BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79752_g1_i1 len=1106 path=[1:0-1105]

Length=1106
                                                                      Score     E

ref|XP_009778082.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    283   9e-90   
ref|XP_004245902.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    270   1e-84   
ref|XP_011082360.1|  PREDICTED: 29 kDa ribonucleoprotein, chlorop...    269   4e-84   
ref|XP_006352864.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    268   1e-83   
ref|XP_010053618.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    260   2e-80   
gb|KHG14110.1|  33 kDa ribonucleoprotein, chloroplastic                 258   7e-80   
emb|CDP13040.1|  unnamed protein product                                258   9e-80   
ref|XP_004301780.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    258   1e-79   
emb|CBI33876.3|  unnamed protein product                                254   6e-79   
ref|XP_002279685.1|  PREDICTED: ribonucleoprotein At2g37220, chlo...    255   9e-79   Vitis vinifera
gb|KDO39068.1|  hypothetical protein CISIN_1g044184mg                   254   1e-78   
ref|XP_010273155.1|  PREDICTED: 29 kDa ribonucleoprotein A, chlor...    254   2e-78   
ref|XP_006428430.1|  hypothetical protein CICLE_v10012439mg             253   3e-78   
ref|XP_007039474.1|  RNA-binding family protein isoform 1               249   2e-76   
ref|XP_002527668.1|  ribonucleoprotein, chloroplast, putative           247   1e-75   Ricinus communis
ref|XP_006294626.1|  hypothetical protein CARUB_v10023663mg             246   5e-75   
ref|XP_002879549.1|  hypothetical protein ARALYDRAFT_482506             246   9e-75   
gb|EYU34147.1|  hypothetical protein MIMGU_mgv1a010436mg                245   2e-74   
ref|NP_181084.1|  RNA-binding (RRM/RBD/RNP motifs) family protein       244   2e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009371216.1|  PREDICTED: 29 kDa ribonucleoprotein A, chlor...    244   3e-74   
ref|XP_009141485.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    243   6e-74   
ref|XP_010509618.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    243   1e-73   
gb|ABK96729.1|  unknown                                                 241   2e-73   Populus trichocarpa x Populus deltoides
ref|XP_006368391.1|  33 kDa ribonucleoprotein                           241   2e-73   
gb|KFK36447.1|  hypothetical protein AALP_AA4G125700                    242   2e-73   
ref|XP_010505047.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    241   5e-73   
ref|XP_007209418.1|  hypothetical protein PRUPE_ppa009362mg             241   5e-73   
ref|XP_010088249.1|  31 kDa ribonucleoprotein                           240   6e-73   
ref|XP_010538381.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    239   1e-72   
emb|CDY62421.1|  BnaA06g39370D                                          240   1e-72   
ref|XP_010516718.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    239   4e-72   
ref|XP_008238232.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    239   4e-72   
ref|XP_008238233.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    238   4e-72   
ref|XP_010695564.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    239   6e-72   
ref|XP_008373580.1|  PREDICTED: 29 kDa ribonucleoprotein A, chlor...    237   1e-71   
ref|XP_004148763.1|  PREDICTED: 29 kDa ribonucleoprotein B, chlor...    236   2e-71   
ref|XP_004164674.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    236   3e-71   
ref|XP_003534278.1|  PREDICTED: 29 kDa ribonucleoprotein, chlorop...    235   4e-71   
gb|KHN38931.1|  31 kDa ribonucleoprotein, chloroplastic                 235   4e-71   
gb|KHG07756.1|  33 kDa ribonucleoprotein, chloroplastic                 234   6e-71   
ref|XP_008448669.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    234   7e-71   
ref|XP_011018552.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    234   9e-71   
ref|XP_006410699.1|  hypothetical protein EUTSA_v10016986mg             234   2e-70   
