BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7979_g2_i1 len=427 path=[1811:0-426]

Length=427
                                                                      Score     E

ref|XP_009800692.1|  PREDICTED: calcium-binding protein PBP1-like     49.7    3e-05   
ref|XP_009628799.1|  PREDICTED: calcium-binding protein PBP1-like     49.3    3e-05   
ref|XP_010247753.1|  PREDICTED: calcium-binding protein PBP1-like     48.1    1e-04   
ref|XP_004293492.1|  PREDICTED: calcium-binding protein PBP1-like     47.8    1e-04   
emb|CDP11867.1|  unnamed protein product                              47.4    2e-04   
ref|XP_002283303.1|  PREDICTED: calcium-binding protein PBP1          47.4    2e-04   Vitis vinifera
ref|XP_004248285.1|  PREDICTED: calcium-binding protein PBP1-like     47.8    2e-04   
ref|XP_002515741.1|  ccd1, putative                                   47.0    2e-04   Ricinus communis
ref|XP_006447438.1|  hypothetical protein CICLE_v10018128mg           46.6    3e-04   
emb|CBI20461.3|  unnamed protein product                              47.4    3e-04   
gb|EYU19179.1|  hypothetical protein MIMGU_mgv1a016452mg              46.6    4e-04   
ref|XP_010240990.1|  PREDICTED: calcium-binding protein PBP1          47.4    4e-04   
gb|KDP32212.1|  hypothetical protein JCGZ_13819                       45.4    5e-04   
ref|XP_009605846.1|  PREDICTED: calcium-binding protein PBP1-like     45.8    6e-04   
gb|KDP32213.1|  hypothetical protein JCGZ_13820                       45.8    6e-04   
gb|KHN36760.1|  Calcium-binding protein PBP1                          45.8    6e-04   
ref|NP_001238195.1|  uncharacterized protein LOC100306396             45.8    6e-04   
ref|XP_011100425.1|  PREDICTED: calcium-binding protein PBP1-like     45.8    6e-04   
ref|XP_008392213.1|  PREDICTED: calcium-binding protein PBP1-like     45.8    6e-04   
ref|XP_007212244.1|  hypothetical protein PRUPE_ppa013497mg           45.8    6e-04   
ref|XP_006362923.1|  PREDICTED: calcium-binding protein PBP1-like     45.8    7e-04   
ref|XP_009785189.1|  PREDICTED: calcium-binding protein PBP1-like     45.4    8e-04   
ref|XP_010062925.1|  PREDICTED: calcium-binding protein PBP1          45.8    8e-04   
ref|XP_003596532.1|  Centrin-2                                        45.4    0.001   
ref|XP_008226736.1|  PREDICTED: calcium-binding protein PBP1-like     45.4    0.001   



>ref|XP_009800692.1| PREDICTED: calcium-binding protein PBP1-like [Nicotiana sylvestris]
Length=119

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    MEFCVLMFRLSPELMHESEALLERLLQQDLNT  97
            MEFCVLMFRLSPELM ESE LLE  LQQ+  T
Sbjct  84   MEFCVLMFRLSPELMEESEDLLELALQQEFKT  115



>ref|XP_009628799.1| PREDICTED: calcium-binding protein PBP1-like [Nicotiana tomentosiformis]
Length=119

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    MEFCVLMFRLSPELMHESEALLERLLQQDLNT  97
            MEFCVLMFRLSPELM ESE LLE  LQQ+  T
Sbjct  84   MEFCVLMFRLSPELMEESEDLLELALQQEFKT  115



>ref|XP_010247753.1| PREDICTED: calcium-binding protein PBP1-like [Nelumbo nucifera]
Length=116

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    MEFCVLMFRLSPELMHESEALLERLLQQDL  91
            MEFCVLMFRLSP+LM ESE  LE  LQQD+
Sbjct  84   MEFCVLMFRLSPDLMEESEMYLEEALQQDM  113



>ref|XP_004293492.1| PREDICTED: calcium-binding protein PBP1-like [Fragaria vesca 
subsp. vesca]
Length=124

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    MEFCVLMFRLSPELMHESEALLERLLQQDLNT  97
            MEFCVLMFRLSPELM ES   LE+ LQ++LN+
Sbjct  88   MEFCVLMFRLSPELMEESWIWLEQGLQEELNS  119



