTSKS+ EDEDDI+ADLY+VKWT LFIMPL
Sbjct  885   FWLIGGTSAHLAAVVQGLLKVIAGIEISFTLTSKSSGEDEDDIFADLYIVKWTGLFIMPL  944

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+VVN+ A+VIG SR IYSVIPQW KL GG FFS WVL H+YPFAKGLMGR+GKVPTIV
Sbjct  945   TIIVVNLVAIVIGASRTIYSVIPQWGKLLGGTFFSLWVLTHMYPFAKGLMGRRGKVPTIV  1004

Query  156   YVwtgllsittsllwiSVNPPQD  88
             YVW+GL+SIT SLLWI+++PP D
Sbjct  1005  YVWSGLVSITVSLLWITISPPDD  1027



>emb|CDY23769.1| BnaC04g43530D [Brassica napus]
Length=1025

 Score =   422 bits (1084),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 214/263 (81%), Positives = 239/263 (91%), Gaps = 0/263 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN   A+RRLKFLQR+AY NVG+YPFTSIF
Sbjct  754   FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNAIFATRRLKFLQRVAYLNVGIYPFTSIF  813

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+C F+G+FIVQ+LD  FL YLL IT+TL LISLLEVKW+ IGLEE WRNEQ
Sbjct  814   LVVYCFLPALCLFSGKFIVQSLDIHFLSYLLCITITLTLISLLEVKWSGIGLEEWWRNEQ  873

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV+QG LKVIAGIEISFTLTSKSA EDEDD++ADLY+VKWT LFIMPL
Sbjct  874   FWLIGGTSAHLAAVVQGFLKVIAGIEISFTLTSKSAGEDEDDVFADLYIVKWTGLFIMPL  933

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+VVN+ A+VIG SR IYSVIPQWNKL GG FFS WVL H+YPFAKGLMGR+GKVPTIV
Sbjct  934   TIIVVNLVAIVIGASRTIYSVIPQWNKLLGGTFFSMWVLTHMYPFAKGLMGRRGKVPTIV  993

Query  156   YVwtgllsittsllwiSVNPPQD  88
             YVW+GL+SIT SLLWI+++PP D
Sbjct  994   YVWSGLVSITVSLLWITISPPDD  1016



>ref|XP_009141287.1| PREDICTED: cellulose synthase-like protein D1 [Brassica rapa]
 emb|CDY37752.1| BnaA04g19160D [Brassica napus]
Length=1023

 Score =   422 bits (1084),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 214/263 (81%), Positives = 239/263 (91%), Gaps = 0/263 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN   A+RRLKFLQR+AY NVG+YPFTSIF
Sbjct  752   FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNAIFATRRLKFLQRVAYLNVGIYPFTSIF  811

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+C F+G+FIVQ+LD  FL YLL IT+TL LISLLEVKW+ IGLEE WRNEQ
Sbjct  812   LVVYCFLPALCLFSGKFIVQSLDIHFLSYLLCITITLTLISLLEVKWSGIGLEEWWRNEQ  871

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV+QG LKVIAGIEISFTLTSKSA EDEDD++ADLY+VKWT LFIMPL
Sbjct  872   FWLIGGTSAHLAAVVQGFLKVIAGIEISFTLTSKSAGEDEDDVFADLYIVKWTGLFIMPL  931

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+VVN+ A+VIG SR IYSVIPQWNKL GG FFS WVL H+YPFAKGLMGR+GKVPTIV
Sbjct  932   TIIVVNLVAIVIGASRTIYSVIPQWNKLLGGTFFSMWVLTHMYPFAKGLMGRRGKVPTIV  991

Query  156   YVwtgllsittsllwiSVNPPQD  88
             YVW+GL+SIT SLLWI+++PP D
Sbjct  992   YVWSGLVSITVSLLWITISPPDD  1014



>ref|XP_006293609.1| hypothetical protein CARUB_v10022555mg [Capsella rubella]
 gb|EOA26507.1| hypothetical protein CARUB_v10022555mg [Capsella rubella]
Length=1039

 Score =   421 bits (1083),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 214/263 (81%), Positives = 239/263 (91%), Gaps = 0/263 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN   A+RRLKFLQR+AY NVG+YPFTSIF
Sbjct  767   FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNAMFATRRLKFLQRVAYLNVGIYPFTSIF  826

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+C F+G+FIVQ+LD  FL YLL ITVTL LISLLEVKW+ IGLEE WRNEQ
Sbjct  827   LVVYCFLPALCLFSGKFIVQSLDIHFLSYLLCITVTLTLISLLEVKWSGIGLEEWWRNEQ  886

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV+QGLLKVIAGIEISFTLTSKS+ EDEDD++ADLY+VKWT LFIMPL
Sbjct  887   FWLIGGTSAHLAAVVQGLLKVIAGIEISFTLTSKSSGEDEDDVFADLYIVKWTGLFIMPL  946

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+VVN+ A+VIG SR IYSVIPQW KL GG FFS WVL H+YPFAKGLMGR+GKVPTIV
Sbjct  947   TIIVVNLVAIVIGASRTIYSVIPQWGKLLGGTFFSLWVLTHMYPFAKGLMGRRGKVPTIV  1006

Query  156   YVwtgllsittsllwiSVNPPQD  88
             YVW+GL+SIT SLLWI+++PP D
Sbjct  1007  YVWSGLVSITVSLLWITISPPDD  1029



>ref|XP_010413915.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase-like protein 
D1 [Camelina sativa]
Length=1038

 Score =   421 bits (1082),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 214/263 (81%), Positives = 238/263 (90%), Gaps = 0/263 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN   A+RRLKFLQR+AY NVG+YPFTSIF
Sbjct  766   FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNAMFATRRLKFLQRVAYLNVGIYPFTSIF  825

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+C F+G+FIVQ+LD  FL YLL IT+TL LISLLEVKW+ IGLEE WRNEQ
Sbjct  826   LVVYCFLPALCLFSGKFIVQSLDIHFLSYLLCITITLTLISLLEVKWSGIGLEEWWRNEQ  885

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV+QGLLKVIAGIEISFTLTSKS  EDEDDI+ADLY+VKWT LFIMPL
Sbjct  886   FWLIGGTSAHLAAVVQGLLKVIAGIEISFTLTSKSGGEDEDDIFADLYIVKWTGLFIMPL  945

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+VVN+ A+VIG SR IYSVIPQW KL GG FFS WVL H+YPFAKGLMGR+GKVPTIV
Sbjct  946   TIIVVNLVAIVIGASRTIYSVIPQWGKLLGGTFFSLWVLTHMYPFAKGLMGRRGKVPTIV  1005

Query  156   YVwtgllsittsllwiSVNPPQD  88
             YVW+GL+SIT SLLWI+++PP D
Sbjct  1006  YVWSGLVSITVSLLWITISPPDD  1028



>ref|XP_006410449.1| hypothetical protein EUTSA_v10016169mg [Eutrema salsugineum]
 gb|ESQ51902.1| hypothetical protein EUTSA_v10016169mg [Eutrema salsugineum]
Length=1039

 Score =   421 bits (1082),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 214/263 (81%), Positives = 239/263 (91%), Gaps = 0/263 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN   A+RRLKFLQR+AY NVG+YPFTSIF
Sbjct  768   FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNAMFATRRLKFLQRVAYLNVGIYPFTSIF  827

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+C F+G+FIVQ+LD  FL YLL IT+TL LISLLEVKW+ IGLEE WRNEQ
Sbjct  828   LVVYCFLPALCLFSGKFIVQSLDVHFLSYLLCITITLTLISLLEVKWSGIGLEEWWRNEQ  887

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV+QGLLKVIAGIEISFTLTSKSA EDEDDI+ADLY+VKWT LFIMPL
Sbjct  888   FWLIGGTSAHLAAVVQGLLKVIAGIEISFTLTSKSAGEDEDDIFADLYIVKWTGLFIMPL  947

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+VVN+ A+VIG SR IYSVIPQW KL GG FFS WVL H+YPFAKGLMGR+GKVPTIV
Sbjct  948   TIIVVNLVAIVIGASRTIYSVIPQWGKLLGGTFFSLWVLTHMYPFAKGLMGRRGKVPTIV  1007

Query  156   YVwtgllsittsllwiSVNPPQD  88
             YVW+GL+SIT SLLWI+++PP +
Sbjct  1008  YVWSGLVSITVSLLWITISPPDE  1030



>ref|XP_010469517.1| PREDICTED: cellulose synthase-like protein D1 [Camelina sativa]
Length=1039

 Score =   421 bits (1081),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 214/263 (81%), Positives = 238/263 (90%), Gaps = 0/263 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN   A+RRLKFLQR+AY NVG+YPFTSIF
Sbjct  767   FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNAMFATRRLKFLQRVAYLNVGIYPFTSIF  826

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+C F+G+FIVQ+LD  FL YLL IT+TL LISLLEVKW+ IGLEE WRNEQ
Sbjct  827   LVVYCFLPALCLFSGKFIVQSLDIHFLSYLLCITITLTLISLLEVKWSGIGLEEWWRNEQ  886

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV+QGLLKVIAGIEISFTLTSKS  EDEDDI+ADLY+VKWT LFIMPL
Sbjct  887   FWLIGGTSAHLAAVVQGLLKVIAGIEISFTLTSKSGGEDEDDIFADLYIVKWTGLFIMPL  946

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+VVN+ A+VIG SR IYSVIPQW KL GG FFS WVL H+YPFAKGLMGR+GKVPTIV
Sbjct  947   TIIVVNLVAIVIGASRTIYSVIPQWGKLLGGTFFSLWVLTHMYPFAKGLMGRRGKVPTIV  1006

Query  156   YVwtgllsittsllwiSVNPPQD  88
             YVW+GL+SIT SLLWI+++PP D
Sbjct  1007  YVWSGLVSITVSLLWITISPPDD  1029



>ref|NP_180869.1| cellulose synthase-like protein D1 [Arabidopsis thaliana]
 sp|O49323.1|CSLD1_ARATH RecName: Full=Cellulose synthase-like protein D1; Short=AtCslD1 
[Arabidopsis thaliana]
 gb|AAC04910.1| putative cellulose synthase [Arabidopsis thaliana]
 gb|AEC08785.1| cellulose synthase-like protein D1 [Arabidopsis thaliana]
 gb|AHL38816.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=1036

 Score =   419 bits (1078),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 213/263 (81%), Positives = 239/263 (91%), Gaps = 0/263 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN   A+RRLKFLQR+AY NVG+YPFTSIF
Sbjct  765   FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNAMFATRRLKFLQRVAYLNVGIYPFTSIF  824

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+C F+G+FIVQ+LD  FL YLL ITVTL LISLLEVKW+ IGLEE WRNEQ
Sbjct  825   LVVYCFLPALCLFSGKFIVQSLDIHFLSYLLCITVTLTLISLLEVKWSGIGLEEWWRNEQ  884

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV+QGLLKVIAGIEISFTLTSK++ EDEDDI+ADLY+VKWT LFIMPL
Sbjct  885   FWLIGGTSAHLAAVVQGLLKVIAGIEISFTLTSKASGEDEDDIFADLYIVKWTGLFIMPL  944

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+VIG SR IYSVIPQW KL GG FFS WVL H+YPFAKGLMGR+GKVPTIV
Sbjct  945   TIIIVNLVAIVIGASRTIYSVIPQWGKLMGGIFFSLWVLTHMYPFAKGLMGRRGKVPTIV  1004

Query  156   YVwtgllsittsllwiSVNPPQD  88
             YVW+GL+SIT SLLWI+++PP D
Sbjct  1005  YVWSGLVSITVSLLWITISPPDD  1027



>ref|XP_011091410.1| PREDICTED: cellulose synthase-like protein D1 [Sesamum indicum]
Length=1041

 Score =   419 bits (1077),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 218/262 (83%), Positives = 239/262 (91%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LA+RRLKFLQRIAY NVG+YPFTS F
Sbjct  768   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAILATRRLKFLQRIAYLNVGIYPFTSFF  827

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LV YCF+PA   F+G FIVQ+L+  FL YLLIIT+TL+ ISLLEVKW+ I LEE WRNEQ
Sbjct  828   LVTYCFLPAFSLFSGHFIVQSLNIAFLSYLLIITLTLVCISLLEVKWSGIALEEWWRNEQ  887

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW+IGG+SAHL AVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWT+LF++PL
Sbjct  888   FWVIGGSSAHLVAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTALFVVPL  947

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I+VVN+ ALVIG +RQIYSVIPQW KLFGGAFFSFWVLAH+YPFAKGLMGRKGKVPTI+
Sbjct  948   MIIVVNLVALVIGLARQIYSVIPQWGKLFGGAFFSFWVLAHMYPFAKGLMGRKGKVPTII  1007

Query  156   YVwtgllsittsllwiSVNPPQ  91
             YVW+GL+SIT SLLWI VNPPQ
Sbjct  1008  YVWSGLISITVSLLWIVVNPPQ  1029



>ref|XP_010258715.1| PREDICTED: cellulose synthase-like protein D1 [Nelumbo nucifera]
Length=1082

 Score =   418 bits (1074),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 216/272 (79%), Positives = 245/272 (90%), Gaps = 0/272 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS RLKFLQRIAY NVG+YPFTSIF
Sbjct  805   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASPRLKFLQRIAYLNVGIYPFTSIF  864

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+  F+G FIV+ L+  FL YLL IT+TL L+SLLE+KW+ + LE+ WRNEQ
Sbjct  865   LVVYCFLPALSLFSGHFIVENLNVSFLLYLLSITITLCLLSLLEIKWSGVSLEDWWRNEQ  924

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGI+ISFTLTSKSAAED+DDIYADLYVVKWTSLFIMPL
Sbjct  925   FWLIGGTSAHLAAVLQGLLKVIAGIDISFTLTSKSAAEDDDDIYADLYVVKWTSLFIMPL  984

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+VVN+ A+V+G +R IYSVIPQWNKLFGG FFSFWVLAH+YPFAKGLMGRKG++PTIV
Sbjct  985   TIMVVNLVAIVMGFARTIYSVIPQWNKLFGGVFFSFWVLAHMYPFAKGLMGRKGRMPTIV  1044

Query  156   YVwtgllsittsllwiSVNPPQDPRAAASNED  61
             YVW+GL++IT SLLWIS++PP D   +A+  D
Sbjct  1045  YVWSGLVTITVSLLWISISPPDDGNNSAALPD  1076



>ref|XP_004239868.1| PREDICTED: cellulose synthase-like protein D1 [Solanum lycopersicum]
Length=1037

 Score =   416 bits (1069),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 212/242 (88%), Positives = 226/242 (93%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIF+SRNNP LAS RLKFLQRIAYFNVGVYPFTSIF
Sbjct  768   FRGTAPINLTDRLHQVLRWATGSVEIFYSRNNPILASPRLKFLQRIAYFNVGVYPFTSIF  827

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCFIPA C FTGQFIVQ L+  FL YLL+ITVTL+LISLLEVKW+ I LEELWRNEQ
Sbjct  828   LVVYCFIPAFCLFTGQFIVQNLNVFFLSYLLLITVTLVLISLLEVKWSGIALEELWRNEQ  887

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAH AAV+QGLLKVIAG+EISFTLTSKSAAEDEDDIYADLYVVKWTSLFI+PL
Sbjct  888   FWLIGGTSAHFAAVIQGLLKVIAGVEISFTLTSKSAAEDEDDIYADLYVVKWTSLFILPL  947

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+VVNI ALVIG SR IYSVIPQWN+LFGG FFSFWVL+HLYPFAKGLMGRKG+V TI+
Sbjct  948   TIMVVNIMALVIGISRTIYSVIPQWNRLFGGVFFSFWVLSHLYPFAKGLMGRKGRVSTII  1007

Query  156   YV  151
             Y+
Sbjct  1008  YI  1009



>gb|KEH37378.1| cellulose synthase-like protein [Medicago truncatula]
Length=1023

 Score =   416 bits (1068),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 212/270 (79%), Positives = 241/270 (89%), Gaps = 0/270 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN   ASRRLKFLQRIAY NVG+YPFTS F
Sbjct  751   FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNAIFASRRLKFLQRIAYLNVGIYPFTSFF  810

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LV+YCF+PAM  F+GQFIVQ LD  FL YLL+ITV+L LISLLEV+W+ IGLEE WRNEQ
Sbjct  811   LVIYCFLPAMSLFSGQFIVQGLDPAFLTYLLLITVSLCLISLLEVRWSGIGLEEWWRNEQ  870

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW IGGTSAHL AV+QGLLKV+AGIEISFTLT+KSA EDE+D+YADLY+VKWTSLFIMPL
Sbjct  871   FWAIGGTSAHLVAVIQGLLKVVAGIEISFTLTTKSAGEDEEDVYADLYLVKWTSLFIMPL  930

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VNI AL++G  R +YSVIPQWNKL GG FFSFWVL+H+YPFAKGLMGR+G+VPTIV
Sbjct  931   TIIIVNIVALIMGFLRTVYSVIPQWNKLMGGTFFSFWVLSHMYPFAKGLMGRRGRVPTIV  990

Query  156   YVwtgllsittsllwiSVNPPQDPRAAASN  67
             YVW+GLLSIT +LLWIS++PP D  A+  N
Sbjct  991   YVWSGLLSITIALLWISIDPPTDTTASGGN  1020



>gb|EPS66341.1| hypothetical protein M569_08434 [Genlisea aurea]
Length=1036

 Score =   416 bits (1068),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 213/272 (78%), Positives = 245/272 (90%), Gaps = 3/272 (1%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LA+RRLKFLQR+AY NVG+YPFTSIF
Sbjct  762   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFLATRRLKFLQRVAYLNVGIYPFTSIF  821

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+  F+GQFIVQ+LD +FL YLL IT+TL++I+LLEVKW+ I LE+ WRNEQ
Sbjct  822   LVVYCFLPALSLFSGQFIVQSLDVKFLLYLLTITITLIMIALLEVKWSGITLEDHWRNEQ  881

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW IGGTSAHL AV+QGLLKV+AGIEISFTLTSKSAAEDEDD +ADLY VKWT LF++PL
Sbjct  882   FWAIGGTSAHLVAVIQGLLKVVAGIEISFTLTSKSAAEDEDDAFADLYEVKWTGLFVVPL  941

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+V+NI ALVIG SR IYSVIP+W+KLFGG+FFSFWVLAH+YPFAKGLMGR+G+VPTIV
Sbjct  942   TIIVINIVALVIGISRTIYSVIPEWSKLFGGSFFSFWVLAHMYPFAKGLMGRRGRVPTIV  1001

Query  156   YVwtgllsittsllwiSVNPPQDPRAAASNED  61
             YVW+GL+SIT SLLWI ++PPQ     A+N D
Sbjct  1002  YVWSGLISITVSLLWIVISPPQ---GGATNSD  1030



>gb|AFZ78592.1| cellulose synthase-like protein [Populus tomentosa]
Length=1025

 Score =   415 bits (1066),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 198/242 (82%), Positives = 218/242 (90%), Gaps = 0/242 (0%)
 Frame = -3

Query  876  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
            FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN  L SRRLKFLQRIAY NVG+YPFTS F
Sbjct  758  FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNAFLGSRRLKFLQRIAYLNVGIYPFTSFF  817

Query  696  LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
            LV YCF+PA+  FTG FIVQ+LD  FLCYLL ITV+L LISLLE+KW+ IGLEELWRNEQ
Sbjct  818  LVTYCFLPALSLFTGTFIVQSLDIAFLCYLLTITVSLTLISLLEIKWSGIGLEELWRNEQ  877

Query  516  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
            FWLIGGTSAHLAAVLQGLLKV AGIEISFTLTSKSA EDEDD++ADLY VKWTSLF++PL
Sbjct  878  FWLIGGTSAHLAAVLQGLLKVTAGIEISFTLTSKSAGEDEDDVFADLYEVKWTSLFLVPL  937

Query  336  TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
            TILVVNI A+VIGCSR +YS IP+W KL GG FFSFWVL+H+YPF KGL+GR+G+VPTIV
Sbjct  938  TILVVNIVAIVIGCSRTLYSEIPEWGKLMGGLFFSFWVLSHMYPFVKGLLGRRGRVPTIV  997

Query  156  YV  151
            YV
Sbjct  998  YV  999



>ref|XP_002304709.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEE79688.1| cellulose synthase family protein [Populus trichocarpa]
Length=1025

 Score =   415 bits (1066),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 198/242 (82%), Positives = 218/242 (90%), Gaps = 0/242 (0%)
 Frame = -3

Query  876  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
            FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN  L SRRLKFLQRIAY NVG+YPFTS F
Sbjct  758  FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNAFLGSRRLKFLQRIAYLNVGIYPFTSFF  817

Query  696  LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
            LV YCF+PA+  FTG FIVQ+LD  FLCYLL ITV+L LISLLE+KW+ IGLEELWRNEQ
Sbjct  818  LVTYCFLPALSLFTGTFIVQSLDIAFLCYLLTITVSLTLISLLEIKWSGIGLEELWRNEQ  877

Query  516  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
            FWLIGGTSAHLAAVLQGLLKV AGIEISFTLTSKSA EDEDD++ADLY VKWTSLF++PL
Sbjct  878  FWLIGGTSAHLAAVLQGLLKVTAGIEISFTLTSKSAGEDEDDVFADLYEVKWTSLFLVPL  937

Query  336  TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
            TILVVNI A+VIGCSR +YS IP+W KL GG FFSFWVL+H+YPF KGL+GR+G+VPTIV
Sbjct  938  TILVVNIVAIVIGCSRTLYSEIPEWGKLMGGLFFSFWVLSHMYPFVKGLLGRRGRVPTIV  997

Query  156  YV  151
            YV
Sbjct  998  YV  999



>ref|XP_006349527.1| PREDICTED: cellulose synthase-like protein D1-like [Solanum tuberosum]
Length=1039

 Score =   415 bits (1066),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 209/242 (86%), Positives = 225/242 (93%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIF+SRNNP LAS RLKFLQRIAYFNVGVYPFTSIF
Sbjct  770   FRGTAPINLTDRLHQVLRWATGSVEIFYSRNNPILASPRLKFLQRIAYFNVGVYPFTSIF  829

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCFIPA C FTGQFIVQ L+  FL YLL+ITVTL+LISLLEVKW+ IGLEELWRNEQ
Sbjct  830   LVVYCFIPAFCLFTGQFIVQNLNVYFLSYLLLITVTLVLISLLEVKWSGIGLEELWRNEQ  889

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAH AAV+QGLLKVIAG+EISFTLTSKS  EDEDDIYADLYVVKWTSLFI+PL
Sbjct  890   FWLIGGTSAHFAAVIQGLLKVIAGVEISFTLTSKSTGEDEDDIYADLYVVKWTSLFILPL  949

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+VVNI ALVIG SR +YS+IPQWN+LFGG FFSFWVL+HLYPFAKGLMGRKG+V TI+
Sbjct  950   TIMVVNIMALVIGISRTVYSIIPQWNRLFGGVFFSFWVLSHLYPFAKGLMGRKGRVSTII  1009

Query  156   YV  151
             Y+
Sbjct  1010  YI  1011



>ref|XP_010673439.1| PREDICTED: cellulose synthase-like protein D1 [Beta vulgaris 
subsp. vulgaris]
Length=1028

 Score =   414 bits (1065),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 210/262 (80%), Positives = 238/262 (91%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNP +A+RRLKFLQR+AY NVG+YPFTS+F
Sbjct  755   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPMIATRRLKFLQRMAYLNVGIYPFTSVF  814

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+  F+GQFIVQ L   FL YLL ITV LML+SLLEVKW+ IGLEE WRNEQ
Sbjct  815   LVVYCFLPALSLFSGQFIVQGLSVPFLSYLLTITVCLMLLSLLEVKWSGIGLEEWWRNEQ  874

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW+IGGTSAH AAVLQGLLKVIAG+EISFTLTSKS +EDEDD+YADLYVVKWTSLF MPL
Sbjct  875   FWVIGGTSAHFAAVLQGLLKVIAGVEISFTLTSKSTSEDEDDVYADLYVVKWTSLFCMPL  934

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+V+N+ ALVIG S+ +YSVIP+WNK  GG FFS WVLAH+YPFAKGLMGRKG+VPTIV
Sbjct  935   TIIVINLVALVIGFSKTVYSVIPEWNKFLGGCFFSLWVLAHMYPFAKGLMGRKGRVPTIV  994

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GL+SIT SLLWI+++PPQ
Sbjct  995   WVWSGLVSITVSLLWITISPPQ  1016



>gb|EYU31744.1| hypothetical protein MIMGU_mgv1a020208mg [Erythranthe guttata]
Length=1057

 Score =   411 bits (1057),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 212/262 (81%), Positives = 238/262 (91%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LA+ RLKFLQRIAY NVG+YPFTSIF
Sbjct  785   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAILATSRLKFLQRIAYLNVGIYPFTSIF  844

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+  F+G+FIVQ+LD  FL YLLIIT+ L+ ISLLEVKW+ IGLEE WRNEQ
Sbjct  845   LVVYCFLPALSLFSGKFIVQSLDIHFLSYLLIITLCLVFISLLEVKWSGIGLEEWWRNEQ  904

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW+IGGTSAHL AV+QGLLKVIAGIEISFTLTSKS  EDEDDIYADLYVVKWT LFIMPL
Sbjct  905   FWVIGGTSAHLVAVIQGLLKVIAGIEISFTLTSKSTGEDEDDIYADLYVVKWTGLFIMPL  964

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I+++N+ ALVIG SR +YSVIP+W+KLFGGAFFSFWVL H+YPFAKGLMGR+G+VPTIV
Sbjct  965   FIIIMNLVALVIGFSRTVYSVIPEWSKLFGGAFFSFWVLVHMYPFAKGLMGRRGRVPTIV  1024

Query  156   YVwtgllsittsllwiSVNPPQ  91
             YVW GL+SIT+SLLWI ++PPQ
Sbjct  1025  YVWAGLISITSSLLWIVISPPQ  1046



>ref|XP_008438379.1| PREDICTED: cellulose synthase-like protein D1 [Cucumis melo]
Length=1047

 Score =   409 bits (1052),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 198/242 (82%), Positives = 220/242 (91%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN  L S+RLKFLQR+AY NVG+YPFTSIF
Sbjct  779   FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNAFLGSKRLKFLQRVAYLNVGIYPFTSIF  838

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+  F+G FIVQ L+  FL YLLIITV L L+SLLEVKW+ I LEE WRNEQ
Sbjct  839   LVVYCFLPALSLFSGHFIVQGLNVAFLIYLLIITVCLCLLSLLEVKWSGIALEEWWRNEQ  898

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW+IGGTSAHLAAV+QGLLKVIAGIEISFTLTSKSA EDEDDIYADLY+VKWTSLFIMPL
Sbjct  899   FWVIGGTSAHLAAVIQGLLKVIAGIEISFTLTSKSAGEDEDDIYADLYLVKWTSLFIMPL  958

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VNI A+VIG SR +YSVIPQW+KL GG FFSFWVLAH+YPFAKGLMGR+G++PTIV
Sbjct  959   TIMIVNIIAVVIGFSRTVYSVIPQWSKLAGGLFFSFWVLAHMYPFAKGLMGRRGRLPTIV  1018

Query  156   YV  151
             YV
Sbjct  1019  YV  1020



>ref|XP_009601450.1| PREDICTED: cellulose synthase-like protein D1 [Nicotiana tomentosiformis]
Length=1040

 Score =   408 bits (1048),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 202/242 (83%), Positives = 227/242 (94%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIF+SRNNPALAS RLKFLQRIAYFNVGVYPFTSIF
Sbjct  770   FRGTAPINLTDRLHQVLRWATGSVEIFYSRNNPALASPRLKFLQRIAYFNVGVYPFTSIF  829

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCFIPA+C F+GQFIV  L   FL YLL+IT+TL+LISLLEVKW+ I LEELWRNEQ
Sbjct  830   LVVYCFIPALCLFSGQFIVSNLSIPFLSYLLLITITLVLISLLEVKWSGIALEELWRNEQ  889

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAH AAV+QGLLKV+AG+EISFTLTSKSA ++++DIYADL+VVKWTSLFI+PL
Sbjct  890   FWLIGGTSAHFAAVIQGLLKVVAGVEISFTLTSKSAGDEDEDIYADLHVVKWTSLFILPL  949

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TILVVN+ A+VIG +R +YSVIPQWN+LFGGAFFSFWVL+HLYPFAKGLMGR+G+VPTIV
Sbjct  950   TILVVNLTAIVIGIARTVYSVIPQWNRLFGGAFFSFWVLSHLYPFAKGLMGRRGRVPTIV  1009

Query  156   YV  151
             Y+
Sbjct  1010  YI  1011



>ref|XP_004134379.1| PREDICTED: cellulose synthase-like protein D1-like [Cucumis sativus]
 ref|XP_004166319.1| PREDICTED: cellulose synthase-like protein D1-like [Cucumis sativus]
 gb|KGN56753.1| hypothetical protein Csa_3G132550 [Cucumis sativus]
Length=1047

 Score =   408 bits (1048),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 196/242 (81%), Positives = 220/242 (91%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN  L S+RLKFLQR+AY NVG+YPFTSIF
Sbjct  779   FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNAFLGSKRLKFLQRVAYLNVGIYPFTSIF  838

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+  F+G FIVQ L+  FL YLLIITV L L+SLLEVKW+ I LEE WRNEQ
Sbjct  839   LVVYCFLPALSLFSGHFIVQGLNVAFLTYLLIITVCLCLLSLLEVKWSGIALEEWWRNEQ  898

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW+IGGTSAHLAAV+QGLLKV+AGIEISFTLTSKSA +DEDDIYADLY+VKWTSLFIMPL
Sbjct  899   FWVIGGTSAHLAAVIQGLLKVVAGIEISFTLTSKSAGDDEDDIYADLYLVKWTSLFIMPL  958

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VNI A+VIG SR +YSVIPQW+KL GG FFSFWVLAH+YPFAKGLMGR+G++PTIV
Sbjct  959   TIMIVNIIAVVIGFSRTVYSVIPQWSKLAGGLFFSFWVLAHMYPFAKGLMGRRGRLPTIV  1018

Query  156   YV  151
             YV
Sbjct  1019  YV  1020



>ref|XP_010109052.1| Cellulose synthase-like protein D1 [Morus notabilis]
 gb|EXC20804.1| Cellulose synthase-like protein D1 [Morus notabilis]
Length=1039

 Score =   405 bits (1042),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 217/267 (81%), Positives = 240/267 (90%), Gaps = 0/267 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LASRRLKFLQR+AY NVG+YPFTSIF
Sbjct  766   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASRRLKFLQRVAYLNVGIYPFTSIF  825

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+   +GQFIVQ LD  FL YLL IT+ L LISLLEVKW+ IGLEE WRNEQ
Sbjct  826   LVVYCFLPALSLLSGQFIVQGLDVAFLSYLLTITICLTLISLLEVKWSGIGLEEWWRNEQ  885

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW+IGGTSAHL AVLQGLLK+IAGIEISF LTSKSA +DE+D+YADLY+VKWTSLFIMPL
Sbjct  886   FWVIGGTSAHLVAVLQGLLKIIAGIEISFKLTSKSAGDDEEDVYADLYLVKWTSLFIMPL  945

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+VVNI A+VIGCSR +YSVIPQWNKL GG FFSFWVLAH+YPFAKGLMGR+G+VPTIV
Sbjct  946   TIIVVNIVAVVIGCSRTLYSVIPQWNKLLGGTFFSFWVLAHMYPFAKGLMGRRGRVPTIV  1005

Query  156   YVwtgllsittsllwiSVNPPQDPRAA  76
             YVW GL+SIT SLLWIS++PP D  +A
Sbjct  1006  YVWAGLVSITVSLLWISISPPDDTLSA  1032



>ref|NP_001169669.1| uncharacterized protein LOC100383550 [Zea mays]
 gb|ACN34455.1| unknown [Zea mays]
Length=553

 Score =   392 bits (1006),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 199/262 (76%), Positives = 231/262 (88%), Gaps = 0/262 (0%)
 Frame = -3

Query  876  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
            FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LASRR+KFLQRIAY NVG+YPFTSIF
Sbjct  280  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASRRMKFLQRIAYLNVGIYPFTSIF  339

Query  696  LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
            L+VYCF+PA+  F+GQFIV+TL+  FL YLL+IT+TL L+++LE+KW+ I LEE WRNEQ
Sbjct  340  LIVYCFLPALSLFSGQFIVKTLNVTFLTYLLVITLTLCLLAVLEIKWSGISLEEWWRNEQ  399

Query  516  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
            FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKS  +D DD +ADLY+VKWTSL I P+
Sbjct  400  FWLIGGTSAHLAAVLQGLLKVVAGIEISFTLTSKSGGDDVDDEFADLYIVKWTSLMIPPI  459

Query  336  TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             I++VN+  + +G SR IYS IPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  460  VIMMVNLIGIAVGFSRTIYSEIPQWSKLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  519

Query  156  YVwtgllsittsllwiSVNPPQ  91
            +VW GLLSIT SLLW+++NPP 
Sbjct  520  FVWAGLLSITISLLWVAINPPS  541



>ref|XP_009779529.1| PREDICTED: cellulose synthase-like protein D1 [Nicotiana sylvestris]
Length=1040

 Score =   404 bits (1038),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 200/242 (83%), Positives = 225/242 (93%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIF+SRNNPALAS RLKFLQR+AYFNVGVYPFTSIF
Sbjct  770   FRGTAPINLTDRLHQVLRWATGSVEIFYSRNNPALASPRLKFLQRVAYFNVGVYPFTSIF  829

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCFIPA+C F+GQFIV  L   FL YLL+IT+TL+LISLLEVKW+ I LEELWRNEQ
Sbjct  830   LVVYCFIPALCLFSGQFIVSNLSVPFLSYLLLITITLVLISLLEVKWSGIALEELWRNEQ  889

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAH AAV+QGLLKV+AG+EISFTLTSKSA +++ DIYADL++VKWTSLFI+PL
Sbjct  890   FWLIGGTSAHFAAVIQGLLKVVAGVEISFTLTSKSAGDEDVDIYADLHIVKWTSLFILPL  949

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TILVVNI A+VIG +R +YSVIPQWN+L GGAFFSFWVL+HLYPFAKGLMGR+G+VPTIV
Sbjct  950   TILVVNITAIVIGMARTVYSVIPQWNRLLGGAFFSFWVLSHLYPFAKGLMGRRGRVPTIV  1009

Query  156   YV  151
             Y+
Sbjct  1010  YI  1011



>ref|XP_006845742.1| hypothetical protein AMTR_s00019p00246190 [Amborella trichopoda]
 gb|ERN07417.1| hypothetical protein AMTR_s00019p00246190 [Amborella trichopoda]
Length=1056

 Score =   404 bits (1037),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 206/263 (78%), Positives = 237/263 (90%), Gaps = 0/263 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LA+ R+KFLQRIAY NVG+YPFTSIF
Sbjct  782   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLATTRMKFLQRIAYMNVGIYPFTSIF  841

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+G FIVQTL+  FL YLLIITVTL L+++LEVKW+ IGLEE WRNEQ
Sbjct  842   LIVYCFLPALSLFSGHFIVQTLNITFLVYLLIITVTLSLLAILEVKWSGIGLEEWWRNEQ  901

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV+QGLLKVIAGIEISFTLTSKS AEDEDD +ADLYVVKWTSL I P+
Sbjct  902   FWLIGGTSAHLAAVIQGLLKVIAGIEISFTLTSKSTAEDEDDAFADLYVVKWTSLMIPPI  961

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR +YS IPQW+KL GG FFSFWVLAH+YPFAKGLMGR+G+ PTIV
Sbjct  962   TIMMVNLVAVAVGFSRTLYSEIPQWSKLLGGVFFSFWVLAHMYPFAKGLMGRRGRTPTIV  1021

Query  156   YVwtgllsittsllwiSVNPPQD  88
             YVW+GL++IT SLLWIS++PP+D
Sbjct  1022  YVWSGLIAITISLLWISISPPKD  1044



>ref|XP_007034422.1| Cellulose synthase-like D1 [Theobroma cacao]
 gb|EOY05348.1| Cellulose synthase-like D1 [Theobroma cacao]
Length=1048

 Score =   403 bits (1036),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 217/268 (81%), Positives = 241/268 (90%), Gaps = 0/268 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNP LA+RRLKFLQRIAY NVG YPFTS+F
Sbjct  774   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPLLATRRLKFLQRIAYLNVGFYPFTSLF  833

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LV YCF+PA+  F+GQFIVQ L+  FL YLLIIT+TL  +SLLEVKW+ I LEE WRNEQ
Sbjct  834   LVTYCFLPALSLFSGQFIVQGLNVAFLFYLLIITLTLTFLSLLEVKWSGIALEEWWRNEQ  893

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW+IGGTSAHL AV+QGLLKVIAGIEISFTLTSKSA +DEDDIYADLYVVKWTSLFI+PL
Sbjct  894   FWVIGGTSAHLVAVIQGLLKVIAGIEISFTLTSKSAGDDEDDIYADLYVVKWTSLFILPL  953

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+VVN+ A+VI  SR IYSVIPQWNKLFGG FFSFWVLAH+YPFAKGLMGR+G+VPTIV
Sbjct  954   TIIVVNLVAVVIAVSRTIYSVIPQWNKLFGGLFFSFWVLAHMYPFAKGLMGRRGRVPTIV  1013

Query  156   YVwtgllsittsllwiSVNPPQDPRAAA  73
             YVW+GL+SIT SLLWIS++PP    A+A
Sbjct  1014  YVWSGLVSITVSLLWISISPPDGNTASA  1041



>gb|KDO49384.1| hypothetical protein CISIN_1g0360642mg, partial [Citrus sinensis]
Length=899

 Score =   399 bits (1025),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 210/262 (80%), Positives = 240/262 (92%), Gaps = 0/262 (0%)
 Frame = -3

Query  876  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
            FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  L +RRLKFLQR+AY N G+YPFTSIF
Sbjct  630  FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNAILGTRRLKFLQRMAYLNTGIYPFTSIF  689

Query  696  LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
            LV YCF+PAMC+F+G+FIV  L+  FLCYLL ITVTL LISLLEVKW+ IGLEE WRNEQ
Sbjct  690  LVTYCFLPAMCHFSGKFIVPNLNIAFLCYLLTITVTLTLISLLEVKWSGIGLEEWWRNEQ  749

Query  516  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
            FW+IGG+SAHLAAVLQGLLKVIAGIEISFTLT+KSAAED++D+YADLY++KWTSLFI+PL
Sbjct  750  FWVIGGSSAHLAAVLQGLLKVIAGIEISFTLTTKSAAEDDEDMYADLYIIKWTSLFIVPL  809

Query  336  TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
            TI+VVNI ALVIG SR IYSV+PQW KL GG+FFSFWVLAH+YPF KGLMGR+GK+PTI+
Sbjct  810  TIIVVNIVALVIGASRTIYSVLPQWGKLLGGSFFSFWVLAHMYPFCKGLMGRRGKLPTII  869

Query  156  YVwtgllsittsllwiSVNPPQ  91
            YVWTGLLSIT SL+W++V+PP 
Sbjct  870  YVWTGLLSITLSLIWVTVSPPD  891



>ref|XP_010522413.1| PREDICTED: cellulose synthase-like protein D1 [Tarenaya hassleriana]
 ref|XP_010522414.1| PREDICTED: cellulose synthase-like protein D1 [Tarenaya hassleriana]
Length=1040

 Score =   402 bits (1033),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 215/263 (82%), Positives = 243/263 (92%), Gaps = 0/263 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN   A+RRLKFLQR+AY NVG+YPFTSIF
Sbjct  769   FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNALFATRRLKFLQRVAYLNVGIYPFTSIF  828

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+C FTGQFIVQ+LD  FL YLL IT+TL LISLLEVKW+ IGLEE WRNEQ
Sbjct  829   LVVYCFLPALCLFTGQFIVQSLDIHFLIYLLCITLTLTLISLLEVKWSGIGLEEWWRNEQ  888

