BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79758_g1_i1 len=554 path=[1:0-553]

Length=554
                                                                      Score     E

ref|XP_007158665.1|  hypothetical protein PHAVU_002G1723001g            132   2e-35   
ref|XP_007158666.1|  hypothetical protein PHAVU_002G1723001g            132   2e-35   
gb|ADU56819.1|  MADS-box protein AGL2 subfamily                         131   2e-35   
gb|EYU33468.1|  hypothetical protein MIMGU_mgv1a0126181mg               130   2e-35   
gb|AHC54144.1|  sepallata-like MADS box transcription factor 3          133   2e-35   
ref|XP_004170688.1|  PREDICTED: agamous-like MADS-box protein AGL...    129   3e-35   
ref|XP_009622386.1|  PREDICTED: MADS-box protein CMB1-like              130   3e-35   
emb|CAE46179.1|  AGL2-like MADS box transcription factor                132   7e-35   Elaeis guineensis
ref|XP_010532441.1|  PREDICTED: developmental protein SEPALLATA 3...    131   9e-35   
ref|XP_009773225.1|  PREDICTED: MADS-box protein CMB1-like isofor...    131   1e-34   
ref|XP_010532442.1|  PREDICTED: developmental protein SEPALLATA 3...    131   1e-34   
gb|EYU33467.1|  hypothetical protein MIMGU_mgv1a0126181mg               128   1e-34   
gb|AAC78282.1|  MADS box protein                                        130   2e-34   Eucalyptus grandis [rose gum]
ref|XP_008340236.1|  PREDICTED: agamous-like MADS-box protein AGL...    132   2e-34   
gb|KDO65669.1|  hypothetical protein CISIN_1g0246401mg                  127   3e-34   
ref|XP_006385889.1|  hypothetical protein POPTR_0003s16800g             127   3e-34   
ref|NP_001242742.1|  uncharacterized protein LOC100805078               131   3e-34   
ref|XP_010257958.1|  PREDICTED: developmental protein SEPALLATA 1       132   3e-34   
ref|XP_008340234.1|  PREDICTED: agamous-like MADS-box protein AGL...    132   3e-34   
gb|AGW23594.1|  MADS1                                                   132   3e-34   
emb|CDY03905.1|  BnaC07g11300D                                          132   4e-34   
gb|ACD39982.1|  MADS1                                                   132   4e-34   Carica papaya [mamon]
gb|AAX15918.1|  AGL9                                                    131   4e-34   Eschscholzia californica
ref|XP_011036099.1|  PREDICTED: agamous-like MADS-box protein AGL...    131   4e-34   
gb|KHG17252.1|  Developmental SEPALLATA 2 -like protein                 131   4e-34   
gb|AAN15182.1|  MADS box protein GHMADS-1                               131   4e-34   Gossypium hirsutum [American cotton]
ref|XP_004504398.1|  PREDICTED: agamous-like MADS-box protein AGL...    131   5e-34   
ref|XP_004504400.1|  PREDICTED: agamous-like MADS-box protein AGL...    131   5e-34   
ref|XP_004504397.1|  PREDICTED: agamous-like MADS-box protein AGL...    131   5e-34   
ref|XP_004504399.1|  PREDICTED: agamous-like MADS-box protein AGL...    131   5e-34   
gb|AEJ76841.1|  MADS17                                                  131   5e-34   
gb|AAC25922.1|  MADS-box protein 1                                      131   5e-34   Malus domestica [apple tree]
ref|XP_009372256.1|  PREDICTED: agamous-like MADS-box protein AGL...    132   5e-34   
gb|EPS70807.1|  hypothetical protein M569_03954                         132   5e-34   
ref|XP_010681125.1|  PREDICTED: MADS-box protein CMB1-like              131   5e-34   
emb|CAA64741.1|  DEFH49                                                 131   5e-34   Antirrhinum majus [garden snapdragon]
dbj|BAG55316.1|  transcription factor                                   131   5e-34   Petunia integrifolia subsp. inflata
ref|XP_010260833.1|  PREDICTED: MADS-box protein CMB1                   131   5e-34   
emb|CAL36576.1|  deficiens H49 homologue                                131   6e-34   Misopates orontium
ref|NP_001289529.1|  agamous-like MADS-box protein AGL9 homolog         131   6e-34   
gb|AHH28273.1|  MADS-box transcription factor                           129   6e-34   
sp|Q03489.2|AGL9_PETHY  RecName: Full=Agamous-like MADS-box prote...    131   6e-34   Petunia x hybrida [garden petunia]
ref|XP_009372255.1|  PREDICTED: agamous-like MADS-box protein AGL...    132   6e-34   
ref|XP_009600809.1|  PREDICTED: agamous-like MADS-box protein AGL...    131   6e-34   
ref|XP_006585131.1|  PREDICTED: MADS-box transcription factor 1-l...    131   6e-34   
ref|XP_006430949.1|  hypothetical protein CICLE_v10012593mg             131   6e-34   
gb|ACB69511.1|  SEPALLATA3-like MADS-box protein                        131   6e-34   Crocus sativus [saffron crocus]
ref|XP_011020782.1|  PREDICTED: agamous-like MADS-box protein AGL...    131   6e-34   
gb|EMT30881.1|  MADS-box transcription factor 7                         127   6e-34   
ref|XP_010917558.1|  PREDICTED: agamous-like MADS-box protein AGL...    131   6e-34   
dbj|BAO74162.1|  MADS-box transcription factor SEP1.2                   131   6e-34   
ref|XP_006579435.1|  PREDICTED: uncharacterized protein LOC100805...    131   7e-34   
ref|XP_010917559.1|  PREDICTED: agamous-like MADS-box protein AGL...    131   7e-34   
ref|XP_006579434.1|  PREDICTED: uncharacterized protein LOC100805...    131   7e-34   
ref|NP_001289232.1|  agamous-like MADS-box protein AGL9 homolog         131   7e-34   
gb|AEF59025.1|  MADS-1                                                  131   7e-34   
gb|AFX72879.1|  MADS-box protein SEP3                                   131   7e-34   
ref|XP_006579433.1|  PREDICTED: uncharacterized protein LOC100805...    131   7e-34   
ref|XP_006585132.1|  PREDICTED: MADS-box transcription factor 1-l...    131   7e-34   
ref|XP_006482430.1|  PREDICTED: developmental protein SEPALLATA 1...    131   7e-34   
ref|XP_006579436.1|  PREDICTED: uncharacterized protein LOC100805...    131   7e-34   
ref|XP_010531079.1|  PREDICTED: developmental protein SEPALLATA 3...    131   7e-34   
gb|AAX13298.1|  MADS box protein SEP3                                   131   7e-34   Lotus japonicus
gb|KHN34832.1|  MADS-box transcription factor 1                         131   7e-34   
ref|XP_004304204.1|  PREDICTED: developmental protein SEPALLATA 2...    131   7e-34   
ref|XP_006585129.1|  PREDICTED: MADS-box transcription factor 1-l...    131   7e-34   
gb|AAK21254.1|AF335241_1  MADS-box transcription factor FBP23           131   7e-34   Petunia x hybrida [garden petunia]
ref|NP_001185081.1|  MADs box transcription factor SEPALLATA3           130   7e-34   
ref|XP_006585130.1|  PREDICTED: MADS-box transcription factor 1-l...    131   7e-34   
gb|AEL33633.1|  SEPALLATA3                                              131   7e-34   
gb|ACB69512.1|  SEPALLATA3-like MADS-box protein                        130   8e-34   Crocus sativus [saffron crocus]
gb|AET04966.2|  MADS-box transcription factor                           131   8e-34   
ref|XP_010531071.1|  PREDICTED: developmental protein SEPALLATA 3...    131   8e-34   
ref|XP_010460483.1|  PREDICTED: developmental protein SEPALLATA 3...    131   8e-34   
ref|XP_010090648.1|  Agamous-like MADS-box protein AGL9-like protein    131   8e-34   
dbj|BAM36705.1|  MADS transcriptional factor SEP3 homolog               130   8e-34   
ref|XP_008801853.1|  PREDICTED: agamous-like MADS-box protein AGL...    130   8e-34   
gb|KHG25284.1|  Agamous-like MADS-box protein AGL9                      131   8e-34   
ref|XP_010460482.1|  PREDICTED: developmental protein SEPALLATA 3...    131   9e-34   
ref|XP_010530561.1|  PREDICTED: developmental protein SEPALLATA 3...    131   9e-34   
gb|AEJ76840.1|  MADS16                                                  130   9e-34   
ref|NP_564214.2|  MADs box transcription factor SEPALLATA3              131   9e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003531877.1|  PREDICTED: developmental protein SEPALLATA 1...    131   9e-34   
gb|ABC70706.1|  MADS-box transcription factor                           130   9e-34   Asparagus virgatus
gb|AGH61294.1|  sepallata 3                                             130   9e-34   
gb|AAF22138.1|AF129875_1  MADS box transcription factor MADS1           130   9e-34   Capsicum annuum
ref|XP_010530562.1|  PREDICTED: developmental protein SEPALLATA 3...    131   9e-34   
ref|XP_006585806.1|  PREDICTED: developmental protein SEPALLATA 1...    131   9e-34   
ref|NP_850953.1|  MADs box transcription factor SEPALLATA3              131   9e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007043949.1|  K-box region and MADS-box transcription fact...    130   9e-34   
gb|KFK44483.1|  developmental protein sepallata 3                       130   9e-34   
emb|CAX65570.1|  GRCD4 protein                                          130   9e-34   Gerbera hybrid cultivar
ref|XP_009102995.1|  PREDICTED: agamous-like MADS-box protein AGL...    131   9e-34   
gb|ADU56818.1|  MADS-box protein AGL2 subfamily                         129   1e-33   
gb|AEL33631.1|  SEPALLATA1                                              130   1e-33   
ref|XP_006415783.1|  hypothetical protein EUTSA_v10008591mg             130   1e-33   
gb|AEE60891.1|  MADS-box protein 5                                      130   1e-33   
gb|AAQ83834.1|  MADS box protein                                        130   1e-33   Asparagus officinalis
ref|XP_010913018.1|  PREDICTED: agamous-like MADS-box protein AGL...    130   1e-33   
ref|XP_007043947.1|  K-box region and MADS-box transcription fact...    130   1e-33   
gb|AAO22982.1|  MADS-box transcription factor CDM44                     130   1e-33   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_003552609.1|  PREDICTED: developmental protein SEPALLATA 1...    131   1e-33   
ref|XP_006602962.1|  PREDICTED: developmental protein SEPALLATA 1...    131   1e-33   
gb|AAK21247.1|AF335234_1  MADS-box transcription factor FBP4            130   1e-33   Petunia x hybrida [garden petunia]
gb|KDP41334.1|  hypothetical protein JCGZ_15741                         130   1e-33   
ref|XP_004140534.1|  PREDICTED: agamous-like MADS-box protein AGL...    130   1e-33   
ref|XP_008459849.1|  PREDICTED: agamous-like MADS-box protein AGL...    130   1e-33   
ref|XP_009102994.1|  PREDICTED: agamous-like MADS-box protein AGL...    130   1e-33   
ref|XP_010478051.1|  PREDICTED: developmental protein SEPALLATA 3...    130   1e-33   
emb|CDP02339.1|  unnamed protein product                                130   1e-33   
ref|NP_001284431.1|  agamous-like MADS-box protein AGL9 homolog         130   1e-33   
emb|CBI27678.3|  unnamed protein product                                130   1e-33   
ref|NP_001268114.1|  MADS-box protein 4                                 130   1e-33   
gb|ADU56817.1|  MADS-box protein AGL2 subfamily                         130   1e-33   
gb|AAF77579.1|AF072534_1  pepper MADS-box protein                       129   1e-33   Capsicum annuum
ref|XP_010478049.1|  PREDICTED: developmental protein SEPALLATA 3...    130   1e-33   
sp|O04067.1|AGL9_SINAL  RecName: Full=Agamous-like MADS-box prote...    130   1e-33   Sinapis alba [bai jie]
ref|XP_011086825.1|  PREDICTED: agamous-like MADS-box protein AGL...    130   1e-33   
ref|XP_010318407.1|  PREDICTED: MADS-box protein 1 isoform X1           130   1e-33   
ref|XP_009788128.1|  PREDICTED: MADS-box protein CMB1-like              130   1e-33   