>emb|CDP11867.1| unnamed protein product [Coffea canephora]
Length=120

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +2

Query  2    MEFCVLMFRLSPELMHESEALLERLLQQ  85
            MEFCVLMFRLSPELM ESEA L++ L+Q
Sbjct  85   MEFCVLMFRLSPELMQESEAWLDQALRQ  112



>ref|XP_002283303.1| PREDICTED: calcium-binding protein PBP1 [Vitis vinifera]
 emb|CAN77257.1| hypothetical protein VITISV_016389 [Vitis vinifera]
Length=117

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    MEFCVLMFRLSPELMHESEALLERLLQQDLNT  97
            MEFCVLMFRLSPELM ESE  LE  LQQ+L  
Sbjct  84   MEFCVLMFRLSPELMEESEFWLEEALQQELKN  115



>ref|XP_004248285.1| PREDICTED: calcium-binding protein PBP1-like [Solanum lycopersicum]
Length=165

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    MEFCVLMFRLSPELMHESEALLERLLQQDLNTADSWF  112
            MEFCVLMFRLSPELM +S+ LLE  LQQ+   +D  F
Sbjct  129  MEFCVLMFRLSPELMEQSQFLLEEALQQEFVDSDFSF  165



>ref|XP_002515741.1| ccd1, putative [Ricinus communis]
 gb|EEF46688.1| ccd1, putative [Ricinus communis]
Length=115

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    MEFCVLMFRLSPELMHESEALLERLLQQDLNT  97
            MEFCVLMFRLSP+LM ES A L+  L+++LN+
Sbjct  81   MEFCVLMFRLSPDLMQESRAWLQYALEEELNS  112



>ref|XP_006447438.1| hypothetical protein CICLE_v10018128mg [Citrus clementina]
 ref|XP_006469746.1| PREDICTED: calcium-binding protein PBP1-like [Citrus sinensis]
 gb|ESR60678.1| hypothetical protein CICLE_v10018128mg [Citrus clementina]
 gb|KDO39089.1| hypothetical protein CISIN_1g033580mg [Citrus sinensis]
Length=116

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    MEFCVLMFRLSPELMHESEALLERLLQQDLNTADS  106
            MEFCVLMFRLSP+LM ES+  L   L ++LN A S
Sbjct  79   MEFCVLMFRLSPQLMEESQLWLREALNEELNNAGS  113



>emb|CBI20461.3| unnamed protein product [Vitis vinifera]
Length=156

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    MEFCVLMFRLSPELMHESEALLERLLQQDLNT  97
            MEFCVLMFRLSPELM ESE  LE  LQQ+L  
Sbjct  123  MEFCVLMFRLSPELMEESEFWLEEALQQELKN  154



>gb|EYU19179.1| hypothetical protein MIMGU_mgv1a016452mg [Erythranthe guttata]
Length=121

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    MEFCVLMFRLSPELMHESEALLERLLQQDLNTADSWF  112
            MEFCVLMFRLSP+LM  S+ LLE  L QD    DS+F
Sbjct  85   MEFCVLMFRLSPDLMGHSQFLLEEALLQDHAFQDSFF  121



>ref|XP_010240990.1| PREDICTED: calcium-binding protein PBP1 [Nelumbo nucifera]
Length=175

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    MEFCVLMFRLSPELMHESEALLERLLQQDL  91
            MEFCVLMFRLSP+LM  SE  LE++LQQD 
Sbjct  143  MEFCVLMFRLSPDLMESSEMWLEQVLQQDF  172



>gb|KDP32212.1| hypothetical protein JCGZ_13819 [Jatropha curcas]
Length=70

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  2   MEFCVLMFRLSPELMHESEALLERLLQQDLNTA  100
           MEFCVLMFRLSP+LMHESE  L+  ++++L  +
Sbjct  36  MEFCVLMFRLSPQLMHESELWLKDAIEEELKNS  68



>ref|XP_009605846.1| PREDICTED: calcium-binding protein PBP1-like [Nicotiana tomentosiformis]
Length=117

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +2

Query  2    MEFCVLMFRLSPELMHESEALLERLLQQD  88
            MEFCVLMFRLSPELM +S+ LLE  L QD
Sbjct  84   MEFCVLMFRLSPELMEQSQFLLEEALNQD  112



>gb|KDP32213.1| hypothetical protein JCGZ_13820 [Jatropha curcas]
Length=113

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  2    MEFCVLMFRLSPELMHESEALLERLLQQDLNTA  100
            MEFCVLMFRLSP+LMHESE  L+  ++++L  +
Sbjct  79   MEFCVLMFRLSPQLMHESELWLKDAIEEELKNS  111