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV+QGLLKVIAGIEISFTLTSKSA +DEDD+YADLY+VKWTSLFIMPL
Sbjct  889   FWLIGGTSAHLAAVIQGLLKVIAGIEISFTLTSKSAGDDEDDVYADLYIVKWTSLFIMPL  948

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+VVN+ A+VIG SR IYSVIPQW+KL GG+FFSFWVL H+YPFAKGLMGR+G+VPTIV
Sbjct  949   TIIVVNLVAVVIGASRTIYSVIPQWSKLMGGSFFSFWVLVHMYPFAKGLMGRRGRVPTIV  1008

Query  156   YVwtgllsittsllwiSVNPPQD  88
             +VW+GL+SIT SLLWI+++PP +
Sbjct  1009  WVWSGLVSITVSLLWITISPPDE  1031



>emb|CDY17138.1| BnaA05g10500D [Brassica napus]
Length=972

 Score =   399 bits (1025),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 211/263 (80%), Positives = 239/263 (91%), Gaps = 0/263 (0%)
 Frame = -3

Query  876  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
            FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN   A+RRLKFLQR+AY NVG+YPFTSIF
Sbjct  701  FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNAMFATRRLKFLQRVAYLNVGIYPFTSIF  760

Query  696  LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
            LVVYCF+PA+C F+G+FIVQ+LD  FL YLL I++TL+LISLLEVKW+ IGLEE WRNEQ
Sbjct  761  LVVYCFLPALCLFSGKFIVQSLDIHFLSYLLCISLTLILISLLEVKWSGIGLEEWWRNEQ  820

Query  516  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
            FWLIGG+SAHLAAV QGLLKV+AGIEISFTLTSK++ EDEDD +ADLYVVKWT LFIMPL
Sbjct  821  FWLIGGSSAHLAAVFQGLLKVLAGIEISFTLTSKASGEDEDDAFADLYVVKWTGLFIMPL  880

Query  336  TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
            TI+VVN+ A+VIG SR IYSVIPQWNKLFGG FFS WVL H+YPF KGLMGR+GKVPTIV
Sbjct  881  TIIVVNLVAIVIGASRTIYSVIPQWNKLFGGIFFSMWVLTHMYPFCKGLMGRRGKVPTIV  940

Query  156  YVwtgllsittsllwiSVNPPQD  88
            YVW+GL+SIT SLLWI+++PP D
Sbjct  941  YVWSGLVSITVSLLWITISPPDD  963



>ref|XP_006489806.1| PREDICTED: cellulose synthase-like protein D1-like [Citrus sinensis]
Length=1044

 Score =   400 bits (1029),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 196/242 (81%), Positives = 222/242 (92%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  L +RRLKFLQR+AY N G+YPFTSIF
Sbjct  775   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNAILGTRRLKFLQRMAYLNTGIYPFTSIF  834

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LV YCF+PAMC+F+G+FIV  L+  FLCYLL ITVTL LISLLEVKW+ IGLEE WRNEQ
Sbjct  835   LVTYCFLPAMCHFSGKFIVPNLNIAFLCYLLTITVTLTLISLLEVKWSGIGLEEWWRNEQ  894

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW+IGG+SAHLAAVLQGLLKVIAGIEISFTLT+KSAAED++D+YADLY++KWTSLFI+PL
Sbjct  895   FWVIGGSSAHLAAVLQGLLKVIAGIEISFTLTTKSAAEDDEDMYADLYIIKWTSLFIVPL  954

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+VVNI ALVIG SR IYSV+PQW KL GG+FFSFWVLAH+YPF KGLMGR+GK+PTI+
Sbjct  955   TIIVVNIVALVIGASRTIYSVLPQWGKLLGGSFFSFWVLAHMYPFCKGLMGRRGKLPTII  1014

Query  156   YV  151
             YV
Sbjct  1015  YV  1016



>ref|XP_011020671.1| PREDICTED: cellulose synthase-like protein D1 [Populus euphratica]
Length=1038

 Score =   400 bits (1028),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 199/242 (82%), Positives = 218/242 (90%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN  L SRRLKFLQRIAY NVG+YPFTS F
Sbjct  771   FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNAFLGSRRLKFLQRIAYLNVGIYPFTSFF  830

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LV YCF+PA+  FTG FIVQ+LD  FLCYLL ITVTL LISLLE+KW+ IGLEELWRNEQ
Sbjct  831   LVTYCFLPALSLFTGTFIVQSLDIAFLCYLLTITVTLTLISLLEIKWSGIGLEELWRNEQ  890

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV+QGLLKV AGIEISFTLTSKSA EDEDD++ADLY VKWTSLF+MPL
Sbjct  891   FWLIGGTSAHLAAVIQGLLKVTAGIEISFTLTSKSAGEDEDDVFADLYEVKWTSLFLMPL  950

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              ILVVNI A+VIGCSR +YSVIP+W KL GG FFSFWVL+H+YPF KGL+GR+G+VPTIV
Sbjct  951   AILVVNIVAIVIGCSRTLYSVIPEWGKLMGGLFFSFWVLSHMYPFVKGLLGRRGRVPTIV  1010

Query  156   YV  151
             YV
Sbjct  1011  YV  1012



>emb|CDY19449.1| BnaC04g11500D [Brassica napus]
Length=971

 Score =   399 bits (1024),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 210/263 (80%), Positives = 240/263 (91%), Gaps = 0/263 (0%)
 Frame = -3

Query  876  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
            FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN   A+RRLKFLQR+AY NVG+YPFTSIF
Sbjct  700  FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNAMFATRRLKFLQRVAYLNVGIYPFTSIF  759

Query  696  LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
            LVVYCF+PA+C F+G+FIVQ+LD  FL YLL I++TL+LISLLEVKW+ IGLEE WRNEQ
Sbjct  760  LVVYCFLPALCLFSGKFIVQSLDIHFLSYLLCISLTLILISLLEVKWSGIGLEEWWRNEQ  819

Query  516  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
            FWLIGG+SAHLAAV+QGLLKV+AGIEISFTLTSK++ EDEDD +ADLY+VKWT LFIMPL
Sbjct  820  FWLIGGSSAHLAAVVQGLLKVLAGIEISFTLTSKASGEDEDDAFADLYIVKWTGLFIMPL  879

Query  336  TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
            TI+VVN+ A+VIG SR IYSVIPQWNKLFGG FFS WVL H+YPF KGLMGR+GKVPTIV
Sbjct  880  TIIVVNLVAIVIGASRTIYSVIPQWNKLFGGIFFSMWVLTHMYPFCKGLMGRRGKVPTIV  939

Query  156  YVwtgllsittsllwiSVNPPQD  88
            YVW+GL+SIT SLLWI+++PP D
Sbjct  940  YVWSGLVSITVSLLWITISPPDD  962



>ref|XP_007225503.1| hypothetical protein PRUPE_ppa000644mg [Prunus persica]
 gb|EMJ26702.1| hypothetical protein PRUPE_ppa000644mg [Prunus persica]
Length=1054

 Score =   400 bits (1028),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 209/262 (80%), Positives = 232/262 (89%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIF+SRNN  LA RRLKFLQRIAY NVG+YPFTSIF
Sbjct  782   FRGTAPINLTDRLHQVLRWATGSVEIFYSRNNAFLACRRLKFLQRIAYLNVGIYPFTSIF  841

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+C FTGQFIV  L   FL YLLIIT+ L L+SLLEV+W+ IGLEE WRNEQ
Sbjct  842   LVVYCFLPALCLFTGQFIVAGLSVPFLIYLLIITICLCLLSLLEVRWSGIGLEEWWRNEQ  901

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHL AV+QGLLKV+AGIEI FTLTSKS AEDE+DIYADLYVVKWTSLF+MPL
Sbjct  902   FWLIGGTSAHLVAVIQGLLKVVAGIEIHFTLTSKSTAEDEEDIYADLYVVKWTSLFLMPL  961

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+++NI A+VIG SR +Y VIPQWNKL GG FFSFWVLAH+YPF KGLMGR+G++PTIV
Sbjct  962   TIIIINIIAMVIGISRTLYEVIPQWNKLLGGLFFSFWVLAHMYPFMKGLMGRRGRIPTIV  1021

Query  156   YVwtgllsittsllwiSVNPPQ  91
             YVW GLL+I  SLLWI +NPP 
Sbjct  1022  YVWAGLLAIIISLLWIVINPPN  1043



>ref|XP_004296630.1| PREDICTED: cellulose synthase-like protein D1-like [Fragaria 
vesca subsp. vesca]
Length=1063

 Score =   400 bits (1028),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 210/261 (80%), Positives = 233/261 (89%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIF+SRNN  LA +RLKFLQRIAY NVG+YPFTSIF
Sbjct  789   FRGTAPINLTDRLHQVLRWATGSVEIFYSRNNAFLACKRLKFLQRIAYLNVGIYPFTSIF  848

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+C FTGQFIV  L   FLCYLL I++ L+LIS+LEVKW+ IGLEE WRNEQ
Sbjct  849   LVVYCFLPALCLFTGQFIVSGLSLPFLCYLLTISICLILISILEVKWSGIGLEEWWRNEQ  908

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW IGGTSAHLAAV+QGLLKVIAGIEISFTLTSKS+ EDEDDIYADLY+VKWTSLFIMPL
Sbjct  909   FWCIGGTSAHLAAVIQGLLKVIAGIEISFTLTSKSSGEDEDDIYADLYIVKWTSLFIMPL  968

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I+V NI A VIG SR +Y+VIPQWNKL GG FFSFWVLAH+YPF KGLMGR+GK+PTIV
Sbjct  969   LIIVTNIIAAVIGISRTLYAVIPQWNKLLGGLFFSFWVLAHMYPFMKGLMGRRGKIPTIV  1028

Query  156   YVwtgllsittsllwiSVNPP  94
             YVW GL++IT SLLW+ +NPP
Sbjct  1029  YVWAGLVAITISLLWLLINPP  1049



>ref|XP_008224588.1| PREDICTED: cellulose synthase-like protein D1 [Prunus mume]
Length=1066

 Score =   399 bits (1026),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 208/262 (79%), Positives = 232/262 (89%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIF+SRNN  LA RRLKFLQRIAY NVG+YPFTSIF
Sbjct  794   FRGTAPINLTDRLHQVLRWATGSVEIFYSRNNAFLACRRLKFLQRIAYLNVGIYPFTSIF  853

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+C FTGQFIV  L   FL YLLIIT+ L L+SLLEV+W+ IGLEE WRNEQ
Sbjct  854   LVVYCFLPALCLFTGQFIVAGLSVPFLIYLLIITICLCLLSLLEVRWSGIGLEEWWRNEQ  913

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHL AV+QGLLKV+AG+EI FTLTSKS AEDE+DIYADLYVVKWTSLF+MPL
Sbjct  914   FWLIGGTSAHLVAVIQGLLKVVAGVEIHFTLTSKSTAEDEEDIYADLYVVKWTSLFLMPL  973

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+++NI A+VIG SR +Y VIPQWNKL GG FFSFWVLAH+YPF KGLMGR+G++PTIV
Sbjct  974   TIIIINIIAMVIGISRTLYEVIPQWNKLLGGLFFSFWVLAHMYPFMKGLMGRRGRIPTIV  1033

Query  156   YVwtgllsittsllwiSVNPPQ  91
             YVW GLL+I  SLLWI +NPP 
Sbjct  1034  YVWAGLLAIIISLLWIVINPPN  1055



>ref|XP_002518122.1| Cellulose synthase A catalytic subunit 1 [UDP-forming], putative 
[Ricinus communis]
 gb|EEF44255.1| Cellulose synthase A catalytic subunit 1 [UDP-forming], putative 
[Ricinus communis]
Length=1059

 Score =   399 bits (1025),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 206/263 (78%), Positives = 228/263 (87%), Gaps = 0/263 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFS+NN  LASRRLKFLQRIAY NVG+YPFTS F
Sbjct  786   FRGSAPINLTDRLHQVLRWATGSVEIFFSKNNAFLASRRLKFLQRIAYLNVGMYPFTSFF  845

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LV YCF+PA+   +G FIV +L+  FL YLLIITVTL LISLLEVKW+ IGLEE WRNEQ
Sbjct  846   LVTYCFLPALSLISGHFIVSSLNIAFLSYLLIITVTLTLISLLEVKWSGIGLEEWWRNEQ  905

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW IGGTSAH  AVLQGLLKVIAGIEISF LTSKSA EDEDD +ADLY+VKWTSLFIMPL
Sbjct  906   FWAIGGTSAHFVAVLQGLLKVIAGIEISFKLTSKSAGEDEDDAFADLYMVKWTSLFIMPL  965

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I++ NI A+VIG SR IYSVIPQW KL GG FFSFWVLAH+YPF KGL+GR+G+VPTI+
Sbjct  966   AIILCNIIAIVIGVSRTIYSVIPQWGKLIGGCFFSFWVLAHMYPFIKGLLGRRGRVPTII  1025

Query  156   YVwtgllsittsllwiSVNPPQD  88
             YVW G+LSIT SLL IS++PP D
Sbjct  1026  YVWAGILSITVSLLMISIDPPTD  1048



>ref|XP_009143896.1| PREDICTED: cellulose synthase-like protein D1 [Brassica rapa]
Length=1035

 Score =   398 bits (1023),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 211/263 (80%), Positives = 238/263 (90%), Gaps = 0/263 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN   A+RRLKFLQR+AY NVG+YPFTSIF
Sbjct  764   FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNAMFATRRLKFLQRVAYLNVGIYPFTSIF  823

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+C F+G FIVQ+LD  FL YLL I++TL+LISLLEVKW+ IGLEE WRNEQ
Sbjct  824   LVVYCFLPALCLFSGTFIVQSLDIHFLSYLLCISLTLILISLLEVKWSGIGLEEWWRNEQ  883

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGG+SAHLAAV QGLLKV+AGIEISFTLTSK++ EDEDD +ADLYVVKWT LFIMPL
Sbjct  884   FWLIGGSSAHLAAVFQGLLKVLAGIEISFTLTSKASGEDEDDAFADLYVVKWTGLFIMPL  943

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+VVN+ A+VIG SR IYSVIPQWNKLFGG FFS WVL H+YPF KGLMGR+GKVPTIV
Sbjct  944   TIIVVNLVAIVIGASRTIYSVIPQWNKLFGGIFFSMWVLTHMYPFCKGLMGRRGKVPTIV  1003

Query  156   YVwtgllsittsllwiSVNPPQD  88
             YVW+GL+SIT SLLWI+++PP D
Sbjct  1004  YVWSGLVSITVSLLWITISPPDD  1026



>gb|EMT24169.1| Cellulose synthase-like protein D2 [Aegilops tauschii]
Length=926

 Score =   395 bits (1016),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 200/262 (76%), Positives = 233/262 (89%), Gaps = 0/262 (0%)
 Frame = -3

Query  876  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
            FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LASRR+K LQRIAY NVG+YPFTSIF
Sbjct  653  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASRRMKCLQRIAYLNVGIYPFTSIF  712

Query  696  LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
            L+VYCF+PA+  F+GQFIV+ LD  FL YLL+IT+TL ++++LE+KW+ I LEE WRNEQ
Sbjct  713  LIVYCFLPALSLFSGQFIVKELDVTFLTYLLVITLTLCMLAVLEIKWSGINLEEWWRNEQ  772

Query  516  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
            FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKS A+DE+D YADLY+VKWTSL I P+
Sbjct  773  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSGADDENDEYADLYIVKWTSLMIPPI  832

Query  336  TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             I++VN+ A+ +G SR IYS IPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  833  VIMMVNLIAIAVGFSRTIYSEIPQWSKLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  892

Query  156  YVwtgllsittsllwiSVNPPQ  91
            +VW+GLL+IT SLLW+++NPP 
Sbjct  893  FVWSGLLAITISLLWVAINPPS  914



>ref|XP_011006034.1| PREDICTED: cellulose synthase-like protein D2 [Populus euphratica]
 ref|XP_011006035.1| PREDICTED: cellulose synthase-like protein D2 [Populus euphratica]
Length=1143

 Score =   400 bits (1027),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 202/262 (77%), Positives = 235/262 (90%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LASRR+KFLQRIAY NVG+YPFTSIF
Sbjct  870   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASRRMKFLQRIAYLNVGIYPFTSIF  929

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLL+IT+TL L+++LE+KW+ I LEE WRNEQ
Sbjct  930   LIVYCFLPALSLFSGQFIVQTLNVTFLAYLLVITLTLCLLAVLEIKWSGIDLEEWWRNEQ  989

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKS  +D DD +ADLYVVKWTSL I P+
Sbjct  990   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSGGDDVDDEFADLYVVKWTSLMIPPI  1049

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1050  TIMMVNLIAIAVGFSRTIYSVIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1109

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GL++IT SLLW+++NPP 
Sbjct  1110  FVWSGLIAITISLLWVAINPPS  1131



>ref|XP_004162892.1| PREDICTED: cellulose synthase-like protein D4-like, partial [Cucumis 
sativus]
Length=663

 Score =   387 bits (995),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 198/262 (76%), Positives = 231/262 (88%), Gaps = 0/262 (0%)
 Frame = -3

Query  876  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
            FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  LASRRLK LQR+AY NVG+YPFTSIF
Sbjct  385  FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNALLASRRLKLLQRLAYLNVGIYPFTSIF  444

Query  696  LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
            L+VYCF+PA+  F+GQFIVQTL+  FL YLLIITV L+ +++LEVKW+ IGLEE WRNEQ
Sbjct  445  LIVYCFLPALSLFSGQFIVQTLNVTFLIYLLIITVCLISLAILEVKWSGIGLEEWWRNEQ  504

Query  516  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
            FWLI GTSAHLAAV+QGLLKVIAGIEISFTLTSKS+ +D +DIYADLY+VKWTSL + P+
Sbjct  505  FWLISGTSAHLAAVVQGLLKVIAGIEISFTLTSKSSGDDVEDIYADLYLVKWTSLMVPPI  564

Query  336  TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             I ++NI A+ +  SR IYS +PQW+K  GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  565  VIAMMNIIAMAVAFSRTIYSSVPQWSKFIGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  624

Query  156  YVwtgllsittsllwiSVNPPQ  91
             VW+GL++IT SLLWI++NPP+
Sbjct  625  IVWSGLIAITLSLLWIAINPPK  646



>ref|XP_002274474.1| PREDICTED: cellulose synthase-like protein D1 [Vitis vinifera]
Length=1043

 Score =   396 bits (1018),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 199/242 (82%), Positives = 224/242 (93%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LASRRLKFLQR+AY NVG+YPFTSIF
Sbjct  781   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNVLLASRRLKFLQRVAYLNVGIYPFTSIF  840

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+   TGQFIVQ+L+  FL YLL IT+TL L++LLEVKW+ IGLEE WRNEQ
Sbjct  841   LVVYCFLPALSLLTGQFIVQSLNTAFLSYLLTITITLALLALLEVKWSGIGLEEWWRNEQ  900

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW+IGG+SAHLAAVLQGLLKV+AGIEI FTLTSKSAAEDE+DI+ADLYV+KWTSLFIMPL
Sbjct  901   FWVIGGSSAHLAAVLQGLLKVLAGIEIHFTLTSKSAAEDEEDIFADLYVIKWTSLFIMPL  960

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+VVNI ALVIG SR +YSV+PQWNKL GG+FFSFWVL+H+YPFAKGLMGR+G++PTIV
Sbjct  961   TIMVVNIVALVIGISRTVYSVLPQWNKLVGGSFFSFWVLSHMYPFAKGLMGRRGRMPTIV  1020

Query  156   YV  151
             YV
Sbjct  1021  YV  1022



>ref|XP_003557145.1| PREDICTED: cellulose synthase-like protein D2 [Brachypodium distachyon]
Length=1182

 Score =   399 bits (1026),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 201/262 (77%), Positives = 234/262 (89%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LASRR+KFLQRIAY NVG+YPFTSIF
Sbjct  909   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASRRMKFLQRIAYLNVGIYPFTSIF  968

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIV+TLD  FL YLL+IT+TL ++++LE+KW+ I LEE WRNEQ
Sbjct  969   LIVYCFLPALSLFSGQFIVRTLDVTFLTYLLVITLTLCMLAVLEIKWSGINLEEWWRNEQ  1028

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKS  +DE+D YADLY+VKWTSL I P+
Sbjct  1029  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSGGDDENDDYADLYIVKWTSLMIPPI  1088

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I++VN+ A+ +G SR IYS IPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1089  VIMMVNLIAIAVGFSRTIYSEIPQWSKLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1148

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GLL+IT SLLW+++NPP 
Sbjct  1149  FVWSGLLAITISLLWVAINPPS  1170



>gb|AFM37967.1| cellulose synthase-like protein D [Cunninghamia lanceolata]
Length=1131

 Score =   398 bits (1023),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 203/262 (77%), Positives = 234/262 (89%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  L S R+KFLQ+IAY NVG+YPFTSIF
Sbjct  858   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLGSSRIKFLQKIAYLNVGIYPFTSIF  917

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLIIT+TL L+++LE+KW+ I LEE WRNEQ
Sbjct  918   LIVYCFLPALSLFSGQFIVQTLNVSFLIYLLIITITLSLLAVLEIKWSGIELEEWWRNEQ  977

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKS  ED DDI+ADLY+VKWTSL I P+
Sbjct  978   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSGGEDIDDIFADLYIVKWTSLMIPPI  1037

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYS IPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1038  TIMMVNLIAIAVGFSRTIYSEIPQWSKLIGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1097

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GLL+IT SLLW+++NPPQ
Sbjct  1098  FVWSGLLAITISLLWVAINPPQ  1119



>ref|XP_009608734.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana tomentosiformis]
 ref|XP_009608735.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana tomentosiformis]
Length=1139

 Score =   398 bits (1022),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 200/261 (77%), Positives = 235/261 (90%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS ++KFLQ+IAY N G+YPFTSIF
Sbjct  866   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASSKMKFLQKIAYLNCGIYPFTSIF  925

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLL ITVTL ++++LEVKW+ I LEELWRNEQ
Sbjct  926   LIVYCFLPALSLFSGQFIVQTLNVTFLVYLLTITVTLCMLAVLEVKWSGIELEELWRNEQ  985

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKSA +DEDD +ADLY+VKWTSL I P+
Sbjct  986   FWLIGGTSAHLAAVLQGLLKVVAGIEISFTLTSKSAGDDEDDEFADLYMVKWTSLMIPPI  1045

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1046  TIMMVNLIAIAVGFSRTIYSVIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1105

Query  156   YVwtgllsittsllwiSVNPP  94
             +VW+GL++IT SLLW+++NPP
Sbjct  1106  FVWSGLIAITISLLWVAINPP  1126



>ref|XP_006854073.1| hypothetical protein AMTR_s00048p00116140 [Amborella trichopoda]
 gb|ERN15540.1| hypothetical protein AMTR_s00048p00116140 [Amborella trichopoda]
Length=1141

 Score =   398 bits (1022),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 201/261 (77%), Positives = 234/261 (90%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+KFLQRIAY NVG+YPFTSIF
Sbjct  868   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKFLQRIAYLNVGIYPFTSIF  927

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTLD  FL YLL+IT+TL ++++LE+KW+ I LEE WRNEQ
Sbjct  928   LIVYCFLPALSLFSGQFIVQTLDVMFLVYLLLITLTLCMLAVLEIKWSGIELEEWWRNEQ  987

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSA ED DD +ADLY+VKWTSL I P+
Sbjct  988   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAGEDVDDEFADLYIVKWTSLMIAPI  1047

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++ N+ A+ +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1048  TIMMTNLIAIAVGISRTIYSVIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1107

Query  156   YVwtgllsittsllwiSVNPP  94
             +VW+GL++IT SLLW+++NPP
Sbjct  1108  FVWSGLIAITISLLWVAINPP  1128



>gb|EMS48924.1| Cellulose synthase-like protein D2 [Triticum urartu]
Length=944

 Score =   393 bits (1010),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 199/262 (76%), Positives = 233/262 (89%), Gaps = 0/262 (0%)
 Frame = -3

Query  876  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
            FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LASRR+K LQRIAY NVG+YPFTSIF
Sbjct  671  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASRRMKCLQRIAYLNVGIYPFTSIF  730

Query  696  LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
            L+VYCF+PA+  F+GQFIV+ LD  FL YLL+IT+TL ++++LE+KW+ I LEE WRNEQ
Sbjct  731  LIVYCFLPALSLFSGQFIVKELDVTFLTYLLVITLTLCMLAVLEIKWSGINLEEWWRNEQ  790

Query  516  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
            FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKS A+DE+D +ADLY+VKWTSL I P+
Sbjct  791  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSGADDENDEFADLYIVKWTSLMIPPI  850

Query  336  TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             I++VN+ A+ +G SR IYS IPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  851  VIMMVNLIAIAVGFSRTIYSEIPQWSKLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  910

Query  156  YVwtgllsittsllwiSVNPPQ  91
            +VW+GLL+IT SLLW+++NPP 
Sbjct  911  FVWSGLLAITISLLWVAINPPS  932



>ref|XP_009788168.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana sylvestris]
 ref|XP_009788172.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana sylvestris]
Length=1139

 Score =   397 bits (1021),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 200/261 (77%), Positives = 235/261 (90%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS ++KFLQ+IAY N G+YPFTSIF
Sbjct  866   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASSKMKFLQKIAYLNCGIYPFTSIF  925

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLL ITVTL ++++LEVKW+ I LEELWRNEQ
Sbjct  926   LIVYCFLPALSLFSGQFIVQTLNVTFLVYLLTITVTLCMLAVLEVKWSGIELEELWRNEQ  985

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKSA +DEDD +ADLY+VKWTSL I P+
Sbjct  986   FWLIGGTSAHLAAVLQGLLKVVAGIEISFTLTSKSAGDDEDDEFADLYMVKWTSLMIPPI  1045

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1046  TIMMVNLIAIAVGFSRTIYSVIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1105

Query  156   YVwtgllsittsllwiSVNPP  94
             +VW+GL++IT SLLW+++NPP
Sbjct  1106  FVWSGLIAITISLLWVAINPP  1126



>ref|XP_010558640.1| PREDICTED: cellulose synthase-like protein D3 [Tarenaya hassleriana]
 ref|XP_010558642.1| PREDICTED: cellulose synthase-like protein D3 [Tarenaya hassleriana]
 ref|XP_010558643.1| PREDICTED: cellulose synthase-like protein D3 [Tarenaya hassleriana]
Length=1141

 Score =   397 bits (1020),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 204/271 (75%), Positives = 237/271 (87%), Gaps = 5/271 (2%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQRIAY NVG+YPFTSIF
Sbjct  868   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASPRMKILQRIAYLNVGIYPFTSIF  927

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLII++TL L++LLE+KW+ I LEE WRNEQ
Sbjct  928   LIVYCFLPALSLFSGQFIVQTLNVTFLTYLLIISITLCLLALLEIKWSGISLEEWWRNEQ  987

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSA +D DD +ADLY+VKWTSL I P+
Sbjct  988   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAGDDNDDEFADLYIVKWTSLMIPPI  1047

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I++VN+ A+ +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1048  VIMMVNLIAIAVGFSRTIYSVIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1107

Query  156   YVwtgllsittsllwiSVNPPQDPRAAASNE  64
             YVW+GL++IT SLLW+++NPP     A SN+
Sbjct  1108  YVWSGLVAITISLLWVAINPP-----AGSNQ  1133



>ref|XP_009415293.1| PREDICTED: cellulose synthase-like protein D2 [Musa acuminata 
subsp. malaccensis]
Length=1149

 Score =   397 bits (1019),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 189/242 (78%), Positives = 216/242 (89%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQRIAY NVG+YPFTSIF
Sbjct  875   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKILQRIAYLNVGIYPFTSIF  934

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  FTGQFIVQTL+  FL YLLIIT+TL ++++LE+KW+ I LEE WRNEQ
Sbjct  935   LIVYCFLPALSLFTGQFIVQTLNVTFLTYLLIITLTLCMLAVLEIKWSGIELEEWWRNEQ  994

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSA +DEDD +ADLY+VKWTSL I P+
Sbjct  995   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAGDDEDDEFADLYIVKWTSLMIPPI  1054

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+++N+ A+ +G SR IYS IPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1055  TIMMMNLIAIAVGVSRTIYSTIPQWSKLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1114

Query  156   YV  151
             +V
Sbjct  1115  FV  1116



>gb|KHG15890.1| Cellulose synthase-like protein D3 [Gossypium arboreum]
Length=1144

 Score =   397 bits (1019),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 202/262 (77%), Positives = 234/262 (89%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQRIAY NVG+YPFTSIF
Sbjct  871   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKILQRIAYLNVGIYPFTSIF  930

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLIITVTL L+++LE+KW+ I LEE WRNEQ
Sbjct  931   LIVYCFLPALSLFSGQFIVQTLNVTFLTYLLIITVTLCLLAVLEIKWSGIELEEWWRNEQ  990

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSA +D DD +ADLY+VKWTSL I P+
Sbjct  991   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAGDDLDDEFADLYIVKWTSLMIPPI  1050

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1051  TIMMVNLIAIAVGFSRTIYSVIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1110

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GL++IT SLLW+++NPP 
Sbjct  1111  FVWSGLMAITISLLWVAINPPS  1132



>ref|XP_009386238.1| PREDICTED: cellulose synthase-like protein D2 [Musa acuminata 
subsp. malaccensis]
Length=1150

 Score =   397 bits (1019),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 201/262 (77%), Positives = 234/262 (89%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQRIAY NVG+YPFTSIF
Sbjct  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKILQRIAYLNVGIYPFTSIF  935

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  FTGQFIVQTL+  FL YLLIIT+TL ++++LE+KW+ I LEE WRNEQ
Sbjct  936   LIVYCFLPALSLFTGQFIVQTLNVTFLTYLLIITLTLCMLAVLEIKWSGIELEEWWRNEQ  995

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSA +DE+D +ADLY+VKWTSL I P+
Sbjct  996   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAGDDENDEFADLYIVKWTSLMIPPI  1055

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYS IPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1056  TIMMVNLIAIAVGFSRTIYSTIPQWSKLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1115

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GL++IT SLLW+++NPP 
Sbjct  1116  FVWSGLIAITISLLWVAINPPS  1137



>ref|XP_008354283.1| PREDICTED: cellulose synthase-like protein D3 [Malus domestica]
Length=1146

 Score =   396 bits (1018),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 199/262 (76%), Positives = 234/262 (89%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQRIAY NVG+YPFTSIF
Sbjct  873   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASTRMKLLQRIAYLNVGIYPFTSIF  932

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQ+L+  FL YLLIIT+TL ++++LE+KW+ I LEE WRNEQ
Sbjct  933   LIVYCFLPALSLFSGQFIVQSLNVTFLTYLLIITLTLCMLAILEIKWSGIELEEWWRNEQ  992

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKS  EDEDD +ADLY+VKW+SL + P+
Sbjct  993   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSGGEDEDDEFADLYIVKWSSLMLPPI  1052

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1053  TIMMVNLIAIAVGFSRTIYSVIPQWSKLIGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1112

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GL++IT SLLW+++NPP 
Sbjct  1113  FVWSGLIAITISLLWVAINPPS  1134



>ref|XP_009130327.1| PREDICTED: cellulose synthase-like protein D3 [Brassica rapa]
Length=1146

 Score =   396 bits (1018),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 202/261 (77%), Positives = 233/261 (89%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQRIAY NVG+YPFTSIF
Sbjct  873   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASPRMKILQRIAYLNVGIYPFTSIF  932

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLII++TL L++LLE+KW+ I LEE WRNEQ
Sbjct  933   LIVYCFLPALSLFSGQFIVQTLNVTFLIYLLIISITLCLLALLEIKWSGISLEEWWRNEQ  992

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV+QGLLKV+AGIEISFTLTSKS  +D DD +ADLY+VKWTSL I P+
Sbjct  993   FWLIGGTSAHLAAVIQGLLKVVAGIEISFTLTSKSGGDDVDDEFADLYIVKWTSLMIPPI  1052

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW+KL GG FFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1053  TIMMVNLIAIAVGFSRTIYSVIPQWSKLIGGVFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1112

Query  156   YVwtgllsittsllwiSVNPP  94
             YVW+GL++IT SLLW++VNPP
Sbjct  1113  YVWSGLIAITISLLWVAVNPP  1133



>gb|KHG15286.1| Cellulose synthase-like protein D3 [Gossypium arboreum]
Length=1143

 Score =   396 bits (1017),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 202/262 (77%), Positives = 233/262 (89%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQRIAY NVG+YPFTSIF
Sbjct  870   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKLLQRIAYLNVGIYPFTSIF  929

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLIITVTL L+++LE+KW+ I LEE WRNEQ
Sbjct  930   LIVYCFLPALSLFSGQFIVQTLNVTFLTYLLIITVTLCLLAVLEIKWSGIELEEWWRNEQ  989

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKS  +D DD YADLYVVKWTSL I P+
Sbjct  990   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSGGDDLDDEYADLYVVKWTSLMIPPI  1049

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR +YSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1050  TIMMVNLIAIAVGFSRTVYSVIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1109

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GL++IT SLLW+++NPP 
Sbjct  1110  FVWSGLIAITISLLWVAINPPS  1131



>ref|XP_009351828.1| PREDICTED: cellulose synthase-like protein D3 [Pyrus x bretschneideri]
Length=1146

 Score =   396 bits (1018),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 199/262 (76%), Positives = 234/262 (89%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQRIAY NVG+YPFTSIF
Sbjct  873   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASTRMKLLQRIAYLNVGIYPFTSIF  932

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQ+L+  FL YLLIIT+TL ++++LE+KW+ I LEE WRNEQ
Sbjct  933   LIVYCFLPALSLFSGQFIVQSLNVTFLTYLLIITLTLCMLAILEIKWSGIELEEWWRNEQ  992

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKS  EDEDD +ADLY+VKW+SL + P+
Sbjct  993   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSGGEDEDDEFADLYIVKWSSLMLPPI  1052

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1053  TIMMVNLIAIAVGFSRTIYSVIPQWSKLIGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1112

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GL++IT SLLW+++NPP 
Sbjct  1113  FVWSGLIAITISLLWVAINPPS  1134



>ref|XP_008786432.1| PREDICTED: cellulose synthase-like protein D2 [Phoenix dactylifera]
 ref|XP_008786433.1| PREDICTED: cellulose synthase-like protein D2 [Phoenix dactylifera]
 ref|XP_008786434.1| PREDICTED: cellulose synthase-like protein D2 [Phoenix dactylifera]
Length=1148

 Score =   396 bits (1017),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 199/262 (76%), Positives = 234/262 (89%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQRIAY NVG+YPFTSIF
Sbjct  875   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASSRMKLLQRIAYLNVGIYPFTSIF  934

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLL+IT+TL +I++LE+KW+ + LEE WRNEQ
Sbjct  935   LLVYCFLPALSLFSGQFIVQTLNVTFLTYLLMITLTLCMIAMLEIKWSGVSLEEWWRNEQ  994

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSA +D DD +ADLY+VKWTSL I P+
Sbjct  995   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAGDDVDDEFADLYIVKWTSLMIPPI  1054

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSV+PQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1055  TIMMVNLIAIAVGVSRTIYSVLPQWSKLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1114

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GL++IT SLLW+++NPP 
Sbjct  1115  FVWSGLIAITISLLWVAINPPS  1136



>ref|XP_006656561.1| PREDICTED: cellulose synthase-like protein D2-like, partial [Oryza 
brachyantha]
Length=890

 Score =   390 bits (1002),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 196/262 (75%), Positives = 233/262 (89%), Gaps = 0/262 (0%)
 Frame = -3

Query  876  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
            FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LASR++KFLQRIAY NVG+YPFTSIF
Sbjct  617  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASRKMKFLQRIAYLNVGIYPFTSIF  676

Query  696  LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
            L+VYCF+PA+  F+GQFIV+TL+  FL YLL+IT+T+ ++++LE+KW+ I LEE WRNEQ
Sbjct  677  LIVYCFLPALSLFSGQFIVRTLNVAFLTYLLVITLTMCMLAVLEIKWSGISLEEWWRNEQ  736

Query  516  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
            FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKS  ++ DD +ADLY+VKWTSL I P+
Sbjct  737  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSGGDEADDDFADLYIVKWTSLMIPPI  796

Query  336  TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             I++VN+ A+ +G SR IYS IPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  797  VIMMVNLIAIAVGFSRTIYSEIPQWSKLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  856

Query  156  YVwtgllsittsllwiSVNPPQ  91
            +VW+GLL+IT SLLW+++NPP 
Sbjct  857  FVWSGLLAITISLLWVAINPPS  878



>ref|XP_009119010.1| PREDICTED: cellulose synthase-like protein D3 [Brassica rapa]
Length=1151

 Score =   396 bits (1017),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 202/261 (77%), Positives = 233/261 (89%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS ++K LQRIAY NVG+YPFTSIF
Sbjct  878   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASPKMKILQRIAYLNVGIYPFTSIF  937

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLII++TL L++LLE+KW+ I LEE WRNEQ
Sbjct  938   LIVYCFLPALSLFSGQFIVQTLNVTFLIYLLIISITLCLLALLEIKWSGISLEEWWRNEQ  997

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV+QGLLKV+AGIEISFTLTSKS  +D DD +ADLYVVKWTSL I P+
Sbjct  998   FWLIGGTSAHLAAVIQGLLKVVAGIEISFTLTSKSGGDDVDDEFADLYVVKWTSLMIPPI  1057

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW+KL GG FFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1058  TIMMVNLIAIAVGFSRTIYSVIPQWSKLIGGVFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1117

Query  156   YVwtgllsittsllwiSVNPP  94
             YVW+GL++IT SLLW++VNPP
Sbjct  1118  YVWSGLVAITISLLWVAVNPP  1138



>ref|XP_006296860.1| hypothetical protein CARUB_v10012847mg [Capsella rubella]
 gb|EOA29758.1| hypothetical protein CARUB_v10012847mg [Capsella rubella]
Length=1147

 Score =   395 bits (1014),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 200/261 (77%), Positives = 233/261 (89%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQRIAY NVG+YPFTSIF
Sbjct  874   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASPRMKILQRIAYLNVGIYPFTSIF  933

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLII++TL L++LLE+KW+ I LEE WRNEQ
Sbjct  934   LIVYCFLPALSLFSGQFIVQTLNVTFLVYLLIISITLCLLALLEIKWSGISLEEWWRNEQ  993

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV+QGLLKV+AGIEISFTLTSKS  +D DD +ADLY+VKWTSL I P+
Sbjct  994   FWLIGGTSAHLAAVIQGLLKVVAGIEISFTLTSKSGGDDVDDEFADLYIVKWTSLMIPPI  1053

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1054  TIMMVNLIAIAVGFSRTIYSVIPQWSKLIGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1113

Query  156   YVwtgllsittsllwiSVNPP  94
             YVW+GL++IT SLLW+++NPP
Sbjct  1114  YVWSGLVAITISLLWVAINPP  1134



>ref|XP_006400233.1| hypothetical protein EUTSA_v10012495mg [Eutrema salsugineum]
 gb|ESQ41686.1| hypothetical protein EUTSA_v10012495mg [Eutrema salsugineum]
Length=1152

 Score =   394 bits (1013),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 199/261 (76%), Positives = 233/261 (89%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQRIAY NVG+YPFTSIF
Sbjct  879   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKILQRIAYLNVGIYPFTSIF  938

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLII++TL L++LLE+KW+ I LEE WRNEQ
Sbjct  939   LIVYCFLPALSLFSGQFIVQTLNVTFLVYLLIISITLCLLALLEIKWSGISLEEWWRNEQ  998

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AG+EISFTLTSKS  +D DD +ADLY+VKWTSL I P+
Sbjct  999   FWLIGGTSAHLAAVLQGLLKVVAGVEISFTLTSKSGGDDVDDEFADLYMVKWTSLMIPPI  1058

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIP+W+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1059  TIMMVNLIAIAVGFSRTIYSVIPEWSKLIGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1118