ref|XP_002890717.1|  hypothetical protein ARALYDRAFT_472923             130   1e-33   
gb|AAX15924.1|  AGL9.2                                                  130   1e-33   Persea americana
dbj|BAN89460.1|  sepallata 3                                            130   1e-33   
ref|XP_011099041.1|  PREDICTED: developmental protein SEPALLATA 1...    130   1e-33   
ref|XP_006345102.1|  PREDICTED: MADS-box protein CMB1-like              130   1e-33   
ref|XP_006352168.1|  PREDICTED: agamous-like MADS-box protein AGL...    130   1e-33   
ref|XP_006400104.1|  hypothetical protein EUTSA_v10014493mg             130   1e-33   
ref|XP_011099040.1|  PREDICTED: developmental protein SEPALLATA 1...    130   1e-33   
ref|XP_006437995.1|  hypothetical protein CICLE_v10032507mg             130   1e-33   
ref|NP_001234384.1|  agamous-like MADS-box protein AGL9 homolog         130   1e-33   
ref|XP_006437996.1|  hypothetical protein CICLE_v10032507mg             130   1e-33   
ref|XP_008801852.1|  PREDICTED: agamous-like MADS-box protein AGL...    130   1e-33   
gb|KDP31378.1|  hypothetical protein JCGZ_11754                         129   1e-33   
ref|XP_006437997.1|  hypothetical protein CICLE_v10032507mg             130   1e-33   
ref|XP_010499201.1|  PREDICTED: developmental protein SEPALLATA 3...    130   1e-33   
gb|EPS57613.1|  hypothetical protein M569_17204                         125   1e-33   
gb|AFU81296.1|  SEPALLATA3                                              130   1e-33   
ref|XP_010653929.1|  PREDICTED: MADS-box protein 4 isoform X1           130   1e-33   
ref|XP_007032865.1|  K-box region and MADS-box transcription fact...    130   1e-33   
ref|XP_010499198.1|  PREDICTED: developmental protein SEPALLATA 3...    130   1e-33   
gb|AFS60087.1|  MADS box transcription factor SEP2                      129   1e-33   
ref|XP_006437994.1|  hypothetical protein CICLE_v10032507mg             130   1e-33   
ref|XP_006484143.1|  PREDICTED: agamous-like MADS-box protein AGL...    130   1e-33   
ref|XP_010250667.1|  PREDICTED: agamous-like MADS-box protein AGL...    130   1e-33   
gb|AEX92976.1|  MADS box protein 1                                      130   1e-33   
emb|CDY15724.1|  BnaA07g08950D                                          130   1e-33   
ref|XP_010499199.1|  PREDICTED: developmental protein SEPALLATA 3...    130   2e-33   
gb|AAZ95252.1|  MADS box protein SEP1                                   130   2e-33   Dendrobium crumenatum
gb|AAQ72506.1|  MADS-box protein 12                                     125   2e-33   Petunia x hybrida [garden petunia]
ref|NP_001234380.1|  MADS-box protein 1                                 130   2e-33   
gb|ADC79703.1|  SEPALLATA3-like protein                                 130   2e-33   Pachysandra terminalis
gb|ACJ83943.1|  unknown                                                 129   2e-33   Medicago truncatula
gb|AEW50208.1|  SEP1                                                    130   2e-33   
emb|CAC81072.1|  MADS box transcription factor                          130   2e-33   Daucus carota subsp. sativus
gb|ADU56820.1|  MADS-box protein AGL2 subfamily                         130   2e-33   
ref|XP_010913017.1|  PREDICTED: agamous-like MADS-box protein AGL...    130   2e-33   
ref|XP_007043948.1|  K-box region and MADS-box transcription fact...    130   2e-33   
gb|AHW58033.1|  SEP4                                                    130   2e-33   
emb|CAX65571.1|  GRCD5 protein                                          130   2e-33   Gerbera hybrid cultivar
gb|KCW86946.1|  hypothetical protein EUGRSUZ_B03516                     125   2e-33   
gb|AIU94434.1|  MADS-box transcription factor 2 isoform 2               130   2e-33   
gb|AHW58036.1|  SEP1/2                                                  130   2e-33   
gb|KFK25803.1|  hypothetical protein AALP_AA8G163200                    130   2e-33   
gb|ABI60898.1|  MADS-box transcription factor                           130   2e-33   Arachis hypogaea [goober]
ref|XP_007139420.1|  hypothetical protein PHAVU_008G027900g             130   2e-33   
gb|AGW23364.1|  MADS box protein MADS62                                 130   2e-33   
ref|XP_002873742.1|  hypothetical protein ARALYDRAFT_909555             130   2e-33   
ref|NP_568322.1|  MADS box transcription factor SEPALLATA 1             130   2e-33   Arabidopsis thaliana [mouse-ear cress]
emb|CDP00462.1|  unnamed protein product                                129   2e-33   
ref|XP_004490239.1|  PREDICTED: MADS-box protein CMB1-like isofor...    129   2e-33   
ref|XP_009788435.1|  PREDICTED: MADS-box protein CMB1-like              129   2e-33   
ref|XP_010025293.1|  PREDICTED: agamous-like MADS-box protein AGL...    130   2e-33   
ref|XP_011021072.1|  PREDICTED: developmental protein SEPALLATA 2...    129   2e-33   
sp|Q42464.1|AGL9_SOLLC  RecName: Full=Agamous-like MADS-box prote...    129   2e-33   Solanum lycopersicum
gb|AAA32732.1|  transcription factor                                    129   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001280893.1|  developmental protein SEPALLATA 1                  129   3e-33   
ref|XP_004490238.1|  PREDICTED: MADS-box protein CMB1-like isofor...    129   3e-33   
ref|XP_010025292.1|  PREDICTED: agamous-like MADS-box protein AGL...    130   3e-33   
ref|XP_004502274.1|  PREDICTED: MADS-box transcription factor 1-l...    129   3e-33   
gb|KHG04329.1|  MADS-box CMB1                                           129   3e-33   
ref|XP_009373782.1|  PREDICTED: developmental protein SEPALLATA 1...    129   3e-33   
ref|XP_004502275.1|  PREDICTED: MADS-box transcription factor 1-l...    129   3e-33   
ref|XP_009373783.1|  PREDICTED: developmental protein SEPALLATA 1...    129   3e-33   
ref|XP_009415892.1|  PREDICTED: agamous-like MADS-box protein AGL...    129   3e-33   
gb|AEN75254.1|  transcription factor MADS3                              129   3e-33   
ref|XP_007151388.1|  hypothetical protein PHAVU_004G042300g             129   3e-33   
gb|ACJ64678.1|  MADS-box protein MADS2                                  129   3e-33   Musa acuminata AAA Group [Cavendish banana]
ref|XP_004490237.1|  PREDICTED: MADS-box protein CMB1-like isofor...    129   3e-33   
ref|XP_004137606.1|  PREDICTED: MADS-box transcription factor 8-like    128   3e-33   
emb|CAN59955.1|  hypothetical protein VITISV_006723                     129   3e-33   Vitis vinifera
emb|CAA64743.1|  DEFH200                                                129   3e-33   Antirrhinum majus [garden snapdragon]
ref|XP_007045799.1|  MADS-box transcription factor                      129   3e-33   
ref|XP_009131500.1|  PREDICTED: developmental protein SEPALLATA 1...    129   3e-33   
gb|AIU94433.1|  MADS-box transcription factor 2 isoform 1               129   3e-33   
gb|AHH28266.1|  MADS-box transcription factor                           129   3e-33   
ref|XP_010558530.1|  PREDICTED: developmental protein SEPALLATA 1       129   3e-33   
gb|KCW48935.1|  hypothetical protein EUGRSUZ_K02546                     129   3e-33   
gb|AIU94432.1|  MADS-box transcription factor 2 isoform 3               129   3e-33   
gb|AIU94430.1|  MADS-box transcription factor 2 isoform 2               129   3e-33   
ref|NP_001267667.1|  developmental protein SEPALLATA 2-like             129   3e-33   
ref|XP_009121545.1|  PREDICTED: developmental protein SEPALLATA 1       129   3e-33   
gb|ADC79704.1|  SEPALLATA3-like protein                                 129   3e-33   Pachysandra terminalis
gb|AAY21913.2|  putative MADS box protein                               129   3e-33   Musa acuminata [banana]
ref|XP_004154725.1|  PREDICTED: developmental protein SEPALLATA 2...    129   3e-33   
gb|AAX15920.1|  AGL9                                                    129   3e-33   Liriodendron tulipifera
gb|ACB69509.1|  SEPALLATA3-like MADS-box protein                        129   3e-33   Crocus sativus [saffron crocus]
ref|XP_009419371.1|  PREDICTED: agamous-like MADS-box protein AGL...    129   3e-33   
ref|XP_008801851.1|  PREDICTED: agamous-like MADS-box protein AGL...    130   3e-33   
gb|KFK37664.1|  hypothetical protein AALP_AA3G012500                    126   3e-33   
gb|AGS42240.1|  MADS-box protein                                        129   3e-33   
ref|XP_002306051.2|  hypothetical protein POPTR_0004s11440g             129   3e-33   Populus trichocarpa [western balsam poplar]
gb|AEL33632.1|  SEPALLATA2                                              129   3e-33   
ref|XP_008222191.1|  PREDICTED: agamous-like MADS-box protein AGL...    129   4e-33   
gb|ABD19719.1|  SEP3-like MADS-box protein                              129   4e-33   Taihangia rupestris
gb|AAQ72498.1|  MADS-box protein 12                                     129   4e-33   Petunia x hybrida [garden petunia]
ref|XP_007223808.1|  hypothetical protein PRUPE_ppa010679mg             129   4e-33   
ref|XP_003601749.1|  MADS-box transcription factor                      129   4e-33   
ref|XP_008230292.1|  PREDICTED: developmental protein SEPALLATA 1...    129   4e-33   
gb|AAL08423.2|AF185574_1  transcription factor MAGL4                    129   4e-33   Populus tremuloides
ref|XP_008230291.1|  PREDICTED: developmental protein SEPALLATA 1...    129   4e-33   
ref|XP_007215876.1|  hypothetical protein PRUPE_ppa010548mg             129   4e-33   
dbj|BAC80255.1|  MADS-box transcription factor                          129   4e-33   Houttuynia cordata [chameleon-plant]
ref|NP_001280756.1|  agamous-like MADS-box protein AGL9 homolog         129   4e-33   
gb|ABG78619.1|  MADS4                                                   129   4e-33   Populus tomentosa [Chinese white poplar]
gb|KHN15201.1|  MADS-box protein CMB1                                   129   5e-33   
gb|ACB69510.1|  SEPALLATA3-like MADS-box protein                        129   5e-33   Crocus sativus [saffron crocus]
ref|NP_001119230.1|  MADS box transcription factor SEPALLATA 1          129   5e-33   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001268109.1|  MADS-box protein 2                                 129   5e-33   
ref|XP_006856372.1|  hypothetical protein AMTR_s00047p00190220          129   5e-33   
ref|NP_001242365.1|  uncharacterized protein LOC100797819               129   5e-33   
gb|AAY30858.1|  MADS-box transcription factor                           129   5e-33   Prunus dulcis [sweet almond]
gb|ABD17386.1|  MADS-box protein SEP3-1                                 130   5e-33   Taihangia rupestris
ref|XP_007155209.1|  hypothetical protein PHAVU_003G182800g             129   5e-33   
ref|XP_008230289.1|  PREDICTED: developmental protein SEPALLATA 1...    129   5e-33   
ref|XP_006848294.1|  hypothetical protein AMTR_s00013p00103080          129   5e-33   
gb|AHM92085.1|  MADS-box protein 9                                      129   5e-33   
gb|AAD09206.1|  putative MADS-box family transcription factor           129   5e-33   Pinus radiata
dbj|BAO74164.1|  MADS-box transcription factor SEP3.2                   129   5e-33   
emb|CDY26462.1|  BnaC09g42060D                                          129   5e-33   
ref|XP_010660492.1|  PREDICTED: MADS-box protein 2 isoform X1           129   5e-33   
ref|XP_009773224.1|  PREDICTED: MADS-box protein CMB1-like isofor...    129   5e-33   