gb|KDP29602.1|  hypothetical protein JCGZ_19129                         233   5e-70   
ref|XP_010933475.1|  PREDICTED: 29 kDa ribonucleoprotein A, chlor...    233   8e-70   
ref|XP_004512519.1|  PREDICTED: 29 kDa ribonucleoprotein A, chlor...    231   1e-69   
ref|NP_001242808.1|  uncharacterized protein LOC100793319               230   4e-69   
gb|KHN04874.1|  31 kDa ribonucleoprotein, chloroplastic                 230   4e-69   
ref|XP_007039475.1|  RNA-binding family protein isoform 2               227   3e-68   
ref|XP_009384706.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    228   3e-68   
gb|AFK48727.1|  unknown                                                 226   3e-67   
ref|XP_008786323.1|  PREDICTED: 29 kDa ribonucleoprotein A, chlor...    223   2e-66   
gb|AFK40547.1|  unknown                                                 219   5e-65   
ref|XP_007158292.1|  hypothetical protein PHAVU_002G140400g             219   1e-64   
ref|XP_003612875.1|  31 kDa ribonucleoprotein                           209   2e-60   
ref|XP_004976651.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    207   2e-60   
gb|AFK40024.1|  unknown                                                 206   3e-59   
ref|XP_006838538.1|  hypothetical protein AMTR_s00002p00197820          202   1e-58   
ref|XP_006652723.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    202   3e-58   
ref|NP_001147738.1|  plastid-specific 30S ribosomal protein 2           197   2e-56   Zea mays [maize]
ref|XP_002448426.1|  hypothetical protein SORBIDRAFT_06g026990          192   2e-54   Sorghum bicolor [broomcorn]
gb|EAY95360.1|  hypothetical protein OsI_17193                          188   5e-53   Oryza sativa Indica Group [Indian rice]
ref|NP_001053710.1|  Os04g0591000                                       185   1e-51   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67960.1|  OSIGBa0142I02-OSIGBa0101B20.3                          185   1e-51   Oryza sativa [red rice]
ref|XP_004976650.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    186   2e-51   
ref|XP_003580456.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    183   4e-51   
dbj|BAJ98479.1|  predicted protein                                      182   7e-51   
dbj|BAJ86328.1|  predicted protein                                      182   8e-51   
ref|XP_006827955.1|  hypothetical protein AMTR_s00008p00202090          172   9e-47   
gb|EMT28681.1|  33 kDa ribonucleoprotein, chloroplastic                 166   2e-45   
ref|XP_010942624.1|  PREDICTED: 29 kDa ribonucleoprotein B, chlor...    167   4e-45   
ref|XP_008775879.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    168   4e-45   
ref|XP_009340208.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    159   2e-43   
ref|XP_009417600.1|  PREDICTED: 29 kDa ribonucleoprotein A, chlor...    162   2e-43   
gb|ACG27691.1|  ribonucleoprotein                                       155   8e-40   Zea mays [maize]
gb|ACJ85486.1|  unknown                                                 150   2e-39   Medicago truncatula
ref|XP_004955488.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    152   5e-39   
ref|XP_010266776.1|  PREDICTED: 30S ribosomal protein 2, chloropl...    150   1e-38   
ref|XP_002285735.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    150   1e-38   Vitis vinifera
emb|CAN61580.1|  hypothetical protein VITISV_008033                     150   2e-38   Vitis vinifera
ref|NP_001140274.1|  ribonucleoprotein                                  150   3e-38   Zea mays [maize]
ref|XP_002461480.1|  hypothetical protein SORBIDRAFT_02g003310          150   4e-38   Sorghum bicolor [broomcorn]
ref|XP_008442686.1|  PREDICTED: 29 kDa ribonucleoprotein, chlorop...    147   1e-37   
ref|XP_006658290.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    149   1e-37   
gb|KHF99254.1|  29 kDa ribonucleoprotein B, chloroplastic               146   3e-37   
ref|NP_001062073.1|  Os08g0483200                                       144   1e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010264653.1|  PREDICTED: 29 kDa ribonucleoprotein A, chlor...    144   1e-36   