Query  156   YVwtgllsittsllwiSVNPP  94
             YVW+GL++IT SLLW+++NPP
Sbjct  1119  YVWSGLVAITISLLWVAINPP  1139



>ref|XP_004235281.1| PREDICTED: cellulose synthase-like protein D3 [Solanum lycopersicum]
Length=1141

 Score =   394 bits (1012),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 199/261 (76%), Positives = 235/261 (90%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  L+S ++KFLQ+IAY N G+YPFTSIF
Sbjct  868   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLSSSKMKFLQKIAYLNCGIYPFTSIF  927

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLIITVTL L+++LEVKW+ I LEE WRNEQ
Sbjct  928   LIVYCFLPALSLFSGQFIVQTLNVTFLVYLLIITVTLCLLAVLEVKWSGIELEEWWRNEQ  987

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKSA ++EDD +ADLY+VKWTSL I P+
Sbjct  988   FWLIGGTSAHLAAVLQGLLKVVAGIEISFTLTSKSAGDEEDDDFADLYLVKWTSLMIPPI  1047

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1048  TIMMVNLIAIAVGFSRTIYSVIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1107

Query  156   YVwtgllsittsllwiSVNPP  94
             +VW+GL++IT SLLW+++NPP
Sbjct  1108  FVWSGLIAITISLLWVAINPP  1128



>ref|XP_006286350.1| hypothetical protein CARUB_v10000079mg [Capsella rubella]
 ref|XP_006286351.1| hypothetical protein CARUB_v10000079mg [Capsella rubella]
 gb|EOA19248.1| hypothetical protein CARUB_v10000079mg [Capsella rubella]
 gb|EOA19249.1| hypothetical protein CARUB_v10000079mg [Capsella rubella]
Length=1146

 Score =   394 bits (1012),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 198/261 (76%), Positives = 233/261 (89%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS ++K LQRIAY NVG+YPFTSIF
Sbjct  873   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASSKMKILQRIAYLNVGIYPFTSIF  932

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLII++TL L++LLE+KW+ I LEE WRNEQ
Sbjct  933   LIVYCFLPALSLFSGQFIVQTLNVTFLVYLLIISITLCLLALLEIKWSGISLEEWWRNEQ  992

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AG+EISFTLTSKS  +D DD +ADLY+VKWTSL I P+
Sbjct  993   FWLIGGTSAHLAAVLQGLLKVVAGVEISFTLTSKSGGDDIDDEFADLYMVKWTSLMIPPI  1052

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSV+PQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1053  TIIMVNLIAIAVGFSRTIYSVVPQWSKLIGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1112

Query  156   YVwtgllsittsllwiSVNPP  94
             YVW+GL++IT SLLW+++NPP
Sbjct  1113  YVWSGLVAITISLLWVAINPP  1133



>ref|XP_010485639.1| PREDICTED: cellulose synthase-like protein D3 [Camelina sativa]
Length=1149

 Score =   394 bits (1012),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 199/261 (76%), Positives = 233/261 (89%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQRIAY NVG+YPFTSIF
Sbjct  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASPRMKILQRIAYLNVGIYPFTSIF  935

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLII++TL L++LLE+KW+ I LEE WRNEQ
Sbjct  936   LIVYCFLPALSLFSGQFIVQTLNVTFLIYLLIISITLCLLALLEIKWSGISLEEWWRNEQ  995

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV+QGLLKV+AGIEISFTLTSKS  +D DD +ADLY+VKW+SL I P+
Sbjct  996   FWLIGGTSAHLAAVIQGLLKVVAGIEISFTLTSKSGGDDVDDEFADLYIVKWSSLMIPPI  1055

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1056  TIMMVNLIAIAVGFSRTIYSVIPQWSKLIGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1115

Query  156   YVwtgllsittsllwiSVNPP  94
             YVW+GL++IT SLLW+++NPP
Sbjct  1116  YVWSGLVAITISLLWVAINPP  1136



>gb|KHN34145.1| Cellulose synthase-like protein D1 [Glycine soja]
Length=1084

 Score =   392 bits (1008),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 199/261 (76%), Positives = 232/261 (89%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQRIAY NVG+YPFTSIF
Sbjct  811   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKILQRIAYLNVGIYPFTSIF  870

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLL ITVTL ++++LE+KW+ I LEE WRNEQ
Sbjct  871   LIVYCFLPALSLFSGQFIVQTLNVTFLSYLLGITVTLCMLAVLEIKWSGIELEEWWRNEQ  930

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKS  +D DD +ADLY+VKWTSL I P+
Sbjct  931   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSGGDDVDDEFADLYIVKWTSLMIPPI  990

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  991   TIMMVNLIAIAVGVSRTIYSVIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1050

Query  156   YVwtgllsittsllwiSVNPP  94
             +VW+GL++IT SLLW+++NPP
Sbjct  1051  FVWSGLIAITISLLWVAINPP  1071



>ref|XP_010549830.1| PREDICTED: cellulose synthase-like protein D3 [Tarenaya hassleriana]
Length=1142

 Score =   394 bits (1011),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 202/271 (75%), Positives = 237/271 (87%), Gaps = 5/271 (2%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQRIAY NVG+YPFTSIF
Sbjct  869   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASPRMKILQRIAYLNVGIYPFTSIF  928

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLII++TL L++LLE+KW+ I LEE WRNEQ
Sbjct  929   LIVYCFLPALSLFSGQFIVQTLNVTFLSYLLIISITLCLLALLEIKWSGISLEEWWRNEQ  988

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSA ++ DD +ADLY+VKWTSL I P+
Sbjct  989   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAGDENDDDFADLYIVKWTSLMIPPI  1048

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I++VN+ A+ +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1049  VIMMVNLIAIAVGFSRTIYSVIPQWSRLIGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1108

Query  156   YVwtgllsittsllwiSVNPPQDPRAAASNE  64
             +VW+GL++IT SLLW+++NPP     A SN+
Sbjct  1109  FVWSGLVAITISLLWVAINPP-----AGSNQ  1134



>ref|XP_010463749.1| PREDICTED: cellulose synthase-like protein D3 [Camelina sativa]
Length=1150

 Score =   394 bits (1011),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 200/261 (77%), Positives = 232/261 (89%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQRIAY NVG+YPFTSIF
Sbjct  877   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASPRMKILQRIAYLNVGIYPFTSIF  936

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLL I++TL L++LLE+KW+ I LEE WRNEQ
Sbjct  937   LIVYCFLPALSLFSGQFIVQTLNVTFLIYLLTISITLCLLALLEIKWSGISLEEWWRNEQ  996

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV+QGLLKV+AGIEISFTLTSKS  +D DD +ADLYVVKWTSL I P+
Sbjct  997   FWLIGGTSAHLAAVIQGLLKVVAGIEISFTLTSKSGGDDVDDEFADLYVVKWTSLMIPPI  1056

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1057  TIMMVNLIAIAVGFSRTIYSVIPQWSKLIGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1116

Query  156   YVwtgllsittsllwiSVNPP  94
             YVW+GL++IT SLLW+++NPP
Sbjct  1117  YVWSGLVAITISLLWVAINPP  1137



>ref|XP_004964325.1| PREDICTED: cellulose synthase-like protein D2-like [Setaria italica]
Length=1175

 Score =   394 bits (1012),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 200/262 (76%), Positives = 233/262 (89%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LASR++KFLQRIAY NVG+YPFTSIF
Sbjct  902   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASRKMKFLQRIAYLNVGIYPFTSIF  961

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIV+TL+  FL YLL+IT+TL L+++LE+KW+ I LEE WRNEQ
Sbjct  962   LIVYCFLPALSLFSGQFIVKTLNVAFLTYLLVITLTLCLLAVLEIKWSGISLEEWWRNEQ  1021

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKS  +DE+D +ADLY+VKWTSL I P+
Sbjct  1022  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSGGDDENDEFADLYIVKWTSLMIPPI  1081

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I++VN+ A+ +G SR IYS IPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1082  VIMMVNLIAIAVGFSRTIYSEIPQWSKLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1141

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW GLLSIT SLLW+++NPP 
Sbjct  1142  FVWAGLLSITISLLWVAINPPS  1163



>ref|XP_008459144.1| PREDICTED: cellulose synthase-like protein D3 [Cucumis melo]
 ref|XP_008459145.1| PREDICTED: cellulose synthase-like protein D3 [Cucumis melo]
Length=1148

 Score =   394 bits (1011),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 199/263 (76%), Positives = 234/263 (89%), Gaps = 0/263 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQRIAY NVG+YPFTSIF
Sbjct  875   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKILQRIAYLNVGIYPFTSIF  934

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLL+IT+TL L+++LE+KW+ I LEE WRNEQ
Sbjct  935   LIVYCFLPALSLFSGQFIVQTLNVTFLTYLLVITITLCLLAVLEIKWSGIELEEWWRNEQ  994

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSA +D DD +ADLY+VKWTSL I P+
Sbjct  995   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAGDDVDDEFADLYIVKWTSLMIPPI  1054

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+++N+ A+ +G SR IYS IPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1055  TIMMINLIAIAVGVSRTIYSTIPQWSRLIGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1114

Query  156   YVwtgllsittsllwiSVNPPQD  88
             +VW+GLL+IT SLLW++++PP D
Sbjct  1115  FVWSGLLAITISLLWVAISPPGD  1137



>ref|XP_009361165.1| PREDICTED: cellulose synthase-like protein D3 [Pyrus x bretschneideri]
 ref|XP_009361166.1| PREDICTED: cellulose synthase-like protein D3 [Pyrus x bretschneideri]
Length=1146

 Score =   394 bits (1011),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 197/262 (75%), Positives = 232/262 (89%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+KFLQRIAY NVG+YPFTSIF
Sbjct  873   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNALLASSRMKFLQRIAYLNVGIYPFTSIF  932

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLL IT+TL ++++LE+KW+ I LEE WRNEQ
Sbjct  933   LIVYCFLPALSLFSGQFIVQTLNVSFLTYLLAITLTLCMLAILEIKWSGIELEEWWRNEQ  992

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKS  +DEDD +ADLY+VKW+SL I P+
Sbjct  993   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSGGDDEDDEFADLYIVKWSSLMIPPI  1052

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+  + +G SR IYS IP+W++L GG FFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1053  TIMMVNLIGIAVGFSRTIYSEIPEWSRLIGGVFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1112

Query  156   YVwtgllsittsllwiSVNPPQ  91
             YVW+GL++IT SLLW+++NPP 
Sbjct  1113  YVWSGLIAITISLLWVAINPPS  1134



>ref|NP_197193.1| cellulose synthase-like protein D2 [Arabidopsis thaliana]
 sp|Q9LFL0.1|CSLD2_ARATH RecName: Full=Cellulose synthase-like protein D2; Short=AtCslD2 
[Arabidopsis thaliana]
 emb|CAC01704.1| cellulose synthase catalytic subunit-like protein [Arabidopsis 
thaliana]
 gb|AED92357.1| cellulose synthase-like protein D2 [Arabidopsis thaliana]
Length=1145

 Score =   393 bits (1010),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 198/261 (76%), Positives = 233/261 (89%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS ++K LQRIAY NVG+YPFTSIF
Sbjct  872   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASSKMKILQRIAYLNVGIYPFTSIF  931

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLII++TL L++LLE+KW+ I LEE WRNEQ
Sbjct  932   LIVYCFLPALSLFSGQFIVQTLNVTFLVYLLIISITLCLLALLEIKWSGISLEEWWRNEQ  991

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AG+EISFTLTSKS  +D DD +ADLY+VKWTSL I P+
Sbjct  992   FWLIGGTSAHLAAVLQGLLKVVAGVEISFTLTSKSGGDDIDDEFADLYMVKWTSLMIPPI  1051

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSV+PQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1052  TIIMVNLIAIAVGFSRTIYSVVPQWSKLIGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1111

Query  156   YVwtgllsittsllwiSVNPP  94
             YVW+GL++IT SLLW+++NPP
Sbjct  1112  YVWSGLVAITISLLWVAINPP  1132



>ref|XP_010925919.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase-like protein 
D1 [Elaeis guineensis]
Length=852

 Score =   387 bits (993),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 208/262 (79%), Positives = 234/262 (89%), Gaps = 0/262 (0%)
 Frame = -3

Query  876  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
            FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN  LA+ RLKFLQRIAY NVG+YPFTSIF
Sbjct  583  FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNAFLATSRLKFLQRIAYLNVGIYPFTSIF  642

Query  696  LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
            LV+YC +PA   F+G FIVQTL+  FL YLL IT+TL L++LLEVKW+ I LEE WRNEQ
Sbjct  643  LVIYCLLPAFSLFSGHFIVQTLNVSFLVYLLFITITLTLLALLEVKWSGIALEEWWRNEQ  702

Query  516  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
            FW+IGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSA EDEDDIYADLYV+KWTSLFI PL
Sbjct  703  FWVIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSANEDEDDIYADLYVIKWTSLFIPPL  762

Query  336  TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
            TI+V+N+ A+V+G SR +YS IP+W+KL GG FFSFWVLAH+YPFAKGLMGR+G+VPTIV
Sbjct  763  TIIVINLVAVVVGFSRTVYSEIPEWSKLMGGLFFSFWVLAHMYPFAKGLMGRRGRVPTIV  822

Query  156  YVwtgllsittsllwiSVNPPQ  91
            YVW GLLSIT SL+WI+VNPP 
Sbjct  823  YVWAGLLSITLSLMWITVNPPN  844



>ref|XP_004307862.1| PREDICTED: cellulose synthase-like protein D3-like [Fragaria 
vesca subsp. vesca]
Length=1149

 Score =   393 bits (1010),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 196/261 (75%), Positives = 234/261 (90%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQRIAY NVG+YPFTSIF
Sbjct  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKLLQRIAYLNVGIYPFTSIF  935

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQ+L+  FL YLL+IT+TL ++++LE+KW+ I LEE WRNEQ
Sbjct  936   LIVYCFLPALSLFSGQFIVQSLNVTFLTYLLVITLTLCMLAILEIKWSGIELEEWWRNEQ  995

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV+QGLLKVIAGIEISFTLTSKS  +DEDD +ADLY+VKW+SL I P+
Sbjct  996   FWLIGGTSAHLAAVIQGLLKVIAGIEISFTLTSKSGGDDEDDEFADLYIVKWSSLMIPPI  1055

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1056  TIMMVNLIAIAVGFSRTIYSVIPQWSRLIGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1115

Query  156   YVwtgllsittsllwiSVNPP  94
             +VW+GL++IT SLLW+++NPP
Sbjct  1116  FVWSGLIAITISLLWVAINPP  1136



>dbj|BAJ93918.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95261.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1188

 Score =   394 bits (1012),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 199/262 (76%), Positives = 233/262 (89%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LASRR+K LQRIAY NVG+YPFTSIF
Sbjct  915   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASRRMKCLQRIAYLNVGIYPFTSIF  974

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIV+ LD  FL YLL+IT+TL ++++LE+KW+ I LEE WRNEQ
Sbjct  975   LIVYCFLPALSLFSGQFIVKELDVTFLTYLLVITLTLCMLAVLEIKWSGINLEEWWRNEQ  1034

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKS A+DE+D +ADLY+VKWTSL I P+
Sbjct  1035  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSGADDENDEFADLYIVKWTSLMIPPI  1094

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I++VN+ A+ +G SR IYS IPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1095  VIMMVNLIAIAVGFSRTIYSEIPQWSKLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1154

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GLL+IT SLLW+++NPP 
Sbjct  1155  FVWSGLLAITISLLWVAINPPS  1176



>ref|NP_186955.1| cellulose synthase-like protein D3 [Arabidopsis thaliana]
 sp|Q9M9M4.1|CSLD3_ARATH RecName: Full=Cellulose synthase-like protein D3; Short=AtCslD3; 
AltName: Full=Protein KOJAK [Arabidopsis thaliana]
 gb|AAF26119.1|AC012328_22 putative cellulose synthase catalytic subunit [Arabidopsis thaliana]
 gb|AAG60543.1|AF232907_1 cellulose synthase-like CSLD3 [Arabidopsis thaliana]
 gb|AAK25890.1|AF360180_1 putative cellulose synthase catalytic subunit [Arabidopsis thaliana]
 gb|AAK64073.1| putative cellulose synthase catalytic subunit [Arabidopsis thaliana]
 emb|CAC82909.1| cellulose synthase-like protein [Arabidopsis thaliana]
 gb|AEE73896.1| cellulose synthase-like protein D3 [Arabidopsis thaliana]
 gb|AHL38784.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=1145

 Score =   393 bits (1010),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 199/261 (76%), Positives = 231/261 (89%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN   AS R+K LQRIAY NVG+YPFTS F
Sbjct  872   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFFASPRMKILQRIAYLNVGIYPFTSFF  931

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLII++TL L++LLE+KW+ I LEE WRNEQ
Sbjct  932   LIVYCFLPALSLFSGQFIVQTLNVTFLVYLLIISITLCLLALLEIKWSGISLEEWWRNEQ  991

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV+QGLLKV+AGIEISFTLTSKS  ED DD +ADLY+VKWTSL I P+
Sbjct  992   FWLIGGTSAHLAAVIQGLLKVVAGIEISFTLTSKSGGEDVDDEFADLYIVKWTSLMIPPI  1051

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1052  TIMMVNLIAIAVGFSRTIYSVIPQWSKLIGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1111

Query  156   YVwtgllsittsllwiSVNPP  94
             YVW+GL++IT SLLW+++NPP
Sbjct  1112  YVWSGLVAITISLLWVAINPP  1132



>gb|KHN35142.1| Cellulose synthase-like protein D3 [Glycine soja]
Length=1084

 Score =   392 bits (1007),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 198/261 (76%), Positives = 232/261 (89%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQRIAY NVG+YPFTSIF
Sbjct  811   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKILQRIAYLNVGIYPFTSIF  870

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLL ITVTL ++++LE+KW+ I LEE WRNEQ
Sbjct  871   LIVYCFLPALSLFSGQFIVQTLNVTFLSYLLGITVTLCMLAVLEIKWSGIELEEWWRNEQ  930

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKS  +D DD +ADLY+VKWTSL I P+
Sbjct  931   FWLIGGTSAHLAAVLQGLLKVVAGIEISFTLTSKSGGDDVDDEFADLYIVKWTSLMIPPI  990

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  991   TIMMVNLIAIAVGVSRTIYSVIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1050

Query  156   YVwtgllsittsllwiSVNPP  94
             +VW+GL++IT SLLW+++NPP
Sbjct  1051  FVWSGLIAITISLLWVAINPP  1071



>ref|XP_002871742.1| hypothetical protein ARALYDRAFT_488554 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48001.1| hypothetical protein ARALYDRAFT_488554 [Arabidopsis lyrata subsp. 
lyrata]
Length=1143

 Score =   393 bits (1010),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 198/261 (76%), Positives = 233/261 (89%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS ++K LQRIAY NVG+YPFTSIF
Sbjct  870   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASSKMKILQRIAYLNVGIYPFTSIF  929

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLII++TL L++LLE+KW+ I LEE WRNEQ
Sbjct  930   LIVYCFLPALSLFSGQFIVQTLNVTFLVYLLIISITLCLLALLEIKWSGISLEEWWRNEQ  989

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AG+EISFTLTSKS  +D DD +ADLY+VKWTSL I P+
Sbjct  990   FWLIGGTSAHLAAVLQGLLKVVAGVEISFTLTSKSGGDDIDDEFADLYMVKWTSLMIPPI  1049

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSV+PQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1050  TIIMVNLIAIAVGFSRTIYSVVPQWSKLIGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1109

Query  156   YVwtgllsittsllwiSVNPP  94
             YVW+GL++IT SLLW+++NPP
Sbjct  1110  YVWSGLVAITISLLWVAINPP  1130



>gb|KDO47249.1| hypothetical protein CISIN_1g001213mg [Citrus sinensis]
Length=1122

 Score =   392 bits (1008),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 199/261 (76%), Positives = 232/261 (89%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS ++K LQRIAY NVG+YPFTSIF
Sbjct  849   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPKMKLLQRIAYLNVGIYPFTSIF  908

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLL ITVTL +++LLE+KW+ I LEE WRNEQ
Sbjct  909   LIVYCFLPALSLFSGQFIVQTLNVTFLSYLLTITVTLSILALLEIKWSGIELEEWWRNEQ  968

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKS  +D DD +ADLY+VKWTSL I P+
Sbjct  969   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSGGDDVDDEFADLYIVKWTSLMIPPI  1028

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1029  TIMMVNLIAIAVGLSRTIYSVIPQWSRLVGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1088

Query  156   YVwtgllsittsllwiSVNPP  94
             +VW+GL++IT SLLW+++NPP
Sbjct  1089  FVWSGLIAITISLLWVAINPP  1109



>ref|XP_004156753.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase-like protein 
D3-like [Cucumis sativus]
Length=1148

 Score =   393 bits (1009),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 198/263 (75%), Positives = 234/263 (89%), Gaps = 0/263 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQRIAY NVG+YPFTSIF
Sbjct  875   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKILQRIAYLNVGIYPFTSIF  934

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLL+IT+TL L+++LE+KW+ I LEE WRNEQ
Sbjct  935   LIVYCFLPALSLFSGQFIVQTLNVTFLTYLLVITITLCLLAVLEIKWSGIELEEWWRNEQ  994

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKS  +D DD +ADLY+VKWTSL I P+
Sbjct  995   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSGGDDVDDEFADLYIVKWTSLMIPPI  1054

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+++N+ A+ +G SR IYS+IPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1055  TIMMINLIAIAVGVSRTIYSIIPQWSRLIGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1114

Query  156   YVwtgllsittsllwiSVNPPQD  88
             +VW+GLL+IT SLLW++++PP D
Sbjct  1115  FVWSGLLAITISLLWVAISPPGD  1137



>ref|XP_008805561.1| PREDICTED: cellulose synthase-like protein D1 [Phoenix dactylifera]
Length=843

 Score =   386 bits (991),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 192/242 (79%), Positives = 217/242 (90%), Gaps = 0/242 (0%)
 Frame = -3

Query  876  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
            FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN  LA+ RLKFLQRIAY NVG+YPFTSIF
Sbjct  583  FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNAVLATSRLKFLQRIAYLNVGIYPFTSIF  642

Query  696  LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
            LV+YC +PA   F+G FIVQTL+  FL YLL IT+TL L++LLEVKW+ I LEE WRNEQ
Sbjct  643  LVIYCLLPAFSLFSGHFIVQTLNVSFLVYLLFITITLTLLALLEVKWSGIALEEWWRNEQ  702

Query  516  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
            FW+IGGTSAHLAAVLQGLLKV+AGIEISFTLTSKSA EDEDDIYADLY++KWTSLFI PL
Sbjct  703  FWVIGGTSAHLAAVLQGLLKVVAGIEISFTLTSKSANEDEDDIYADLYIIKWTSLFIPPL  762

Query  336  TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
            TI+V+N+ A+V+G SR +YS IPQW+KL GG FFSFWVLAH+YPFAKGLMGR+G+VPTIV
Sbjct  763  TIIVINLVAVVVGFSRTVYSEIPQWSKLMGGLFFSFWVLAHMYPFAKGLMGRRGRVPTIV  822

Query  156  YV  151
            YV
Sbjct  823  YV  824



>ref|XP_007131523.1| hypothetical protein PHAVU_011G020100g [Phaseolus vulgaris]
 ref|XP_007131524.1| hypothetical protein PHAVU_011G020100g [Phaseolus vulgaris]
 gb|ESW03517.1| hypothetical protein PHAVU_011G020100g [Phaseolus vulgaris]
 gb|ESW03518.1| hypothetical protein PHAVU_011G020100g [Phaseolus vulgaris]
Length=1148

 Score =   393 bits (1009),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 199/261 (76%), Positives = 232/261 (89%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+KFLQRIAY NVG+YPFTS F
Sbjct  875   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKFLQRIAYLNVGIYPFTSFF  934

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLL ITVTL ++++LE+KW+ I LEE WRNEQ
Sbjct  935   LIVYCFLPALSLFSGQFIVQTLNVTFLVYLLTITVTLCMLAVLEIKWSGIELEEWWRNEQ  994

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKSA +D DD +ADLYVVKWTSL I P+
Sbjct  995   FWLIGGTSAHLAAVLQGLLKVVAGIEISFTLTSKSAGDDVDDEFADLYVVKWTSLMIPPI  1054

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW++L GG FFSFWVL HLYPFAKGLMGR+G+ PTIV
Sbjct  1055  TIMMVNLIAIAVGVSRTIYSVIPQWSRLLGGVFFSFWVLTHLYPFAKGLMGRRGRTPTIV  1114

Query  156   YVwtgllsittsllwiSVNPP  94
             +VW+GL++IT SLLW+++NPP
Sbjct  1115  FVWSGLIAITISLLWVAINPP  1135



>ref|XP_007029578.1| Cellulose synthase-like D3 [Theobroma cacao]
 gb|EOY10080.1| Cellulose synthase-like D3 [Theobroma cacao]
Length=1175

 Score =   394 bits (1011),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 201/262 (77%), Positives = 233/262 (89%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQRIAY NVG+YPFTSIF
Sbjct  902   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASPRMKLLQRIAYLNVGIYPFTSIF  961

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLL ITVTL L+++LE+KW+ I LEE WRNEQ
Sbjct  962   LIVYCFLPALSLFSGQFIVQTLNVTFLTYLLTITVTLCLLAVLEIKWSGIELEEWWRNEQ  1021

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSA +D DD +ADLYVVKWTSL I P+
Sbjct  1022  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAGDDVDDEFADLYVVKWTSLMIPPI  1081

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+++N+ A+ +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1082  TIMMINLIAIAVGFSRTIYSVIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1141

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GL++IT SLLW+++NPP 
Sbjct  1142  FVWSGLIAITISLLWVAINPPS  1163



>ref|XP_006347576.1| PREDICTED: cellulose synthase-like protein D3-like [Solanum tuberosum]
Length=1141

 Score =   392 bits (1008),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 198/261 (76%), Positives = 234/261 (90%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN   +S ++KFLQ+IAY N G+YPFTSIF
Sbjct  868   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALFSSSKMKFLQKIAYLNCGIYPFTSIF  927

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLIITVTL L+++LEVKW+ I LEE WRNEQ
Sbjct  928   LIVYCFLPALSLFSGQFIVQTLNVTFLVYLLIITVTLCLLAVLEVKWSGIELEEWWRNEQ  987

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKSA ++EDD +ADLY+VKWTSL I P+
Sbjct  988   FWLIGGTSAHLAAVLQGLLKVVAGIEISFTLTSKSAGDEEDDDFADLYLVKWTSLMIPPI  1047

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1048  TIMMVNLIAIAVGFSRTIYSVIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1107

Query  156   YVwtgllsittsllwiSVNPP  94
             +VW+GL++IT SLLW+++NPP
Sbjct  1108  FVWSGLIAITISLLWVAINPP  1128



>ref|XP_006443224.1| hypothetical protein CICLE_v10023400mg [Citrus clementina]
 ref|XP_006478926.1| PREDICTED: cellulose synthase-like protein D3-like isoform X1 
[Citrus sinensis]
 ref|XP_006478927.1| PREDICTED: cellulose synthase-like protein D3-like isoform X2 
[Citrus sinensis]
 ref|XP_006478928.1| PREDICTED: cellulose synthase-like protein D3-like isoform X3 
[Citrus sinensis]
 ref|XP_006478929.1| PREDICTED: cellulose synthase-like protein D3-like isoform X4 
[Citrus sinensis]
 gb|ESR56464.1| hypothetical protein CICLE_v10023400mg [Citrus clementina]
Length=1142

 Score =   392 bits (1008),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 199/261 (76%), Positives = 232/261 (89%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS ++K LQRIAY NVG+YPFTSIF
Sbjct  869   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPKMKLLQRIAYLNVGIYPFTSIF  928

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLL ITVTL +++LLE+KW+ I LEE WRNEQ
Sbjct  929   LIVYCFLPALSLFSGQFIVQTLNVTFLSYLLTITVTLSILALLEIKWSGIELEEWWRNEQ  988

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKS  +D DD +ADLY+VKWTSL I P+
Sbjct  989   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSGGDDVDDEFADLYIVKWTSLMIPPI  1048

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1049  TIMMVNLIAIAVGLSRTIYSVIPQWSRLVGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1108

Query  156   YVwtgllsittsllwiSVNPP  94
             +VW+GL++IT SLLW+++NPP
Sbjct  1109  FVWSGLIAITISLLWVAINPP  1129



>ref|XP_007157068.1| hypothetical protein PHAVU_002G040200g [Phaseolus vulgaris]
 gb|ESW29062.1| hypothetical protein PHAVU_002G040200g [Phaseolus vulgaris]
Length=1144

 Score =   392 bits (1008),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 202/271 (75%), Positives = 236/271 (87%), Gaps = 5/271 (2%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQRIAY NVG+YPFTSIF
Sbjct  871   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKILQRIAYLNVGIYPFTSIF  930

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLL ITVTL ++++LE+KW+ I LEE WRNEQ
Sbjct  931   LIVYCFLPALSLFSGQFIVQTLNVTFLSYLLGITVTLCILAVLEIKWSGIELEEWWRNEQ  990

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKS  +D DD +ADLY+VKWTSL I P+
Sbjct  991   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSGGDDVDDEFADLYIVKWTSLMIPPI  1050

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1051  TIMMVNLIAIAVGVSRTIYSVIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1110

Query  156   YVwtgllsittsllwiSVNPPQDPRAAASNE  64
             +VW+GL++IT SLLW+++NPP     A SN+
Sbjct  1111  FVWSGLIAITISLLWVAINPP-----AGSNQ  1136



>ref|XP_008451182.1| PREDICTED: cellulose synthase-like protein D4 [Cucumis melo]
Length=1122

 Score =   392 bits (1007),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 201/262 (77%), Positives = 232/262 (89%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  LASRRLKFLQR+AY NVG+YPFTSIF
Sbjct  844   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNALLASRRLKFLQRLAYLNVGIYPFTSIF  903

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLIITV L+ +++LEVKW+ IGLEE WRNEQ
Sbjct  904   LIVYCFLPALSLFSGQFIVQTLNVTFLIYLLIITVCLISLAILEVKWSGIGLEEWWRNEQ  963

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLI GTSAHLAAV+QGLLKVIAGIEISFTLTSKSA +D DDIYADLY+VKWTSL + P+
Sbjct  964   FWLISGTSAHLAAVVQGLLKVIAGIEISFTLTSKSAGDDVDDIYADLYLVKWTSLMVPPI  1023

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I ++NI A+ +  SR IYS +PQW+K  GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1024  VIAMMNIIAIAVAFSRTIYSSVPQWSKFIGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1083

Query  156   YVwtgllsittsllwiSVNPPQ  91
              VW+GL++IT SLLWI++NPP+
Sbjct  1084  IVWSGLIAITLSLLWIAINPPK  1105



>gb|AFK35232.1| unknown [Lotus japonicus]
Length=292

 Score =   368 bits (944),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 187/262 (71%), Positives = 227/262 (87%), Gaps = 1/262 (0%)
 Frame = -3

Query  876  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
            FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+KFLQR+AYFNVG+YPFTS F
Sbjct  18   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKFLQRVAYFNVGMYPFTSGF  77

Query  696  LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
            L++YCF+PA+  F+GQFIVQ+++A FL +LL IT+TL L++LLE+KW+ I L + WRNEQ
Sbjct  78   LILYCFLPALSLFSGQFIVQSVNATFLVFLLGITITLCLLALLEIKWSGITLHDWWRNEQ  137

Query  516  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAA-EDEDDIYADLYVVKWTSLFIMP  340
            FWLIGGTSAH AAVLQGLLKVIAG++ISFTLTSKSA  ED DD +ADLY VKW+ L + P
Sbjct  138  FWLIGGTSAHPAAVLQGLLKVIAGVDISFTLTSKSATPEDGDDEFADLYEVKWSFLMVPP  197

Query  339  LTILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTI  160
            +TI++VN+ A+ +G SR +YS  PQW++L GG FFSFWVL HLYPFA+GL+GR+GKVPTI
Sbjct  198  ITIMMVNMIAIAVGGSRTLYSPFPQWSRLVGGVFFSFWVLCHLYPFAEGLLGRRGKVPTI  257

Query  159  VYVwtgllsittsllwiSVNPP  94
            VYVW+GL+SI  S+LW+ +NPP
Sbjct  258  VYVWSGLISIIISMLWVYINPP  279



>ref|XP_004148100.1| PREDICTED: cellulose synthase-like protein D3-like [Cucumis sativus]
Length=1148

 Score =   392 bits (1007),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 198/263 (75%), Positives = 233/263 (89%), Gaps = 0/263 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQRIAY NVG+YPFTSIF
Sbjct  875   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKILQRIAYLNVGIYPFTSIF  934

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLL+IT+TL L+++LE+KW+ I LEE WRNEQ
Sbjct  935   LIVYCFLPALSLFSGQFIVQTLNVTFLTYLLVITITLCLLAVLEIKWSGIELEEWWRNEQ  994

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKS  +D DD +ADLY+VKWTSL I P+
Sbjct  995   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSGGDDVDDEFADLYIVKWTSLMIPPI  1054

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+++N+ A+ +G SR IYS IPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1055  TIMMINLIAIAVGVSRTIYSTIPQWSRLIGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1114

Query  156   YVwtgllsittsllwiSVNPPQD  88
             +VW+GLL+IT SLLW++++PP D
Sbjct  1115  FVWSGLLAITISLLWVAISPPGD  1137



>ref|XP_003517548.1| PREDICTED: cellulose synthase-like protein D2-like isoform X1 
[Glycine max]
 ref|XP_006573847.1| PREDICTED: cellulose synthase-like protein D2-like isoform X2 
[Glycine max]
Length=1143

 Score =   392 bits (1007),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 199/261 (76%), Positives = 232/261 (89%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQRIAY NVG+YPFTSIF
Sbjct  870   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKILQRIAYLNVGIYPFTSIF  929

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLL ITVTL ++++LE+KW+ I LEE WRNEQ
Sbjct  930   LIVYCFLPALSLFSGQFIVQTLNVTFLSYLLGITVTLCMLAVLEIKWSGIELEEWWRNEQ  989

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKS  +D DD +ADLY+VKWTSL I P+
Sbjct  990   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSGGDDVDDEFADLYIVKWTSLMIPPI  1049

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1050  TIMMVNLIAIAVGVSRTIYSVIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1109

Query  156   YVwtgllsittsllwiSVNPP  94
             +VW+GL++IT SLLW+++NPP
Sbjct  1110  FVWSGLIAITISLLWVAINPP  1130



>ref|XP_003537778.1| PREDICTED: cellulose synthase-like protein D2-like [Glycine max]
Length=1143

 Score =   392 bits (1007),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 198/261 (76%), Positives = 232/261 (89%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQRIAY NVG+YPFTSIF
Sbjct  870   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKILQRIAYLNVGIYPFTSIF  929

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLL ITVTL ++++LE+KW+ I LEE WRNEQ
Sbjct  930   LIVYCFLPALSLFSGQFIVQTLNVTFLSYLLGITVTLCMLAVLEIKWSGIELEEWWRNEQ  989

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKS  +D DD +ADLY+VKWTSL I P+
Sbjct  990   FWLIGGTSAHLAAVLQGLLKVVAGIEISFTLTSKSGGDDVDDEFADLYIVKWTSLMIPPI  1049

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1050  TIMMVNLIAIAVGVSRTIYSVIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1109

Query  156   YVwtgllsittsllwiSVNPP  94
             +VW+GL++IT SLLW+++NPP
Sbjct  1110  FVWSGLIAITISLLWVAINPP  1130



>ref|XP_002436356.1| hypothetical protein SORBIDRAFT_10g000980 [Sorghum bicolor]
 gb|EER87723.1| hypothetical protein SORBIDRAFT_10g000980 [Sorghum bicolor]
Length=1179

 Score =   392 bits (1008),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 199/262 (76%), Positives = 231/262 (88%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LASRR+KFLQRIAY NVG+YPFTSIF
Sbjct  906   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASRRMKFLQRIAYLNVGIYPFTSIF  965

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIV+TL+  FL YLL+IT+TL L+++LE+KW+ I LEE WRNEQ
Sbjct  966   LIVYCFLPALSLFSGQFIVKTLNVAFLTYLLVITLTLCLLAVLEIKWSGISLEEWWRNEQ  1025

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKS  +D DD +ADLY+VKWTSL I P+
Sbjct  1026  FWLIGGTSAHLAAVLQGLLKVVAGIEISFTLTSKSGGDDVDDEFADLYIVKWTSLMIPPI  1085

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I++VN+  + +G SR IYS IPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1086  VIMMVNLIGIAVGFSRTIYSEIPQWSKLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1145

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW GLLSIT SLLW+++NPP 
Sbjct  1146  FVWAGLLSITISLLWVAINPPS  1167



>ref|XP_010087475.1| Cellulose synthase-like protein D3 [Morus notabilis]
 gb|EXB29156.1| Cellulose synthase-like protein D3 [Morus notabilis]
Length=1146

 Score =   392 bits (1006),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 200/271 (74%), Positives = 235/271 (87%), Gaps = 5/271 (2%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+KFLQRIAY NVG+YPFTSIF
Sbjct  873   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKFLQRIAYLNVGIYPFTSIF  932

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLIITVTL ++++LE++W+ I LEE WRNEQ
Sbjct  933   LIVYCFLPALSLFSGQFIVQTLNVTFLTYLLIITVTLCMLAVLEIRWSGIELEEWWRNEQ  992

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKS  +D DD +ADLY VKWTSL I P+
Sbjct  993   FWLIGGTSAHLAAVLQGLLKVVAGIEISFTLTSKSGGDDVDDEFADLYTVKWTSLMIPPI  1052

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++ N+  + +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1053  TIMMTNLIGIAVGFSRTIYSVIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1112

Query  156   YVwtgllsittsllwiSVNPPQDPRAAASNE  64
             +VW+GL++IT SLLW+++NPP     A SN+
Sbjct  1113  FVWSGLIAITISLLWVAINPP-----AGSNQ  1138



>ref|XP_002882269.1| hypothetical protein ARALYDRAFT_477551 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58528.1| hypothetical protein ARALYDRAFT_477551 [Arabidopsis lyrata subsp. 
lyrata]
Length=1145

 Score =   392 bits (1006),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 198/261 (76%), Positives = 231/261 (89%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN   AS R+K LQRIAY NVG+YPFTS F
Sbjct  872   FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNAFFASPRMKILQRIAYLNVGIYPFTSFF  931

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLII++TL L++LLE+KW+ I LEE WRNEQ
Sbjct  932   LIVYCFLPALSLFSGQFIVQTLNVTFLVYLLIISITLCLLALLEIKWSGISLEEWWRNEQ  991

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV+QGLLKV+AGIEISFTLTSKS  ED DD +ADLY+VKWTSL I P+
Sbjct  992   FWLIGGTSAHLAAVIQGLLKVVAGIEISFTLTSKSGGEDVDDEFADLYIVKWTSLMIPPI  1051

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1052  TIMMVNLIAIAVGFSRTIYSVIPQWSKLIGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1111

Query  156   YVwtgllsittsllwiSVNPP  94
             YVW+GL++IT SLLW+++NPP
Sbjct  1112  YVWSGLVAITISLLWVAINPP  1132



>ref|XP_008789902.1| PREDICTED: cellulose synthase-like protein D2 isoform X2 [Phoenix 
dactylifera]
Length=1134

 Score =   391 bits (1005),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 198/262 (76%), Positives = 231/262 (88%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQRIAY NVG+YPFTSIF
Sbjct  861   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASARMKLLQRIAYLNVGIYPFTSIF  920

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLIIT+TL  ++ LE+KW+ I LEE WRNEQ
Sbjct  921   LIVYCFLPALSLFSGQFIVQTLNVAFLTYLLIITLTLSALAALEIKWSGISLEEWWRNEQ  980

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKSA +D DD +ADLY+VKWTSL I P+
Sbjct  981   FWLIGGTSAHLAAVLQGLLKVVAGIEISFTLTSKSAGDDVDDEFADLYIVKWTSLMIPPI  1040