gb|AFM30904.1|  transcription factor MADS4                              129   5e-33   
gb|KHN18378.1|  MADS-box protein CMB1                                   129   5e-33   
emb|CDX78653.1|  BnaA03g05650D                                          129   5e-33   
ref|XP_003549578.1|  PREDICTED: MADS-box protein CMB1-like              129   5e-33   
gb|AHW52536.1|  SEPALLATA-like MADS-box protein 1                       129   5e-33   
ref|XP_009773223.1|  PREDICTED: MADS-box protein CMB1-like isofor...    129   5e-33   
ref|XP_010678363.1|  PREDICTED: MADS-box protein CMB1-like              129   5e-33   
ref|XP_008230290.1|  PREDICTED: developmental protein SEPALLATA 1...    129   5e-33   
ref|XP_008801850.1|  PREDICTED: agamous-like MADS-box protein AGL...    129   6e-33   
sp|O65874.1|MTF1_PEA  RecName: Full=MADS-box transcription factor 1     129   6e-33   Pisum sativum [garden pea]
ref|XP_007215877.1|  hypothetical protein PRUPE_ppa010548mg             129   6e-33   
gb|AHJ80843.1|  SEPALLATA3                                              129   6e-33   
dbj|BAD10945.1|  SEPALLATA3 homologous protein                          129   6e-33   Silene latifolia
gb|ADR83588.1|  Sepallata 1-like protein                                129   6e-33   
ref|XP_004507287.1|  PREDICTED: developmental protein SEPALLATA 1...    129   6e-33   
ref|XP_010460481.1|  PREDICTED: developmental protein SEPALLATA 3...    129   6e-33   
ref|XP_004507289.1|  PREDICTED: developmental protein SEPALLATA 1...    129   6e-33   
ref|XP_010460480.1|  PREDICTED: developmental protein SEPALLATA 3...    129   6e-33   
ref|XP_007037631.1|  K-box region and MADS-box transcription fact...    132   6e-33   
ref|XP_003630490.1|  MADS-box transcription factor                      130   7e-33   
ref|XP_004507288.1|  PREDICTED: developmental protein SEPALLATA 1...    129   7e-33   
gb|AFH66785.1|  SEP-like MADS-box protein                               128   7e-33   
dbj|BAM34478.1|  MADS-box transcription factor                          128   7e-33   
ref|XP_010099309.1|  Developmental protein SEPALLATA 2                  128   7e-33   
emb|CAN84110.1|  hypothetical protein VITISV_036170                     128   7e-33   Vitis vinifera
ref|NP_001289642.1|  developmental protein SEPALLATA 1-like             128   7e-33   
ref|XP_007151389.1|  hypothetical protein PHAVU_004G042300g             128   7e-33   
gb|AJC01940.1|  MADS-box protein                                        128   7e-33   
gb|KEH25149.1|  MADS-box transcription factor                           129   7e-33   
ref|XP_009598871.1|  PREDICTED: MADS-box protein CMB1-like              128   7e-33   
gb|ACB45304.1|  MIKC-type MADS-box transcription factor WM10A           129   7e-33   Hordeum vulgare [barley]
ref|XP_002263410.2|  PREDICTED: MADS-box protein CMB1                   128   7e-33   Vitis vinifera
emb|CDX69499.1|  BnaA10g18480D                                          129   7e-33   
gb|KDO70302.1|  hypothetical protein CISIN_1g0260431mg                  123   8e-33   
ref|XP_010478050.1|  PREDICTED: developmental protein SEPALLATA 3...    129   8e-33   
ref|XP_009615088.1|  PREDICTED: MADS-box protein CMB1-like isofor...    128   8e-33   
ref|XP_010478048.1|  PREDICTED: developmental protein SEPALLATA 3...    128   8e-33   
gb|AAF13260.1|AF198174_1  MADS box protein DOMADS1                      126   8e-33   Dendrobium grex Madame Thong-In
gb|AHM92067.1|  MADS-box protein 7                                      128   8e-33   
ref|XP_010499200.1|  PREDICTED: developmental protein SEPALLATA 3...    128   8e-33   
ref|XP_010499195.1|  PREDICTED: developmental protein SEPALLATA 3...    128   9e-33   
ref|XP_009761698.1|  PREDICTED: MADS-box protein CMB1-like              128   9e-33   
ref|XP_010499197.1|  PREDICTED: developmental protein SEPALLATA 3...    128   9e-33   
ref|XP_010319477.1|  PREDICTED: MADS-box protein CMB1 isoform X2        127   9e-33   
gb|ADF49576.1|  transcription factor MADS-box 2                         128   1e-32   
ref|XP_009615091.1|  PREDICTED: MADS-box protein CMB1-like isofor...    127   1e-32   
gb|AAK21249.1|AF335236_1  MADS-box transcription factor FBP9            128   1e-32   
ref|XP_010320555.1|  PREDICTED: MADS-box transcription factor iso...    127   1e-32   
gb|ACJ64681.1|  MADS-box protein MADS4                                  128   1e-32   
ref|XP_009615089.1|  PREDICTED: MADS-box protein CMB1-like isofor...    127   1e-32   
ref|XP_004974003.1|  PREDICTED: MADS-box transcription factor 7-like    128   1e-32   
gb|KHG12954.1|  MADS-box CMB1                                           128   1e-32   
gb|AIC33052.1|  flower development transporter SEP3                     128   1e-32   
ref|XP_011014957.1|  PREDICTED: developmental protein SEPALLATA 2...    128   1e-32   
gb|AAZ77748.1|  AGL2-like MADS box 3                                    128   1e-32   
gb|ABF67487.1|  MADS-domain transcription factor                        128   1e-32   
gb|ADC79706.1|  SEPALLATA3-like protein                                 128   1e-32   
ref|XP_008453505.1|  PREDICTED: MADS-box protein CMB1-like isofor...    128   1e-32   
gb|ADP09004.1|  SEP3-like protein                                       127   1e-32   
gb|KDP26829.1|  hypothetical protein JCGZ_17987                         128   1e-32   
sp|Q0J466.2|MADS7_ORYSJ  RecName: Full=MADS-box transcription fac...    128   1e-32   
gb|EEC84853.1|  hypothetical protein OsI_31966                          128   1e-32   
gb|AAQ11687.1|  MADS box protein                                        128   1e-32   
gb|EMT12289.1|  MADS-box transcription factor 8                         128   1e-32   
ref|NP_001289804.1|  MADS-box transcription factor 8                    127   1e-32   
ref|NP_001063613.1|  Os09g0507200                                       127   1e-32   
ref|XP_003621519.1|  MADS-box protein                                   127   1e-32   
ref|NP_001234201.1|  TAGL2 transcription factor                         127   1e-32   
ref|XP_008341807.1|  PREDICTED: developmental protein SEPALLATA 1...    127   1e-32   
gb|AHW52538.1|  SEPALLATA-like MADS-box protein 3                       127   1e-32   
emb|CAM59053.1|  MIKC-type MADS-box transcription factor WM10A          127   2e-32   
ref|XP_003518786.1|  PREDICTED: developmental protein SEPALLATA 1...    127   2e-32   
gb|ACA24481.1|  agamous-like 9 protein 1                                127   2e-32   
ref|XP_006660815.1|  PREDICTED: MADS-box transcription factor 8-like    127   2e-32   
gb|AFU61112.1|  MADS-box transcription factor MADS-RIN                  127   2e-32   
gb|AES77737.2|  MADS-box transcription factor                           127   2e-32   
gb|AFS60086.1|  MADS box transcription factor SEP1                      127   2e-32   
gb|AFU81295.1|  SEPALLATA1                                              127   2e-32   
ref|XP_010233642.1|  PREDICTED: MADS-box transcription factor 7-l...    127   2e-32   
ref|NP_001288311.1|  MADS-box transcription factor 7-like               127   2e-32   
emb|CAB97355.1|  MADS-box protein 9                                     127   2e-32   
ref|XP_006363565.1|  PREDICTED: MADS-box protein CMB1-like              127   2e-32   
ref|XP_009625300.1|  PREDICTED: MADS-box protein CMB1-like              127   2e-32   
gb|ADC79707.1|  SEPALLATA1-like protein                                 127   2e-32   
ref|XP_010682730.1|  PREDICTED: agamous-like MADS-box protein AGL...    127   2e-32   
ref|XP_010682728.1|  PREDICTED: agamous-like MADS-box protein AGL...    127   2e-32   
gb|ABF57929.1|  MADS-box transcription factor TaAGL28                   127   2e-32   
gb|AAX69068.1|  MADS box protein M6                                     127   2e-32   
ref|XP_006408426.1|  hypothetical protein EUTSA_v10021390mg             127   2e-32   
gb|ADC79693.1|  SEPALLATA1-like protein                                 127   2e-32   
ref|XP_010682729.1|  PREDICTED: agamous-like MADS-box protein AGL...    127   2e-32   
ref|XP_006659622.1|  PREDICTED: MADS-box transcription factor 7-like    127   2e-32   
gb|ABQ85951.1|  MADS-box transcription factor SEP-like 2                127   2e-32   
gb|AAF13262.1|AF198176_1  MADS box protein DOMADS3                      126   2e-32   
gb|AAO45877.1|  MADS5                                                   127   2e-32   
gb|AEJ76842.1|  MADS18                                                  127   2e-32   
ref|XP_009757152.1|  PREDICTED: developmental protein SEPALLATA 1...    127   2e-32   
gb|ABF57932.1|  MADS-box transcription factor TaAGL30                   127   2e-32   
ref|XP_009757151.1|  PREDICTED: developmental protein SEPALLATA 1...    127   2e-32   
dbj|BAF75018.1|  MADS-box protein                                       127   2e-32   
gb|ABF57918.1|  MADS-box transcription factor TaAGL16                   127   2e-32   
ref|XP_010694117.1|  PREDICTED: developmental protein SEPALLATA 1...    127   2e-32   
gb|AAO49811.1|  SEP3-related MADS-box protein                           127   2e-32   
dbj|BAF75017.1|  MADS-box protein                                       127   2e-32   
dbj|BAF75016.1|  MADS-box protein                                       127   2e-32   
emb|CAH04878.1|  MADS domain protein                                    127   2e-32   
gb|AAC49816.2|  MADS box protein                                        127   2e-32   
ref|XP_010694125.1|  PREDICTED: developmental protein SEPALLATA 1...    127   3e-32   
ref|XP_004237061.1|  PREDICTED: MADS-box protein CMB1 isoform X1        127   3e-32   
gb|AHH28272.1|  MADS-box transcription factor                           127   3e-32   
gb|EMS49687.1|  MADS-box transcription factor 7                         127   3e-32   
gb|ABD17387.1|  MADS-box protein SEP3                                   127   3e-32   
gb|ABE02212.1|  SEP-like                                                127   3e-32   
ref|XP_010694134.1|  PREDICTED: developmental protein SEPALLATA 1...    127   3e-32   
gb|EMS66516.1|  MADS-box transcription factor 8                         123   3e-32   
gb|AAZ20812.1|  MADS1                                                   126   3e-32   
ref|XP_006288512.1|  hypothetical protein CARUB_v10001783mg             127   3e-32   
ref|XP_003544012.1|  PREDICTED: developmental protein SEPALLATA 1...    127   3e-32   
ref|XP_006593703.1|  PREDICTED: developmental protein SEPALLATA 1...    127   3e-32   
ref|XP_004491903.1|  PREDICTED: developmental protein SEPALLATA 1...    127   3e-32   
gb|AEX58640.1|  AGL2-2                                                  127   3e-32   
ref|XP_011018962.1|  PREDICTED: MADS-box protein CMB1-like              126   3e-32   
ref|XP_010420253.1|  PREDICTED: developmental protein SEPALLATA 1...    127   3e-32   
ref|XP_010453727.1|  PREDICTED: developmental protein SEPALLATA 1       127   3e-32   
gb|ADU15477.1|  SEP3                                                    127   3e-32   
sp|Q39685.1|CMB1_DIACA  RecName: Full=MADS-box protein CMB1             126   3e-32   
gb|AHY82573.1|  MADS-box protein 6                                      126   3e-32   
ref|XP_004491904.1|  PREDICTED: developmental protein SEPALLATA 1...    127   4e-32   
ref|NP_001281016.1|  MADS-box protein CMB1-like                         127   4e-32   