>gb|KHN36760.1| Calcium-binding protein PBP1 [Glycine soja]
Length=116

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    MEFCVLMFRLSPELMHESEALLERLLQQDL  91
            MEFCVLMFRLSPELM  S+  LE++LQQ+L
Sbjct  83   MEFCVLMFRLSPELMEGSKMWLEQVLQQEL  112



>ref|NP_001238195.1| uncharacterized protein LOC100306396 [Glycine max]
 gb|ACU14545.1| unknown [Glycine max]
Length=116

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    MEFCVLMFRLSPELMHESEALLERLLQQDL  91
            MEFCVLMFRLSPELM  S+  LE++LQQ+L
Sbjct  83   MEFCVLMFRLSPELMEGSKMWLEQVLQQEL  112



>ref|XP_011100425.1| PREDICTED: calcium-binding protein PBP1-like [Sesamum indicum]
Length=115

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +2

Query  2    MEFCVLMFRLSPELMHESEALLER  73
            MEFCVLMFRLSPELM +SEALL R
Sbjct  84   MEFCVLMFRLSPELMQQSEALLGR  107



>ref|XP_008392213.1| PREDICTED: calcium-binding protein PBP1-like [Malus domestica]
Length=119

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +2

Query  2    MEFCVLMFRLSPELMHESEALLERLLQQ  85
            MEFCVLMFRLSPELM ES+  LE  LQQ
Sbjct  86   MEFCVLMFRLSPELMDESKVWLEDALQQ  113



>ref|XP_007212244.1| hypothetical protein PRUPE_ppa013497mg [Prunus persica]
 gb|EMJ13443.1| hypothetical protein PRUPE_ppa013497mg [Prunus persica]
Length=119

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    MEFCVLMFRLSPELMHESEALLERLLQQDL  91
            MEFCVLMFRLSPELM ES   LE+ LQQ+L
Sbjct  86   MEFCVLMFRLSPELMDESRLWLEQALQQEL  115



>ref|XP_006362923.1| PREDICTED: calcium-binding protein PBP1-like [Solanum tuberosum]
Length=122

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    MEFCVLMFRLSPELMHESEALLERLLQQDLNTADSWF  112
            MEFCVLMFRLSPELM +S+ LLE  L Q+   +D  F
Sbjct  86   MEFCVLMFRLSPELMEQSQFLLEEALHQEFVDSDFSF  122



>ref|XP_009785189.1| PREDICTED: calcium-binding protein PBP1-like [Nicotiana sylvestris]
Length=117

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    MEFCVLMFRLSPELMHESEALLERLLQQDLN  94
            MEFCVLMFRLSPELM +S+  LE  L QD +
Sbjct  84   MEFCVLMFRLSPELMEQSQFFLEEALNQDFD  114



>ref|XP_010062925.1| PREDICTED: calcium-binding protein PBP1 [Eucalyptus grandis]
 gb|KCW70076.1| hypothetical protein EUGRSUZ_F03381 [Eucalyptus grandis]
Length=127

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    MEFCVLMFRLSPELMHESEALLERLLQQDLNT  97
            MEFCVLMFRLSPELM ++E+ LE  L+Q+L  
Sbjct  93   MEFCVLMFRLSPELMEDAESFLEDALEQELKA  124



>ref|XP_003596532.1| Centrin-2 [Medicago truncatula]
 gb|ACJ84099.1| unknown [Medicago truncatula]
 gb|AES66783.1| calcium-binding EF-hand protein [Medicago truncatula]
 gb|AFK36531.1| unknown [Medicago truncatula]
Length=118

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  2    MEFCVLMFRLSPELMHESEALLERLLQQDLNTA  100
            MEFCVLMFRLSPELM  S+  LE++LQQ++  +
Sbjct  85   MEFCVLMFRLSPELMDGSKMWLEQMLQQEVQDS  117



>ref|XP_008226736.1| PREDICTED: calcium-binding protein PBP1-like [Prunus mume]
Length=119

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    MEFCVLMFRLSPELMHESEALLERLLQQDL  91
            MEFCVLMFRLSPELM ES   LE  LQQ+L
Sbjct  86   MEFCVLMFRLSPELMDESRLWLEEALQQEL  115



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 509248079690