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYS +PQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1041  TIMMVNLIAIAVGVSRTIYSELPQWSKLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1100

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GL++IT SLLW+++NPP 
Sbjct  1101  FVWSGLIAITISLLWVAINPPS  1122



>gb|ABK93618.1| unknown [Populus trichocarpa]
Length=290

 Score =   367 bits (941),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 187/266 (70%), Positives = 227/266 (85%), Gaps = 3/266 (1%)
 Frame = -3

Query  876  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
            FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN   A+RR+KFLQR+AYFN G+YPFTS+F
Sbjct  18   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALFATRRMKFLQRVAYFNCGMYPFTSMF  77

Query  696  LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
            L+VYC +PA+  F+GQFIVQ+L   FL  LL IT+TL L+++LE+KW+ I L + WRNEQ
Sbjct  78   LIVYCVLPAISLFSGQFIVQSLSVTFLVLLLAITITLCLLAILEIKWSGITLHDWWRNEQ  137

Query  516  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAA-EDEDDIYADLYVVKWTSLFIMP  340
            FWLIGGTSAH AAVLQGLLKVIAG++ISFTLTSKSA  ED DD +ADLYVVKW+ L + P
Sbjct  138  FWLIGGTSAHPAAVLQGLLKVIAGVDISFTLTSKSATPEDADDEFADLYVVKWSFLMVPP  197

Query  339  LTILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTI  160
            +TI+++N+ A+ +G +R +YS  PQW++L GG FFSFWVL+HLYPFAKGLMGR+G+VPTI
Sbjct  198  ITIMMLNLIAIAVGVARTLYSPFPQWSRLVGGVFFSFWVLSHLYPFAKGLMGRRGRVPTI  257

Query  159  VYVwtgllsittsllwiSVNPP--QD  88
            VYVW+GLLSI  SLLW+ ++PP  QD
Sbjct  258  VYVWSGLLSIIISLLWVYISPPGTQD  283



>ref|XP_008658883.1| PREDICTED: uncharacterized protein LOC100383550 isoform X1 [Zea 
mays]
 gb|AFW86164.1| putative cellulose synthase-like family protein [Zea mays]
Length=1180

 Score =   392 bits (1007),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 199/262 (76%), Positives = 231/262 (88%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LASRR+KFLQRIAY NVG+YPFTSIF
Sbjct  907   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASRRMKFLQRIAYLNVGIYPFTSIF  966

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIV+TL+  FL YLL+IT+TL L+++LE+KW+ I LEE WRNEQ
Sbjct  967   LIVYCFLPALSLFSGQFIVKTLNVTFLTYLLVITLTLCLLAVLEIKWSGISLEEWWRNEQ  1026

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKS  +D DD +ADLY+VKWTSL I P+
Sbjct  1027  FWLIGGTSAHLAAVLQGLLKVVAGIEISFTLTSKSGGDDVDDEFADLYIVKWTSLMIPPI  1086

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I++VN+  + +G SR IYS IPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1087  VIMMVNLIGIAVGFSRTIYSEIPQWSKLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1146

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW GLLSIT SLLW+++NPP 
Sbjct  1147  FVWAGLLSITISLLWVAINPPS  1168



>ref|XP_010267650.1| PREDICTED: cellulose synthase-like protein D3 [Nelumbo nucifera]
 ref|XP_010267651.1| PREDICTED: cellulose synthase-like protein D3 [Nelumbo nucifera]
Length=1147

 Score =   392 bits (1006),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 194/263 (74%), Positives = 233/263 (89%), Gaps = 0/263 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN   AS ++KFLQRIAY NVG+YPFTSIF
Sbjct  874   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAIFASSKMKFLQRIAYLNVGIYPFTSIF  933

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQ+L+  FL YLL+IT+TL ++++LE++W+ I LEE WRNEQ
Sbjct  934   LIVYCFLPALSLFSGQFIVQSLNVTFLVYLLLITLTLCMLAILEIRWSGIELEEWWRNEQ  993

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSA EDEDD +ADLY+VKWTSL I P+
Sbjct  994   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAGEDEDDEFADLYIVKWTSLMIPPI  1053

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++ N+ A+ +G SR IYS +PQW++L GG FFSFWVL HLYPFAKGLMGR+G+ PTIV
Sbjct  1054  TIMMTNLIAIAVGVSRTIYSTLPQWSRLLGGVFFSFWVLVHLYPFAKGLMGRRGRTPTIV  1113

Query  156   YVwtgllsittsllwiSVNPPQD  88
             +VW+GL++IT SLLW+++NPP +
Sbjct  1114  FVWSGLIAITISLLWVAINPPSN  1136



>ref|XP_008376925.1| PREDICTED: cellulose synthase-like protein D3 [Malus domestica]
 ref|XP_008376926.1| PREDICTED: cellulose synthase-like protein D3 [Malus domestica]
 ref|XP_008376927.1| PREDICTED: cellulose synthase-like protein D3 [Malus domestica]
Length=1141

 Score =   391 bits (1005),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 196/262 (75%), Positives = 231/262 (88%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+KFLQRIAY NVG+YPFTSIF
Sbjct  868   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNALLASSRMKFLQRIAYLNVGIYPFTSIF  927

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQ L+  FL YLL IT+TL ++++LE+KW+ I LEE WRNEQ
Sbjct  928   LIVYCFLPALSLFSGQFIVQNLNVSFLTYLLAITLTLCMLAILEIKWSGIELEEWWRNEQ  987

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKS  +DEDD +ADLY+VKW+SL I P+
Sbjct  988   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSGGDDEDDEFADLYIVKWSSLMIPPI  1047

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+  + +G SR IYS IP+W++L GG FFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1048  TIMMVNLIGIAVGFSRTIYSEIPEWSRLIGGVFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1107

Query  156   YVwtgllsittsllwiSVNPPQ  91
             YVW+GL++IT SLLW+++NPP 
Sbjct  1108  YVWSGLIAITISLLWVAINPPS  1129



>ref|XP_009126147.1| PREDICTED: cellulose synthase-like protein D2 isoform X1 [Brassica 
rapa]
 ref|XP_009126148.1| PREDICTED: cellulose synthase-like protein D2 isoform X2 [Brassica 
rapa]
 ref|XP_009126150.1| PREDICTED: cellulose synthase-like protein D2 isoform X1 [Brassica 
rapa]
Length=1140

 Score =   391 bits (1005),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/261 (75%), Positives = 232/261 (89%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS ++K LQRIAY NVG+YPFTSIF
Sbjct  867   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPKMKILQRIAYLNVGIYPFTSIF  926

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLII++TL L++LLE+KW+ I LEE WRNEQ
Sbjct  927   LIVYCFLPALSLFSGQFIVQTLNVTFLVYLLIISITLCLLALLEIKWSGISLEEWWRNEQ  986

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAG+EISFTLT+KS  +D DD +ADLY+VKWTSL I P+
Sbjct  987   FWLIGGTSAHLAAVLQGLLKVIAGVEISFTLTTKSGGDDVDDEFADLYMVKWTSLMIPPI  1046

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IY+V+PQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1047  TIMMVNLIAIAVGFSRTIYAVVPQWSKLIGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1106

Query  156   YVwtgllsittsllwiSVNPP  94
             YVW GL++IT SLLW+++NPP
Sbjct  1107  YVWAGLIAITISLLWVAINPP  1127



>gb|AFZ78593.1| cellulose synthase-like protein [Populus tomentosa]
Length=1032

 Score =   389 bits (999),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 192/242 (79%), Positives = 213/242 (88%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN    SRRLKFLQRIAY NVG+YPFTS F
Sbjct  765   FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNALFGSRRLKFLQRIAYLNVGIYPFTSFF  824

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LV YCF+PA+C FTG FIVQ LD  FL YLL ITVTL LISLLE++W+ +GLEE WRNEQ
Sbjct  825   LVTYCFLPALCLFTGTFIVQNLDISFLIYLLTITVTLTLISLLEIRWSGVGLEEWWRNEQ  884

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW IGGTSAHL AV+QGLLKV+AGIEISFTLTSKSA EDEDDIYADLY+VKWT LF MPL
Sbjct  885   FWAIGGTSAHLIAVIQGLLKVVAGIEISFTLTSKSAGEDEDDIYADLYIVKWTGLFFMPL  944

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+VVN+ A+VIGCSR +YS IP+W KL GG FFSFWVL+H+YPF KGL+GR+G+VPTIV
Sbjct  945   TIIVVNLVAIVIGCSRTLYSEIPEWGKLMGGLFFSFWVLSHMYPFVKGLLGRRGRVPTIV  1004

Query  156   YV  151
             YV
Sbjct  1005  YV  1006



>ref|XP_008789900.1| PREDICTED: cellulose synthase-like protein D2 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008789901.1| PREDICTED: cellulose synthase-like protein D2 isoform X1 [Phoenix 
dactylifera]
Length=1148

 Score =   391 bits (1005),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 198/262 (76%), Positives = 231/262 (88%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQRIAY NVG+YPFTSIF
Sbjct  875   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASARMKLLQRIAYLNVGIYPFTSIF  934

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLIIT+TL  ++ LE+KW+ I LEE WRNEQ
Sbjct  935   LIVYCFLPALSLFSGQFIVQTLNVAFLTYLLIITLTLSALAALEIKWSGISLEEWWRNEQ  994

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKSA +D DD +ADLY+VKWTSL I P+
Sbjct  995   FWLIGGTSAHLAAVLQGLLKVVAGIEISFTLTSKSAGDDVDDEFADLYIVKWTSLMIPPI  1054

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYS +PQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1055  TIMMVNLIAIAVGVSRTIYSELPQWSKLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1114

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GL++IT SLLW+++NPP 
Sbjct  1115  FVWSGLIAITISLLWVAINPPS  1136



>ref|XP_006408348.1| hypothetical protein EUTSA_v10019935mg [Eutrema salsugineum]
 ref|XP_006408349.1| hypothetical protein EUTSA_v10019935mg [Eutrema salsugineum]
 gb|ESQ49801.1| hypothetical protein EUTSA_v10019935mg [Eutrema salsugineum]
 gb|ESQ49802.1| hypothetical protein EUTSA_v10019935mg [Eutrema salsugineum]
Length=1151

 Score =   391 bits (1005),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 198/261 (76%), Positives = 232/261 (89%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQRIAY NVG+YPFTSIF
Sbjct  878   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASPRMKILQRIAYLNVGIYPFTSIF  937

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLII++TL L+++LE+KW+ I LEE WRNEQ
Sbjct  938   LIVYCFLPALSLFSGQFIVQTLNVTFLIYLLIISITLCLLAILEIKWSGISLEEWWRNEQ  997

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAH AAV+QGLLKV+AGIEISFTLTSKS  +D DD +ADLY+VKWTSL I P+
Sbjct  998   FWLIGGTSAHFAAVIQGLLKVVAGIEISFTLTSKSGGDDIDDEFADLYLVKWTSLMIPPI  1057

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1058  TIMMVNLIAIAVGFSRTIYSVIPQWSKLIGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1117

Query  156   YVwtgllsittsllwiSVNPP  94
             YVW+GL++IT SLLW+++NPP
Sbjct  1118  YVWSGLVAITISLLWVAINPP  1138



>ref|XP_001769140.1| cellulose synthase-like D3, glycosyltransferase family 2 protein 
[Physcomitrella patens]
 gb|EDQ66012.1| cellulose synthase-like D3, glycosyltransferase family 2 protein 
[Physcomitrella patens]
Length=1182

 Score =   391 bits (1005),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 188/242 (78%), Positives = 212/242 (88%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN   AS R+KFLQRIAY NVG+YPFTSIF
Sbjct  906   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFFASPRMKFLQRIAYLNVGIYPFTSIF  965

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  FTGQFIVQTL+  FL YLLIITVTL ++++LEVKW+ I LEE WRNEQ
Sbjct  966   LLVYCFLPALSLFTGQFIVQTLNLSFLVYLLIITVTLCMLAILEVKWSGITLEEWWRNEQ  1025

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW+IGGTSAH+AAV+QGLLKV+AG+EISFTLTSKSA EDEDDIYADLYVVKWTSL I P+
Sbjct  1026  FWVIGGTSAHVAAVIQGLLKVMAGVEISFTLTSKSAGEDEDDIYADLYVVKWTSLMIPPI  1085

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI + NI A+ +G SR IYS IP+W+KL GG FFS WVL HLYPFAKGLMG+ GK PTI+
Sbjct  1086  TIGLTNIIAIAVGVSRTIYSEIPEWSKLIGGVFFSLWVLFHLYPFAKGLMGKGGKTPTII  1145

Query  156   YV  151
             YV
Sbjct  1146  YV  1147



>gb|KDP21765.1| hypothetical protein JCGZ_00552 [Jatropha curcas]
Length=1141

 Score =   390 bits (1003),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 196/263 (75%), Positives = 233/263 (89%), Gaps = 0/263 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+KFLQRIAY NVG+YPFTSIF
Sbjct  868   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKFLQRIAYLNVGIYPFTSIF  927

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLL+ITVTL L+++LE+KW+ I LEE WRNEQ
Sbjct  928   LIVYCFLPALSLFSGQFIVQTLNVTFLVYLLVITVTLCLLAILEIKWSGIELEEWWRNEQ  987

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKS  +D DD +ADLY+VKWTSL I P+
Sbjct  988   FWLIGGTSAHLAAVLQGLLKVVAGIEISFTLTSKSGGDDVDDEFADLYIVKWTSLMIPPI  1047

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I++ N+ A+ +G SR IYSV+PQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1048  VIMMTNLIAIAVGFSRTIYSVLPQWSRLIGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1107

Query  156   YVwtgllsittsllwiSVNPPQD  88
             +VW+GL++IT SLLW++++PP +
Sbjct  1108  FVWSGLIAITISLLWVAIDPPSN  1130



>ref|XP_009376356.1| PREDICTED: cellulose synthase-like protein D1 [Pyrus x bretschneideri]
Length=1060

 Score =   389 bits (998),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 208/270 (77%), Positives = 236/270 (87%), Gaps = 0/270 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIF+SRNN  LA RRLKFLQRIAY NVG+YPFTSIF
Sbjct  788   FRGTAPINLTDRLHQVLRWATGSVEIFYSRNNAFLACRRLKFLQRIAYLNVGIYPFTSIF  847

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+C FTGQFIV  L+  FL YLL ITV L L+SLLEV+W+ IGLEE WRNEQ
Sbjct  848   LVVYCFLPALCLFTGQFIVAGLNVAFLSYLLTITVCLCLLSLLEVRWSGIGLEEWWRNEQ  907

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW+IGGTSAHL AV+QGLLKV+AGIEISFTLT+KS AEDE+DIYADLYVVKWTSLF+MPL
Sbjct  908   FWVIGGTSAHLVAVIQGLLKVVAGIEISFTLTTKSTAEDEEDIYADLYVVKWTSLFLMPL  967

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VNI A+VIG SR +Y+VIPQWN+L GG FFSFWVL H+YPF KGLMGR+G++PTI+
Sbjct  968   TIIIVNIVAVVIGISRTLYAVIPQWNRLLGGLFFSFWVLVHMYPFMKGLMGRRGRIPTII  1027

Query  156   YVwtgllsittsllwiSVNPPQDPRAAASN  67
             YVW GLL+ITTSLLW+ +NPP        N
Sbjct  1028  YVWAGLLAITTSLLWVLINPPNGANFGGGN  1057



>sp|A2YU42.1|CSLD2_ORYSI RecName: Full=Cellulose synthase-like protein D2; AltName: Full=OsCslD2 
[Oryza sativa Indica Group]
 gb|EAZ06603.1| hypothetical protein OsI_28847 [Oryza sativa Indica Group]
Length=1170

 Score =   390 bits (1003),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 196/262 (75%), Positives = 233/262 (89%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LASR++KFLQRIAY NVG+YPFTSIF
Sbjct  897   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASRKMKFLQRIAYLNVGIYPFTSIF  956

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIV+TL+  FL YLL+IT+T+ ++++LE+KW+ I LEE WRNEQ
Sbjct  957   LIVYCFLPALSLFSGQFIVRTLNVTFLTYLLVITLTMCMLAVLEIKWSGISLEEWWRNEQ  1016

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKS  ++ DD +ADLY+VKWTSL I P+
Sbjct  1017  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSGGDEADDEFADLYIVKWTSLMIPPI  1076

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I++VN+ A+ +G SR IYS IPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1077  VIMMVNLIAIAVGFSRTIYSEIPQWSKLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1136

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GLL+IT SLLW+++NPP 
Sbjct  1137  FVWSGLLAITISLLWVAINPPS  1158



>ref|NP_001056589.1| Os06g0111800 [Oryza sativa Japonica Group]
 sp|Q9LHZ7.1|CSLD2_ORYSJ RecName: Full=Cellulose synthase-like protein D2; AltName: Full=OsCslD2 
[Oryza sativa Japonica Group]
 dbj|BAA93027.1| putative cellulose synthase [Oryza sativa Japonica Group]
 tpg|DAA01753.1| TPA_exp: cellulose synthase-like D2 [Oryza sativa (japonica cultivar-group)]
 dbj|BAF18503.1| Os06g0111800 [Oryza sativa Japonica Group]
 gb|EAZ35581.1| hypothetical protein OsJ_19867 [Oryza sativa Japonica Group]
 dbj|BAG97224.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1170

 Score =   390 bits (1003),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 196/262 (75%), Positives = 233/262 (89%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LASR++KFLQRIAY NVG+YPFTSIF
Sbjct  897   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASRKMKFLQRIAYLNVGIYPFTSIF  956

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIV+TL+  FL YLL+IT+T+ ++++LE+KW+ I LEE WRNEQ
Sbjct  957   LIVYCFLPALSLFSGQFIVRTLNVTFLTYLLVITLTMCMLAVLEIKWSGISLEEWWRNEQ  1016

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKS  ++ DD +ADLY+VKWTSL I P+
Sbjct  1017  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSGGDEADDEFADLYIVKWTSLMIPPI  1076

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I++VN+ A+ +G SR IYS IPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1077  VIMMVNLIAIAVGFSRTIYSEIPQWSKLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1136

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GLL+IT SLLW+++NPP 
Sbjct  1137  FVWSGLLAITISLLWVAINPPS  1158



>ref|XP_009374628.1| PREDICTED: cellulose synthase-like protein D1 [Pyrus x bretschneideri]
Length=1071

 Score =   388 bits (997),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 208/270 (77%), Positives = 236/270 (87%), Gaps = 0/270 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIF+SRNN  LA RRLKFLQRIAY NVG+YPFTSIF
Sbjct  799   FRGTAPINLTDRLHQVLRWATGSVEIFYSRNNAFLACRRLKFLQRIAYLNVGIYPFTSIF  858

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+C FTGQFIV  L+  FL YLL ITV L L+SLLEV+W+ IGLEE WRNEQ
Sbjct  859   LVVYCFLPALCLFTGQFIVAGLNVAFLSYLLTITVCLCLLSLLEVRWSGIGLEEWWRNEQ  918

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW+IGGTSAHL AV+QGLLKV+AGIEISFTLT+KS AEDE+DIYADLYVVKWTSLF+MPL
Sbjct  919   FWVIGGTSAHLVAVIQGLLKVVAGIEISFTLTTKSTAEDEEDIYADLYVVKWTSLFLMPL  978

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VNI A+VIG SR +Y+VIPQWN+L GG FFSFWVL H+YPF KGLMGR+G++PTI+
Sbjct  979   TIIIVNIVAVVIGISRTLYAVIPQWNRLLGGLFFSFWVLVHMYPFMKGLMGRRGRIPTII  1038

Query  156   YVwtgllsittsllwiSVNPPQDPRAAASN  67
             YVW GLL+ITTSLLW+ +NPP        N
Sbjct  1039  YVWAGLLAITTSLLWVLINPPNGANFGGGN  1068



>ref|XP_002274896.1| PREDICTED: cellulose synthase-like protein D3 [Vitis vinifera]
Length=1149

 Score =   390 bits (1001),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 185/242 (76%), Positives = 213/242 (88%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQR+AY NVG+YPFTSIF
Sbjct  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKLLQRVAYLNVGIYPFTSIF  935

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLL+ITVTL ++++LE+KW+ I LEE WRNEQ
Sbjct  936   LIVYCFLPALSLFSGQFIVQTLNVTFLTYLLVITVTLCMLAVLEIKWSGIELEEWWRNEQ  995

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKS  +D DD YADLYVVKWTSL I P+
Sbjct  996   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSGGDDIDDEYADLYVVKWTSLMIPPI  1055

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++ N+ A+ +  SR IYSV+PQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1056  TIMMTNLIAIAVAFSRTIYSVLPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1115

Query  156   YV  151
             +V
Sbjct  1116  FV  1117



>emb|CDO97026.1| unnamed protein product [Coffea canephora]
Length=1140

 Score =   389 bits (1000),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 196/262 (75%), Positives = 231/262 (88%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+KFLQRIAY NVG+YPFTSIF
Sbjct  867   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAILASSRMKFLQRIAYLNVGIYPFTSIF  926

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+G FIVQTL+  FL YLLIIT+TL ++++LE+KW+ I L++ WRNEQ
Sbjct  927   LIVYCFLPALSLFSGHFIVQTLNVTFLIYLLIITLTLSMLAILEIKWSGIELQDWWRNEQ  986

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIA  EISFTLTSKSA +DE+D +ADLY+VKWTSL I P+
Sbjct  987   FWLIGGTSAHLAAVLQGLLKVIARFEISFTLTSKSAGDDEEDEFADLYIVKWTSLMIPPI  1046

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN  A+ +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1047  TIMMVNFIAIAVGISRTIYSVIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1106

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GL++I  SLLW+S+NPP 
Sbjct  1107  FVWSGLVAIIISLLWVSINPPD  1128



>gb|KHN36420.1| Cellulose synthase-like protein D1 [Glycine soja]
Length=933

 Score =   385 bits (989),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 204/271 (75%), Positives = 238/271 (88%), Gaps = 0/271 (0%)
 Frame = -3

Query  876  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
            FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN   A+RRLKFLQRI+Y NVG+YPFTS+F
Sbjct  662  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFFATRRLKFLQRISYLNVGIYPFTSVF  721

Query  696  LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
            LVVYCFIPA+  F+GQFIV  L+  FL YLL+IT+ L L+SLLEVKW+ I LEE WRNEQ
Sbjct  722  LVVYCFIPALSLFSGQFIVNGLNPAFLIYLLLITICLTLLSLLEVKWSGIALEEWWRNEQ  781

Query  516  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
            FW+IGGTSAHL AV+QGLLKVIAGIEISFTLTSKSA +DE D +ADLY+VKWTSLFIMPL
Sbjct  782  FWVIGGTSAHLVAVVQGLLKVIAGIEISFTLTSKSAGDDELDEFADLYIVKWTSLFIMPL  841

Query  336  TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
            TIL+VN+ ALV+G  R +YSVIP+WNKL GG FFSFWVL+H+YPFAKGLMG++G+VPTI+
Sbjct  842  TILIVNLIALVMGILRTVYSVIPEWNKLLGGMFFSFWVLSHMYPFAKGLMGKRGRVPTII  901

Query  156  YVwtgllsittsllwiSVNPPQDPRAAASNE  64
            YVW+G+LSIT +LLWI+++PP D   A + E
Sbjct  902  YVWSGILSITIALLWITIDPPSDSIQAGNLE  932



>ref|XP_010671117.1| PREDICTED: cellulose synthase-like protein D3 [Beta vulgaris 
subsp. vulgaris]
Length=1143

 Score =   389 bits (1000),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 201/263 (76%), Positives = 231/263 (88%), Gaps = 1/263 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS ++K LQRIAY NVG+YPFTSIF
Sbjct  871   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPKMKILQRIAYLNVGIYPFTSIF  930

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTLD  FL YLL ITVTL L+++LE+KW+ I LEE WRNEQ
Sbjct  931   LIVYCFLPALSLFSGQFIVQTLDVTFLTYLLTITVTLCLLAVLEIKWSGIALEEWWRNEQ  990

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKS A DEDD +ADLY+VKWTSL I P+
Sbjct  991   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSGA-DEDDEFADLYIVKWTSLMIPPI  1049

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I+++N+ A+ +G SR IYS IP+W+KL GG FFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1050  LIMMLNLIAIAVGFSRTIYSTIPEWSKLIGGVFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1109

Query  156   YVwtgllsittsllwiSVNPPQD  88
             +VW+GLL+IT SLLW+++ PP D
Sbjct  1110  FVWSGLLAITISLLWVAIKPPSD  1132



>ref|XP_008380666.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase-like protein 
D1 [Malus domestica]
Length=1078

 Score =   388 bits (997),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 208/270 (77%), Positives = 236/270 (87%), Gaps = 0/270 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIF+SRNN  LA RRLKFLQRIAY NVG+YPFTSIF
Sbjct  806   FRGTAPINLTDRLHQVLRWATGSVEIFYSRNNAFLACRRLKFLQRIAYLNVGIYPFTSIF  865

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+C FTGQFIV  L+  FL YLL ITV L L+SLLEV+W+ IGLEE WRNEQ
Sbjct  866   LVVYCFLPALCLFTGQFIVAGLNVAFLVYLLTITVCLCLLSLLEVRWSGIGLEEWWRNEQ  925

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW+IGGTSAHL AV+QGLLKV+AGIEISFTLT+KS AEDE+DIYADLYVVKWTSLF+MPL
Sbjct  926   FWVIGGTSAHLVAVIQGLLKVVAGIEISFTLTTKSTAEDEEDIYADLYVVKWTSLFLMPL  985

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VNI A+VIG SR +Y+VIPQWN+L GG FFSFWVL H+YPF KGLMGR+G++PTI+
Sbjct  986   TIIIVNIIAIVIGISRTLYAVIPQWNRLLGGLFFSFWVLVHMYPFMKGLMGRRGRIPTII  1045

Query  156   YVwtgllsittsllwiSVNPPQDPRAAASN  67
             YVW GLL+ITTSLLW+ +NPP        N
Sbjct  1046  YVWAGLLAITTSLLWVLINPPNGANFGGGN  1075



>ref|XP_008805451.1| PREDICTED: cellulose synthase-like protein D4 [Phoenix dactylifera]
Length=1153

 Score =   389 bits (1000),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 187/242 (77%), Positives = 212/242 (88%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  LAS RLKFLQRIAY NVG+YPFTSIF
Sbjct  872   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNALLASSRLKFLQRIAYLNVGIYPFTSIF  931

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  FTG FIVQTL   FL YLLIITV L+ I++LEVKW+ +GLEE WRNEQ
Sbjct  932   LLVYCFLPALSLFTGHFIVQTLSVAFLVYLLIITVFLICIAILEVKWSGVGLEEFWRNEQ  991

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLI GTSAHL AV+QGLLKVIAGIEISFTLTSKSA +D +DIYADLY+V+WTSL I P+
Sbjct  992   FWLISGTSAHLYAVVQGLLKVIAGIEISFTLTSKSAGDDAEDIYADLYIVRWTSLMIPPI  1051

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VNI A+  G +R +YS +P W+KL GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1052  TIMMVNIIAIAFGFARTVYSEVPNWSKLMGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1111

Query  156   YV  151
             +V
Sbjct  1112  FV  1113



>ref|XP_008800063.1| PREDICTED: cellulose synthase-like protein D2 [Phoenix dactylifera]
Length=1147

 Score =   389 bits (999),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 184/242 (76%), Positives = 213/242 (88%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN   AS ++K LQRIAY NVG+YPFTS F
Sbjct  874   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAIFASPKMKLLQRIAYLNVGIYPFTSFF  933

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLIIT+TL ++++LEVKW+ I LEE WRNEQ
Sbjct  934   LIVYCFLPALSLFSGQFIVQTLNVTFLTYLLIITLTLCMLAVLEVKWSGIELEEWWRNEQ  993

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW++GGTSAHLAAVLQGLLKVIAGIEISFTLTSKSA +D DD YADLY+V+WTSL I P+
Sbjct  994   FWVVGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAGDDIDDEYADLYIVRWTSLMIPPI  1053

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+++N+ A+ +G  R IYSVIPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1054  TIMILNLIAIAVGVGRTIYSVIPQWSKLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1113

Query  156   YV  151
             YV
Sbjct  1114  YV  1115



>ref|XP_002297815.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEE82620.1| cellulose synthase family protein [Populus trichocarpa]
Length=1032

 Score =   386 bits (992),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 191/242 (79%), Positives = 213/242 (88%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN    SRRLKFLQRIAY NVG+YPFTS F
Sbjct  765   FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNALFGSRRLKFLQRIAYLNVGIYPFTSFF  824

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LV YCF+PA+  FTG FIVQ+LD  FL YLL ITVTL LISLLE++W+ IGLEE WRNEQ
Sbjct  825   LVTYCFLPALSLFTGTFIVQSLDISFLIYLLTITVTLTLISLLEIRWSGIGLEEWWRNEQ  884

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW IGGTSAHL AV+QGLLKV+AG+EISFTLTSKSA EDEDDIYADLY+VKWT LF MPL
Sbjct  885   FWAIGGTSAHLIAVIQGLLKVVAGVEISFTLTSKSAGEDEDDIYADLYIVKWTGLFFMPL  944

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+VVN+ A+VIGCSR +YS IP+W KL GG FFSFWVL+H+YPF KGL+GR+G+VPTIV
Sbjct  945   TIIVVNLVAIVIGCSRTLYSEIPEWGKLMGGLFFSFWVLSHMYPFVKGLLGRRGRVPTIV  1004

Query  156   YV  151
             YV
Sbjct  1005  YV  1006



>ref|XP_004148102.1| PREDICTED: cellulose synthase-like protein D3-like [Cucumis sativus]
 ref|XP_004156754.1| PREDICTED: cellulose synthase-like protein D3-like [Cucumis sativus]
 gb|KGN63376.1| hypothetical protein Csa_2G433910 [Cucumis sativus]
Length=1146

 Score =   389 bits (998),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 184/242 (76%), Positives = 215/242 (89%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS ++K LQRIAY NVG+YPFTSIF
Sbjct  873   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASPKMKVLQRIAYLNVGIYPFTSIF  932

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLIIT+TL ++++LE++W+ I LEE WRNEQ
Sbjct  933   LIVYCFLPALSLFSGQFIVQTLNVTFLTYLLIITLTLCMLAVLEIRWSGIELEEWWRNEQ  992

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKSA +D DD +ADLY+VKWTSL I P+
Sbjct  993   FWLIGGTSAHLAAVLQGLLKVVAGIEISFTLTSKSAGDDVDDEFADLYIVKWTSLMIPPI  1052

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++ N+ A+ +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1053  TIMITNLIAIAVGFSRTIYSVIPQWSRLIGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1112

Query  156   YV  151
             +V
Sbjct  1113  FV  1114



>ref|XP_008459143.1| PREDICTED: cellulose synthase-like protein D3 [Cucumis melo]
Length=1146

 Score =   389 bits (998),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 184/242 (76%), Positives = 215/242 (89%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS ++K LQRIAY NVG+YPFTSIF
Sbjct  873   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASPKMKVLQRIAYLNVGIYPFTSIF  932

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLIIT+TL ++++LE++W+ I LEE WRNEQ
Sbjct  933   LIVYCFLPALSLFSGQFIVQTLNVTFLTYLLIITLTLCMLAVLEIRWSGIELEEWWRNEQ  992

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKSA +D DD +ADLY+VKWTSL I P+
Sbjct  993   FWLIGGTSAHLAAVLQGLLKVVAGIEISFTLTSKSAGDDVDDEFADLYIVKWTSLMIPPI  1052

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++ N+ A+ +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1053  TIMITNLIAIAVGFSRTIYSVIPQWSRLIGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1112

Query  156   YV  151
             +V
Sbjct  1113  FV  1114



>ref|XP_006588165.1| PREDICTED: cellulose synthase-like protein D1-like [Glycine max]
Length=1004

 Score =   385 bits (990),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 204/271 (75%), Positives = 238/271 (88%), Gaps = 0/271 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN   A+RRLKFLQRI+Y NVG+YPFTS+F
Sbjct  733   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFFATRRLKFLQRISYLNVGIYPFTSVF  792

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCFIPA+  F+GQFIV  L+  FL YLL+IT+ L L+SLLEVKW+ I LEE WRNEQ
Sbjct  793   LVVYCFIPALSLFSGQFIVNGLNPAFLIYLLLITICLTLLSLLEVKWSGIALEEWWRNEQ  852

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW+IGGTSAHL AV+QGLLKVIAGIEISFTLTSKSA +DE D +ADLY+VKWTSLFIMPL
Sbjct  853   FWVIGGTSAHLVAVVQGLLKVIAGIEISFTLTSKSAGDDELDEFADLYIVKWTSLFIMPL  912

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TIL+VN+ ALV+G  R +YSVIP+WNKL GG FFSFWVL+H+YPFAKGLMG++G+VPTI+
Sbjct  913   TILIVNLIALVMGILRTVYSVIPEWNKLLGGMFFSFWVLSHMYPFAKGLMGKRGRVPTII  972

Query  156   YVwtgllsittsllwiSVNPPQDPRAAASNE  64
             YVW+G+LSIT +LLWI+++PP D   A + E
Sbjct  973   YVWSGILSITIALLWITIDPPSDSIQAGNLE  1003



>gb|KDO57192.1| hypothetical protein CISIN_1g003243mg [Citrus sinensis]
Length=837

 Score =   381 bits (979),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 196/262 (75%), Positives = 223/262 (85%), Gaps = 0/262 (0%)
 Frame = -3

Query  876  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
            F GTAPINLTDRLHQVLRWATGSVEIFFSRNN  L S RLK LQRIAY NVG+YPFTSIF
Sbjct  564  FHGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLGSSRLKLLQRIAYLNVGIYPFTSIF  623

Query  696  LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
            L+VYCF+PA+  F+GQFIVQTL+  FL YL  ITVTL L+++LEVKW+ I LEE WRNEQ
Sbjct  624  LIVYCFLPALSLFSGQFIVQTLNVTFLVYLFAITVTLSLLAVLEVKWSGIDLEEWWRNEQ  683

Query  516  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
            FWLIGGTSAHL AVLQGLLKVIAGIEISFTLTSKS  ED DD +ADLY+ KWTSL I PL
Sbjct  684  FWLIGGTSAHLVAVLQGLLKVIAGIEISFTLTSKSVGEDVDDEFADLYIFKWTSLMIPPL  743

Query  336  TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
            TI++VN+ A+ +  SR IYS  PQW++L GG FFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  744  TIIMVNLIAIAVAVSRTIYSAEPQWSQLVGGVFFSFWVLAHLYPFAKGLMGRRGKTPTIV  803

Query  156  YVwtgllsittsllwiSVNPPQ  91
            +VW+GLL++  SLLW+++NPP 
Sbjct  804  FVWSGLLAVCISLLWVAINPPS  825



>gb|EMT31463.1| Cellulose synthase-like protein D1 [Aegilops tauschii]
Length=1141

 Score =   388 bits (997),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 201/271 (74%), Positives = 234/271 (86%), Gaps = 4/271 (1%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN   AS ++K LQRIAY NVG+YPFTSIF
Sbjct  871   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALFASSKMKVLQRIAYLNVGIYPFTSIF  930

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLIITVTL L+++LE+KW+ I LEE WRNEQ
Sbjct  931   LIVYCFLPALSLFSGQFIVQTLNVTFLTYLLIITVTLCLLAMLEIKWSGIALEEWWRNEQ  990

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV+QGLLKV+AGIEISFTLTSK   +D DD +A+LY VKWTSL I PL
Sbjct  991   FWLIGGTSAHLAAVMQGLLKVVAGIEISFTLTSKQVGDDIDDEFAELYEVKWTSLMIPPL  1050

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYS IPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1051  TIIMVNLVAIAVGFSRTIYSTIPQWSKLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1110

Query  156   YVwtgllsittsllwiSVNPPQDPRAAASNE  64
             YVW GL+SIT SLLWI++NPP    ++A+N+
Sbjct  1111  YVWAGLVSITISLLWIAINPP----SSAANQ  1137



>ref|XP_003572134.1| PREDICTED: cellulose synthase-like protein D1 [Brachypodium distachyon]
Length=1151

 Score =   388 bits (997),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 197/262 (75%), Positives = 230/262 (88%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN   AS ++K LQRIAY NVG+YPFTSIF
Sbjct  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALFASSKMKVLQRIAYLNVGIYPFTSIF  935

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLII++TL L+++LE+KW+ I LEE WRNEQ
Sbjct  936   LIVYCFLPALSLFSGQFIVQTLNVTFLTYLLIISITLCLLAMLEIKWSGIALEEWWRNEQ  995

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV+QGLLKV+AGIEISFTLTSK   +D DD +A+LYVVKWTSL + PL
Sbjct  996   FWLIGGTSAHLAAVMQGLLKVVAGIEISFTLTSKQVGDDVDDEFAELYVVKWTSLMVPPL  1055

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYS IPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1056  TIIMVNLVAIAVGFSRTIYSTIPQWSKLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1115

Query  156   YVwtgllsittsllwiSVNPPQ  91
             YVW+GL+SIT SLLWI++NPP 
Sbjct  1116  YVWSGLVSITISLLWIAINPPS  1137



>ref|XP_010940784.1| PREDICTED: cellulose synthase-like protein D2 [Elaeis guineensis]
 ref|XP_010940786.1| PREDICTED: cellulose synthase-like protein D2 [Elaeis guineensis]
Length=1154

 Score =   388 bits (997),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 196/262 (75%), Positives = 230/262 (88%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  L S RLK LQR+AY NVG+YPFTSIF
Sbjct  881   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLGSTRLKLLQRVAYLNVGIYPFTSIF  940

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLIIT+TL +++ LE+KW+ I LEE WRNEQ
Sbjct  941   LIVYCFLPALSLFSGQFIVQTLNVTFLTYLLIITLTLSMLAGLEIKWSGISLEEWWRNEQ  1000

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSA +D DD +ADLY+VKW+ L I P+
Sbjct  1001  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAGDDVDDEFADLYIVKWSFLMIPPI  1060

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+  + +G SR IYSV+PQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1061  TIMMVNLIGIAVGVSRTIYSVVPQWSKLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1120

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GL++IT SLLW+++NPP 
Sbjct  1121  FVWSGLIAITISLLWVAINPPS  1142



>ref|XP_003607427.1| Cellulose synthase-like protein [Medicago truncatula]
 gb|AES89624.1| cellulose synthase-like protein [Medicago truncatula]
Length=1142

 Score =   388 bits (996),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 192/261 (74%), Positives = 229/261 (88%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN  +A+RR+KFLQRIAY NVG+YPFTS F
Sbjct  869   FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNAIMATRRMKFLQRIAYLNVGIYPFTSFF  928

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLL ITVTL ++++LE+KW+ I LEE WRNEQ
Sbjct  929   LIVYCFLPALSLFSGQFIVQTLNVTFLAYLLAITVTLCILAVLEIKWSGIELEEWWRNEQ  988

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKS  +D DD YADLY+VKW+SL I P+
Sbjct  989   FWLIGGTSAHLAAVLQGLLKVVAGIEISFTLTSKSGGDDVDDEYADLYIVKWSSLMIPPI  1048

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I++VN+  + +G SR IYS IPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1049  VIMMVNLIGIAVGVSRTIYSTIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1108

Query  156   YVwtgllsittsllwiSVNPP  94
             +VW+GL++I  SLLW+++NPP
Sbjct  1109  FVWSGLIAIIISLLWVAINPP  1129



>ref|XP_009387033.1| PREDICTED: cellulose synthase-like protein D4 [Musa acuminata 
subsp. malaccensis]
Length=1148

 Score =   388 bits (996),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 197/263 (75%), Positives = 235/263 (89%), Gaps = 0/263 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  LASRRLK LQRIAY NVG+YPFTSIF
Sbjct  873   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNALLASRRLKLLQRIAYLNVGIYPFTSIF  932