emb|CAA04323.1|  MADS-box protein                                       127   4e-32   
ref|XP_007209505.1|  hypothetical protein PRUPE_ppa010391mg             127   4e-32   
gb|ADU15478.1|  SEP1                                                    126   4e-32   
ref|XP_006603756.1|  PREDICTED: MADS-box protein isoform X1             126   4e-32   
gb|KHN24051.1|  MADS-box transcription factor 1                         126   4e-32   
ref|NP_001236390.1|  MADS transcription factor                          126   4e-32   
gb|AAU82031.1|  SEPALLATA2                                              126   4e-32   
gb|ABD60322.1|  SEP2                                                    127   4e-32   
ref|XP_010315869.1|  PREDICTED: MADS-box protein isoform X1             126   4e-32   
ref|XP_009337956.1|  PREDICTED: MADS-box protein CMB1-like              126   4e-32   
dbj|BAM71399.1|  transcription factor                                   126   4e-32   
ref|NP_001238296.1|  MADS-box protein                                   126   4e-32   
gb|AAX15922.1|  AGL2                                                    126   4e-32   
gb|ACA24482.1|  agamous-like 9 protein 2                                126   4e-32   
ref|XP_003538541.1|  PREDICTED: MADS-box transcription factor 1-l...    126   4e-32   
ref|XP_006338336.1|  PREDICTED: developmental protein SEPALLATA 1...    126   4e-32   
gb|ACU13166.1|  unknown                                                 125   4e-32   
gb|AHW58034.1|  SEP3                                                    126   4e-32   
ref|XP_009608617.1|  PREDICTED: developmental protein SEPALLATA 1...    126   4e-32   
ref|XP_010463632.1|  PREDICTED: developmental protein SEPALLATA 2...    126   4e-32   
gb|AFX72877.1|  MADS-box protein SEP2A                                  126   4e-32   
ref|NP_001233911.1|  MADS-box protein                                   126   4e-32   
gb|AGT21645.1|  PFRIN                                                   126   4e-32   
ref|XP_006591442.1|  PREDICTED: MADS-box transcription factor 1-l...    126   4e-32   
ref|XP_009608616.1|  PREDICTED: developmental protein SEPALLATA 1...    126   4e-32   
ref|NP_973411.1|  protein SEPALLATA 4                                   125   4e-32   
ref|XP_002311352.1|  MADS-box protein 4                                 126   4e-32   
ref|XP_009608615.1|  PREDICTED: developmental protein SEPALLATA 1...    126   4e-32   
ref|XP_010485469.1|  PREDICTED: developmental protein SEPALLATA 2       126   4e-32   
gb|AAT46095.1|  SEPALLATA-like protein                                  126   4e-32   
gb|AAB50187.1|  MADS box transcription factor SbMADS1                   126   4e-32   
gb|AAU82009.1|  SEPALLATA2                                              126   4e-32   
ref|XP_008240082.1|  PREDICTED: MADS-box protein CMB1-like              126   4e-32   
ref|XP_009147359.1|  PREDICTED: developmental protein SEPALLATA 2...    126   5e-32   
gb|AGT20511.1|  SEP2.a                                                  126   5e-32   
emb|CAA75241.1|  M79 protein                                            126   5e-32   
emb|CDX70651.1|  BnaC03g07350D                                          127   5e-32   
gb|AEO45959.1|  SEPALLATA3-like protein                                 126   5e-32   
ref|NP_186880.1|  developmental protein SEPALLATA 2                     126   5e-32   
emb|CDY34718.1|  BnaA01g33070D                                          126   5e-32   
ref|NP_001234670.1|  MADS-box transcription factor                      126   5e-32   
dbj|BAD38890.1|  MADS box transcription factor                          126   5e-32   
gb|AHW52537.1|  SEPALLATA-like MADS-box protein 2                       126   5e-32   
gb|AAO42085.1|  putative floral homeotic protein AGL4                   126   5e-32   
ref|XP_006484242.1|  PREDICTED: developmental protein SEPALLATA 1...    126   5e-32   
dbj|BAC80254.1|  MADS-box transcription factor                          126   5e-32   
ref|XP_006298399.1|  hypothetical protein CARUB_v10014470mg             126   5e-32   
ref|XP_009117898.1|  PREDICTED: developmental protein SEPALLATA 2       126   5e-32   
emb|CAA64742.1|  DEFH72                                                 126   5e-32   
gb|AIU94287.1|  SEPALLATA1-like protein                                 126   5e-32   
gb|AGW23350.1|  MADS box protein MADS48                                 126   5e-32   
gb|AGT20512.1|  SEP2.b                                                  126   5e-32   
gb|ABJ98752.1|  MADS-box transcription factor MADS-RIN                  126   5e-32   
ref|XP_010470619.1|  PREDICTED: developmental protein SEPALLATA 2...    126   5e-32   
gb|AEX58639.1|  AGL2-1                                                  126   5e-32   
ref|XP_002884314.1|  SEPALLATA2                                         126   5e-32   
ref|XP_006484241.1|  PREDICTED: developmental protein SEPALLATA 1...    126   6e-32   
gb|AIE44769.1|  putative MADS-domain transcription factor AGL2          126   6e-32   
ref|XP_006484240.1|  PREDICTED: developmental protein SEPALLATA 1...    126   6e-32   
ref|XP_007153483.1|  hypothetical protein PHAVU_003G039400g             121   6e-32   
emb|CDY27603.1|  BnaA09g28040D                                          126   6e-32   
ref|XP_006437878.1|  hypothetical protein CICLE_v10032572mg             126   6e-32   
ref|NP_001062335.1|  Os08g0531700                                       127   6e-32   
gb|AHC54151.1|  sepallata-like MADS box transcription factor 3          123   6e-32   
gb|ADC79694.1|  SEPALLATA1-like protein                                 126   6e-32   
ref|XP_009113783.1|  PREDICTED: agamous-like MADS-box protein AGL...    126   6e-32   
ref|XP_009113782.1|  PREDICTED: agamous-like MADS-box protein AGL...    126   6e-32   
ref|XP_004299281.1|  PREDICTED: MADS-box protein CMB1-like              126   6e-32   
gb|AAT37485.1|  MADS6 protein                                           126   6e-32   
ref|XP_006477713.1|  PREDICTED: developmental protein SEPALLATA 1...    126   6e-32   
ref|NP_001105525.1|  MADS27                                             126   6e-32   
gb|AET98846.1|  SEPALLATA1                                              126   6e-32   
ref|XP_006477714.1|  PREDICTED: developmental protein SEPALLATA 1...    126   6e-32   
ref|XP_010549963.1|  PREDICTED: developmental protein SEPALLATA 1       126   6e-32   
gb|ACF78403.1|  unknown                                                 126   6e-32   
gb|AHM92084.1|  MADS-box protein 8                                      126   6e-32   
gb|AAT37484.1|  MADS5 protein                                           126   6e-32   
gb|AAT37482.1|  MADS3 protein                                           126   6e-32   
gb|ABK41485.1|  putative MADS box protein                               125   7e-32   
ref|XP_002460491.1|  hypothetical protein SORBIDRAFT_02g029310          125   7e-32   
ref|XP_007163780.1|  hypothetical protein PHAVU_001G263400g             125   7e-32   
emb|CDY57524.1|  BnaA05g33600D                                          126   7e-32   
gb|AES97199.2|  MADS-box transcription factor family protein            122   7e-32   
dbj|BAD10944.1|  SEPALLATA1 homologous protein                          126   7e-32   
gb|AGT20513.1|  SEP3                                                    125   8e-32   
ref|XP_007163779.1|  hypothetical protein PHAVU_001G263400g             125   8e-32   
ref|XP_008464576.1|  PREDICTED: developmental protein SEPALLATA 1...    125   8e-32   
gb|ADL36751.1|  MADS domain class transcription factor                  125   8e-32   
ref|XP_008243816.1|  PREDICTED: MADS-box protein CMB1-like isofor...    125   8e-32   
gb|ADU15479.1|  SEP4                                                    125   8e-32   
emb|CDX84935.1|  BnaC05g21200D                                          125   8e-32   
gb|AHM92068.1|  MADS-box protein 8                                      125   9e-32   
gb|AAQ01163.1|  MADS box protein                                        125   9e-32   
gb|AAQ83836.1|  MADS box protein                                        125   9e-32   
ref|XP_008365428.1|  PREDICTED: developmental protein SEPALLATA 1...    125   9e-32   
ref|XP_006477711.1|  PREDICTED: developmental protein SEPALLATA 1...    126   1e-31   
ref|XP_006477712.1|  PREDICTED: developmental protein SEPALLATA 1...    126   1e-31   
ref|XP_006440805.1|  hypothetical protein CICLE_v10021357mg             125   1e-31   
ref|XP_009415674.1|  PREDICTED: MADS-box protein CMB1-like              124   1e-31   
ref|XP_008453343.1|  PREDICTED: MADS-box protein CMB1-like isofor...    126   1e-31   
ref|XP_008453430.1|  PREDICTED: MADS-box protein CMB1-like isofor...    125   1e-31   
gb|AGV31155.1|  E-class MADS-box protein                                125   1e-31   
ref|XP_011071269.1|  PREDICTED: floral homeotic protein APETALA 1       129   1e-31   
gb|AAT37486.1|  MADS7 protein                                           125   1e-31   
gb|AAX15923.1|  AGL9.1                                                  125   1e-31   
tpg|DAA40488.2|  TPA: LOW QUALITY PROTEIN: zea mays MADS7               125   1e-31   
gb|AEX92975.1|  MADS box protein 2                                      125   1e-31   
ref|XP_009378252.1|  PREDICTED: developmental protein SEPALLATA 1...    125   1e-31   
gb|EEE69055.1|  hypothetical protein OsJ_28057                          127   1e-31   
gb|AGT80607.1|  AGL6-like MADS-box protein                              123   1e-31   
gb|AHM92082.1|  MADS-box protein 6                                      125   1e-31   
ref|XP_008786031.1|  PREDICTED: truncated transcription factor CA...    125   1e-31   
emb|CAN77787.1|  hypothetical protein VITISV_023233                     121   1e-31   
dbj|BAM34480.1|  MADS-box transcription factor                          124   1e-31   
gb|AHC54096.1|  sepallata-like MADS box transcription factor LOFSEP     122   1e-31   
ref|XP_008243812.1|  PREDICTED: MADS-box protein CMB1-like isofor...    125   2e-31   
ref|XP_007221848.1|  hypothetical protein PRUPE_ppa1027139mg            125   2e-31   
ref|XP_008243815.1|  PREDICTED: MADS-box protein CMB1-like isofor...    124   2e-31   
ref|NP_001233976.1|  MADS-box transcription factor MADS-rin             127   2e-31   
ref|NP_001105153.1|  MADS6                                              124   2e-31   
ref|XP_008243814.1|  PREDICTED: MADS-box protein CMB1-like isofor...    125   2e-31   
gb|ABC70710.1|  MADS-box transcription factor                           125   2e-31   
ref|XP_003516451.1|  PREDICTED: developmental protein SEPALLATA 1...    125   2e-31   
ref|XP_009152152.1|  PREDICTED: agamous-like MADS-box protein AGL3      125   2e-31   
gb|ACG32829.1|  SRF-type transcription factor family protein            124   2e-31   
emb|CAL36578.1|  deficiens H200 homologue                               124   2e-31   
gb|KHN29767.1|  Developmental protein SEPALLATA 2                       125   2e-31   
gb|ABC70707.1|  MADS-box transcription factor                           124   2e-31   
gb|AAF76381.1|AF068723_1  MADS-box protein MADS4                        124   2e-31   
ref|XP_010029406.1|  PREDICTED: developmental protein SEPALLATA 1       124   2e-31   