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+G FIVQTL+  FL YLL IT+TL+ +++LEVKW+ +GLEE WRNEQ
Sbjct  933   LLVYCFLPALSLFSGYFIVQTLNVTFLVYLLTITLTLIGLAILEVKWSGVGLEEWWRNEQ  992

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLI GTSAHL AV+QGLLKV+AGIEISFTLT+KS AEDE+DIYADLY+VKWTSL I P+
Sbjct  993   FWLISGTSAHLYAVVQGLLKVVAGIEISFTLTTKSTAEDEEDIYADLYLVKWTSLMIPPI  1052

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VNI A+  G ++ IYS +P+W+KL GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1053  TIMMVNIIAIAFGFAKTIYSEVPKWSKLMGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1112

Query  156   YVwtgllsittsllwiSVNPPQD  88
             +VW+GL++IT SLLWI+++PP++
Sbjct  1113  FVWSGLIAITISLLWIAISPPKE  1135



>ref|XP_011070338.1| PREDICTED: cellulose synthase-like protein D3 isoform X1 [Sesamum 
indicum]
Length=1152

 Score =   388 bits (996),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 180/242 (74%), Positives = 214/242 (88%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQR+AY NVG+YPFTS+F
Sbjct  879   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKLLQRVAYLNVGIYPFTSLF  938

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQ+L+  FL YLL+IT+TL ++++LE+KW+ I LEE WRNEQ
Sbjct  939   LIVYCFLPALSLFSGQFIVQSLNVTFLTYLLVITLTLCVLAMLEIKWSGINLEEWWRNEQ  998

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSA +D DD +ADLY++KW+SL I P+
Sbjct  999   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAGDDNDDEFADLYILKWSSLMIPPI  1058

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++ N+ A+ +G SR IYS IPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1059  TIMITNLIAIAVGFSRTIYSAIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1118

Query  156   YV  151
             +V
Sbjct  1119  FV  1120



>ref|XP_004144564.1| PREDICTED: cellulose synthase-like protein D4-like [Cucumis sativus]
 gb|KGN43376.1| Cellulose synthase [Cucumis sativus]
Length=1122

 Score =   387 bits (994),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 198/262 (76%), Positives = 231/262 (88%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  LASRRLK LQR+AY NVG+YPFTSIF
Sbjct  844   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNALLASRRLKLLQRLAYLNVGIYPFTSIF  903

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLIITV L+ +++LEVKW+ IGLEE WRNEQ
Sbjct  904   LIVYCFLPALSLFSGQFIVQTLNVTFLIYLLIITVCLISLAILEVKWSGIGLEEWWRNEQ  963

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLI GTSAHLAAV+QGLLKVIAGIEISFTLTSKS+ +D +DIYADLY+VKWTSL + P+
Sbjct  964   FWLISGTSAHLAAVVQGLLKVIAGIEISFTLTSKSSGDDVEDIYADLYLVKWTSLMVPPI  1023

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I ++NI A+ +  SR IYS +PQW+K  GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1024  VIAMMNIIAMAVAFSRTIYSSVPQWSKFIGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1083

Query  156   YVwtgllsittsllwiSVNPPQ  91
              VW+GL++IT SLLWI++NPP+
Sbjct  1084  IVWSGLIAITLSLLWIAINPPK  1105



>ref|XP_011070339.1| PREDICTED: cellulose synthase-like protein D3 isoform X2 [Sesamum 
indicum]
 ref|XP_011070340.1| PREDICTED: cellulose synthase-like protein D3 isoform X2 [Sesamum 
indicum]
 ref|XP_011070342.1| PREDICTED: cellulose synthase-like protein D3 isoform X2 [Sesamum 
indicum]
 ref|XP_011070343.1| PREDICTED: cellulose synthase-like protein D3 isoform X2 [Sesamum 
indicum]
Length=1149

 Score =   387 bits (995),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 180/242 (74%), Positives = 214/242 (88%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQR+AY NVG+YPFTS+F
Sbjct  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKLLQRVAYLNVGIYPFTSLF  935

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQ+L+  FL YLL+IT+TL ++++LE+KW+ I LEE WRNEQ
Sbjct  936   LIVYCFLPALSLFSGQFIVQSLNVTFLTYLLVITLTLCVLAMLEIKWSGINLEEWWRNEQ  995

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSA +D DD +ADLY++KW+SL I P+
Sbjct  996   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAGDDNDDEFADLYILKWSSLMIPPI  1055

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++ N+ A+ +G SR IYS IPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1056  TIMITNLIAIAVGFSRTIYSAIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1115

Query  156   YV  151
             +V
Sbjct  1116  FV  1117



>gb|EYU45377.1| hypothetical protein MIMGU_mgv1a000447mg [Erythranthe guttata]
Length=1148

 Score =   387 bits (995),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 191/262 (73%), Positives = 230/262 (88%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS ++K LQR+AY NVG+YPFTS+F
Sbjct  875   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAILASSKMKILQRVAYLNVGIYPFTSVF  934

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTLD  FL YLL+IT+TL  +++LEVKW+ I LEE WRNEQ
Sbjct  935   LIVYCFLPALSLFSGQFIVQTLDVTFLVYLLLITITLCGLAVLEVKWSGIELEEWWRNEQ  994

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV QGLLKV+AG+EISFTLTSKS  +D++D +ADLY+VKWTSL I P+
Sbjct  995   FWLIGGTSAHLAAVFQGLLKVVAGVEISFTLTSKSGGDDDEDEFADLYIVKWTSLMIPPI  1054

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I++VN+ A+ +G SR IYSVIPQW++L GG FFSFWVL HLYPFAKGLMGR+G+ PTIV
Sbjct  1055  VIMMVNLIAIAVGLSRTIYSVIPQWSRLLGGVFFSFWVLVHLYPFAKGLMGRRGRTPTIV  1114

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GL++I  SLLW+++NPPQ
Sbjct  1115  FVWSGLIAIIISLLWVAINPPQ  1136



>ref|XP_011034477.1| PREDICTED: cellulose synthase-like protein D1 isoform X1 [Populus 
euphratica]
Length=1032

 Score =   385 bits (989),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 191/242 (79%), Positives = 213/242 (88%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN    SRRLKFLQRIAY NVG+YPFTS F
Sbjct  765   FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNAFFGSRRLKFLQRIAYLNVGIYPFTSFF  824

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LV YCF+PA+  FTG FIVQ+LD  FL YLL ITVTL LISLLE++W+ IGLE+ WRNEQ
Sbjct  825   LVTYCFLPALSLFTGTFIVQSLDISFLIYLLTITVTLTLISLLEIRWSGIGLEDWWRNEQ  884

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW IGGTSAHL AV+QGLLKV+AGIEISFTLTSKSA EDEDDIYADLY+VKWT LF MPL
Sbjct  885   FWAIGGTSAHLIAVIQGLLKVVAGIEISFTLTSKSAGEDEDDIYADLYIVKWTGLFFMPL  944

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+VVN+ A+VIGCSR +YS IP+W KL GG FFSFWVL+H+YPF KGL+GR+G+VPTIV
Sbjct  945   TIIVVNLVAIVIGCSRTLYSEIPEWGKLMGGLFFSFWVLSHMYPFVKGLLGRRGRVPTIV  1004

Query  156   YV  151
             YV
Sbjct  1005  YV  1006



>ref|XP_010417413.1| PREDICTED: cellulose synthase-like protein D3 [Camelina sativa]
Length=1152

 Score =   387 bits (995),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 197/261 (75%), Positives = 230/261 (88%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN   AS R+K LQRIAY NVG+YPFTSIF
Sbjct  879   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFFASPRMKILQRIAYLNVGIYPFTSIF  938

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLII++TL L++LLEVKW+ I LEE WRNEQ
Sbjct  939   LIVYCFLPALSLFSGQFIVQTLNVTFLIYLLIISITLCLLALLEVKWSGISLEEWWRNEQ  998

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAH+ AV+QGLLKV+AGIEISFTLTSKS  +D DD +ADLY+VKWT L I P+
Sbjct  999   FWLIGGTSAHIVAVIQGLLKVVAGIEISFTLTSKSGGDDVDDEFADLYIVKWTLLMIPPI  1058

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+++NI A+ +G SR IYSVIPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1059  TIMMLNIIAIAVGFSRTIYSVIPQWSKLIGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1118

Query  156   YVwtgllsittsllwiSVNPP  94
             YVW+GL++IT SLLW+++NPP
Sbjct  1119  YVWSGLVAITISLLWVAINPP  1139



>gb|KDP20319.1| hypothetical protein JCGZ_06405 [Jatropha curcas]
Length=1043

 Score =   385 bits (989),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 204/263 (78%), Positives = 233/263 (89%), Gaps = 0/263 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN  LA+RRLKFLQRIAY NVG+YPFTS F
Sbjct  773   FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNAFLATRRLKFLQRIAYLNVGIYPFTSFF  832

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LV YCF+PA+   +G FIV +L+  FL YLL+IT+TL L+SLLEVKW+ IGLE+ WRNEQ
Sbjct  833   LVTYCFLPALSLISGHFIVSSLNIAFLSYLLVITITLTLLSLLEVKWSGIGLEDWWRNEQ  892

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW+IGGTSAH AAVLQGLLKV+AGIEISFTLTSKSA EDEDD+YADLY+VKWTSLFIMPL
Sbjct  893   FWVIGGTSAHFAAVLQGLLKVLAGIEISFTLTSKSAGEDEDDVYADLYMVKWTSLFIMPL  952

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I++ N  A+VIG SR IYSVIPQW KL GG+FFSFWVLAH+YPF KGL+GR+G+VPTIV
Sbjct  953   AIIMSNFVAIVIGISRTIYSVIPQWGKLIGGSFFSFWVLAHMYPFIKGLLGRRGRVPTIV  1012

Query  156   YVwtgllsittsllwiSVNPPQD  88
             YVW GL+SIT SLLW+S++PP D
Sbjct  1013  YVWAGLISITVSLLWVSIDPPTD  1035



>ref|XP_011034478.1| PREDICTED: cellulose synthase-like protein D1 isoform X2 [Populus 
euphratica]
Length=1031

 Score =   385 bits (988),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 191/242 (79%), Positives = 213/242 (88%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN    SRRLKFLQRIAY NVG+YPFTS F
Sbjct  764   FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNAFFGSRRLKFLQRIAYLNVGIYPFTSFF  823

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LV YCF+PA+  FTG FIVQ+LD  FL YLL ITVTL LISLLE++W+ IGLE+ WRNEQ
Sbjct  824   LVTYCFLPALSLFTGTFIVQSLDISFLIYLLTITVTLTLISLLEIRWSGIGLEDWWRNEQ  883

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW IGGTSAHL AV+QGLLKV+AGIEISFTLTSKSA EDEDDIYADLY+VKWT LF MPL
Sbjct  884   FWAIGGTSAHLIAVIQGLLKVVAGIEISFTLTSKSAGEDEDDIYADLYIVKWTGLFFMPL  943

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+VVN+ A+VIGCSR +YS IP+W KL GG FFSFWVL+H+YPF KGL+GR+G+VPTIV
Sbjct  944   TIIVVNLVAIVIGCSRTLYSEIPEWGKLMGGLFFSFWVLSHMYPFVKGLLGRRGRVPTIV  1003

Query  156   YV  151
             YV
Sbjct  1004  YV  1005



>ref|XP_010053642.1| PREDICTED: cellulose synthase-like protein D3 [Eucalyptus grandis]
 ref|XP_010053643.1| PREDICTED: cellulose synthase-like protein D3 [Eucalyptus grandis]
 gb|KCW77985.1| hypothetical protein EUGRSUZ_D02228 [Eucalyptus grandis]
Length=1116

 Score =   386 bits (992),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 182/242 (75%), Positives = 213/242 (88%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LASRR+KFLQRIAY NVG+YPFTSIF
Sbjct  843   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASRRMKFLQRIAYMNVGLYPFTSIF  902

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+  F+GQFIVQ+LD  FL YLL ITVTL ++++LE+KW+ I LEE WRNEQ
Sbjct  903   LVVYCFLPALSLFSGQFIVQSLDVTFLTYLLAITVTLCILAMLEIKWSGIELEEWWRNEQ  962

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV+QGLLKVIAGIEISFTLTSKSA ++ DD +A+LY+ KWTSL I+P+
Sbjct  963   FWLIGGTSAHLAAVIQGLLKVIAGIEISFTLTSKSAGDENDDEFAELYLFKWTSLMILPI  1022

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++ N+ A+ +   R IYS+IPQW++L GG FFSFWVL HLYPFAKGLMG++G+ PTIV
Sbjct  1023  TIMLTNLIAIAVAVCRTIYSIIPQWSRLMGGVFFSFWVLVHLYPFAKGLMGKRGRTPTIV  1082

Query  156   YV  151
             YV
Sbjct  1083  YV  1084



>ref|XP_009771399.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana sylvestris]
 ref|XP_009771400.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana sylvestris]
Length=1137

 Score =   387 bits (993),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 192/261 (74%), Positives = 233/261 (89%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS ++K LQRIAY NVG+YPFTSIF
Sbjct  864   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASPKMKILQRIAYLNVGIYPFTSIF  923

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQ+L+  FL YLL+I++TL ++++LE+KW+ I LEE WRNEQ
Sbjct  924   LIVYCFLPALSLFSGQFIVQSLNITFLVYLLVISLTLCMLAILEIKWSGIALEEWWRNEQ  983

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKSA ++ DD +ADLY++KWTSL I P+
Sbjct  984   FWLIGGTSAHLAAVLQGLLKVVAGIEISFTLTSKSAGDENDDEFADLYIIKWTSLMIPPI  1043

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYS IPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1044  TIMMVNLVAIAVGFSRTIYSTIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1103

Query  156   YVwtgllsittsllwiSVNPP  94
             +VW+GL++IT SLLW+++NPP
Sbjct  1104  FVWSGLIAITISLLWVAINPP  1124



>gb|ABI75157.1| cellulose synthase-like D7 [Physcomitrella patens]
Length=1182

 Score =   387 bits (995),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 185/242 (76%), Positives = 211/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN   AS R+KFLQR+AY NVG+YPFTSIF
Sbjct  906   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFFASPRMKFLQRVAYLNVGIYPFTSIF  965

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  FTGQFIVQTL+  FL YLL ITVTL ++++LEV+W+ I LEE WRNEQ
Sbjct  966   LLVYCFLPALSLFTGQFIVQTLNLSFLIYLLTITVTLCVLAILEVRWSGITLEEWWRNEQ  1025

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW+IGGTSAH+AAV+QGLLKV+AG+EISFTLTSKSA EDEDDIYADLYVVKWTSL I P+
Sbjct  1026  FWVIGGTSAHVAAVIQGLLKVMAGVEISFTLTSKSAGEDEDDIYADLYVVKWTSLMIPPI  1085

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI + NI A+ +G SR IYS IP+W+KL GG FFS WVL HLYPFAKGLMG+ GK PTI+
Sbjct  1086  TIGLTNIIAIAVGVSRTIYSEIPEWSKLIGGVFFSLWVLFHLYPFAKGLMGKGGKTPTII  1145

Query  156   YV  151
             YV
Sbjct  1146  YV  1147



>sp|Q8W3F9.1|CSLD1_ORYSJ RecName: Full=Cellulose synthase-like protein D1; AltName: Full=OsCslD1 
[Oryza sativa Japonica Group]
 sp|A2ZAK8.2|CSLD1_ORYSI RecName: Full=Cellulose synthase-like protein D1; AltName: Full=OsCslD1 
[Oryza sativa Indica Group]
 gb|AAL58185.1|AC027037_7 putative cellulose synthase [Oryza sativa Japonica Group]
 gb|AAP55168.1| cellulose synthase-like protein D4, putative, expressed [Oryza 
sativa Japonica Group]
 tpg|DAA01752.1| TPA_exp: cellulose synthase-like D1 [Oryza sativa (japonica cultivar-group)]
 gb|EAZ17092.1| hypothetical protein OsJ_32590 [Oryza sativa Japonica Group]
 gb|EEC67503.1| hypothetical protein OsI_34786 [Oryza sativa Indica Group]
Length=1127

 Score =   386 bits (992),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 184/242 (76%), Positives = 211/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN   AS ++K LQRIAY NVG+YPFTS+F
Sbjct  852   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALFASSKMKVLQRIAYLNVGIYPFTSVF  911

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLIIT+TL L+++LE+KW+ I LEE WRNEQ
Sbjct  912   LIVYCFLPALSLFSGQFIVQTLNVTFLTYLLIITITLCLLAMLEIKWSGIALEEWWRNEQ  971

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSK   +D DD +A+LY VKWTSL I PL
Sbjct  972   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKQLGDDVDDEFAELYAVKWTSLMIPPL  1031

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+++N+ A+ +G SR IYS IPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1032  TIIMINLVAIAVGFSRTIYSTIPQWSKLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1091

Query  156   YV  151
             YV
Sbjct  1092  YV  1093



>ref|XP_004505600.1| PREDICTED: cellulose synthase-like protein D3-like isoform X1 
[Cicer arietinum]
 ref|XP_004505601.1| PREDICTED: cellulose synthase-like protein D3-like isoform X2 
[Cicer arietinum]
Length=1141

 Score =   387 bits (993),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 194/261 (74%), Positives = 228/261 (87%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS ++K LQRIAY NVG+YPFTS F
Sbjct  868   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAILASPKMKILQRIAYLNVGIYPFTSFF  927

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL   FL YLL I+VTL ++++LE+KW+ I LEE WRNEQ
Sbjct  928   LIVYCFLPALSLFSGQFIVQTLSVTFLAYLLAISVTLCILAVLEIKWSGIELEEWWRNEQ  987

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKS  +D DD +ADLYVVKW+SL I P+
Sbjct  988   FWLIGGTSAHLAAVLQGLLKVVAGIEISFTLTSKSGGDDVDDEFADLYVVKWSSLMIPPI  1047

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VNI A+ +G SR IYS IPQW++L GG FFSFWVL+HLYPFAKGLMGR+GK PTIV
Sbjct  1048  TIMMVNIIAIAVGVSRTIYSTIPQWSRLLGGVFFSFWVLSHLYPFAKGLMGRRGKTPTIV  1107

Query  156   YVwtgllsittsllwiSVNPP  94
             +VW+GL++I  SLLW+++NPP
Sbjct  1108  FVWSGLIAIIISLLWVAINPP  1128



>ref|XP_010492624.1| PREDICTED: cellulose synthase-like protein D2 [Camelina sativa]
Length=1146

 Score =   387 bits (993),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 192/261 (74%), Positives = 232/261 (89%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS ++K LQRIAY NVG+YPFTSIF
Sbjct  873   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASSKMKILQRIAYLNVGIYPFTSIF  932

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLL I++TL L++LLE+KW+ I LEE WRNEQ
Sbjct  933   LIVYCFLPALSLFSGQFIVQTLNVTFLVYLLTISITLCLLALLEIKWSGISLEEWWRNEQ  992

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAH+AAVLQGLLK++AG+EI+FTLTSKS  +D DD +ADLY+VK+TSL +MP+
Sbjct  993   FWLIGGTSAHIAAVLQGLLKIVAGVEINFTLTSKSGGDDVDDEFADLYIVKYTSLMLMPI  1052

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I++VN+ A+ +G SR IYSV+PQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1053  LIIMVNLIAIAVGFSRTIYSVVPQWSKLIGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1112

Query  156   YVwtgllsittsllwiSVNPP  94
             YVW+GL++IT SLLW+++NPP
Sbjct  1113  YVWSGLIAITISLLWVAINPP  1133



>ref|XP_001778678.1| cellulose synthase-like D7, glycosyltransferase family 2 [Physcomitrella 
patens]
 gb|EDQ56471.1| cellulose synthase-like D7, glycosyltransferase family 2 [Physcomitrella 
patens]
Length=1182

 Score =   387 bits (994),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 185/242 (76%), Positives = 211/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN   AS R+KFLQR+AY NVG+YPFTSIF
Sbjct  906   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFFASPRMKFLQRVAYLNVGIYPFTSIF  965

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  FTGQFIVQTL+  FL YLL ITVTL ++++LEV+W+ I LEE WRNEQ
Sbjct  966   LLVYCFLPALSLFTGQFIVQTLNLSFLIYLLTITVTLCVLAILEVRWSGITLEEWWRNEQ  1025

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW+IGGTSAH+AAV+QGLLKV+AG+EISFTLTSKSA EDEDDIYADLYVVKWTSL I P+
Sbjct  1026  FWVIGGTSAHVAAVIQGLLKVMAGVEISFTLTSKSAGEDEDDIYADLYVVKWTSLMIPPI  1085

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI + NI A+ +G SR IYS IP+W+KL GG FFS WVL HLYPFAKGLMG+ GK PTI+
Sbjct  1086  TIGLTNIIAIAVGVSRTIYSEIPEWSKLIGGVFFSLWVLFHLYPFAKGLMGKGGKTPTII  1145

Query  156   YV  151
             YV
Sbjct  1146  YV  1147



>ref|XP_010420398.1| PREDICTED: cellulose synthase-like protein D2 [Camelina sativa]
Length=1146

 Score =   386 bits (992),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 193/261 (74%), Positives = 232/261 (89%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS ++K LQRIAY NVG+YPFTSIF
Sbjct  873   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASSKMKILQRIAYLNVGIYPFTSIF  932

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLL I++TL L++LLE+KW+ I LEE WRNEQ
Sbjct  933   LIVYCFLPALSLFSGQFIVQTLNVTFLVYLLTISITLCLLALLEIKWSGISLEEWWRNEQ  992

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAH+AAVLQGLLKV+AG+EI+FTLTSKS  +D DD +ADLY+VK+TSL + P+
Sbjct  993   FWLIGGTSAHIAAVLQGLLKVVAGVEINFTLTSKSGGDDVDDEFADLYMVKYTSLMLPPI  1052

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSV+PQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1053  TIIMVNLIAIAVGFSRTIYSVVPQWSKLIGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1112

Query  156   YVwtgllsittsllwiSVNPP  94
             YVW+GL++IT SLLW+++NPP
Sbjct  1113  YVWSGLVAITISLLWVAINPP  1133



>ref|XP_009625984.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana tomentosiformis]
 ref|XP_009625985.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana tomentosiformis]
Length=1138

 Score =   386 bits (992),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 192/261 (74%), Positives = 233/261 (89%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS ++K LQRIAY NVG+YPFTSIF
Sbjct  865   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASPKMKILQRIAYLNVGIYPFTSIF  924

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQ+L+  FL YLL+I++TL ++++LE+KW+ I LEE WRNEQ
Sbjct  925   LIVYCFLPALSLFSGQFIVQSLNITFLVYLLVISLTLCMLAILEIKWSGIALEEWWRNEQ  984

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKSA ++ DD +ADLY++KWTSL I P+
Sbjct  985   FWLIGGTSAHLAAVLQGLLKVVAGIEISFTLTSKSAGDENDDEFADLYIIKWTSLMIPPI  1044

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYS IPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1045  TIMMVNLVAIAVGFSRTIYSTIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1104

Query  156   YVwtgllsittsllwiSVNPP  94
             +VW+GL++IT SLLW+++NPP
Sbjct  1105  FVWSGLIAITISLLWVAINPP  1125



>gb|ABI75153.1| cellulose synthase-like D3 [Physcomitrella patens]
Length=1182

 Score =   387 bits (994),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 187/242 (77%), Positives = 211/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN   AS R+KFLQRIAY NVG+YPFTSIF
Sbjct  906   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFFASPRMKFLQRIAYLNVGIYPFTSIF  965

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  FTGQFIVQTL+  FL YLLIITVTL ++++LEVKW+ I LEE WRNEQ
Sbjct  966   LLVYCFLPALSLFTGQFIVQTLNLSFLVYLLIITVTLCMLAILEVKWSGITLEEWWRNEQ  1025

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW+IGGTSAH+AAV+QGLLKV+AG+EISFTLTSKSA EDED IYADLYVVKWTSL I P+
Sbjct  1026  FWVIGGTSAHVAAVIQGLLKVMAGVEISFTLTSKSAGEDEDVIYADLYVVKWTSLMIPPI  1085

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI + NI A+ +G SR IYS IP+W+KL GG FFS WVL HLYPFAKGLMG+ GK PTI+
Sbjct  1086  TIGLTNIIAIAVGVSRTIYSEIPEWSKLIGGVFFSLWVLFHLYPFAKGLMGKGGKTPTII  1145

Query  156   YV  151
             YV
Sbjct  1146  YV  1147



>ref|XP_002467425.1| hypothetical protein SORBIDRAFT_01g027880 [Sorghum bicolor]
 gb|EER94423.1| hypothetical protein SORBIDRAFT_01g027880 [Sorghum bicolor]
Length=1164

 Score =   386 bits (992),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 184/242 (76%), Positives = 212/242 (88%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN   AS ++K LQRIAY NVG+YPFTSIF
Sbjct  889   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALFASSKMKVLQRIAYLNVGIYPFTSIF  948

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLIIT+TL L+++LE+KW+ I LEE WRNEQ
Sbjct  949   LIVYCFLPALSLFSGQFIVQTLNVTFLTYLLIITITLCLLAMLEIKWSGIALEEWWRNEQ  1008

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSK   +D +D +A+LY+VKWTSL I PL
Sbjct  1009  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKQVGDDVEDEFAELYIVKWTSLMIPPL  1068

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+++N+ A+ +G SR IYS IPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1069  TIIMINLVAIAVGFSRTIYSTIPQWSKLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1128

Query  156   YV  151
             YV
Sbjct  1129  YV  1130



>ref|XP_004983532.1| PREDICTED: cellulose synthase-like protein D1-like [Setaria italica]
Length=1157

 Score =   386 bits (992),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 184/242 (76%), Positives = 212/242 (88%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN   AS ++K LQRIAY NVG+YPFTSIF
Sbjct  882   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALFASSKMKVLQRIAYLNVGIYPFTSIF  941

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLIIT+TL L+++LE+KW+ I LEE WRNEQ
Sbjct  942   LIVYCFLPALSLFSGQFIVQTLNVTFLTYLLIITITLCLLAMLEIKWSGIALEEWWRNEQ  1001

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSK   +D +D +A+LY+VKWTSL I PL
Sbjct  1002  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKQVGDDVEDEFAELYIVKWTSLMIPPL  1061

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+++N+ A+ +G SR IYS IPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1062  TIIMINLVAIAVGFSRTIYSTIPQWSKLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1121

Query  156   YV  151
             YV
Sbjct  1122  YV  1123



>ref|XP_008658791.1| PREDICTED: cellulose synthase-like protein D1 [Zea mays]
 tpg|DAA46498.1| TPA: putative cellulose synthase-like family protein [Zea mays]
Length=1159

 Score =   386 bits (991),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 184/242 (76%), Positives = 212/242 (88%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN   AS ++K LQRIAY NVG+YPFTSIF
Sbjct  884   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALFASSKMKVLQRIAYLNVGIYPFTSIF  943

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLIITVTL L+++LE+KW+ I LEE WRNEQ
Sbjct  944   LIVYCFLPALSLFSGQFIVQTLNVTFLTYLLIITVTLCLLAMLEIKWSGIALEEWWRNEQ  1003

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSK   +D +D +A+LY+VKWTSL I PL
Sbjct  1004  FWLIGGTSAHLAAVLQGLLKVVAGIEISFTLTSKQVGDDVEDEFAELYIVKWTSLMIPPL  1063

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+++N+ A+ +G SR IYS IPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1064  TIIMINLVAIAVGFSRTIYSTIPQWSKLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1123

Query  156   YV  151
             YV
Sbjct  1124  YV  1125



>ref|XP_007043112.1| Cellulose synthase like D4 [Theobroma cacao]
 gb|EOX98943.1| Cellulose synthase like D4 [Theobroma cacao]
Length=1124

 Score =   385 bits (989),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 197/261 (75%), Positives = 228/261 (87%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  LASRRLK LQR+AY NVG+YPFTSIF
Sbjct  847   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASRRLKILQRLAYLNVGIYPFTSIF  906

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+   +GQFIV+TL+  FL YLLIIT+ L+ +++LEVKW+ IGLEE WRNEQ
Sbjct  907   LIVYCFLPALSLISGQFIVKTLNVTFLVYLLIITICLITLAILEVKWSGIGLEEWWRNEQ  966

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLI GTS+HLAA +QGLLKVIAGIEISFTLTSKSA ED DDIYADLY+VKWTSL I P+
Sbjct  967   FWLISGTSSHLAACIQGLLKVIAGIEISFTLTSKSAGEDSDDIYADLYLVKWTSLMIPPI  1026

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I ++NI AL I  SR +YS +PQW+K  GGAFFSFWVLAHLYPFAKGLMGR+ K PTIV
Sbjct  1027  VIAMINIIALAIAFSRTVYSSVPQWSKFMGGAFFSFWVLAHLYPFAKGLMGRRRKTPTIV  1086

Query  156   YVwtgllsittsllwiSVNPP  94
             +VW+GL++IT SLLWI++NPP
Sbjct  1087  FVWSGLIAITLSLLWIAINPP  1107



>ref|XP_010914015.1| PREDICTED: cellulose synthase-like protein D4 [Elaeis guineensis]
Length=1138

 Score =   385 bits (989),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 197/262 (75%), Positives = 230/262 (88%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  LAS RLKFLQR+AY NVG+YPFTSIF
Sbjct  864   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNALLASSRLKFLQRVAYLNVGIYPFTSIF  923

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  FTG FIV+TL   FL YLLIITV L+ I++LEVKW+ +GLEE+WRNEQ
Sbjct  924   LLVYCFLPALSLFTGHFIVRTLSVAFLVYLLIITVFLICIAILEVKWSGVGLEEIWRNEQ  983

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLI GTSAH  AV+QGLLKV+AGIEISFTLTSKSA +D +DIYADLY+VKWTSL I P+
Sbjct  984   FWLISGTSAHFYAVVQGLLKVMAGIEISFTLTSKSAGDDVEDIYADLYIVKWTSLMIPPI  1043

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VNI A+  G ++ +YS  P W+KL GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1044  TIMMVNIIAIAFGFAKTVYSETPNWSKLMGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1103

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GL++IT SLLWIS+NPP+
Sbjct  1104  FVWSGLIAITLSLLWISINPPE  1125



>ref|XP_006361262.1| PREDICTED: cellulose synthase-like protein D2-like [Solanum tuberosum]
Length=1137

 Score =   385 bits (988),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 191/261 (73%), Positives = 232/261 (89%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS ++K LQRIAY NVG+YPFTSIF
Sbjct  864   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASPKMKILQRIAYLNVGIYPFTSIF  923

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQ+L+  FL YLL+I++TL +++LLE+KW+ I LE+ WRNEQ
Sbjct  924   LIVYCFLPALSLFSGQFIVQSLNVTFLVYLLVISLTLCILALLEIKWSGIALEDWWRNEQ  983

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV QGLLKV+AGIEISFTLTSKS+ ++ DD +ADLYV+KWTSL I P+
Sbjct  984   FWLIGGTSAHLAAVFQGLLKVVAGIEISFTLTSKSSGDENDDAFADLYVIKWTSLMIPPI  1043

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYS IPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1044  TIMMVNLVAIAVGFSRTIYSTIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1103

Query  156   YVwtgllsittsllwiSVNPP  94
             +VW+GL++IT SLLW+++NPP
Sbjct  1104  FVWSGLIAITISLLWVAINPP  1124



>gb|AFZ78588.1| cellulose synthase-like protein [Populus tomentosa]
Length=958

 Score =   380 bits (977),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 202/262 (77%), Positives = 235/262 (90%), Gaps = 0/262 (0%)
 Frame = -3

Query  876  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
            FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LASRR+KFLQRIAY NVG+YPFTSIF
Sbjct  685  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASRRMKFLQRIAYLNVGIYPFTSIF  744

Query  696  LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
            L+VYCF+PA+  F+GQFIVQTL+  FL YLLIIT+TL L+++LE+KW+ I LEE WRNEQ
Sbjct  745  LIVYCFLPALSLFSGQFIVQTLNVTFLAYLLIITLTLCLLAVLEIKWSGIDLEEWWRNEQ  804

Query  516  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
            FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKS  +D DD +ADLYVVKWTSL I P+
Sbjct  805  FWLIGGTSAHLAAVLQGLLKVVAGIEISFTLTSKSGGDDVDDEFADLYVVKWTSLMIPPI  864

Query  336  TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
            TI++VN+ A+V+G SR IYSVIPQW++L GG FFSF VLAHLYPFAKGLMGR+G+ PTIV
Sbjct  865  TIMMVNLIAIVVGFSRTIYSVIPQWSRLLGGVFFSFRVLAHLYPFAKGLMGRRGRTPTIV  924

Query  156  YVwtgllsittsllwiSVNPPQ  91
            +VW+GL++IT SLLW+++NPP 
Sbjct  925  FVWSGLIAITISLLWVAINPPS  946



>gb|EYU45259.1| hypothetical protein MIMGU_mgv1a000454mg [Erythranthe guttata]
Length=1144

 Score =   384 bits (987),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 179/242 (74%), Positives = 212/242 (88%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS ++K LQRIAY NVG+YPFTS+F
Sbjct  871   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPKMKILQRIAYLNVGIYPFTSLF  930

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQ+L+  FL YLL+IT+TL  +++LE+KW+ I LEE WRNEQ
Sbjct  931   LIVYCFLPALSLFSGQFIVQSLNITFLVYLLVITLTLCALAVLEIKWSGINLEEWWRNEQ  990

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKS  ++ DD +ADLYV+KW+SL I P+
Sbjct  991   FWLIGGTSAHLAAVLQGLLKVVAGIEISFTLTSKSGGDENDDEFADLYVLKWSSLMIPPI  1050

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++ N+ A+ +G SR IYS IPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1051  TIMITNLIAIAVGVSRTIYSAIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1110

Query  156   YV  151
             YV
Sbjct  1111  YV  1112



>ref|XP_007201219.1| hypothetical protein PRUPE_ppa000490mg [Prunus persica]
 gb|EMJ02418.1| hypothetical protein PRUPE_ppa000490mg [Prunus persica]
Length=1131

 Score =   384 bits (986),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 197/261 (75%), Positives = 228/261 (87%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  LAS RLK LQR+AY NVGVYPFTSIF
Sbjct  855   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASMRLKLLQRLAYINVGVYPFTSIF  914

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  FTGQFIV  L+  FL YLL IT+ L+ ++LLEVKW+ IGLEE WRNEQ
Sbjct  915   LIVYCFLPALSLFTGQFIVANLNITFLIYLLTITICLISLALLEVKWSGIGLEEWWRNEQ  974

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLI GTSAHLAAV+QGLLKVIAGIEISFTLTSKSA EDE+D++ADLY+VKWTSL I P+
Sbjct  975   FWLISGTSAHLAAVVQGLLKVIAGIEISFTLTSKSAGEDENDVFADLYLVKWTSLMIPPI  1034

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I +VNI A+ +  SR++Y++ PQW K  GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1035  VIAMVNIIAIAVAFSREVYAINPQWAKFIGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1094

Query  156   YVwtgllsittsllwiSVNPP  94
             +VW+GL++IT SLLW++VNPP
Sbjct  1095  FVWSGLIAITLSLLWVAVNPP  1115



>ref|XP_004244666.1| PREDICTED: cellulose synthase-like protein D3 [Solanum lycopersicum]
Length=1137

 Score =   384 bits (986),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 191/261 (73%), Positives = 232/261 (89%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS ++K LQRIAY NVG+YPFTSIF
Sbjct  864   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASPKMKILQRIAYLNVGIYPFTSIF  923

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQ+L+  FL YLL+I++TL +++LLE+KW+ I LE+ WRNEQ
Sbjct  924   LIVYCFLPALSLFSGQFIVQSLNVTFLVYLLVISLTLCILALLEIKWSGIALEDWWRNEQ  983

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV QGLLKV+AGIEISFTLTSKS+ ++ DD +ADLYV+KWTSL I P+
Sbjct  984   FWLIGGTSAHLAAVFQGLLKVVAGIEISFTLTSKSSGDENDDEFADLYVIKWTSLMIPPI  1043

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYS IPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1044  TIMMVNLVAIAVGFSRTIYSTIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1103

Query  156   YVwtgllsittsllwiSVNPP  94
             +VW+GL++IT SLLW+++NPP
Sbjct  1104  FVWSGLIAITISLLWVAINPP  1124



>gb|KHN46458.1| Cellulose synthase-like protein D3 [Glycine soja]
Length=1037

 Score =   382 bits (981),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 195/261 (75%), Positives = 228/261 (87%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+KFLQRIAY NVG+YPFTSIF
Sbjct  764   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKFLQRIAYLNVGIYPFTSIF  823

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLL ITVTL ++++LE+KW+ I LEE WRNEQ
Sbjct  824   LIVYCFLPALSLFSGQFIVQTLNVTFLVYLLTITVTLCVLAVLEIKWSGIELEEWWRNEQ  883

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAG EI F LTSKSA +  DD +ADLY+VKWTS+ I P+
Sbjct  884   FWLIGGTSAHLAAVLQGLLKVIAGTEIPFALTSKSAGDVVDDEFADLYIVKWTSIMIPPI  943

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW++L GG FFSFWVL HLYPFAKGLMGR+G  PTIV
Sbjct  944   TIMMVNLIAIAVGVSRTIYSVIPQWSRLLGGVFFSFWVLTHLYPFAKGLMGRRGTTPTIV  1003

Query  156   YVwtgllsittsllwiSVNPP  94
             +VW+GL++IT SLLW+++NPP
Sbjct  1004  FVWSGLIAITISLLWVAINPP  1024



>ref|XP_002325817.2| cellulase synthase 3 family protein [Populus trichocarpa]
 gb|EEF00199.2| cellulase synthase 3 family protein [Populus trichocarpa]
Length=1143

 Score =   384 bits (986),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 203/262 (77%), Positives = 235/262 (90%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LASRR+KFLQRIAY NVG+YPFTSIF
Sbjct  870   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASRRMKFLQRIAYLNVGIYPFTSIF  929

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLIIT+TL L+++LE+KW+ I LEE WRNEQ
Sbjct  930   LIVYCFLPALSLFSGQFIVQTLNVTFLAYLLIITLTLCLLAVLEIKWSGIDLEEWWRNEQ  989

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKS  +D DD +ADLYVVKWTSL I P+
Sbjct  990   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSGGDDVDDEFADLYVVKWTSLMIPPI  1049

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1050  TIMMVNLIAIAVGFSRTIYSVIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1109

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GL++IT SLLW+++NPP 
Sbjct  1110  FVWSGLIAITISLLWVAINPPS  1131



>gb|ABI75158.1| cellulose synthase-like D8 [Physcomitrella patens]
Length=1138

 Score =   384 bits (985),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 182/242 (75%), Positives = 208/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS RLKFLQRIAY NVG+YPFTSIF
Sbjct  864   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASSRLKFLQRIAYLNVGIYPFTSIF  923

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  +TGQFIVQ L+  FL YLL IT++L  +++LEVKW+ I LEE WRNEQ
Sbjct  924   LLVYCFLPALSLYTGQFIVQNLNLAFLIYLLTITISLCSLAVLEVKWSGISLEEWWRNEQ  983

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW+IGGTSAHLAAV QG+LKV+AG+EISFTLTSKSA +DEDDIYADLY+VKWTSLFI P+
Sbjct  984   FWVIGGTSAHLAAVFQGILKVMAGVEISFTLTSKSAGDDEDDIYADLYIVKWTSLFIPPI  1043

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI + NI A+ +G SR IYS  P+W+KL GG FFS WVL HLYPF KGLMG+ GK PTI+
Sbjct  1044  TIGITNIVAIAVGVSRTIYSTNPEWSKLLGGVFFSLWVLMHLYPFFKGLMGKGGKTPTII  1103

Query  156   YV  151
             YV
Sbjct  1104  YV  1105



>emb|CDP14480.1| unnamed protein product [Coffea canephora]
Length=1137

 Score =   384 bits (985),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 197/262 (75%), Positives = 229/262 (87%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  LASRRLK LQR+AY NVG+YPFTS+F
Sbjct  859   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASRRLKLLQRLAYLNVGIYPFTSLF  918

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+   +G FIV+ L+  FL YLLIIT+ L+ +++LEVKW+ IGLE+ WRNEQ
Sbjct  919   LIVYCFLPALSLLSGHFIVKNLNVVFLVYLLIITICLISLAILEVKWSGIGLEDWWRNEQ  978

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV+QGLLKVIAGIEISFTLTSKSA ED DDIYADLY+VKWTSL I P+
Sbjct  979   FWLIGGTSAHLAAVVQGLLKVIAGIEISFTLTSKSAGEDNDDIYADLYLVKWTSLMIPPI  1038

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I +VNI A+V+  SR IYS  PQW+K  GGAFFSFWVLAHLYPFAKGLMGR+ K PTIV
Sbjct  1039  VIGMVNIIAMVVAFSRTIYSAEPQWSKFIGGAFFSFWVLAHLYPFAKGLMGRRRKTPTIV  1098

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GL++IT SLLWI++NPP+
Sbjct  1099  FVWSGLIAITLSLLWIAINPPK  1120



>ref|XP_009792052.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana sylvestris]
 ref|XP_009792111.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana sylvestris]
 ref|XP_009792178.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana sylvestris]
 ref|XP_009792246.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana sylvestris]
 ref|XP_009792313.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana sylvestris]
 ref|XP_009792363.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana sylvestris]
Length=1139

 Score =   383 bits (984),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 193/261 (74%), Positives = 231/261 (89%), Gaps = 1/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS ++K LQRIAY N G+YPFTSIF
Sbjct  867   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASPKMKILQRIAYLNCGIYPFTSIF  926

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLL+IT+TL  +++LE+KW+ I LEE WRNEQ
Sbjct  927   LIVYCFLPALSLFSGQFIVQTLNVTFLTYLLVITLTLCALAVLEIKWSGIALEEWWRNEQ  986

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKS+A D+DD +ADLY++KWTSL + P+
Sbjct  987   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSSA-DDDDEFADLYIIKWTSLMVPPI  1045

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++ N+ A+ +G SR IYS IPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1046  TIMITNLIAIAVGFSRTIYSTIPQWSRLLGGIFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1105

Query  156   YVwtgllsittsllwiSVNPP  94
             +VW+GL++IT SLLW+++NPP
Sbjct  1106  FVWSGLIAITISLLWVAINPP  1126



>ref|XP_010025659.1| PREDICTED: cellulose synthase-like protein D4 [Eucalyptus grandis]
 gb|KCW62371.1| hypothetical protein EUGRSUZ_H05010 [Eucalyptus grandis]
Length=1120

 Score =   382 bits (982),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 196/268 (73%), Positives = 233/268 (87%), Gaps = 0/268 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFS+NN  LASR+LKFLQR++Y NVGVYPFTSIF
Sbjct  845   FRGSAPINLTDRLHQVLRWATGSVEIFFSQNNALLASRKLKFLQRLSYINVGVYPFTSIF  904

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+G FIVQTL+  FL YLLIIT+ LM +++LEVKW+ + LEE WRNEQ
Sbjct  905   LIVYCFLPALSLFSGSFIVQTLNVTFLIYLLIITLCLMGLAILEVKWSGVALEEWWRNEQ  964

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLI GTSAHL AV+QGLLKV+AGIEISFTLTSKSAA++++DIYADLY+VKW+SL I P+
Sbjct  965   FWLISGTSAHLYAVVQGLLKVVAGIEISFTLTSKSAADEDEDIYADLYLVKWSSLMIPPI  1024

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I +VNI A+    SR IYS +PQW+K  GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1025  VIAMVNIIAIAFAFSRTIYSTVPQWSKFIGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1084

Query  156   YVwtgllsittsllwiSVNPPQDPRAAA  73
             +VW+GL++IT SLLWI+++PPQ   A A
Sbjct  1085  FVWSGLIAITISLLWIAIDPPQGGTAEA  1112



>ref|XP_003625939.1| Cellulose synthase-like protein D5 [Medicago truncatula]
Length=636

 Score =   370 bits (951),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 190/266 (71%), Positives = 227/266 (85%), Gaps = 1/266 (0%)
 Frame = -3

Query  876  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
            FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+KFLQR+AYFNVG+YPFTSIF
Sbjct  361  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKFLQRVAYFNVGMYPFTSIF  420

Query  696  LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
            L+VYCF+PA+  F+GQFIVQ+L   FL +LL ITVTL L++LLE+KW+ I L + WRNEQ
Sbjct  421  LIVYCFLPALSLFSGQFIVQSLSVTFLVFLLGITVTLCLLALLEIKWSGITLHDWWRNEQ  480

Query  516  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAA-EDEDDIYADLYVVKWTSLFIMP  340
            FWLIGGTSAH AAVLQGLLKVIAG++ISFTLTSKSA  ED +D +ADLY+VKW+ L + P
Sbjct  481  FWLIGGTSAHPAAVLQGLLKVIAGVDISFTLTSKSATPEDGEDEFADLYLVKWSFLMVPP  540

Query  339  LTILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTI  160
            +TI++VN  A+ +G +R +YS  PQW++L GG FFSFWVL HLYPFAKGL+GR+GKVPTI
Sbjct  541  ITIMMVNTIAIAVGVARTLYSPFPQWSRLVGGLFFSFWVLCHLYPFAKGLLGRRGKVPTI  600

Query  159  VYVwtgllsittsllwiSVNPPQDPR  82
            +YVW+GLLSI  S+LW+ +NPP   R
Sbjct  601  IYVWSGLLSIIISMLWVYINPPSGAR  626



>ref|XP_003540119.1| PREDICTED: cellulose synthase-like protein D3-like isoform X1 
[Glycine max]
 ref|XP_006592015.1| PREDICTED: cellulose synthase-like protein D3-like isoform X2 
[Glycine max]
Length=1141

 Score =   383 bits (983),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 195/261 (75%), Positives = 228/261 (87%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+KFLQRIAY NVG+YPFTSIF
Sbjct  868   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKFLQRIAYLNVGIYPFTSIF  927

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLL ITVTL ++++LE+KW+ I LEE WRNEQ
Sbjct  928   LIVYCFLPALSLFSGQFIVQTLNVTFLVYLLTITVTLCVLAVLEIKWSGIELEEWWRNEQ  987

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAG EI F LTSKSA +  DD +ADLY+VKWTS+ I P+
Sbjct  988   FWLIGGTSAHLAAVLQGLLKVIAGTEIPFALTSKSAGDVVDDEFADLYIVKWTSIMIPPI  1047

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW++L GG FFSFWVL HLYPFAKGLMGR+G  PTIV
Sbjct  1048  TIMMVNLIAIAVGVSRTIYSVIPQWSRLLGGVFFSFWVLTHLYPFAKGLMGRRGTTPTIV  1107

Query  156   YVwtgllsittsllwiSVNPP  94
             +VW+GL++IT SLLW+++NPP
Sbjct  1108  FVWSGLIAITISLLWVAINPP  1128



>ref|XP_006662106.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase-like protein 
D1-like [Oryza brachyantha]
Length=1125

 Score =   382 bits (982),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 181/242 (75%), Positives = 211/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN   AS ++K LQRIAY NVG+YPFTS+F
Sbjct  850   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALFASSKMKVLQRIAYLNVGIYPFTSVF  909

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIV+TL+  FL YLLIIT+TL L+++LE+KW+ I LEE WRNEQ
Sbjct  910   LIVYCFLPALSLFSGQFIVKTLNVTFLSYLLIITITLCLLAMLEIKWSGIALEEWWRNEQ  969

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV+QGLLKVIAGIEISFTLTSK   +D +D +A+LY VKWTSL I PL
Sbjct  970   FWLIGGTSAHLAAVMQGLLKVIAGIEISFTLTSKQVGDDVEDEFAELYAVKWTSLMIPPL  1029

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+++N+ A+ +G SR IYS IPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1030  TIIMINLVAIAVGFSRTIYSTIPQWSKLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1089

Query  156   YV  151
             YV
Sbjct  1090  YV  1091



>ref|XP_007153296.1| hypothetical protein PHAVU_003G023000g [Phaseolus vulgaris]
 gb|ESW25290.1| hypothetical protein PHAVU_003G023000g [Phaseolus vulgaris]
Length=970

 Score =   379 bits (973),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 200/269 (74%), Positives = 236/269 (88%), Gaps = 0/269 (0%)
 Frame = -3

Query  876  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
            FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN   ASRRLKFLQRI+Y NVG+YPFTS+F
Sbjct  699  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAIFASRRLKFLQRISYLNVGIYPFTSLF  758

Query  696  LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
            LVVYCFIPA+  F+GQFIV+ L+  FL YLL+IT+ L LISLLEVKW+ I LEE WRNEQ
Sbjct  759  LVVYCFIPALSLFSGQFIVEGLNVAFLVYLLLITICLTLISLLEVKWSGIALEEWWRNEQ  818

Query  516  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
            FW+IGGTSAHL AV+QGLLKV+AGIEISFTLTSKSA +++ D +ADLY+VKWTSLFIMPL
Sbjct  819  FWVIGGTSAHLVAVIQGLLKVVAGIEISFTLTSKSAGDEDVDDFADLYIVKWTSLFIMPL  878

Query  336  TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
            TIL++N+ ALV+G  R +YSVIP+WNKL G  FFSFWVL+H+YPFAKGLMG++G+VPTI+
Sbjct  879  TILIINLIALVMGFLRTVYSVIPEWNKLLGSMFFSFWVLSHMYPFAKGLMGKRGRVPTII  938

Query  156  YVwtgllsittsllwiSVNPPQDPRAAAS  70
            YVW+G+LSIT +LLWI+++PP D     S
Sbjct  939  YVWSGILSITIALLWITIDPPGDSMKKGS  967



>ref|XP_001764498.1| cellulose synthase-like D8, glycosyltransferase family 2 protein 
[Physcomitrella patens]
 gb|EDQ70765.1| cellulose synthase-like D8, glycosyltransferase family 2 protein 
[Physcomitrella patens]
Length=1169

 Score =   383 bits (984),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 182/242 (75%), Positives = 208/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS RLKFLQRIAY NVG+YPFTSIF
Sbjct  895   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASSRLKFLQRIAYLNVGIYPFTSIF  954

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  +TGQFIVQ L+  FL YLL IT++L  +++LEVKW+ I LEE WRNEQ
Sbjct  955   LLVYCFLPALSLYTGQFIVQNLNLAFLIYLLTITISLCSLAVLEVKWSGISLEEWWRNEQ  1014

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW+IGGTSAHLAAV QG+LKV+AG+EISFTLTSKSA +DEDDIYADLY+VKWTSLFI P+
Sbjct  1015  FWVIGGTSAHLAAVFQGILKVMAGVEISFTLTSKSAGDDEDDIYADLYIVKWTSLFIPPI  1074

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI + NI A+ +G SR IYS  P+W+KL GG FFS WVL HLYPF KGLMG+ GK PTI+
Sbjct  1075  TIGITNIVAIAVGVSRTIYSTNPEWSKLLGGVFFSLWVLMHLYPFFKGLMGKGGKTPTII  1134

Query  156   YV  151
             YV
Sbjct  1135  YV  1136



>gb|EMS51869.1| Cellulose synthase-like protein D1 [Triticum urartu]
Length=1150

 Score =   383 bits (983),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 183/240 (76%), Positives = 209/240 (87%), Gaps = 0/240 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN   AS ++K LQRIAY NVG+YPFTSIF
Sbjct  871   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALFASSKMKVLQRIAYLNVGIYPFTSIF  930

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLIITVTL L+++LE+KW+ I LEE WRNEQ
Sbjct  931   LIVYCFLPALSLFSGQFIVQTLNVTFLTYLLIITVTLCLLAMLEIKWSGIALEEWWRNEQ  990

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV+QGLLKV+AGIEISFTLTSK   +D DD +A+LY VKWTSL I PL
Sbjct  991   FWLIGGTSAHLAAVMQGLLKVVAGIEISFTLTSKQVGDDIDDEFAELYEVKWTSLMIPPL  1050

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYS IPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1051  TIIMVNLVAIAVGFSRTIYSTIPQWSKLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1110



>ref|XP_004245916.1| PREDICTED: cellulose synthase-like protein D3 [Solanum lycopersicum]
 ref|XP_010325578.1| PREDICTED: cellulose synthase-like protein D3 [Solanum lycopersicum]
Length=1139

 Score =   382 bits (982),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 193/261 (74%), Positives = 229/261 (88%), Gaps = 1/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS ++K LQRIAY N G+YPFTSIF
Sbjct  867   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASPKMKILQRIAYLNCGIYPFTSIF  926

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQ+L+  FL YLL+IT+TL  +++LE+KW+ I LEE WRNEQ
Sbjct  927   LIVYCFLPALSLFSGQFIVQSLNVTFLTYLLVITLTLCALAVLEIKWSGIALEEWWRNEQ  986

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSA  D+DD YADLY++KWTSL I P+
Sbjct  987   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAT-DDDDEYADLYIIKWTSLMIPPI  1045

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I++ N+ A+ +G SR IYS IPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1046  VIMMTNLIAIAVGVSRTIYSTIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1105

Query  156   YVwtgllsittsllwiSVNPP  94
             +VW+GL++IT SLLW+++NPP
Sbjct  1106  FVWSGLIAITISLLWVAINPP  1126



>ref|XP_001779999.1| cellulose synthase-like D5, glycosyltransferase family 2 [Physcomitrella 
patens]
 gb|ABI75155.1| cellulose synthase-like D5 [Physcomitrella patens]
 gb|EDQ55208.1| cellulose synthase-like D5, glycosyltransferase family 2 [Physcomitrella 
patens]
Length=1135

 Score =   382 bits (982),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 182/242 (75%), Positives = 208/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS RLKFLQRIAY NVG+YPFTSIF
Sbjct  861   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASSRLKFLQRIAYLNVGIYPFTSIF  920

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  +TGQFIVQ L+  FL YLL IT++L  +++LEVKW+ I LEE WRNEQ
Sbjct  921   LLVYCFLPALSLYTGQFIVQNLNLAFLIYLLTITISLCSLAVLEVKWSGISLEEWWRNEQ  980

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW+IGGTSAHLAAV QG+LKV+AG+EISFTLTSKSA +DEDDIYADLY+VKWTSLFI P+
Sbjct  981   FWVIGGTSAHLAAVFQGILKVMAGVEISFTLTSKSAGDDEDDIYADLYIVKWTSLFIPPI  1040

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI + NI A+ +G SR IYS  P+W+KL GG FFS WVL HLYPF KGLMG+ GK PTI+
Sbjct  1041  TIGITNIVAIAVGVSRTIYSPNPEWSKLLGGVFFSLWVLMHLYPFFKGLMGKGGKTPTII  1100

Query  156   YV  151
             YV
Sbjct  1101  YV  1102



>gb|KHN04843.1| Cellulose synthase-like protein D3 [Glycine soja]
Length=1100

 Score =   382 bits (980),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 182/242 (75%), Positives = 211/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS RLKFLQRIAY NVG+YPFTSIF
Sbjct  827   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASSRLKFLQRIAYLNVGIYPFTSIF  886

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  FTGQFIVQTL+  FL YLL IT+TL++++ LE+KW+ I LEE WRNEQ
Sbjct  887   LIVYCFVPALSLFTGQFIVQTLEVTFLVYLLGITLTLVILAALEIKWSGIELEEWWRNEQ  946

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKS  +DE+D +ADLYV+KWTSL I P+
Sbjct  947   FWLIGGTSAHLAAVLQGLLKVMAGIEISFTLTSKSGGDDENDEFADLYVIKWTSLMIPPI  1006

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +  SR IYS   +W+ L GG FFSFWVL+HLYPFAKGLMGR+G+ PTIV
Sbjct  1007  TIMMVNLIAIAVAVSRTIYSEDREWSSLLGGVFFSFWVLSHLYPFAKGLMGRRGRTPTIV  1066

Query  156   YV  151
             +V
Sbjct  1067  FV  1068



>ref|XP_002520032.1| Cellulose synthase A catalytic subunit 3 [UDP-forming], putative 
[Ricinus communis]
 gb|EEF42356.1| Cellulose synthase A catalytic subunit 3 [UDP-forming], putative 
[Ricinus communis]
Length=1143

 Score =   382 bits (981),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 199/263 (76%), Positives = 234/263 (89%), Gaps = 0/263 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQRIAY NVG+YPFTSIF
Sbjct  870   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKLLQRIAYLNVGIYPFTSIF  929

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLL+I++TL L++LLE+KW+ I LEE WRNEQ
Sbjct  930   LIVYCFLPALSLFSGQFIVQTLNVTFLVYLLVISLTLCLLALLEIKWSGIELEEWWRNEQ  989

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKSA +D DD +ADLYVVKWTSL I P+
Sbjct  990   FWLIGGTSAHLAAVLQGLLKVVAGIEISFTLTSKSAGDDVDDEFADLYVVKWTSLMIPPI  1049

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I++VN+ A+ +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1050  VIMMVNLIAIAVGFSRTIYSVIPQWSRLIGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1109

Query  156   YVwtgllsittsllwiSVNPPQD  88
             +VW+GL++IT SLLW+++NPP +
Sbjct  1110  FVWSGLIAITISLLWVAINPPSN  1132



>ref|XP_003517664.1| PREDICTED: cellulose synthase-like protein D2-like isoform X1 
[Glycine max]
 ref|XP_006572955.1| PREDICTED: cellulose synthase-like protein D2-like isoform X2 
[Glycine max]
Length=1118

 Score =   382 bits (980),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 182/242 (75%), Positives = 211/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS RLKFLQRIAY NVG+YPFTSIF
Sbjct  845   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASSRLKFLQRIAYLNVGIYPFTSIF  904

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  FTGQFIVQTL+  FL YLL IT+TL++++ LE+KW+ I LEE WRNEQ
Sbjct  905   LIVYCFVPALSLFTGQFIVQTLEVTFLVYLLGITLTLVILAALEIKWSGIELEEWWRNEQ  964

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKS  +DE+D +ADLYV+KWTSL I P+
Sbjct  965   FWLIGGTSAHLAAVLQGLLKVMAGIEISFTLTSKSGGDDENDEFADLYVIKWTSLMIPPI  1024

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +  SR IYS   +W+ L GG FFSFWVL+HLYPFAKGLMGR+G+ PTIV
Sbjct  1025  TIMMVNLIAIAVAVSRTIYSEDREWSSLLGGVFFSFWVLSHLYPFAKGLMGRRGRTPTIV  1084

Query  156   YV  151
             +V
Sbjct  1085  FV  1086



>ref|XP_007153294.1| hypothetical protein PHAVU_003G023000g [Phaseolus vulgaris]
 gb|ESW25288.1| hypothetical protein PHAVU_003G023000g [Phaseolus vulgaris]
Length=992

 Score =   379 bits (973),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 200/269 (74%), Positives = 236/269 (88%), Gaps = 0/269 (0%)
 Frame = -3

Query  876  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
            FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN   ASRRLKFLQRI+Y NVG+YPFTS+F
Sbjct  721  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAIFASRRLKFLQRISYLNVGIYPFTSLF  780

Query  696  LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
            LVVYCFIPA+  F+GQFIV+ L+  FL YLL+IT+ L LISLLEVKW+ I LEE WRNEQ
Sbjct  781  LVVYCFIPALSLFSGQFIVEGLNVAFLVYLLLITICLTLISLLEVKWSGIALEEWWRNEQ  840

Query  516  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
            FW+IGGTSAHL AV+QGLLKV+AGIEISFTLTSKSA +++ D +ADLY+VKWTSLFIMPL
Sbjct  841  FWVIGGTSAHLVAVIQGLLKVVAGIEISFTLTSKSAGDEDVDDFADLYIVKWTSLFIMPL  900

Query  336  TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
            TIL++N+ ALV+G  R +YSVIP+WNKL G  FFSFWVL+H+YPFAKGLMG++G+VPTI+
Sbjct  901  TILIINLIALVMGFLRTVYSVIPEWNKLLGSMFFSFWVLSHMYPFAKGLMGKRGRVPTII  960

Query  156  YVwtgllsittsllwiSVNPPQDPRAAAS  70
            YVW+G+LSIT +LLWI+++PP D     S
Sbjct  961  YVWSGILSITIALLWITIDPPGDSMKKGS  989



>ref|XP_009607206.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana tomentosiformis]
 ref|XP_009607207.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana tomentosiformis]
 ref|XP_009607208.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana tomentosiformis]
 ref|XP_009607209.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana tomentosiformis]
 ref|XP_009607210.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana tomentosiformis]
 ref|XP_009607211.1| PREDICTED: cellulose synthase-like protein D3 [Nicotiana tomentosiformis]
Length=1139

 Score =   382 bits (981),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 192/261 (74%), Positives = 231/261 (89%), Gaps = 1/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS ++K LQRIAY N G+YPFTSIF
Sbjct  867   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASPKMKILQRIAYLNCGIYPFTSIF  926

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLL+IT+TL  +++LE+KW+ I LEE WRNEQ
Sbjct  927   LIVYCFLPALSLFSGQFIVQTLNVTFLTYLLVITLTLCALAVLEIKWSGIALEEWWRNEQ  986

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKS+A D+DD +ADLY++KWTSL + P+
Sbjct  987   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSSA-DDDDEFADLYIIKWTSLMVPPI  1045

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++ N+ A+ +G SR IYS IPQW++L GG FFSFWVLAHLYPF+KGLMGR+G+ PTIV
Sbjct  1046  TIMITNLIAIAVGFSRTIYSTIPQWSRLLGGVFFSFWVLAHLYPFSKGLMGRRGRTPTIV  1105

Query  156   YVwtgllsittsllwiSVNPP  94
             +VW+GL++IT SLLW+++NPP
Sbjct  1106  FVWSGLIAITISLLWVAINPP  1126



>ref|XP_007158244.1| hypothetical protein PHAVU_002G136300g [Phaseolus vulgaris]
 gb|ESW30238.1| hypothetical protein PHAVU_002G136300g [Phaseolus vulgaris]
Length=1117

 Score =   382 bits (980),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 183/242 (76%), Positives = 211/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS RLKFLQRIAY NVG+YPFTSIF
Sbjct  843   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASSRLKFLQRIAYLNVGIYPFTSIF  902

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  FT QFIVQ+L   FL YLL IT+TL+++++LE+KW+ I LEE WRNEQ
Sbjct  903   LIVYCFLPALSLFTDQFIVQSLQVNFLVYLLGITLTLVILAVLEIKWSGIALEEWWRNEQ  962

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKS+ +DE+D YADLYV+KWTSL I P+
Sbjct  963   FWLIGGTSAHLAAVLQGLLKVMAGIEISFTLTSKSSGDDENDEYADLYVLKWTSLMIPPI  1022

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +  SR IYS   QW+ L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1023  TIMMVNLIAIAVAVSRTIYSEDRQWSSLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1082

Query  156   YV  151
             +V
Sbjct  1083  FV  1084



>ref|XP_003612797.1| Cellulose synthase-like protein [Medicago truncatula]
 gb|AES95755.1| cellulose synthase-like protein [Medicago truncatula]
Length=1121

 Score =   382 bits (980),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 194/261 (74%), Positives = 226/261 (87%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LA+ RLKFLQRIAY NVG+YPFTS F
Sbjct  848   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAILANSRLKFLQRIAYLNVGIYPFTSFF  907

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  FTGQFIVQ+L   FL YLL ITVTL+L+++LE+KW+ I LEE WRNEQ
Sbjct  908   LIVYCFLPALSLFTGQFIVQSLQVTFLIYLLGITVTLILLAILEIKWSGIELEEWWRNEQ  967

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAH AAVLQGLLKVIAGIEISFTLTSKS+ +DE+D YADLY++KW+SL I PL
Sbjct  968   FWLIGGTSAHFAAVLQGLLKVIAGIEISFTLTSKSSGDDENDEYADLYIIKWSSLMIPPL  1027

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+    SR IYS   QW+ L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1028  TIMMVNLIAIATAVSRTIYSDDRQWSSLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1087

Query  156   YVwtgllsittsllwiSVNPP  94
             +VW+ L+SIT SLLW++++PP
Sbjct  1088  FVWSALISITISLLWVAIDPP  1108



>ref|XP_006656942.1| PREDICTED: putative cellulose synthase-like protein D5-like [Oryza 
brachyantha]
Length=828

 Score =   375 bits (962),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 200/263 (76%), Positives = 236/263 (90%), Gaps = 0/263 (0%)
 Frame = -3

Query  876  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
            FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN  LASRRLKFLQR+AY NVG+YPFTS+F
Sbjct  557  FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNALLASRRLKFLQRMAYLNVGIYPFTSLF  616

Query  696  LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
            L++YC +PA+  F+GQFIV TLD  FLCYLL+ITVTLML+ LLEVKW+ IGLEE WRNEQ
Sbjct  617  LIMYCLLPALSLFSGQFIVATLDPTFLCYLLLITVTLMLLCLLEVKWSGIGLEEWWRNEQ  676

Query  516  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
            FW+IGGTSAHLAAVLQGLLKV+AGIEISFTLT+K+AA+D+DD +A+LY++KWTSLFI PL
Sbjct  677  FWVIGGTSAHLAAVLQGLLKVVAGIEISFTLTAKAAADDDDDPFAELYLIKWTSLFIPPL  736

Query  336  TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             ++ +NI ALV+G SR +Y+ IPQ++KL GG FFSFWVLAH YPFAKGLMGR+G+ PTIV
Sbjct  737  AVIGINIIALVVGVSRTVYAEIPQYSKLLGGGFFSFWVLAHYYPFAKGLMGRRGRTPTIV  796

Query  156  YVwtgllsittsllwiSVNPPQD  88
            YVW GL+SIT SLLWI+++PP D
Sbjct  797  YVWAGLISITVSLLWITISPPDD  819



>ref|XP_007153295.1| hypothetical protein PHAVU_003G023000g [Phaseolus vulgaris]
 gb|ESW25289.1| hypothetical protein PHAVU_003G023000g [Phaseolus vulgaris]
Length=986

 Score =   379 bits (972),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 200/269 (74%), Positives = 236/269 (88%), Gaps = 0/269 (0%)
 Frame = -3

Query  876  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
            FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN   ASRRLKFLQRI+Y NVG+YPFTS+F
Sbjct  715  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAIFASRRLKFLQRISYLNVGIYPFTSLF  774

Query  696  LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
            LVVYCFIPA+  F+GQFIV+ L+  FL YLL+IT+ L LISLLEVKW+ I LEE WRNEQ
Sbjct  775  LVVYCFIPALSLFSGQFIVEGLNVAFLVYLLLITICLTLISLLEVKWSGIALEEWWRNEQ  834

Query  516  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
            FW+IGGTSAHL AV+QGLLKV+AGIEISFTLTSKSA +++ D +ADLY+VKWTSLFIMPL
Sbjct  835  FWVIGGTSAHLVAVIQGLLKVVAGIEISFTLTSKSAGDEDVDDFADLYIVKWTSLFIMPL  894

Query  336  TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
            TIL++N+ ALV+G  R +YSVIP+WNKL G  FFSFWVL+H+YPFAKGLMG++G+VPTI+
Sbjct  895  TILIINLIALVMGFLRTVYSVIPEWNKLLGSMFFSFWVLSHMYPFAKGLMGKRGRVPTII  954

Query  156  YVwtgllsittsllwiSVNPPQDPRAAAS  70
            YVW+G+LSIT +LLWI+++PP D     S
Sbjct  955  YVWSGILSITIALLWITIDPPGDSMKKGS  983



>ref|XP_006376007.1| cellulase synthase 3 family protein [Populus trichocarpa]
 gb|AFZ78589.1| cellulose synthase-like protein [Populus tomentosa]
 gb|ERP53804.1| cellulase synthase 3 family protein [Populus trichocarpa]
Length=1143

 Score =   382 bits (980),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 202/262 (77%), Positives = 235/262 (90%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+KFLQRIAY NVG+YPFTSIF
Sbjct  870   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKFLQRIAYLNVGIYPFTSIF  929

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLIIT+TL L+++LE+KW+ I LEE WRNEQ
Sbjct  930   LIVYCFLPALSLFSGQFIVQTLNVTFLAYLLIITLTLCLLAVLEIKWSGIELEEWWRNEQ  989

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKSA +D DD +ADLYVVKWTSL I P+
Sbjct  990   FWLIGGTSAHLAAVLQGLLKVVAGIEISFTLTSKSAGDDVDDEFADLYVVKWTSLMIPPI  1049

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1050  TIMMVNLIAIAVGFSRTIYSVIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1109

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GL++IT SLLW+++NPP 
Sbjct  1110  FVWSGLIAITISLLWVAINPPS  1131



>ref|XP_010276804.1| PREDICTED: cellulose synthase-like protein D3 [Nelumbo nucifera]
 ref|XP_010276805.1| PREDICTED: cellulose synthase-like protein D3 [Nelumbo nucifera]
Length=1151

 Score =   382 bits (980),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 198/262 (76%), Positives = 234/262 (89%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+KFLQRIAY NVG+YPFTSIF
Sbjct  878   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKFLQRIAYLNVGIYPFTSIF  937

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLL ITVTL ++++LE++W+ I LEE WRNEQ
Sbjct  938   LIVYCFLPALSLFSGQFIVQTLNVTFLVYLLTITVTLCMLAILEIRWSGIELEEWWRNEQ  997

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKSA +D DD +ADLY+VKWTSL I P+
Sbjct  998   FWLIGGTSAHLAAVLQGLLKVVAGIEISFTLTSKSAGDDVDDEFADLYIVKWTSLMIPPI  1057

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+++N+ A+ +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1058  TIMIINLIAIAVGVSRTIYSVIPQWSRLIGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1117

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GL++IT SLLW+++NPP 
Sbjct  1118  FVWSGLIAITISLLWVAINPPS  1139



>ref|XP_002280032.1| PREDICTED: cellulose synthase-like protein D4 [Vitis vinifera]
Length=1116

 Score =   381 bits (978),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 195/270 (72%), Positives = 234/270 (87%), Gaps = 0/270 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  LASR+LKFLQR+AY NVG+YPFTS+F
Sbjct  841   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASRKLKFLQRLAYLNVGIYPFTSMF  900

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+   +G FIVQTL+  FL YLL I++ L+L+++LEVKW+ +GLE+ WRNEQ
Sbjct  901   LVVYCFLPALSLLSGHFIVQTLNIAFLLYLLTISICLILLAILEVKWSGVGLEDWWRNEQ  960

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLI GTSAHLAAV+QGLLKVIAGIEISFTLTSKS+ ++ +DIYA+LY+VKWTSL I P+
Sbjct  961   FWLISGTSAHLAAVVQGLLKVIAGIEISFTLTSKSSGDENEDIYAELYLVKWTSLMIPPI  1020

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I ++NI A+ +  SR IYS IPQW+K  GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1021  VIGMMNILAIAVAFSRTIYSAIPQWSKFIGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1080

Query  156   YVwtgllsittsllwiSVNPPQDPRAAASN  67
             +VW+GL++IT SLLWIS+NPP+   +A  N
Sbjct  1081  FVWSGLIAITLSLLWISINPPKGATSATLN  1110



>ref|XP_006432701.1| hypothetical protein CICLE_v10000098mg [Citrus clementina]
 ref|XP_006471489.1| PREDICTED: cellulose synthase-like protein D3-like isoform X3 
[Citrus sinensis]
 ref|XP_006471490.1| PREDICTED: cellulose synthase-like protein D3-like isoform X4 
[Citrus sinensis]
 ref|XP_006471491.1| PREDICTED: cellulose synthase-like protein D3-like isoform X5 
[Citrus sinensis]
 ref|XP_006471492.1| PREDICTED: cellulose synthase-like protein D3-like isoform X6 
[Citrus sinensis]
 gb|ESR45941.1| hypothetical protein CICLE_v10000098mg [Citrus clementina]
Length=1103

 Score =   380 bits (976),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 195/262 (74%), Positives = 222/262 (85%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             F GTAPINLTDRLHQVLRWATGSVEIFFSRNN  L S RLK LQRIAY NVG+YPFTSIF
Sbjct  830   FHGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLGSSRLKLLQRIAYLNVGIYPFTSIF  889

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YL  ITVTL L+++LEVKW+ I LEE WRNEQ
Sbjct  890   LIVYCFLPALSLFSGQFIVQTLNVTFLVYLFAITVTLSLLAVLEVKWSGIDLEEWWRNEQ  949

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAH  AVLQGLLKVIAGIEISFTLTSKS  ED DD +ADLY+ KWTSL I PL
Sbjct  950   FWLIGGTSAHFVAVLQGLLKVIAGIEISFTLTSKSVGEDVDDEFADLYIFKWTSLMIPPL  1009

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +  SR IYS  PQW++L GG FFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1010  TIIMVNLIAIAVAVSRTIYSAEPQWSQLVGGVFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1069

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GLL++  SLLW+++NPP 
Sbjct  1070  FVWSGLLAVCISLLWVAINPPS  1091



>ref|XP_003589804.1| Cellulose synthase D-like protein [Medicago truncatula]
Length=1104

 Score =   380 bits (976),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 180/242 (74%), Positives = 210/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFS+NN  LAS+RLK LQR+AY NVG+YPFTS+F
Sbjct  836   FRGSAPINLTDRLHQVLRWATGSVEIFFSKNNAFLASKRLKLLQRLAYLNVGIYPFTSLF  895

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  FTG FIVQTL   FL YLL++TV L+ +++LEVKW+ + LE+ WRNEQ
Sbjct  896   LIVYCFLPALSLFTGYFIVQTLSVAFLIYLLLMTVCLVALAILEVKWSGVELEQWWRNEQ  955

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLI GTSAHLAAV+QGLLKVIAGIEISFTLT+KS  ED+DDIYADLY+VKWTSL I P+
Sbjct  956   FWLISGTSAHLAAVIQGLLKVIAGIEISFTLTTKSGGEDDDDIYADLYIVKWTSLMIPPI  1015

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I +VN+ A+ +  SR IYS +PQW+K  GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1016  VIAMVNVIAIGVAFSRTIYSAVPQWSKFIGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1075

Query  156   YV  151
             YV
Sbjct  1076  YV  1077



>ref|XP_006471487.1| PREDICTED: cellulose synthase-like protein D3-like isoform X1 
[Citrus sinensis]
 ref|XP_006471488.1| PREDICTED: cellulose synthase-like protein D3-like isoform X2 
[Citrus sinensis]
Length=1115

 Score =   380 bits (976),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 195/262 (74%), Positives = 222/262 (85%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             F GTAPINLTDRLHQVLRWATGSVEIFFSRNN  L S RLK LQRIAY NVG+YPFTSIF
Sbjct  842   FHGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLGSSRLKLLQRIAYLNVGIYPFTSIF  901

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YL  ITVTL L+++LEVKW+ I LEE WRNEQ
Sbjct  902   LIVYCFLPALSLFSGQFIVQTLNVTFLVYLFAITVTLSLLAVLEVKWSGIDLEEWWRNEQ  961

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAH  AVLQGLLKVIAGIEISFTLTSKS  ED DD +ADLY+ KWTSL I PL
Sbjct  962   FWLIGGTSAHFVAVLQGLLKVIAGIEISFTLTSKSVGEDVDDEFADLYIFKWTSLMIPPL  1021

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +  SR IYS  PQW++L GG FFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1022  TIIMVNLIAIAVAVSRTIYSAEPQWSQLVGGVFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1081

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GLL++  SLLW+++NPP 
Sbjct  1082  FVWSGLLAVCISLLWVAINPPS  1103



>ref|XP_011077183.1| PREDICTED: cellulose synthase-like protein D4 [Sesamum indicum]
Length=1120

 Score =   380 bits (976),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 195/272 (72%), Positives = 231/272 (85%), Gaps = 7/272 (3%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  L S ++K LQR+AY NVG+YPFTSIF
Sbjct  846   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNALLGSTKIKVLQRLAYLNVGIYPFTSIF  905

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTLD  FL  LL I++ L+ ++LLEVKW+ +GLEE WRNEQ
Sbjct  906   LIVYCFLPALSLFSGQFIVQTLDVAFLALLLTISLCLVGLALLEVKWSGVGLEEWWRNEQ  965

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLI GTSAHLAAV+QGLLKVIAGIEISFTLTSKSA +D DDIYADLY+VKWTSL I P+
Sbjct  966   FWLISGTSAHLAAVVQGLLKVIAGIEISFTLTSKSAGDDVDDIYADLYLVKWTSLMIPPI  1025

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I ++NI A+V+  SR IY  +PQW+K  GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1026  VIGMINIIAIVVAFSRTIYEQVPQWSKFIGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1085

Query  156   YVwtgllsittsllwiSVNPPQDPRAAASNED  61
             +VW+GL++IT SLL++++NP       ASN+D
Sbjct  1086  FVWSGLIAITLSLLYVAINP-------ASNQD  1110



>ref|XP_011007166.1| PREDICTED: cellulose synthase-like protein D3 [Populus euphratica]
 ref|XP_011007167.1| PREDICTED: cellulose synthase-like protein D3 [Populus euphratica]
 ref|XP_011007168.1| PREDICTED: cellulose synthase-like protein D3 [Populus euphratica]
 ref|XP_011007169.1| PREDICTED: cellulose synthase-like protein D3 [Populus euphratica]
 ref|XP_011007170.1| PREDICTED: cellulose synthase-like protein D3 [Populus euphratica]
 ref|XP_011007171.1| PREDICTED: cellulose synthase-like protein D3 [Populus euphratica]
Length=1143

 Score =   380 bits (977),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 202/262 (77%), Positives = 234/262 (89%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+KFLQRIAY NVG+YPFTSIF
Sbjct  870   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASTRMKFLQRIAYLNVGIYPFTSIF  929

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLIIT+TL L+++LE+KW+ I LEE WRNEQ
Sbjct  930   LIVYCFLPALSLFSGQFIVQTLNVTFLAYLLIITLTLCLLAVLEIKWSGIELEEWWRNEQ  989

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKS  +D DD +ADLYVVKWTSL I P+
Sbjct  990   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSGGDDVDDEFADLYVVKWTSLMIPPI  1049

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1050  TIMMVNLIAIAVGFSRTIYSVIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1109

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GL++IT SLLW+++NPP 
Sbjct  1110  FVWSGLIAITISLLWVAINPPS  1131



>ref|XP_004487933.1| PREDICTED: cellulose synthase-like protein D1-like [Cicer arietinum]
Length=1047

 Score =   379 bits (972),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 208/270 (77%), Positives = 239/270 (89%), Gaps = 0/270 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN   A+RRLKFLQRIAY NVG+YPFTSIF
Sbjct  775   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAIFATRRLKFLQRIAYLNVGIYPFTSIF  834

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+  F+GQFIVQ L+  FL YLL+I++ L LISLLEVKW+ IGLEE WRNEQ
Sbjct  835   LVVYCFLPALSLFSGQFIVQGLNVAFLTYLLLISICLSLISLLEVKWSGIGLEEWWRNEQ  894

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW+IGGTSAHL AV+QGLLKVIAGIEISFTLTSKSA +D DDIYADLY+VKWTSLFIMPL
Sbjct  895   FWVIGGTSAHLVAVVQGLLKVIAGIEISFTLTSKSAGDDVDDIYADLYIVKWTSLFIMPL  954

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+++NI AL++G  R +YS+IPQWNKL G  FFSFWVL+H+YPFAKGLMGR+G+VPTI+
Sbjct  955   TIIIINIVALIMGFLRTVYSIIPQWNKLMGSMFFSFWVLSHMYPFAKGLMGRRGRVPTII  1014

Query  156   YVwtgllsittsllwiSVNPPQDPRAAASN  67
             YVW+GLLSIT +LLWIS++PP D  A   +
Sbjct  1015  YVWSGLLSITIALLWISIDPPTDTAAGGGS  1044



>ref|XP_001781718.1| cellulose synthase-like D6, glycosyltransferase family 2 protein 
[Physcomitrella patens]
 gb|ABI75156.1| cellulose synthase-like D6 [Physcomitrella patens]
 gb|EDQ53447.1| cellulose synthase-like D6, glycosyltransferase family 2 protein 
[Physcomitrella patens]
Length=1165