>ref|XP_007158665.1| hypothetical protein PHAVU_002G1723001g, partial [Phaseolus vulgaris]
 gb|ESW30659.1| hypothetical protein PHAVU_002G1723001g, partial [Phaseolus vulgaris]
Length=144

 Score =   132 bits (332),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_007158666.1| hypothetical protein PHAVU_002G1723001g, partial [Phaseolus vulgaris]
 gb|ESW30660.1| hypothetical protein PHAVU_002G1723001g, partial [Phaseolus vulgaris]
Length=146

 Score =   132 bits (332),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|ADU56819.1| MADS-box protein AGL2 subfamily [Coffea arabica]
Length=108

 Score =   131 bits (329),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            S+M
Sbjct  61   SNM  63



>gb|EYU33468.1| hypothetical protein MIMGU_mgv1a0126181mg, partial [Erythranthe 
guttata]
Length=88

 Score =   130 bits (327),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AHC54144.1| sepallata-like MADS box transcription factor 3, partial [Costus 
spicatus]
Length=175

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_004170688.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog, partial 
[Cucumis sativus]
 gb|KDO72290.1| hypothetical protein CISIN_1g0261432mg, partial [Citrus sinensis]
Length=61

 Score =   129 bits (324),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 61/61 (100%), Positives = 61/61 (100%), Gaps = 0/61 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  S  548
            S
Sbjct  61   S  61



>ref|XP_009622386.1| PREDICTED: MADS-box protein CMB1-like [Nicotiana tomentosiformis]
Length=109

 Score =   130 bits (328),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>emb|CAE46179.1| AGL2-like MADS box transcription factor [Elaeis guineensis]
Length=207

 Score =   132 bits (333),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_010532441.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X1 
[Tarenaya hassleriana]
Length=179

 Score =   131 bits (330),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_009773225.1| PREDICTED: MADS-box protein CMB1-like isoform X3 [Nicotiana sylvestris]
Length=173

 Score =   131 bits (329),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFS RGKLYEFCSS
Sbjct  1    MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_010532442.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X2 
[Tarenaya hassleriana]
Length=178

 Score =   131 bits (330),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|EYU33467.1| hypothetical protein MIMGU_mgv1a0126181mg, partial [Erythranthe 
guttata]
 gb|EYU33469.1| hypothetical protein MIMGU_mgv1a0126181mg, partial [Erythranthe 
guttata]
 gb|EYU33470.1| hypothetical protein MIMGU_mgv1a0126181mg, partial [Erythranthe 
guttata]
Length=89

 Score =   128 bits (322),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/62 (100%), Positives = 62/62 (100%), Gaps = 0/62 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SS  551
            SS
Sbjct  61   SS  62



>gb|AAC78282.1| MADS box protein [Eucalyptus grandis]
Length=183

 Score =   130 bits (328),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEV LIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVGLIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_008340236.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Malus domestica]
Length=250

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|KDO65669.1| hypothetical protein CISIN_1g0246401mg, partial [Citrus sinensis]
Length=61

 Score =   127 bits (318),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 60/60 (100%), Positives = 60/60 (100%), Gaps = 0/60 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60



>ref|XP_006385889.1| hypothetical protein POPTR_0003s16800g [Populus trichocarpa]
 gb|ERP63686.1| hypothetical protein POPTR_0003s16800g [Populus trichocarpa]
Length=89

 Score =   127 bits (320),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAE+ALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEIALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            S +
Sbjct  61   SRI  63



>ref|NP_001242742.1| uncharacterized protein LOC100805078 [Glycine max]
 gb|ACU17977.1| unknown [Glycine max]
Length=226

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_010257958.1| PREDICTED: developmental protein SEPALLATA 1 [Nelumbo nucifera]
Length=243

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_008340234.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Malus domestica]
 ref|XP_008340235.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Malus domestica]
Length=264

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AGW23594.1| MADS1 [Mangifera indica]
Length=254

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>emb|CDY03905.1| BnaC07g11300D [Brassica napus]
Length=270

 Score =   132 bits (333),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%), Gaps = 0/64 (0%)
 Frame = +3

Query  363  RMGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS  542
            RMGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS
Sbjct  18   RMGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS  77

Query  543  SSSM  554
            SSSM
Sbjct  78   SSSM  81



>gb|ACD39982.1| MADS1 [Carica papaya]
Length=245

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AAX15918.1| AGL9 [Eschscholzia californica]
Length=241

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_011036099.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Populus 
euphratica]
Length=242

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|KHG17252.1| Developmental SEPALLATA 2 -like protein [Gossypium arboreum]
Length=244

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AAN15182.1| MADS box protein GHMADS-1 [Gossypium hirsutum]
Length=236

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_004504398.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Cicer arietinum]
Length=241

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_004504400.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X4 [Cicer arietinum]
Length=227

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_004504397.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Cicer arietinum]
Length=242

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_004504399.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X3 [Cicer arietinum]
Length=228

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AEJ76841.1| MADS17 [Gossypium hirsutum]
Length=244

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AAC25922.1| MADS-box protein 1 [Malus domestica]
Length=246

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_009372256.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Pyrus x bretschneideri]
Length=250

 Score =   132 bits (331),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|EPS70807.1| hypothetical protein M569_03954 [Genlisea aurea]
Length=256

 Score =   132 bits (331),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            S+M
Sbjct  61   SNM  63



>ref|XP_010681125.1| PREDICTED: MADS-box protein CMB1-like [Beta vulgaris subsp. vulgaris]
Length=243

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>emb|CAA64741.1| DEFH49 [Antirrhinum majus]
Length=247

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            S+M
Sbjct  61   SNM  63



>dbj|BAG55316.1| transcription factor [Petunia integrifolia subsp. inflata]
 dbj|BAG55317.1| transcription factor [Petunia integrifolia subsp. inflata]
Length=240

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_010260833.1| PREDICTED: MADS-box protein CMB1 [Nelumbo nucifera]
Length=243

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>emb|CAL36576.1| deficiens H49 homologue [Misopates orontium]
Length=247

 Score =   131 bits (330),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            S+M
Sbjct  61   SNM  63



>ref|NP_001289529.1| agamous-like MADS-box protein AGL9 homolog [Nicotiana sylvestris]
 gb|AAD39034.1|AF068722_1 MADS-box protein MADS3 [Nicotiana sylvestris]
 gb|AFY06679.1| sepallata3-like MADS-box [Nicotiana tabacum]
Length=241

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AHH28273.1| MADS-box transcription factor, partial [Rafflesia cantleyi]
Length=155

 Score =   129 bits (323),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/62 (98%), Positives = 62/62 (100%), Gaps = 0/62 (0%)
 Frame = +3

Query  369  GRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSS  548
            GRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSS
Sbjct  1    GRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSS  60

Query  549  SM  554
            +M
Sbjct  61   NM  62



>sp|Q03489.2|AGL9_PETHY RecName: Full=Agamous-like MADS-box protein AGL9 homolog; AltName: 
Full=Floral homeotic protein FBP2; AltName: Full=Floral-binding 
protein 2 [Petunia x hybrida]
 gb|AAA86854.1| transcription factor [Petunia x hybrida]
Length=241

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_009372255.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Pyrus x bretschneideri]
Length=264

 Score =   132 bits (331),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_009600809.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Nicotiana 
tomentosiformis]
Length=242

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_006585131.1| PREDICTED: MADS-box transcription factor 1-like isoform X3 [Glycine 
max]
Length=242

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_006430949.1| hypothetical protein CICLE_v10012593mg [Citrus clementina]
 gb|ESR44189.1| hypothetical protein CICLE_v10012593mg [Citrus clementina]
Length=243

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|ACB69511.1| SEPALLATA3-like MADS-box protein [Crocus sativus]
Length=234

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_011020782.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Populus 
euphratica]
Length=243

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|EMT30881.1| MADS-box transcription factor 7 [Aegilops tauschii]
Length=101

 Score =   127 bits (318),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEFCS+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCST  60

Query  546  SSM  554
             SM
Sbjct  61   QSM  63



>ref|XP_010917558.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Elaeis 
guineensis]
 gb|AAQ03224.1|AF411843_1 MADS box transcription factor [Elaeis guineensis]
Length=242

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>dbj|BAO74162.1| MADS-box transcription factor SEP1.2 [Torenia fournieri]
Length=252

 Score =   131 bits (330),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            S+M
Sbjct  61   SNM  63



>ref|XP_006579435.1| PREDICTED: uncharacterized protein LOC100805078 isoform X3 [Glycine 
max]
Length=242

 Score =   131 bits (329),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_010917559.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Elaeis 
guineensis]
 gb|AAQ03225.1|AF411844_1 MADS box transcription factor [Elaeis guineensis]
 gb|AAY96424.1| putative MADS box protein [Elaeis guineensis]
Length=242

 Score =   131 bits (329),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_006579434.1| PREDICTED: uncharacterized protein LOC100805078 isoform X2 [Glycine 
max]
Length=243

 Score =   131 bits (329),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|NP_001289232.1| agamous-like MADS-box protein AGL9 homolog [Pyrus x bretschneideri]
 ref|XP_009343139.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Pyrus 
x bretschneideri]
 ref|XP_009343141.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Pyrus 
x bretschneideri]
 dbj|BAF44101.1| transcription factor MADS [Pyrus x bretschneideri]
 dbj|BAM71398.1| transcription factor [Pyrus pyrifolia]
Length=239

 Score =   131 bits (329),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AEF59025.1| MADS-1 [Fragaria x ananassa]
Length=249

 Score =   131 bits (329),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AFX72879.1| MADS-box protein SEP3 [Aquilegia coerulea]
Length=244

 Score =   131 bits (329),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_006579433.1| PREDICTED: uncharacterized protein LOC100805078 isoform X1 [Glycine 
max]
Length=244