 Score =   381 bits (978),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 192/262 (73%), Positives = 225/262 (86%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS RLKFLQRIAY NVG+YPFTSIF
Sbjct  891   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRLKFLQRIAYLNVGIYPFTSIF  950

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+  F+GQFIV  L+  FL YLL ITVTL L+++LEVKW+ I LEE WRNEQ
Sbjct  951   LVVYCFLPALSLFSGQFIVYQLNITFLVYLLTITVTLCLLAILEVKWSGITLEEWWRNEQ  1010

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW+IGGTSAHLAAV QG LKVIAG++ISFTLTSKS  ++E D +ADLYVVKW++L I P+
Sbjct  1011  FWVIGGTSAHLAAVFQGFLKVIAGVDISFTLTSKSGGDEEGDEFADLYVVKWSALMIPPI  1070

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++ N  A+ +G SRQIYS IP+W+KL GG FFS WVL+HLYPFAKGLMGR+G+ PTIV
Sbjct  1071  TIMITNAVAIAVGTSRQIYSTIPEWSKLIGGVFFSLWVLSHLYPFAKGLMGRRGRTPTIV  1130

Query  156   YVwtgllsittsllwiSVNPPQ  91
             YVW+GLLS+  SL+W+ ++PPQ
Sbjct  1131  YVWSGLLSVIISLMWVYISPPQ  1152



>ref|XP_008235918.1| PREDICTED: cellulose synthase-like protein D4 [Prunus mume]
Length=1131

 Score =   380 bits (977),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 195/261 (75%), Positives = 227/261 (87%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  LAS RLK LQR+AY NVGVYPFTSIF
Sbjct  855   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASMRLKLLQRLAYINVGVYPFTSIF  914

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  FTGQFIV  L+  FL YLL IT+ L+ ++LLEVKW+ IGLEE WRNEQ
Sbjct  915   LIVYCFLPALSLFTGQFIVANLNITFLVYLLTITICLISLALLEVKWSGIGLEEWWRNEQ  974

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLI GTSAHLAAV+QGLLKVIAGIEISFTLTSKSA +DE+D +ADLY+VKWTSL I P+
Sbjct  975   FWLISGTSAHLAAVVQGLLKVIAGIEISFTLTSKSAGDDENDAFADLYLVKWTSLMIPPI  1034

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I +VNI A+ +  SR++Y++ PQW K  GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1035  VIAMVNIIAIAVAFSREVYALNPQWAKFIGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1094

Query  156   YVwtgllsittsllwiSVNPP  94
             +VW+GL++IT SLLW+++NPP
Sbjct  1095  FVWSGLIAITLSLLWVAINPP  1115



>ref|XP_002313568.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEE87523.1| cellulose synthase family protein [Populus trichocarpa]
Length=1116

 Score =   380 bits (976),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/242 (76%), Positives = 208/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  LASRRLK LQR AY NVG+YPFTSIF
Sbjct  840   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASRRLKLLQRFAYLNVGIYPFTSIF  899

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+G FIVQTLD  FL YLL+IT+ L+++++LEVKW+ I LEE WRNEQ
Sbjct  900   LIVYCFLPALSLFSGYFIVQTLDVAFLIYLLLITICLVVLAILEVKWSGIELEEWWRNEQ  959

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLI GTSAH AAV+QGLLKVIAGIEISFTLTSKSA ++ DDIYADLY+VKWTSL IMP+
Sbjct  960   FWLISGTSAHFAAVMQGLLKVIAGIEISFTLTSKSAGDEVDDIYADLYLVKWTSLMIMPI  1019

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I + NI A+     R IYS +PQW+K  GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1020  VIAMTNIIAMAFAFIRTIYSTVPQWSKFVGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1079

Query  156   YV  151
             +V
Sbjct  1080  FV  1081



>ref|XP_001769175.1| cellulose synthase-like D4, glycosyltransferase family 2 protein 
[Physcomitrella patens]
 gb|EDQ66047.1| cellulose synthase-like D4, glycosyltransferase family 2 protein 
[Physcomitrella patens]
Length=1169

 Score =   381 bits (978),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 194/268 (72%), Positives = 226/268 (84%), Gaps = 0/268 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS RLKFLQRIAY NVG+YPFTSIF
Sbjct  896   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASSRLKFLQRIAYLNVGIYPFTSIF  955

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  +TGQFIVQ L+  FL YLL IT+TL  +++LEVKW+ I LEE WRNEQ
Sbjct  956   LLVYCFLPALSLYTGQFIVQNLNLSFLIYLLTITITLFALAVLEVKWSGISLEEWWRNEQ  1015

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW+IGGTSAHLAAV QGLLKV+AG++ISFTLTSKSA EDEDDIYADLY+VKW+SLFI P+
Sbjct  1016  FWVIGGTSAHLAAVFQGLLKVMAGVDISFTLTSKSAGEDEDDIYADLYIVKWSSLFIPPI  1075

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI + N+ A+ +G SR IY+  P+W+KL GG FFS WVL HLYPF KGLMG+ GK PTIV
Sbjct  1076  TIGLTNMVAIAVGISRTIYATNPEWSKLLGGVFFSLWVLLHLYPFFKGLMGKGGKTPTIV  1135

Query  156   YVwtgllsittsllwiSVNPPQDPRAAA  73
             +VW GLLS+  SLLW+ ++P  D  AA+
Sbjct  1136  FVWAGLLSVIISLLWVYISPSNDSTAAS  1163



>gb|ACM89779.1| truncated cellulose synthase [Gossypium hirsutum]
Length=441

 Score =   362 bits (928),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 184/242 (76%), Positives = 206/242 (85%), Gaps = 0/242 (0%)
 Frame = -3

Query  876  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
            FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  L S RLKFLQRIAY NVG+YPFTSIF
Sbjct  168  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLGSPRLKFLQRIAYLNVGIYPFTSIF  227

Query  696  LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
            L+VYCF+PA+  F+ QFIVQTL+  FL YLL IT TL  +++LE+KW+ I LEE WRNEQ
Sbjct  228  LIVYCFLPALSLFSDQFIVQTLNVTFLVYLLAITQTLCALAVLEIKWSGIELEEWWRNEQ  287

Query  516  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
            FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSA +D DD +ADLY+ KWTSL I PL
Sbjct  288  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAGDDVDDDFADLYIFKWTSLMIPPL  347

Query  336  TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
            TI+ VN+ A+  G  R +YS +P+W+ L GG FFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  348  TIIFVNLIAIAYGVLRTVYSDVPEWSHLLGGVFFSFWVLAHLYPFAKGLMGRRGKTPTIV  407

Query  156  YV  151
            YV
Sbjct  408  YV  409



>gb|AFZ78591.1| cellulose synthase-like protein [Populus tomentosa]
Length=1115

 Score =   380 bits (975),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 182/242 (75%), Positives = 209/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  LA+RRLK LQR+AY NVG+YPFTSIF
Sbjct  839   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNAFLATRRLKMLQRLAYLNVGIYPFTSIF  898

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+G FIVQTLD  FL YLL+IT+ L+++++LEVKW+ I LEE WRNEQ
Sbjct  899   LIVYCFLPALSLFSGYFIVQTLDVAFLIYLLLITICLIVLAILEVKWSGIELEEWWRNEQ  958

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLI GTSAH AAV+QGLLKVIAGIEISFTLTSKSA ++ DDIYADLY+VKWTSL IMP+
Sbjct  959   FWLISGTSAHFAAVMQGLLKVIAGIEISFTLTSKSAGDEVDDIYADLYLVKWTSLMIMPI  1018

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I + NI A+     R IYS +PQW+K  GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1019  VIAMTNIIAMAFAFIRTIYSTVPQWSKFVGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1078

Query  156   YV  151
             +V
Sbjct  1079  FV  1080



>gb|AES60055.2| cellulose synthase-like protein [Medicago truncatula]
Length=1133

 Score =   380 bits (976),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 180/242 (74%), Positives = 210/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFS+NN  LAS+RLK LQR+AY NVG+YPFTS+F
Sbjct  858   FRGSAPINLTDRLHQVLRWATGSVEIFFSKNNAFLASKRLKLLQRLAYLNVGIYPFTSLF  917

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  FTG FIVQTL   FL YLL++TV L+ +++LEVKW+ + LE+ WRNEQ
Sbjct  918   LIVYCFLPALSLFTGYFIVQTLSVAFLIYLLLMTVCLVALAILEVKWSGVELEQWWRNEQ  977

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLI GTSAHLAAV+QGLLKVIAGIEISFTLT+KS  ED+DDIYADLY+VKWTSL I P+
Sbjct  978   FWLISGTSAHLAAVIQGLLKVIAGIEISFTLTTKSGGEDDDDIYADLYIVKWTSLMIPPI  1037

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I +VN+ A+ +  SR IYS +PQW+K  GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1038  VIAMVNVIAIGVAFSRTIYSAVPQWSKFIGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1097

Query  156   YV  151
             YV
Sbjct  1098  YV  1099



>ref|XP_011075792.1| PREDICTED: cellulose synthase-like protein D3 [Sesamum indicum]
 ref|XP_011075793.1| PREDICTED: cellulose synthase-like protein D3 [Sesamum indicum]
 ref|XP_011075794.1| PREDICTED: cellulose synthase-like protein D3 [Sesamum indicum]
 ref|XP_011075795.1| PREDICTED: cellulose synthase-like protein D3 [Sesamum indicum]
Length=1148

 Score =   380 bits (975),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 199/271 (73%), Positives = 235/271 (87%), Gaps = 5/271 (2%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQRIAY NVG+YPFTS+F
Sbjct  875   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASSRMKVLQRIAYLNVGIYPFTSVF  934

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLIIT+TL  +++LEVKW+ I LEE WRNEQ
Sbjct  935   LIVYCFLPALSLFSGQFIVQTLNVTFLVYLLIITITLCTLAVLEVKWSGIELEEWWRNEQ  994

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV QGLLKV+AG+EISFTLTSKSA +D+DD +ADLY+VKWTSL I PL
Sbjct  995   FWLIGGTSAHLAAVFQGLLKVVAGVEISFTLTSKSAGDDDDDEFADLYIVKWTSLMIPPL  1054

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I++VN+ A+ +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1055  VIMMVNLIAIAVGISRTIYSVIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1114

Query  156   YVwtgllsittsllwiSVNPPQDPRAAASNE  64
             +VW+GL++I  SLLW+++NPP     A SN+
Sbjct  1115  FVWSGLIAIIISLLWVAINPP-----AGSNQ  1140



>ref|XP_004512470.1| PREDICTED: cellulose synthase-like protein D3-like isoform X1 
[Cicer arietinum]
 ref|XP_004512471.1| PREDICTED: cellulose synthase-like protein D3-like isoform X2 
[Cicer arietinum]
Length=1130

 Score =   379 bits (974),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 190/261 (73%), Positives = 228/261 (87%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN   A+ RLKFLQRIAY NVG+YPFTSIF
Sbjct  857   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALFANTRLKFLQRIAYLNVGIYPFTSIF  916

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+  F+GQFIVQ+L   FL YL+ ITVTL+L++ LE+KW+ I LEE WRNEQ
Sbjct  917   LVVYCFLPALSLFSGQFIVQSLKVTFLVYLMGITVTLILLAALEIKWSGIELEEWWRNEQ  976

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKS+ +DE+D YA+LY++KW+SL I+P+
Sbjct  977   FWLIGGTSAHLAAVLQGLLKVVAGIEISFTLTSKSSGDDENDEYAELYLIKWSSLMILPI  1036

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +  SR IYS   QW+ L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1037  TIMMVNLIAIAVAVSRTIYSDDRQWSSLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1096

Query  156   YVwtgllsittsllwiSVNPP  94
             +VW+ L++IT SLLW++++PP
Sbjct  1097  FVWSALIAITISLLWVAIDPP  1117



>ref|XP_006352916.1| PREDICTED: cellulose synthase-like protein D3-like isoform X1 
[Solanum tuberosum]
 ref|XP_006352917.1| PREDICTED: cellulose synthase-like protein D3-like isoform X2 
[Solanum tuberosum]
Length=1139

 Score =   379 bits (974),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 191/261 (73%), Positives = 229/261 (88%), Gaps = 1/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS ++K LQRIAY N G+YPFTSIF
Sbjct  867   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASPKMKILQRIAYLNCGIYPFTSIF  926

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQ+L+  FL YLL+IT+TL  +++LE+KW+ I LEE WRNEQ
Sbjct  927   LIVYCFLPALSLFSGQFIVQSLNVTFLTYLLVITLTLCALAVLEIKWSGIALEEWWRNEQ  986

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSA  D+DD +ADLY++KW+SL I P+
Sbjct  987   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAT-DDDDEFADLYIIKWSSLMIPPI  1045

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I++ N+ A+ +G SR IYS IPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1046  VIMMTNLIAIAVGVSRTIYSTIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1105

Query  156   YVwtgllsittsllwiSVNPP  94
             +VW+GL++IT SLLW+++NPP
Sbjct  1106  FVWSGLIAITISLLWVAINPP  1126



>ref|XP_004511422.1| PREDICTED: cellulose synthase-like protein D3-like [Cicer arietinum]
Length=1136

 Score =   379 bits (974),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 190/261 (73%), Positives = 225/261 (86%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIF SRNN   AS R+K LQR+AY NVG+YPFTS F
Sbjct  863   FRGTAPINLTDRLHQVLRWATGSVEIFLSRNNALFASPRMKLLQRLAYLNVGIYPFTSFF  922

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLL ITVTL ++++LE+KW+ I LEE WRNEQ
Sbjct  923   LIVYCFLPALSLFSGQFIVQTLNVTFLSYLLGITVTLCMLAVLEIKWSGIELEEWWRNEQ  982

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV QGLLKVI GI  SFTLT+KS  +D DD +ADLY+VKWTSL I P+
Sbjct  983   FWLIGGTSAHLAAVFQGLLKVIGGINTSFTLTTKSGGDDIDDEFADLYIVKWTSLMIPPI  1042

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1043  TIMMVNLIAIAVGISRTIYSVIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1102

Query  156   YVwtgllsittsllwiSVNPP  94
             Y+W+GL++IT SLLW+++NPP
Sbjct  1103  YIWSGLIAITISLLWVAINPP  1123



>gb|KHN38323.1| Cellulose synthase-like protein D4 [Glycine soja]
Length=1054

 Score =   377 bits (969),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 190/262 (73%), Positives = 229/262 (87%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFS+NN  LAS+RLK LQR++Y NVG+YPFTS+F
Sbjct  779   FRGSAPINLTDRLHQVLRWATGSVEIFFSKNNAFLASKRLKILQRLSYLNVGIYPFTSLF  838

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+  F+G FIV+TL   FL YLLIITV L+++++LEVKW+ + LE+ WRNEQ
Sbjct  839   LVVYCFLPALSLFSGSFIVETLSIAFLIYLLIITVCLVMLAILEVKWSGVELEQWWRNEQ  898

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLI GTSAHLAAV+QGLLKV+AGIEISFTLTSKSA EDEDD++ADLY+VKW+SL + P+
Sbjct  899   FWLISGTSAHLAAVVQGLLKVMAGIEISFTLTSKSAGEDEDDMFADLYIVKWSSLMVPPI  958

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I + NI A+ +  SR IYS  PQW+K  GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  959   VIAMTNIIAIAVAFSRTIYSANPQWSKFIGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1018

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GL++IT SLLW+S++PPQ
Sbjct  1019  FVWSGLIAITLSLLWVSISPPQ  1040



>ref|XP_001778677.1| cellulose synthase-like D1, glycosyltransferase family 2 protein 
[Physcomitrella patens]
 gb|EDQ56470.1| cellulose synthase-like D1, glycosyltransferase family 2 protein 
[Physcomitrella patens]
Length=1175

 Score =   380 bits (975),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 180/242 (74%), Positives = 208/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS RLKFLQR+AY NVG+YPFTSIF
Sbjct  902   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASSRLKFLQRVAYLNVGIYPFTSIF  961

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  FTGQFIVQ L+  FL YLL ITVTL  +++LEVKW+ I LEE WRNEQ
Sbjct  962   LLVYCFLPALSLFTGQFIVQNLNLSFLIYLLTITVTLCALAVLEVKWSGISLEEWWRNEQ  1021

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW+IGGTSAHLAAV QGLLKV+AG++ISFTLTSKSA EDEDDIYADLY+VKW+SLFI P+
Sbjct  1022  FWVIGGTSAHLAAVFQGLLKVMAGVDISFTLTSKSAGEDEDDIYADLYIVKWSSLFIPPI  1081

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI + N+ A+ +G SR +Y+  P+W+KL GG FF+ WVL HLYPF KGLMG+ GK PTIV
Sbjct  1082  TIGITNMVAIAVGFSRTVYATSPEWSKLLGGVFFALWVLMHLYPFFKGLMGKGGKTPTIV  1141

Query  156   YV  151
             +V
Sbjct  1142  FV  1143



>gb|ABI75154.1| cellulose synthase-like D4 [Physcomitrella patens]
Length=1168

 Score =   380 bits (975),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 193/268 (72%), Positives = 226/268 (84%), Gaps = 0/268 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS RLKFLQRIAY NVG+YPFTSIF
Sbjct  895   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASSRLKFLQRIAYLNVGIYPFTSIF  954

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  +TGQFIVQ L+  FL YLL IT+TL  +++LEVKW+ I LEE WRNEQ
Sbjct  955   LLVYCFLPALSLYTGQFIVQNLNLSFLIYLLTITITLFALAVLEVKWSGISLEEWWRNEQ  1014

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW+IGGTSAHLAAV QGLLKV+AG++ISFTLTSKSA EDEDDIYADLY+VKW+SL+I P+
Sbjct  1015  FWVIGGTSAHLAAVFQGLLKVMAGVDISFTLTSKSAGEDEDDIYADLYIVKWSSLYIPPI  1074

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI + N+ A+ +G SR IY+  P+W+KL GG FFS WVL HLYPF KGLMG+ GK PTIV
Sbjct  1075  TIGLTNMVAIAVGISRTIYATNPEWSKLLGGVFFSLWVLLHLYPFFKGLMGKGGKTPTIV  1134

Query  156   YVwtgllsittsllwiSVNPPQDPRAAA  73
             +VW GLLS+  SLLW+ ++P  D  AA+
Sbjct  1135  FVWAGLLSVIISLLWVYISPSNDSTAAS  1162



>ref|XP_002966771.1| cellulose synthase-like D3-1, glycosyltransferase family 2 protein 
[Selaginella moellendorffii]
 gb|EFJ32798.1| cellulose synthase-like D3-1, glycosyltransferase family 2 protein 
[Selaginella moellendorffii]
Length=1134

 Score =   379 bits (973),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 179/242 (74%), Positives = 210/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN   AS RLKFLQRIAY NVG+YPFTSIF
Sbjct  861   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNALFASSRLKFLQRIAYLNVGIYPFTSIF  920

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  FTGQFIVQTL+  FL YLL ITVTL L+++LE+KW+ I L+E WRNEQ
Sbjct  921   LLVYCFLPALSLFTGQFIVQTLNVTFLVYLLTITVTLCLLAVLEIKWSGITLDEWWRNEQ  980

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW+IGGTSAHLAAVLQGLLKVIAG++ISFTLTSK+  E EDD YADLY+VKW++L I P+
Sbjct  981   FWVIGGTSAHLAAVLQGLLKVIAGVDISFTLTSKAGGEGEDDAYADLYIVKWSALMIPPI  1040

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++ N+ A+ +G SR IYS IPQW++L GG FFS WVL HLYPFAKGLMGR+G+ PTIV
Sbjct  1041  TIMMTNLIAIGVGVSRTIYSEIPQWSRLLGGVFFSAWVLFHLYPFAKGLMGRRGRTPTIV  1100

Query  156   YV  151
             ++
Sbjct  1101  FI  1102



>ref|XP_002977978.1| cellulose synthase-like D3-2, glycosyltransferase family 2 protein 
[Selaginella moellendorffii]
 gb|EFJ20635.1| cellulose synthase-like D3-2, glycosyltransferase family 2 protein 
[Selaginella moellendorffii]
Length=1134

 Score =   379 bits (973),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 179/242 (74%), Positives = 210/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN   AS RLKFLQRIAY NVG+YPFTSIF
Sbjct  861   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNALFASSRLKFLQRIAYLNVGIYPFTSIF  920

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  FTGQFIVQTL+  FL YLL ITVTL L+++LE+KW+ I L+E WRNEQ
Sbjct  921   LLVYCFLPALSLFTGQFIVQTLNVTFLVYLLTITVTLCLLAVLEIKWSGITLDEWWRNEQ  980

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW+IGGTSAHLAAVLQGLLKVIAG++ISFTLTSK+  E EDD YADLY+VKW++L I P+
Sbjct  981   FWVIGGTSAHLAAVLQGLLKVIAGVDISFTLTSKAGGEGEDDAYADLYIVKWSALMIPPI  1040

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++ N+ A+ +G SR IYS IPQW++L GG FFS WVL HLYPFAKGLMGR+G+ PTIV
Sbjct  1041  TIMMTNLIAIGVGVSRTIYSEIPQWSRLLGGVFFSAWVLFHLYPFAKGLMGRRGRTPTIV  1100

Query  156   YV  151
             ++
Sbjct  1101  FI  1102



>ref|XP_011000846.1| PREDICTED: cellulose synthase-like protein D4 [Populus euphratica]
Length=1126

 Score =   379 bits (972),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 182/242 (75%), Positives = 208/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  LAS RLK LQR AY NVG+YPFTSIF
Sbjct  850   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASGRLKLLQRFAYLNVGIYPFTSIF  909

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+G FIVQTLD  FL YLL+IT++L+++++LEVKW+ I LEE WRNEQ
Sbjct  910   LIVYCFLPALSLFSGYFIVQTLDVAFLIYLLLITISLIVLAILEVKWSGIELEEWWRNEQ  969

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLI GTSAH AAV+QGLLKVIAGIEISFTLTSKSA ++ DDIYADLY+VKWTSL IMP+
Sbjct  970   FWLISGTSAHFAAVMQGLLKVIAGIEISFTLTSKSAGDEVDDIYADLYLVKWTSLMIMPI  1029

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I + NI A+     R IYS +PQW+K  GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1030  VIAMTNIIAMAFAFIRTIYSTVPQWSKFVGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1089

Query  156   YV  151
             +V
Sbjct  1090  FV  1091



>ref|XP_004301655.1| PREDICTED: cellulose synthase-like protein D3-like [Fragaria 
vesca subsp. vesca]
Length=1114

 Score =   378 bits (970),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 181/242 (75%), Positives = 207/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN   AS ++KFLQRIAY NVG+YPFTS F
Sbjct  841   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALFASSKMKFLQRIAYLNVGMYPFTSFF  900

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+   +GQFIVQTL+  FL YLL ITVTL+L+++LE+KW+ I LEE WRNEQ
Sbjct  901   LIVYCFLPALSLISGQFIVQTLNITFLVYLLGITVTLILLAVLEIKWSGIELEEWWRNEQ  960

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKS  +D DD + DLY+ KWTSL I P+
Sbjct  961   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSGGDDIDDEFVDLYIFKWTSLMIPPI  1020

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++ N+  + I   R +YSVIPQW+KL GG FFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1021  TIMMTNLIGIAIAVCRTVYSVIPQWSKLLGGVFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1080

Query  156   YV  151
             +V
Sbjct  1081  FV  1082



>ref|XP_004292316.1| PREDICTED: cellulose synthase-like protein D4-like [Fragaria 
vesca subsp. vesca]
Length=1138

 Score =   378 bits (971),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 182/242 (75%), Positives = 209/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  L S RLK LQR++Y NVGVYPFTSIF
Sbjct  864   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNAILGSMRLKVLQRMSYINVGVYPFTSIF  923

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIV  LD  FL YLL +T+ L+ +++LEVKW+ IGLEE WRNEQ
Sbjct  924   LIVYCFLPALSLFSGQFIVANLDITFLAYLLTMTICLIGLAVLEVKWSGIGLEEWWRNEQ  983

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLI GTSAHLAAV+QG+LKVIAGIEISFTLTSKSAA+D DDI+ADLY+VKWTSL I P+
Sbjct  984   FWLISGTSAHLAAVVQGILKVIAGIEISFTLTSKSAADDNDDIFADLYLVKWTSLMIPPI  1043

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I +VNI A+ +  SR++YSV  QW KL GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1044  VIALVNIIAIAVAVSRELYSVNAQWAKLVGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1103

Query  156   YV  151
             +V
Sbjct  1104  FV  1105



>gb|ABI75151.1| cellulose synthase-like D1 [Physcomitrella patens]
Length=1175

 Score =   379 bits (972),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 179/242 (74%), Positives = 208/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS RLKFLQR+AY NVG+YPFTSIF
Sbjct  902   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASSRLKFLQRVAYLNVGIYPFTSIF  961

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  FTGQFIVQ L+  FL YLL ITVTL  +++LEVKW+ I LEE WRNEQ
Sbjct  962   LLVYCFLPALSLFTGQFIVQNLNLSFLIYLLTITVTLCALAVLEVKWSGISLEEWWRNEQ  1021

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW+IGGTSAHLAAV QGLLKV+AG++ISFTLTSKSA EDEDDIYADLY+VKW+SLFI P+
Sbjct  1022  FWVIGGTSAHLAAVFQGLLKVMAGVDISFTLTSKSAGEDEDDIYADLYIVKWSSLFIPPI  1081

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI + N+ A+ +G SR +Y+  P+W+KL GG FF+ WVL HLYPF KGLMG+ GK PTIV
Sbjct  1082  TIGITNMVAIAVGFSRTVYATSPEWSKLLGGVFFALWVLMHLYPFFKGLMGKGGKTPTIV  1141

Query  156   YV  151
             ++
Sbjct  1142  FM  1143



>emb|CAN70317.1| hypothetical protein VITISV_038092 [Vitis vinifera]
Length=1075

 Score =   377 bits (967),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 176/242 (73%), Positives = 210/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+KFLQ+IAY NVG+YPFTSIF
Sbjct  803   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASHRMKFLQKIAYMNVGIYPFTSIF  862

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+  F+G+FIVQ+L   FL YLL IT+TL L+++LE+KW+ I LEE WRNEQ
Sbjct  863   LVVYCFLPALSLFSGEFIVQSLSVAFLTYLLGITITLCLLAVLEIKWSGITLEEWWRNEQ  922

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV+QGLLKV+AGIEISFTLTSKSA +D D+ +ADL+++KWTSL I P+
Sbjct  923   FWLIGGTSAHLAAVIQGLLKVVAGIEISFTLTSKSAGDDADEDFADLHLIKWTSLMIPPV  982

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++ N+  + +G  R IYS +PQW++L GG FFSFWVL HLYPFAKGLMGR+G+ PTIV
Sbjct  983   TIIITNLIGIAVGVVRTIYSELPQWSRLLGGVFFSFWVLVHLYPFAKGLMGRRGRTPTIV  1042

Query  156   YV  151
             +V
Sbjct  1043  FV  1044



>ref|XP_006411601.1| hypothetical protein EUTSA_v10024267mg [Eutrema salsugineum]
 gb|ESQ53054.1| hypothetical protein EUTSA_v10024267mg [Eutrema salsugineum]
Length=1112

 Score =   377 bits (969),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 179/242 (74%), Positives = 210/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  LAS+RLKFLQR+AY NVG+YPFTS+F
Sbjct  834   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNALLASKRLKFLQRLAYLNVGIYPFTSLF  893

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L++YCF+PA   F+GQFIV+TL   FL YLLIIT+ L+ +++LEVKW+ IGLEE WRNEQ
Sbjct  894   LILYCFLPAFSLFSGQFIVRTLSISFLVYLLIITICLIGLAVLEVKWSGIGLEEWWRNEQ  953

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             +WLI GTS+HL AV+QG+LKVIAGIEISFTLTSKS  +D DDIYADLY+VKW+SL I P+
Sbjct  954   WWLISGTSSHLYAVVQGILKVIAGIEISFTLTSKSGGDDNDDIYADLYIVKWSSLMIPPI  1013

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I +VNI A+V+   R IY  +PQW+KL GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1014  VIAMVNIIAIVVAFVRTIYQAVPQWSKLIGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1073

Query  156   YV  151
             +V
Sbjct  1074  FV  1075



>ref|XP_002868836.1| hypothetical protein ARALYDRAFT_490578 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45095.1| hypothetical protein ARALYDRAFT_490578 [Arabidopsis lyrata subsp. 
lyrata]
Length=1111

 Score =   377 bits (968),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 179/242 (74%), Positives = 210/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  LAS+RLKFLQR+AY NVG+YPFTS+F
Sbjct  833   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNAILASKRLKFLQRLAYLNVGIYPFTSLF  892

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L++YCF+PA   F+GQFIV+TL   FL YLLIIT+ L+ +++LEVKW+ IGLEE WRNEQ
Sbjct  893   LILYCFLPAFSLFSGQFIVRTLSISFLVYLLIITICLIGLAVLEVKWSGIGLEEWWRNEQ  952

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             +WLI GTS+HL AV+QG+LKVIAGIEISFTLTSKS  +D DDIYADLY+VKW+SL I P+
Sbjct  953   WWLISGTSSHLYAVVQGILKVIAGIEISFTLTSKSGGDDNDDIYADLYIVKWSSLMIPPI  1012

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I +VNI A+V+   R IY  +PQW+KL GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1013  VIAMVNIIAIVVAFIRTIYQAVPQWSKLIGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1072

Query  156   YV  151
             +V
Sbjct  1073  FV  1074



>emb|CDY61894.1| BnaAnng17960D [Brassica napus]
Length=1078

 Score =   376 bits (966),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 178/242 (74%), Positives = 210/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  LAS+RLKFLQR+AY NVG+YPFTS+F
Sbjct  800   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNAILASKRLKFLQRLAYLNVGIYPFTSLF  859

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L++YCF+PA   F+GQFIV+TL   FL YLLIIT+ L+ +++LEVKW+ IGLEE WRNEQ
Sbjct  860   LILYCFLPAFSLFSGQFIVRTLSISFLVYLLIITICLIGLAVLEVKWSGIGLEEWWRNEQ  919

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             +WLI GTS+HL AV+QG+LKVIAGIEISFTLT+KS  +D DDIYADLY+VKW+SL I P+
Sbjct  920   WWLISGTSSHLYAVVQGILKVIAGIEISFTLTTKSGGDDNDDIYADLYIVKWSSLMIPPI  979

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I +VNI A+V+   R IY  +PQW+KL GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  980   VIAMVNIIAIVVAFVRTIYQAVPQWSKLIGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1039

Query  156   YV  151
             +V
Sbjct  1040  FV  1041



>ref|XP_003533446.1| PREDICTED: cellulose synthase-like protein D3-like isoform X1 
[Glycine max]
 ref|XP_006587610.1| PREDICTED: cellulose synthase-like protein D3-like isoform X2 
[Glycine max]
 gb|KHN38958.1| Cellulose synthase-like protein D3 [Glycine soja]
Length=1117

 Score =   377 bits (968),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 180/242 (74%), Positives = 208/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN   AS RLK LQRIAY NVG+YPFTSIF
Sbjct  844   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALFASSRLKLLQRIAYLNVGIYPFTSIF  903

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  FTGQFIVQTL   FL YLL IT+TL++++ LE+KW+ I LEE WRNEQ
Sbjct  904   LIVYCFVPALSLFTGQFIVQTLQVTFLVYLLGITLTLVILAALEIKWSGIELEEWWRNEQ  963

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKS  +DE+D +ADLYV+KWTSL I P+
Sbjct  964   FWLIGGTSAHLAAVLQGLLKVMAGIEISFTLTSKSGGDDENDEFADLYVIKWTSLMIPPI  1023

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +  SR IYS   +W+ L GG FFSFWVL+HLYPFAKGLMGR+G+ PTIV
Sbjct  1024  TIMMVNLIAIAVAVSRTIYSEDREWSSLLGGVFFSFWVLSHLYPFAKGLMGRRGRTPTIV  1083

Query  156   YV  151
             +V
Sbjct  1084  FV  1085



>ref|XP_007210976.1| hypothetical protein PRUPE_ppa021772mg [Prunus persica]
 gb|EMJ12175.1| hypothetical protein PRUPE_ppa021772mg [Prunus persica]
Length=1129

 Score =   377 bits (968),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 179/242 (74%), Positives = 208/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRW TGSVEIFFSRNN  LAS R+K LQRIAY +VG+YPFTS F
Sbjct  856   FRGTAPINLTDRLHQVLRWGTGSVEIFFSRNNALLASSRMKILQRIAYLSVGMYPFTSFF  915

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQ+L+  FL YLL IT+TL+L+++LE+KW+ I LEE WRNEQ
Sbjct  916   LIVYCFLPALSLFSGQFIVQSLNITFLAYLLGITITLILLAVLEIKWSGIALEEWWRNEQ  975

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKS  +D DD + DLY+ KWTSL I P+
Sbjct  976   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSGGDDADDEFVDLYIFKWTSLMIPPI  1035

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++ N+ A+ +   R IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1036  TIMMTNLIAIAVATCRTIYSVIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1095

Query  156   YV  151
             +V
Sbjct  1096  FV  1097



>ref|XP_004494401.1| PREDICTED: cellulose synthase-like protein D5-like isoform X2 
[Cicer arietinum]
Length=1148

 Score =   377 bits (969),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 193/263 (73%), Positives = 228/263 (87%), Gaps = 1/263 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+KFLQR+AYFNVG+YPFTS+F
Sbjct  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKFLQRVAYFNVGMYPFTSMF  935

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQ+L+  FL YLL ITVTL +++LLE+KW++I L +LWRNEQ
Sbjct  936   LIVYCFLPALSLFSGQFIVQSLNVNFLVYLLGITVTLCMLALLEIKWSKITLHDLWRNEQ  995

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAA-EDEDDIYADLYVVKWTSLFIMP  340
             FWLIGGTSAH AAVLQGLLKVIAG++ISFTLTSKSA  ED D+ +ADLY VKW+ L + P
Sbjct  996   FWLIGGTSAHPAAVLQGLLKVIAGVDISFTLTSKSATPEDGDEEFADLYEVKWSFLMVPP  1055

Query  339   LTILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTI  160
             +TI++VN  A+ +G +R +YS  PQW+KL GG FFSFWVL HLYPFAKGLMGR+GKVPTI
Sbjct  1056  ITIMMVNAIAIAVGVARTLYSPFPQWSKLVGGLFFSFWVLCHLYPFAKGLMGRRGKVPTI  1115

Query  159   VYVwtgllsittsllwiSVNPPQ  91
             +YVW+GLLSI  SLLW+ VNPP 
Sbjct  1116  IYVWSGLLSIIISLLWVYVNPPS  1138



>gb|KEH40956.1| cellulose synthase-like protein [Medicago truncatula]
Length=1105

 Score =   377 bits (967),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 194/272 (71%), Positives = 229/272 (84%), Gaps = 0/272 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFS+NN  LAS+RLK LQR+AY NVGVYPFTSI 
Sbjct  830   FRGSAPINLTDRLHQVLRWATGSVEIFFSKNNAFLASKRLKLLQRLAYLNVGVYPFTSIL  889

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+G FIVQTL   FL YLL +TV L+ +++LEVKW+ I LE+ WRNEQ
Sbjct  890   LIVYCFLPALSLFSGYFIVQTLSIAFLIYLLTMTVCLVGLAILEVKWSGIELEQWWRNEQ  949

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLI GTSAHLAAV+QGLLKVIAGIEISFTLTSKS  ED+DDI+ADLY+VKW+SL I P+
Sbjct  950   FWLISGTSAHLAAVIQGLLKVIAGIEISFTLTSKSGGEDDDDIFADLYIVKWSSLMIPPI  1009

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I +VN+ A+V+  SR IYS  PQW+K  GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1010  VIAMVNVIAIVVAFSRTIYSANPQWSKFIGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1069

Query  156   YVwtgllsittsllwiSVNPPQDPRAAASNED  61
             +VW+GL++I  SLLW+S++PP+     AS  D
Sbjct  1070  FVWSGLIAIILSLLWVSISPPKATDGEASGGD  1101



>ref|XP_008238167.1| PREDICTED: cellulose synthase-like protein D3 [Prunus mume]
Length=1129

 Score =   377 bits (967),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 179/242 (74%), Positives = 208/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQRI Y NVG+YPFTS F
Sbjct  856   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASSRMKILQRIFYLNVGMYPFTSFF  915

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQ+L+  FL YLL IT+TL+L+++LE+KW+ I LEE WRNEQ
Sbjct  916   LIVYCFLPALSLFSGQFIVQSLNITFLAYLLGITITLILLAVLEIKWSGIALEEWWRNEQ  975

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAG+EISFTLTSKS  +D DD + DLY+ KWTSL I P+
Sbjct  976   FWLIGGTSAHLAAVLQGLLKVIAGVEISFTLTSKSGGDDADDEFVDLYIFKWTSLMIPPI  1035

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++ N+ A+ +   R IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1036  TIMMTNLIAIAVATCRTIYSVIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1095

Query  156   YV  151
             +V
Sbjct  1096  FV  1097



>ref|XP_003519547.1| PREDICTED: cellulose synthase-like protein D4-like [Glycine max]
Length=1124

 Score =   377 bits (967),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 190/262 (73%), Positives = 229/262 (87%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFS+NN  LAS+RLK LQR++Y NVG+YPFTS+F
Sbjct  849   FRGSAPINLTDRLHQVLRWATGSVEIFFSKNNAFLASKRLKILQRLSYLNVGIYPFTSLF  908

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+  F+G FIV+TL   FL YLLIITV L+++++LEVKW+ + LE+ WRNEQ
Sbjct  909   LVVYCFLPALSLFSGSFIVETLSIAFLIYLLIITVCLVMLAILEVKWSGVELEQWWRNEQ  968

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLI GTSAHLAAV+QGLLKV+AGIEISFTLTSKSA EDEDD++ADLY+VKW+SL + P+
Sbjct  969   FWLISGTSAHLAAVVQGLLKVMAGIEISFTLTSKSAGEDEDDMFADLYIVKWSSLMVPPI  1028

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I + NI A+ +  SR IYS  PQW+K  GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1029  VIAMTNIIAIAVAFSRTIYSANPQWSKFIGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1088

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GL++IT SLLW+S++PPQ
Sbjct  1089  FVWSGLIAITLSLLWVSISPPQ  1110



>gb|AAO03579.1| cellulose synthase-like protein D4 [Populus tremuloides]
Length=1104

 Score =   376 bits (966),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 199/262 (76%), Positives = 233/262 (89%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFF  NN  LASRR++FLQRIAY NVG+YPFTSIF
Sbjct  831   FRGTAPINLTDRLHQVLRWATGSVEIFFPCNNALLASRRMQFLQRIAYLNVGIYPFTSIF  890

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLIIT+TL L+++LE+KW+ I LEE WRNEQ
Sbjct  891   LIVYCFLPALSLFSGQFIVQTLNVTFLAYLLIITLTLCLLAVLEIKWSGIDLEEWWRNEQ  950

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKS  +D DD +ADLYVVKWTSL I P+
Sbjct  951   FWLIGGTSAHLAAVLQGLLKVVAGIEISFTLTSKSGGDDVDDEFADLYVVKWTSLMIPPI  1010

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1011  TIMMVNLIAIAVGFSRTIYSVIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1070

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GL++IT SLLW+++NPP 
Sbjct  1071  FVWSGLIAITISLLWVAINPPS  1092



>ref|XP_002518991.1| cellulose synthase, putative [Ricinus communis]
 gb|EEF43524.1| cellulose synthase, putative [Ricinus communis]
Length=1086

 Score =   376 bits (965),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 179/242 (74%), Positives = 205/242 (85%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  L   RLK LQRIAY NVG+YPFTSIF
Sbjct  813   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLGGHRLKLLQRIAYLNVGIYPFTSIF  872

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+ QFIV +L   FL YLL+IT TL ++++LE+KWA I +E+ WRNEQ
Sbjct  873   LIVYCFLPALSLFSNQFIVDSLSVNFLVYLLMITSTLCILAILEIKWAGIAVEDWWRNEQ  932

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGI+ISFTLTSKSA +D DD +ADLY+VKWTSL I P 
Sbjct  933   FWLIGGTSAHLAAVLQGLLKVIAGIDISFTLTSKSAGDDGDDEFADLYIVKWTSLMIPPC  992

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G  R IYS  PQW+ L GG FFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  993   TIIMVNLIAIAVGICRTIYSNTPQWSNLVGGVFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1052

Query  156   YV  151
             +V
Sbjct  1053  FV  1054



>ref|XP_002514401.1| cellulose synthase, putative [Ricinus communis]
 gb|EEF47997.1| cellulose synthase, putative [Ricinus communis]
Length=1122

 Score =   376 bits (966),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 194/272 (71%), Positives = 231/272 (85%), Gaps = 4/272 (1%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  LASR+LK LQR+AY NVG+YPFTS+F
Sbjct  846   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASRKLKLLQRLAYLNVGIYPFTSMF  905

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+G FIV+TL   FL YLL ITV L+++++LE++W+ IGLEE WRNEQ
Sbjct  906   LIVYCFLPALSLFSGFFIVETLSITFLVYLLTITVCLIMLAILELRWSGIGLEEWWRNEQ  965

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLI GTSAH AAV+QGLLKVIAGIEISFTLTSKSA +D DDI+ADLY+VKWTSL I P+
Sbjct  966   FWLISGTSAHFAAVVQGLLKVIAGIEISFTLTSKSAGDDVDDIFADLYIVKWTSLMIPPI  1025

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I + NI A+     R +YS +PQW+K  GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1026  VIAMTNIIAIAFAFIRTVYSTVPQWSKFIGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1085

Query  156   YVwtgllsittsllwiSVNPPQDPRAAASNED  61
             +VW+GL++IT SLLWI+++PPQ    AA+N D
Sbjct  1086  FVWSGLIAITLSLLWIAISPPQ----AATNAD  1113



>ref|XP_010663029.1| PREDICTED: cellulose synthase-like protein D2 [Vitis vinifera]
Length=1114

 Score =   376 bits (966),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 176/242 (73%), Positives = 210/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+KFLQ+IAY NVG+YPFTSIF
Sbjct  858   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASHRMKFLQKIAYMNVGIYPFTSIF  917

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+  F+G+FIVQ+L   FL YLL IT+TL L+++LE+KW+ I LEE WRNEQ
Sbjct  918   LVVYCFLPALSLFSGEFIVQSLSVAFLTYLLGITITLCLLAVLEIKWSGITLEEWWRNEQ  977

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV+QGLLKV+AGIEISFTLTSKSA +D D+ +ADL+++KWTSL I P+
Sbjct  978   FWLIGGTSAHLAAVIQGLLKVVAGIEISFTLTSKSAGDDADEDFADLHLIKWTSLMIPPV  1037

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++ N+  + +G  R IYS +PQW++L GG FFSFWVL HLYPFAKGLMGR+G+ PTIV
Sbjct  1038  TIIITNLIGIAVGVVRTIYSELPQWSRLLGGVFFSFWVLVHLYPFAKGLMGRRGRTPTIV  1097

Query  156   YV  151
             +V
Sbjct  1098  FV  1099



>ref|XP_004494400.1| PREDICTED: cellulose synthase-like protein D5-like isoform X1 
[Cicer arietinum]
Length=1167

 Score =   377 bits (968),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 193/263 (73%), Positives = 228/263 (87%), Gaps = 1/263 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+KFLQR+AYFNVG+YPFTS+F
Sbjct  895   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKFLQRVAYFNVGMYPFTSMF  954

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQ+L+  FL YLL ITVTL +++LLE+KW++I L +LWRNEQ
Sbjct  955   LIVYCFLPALSLFSGQFIVQSLNVNFLVYLLGITVTLCMLALLEIKWSKITLHDLWRNEQ  1014

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAA-EDEDDIYADLYVVKWTSLFIMP  340
             FWLIGGTSAH AAVLQGLLKVIAG++ISFTLTSKSA  ED D+ +ADLY VKW+ L + P
Sbjct  1015  FWLIGGTSAHPAAVLQGLLKVIAGVDISFTLTSKSATPEDGDEEFADLYEVKWSFLMVPP  1074

Query  339   LTILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTI  160
             +TI++VN  A+ +G +R +YS  PQW+KL GG FFSFWVL HLYPFAKGLMGR+GKVPTI
Sbjct  1075  ITIMMVNAIAIAVGVARTLYSPFPQWSKLVGGLFFSFWVLCHLYPFAKGLMGRRGKVPTI  1134

Query  159   VYVwtgllsittsllwiSVNPPQ  91
             +YVW+GLLSI  SLLW+ VNPP 
Sbjct  1135  IYVWSGLLSIIISLLWVYVNPPS  1157



>ref|XP_010055254.1| PREDICTED: cellulose synthase-like protein D2 [Eucalyptus grandis]
 ref|XP_010055255.1| PREDICTED: cellulose synthase-like protein D2 [Eucalyptus grandis]
 gb|KCW71715.1| hypothetical protein EUGRSUZ_E00226 [Eucalyptus grandis]
Length=1100

 Score =   376 bits (965),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 191/263 (73%), Positives = 226/263 (86%), Gaps = 0/263 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  +AS RLKFLQRIAY NVG+YPFTSIF
Sbjct  827   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAIMASGRLKFLQRIAYLNVGIYPFTSIF  886

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+G+FIVQ+L   FL YLL IT+TL L+++LE+KW+ + LEE WRNEQ
Sbjct  887   LIVYCFLPALSLFSGKFIVQSLSVSFLIYLLAITLTLCLLAILEIKWSGVTLEEWWRNEQ  946

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSA +D DD +ADLY+ KWT+L I P+
Sbjct  947   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAGDDIDDEFADLYIFKWTALMIPPV  1006

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI+  N+ A+ +  SR IYS  PQW++L GG FFS WVL HLYPFAKGLMGR+G+ PTIV
Sbjct  1007  TIIFTNLIAIAVAFSRTIYSTNPQWSQLIGGVFFSVWVLTHLYPFAKGLMGRRGRTPTIV  1066

Query  156   YVwtgllsittsllwiSVNPPQD  88
             YVW+GLL+IT SLLW++++PP +
Sbjct  1067  YVWSGLLAITISLLWVAIDPPSN  1089



>gb|KHN11971.1| Cellulose synthase-like protein D4 [Glycine soja]
Length=1066

 Score =   375 bits (963),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 190/262 (73%), Positives = 229/262 (87%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFS+NN  LAS+RLK LQR++Y NVG+YPFTS+F
Sbjct  791   FRGSAPINLTDRLHQVLRWATGSVEIFFSKNNAFLASKRLKLLQRLSYLNVGIYPFTSVF  850

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+  F+G FIV+TL   FL YLLIITV L+++++LEVKW+ + LE+ WRNEQ
Sbjct  851   LVVYCFLPALSLFSGFFIVETLSIAFLIYLLIITVCLVMLAILEVKWSGVELEQWWRNEQ  910

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLI GTSAHLAAV+QGLLKV+AGIEISFTLTSKSA EDEDD++ADLY+VKW+SL + P+
Sbjct  911   FWLISGTSAHLAAVVQGLLKVMAGIEISFTLTSKSAGEDEDDMFADLYIVKWSSLMVPPI  970

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I + NI A+ +  SR IYS  PQW+K  GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  971   VIAMTNIIAIAVAFSRTIYSANPQWSKFIGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1030

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GL++IT SLLW+S++PPQ
Sbjct  1031  FVWSGLIAITLSLLWVSISPPQ  1052



>gb|EYU19742.1| hypothetical protein MIMGU_mgv1a017980mg [Erythranthe guttata]
Length=1159

 Score =   376 bits (966),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 195/261 (75%), Positives = 231/261 (89%), Gaps = 0/261 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQR+AY NVG+YPFTSIF
Sbjct  886   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKVLQRLAYLNVGIYPFTSIF  945

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLIIT+TL  +++LEVKW+ I LEE WRNEQ
Sbjct  946   LIVYCFLPALSLFSGQFIVQTLNVTFLVYLLIITITLCGLAVLEVKWSGIELEEWWRNEQ  1005

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV QGLLKV+AG+EISFTLTSKS+ +D+DD +A+LYVVKWTSL I P+
Sbjct  1006  FWLIGGTSAHLAAVFQGLLKVVAGVEISFTLTSKSSGDDDDDEFAELYVVKWTSLMIPPI  1065

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I++VN+ A+ +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1066  VIIMVNLIAIAVGLSRTIYSVIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1125

Query  156   YVwtgllsittsllwiSVNPP  94
             +VW+GL++I  SLLW+++NPP
Sbjct  1126  FVWSGLIAIIISLLWVAINPP  1146



>ref|XP_006422380.1| hypothetical protein CICLE_v10029850mg [Citrus clementina]
 ref|XP_006486837.1| PREDICTED: cellulose synthase-like protein D4-like [Citrus sinensis]
 gb|ESR35620.1| hypothetical protein CICLE_v10029850mg [Citrus clementina]
 gb|KDO68431.1| hypothetical protein CISIN_1g042084mg [Citrus sinensis]
Length=1124

 Score =   375 bits (964),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 193/271 (71%), Positives = 229/271 (85%), Gaps = 0/271 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  LASR+LK LQR+AY NVG+YPFTS+F
Sbjct  850   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASRKLKLLQRLAYLNVGIYPFTSLF  909

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+   +G FIV+ L+  FL YLLI ++ L+ +++LEVKW+ IGLEE WRNEQ
Sbjct  910   LIVYCFLPALSLISGHFIVKNLNITFLVYLLIQSLCLIGLAILEVKWSGIGLEEWWRNEQ  969

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FW+IGGTSAH AAV+QGLLKV+AGIEISFTLT+KSAAED DDIYADLYVVKWTSL I P+
Sbjct  970   FWVIGGTSAHFAAVIQGLLKVMAGIEISFTLTTKSAAEDNDDIYADLYVVKWTSLMIPPI  1029

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I +VNI A+VI   R IY+  P W+K  GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1030  VIAMVNIVAMVIAFLRTIYATNPSWSKFIGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1089

Query  156   YVwtgllsittsllwiSVNPPQDPRAAASNE  64
             +VW+GL++IT SLLW++++PP    AA   E
Sbjct  1090  FVWSGLIAITLSLLWMAISPPGSTPAATGGE  1120



>ref|XP_010446321.1| PREDICTED: cellulose synthase-like protein D4 [Camelina sativa]
Length=1111

 Score =   375 bits (963),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/242 (73%), Positives = 210/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  LAS+RLKFLQR+AY NVG+YPFTS+F
Sbjct  833   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNAILASKRLKFLQRLAYLNVGIYPFTSLF  892

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L++YCF+PA   F+GQFIV+TL   FL YLLIIT+ L+ +++LEVKW+ IGLEE WRNEQ
Sbjct  893   LILYCFLPAFSLFSGQFIVRTLSISFLVYLLIITICLIGLAVLEVKWSGIGLEEWWRNEQ  952

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             +WLI GTS+HL AV+QG+LKV+AGIEISFTLT+KS  +D DDIYADLY+VKW+SL I P+
Sbjct  953   WWLISGTSSHLYAVVQGILKVLAGIEISFTLTTKSGGDDNDDIYADLYIVKWSSLMIPPI  1012

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I +VNI A+V+   R IY  +PQW+KL GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1013  VIAMVNIIAIVVAFVRTIYQAVPQWSKLIGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1072

Query  156   YV  151
             +V
Sbjct  1073  FV  1074



>dbj|BAO02532.1| predicted cellulose synthase D-like, partial [Nicotiana alata]
Length=690

 Score =   365 bits (936),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 188/262 (72%), Positives = 224/262 (85%), Gaps = 0/262 (0%)
 Frame = -3

Query  876  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
            FRG+APINLTDRLHQVLRWATGSVEIFFS NN  LASR+LK LQR+AY NVG+YPFTS+F
Sbjct  416  FRGSAPINLTDRLHQVLRWATGSVEIFFSGNNAFLASRKLKVLQRLAYLNVGIYPFTSLF  475

Query  696  LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
            L+VYCF+PA+   +GQFIVQ L+  FL +LL ITV L+ ++LLEVKW+ + LE+ WRNEQ
Sbjct  476  LIVYCFLPALSLISGQFIVQNLNVAFLIFLLTITVCLIGLALLEVKWSGVALEDWWRNEQ  535

Query  516  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
            FWLI GTSAHLAAV+QGLLKVIAGIEISFTLTSKSA ED DDIYADLY+VKWTSL I P+
Sbjct  536  FWLISGTSAHLAAVVQGLLKVIAGIEISFTLTSKSAGEDVDDIYADLYLVKWTSLMIPPI  595

Query  336  TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             I ++NI A+VI  SR +++ +P+W K  GGAFF+FWVLAHLYPFAKGLMGR  K PTIV
Sbjct  596  VIGMINIIAIVIAFSRAVFATVPEWGKFIGGAFFAFWVLAHLYPFAKGLMGRGRKTPTIV  655

Query  156  YVwtgllsittsllwiSVNPPQ  91
            +VW+GL++IT SLLW+++NP Q
Sbjct  656  FVWSGLIAITLSLLWVAINPQQ  677



>ref|XP_006282906.1| hypothetical protein CARUB_v10007301mg [Capsella rubella]
 gb|EOA15804.1| hypothetical protein CARUB_v10007301mg [Capsella rubella]
Length=1111

 Score =   375 bits (962),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 178/242 (74%), Positives = 209/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  LAS RLKFLQR+AY NVG+YPFTS+F
Sbjct  833   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNAILASNRLKFLQRLAYLNVGIYPFTSLF  892

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L++YCF+PA   F+GQFIV+TL   FL YLLIIT+ L+ +++LEVKW+ IGLEE WRNEQ
Sbjct  893   LILYCFLPAFSLFSGQFIVRTLSISFLVYLLIITICLIGLAVLEVKWSGIGLEEWWRNEQ  952

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             +WLI GTS+HL AV+QG+LKVIAGIEISFTLT+KS  +D DDIYADLY+VKW+SL I P+
Sbjct  953   WWLISGTSSHLYAVVQGILKVIAGIEISFTLTTKSGGDDNDDIYADLYIVKWSSLMIPPI  1012

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I +VNI A+V+   R IY  +PQW+KL GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1013  VIAMVNIIAIVVAFIRTIYQAVPQWSKLIGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1072

Query  156   YV  151
             +V
Sbjct  1073  FV  1074



>ref|XP_010496636.1| PREDICTED: cellulose synthase-like protein D4 [Camelina sativa]
Length=1111

 Score =   375 bits (962),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 177/242 (73%), Positives = 210/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  LAS+RLKFLQR+AY NVG+YPFTS+F
Sbjct  833   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNAILASKRLKFLQRLAYLNVGIYPFTSLF  892

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L++YCF+PA   F+GQFIV+TL   FL YLLIIT+ L+ +++LEVKW+ IGLEE WRNEQ
Sbjct  893   LILYCFLPAFSLFSGQFIVRTLSISFLVYLLIITICLIGLAVLEVKWSGIGLEEWWRNEQ  952

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             +WLI GTS+HL AV+QG+LKV+AGIEISFTLT+KS  +D DDIYADLY+VKW+SL I P+
Sbjct  953   WWLISGTSSHLYAVVQGILKVLAGIEISFTLTTKSGGDDNDDIYADLYIVKWSSLMIPPI  1012

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I +VNI A+V+   R IY  +PQW+KL GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1013  VIAMVNIIAIVVAFVRTIYQAVPQWSKLIGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1072

Query  156   YV  151
             +V
Sbjct  1073  FV  1074



>ref|XP_007141409.1| hypothetical protein PHAVU_008G193000g [Phaseolus vulgaris]
 gb|ESW13403.1| hypothetical protein PHAVU_008G193000g [Phaseolus vulgaris]
Length=1128

 Score =   375 bits (962),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 189/262 (72%), Positives = 227/262 (87%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFS+NN  LAS+RLK LQR+AY NVG+YPFTS+F
Sbjct  853   FRGSAPINLTDRLHQVLRWATGSVEIFFSKNNAFLASKRLKILQRLAYLNVGIYPFTSLF  912

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCF+PA+  F+G FIVQTL   FL YLL+ITV L+ +++LEVKW+ + LE+ WRNEQ
Sbjct  913   LVVYCFLPALSLFSGFFIVQTLSIAFLVYLLLITVCLVALAILEVKWSGVELEQWWRNEQ  972

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLI GTSAHLAAV+QGLLKV+AGIEISFTLT+KS  EDE+DIYADLY+VKW+SL + P+
Sbjct  973   FWLISGTSAHLAAVVQGLLKVMAGIEISFTLTTKSGGEDEEDIYADLYIVKWSSLMVPPI  1032

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I ++NI  + +  SR IYS  PQW+K  GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1033  VIAMMNIIGIAVAFSRTIYSANPQWSKFIGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1092

Query  156   YVwtgllsittsllwiSVNPPQ  91
             +VW+GL++IT SLLW+++NPPQ
Sbjct  1093  FVWSGLIAITLSLLWVAINPPQ  1114



>ref|XP_009121428.1| PREDICTED: cellulose synthase-like protein D2 [Brassica rapa]
 ref|XP_009121429.1| PREDICTED: cellulose synthase-like protein D2 [Brassica rapa]
Length=1143

 Score =   375 bits (962),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 176/242 (73%), Positives = 211/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS ++K LQRIAY NVG+YPFTSIF
Sbjct  870   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPKMKLLQRIAYLNVGIYPFTSIF  929

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLII++TL+L++LLE+KW+ I LEE WRNEQ
Sbjct  930   LIVYCFLPALSLFSGQFIVQTLNVTFLIYLLIISITLVLLALLEIKWSGISLEEWWRNEQ  989

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAH+AAV QGL+K   G E++FTLTSKS  +D DD +A+LY+V+W+SL I P+
Sbjct  990   FWLIGGTSAHIAAVFQGLIKFGFGYEVAFTLTSKSGGDDVDDEFAELYIVRWSSLMIPPI  1049

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+ A+ +G SR IY+VIPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1050  TIMMVNLIAIAVGFSRTIYAVIPQWSKLIGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1109

Query  156   YV  151
             YV
Sbjct  1110  YV  1111



>ref|XP_010677380.1| PREDICTED: cellulose synthase-like protein D3 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=1128

 Score =   374 bits (961),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 182/242 (75%), Positives = 213/242 (88%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQR+AY NVG+YPFTSIF
Sbjct  853   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKLLQRVAYLNVGIYPFTSIF  912

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQ+L   FL YLL+I+++L L++LLE+KW+ I LEE WRNEQ
Sbjct  913   LIVYCFLPALSLFSGQFIVQSLSITFLIYLLVISLSLCLLALLEIKWSGINLEEWWRNEQ  972

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKSA ++ DD +ADLYVVKWTSL I PL
Sbjct  973   FWLIGGTSAHLAAVLQGLLKVVAGIEISFTLTSKSAGDENDDDFADLYVVKWTSLMIPPL  1032

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I++VN+ A+ +G SR IYS IPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTI+
Sbjct  1033  VIIMVNLIAIAVGFSRTIYSTIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTII  1092

Query  156   YV  151
             +V
Sbjct  1093  FV  1094



>ref|XP_010677379.1| PREDICTED: cellulose synthase-like protein D3 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1148

 Score =   375 bits (962),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 182/242 (75%), Positives = 213/242 (88%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQR+AY NVG+YPFTSIF
Sbjct  873   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASPRMKLLQRVAYLNVGIYPFTSIF  932

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQ+L   FL YLL+I+++L L++LLE+KW+ I LEE WRNEQ
Sbjct  933   LIVYCFLPALSLFSGQFIVQSLSITFLIYLLVISLSLCLLALLEIKWSGINLEEWWRNEQ  992

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKV+AGIEISFTLTSKSA ++ DD +ADLYVVKWTSL I PL
Sbjct  993   FWLIGGTSAHLAAVLQGLLKVVAGIEISFTLTSKSAGDENDDDFADLYVVKWTSLMIPPL  1052

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I++VN+ A+ +G SR IYS IPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTI+
Sbjct  1053  VIIMVNLIAIAVGFSRTIYSTIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTII  1112

Query  156   YV  151
             +V
Sbjct  1113  FV  1114



>gb|KFK30429.1| hypothetical protein AALP_AA7G260000 [Arabis alpina]
Length=1114

 Score =   374 bits (960),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 177/242 (73%), Positives = 210/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  LAS+RLKFLQR+AY NVG+YPFTS+F
Sbjct  836   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNAILASKRLKFLQRLAYLNVGIYPFTSLF  895

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L++YCF+PA   F+GQFIV+TL   FL YLLIIT+ L+ +++LEVKW+ IGLEE WRNEQ
Sbjct  896   LILYCFLPAFSLFSGQFIVRTLSISFLVYLLIITICLIGLAVLEVKWSGIGLEEWWRNEQ  955

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             +WLI GTS+HL AV+QG+LKVIAGIEISFTLT+KS  +D +DIYADLY+VKW+SL I P+
Sbjct  956   WWLISGTSSHLYAVVQGVLKVIAGIEISFTLTTKSGGDDNEDIYADLYIVKWSSLMIPPI  1015

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I +VNI A+V+   R IY  +PQW+KL GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  1016  VIAMVNIIAIVVAFVRTIYQAVPQWSKLIGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1075

Query  156   YV  151
             +V
Sbjct  1076  FV  1077



>ref|XP_010088647.1| Cellulose synthase-like protein D3 [Morus notabilis]
 gb|EXB36807.1| Cellulose synthase-like protein D3 [Morus notabilis]
Length=1176

 Score =   375 bits (963),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 177/242 (73%), Positives = 208/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS RLKFLQRIAY NVG+YPFTS+F
Sbjct  903   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLASSRLKFLQRIAYLNVGIYPFTSLF  962

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+G+FIVQ+L+  FL YLL IT+ L+ +++LE+KW+ I LEE WRNEQ
Sbjct  963   LIVYCFLPALSLFSGEFIVQSLNVTFLTYLLGITLALIALAVLEIKWSGIELEEWWRNEQ  1022

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKS  +D +D YADLY+ KWTSL + P+
Sbjct  1023  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSGGDDANDDYADLYIFKWTSLMVPPI  1082

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++VN+  + +   R IYS  P+W+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1083  TIMMVNLIGIAVATCRTIYSDNPEWSKLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1142

Query  156   YV  151
             +V
Sbjct  1143  FV  1144



>ref|NP_171773.1| cellulose synthase-like protein D5 [Arabidopsis thaliana]
 sp|Q9SRW9.1|CSLD5_ARATH RecName: Full=Cellulose synthase-like protein D5; Short=AtCslD5 
[Arabidopsis thaliana]
 gb|AAF02892.1|AC009525_26 Very similar to cellulose synthase catalytic subunit [Arabidopsis 
thaliana]
 gb|AEE27464.1| cellulose synthase-like protein D5 [Arabidopsis thaliana]
 gb|AHL38973.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=1181

 Score =   375 bits (963),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 192/262 (73%), Positives = 228/262 (87%), Gaps = 1/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN   A+RR+KFLQR+AYFNVG+YPFTS+F
Sbjct  908   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAIFATRRMKFLQRVAYFNVGMYPFTSLF  967

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYC +PA+  F+GQFIVQ+LD  FL YLL IT+TL ++SLLE+KW+ I L E WRNEQ
Sbjct  968   LIVYCILPAISLFSGQFIVQSLDITFLIYLLSITLTLCMLSLLEIKWSGITLHEWWRNEQ  1027

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAA-EDEDDIYADLYVVKWTSLFIMP  340
             FW+IGGTSAH AAVLQGLLKVIAG++ISFTLTSKS+A ED DD +ADLYVVKW+ L + P
Sbjct  1028  FWVIGGTSAHPAAVLQGLLKVIAGVDISFTLTSKSSAPEDGDDEFADLYVVKWSFLMVPP  1087

Query  339   LTILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTI  160
             LTI++VN+ A+ +G +R +YS  PQW+KL GG FFSFWVL HLYPFAKGLMGR+G+VPTI
Sbjct  1088  LTIMMVNMIAIAVGLARTLYSPFPQWSKLVGGVFFSFWVLCHLYPFAKGLMGRRGRVPTI  1147

Query  159   VYVwtgllsittsllwiSVNPP  94
             V+VW+GLLSI  SLLW+ +NPP
Sbjct  1148  VFVWSGLLSIIVSLLWVYINPP  1169



>ref|XP_006384874.1| cellulose synthase family protein [Populus trichocarpa]
 gb|ERP62671.1| cellulose synthase family protein [Populus trichocarpa]
Length=1128

 Score =   374 bits (960),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 181/242 (75%), Positives = 207/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  LA+RRLK LQR+AY NVG+YPFTSIF
Sbjct  852   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNAFLATRRLKILQRLAYLNVGIYPFTSIF  911

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+G FIVQTLD  FL YLL+IT+ L+L+++LEVKW+ I LEE WRNEQ
Sbjct  912   LIVYCFLPALSLFSGFFIVQTLDIAFLIYLLLITICLVLLAILEVKWSGIELEEWWRNEQ  971

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLI GTSAH AAV+QGLLKVIAGIEISFTLTSKSA +D DDIYADLY+VKWTSL I P+
Sbjct  972   FWLISGTSAHFAAVMQGLLKVIAGIEISFTLTSKSAGDDVDDIYADLYLVKWTSLMIPPI  1031

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I + N+ A+     R IYS +PQW+K  GGAFFSFWVLAHLYPFAKGLMGR+ K PTIV
Sbjct  1032  VIAMTNMIAMAFAFIRTIYSTVPQWSKFVGGAFFSFWVLAHLYPFAKGLMGRRRKTPTIV  1091

Query  156   YV  151
             +V
Sbjct  1092  FV  1093



>ref|XP_011042830.1| PREDICTED: cellulose synthase-like protein D5 [Populus euphratica]
Length=806

 Score =   367 bits (942),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 173/243 (71%), Positives = 210/243 (86%), Gaps = 1/243 (0%)
 Frame = -3

Query  876  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
            FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN   A+RR+KFLQR+AYFN G+YPFTS+F
Sbjct  534  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALFATRRMKFLQRVAYFNCGMYPFTSMF  593

Query  696  LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
            L+VYC +PA+  F+GQFIVQ+L+  FL  LL IT+TL L+++LE+KW+ I L + WRNEQ
Sbjct  594  LLVYCVLPAISLFSGQFIVQSLNVTFLVLLLAITITLCLLAILEIKWSGITLHDWWRNEQ  653

Query  516  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAA-EDEDDIYADLYVVKWTSLFIMP  340
            FWLIGGTSAH AAVLQGLLKVIAG++ISFTLTSKSA  ED DD +ADLYVVKW+ L + P
Sbjct  654  FWLIGGTSAHPAAVLQGLLKVIAGVDISFTLTSKSATPEDADDEFADLYVVKWSFLMVPP  713

Query  339  LTILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTI  160
            +TI+++N+ A+ +G +R +YS  PQW++L GG FFSFWVL+HLYPFAKGLMGR+G+VPTI
Sbjct  714  ITIMILNLIAIAVGVTRTMYSPFPQWSRLVGGVFFSFWVLSHLYPFAKGLMGRRGRVPTI  773

Query  159  VYV  151
            VYV
Sbjct  774  VYV  776



>gb|AFZ78590.1| cellulose synthase-like protein [Populus tomentosa]
Length=1126

 Score =   374 bits (959),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 181/242 (75%), Positives = 207/242 (86%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  LA+RRLK LQR+AY NVG+YPFTSIF
Sbjct  850   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNAFLATRRLKILQRLAYLNVGIYPFTSIF  909

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+G FIVQTLD  FL YLL+IT+ L+L+++LEVKW+ I LEE WRNEQ
Sbjct  910   LIVYCFLPALSLFSGFFIVQTLDIAFLIYLLLITICLVLLAILEVKWSGIELEEWWRNEQ  969

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLI GTSAH AAV+QGLLKVIAGIEISFTLTSKSA +D DDIYADLY+VKWTSL I P+
Sbjct  970   FWLISGTSAHFAAVMQGLLKVIAGIEISFTLTSKSAGDDVDDIYADLYLVKWTSLMIPPI  1029

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I + N+ A+     R IYS +PQW+K  GGAFFSFWVLAHLYPFAKGLMGR+ K PTIV
Sbjct  1030  VIAMTNMIAMAFAFIRTIYSTVPQWSKFVGGAFFSFWVLAHLYPFAKGLMGRRRKTPTIV  1089

Query  156   YV  151
             +V
Sbjct  1090  FV  1091



>ref|XP_010259829.1| PREDICTED: cellulose synthase-like protein D4 [Nelumbo nucifera]
Length=1125

 Score =   374 bits (959),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 181/242 (75%), Positives = 208/242 (86%), Gaps = 1/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  LA  RLKFLQR++Y NVGVYPFTS+F
Sbjct  849   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNAFLAKSRLKFLQRLSYINVGVYPFTSMF  908

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L++YCF+PA+  F+G FIVQTL+  FL YLLIIT+ L+ +++LEVKW+ IGLEE WRNEQ
Sbjct  909   LIMYCFLPALSLFSGHFIVQTLNVAFLVYLLIITICLISLAILEVKWSGIGLEEWWRNEQ  968

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLI GTSAHLAAV+QGLLKV+AGIEISFTLTSK A ED DDIYA+LY+VKWTSL I P+
Sbjct  969   FWLISGTSAHLAAVIQGLLKVMAGIEISFTLTSK-AVEDSDDIYAELYLVKWTSLMIPPI  1027

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI +VNI A+    +R +YS  PQWNK  GGAFFSFWVLAHLYPFAKGLMGR+ K PTIV
Sbjct  1028  TIAMVNIIAMFTAFARTVYSTTPQWNKFVGGAFFSFWVLAHLYPFAKGLMGRRRKTPTIV  1087

Query  156   YV  151
             +V
Sbjct  1088  FV  1089



>dbj|BAK08214.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=996

 Score =   371 bits (952),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 197/263 (75%), Positives = 234/263 (89%), Gaps = 0/263 (0%)
 Frame = -3

Query  876  FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
            FRGTAPINLTDRLHQVLRWATGSVEIFFS+NN  LASRRL FLQR++Y NVG+YPFTS+F
Sbjct  725  FRGTAPINLTDRLHQVLRWATGSVEIFFSKNNALLASRRLMFLQRMSYLNVGIYPFTSLF  784

Query  696  LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
            L++YC +PA+  F+GQFIV TLD  FLCYLL+I++TLML+ LLEVKW+ IGLEE WRNEQ
Sbjct  785  LIMYCLLPALSLFSGQFIVATLDPTFLCYLLLISITLMLLCLLEVKWSGIGLEEWWRNEQ  844

Query  516  FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
            FW+IGGTSAHLAAVLQGLLKV AGIEISFTLT+K+AAED+DD +A+LY++KWTSLFI PL
Sbjct  845  FWVIGGTSAHLAAVLQGLLKVAAGIEISFTLTAKAAAEDDDDPFAELYLIKWTSLFIPPL  904

Query  336  TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             I+ +NI A+V+G SR +Y+ IPQ++KL GG FFSFWVLAH YPFAKGLMGR+G+ PTIV
Sbjct  905  AIIGINIIAMVVGVSRCVYAEIPQYSKLLGGGFFSFWVLAHYYPFAKGLMGRRGRTPTIV  964

Query  156  YVwtgllsittsllwiSVNPPQD  88
            YVW GL+SIT SLLWI+++PP D
Sbjct  965  YVWAGLISITVSLLWITISPPDD  987



>ref|NP_001065498.1| Os10g0578200 [Oryza sativa Japonica Group]
 dbj|BAF27335.1| Os10g0578200, partial [Oryza sativa Japonica Group]
Length=257

 Score =   348 bits (894),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 177/243 (73%), Positives = 209/243 (86%), Gaps = 0/243 (0%)
 Frame = -3

Query  819  ATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIFLVVYCFIPAMCNFTGQFIV  640
            ATGSVEIFFSRNN   AS ++K LQRIAY NVG+YPFTS+FL+VYCF+PA+  F+GQFIV
Sbjct  1    ATGSVEIFFSRNNALFASSKMKVLQRIAYLNVGIYPFTSVFLIVYCFLPALSLFSGQFIV  60

Query  639  QTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQFWLIGGTSAHLAAVLQGLL  460
            QTL+  FL YLLIIT+TL L+++LE+KW+ I LEE WRNEQFWLIGGTSAHLAAVLQGLL
Sbjct  61   QTLNVTFLTYLLIITITLCLLAMLEIKWSGIALEEWWRNEQFWLIGGTSAHLAAVLQGLL  120

Query  459  KVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPLTILVVNIFALVIGCSRQIY  280
            KVIAGIEISFTLTSK   +D DD +A+LY VKWTSL I PLTI+++N+ A+ +G SR IY
Sbjct  121  KVIAGIEISFTLTSKQLGDDVDDEFAELYAVKWTSLMIPPLTIIMINLVAIAVGFSRTIY  180

Query  279  SVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIVYVwtgllsittsllwiSVN  100
            S IPQW+KL GG FFSFWVLAHLYPFAKGLMGR+G+ PTIVYVW+GL++IT SLLWI++ 
Sbjct  181  STIPQWSKLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIVYVWSGLVAITISLLWIAIK  240

Query  99   PPQ  91
            PP 
Sbjct  241  PPS  243



>ref|XP_002303441.1| cellulose synthase-like D1 family protein [Populus trichocarpa]
 gb|EEE78420.1| cellulose synthase-like D1 family protein [Populus trichocarpa]
Length=1094

 Score =   373 bits (957),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 180/242 (74%), Positives = 201/242 (83%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  L   RLK LQRIAY NVG+YPFTSIF
Sbjct  821   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNALLGGPRLKLLQRIAYLNVGIYPFTSIF  880

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             LVVYCFIPA   FT QFIV +L   FL YL II+VTL ++++LE+ W+ I LEE WRNEQ
Sbjct  881   LVVYCFIPAFSLFTNQFIVASLTVTFLVYLFIISVTLCILAVLEINWSGIELEEWWRNEQ  940

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSA +D DD ++DLY+ KWTSL I+P 
Sbjct  941   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAGDDADDEFSDLYLFKWTSLMILPC  1000

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
             TI++ N  A+ +G SR IYS  PQW+KL GG FFSFWVLAH YPF KGLMGR+GK PTI+
Sbjct  1001  TIIMTNFIAIAVGVSRTIYSEAPQWSKLLGGVFFSFWVLAHFYPFVKGLMGRRGKTPTII  1060

Query  156   YV  151
             YV
Sbjct  1061  YV  1062



>ref|XP_010474851.1| PREDICTED: cellulose synthase-like protein D5 [Camelina sativa]
Length=1190

 Score =   374 bits (961),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 191/263 (73%), Positives = 227/263 (86%), Gaps = 1/263 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN   A+RR+KFLQR+AYFNVG+YPFTS+F
Sbjct  917   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAIFATRRMKFLQRVAYFNVGMYPFTSLF  976

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYC +PA+  F+GQFIVQ+LD  FL +LL IT+TL ++SLLE+KW+ I L E WRNEQ
Sbjct  977   LIVYCILPAVSLFSGQFIVQSLDITFLIFLLAITLTLCMLSLLEIKWSGITLHEWWRNEQ  1036

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAA-EDEDDIYADLYVVKWTSLFIMP  340
             FW+IGGTSAH AAVLQGLLKVIAG+++SFTLTSKSA  ED DD YADLYVVKW+ L + P
Sbjct  1037  FWVIGGTSAHPAAVLQGLLKVIAGVDVSFTLTSKSATPEDGDDEYADLYVVKWSFLMVPP  1096

Query  339   LTILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTI  160
             LTI++VN+ A+ +G +R +YS  PQW+KL GG FFSFWVL HLYPFAKGLMGR+G+VPTI
Sbjct  1097  LTIMMVNMIAIAVGMARTLYSPFPQWSKLVGGVFFSFWVLCHLYPFAKGLMGRRGRVPTI  1156

Query  159   VYVwtgllsittsllwiSVNPPQ  91
             V+VW+GLLSI  SLLW+ +NPP 
Sbjct  1157  VFVWSGLLSIIVSLLWVYINPPS  1179



>gb|AAO64152.1| unknown protein [Arabidopsis thaliana]
Length=1072

 Score =   372 bits (956),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 176/242 (73%), Positives = 210/242 (87%), Gaps = 0/242 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRG+APINLTDRLHQVLRWATGSVEIFFSRNN  LAS+RLKFLQR+AY NVG+YPFTS+F
Sbjct  794   FRGSAPINLTDRLHQVLRWATGSVEIFFSRNNAILASKRLKFLQRLAYLNVGIYPFTSLF  853

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L++YCF+PA   F+GQFIV+TL   FL YLL+IT+ L+ +++LEVKW+ IGLEE WRNEQ
Sbjct  854   LILYCFLPAFSLFSGQFIVRTLSISFLVYLLMITICLIGLAVLEVKWSGIGLEEWWRNEQ  913

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             +WLI GTS+HL AV+QG+LKVIAGIEISFTLT+KS  +D +DIYADLY+VKW+SL I P+
Sbjct  914   WWLISGTSSHLYAVVQGVLKVIAGIEISFTLTTKSGGDDNEDIYADLYIVKWSSLMIPPI  973

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I +VNI A+V+   R IY  +PQW+KL GGAFFSFWVLAHLYPFAKGLMGR+GK PTIV
Sbjct  974   VIAMVNIIAIVVAFIRTIYQAVPQWSKLIGGAFFSFWVLAHLYPFAKGLMGRRGKTPTIV  1033

Query  156   YV  151
             +V
Sbjct  1034  FV  1035



>ref|XP_011084614.1| PREDICTED: cellulose synthase-like protein D3 [Sesamum indicum]
Length=1148

 Score =   374 bits (959),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 199/262 (76%), Positives = 232/262 (89%), Gaps = 0/262 (0%)
 Frame = -3

Query  876   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNPALASRRLKFLQRIAYFNVGVYPFTSIF  697
             FRGTAPINLTDRLHQVLRWATGSVEIFFSRNN  LAS R+K LQRIAY NVG+YPFTS+F
Sbjct  873   FRGTAPINLTDRLHQVLRWATGSVEIFFSRNNAFLASSRMKVLQRIAYLNVGIYPFTSVF  932

Query  696   LVVYCFIPAMCNFTGQFIVQTLDAEFLCYLLIITVTLMLISLLEVKWARIGLEELWRNEQ  517
             L+VYCF+PA+  F+GQFIVQTL+  FL YLLIIT+TL  +++LEVKW+ I LEE WRNEQ
Sbjct  933   LIVYCFLPALSLFSGQFIVQTLNVTFLIYLLIITMTLCALAVLEVKWSGIELEEWWRNEQ  992

Query  516   FWLIGGTSAHLAAVLQGLLKVIAGIEISFTLTSKSAAEDEDDIYADLYVVKWTSLFIMPL  337
             FWLIGGTSAHLAAV QGLLKVIAG+EISFTLTSKSA +DEDD +ADLY+VKWTSL I P+
Sbjct  993   FWLIGGTSAHLAAVFQGLLKVIAGVEISFTLTSKSAGDDEDDDFADLYMVKWTSLMIPPI  1052

Query  336   TILVVNIFALVIGCSRQIYSVIPQWNKLFGGAFFSFWVLAHLYPFAKGLMGRKGKVPTIV  157
              I++VN+ A+ +G SR IYSVIPQW++L GG FFSFWVLAHLYPFAKGLMGR+G+ PTIV
Sbjct  1053  VIIMVNLIAIAVGVSRTIYSVIPQWSRLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIV  1112

Query  156   YVwtgllsittsllwiSVNPPQ  91
             YVW+GL++IT SLLW+++NPP 
Sbjct  1113  YVWSGLIAITISLLWVAINPPS  1134



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1774205954430