 Score =   131 bits (329),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_006585132.1| PREDICTED: MADS-box transcription factor 1-like isoform X4 [Glycine 
max]
 gb|KHN12377.1| MADS-box transcription factor 1 [Glycine soja]
Length=241

 Score =   131 bits (329),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_006482430.1| PREDICTED: developmental protein SEPALLATA 1-like [Citrus sinensis]
 dbj|BAF95941.1| SEPALLATA1 homolog [Citrus unshiu]
Length=243

 Score =   131 bits (329),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_006579436.1| PREDICTED: uncharacterized protein LOC100805078 isoform X4 [Glycine 
max]
Length=241

 Score =   131 bits (329),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_010531079.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X2 
[Tarenaya hassleriana]
Length=249

 Score =   131 bits (329),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AAX13298.1| MADS box protein SEP3 [Lotus japonicus]
Length=243

 Score =   131 bits (329),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|KHN34832.1| MADS-box transcription factor 1 [Glycine soja]
Length=241

 Score =   131 bits (329),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_004304204.1| PREDICTED: developmental protein SEPALLATA 2-like [Fragaria vesca 
subsp. vesca]
 gb|AAO49380.1| MADS-RIN-like protein [Fragaria x ananassa]
Length=249

 Score =   131 bits (329),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_006585129.1| PREDICTED: MADS-box transcription factor 1-like isoform X1 [Glycine 
max]
Length=244

 Score =   131 bits (329),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AAK21254.1|AF335241_1 MADS-box transcription factor FBP23 [Petunia x hybrida]
Length=245

 Score =   131 bits (329),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|NP_001185081.1| MADs box transcription factor SEPALLATA3 [Arabidopsis thaliana]
 gb|AEE30504.1| MADs box transcription factor SEPALLATA3 [Arabidopsis thaliana]
Length=237

 Score =   130 bits (328),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_006585130.1| PREDICTED: MADS-box transcription factor 1-like isoform X2 [Glycine 
max]
Length=243

 Score =   131 bits (329),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AEL33633.1| SEPALLATA3 [Gossypium hirsutum]
Length=243

 Score =   131 bits (329),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|ACB69512.1| SEPALLATA3-like MADS-box protein [Crocus sativus]
Length=239

 Score =   130 bits (328),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AET04966.2| MADS-box transcription factor [Medicago truncatula]
Length=242

 Score =   131 bits (329),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_010531071.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X1 
[Tarenaya hassleriana]
Length=250

 Score =   131 bits (329),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_010460483.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X4 
[Camelina sativa]
Length=254

 Score =   131 bits (329),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_010090648.1| Agamous-like MADS-box protein AGL9-like protein [Morus notabilis]
 gb|EXB40312.1| Agamous-like MADS-box protein AGL9-like protein [Morus notabilis]
Length=244

 Score =   131 bits (329),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>dbj|BAM36705.1| MADS transcriptional factor SEP3 homolog, partial [Rosa hybrid 
cultivar]
Length=244

 Score =   130 bits (328),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_008801853.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X4 [Phoenix dactylifera]
Length=234

 Score =   130 bits (328),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|KHG25284.1| Agamous-like MADS-box protein AGL9 [Gossypium arboreum]
Length=246

 Score =   131 bits (329),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_010460482.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X3 
[Camelina sativa]
Length=255

 Score =   131 bits (329),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_010530561.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X1 
[Tarenaya hassleriana]
Length=249

 Score =   131 bits (329),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AEJ76840.1| MADS16 [Gossypium hirsutum]
 gb|KHG22181.1| Agamous-like MADS-box protein AGL9 [Gossypium arboreum]
Length=243

 Score =   130 bits (328),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|NP_564214.2| MADs box transcription factor SEPALLATA3 [Arabidopsis thaliana]
 sp|O22456.1|SEP3_ARATH RecName: Full=Developmental protein SEPALLATA 3; AltName: Full=Agamous-like 
MADS-box protein AGL9 [Arabidopsis thaliana]
 gb|AAB67832.1| AGL9 [Arabidopsis thaliana]
 gb|AAC00586.1| AGL9 [Arabidopsis thaliana]
 gb|ACF75546.1| At1g24260 [Arabidopsis thaliana]
 gb|AEE30503.1| MADs box transcription factor SEPALLATA3 [Arabidopsis thaliana]
Length=251

 Score =   131 bits (329),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_003531877.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Glycine max]
 gb|KHN30313.1| Developmental protein SEPALLATA 2 [Glycine soja]
Length=251

 Score =   131 bits (329),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|ABC70706.1| MADS-box transcription factor [Asparagus virgatus]
Length=239

 Score =   130 bits (328),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AGH61294.1| sepallata 3 [Paeonia lactiflora]
Length=243

 Score =   130 bits (328),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AAF22138.1|AF129875_1 MADS box transcription factor MADS1 [Capsicum annuum]
Length=245

 Score =   130 bits (328),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_010530562.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X2 
[Tarenaya hassleriana]
Length=248

 Score =   131 bits (329),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_006585806.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Glycine max]
Length=250

 Score =   131 bits (329),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|NP_850953.1| MADs box transcription factor SEPALLATA3 [Arabidopsis thaliana]
 gb|AAM65812.1| putative floral homeotic protein, AGL9 [Arabidopsis thaliana]
 gb|AEE30502.1| MADs box transcription factor SEPALLATA3 [Arabidopsis thaliana]
Length=250

 Score =   131 bits (329),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_007043949.1| K-box region and MADS-box transcription factor family protein 
isoform 3 [Theobroma cacao]
 gb|EOX99780.1| K-box region and MADS-box transcription factor family protein 
isoform 3 [Theobroma cacao]
Length=247

 Score =   130 bits (328),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|KFK44483.1| developmental protein sepallata 3 [Arabis alpina]
Length=249

 Score =   130 bits (328),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>emb|CAX65570.1| GRCD4 protein [Gerbera hybrid cultivar]
Length=249

 Score =   130 bits (328),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_009102995.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Brassica rapa]
Length=252

 Score =   131 bits (329),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|ADU56818.1| MADS-box protein AGL2 subfamily [Coffea arabica]
Length=170

 Score =   129 bits (323),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/61 (100%), Positives = 61/61 (100%), Gaps = 0/61 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  S  548
            S
Sbjct  61   S  61



>gb|AEL33631.1| SEPALLATA1 [Gossypium hirsutum]
Length=245

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_006415783.1| hypothetical protein EUTSA_v10008591mg [Eutrema salsugineum]
 gb|ESQ34136.1| hypothetical protein EUTSA_v10008591mg [Eutrema salsugineum]
Length=247

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AEE60891.1| MADS-box protein 5 [Paeonia suffruticosa]
Length=243

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AAQ83834.1| MADS box protein [Asparagus officinalis]
 gb|ABC70709.1| MADS-box transcription factor [Asparagus officinalis]
Length=239

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_010913018.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Elaeis guineensis]
Length=234

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_007043947.1| K-box region and MADS-box transcription factor family protein 
isoform 1 [Theobroma cacao]
 gb|EOX99778.1| K-box region and MADS-box transcription factor family protein 
isoform 1 [Theobroma cacao]
Length=242

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AAO22982.1| MADS-box transcription factor CDM44 [Chrysanthemum x morifolium]
Length=249

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_003552609.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Glycine max]
Length=254

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_006602962.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Glycine max]
 gb|KHN37943.1| Developmental protein SEPALLATA 2 [Glycine soja]
Length=255

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AAK21247.1|AF335234_1 MADS-box transcription factor FBP4 [Petunia x hybrida]
Length=240

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|KDP41334.1| hypothetical protein JCGZ_15741 [Jatropha curcas]
Length=227

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_004140534.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Cucumis 
sativus]
Length=242

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_008459849.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Cucumis melo]
Length=228

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_009102994.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Brassica rapa]
Length=253

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_010478051.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X4 
[Camelina sativa]
Length=253

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>emb|CDP02339.1| unnamed protein product [Coffea canephora]
Length=245

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            S+M
Sbjct  61   SNM  63



>ref|NP_001284431.1| agamous-like MADS-box protein AGL9 homolog [Cucumis melo]
 gb|AGZ03887.1| sepallata 3-like MADS-box protein [Cucumis melo]
Length=242

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>emb|CBI27678.3| unnamed protein product [Vitis vinifera]
Length=242

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|NP_001268114.1| MADS-box protein 4 [Vitis vinifera]
 gb|AAM21344.1|AF373603_1 MADS-box protein 4 [Vitis vinifera]
Length=242

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|ADU56817.1| MADS-box protein AGL2 subfamily [Coffea arabica]
 emb|CDP13360.1| unnamed protein product [Coffea canephora]
Length=241

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AAF77579.1|AF072534_1 pepper MADS-box protein [Capsicum annuum]
Length=175

 Score =   129 bits (323),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/63 (94%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRG+VELKRI+NKINRQVTFAKRRNGLLKKAYELSVLCDAE+ALIIFS+RGKLYEFCSS
Sbjct  1    MGRGKVELKRIDNKINRQVTFAKRRNGLLKKAYELSVLCDAEIALIIFSSRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_010478049.1| PREDICTED: developmental protein SEPALLATA 3-like isoform X2 
[Camelina sativa]
Length=254

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>sp|O04067.1|AGL9_SINAL RecName: Full=Agamous-like MADS-box protein AGL9 homolog; AltName: 
Full=MADS D [Sinapis alba]
 emb|CAA69916.1| MADS D [Sinapis alba]
Length=254

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_011086825.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Sesamum 
indicum]
Length=242

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_010318407.1| PREDICTED: MADS-box protein 1 isoform X1 [Solanum lycopersicum]
Length=232

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_009788128.1| PREDICTED: MADS-box protein CMB1-like [Nicotiana sylvestris]
Length=242

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_002890717.1| hypothetical protein ARALYDRAFT_472923 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66976.1| hypothetical protein ARALYDRAFT_472923 [Arabidopsis lyrata subsp. 
lyrata]
Length=247

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AAX15924.1| AGL9.2 [Persea americana]
Length=242

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>dbj|BAN89460.1| sepallata 3 [Shorea beccariana]
Length=242

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_011099041.1| PREDICTED: developmental protein SEPALLATA 1 isoform X2 [Sesamum 
indicum]
Length=246

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            S+M
Sbjct  61   SNM  63



>ref|XP_006345102.1| PREDICTED: MADS-box protein CMB1-like [Solanum tuberosum]
Length=246

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_006352168.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Solanum 
tuberosum]
Length=241

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_006400104.1| hypothetical protein EUTSA_v10014493mg [Eutrema salsugineum]
 gb|ESQ41557.1| hypothetical protein EUTSA_v10014493mg [Eutrema salsugineum]
Length=250

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            S+M
Sbjct  61   SNM  63



>ref|XP_011099040.1| PREDICTED: developmental protein SEPALLATA 1 isoform X1 [Sesamum 
indicum]
Length=247

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            S+M
Sbjct  61   SNM  63



>ref|XP_006437995.1| hypothetical protein CICLE_v10032507mg [Citrus clementina]
 ref|XP_006484144.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X3 [Citrus sinensis]
 gb|ESR51235.1| hypothetical protein CICLE_v10032507mg [Citrus clementina]
Length=244

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|NP_001234384.1| agamous-like MADS-box protein AGL9 homolog [Solanum lycopersicum]
 gb|AAP57413.1| MADS-box protein 5 [Solanum lycopersicum]
Length=241

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_006437996.1| hypothetical protein CICLE_v10032507mg [Citrus clementina]
 gb|ESR51236.1| hypothetical protein CICLE_v10032507mg [Citrus clementina]
Length=256

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_008801852.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X3 [Phoenix dactylifera]
Length=242

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|KDP31378.1| hypothetical protein JCGZ_11754 [Jatropha curcas]
Length=191

 Score =   129 bits (323),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_006437997.1| hypothetical protein CICLE_v10032507mg [Citrus clementina]
 ref|XP_006484142.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Citrus sinensis]
 gb|ESR51237.1| hypothetical protein CICLE_v10032507mg [Citrus clementina]
Length=257

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_010499201.1| PREDICTED: developmental protein SEPALLATA 3 isoform X6 [Camelina 
sativa]
Length=237

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|EPS57613.1| hypothetical protein M569_17204 [Genlisea aurea]
Length=67

 Score =   125 bits (314),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/61 (100%), Positives = 61/61 (100%), Gaps = 0/61 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  S  548
            S
Sbjct  61   S  61



>gb|AFU81296.1| SEPALLATA3 [Medicago polyceratia]
Length=244

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_010653929.1| PREDICTED: MADS-box protein 4 isoform X1 [Vitis vinifera]
Length=258

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_007032865.1| K-box region and MADS-box transcription factor family protein 
[Theobroma cacao]
 gb|EOY03791.1| K-box region and MADS-box transcription factor family protein 
[Theobroma cacao]
Length=243

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            +SM
Sbjct  61   ASM  63



>ref|XP_010499198.1| PREDICTED: developmental protein SEPALLATA 3 isoform X3 [Camelina 
sativa]
Length=251

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AFS60087.1| MADS box transcription factor SEP2 [Paphiopedilum concolor]
Length=208

 Score =   129 bits (325),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRG+L+EFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGRLFEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_006437994.1| hypothetical protein CICLE_v10032507mg [Citrus clementina]
 ref|XP_006484145.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X4 [Citrus sinensis]
 gb|ESR51234.1| hypothetical protein CICLE_v10032507mg [Citrus clementina]
Length=242

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_006484143.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Citrus sinensis]
Length=255

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_010250667.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Nelumbo 
nucifera]
Length=239

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AEX92976.1| MADS box protein 1 [Agave tequilana]
Length=243

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVAL+IFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALVIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>emb|CDY15724.1| BnaA07g08950D [Brassica napus]
Length=252

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_010499199.1| PREDICTED: developmental protein SEPALLATA 3 isoform X4 [Camelina 
sativa]
Length=250

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AAZ95252.1| MADS box protein SEP1 [Dendrobium crumenatum]
Length=243

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AAQ72506.1| MADS-box protein 12 [Petunia x hybrida]
Length=62

 Score =   125 bits (313),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/62 (95%), Positives = 62/62 (100%), Gaps = 0/62 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENK+NRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKVNRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SS  551
            ++
Sbjct  61   NN  62



>ref|NP_001234380.1| MADS-box protein 1 [Solanum lycopersicum]
 gb|AAP57412.1| MADS-box protein 1 [Solanum lycopersicum]
Length=246

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|ADC79703.1| SEPALLATA3-like protein [Pachysandra terminalis]
Length=243

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|ACJ83943.1| unknown [Medicago truncatula]
Length=196

 Score =   129 bits (323),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
             SM
Sbjct  61   PSM  63



>gb|AEW50208.1| SEP1 [Acca sellowiana]
Length=245

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>emb|CAC81072.1| MADS box transcription factor [Daucus carota subsp. sativus]
Length=246

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS+
Sbjct  1    MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|ADU56820.1| MADS-box protein AGL2 subfamily [Coffea arabica]
Length=240

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEFCSS
Sbjct  1    MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIVFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_010913017.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Elaeis guineensis]
 gb|AAQ03226.1|AF411845_1 MADS box transcription factor [Elaeis guineensis]
Length=242

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_007043948.1| K-box region and MADS-box transcription factor family protein 
isoform 2 [Theobroma cacao]
 gb|EOX99779.1| K-box region and MADS-box transcription factor family protein 
isoform 2 [Theobroma cacao]
Length=258

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AHW58033.1| SEP4 [Coffea arabica]
Length=239

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEFCSS
Sbjct  1    MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIVFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>emb|CAX65571.1| GRCD5 protein [Gerbera hybrid cultivar]
Length=252

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|KCW86946.1| hypothetical protein EUGRSUZ_B03516 [Eucalyptus grandis]
Length=95

 Score =   125 bits (315),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/62 (98%), Positives = 62/62 (100%), Gaps = 0/62 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFS+RGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSHRGKLYEFCSS  60

Query  546  SS  551
            SS
Sbjct  61   SS  62



>gb|AIU94434.1| MADS-box transcription factor 2 isoform 2, partial [Musa balbisiana]
Length=247

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AHW58036.1| SEP1/2 [Coffea arabica]
Length=247

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            S+M
Sbjct  61   SNM  63



>gb|KFK25803.1| hypothetical protein AALP_AA8G163200 [Arabis alpina]
Length=251

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            S+M
Sbjct  61   SNM  63



>gb|ABI60898.1| MADS-box transcription factor [Arachis hypogaea]
Length=243

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_007139420.1| hypothetical protein PHAVU_008G027900g [Phaseolus vulgaris]
 gb|ESW11414.1| hypothetical protein PHAVU_008G027900g [Phaseolus vulgaris]
Length=248

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            +SM
Sbjct  61   TSM  63



>gb|AGW23364.1| MADS box protein MADS62 [Gossypium hirsutum]
Length=244

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            S M
Sbjct  61   SGM  63



>ref|XP_002873742.1| hypothetical protein ARALYDRAFT_909555 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AAU82008.1| SEPALLATA1 [Arabidopsis lyrata subsp. petraea]
 gb|EFH50001.1| hypothetical protein ARALYDRAFT_909555 [Arabidopsis lyrata subsp. 
lyrata]
Length=249

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            S+M
Sbjct  61   SNM  63



>ref|NP_568322.1| MADS box transcription factor SEPALLATA 1 [Arabidopsis thaliana]
 sp|P29382.2|SEP1_ARATH RecName: Full=Developmental protein SEPALLATA 1; AltName: Full=Agamous-like 
MADS-box protein AGL2 [Arabidopsis thaliana]
 dbj|BAC43207.1| putative transcription factor AGL2 [Arabidopsis thaliana]
 gb|AAP12873.1| At5g15800 [Arabidopsis thaliana]
 gb|AAU81986.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81988.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU82003.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AED92207.1| MADS box transcription factor SEPALLATA 1 [Arabidopsis thaliana]
Length=251

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            S+M
Sbjct  61   SNM  63



>emb|CDP00462.1| unnamed protein product [Coffea canephora]
Length=239

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALI+FSNRGKLYEFCSS
Sbjct  1    MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIVFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_004490239.1| PREDICTED: MADS-box protein CMB1-like isoform X3 [Cicer arietinum]
Length=230

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 
Sbjct  1    MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSG  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_009788435.1| PREDICTED: MADS-box protein CMB1-like [Nicotiana sylvestris]
Length=239

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SS+
Sbjct  61   SSI  63



>ref|XP_010025293.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Eucalyptus grandis]
 gb|KCW61920.1| hypothetical protein EUGRSUZ_H04617 [Eucalyptus grandis]
Length=251

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_011021072.1| PREDICTED: developmental protein SEPALLATA 2-like [Populus euphratica]
 ref|XP_011021073.1| PREDICTED: developmental protein SEPALLATA 2-like [Populus euphratica]
Length=244

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  546  SSM  554
            S+M
Sbjct  61   SNM  63



>sp|Q42464.1|AGL9_SOLLC RecName: Full=Agamous-like MADS-box protein AGL9 homolog; AltName: 
Full=TM5 [Solanum lycopersicum]
 emb|CAA43010.1| TDR5 [Solanum lycopersicum]
 emb|CAA43170.1| TDR5 [Solanum lycopersicum]
Length=224

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIE KINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIEGKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AAA32732.1| transcription factor [Arabidopsis thaliana]
 gb|AAU81987.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81989.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81990.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81991.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81992.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81993.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81994.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81995.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81996.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81997.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81998.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU81999.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU82000.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU82001.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU82002.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU82004.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU82005.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU82006.1| SEPALLATA1 [Arabidopsis thaliana]
 gb|AAU82007.1| SEPALLATA1 [Arabidopsis thaliana]
Length=248

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            S+M
Sbjct  61   SNM  63



>ref|NP_001280893.1| developmental protein SEPALLATA 1 [Malus domestica]
 emb|CAA04919.1| MdMADS8 [Malus domestica]
Length=246

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SS+
Sbjct  61   SSI  63



>ref|XP_004490238.1| PREDICTED: MADS-box protein CMB1-like isoform X2 [Cicer arietinum]
Length=243

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 
Sbjct  1    MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSG  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_010025292.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Eucalyptus grandis]
 gb|KCW61919.1| hypothetical protein EUGRSUZ_H04617 [Eucalyptus grandis]
Length=253

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_004502274.1| PREDICTED: MADS-box transcription factor 1-like isoform X1 [Cicer 
arietinum]
Length=243

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEFCS+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCST  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|KHG04329.1| MADS-box CMB1 [Gossypium arboreum]
Length=244

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCST  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_009373782.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009333661.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Pyrus x bretschneideri]
Length=247

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SS+
Sbjct  61   SSI  63



>ref|XP_004502275.1| PREDICTED: MADS-box transcription factor 1-like isoform X2 [Cicer 
arietinum]
Length=241

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEFCS+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCST  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_009373783.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Pyrus x bretschneideri]
 ref|XP_009333662.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Pyrus x bretschneideri]
 dbj|BAK18787.2| MADS-box protein [Pyrus pyrifolia var. culta]
Length=246

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SS+
Sbjct  61   SSI  63



>ref|XP_009415892.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Musa acuminata 
subsp. malaccensis]
Length=243

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AEN75254.1| transcription factor MADS3 [Prunus avium]
 gb|AIU94282.1| agamous-like MADS-box protein [Prunus pseudocerasus]
Length=240

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLC+AEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_007151388.1| hypothetical protein PHAVU_004G042300g [Phaseolus vulgaris]
 gb|ESW23382.1| hypothetical protein PHAVU_004G042300g [Phaseolus vulgaris]
Length=217

 Score =   129 bits (323),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFS RGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|ACJ64678.1| MADS-box protein MADS2 [Musa acuminata AAA Group]
 gb|AIU94429.1| MADS-box transcription factor 2 isoform 1 [Musa acuminata]
Length=243

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_004490237.1| PREDICTED: MADS-box protein CMB1-like isoform X1 [Cicer arietinum]
Length=244

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 
Sbjct  1    MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSG  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_004137606.1| PREDICTED: MADS-box transcription factor 8-like, partial [Cucumis 
sativus]
Length=189

 Score =   128 bits (321),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAE+ALIIFSNRGKL+EFCS 
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAELALIIFSNRGKLFEFCSG  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>emb|CAN59955.1| hypothetical protein VITISV_006723 [Vitis vinifera]
Length=244

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFS RGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>emb|CAA64743.1| DEFH200 [Antirrhinum majus]
Length=242

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            +SM
Sbjct  61   TSM  63



>ref|XP_007045799.1| MADS-box transcription factor [Theobroma cacao]
 gb|EOY01631.1| MADS-box transcription factor [Theobroma cacao]
Length=240

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCST  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_009131500.1| PREDICTED: developmental protein SEPALLATA 1-like [Brassica rapa]
 emb|CAD48303.1| MADS-box protein SEP1-a [Brassica oleracea var. botrytis]
 gb|AGT20510.1| SEP1.a [Brassica oleracea var. viridis]
Length=250

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            S+M
Sbjct  61   SNM  63



>gb|AIU94433.1| MADS-box transcription factor 2 isoform 1, partial [Musa balbisiana]
Length=243

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AHH28266.1| MADS-box transcription factor, partial [Rhizanthes lowii]
Length=244

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            S+M
Sbjct  61   SNM  63



>ref|XP_010558530.1| PREDICTED: developmental protein SEPALLATA 1 [Tarenaya hassleriana]
 gb|ABD96896.1| hypothetical protein [Cleome spinosa]
Length=248

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            S+M
Sbjct  61   SNM  63



>gb|KCW48935.1| hypothetical protein EUGRSUZ_K02546 [Eucalyptus grandis]
Length=245

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AIU94432.1| MADS-box transcription factor 2 isoform 3, partial [Musa acuminata]
Length=243

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKL+EFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLFEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AIU94430.1| MADS-box transcription factor 2 isoform 2 [Musa acuminata]
 gb|AIU94431.1| MADS-box transcription factor 2 isoform 2 [Musa acuminata]
Length=244

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKL+EFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLFEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|NP_001267667.1| developmental protein SEPALLATA 2-like [Cucumis sativus]
 gb|AAF23363.1|AF135962_1 CAGL2 [Cucumis sativus]
Length=246

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  546  SSM  554
            S+M
Sbjct  61   SNM  63



>ref|XP_009121545.1| PREDICTED: developmental protein SEPALLATA 1 [Brassica rapa]
Length=252

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            S+M
Sbjct  61   SNM  63



>gb|ADC79704.1| SEPALLATA3-like protein [Pachysandra terminalis]
Length=244

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEFCS+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCST  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AAY21913.2| putative MADS box protein [Musa acuminata]
Length=244

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_004154725.1| PREDICTED: developmental protein SEPALLATA 2-like [Cucumis sativus]
Length=246

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  546  SSM  554
            S+M
Sbjct  61   SNM  63



>gb|AAX15920.1| AGL9 [Liriodendron tulipifera]
Length=242

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|ACB69509.1| SEPALLATA3-like MADS-box protein [Crocus sativus]
Length=238

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  546  SSM  554
            SS+
Sbjct  61   SSI  63



>ref|XP_009419371.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Musa acuminata 
subsp. malaccensis]
Length=245

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKL+EFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLFEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_008801851.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Phoenix dactylifera]
Length=263

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|KFK37664.1| hypothetical protein AALP_AA3G012500 [Arabis alpina]
Length=146

 Score =   126 bits (317),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/63 (94%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEV+LI+FSNRGKLYEFCS+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCST  60

Query  546  SSM  554
            S+M
Sbjct  61   SNM  63



>gb|AGS42240.1| MADS-box protein [Daucus carota]
Length=251

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  546  SSM  554
            S+M
Sbjct  61   SNM  63



>ref|XP_002306051.2| hypothetical protein POPTR_0004s11440g [Populus trichocarpa]
 ref|XP_006384290.1| hypothetical protein POPTR_0004s11440g [Populus trichocarpa]
 ref|XP_011008140.1| PREDICTED: developmental protein SEPALLATA 2-like [Populus euphratica]
 ref|XP_011008141.1| PREDICTED: developmental protein SEPALLATA 2-like [Populus euphratica]
 gb|EEE86562.2| hypothetical protein POPTR_0004s11440g [Populus trichocarpa]
 gb|ERP62087.1| hypothetical protein POPTR_0004s11440g [Populus trichocarpa]
Length=245

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  546  SSM  554
            S+M
Sbjct  61   SNM  63



>gb|AEL33632.1| SEPALLATA2 [Gossypium hirsutum]
Length=244

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCS+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCST  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_008222191.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Prunus 
mume]
Length=240

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLC+AEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|ABD19719.1| SEP3-like MADS-box protein [Taihangia rupestris]
Length=249

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/62 (100%), Positives = 62/62 (100%), Gaps = 0/62 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SS  551
            SS
Sbjct  61   SS  62



>gb|AAQ72498.1| MADS-box protein 12 [Petunia x hybrida]
Length=246

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            ++M
Sbjct  61   NNM  63



>ref|XP_007223808.1| hypothetical protein PRUPE_ppa010679mg [Prunus persica]
 gb|ABO27621.1| transcription factor MADS5 [Prunus persica]
 gb|EMJ25007.1| hypothetical protein PRUPE_ppa010679mg [Prunus persica]
Length=240

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLC+AEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_003601749.1| MADS-box transcription factor [Medicago truncatula]
 gb|AES72000.1| MADS-box transcription factor [Medicago truncatula]
Length=244

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEFCS+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCST  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_008230292.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X4 
[Prunus mume]
Length=244

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SS+
Sbjct  61   SSI  63



>gb|AAL08423.2|AF185574_1 transcription factor MAGL4 [Populus tremuloides]
Length=245

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  546  SSM  554
            S+M
Sbjct  61   SNM  63



>ref|XP_008230291.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X3 
[Prunus mume]
Length=245

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SS+
Sbjct  61   SSI  63



>ref|XP_007215876.1| hypothetical protein PRUPE_ppa010548mg [Prunus persica]
 gb|EMJ17075.1| hypothetical protein PRUPE_ppa010548mg [Prunus persica]
Length=244

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SS+
Sbjct  61   SSI  63



>dbj|BAC80255.1| MADS-box transcription factor [Houttuynia cordata]
Length=247

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTF+KRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|NP_001280756.1| agamous-like MADS-box protein AGL9 homolog [Malus domestica]
 ref|XP_008389896.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Malus 
domestica]
 ref|XP_008350960.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Malus 
domestica]
 gb|ADL36740.1| MADS domain class transcription factor [Malus domestica]
Length=239

 Score =   129 bits (323),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/62 (100%), Positives = 62/62 (100%), Gaps = 0/62 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SS  551
            SS
Sbjct  61   SS  62



>gb|ABG78619.1| MADS4 [Populus tomentosa]
Length=245

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  546  SSM  554
            S+M
Sbjct  61   SNM  63



>gb|KHN15201.1| MADS-box protein CMB1 [Glycine soja]
Length=243

 Score =   129 bits (323),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFSST  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|ACB69510.1| SEPALLATA3-like MADS-box protein [Crocus sativus]
Length=239

 Score =   129 bits (323),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALI+FSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCSS  60

Query  546  SSM  554
            SS+
Sbjct  61   SSI  63



>ref|NP_001119230.1| MADS box transcription factor SEPALLATA 1 [Arabidopsis thaliana]
 emb|CAC01779.1| MADS box protein AGL2 [Arabidopsis thaliana]
 gb|AED92208.1| MADS box transcription factor SEPALLATA 1 [Arabidopsis thaliana]
Length=262

 Score =   129 bits (325),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            S+M
Sbjct  61   SNM  63



>ref|NP_001268109.1| MADS-box protein 2 [Vitis vinifera]
 gb|AAM21342.1|AF373601_1 MADS-box protein 2 [Vitis vinifera]
Length=244

 Score =   129 bits (323),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFS RGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_006856372.1| hypothetical protein AMTR_s00047p00190220 [Amborella trichopoda]
 gb|AAX15917.1| AGL2 [Amborella trichopoda]
 gb|AAY25578.1| AGL2 [Amborella trichopoda]
 gb|ERN17839.1| hypothetical protein AMTR_s00047p00190220 [Amborella trichopoda]
Length=243

 Score =   129 bits (323),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|NP_001242365.1| uncharacterized protein LOC100797819 [Glycine max]
 gb|ACU17644.1| unknown [Glycine max]
Length=243

 Score =   129 bits (323),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFSST  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AAY30858.1| MADS-box transcription factor [Prunus dulcis]
Length=246

 Score =   129 bits (323),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/62 (98%), Positives = 62/62 (100%), Gaps = 0/62 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SS  551
            SS
Sbjct  61   SS  62



>gb|ABD17386.1| MADS-box protein SEP3-1 [Taihangia rupestris]
Length=325

 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_007155209.1| hypothetical protein PHAVU_003G182800g [Phaseolus vulgaris]
 gb|ESW27203.1| hypothetical protein PHAVU_003G182800g [Phaseolus vulgaris]
Length=243

 Score =   129 bits (323),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFSST  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_008230289.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X1 
[Prunus mume]
Length=246

 Score =   129 bits (323),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/62 (98%), Positives = 62/62 (100%), Gaps = 0/62 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SS  551
            SS
Sbjct  61   SS  62



>ref|XP_006848294.1| hypothetical protein AMTR_s00013p00103080 [Amborella trichopoda]
 gb|ERN09875.1| hypothetical protein AMTR_s00013p00103080 [Amborella trichopoda]
 gb|AIE44770.1| putative MADS-domain transcription factor AGL9 [Amborella trichopoda]
Length=241

 Score =   129 bits (323),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGK YEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKQYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AHM92085.1| MADS-box protein 9 [Erycina pusilla]
Length=250

 Score =   129 bits (324),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            +SM
Sbjct  61   TSM  63



>gb|AAD09206.1| putative MADS-box family transcription factor [Pinus radiata]
Length=245

 Score =   129 bits (323),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>dbj|BAO74164.1| MADS-box transcription factor SEP3.2 [Torenia fournieri]
Length=253

 Score =   129 bits (324),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/62 (100%), Positives = 62/62 (100%), Gaps = 0/62 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SS  551
            SS
Sbjct  61   SS  62



>emb|CDY26462.1| BnaC09g42060D [Brassica napus]
Length=254

 Score =   129 bits (324),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            S+M
Sbjct  61   SNM  63



>ref|XP_010660492.1| PREDICTED: MADS-box protein 2 isoform X1 [Vitis vinifera]
 emb|CBI16936.3| unnamed protein product [Vitis vinifera]
Length=243

 Score =   129 bits (323),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFS RGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_009773224.1| PREDICTED: MADS-box protein CMB1-like isoform X2 [Nicotiana sylvestris]
Length=244

 Score =   129 bits (323),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFS RGKLYEFCSS
Sbjct  1    MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AFM30904.1| transcription factor MADS4 [Prunus avium]
Length=244

 Score =   129 bits (323),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SS+
Sbjct  61   SSI  63



>gb|KHN18378.1| MADS-box protein CMB1 [Glycine soja]
Length=243

 Score =   129 bits (323),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFSST  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>emb|CDX78653.1| BnaA03g05650D [Brassica napus]
Length=259

 Score =   129 bits (324),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            S+M
Sbjct  61   SNM  63



>ref|XP_003549578.1| PREDICTED: MADS-box protein CMB1-like [Glycine max]
Length=243

 Score =   129 bits (323),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEF S+
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFSST  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>gb|AHW52536.1| SEPALLATA-like MADS-box protein 1 [Phalaenopsis equestris]
Length=244

 Score =   129 bits (323),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLC+AEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_009773223.1| PREDICTED: MADS-box protein CMB1-like isoform X1 [Nicotiana sylvestris]
Length=264

 Score =   129 bits (324),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRG+VELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFS RGKLYEFCSS
Sbjct  1    MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_010678363.1| PREDICTED: MADS-box protein CMB1-like [Beta vulgaris subsp. vulgaris]
Length=252

 Score =   129 bits (324),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKL+EFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLFEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



>ref|XP_008230290.1| PREDICTED: developmental protein SEPALLATA 1-like isoform X2 
[Prunus mume]
Length=245

 Score =   129 bits (323),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/62 (98%), Positives = 62/62 (100%), Gaps = 0/62 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELS+LCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SS  551
            SS
Sbjct  61   SS  62



>ref|XP_008801850.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Phoenix dactylifera]
Length=271

 Score =   129 bits (325),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  366  MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  545
            MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS
Sbjct  1    MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSS  60

Query  546  SSM  554
            SSM
Sbjct  61   SSM  63



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 585029837385