gb|EAZ31815.1|  hypothetical protein OsJ_15973                          143   1e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006660227.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    145   2e-36   
ref|XP_004137828.1|  PREDICTED: 29 kDa ribonucleoprotein, chlorop...    144   3e-36   
ref|XP_010253722.1|  PREDICTED: 29 kDa ribonucleoprotein A, chlor...    144   4e-36   
ref|XP_010101007.1|  28 kDa ribonucleoprotein                           148   4e-36   
ref|XP_004237950.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    143   4e-36   
ref|XP_006363306.1|  PREDICTED: 29 kDa ribonucleoprotein A, chlor...    142   8e-36   
ref|XP_003557582.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    144   9e-36   
gb|EYU36476.1|  hypothetical protein MIMGU_mgv1a011581mg                141   2e-35   
ref|XP_007018692.1|  RNA-binding family protein, putative               141   4e-35   
ref|XP_011077346.1|  PREDICTED: 29 kDa ribonucleoprotein A, chlor...    140   4e-35   
emb|CDP20861.1|  unnamed protein product                                141   5e-35   
gb|AAA79045.1|  24 kDa RNA binding protein                              139   5e-35   Spinacia oleracea
gb|KHN48430.1|  33 kDa ribonucleoprotein, chloroplastic                 140   7e-35   
ref|NP_001058927.1|  Os07g0158300                                       141   8e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004973720.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    139   9e-35   
emb|CAA11894.1|  cp33Hv                                                 141   1e-34   Hordeum vulgare [barley]
dbj|BAJ87580.1|  predicted protein                                      141   1e-34   
ref|XP_008243948.1|  PREDICTED: ribonucleoprotein At2g37220, chlo...    139   1e-34   
ref|XP_010675723.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    139   1e-34   
ref|XP_004497644.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    140   1e-34   
ref|XP_003590324.1|  33 kDa ribonucleoprotein                           139   2e-34   
gb|ACR36437.1|  unknown                                                 138   3e-34   Zea mays [maize]
ref|XP_002465205.1|  hypothetical protein SORBIDRAFT_01g034120          137   4e-34   Sorghum bicolor [broomcorn]
gb|KHG00077.1|  29 kDa ribonucleoprotein A, chloroplastic               137   5e-34   
gb|EPS60671.1|  hypothetical protein M569_14131                         135   5e-34   
ref|XP_007205644.1|  hypothetical protein PRUPE_ppa009295mg             138   5e-34   
gb|EMS58171.1|  33 kDa ribonucleoprotein, chloroplastic                 139   6e-34   
ref|NP_001148607.1|  ribonucleoprotein A precursor                      137   7e-34   Zea mays [maize]
ref|XP_004304439.1|  PREDICTED: 29 kDa ribonucleoprotein A, chlor...    137   7e-34   
gb|ACO71288.1|  cp31BHv                                                 134   8e-34   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006433910.1|  hypothetical protein CICLE_v10001605mg             139   8e-34   
tpg|DAA45554.1|  TPA: ribonucleoprotein A                               136   8e-34   
gb|ABR26075.1|  chloroplast 29 kDa ribonucleoprotein                    135   9e-34   Oryza sativa Indica Group [Indian rice]
gb|ABK26841.1|  unknown                                                 138   1e-33   Picea sitchensis
ref|XP_006650133.1|  PREDICTED: ribonucleoprotein At2g37220, chlo...    136   1e-33   
ref|XP_006658862.1|  PREDICTED: 29 kDa ribonucleoprotein A, chlor...    135   1e-33   
gb|ABK22250.1|  unknown                                                 138   1e-33   Picea sitchensis
ref|XP_009387302.1|  PREDICTED: 29 kDa ribonucleoprotein A, chlor...    136   1e-33   
ref|XP_003535181.1|  PREDICTED: 29 kDa ribonucleoprotein A, chlor...    136   1e-33   
dbj|BAK08134.1|  predicted protein                                      136   1e-33   
ref|XP_002445992.1|  hypothetical protein SORBIDRAFT_07g029220          136   2e-33   Sorghum bicolor [broomcorn]
emb|CAA11893.1|  cp31BHv                                                136   2e-33   Hordeum vulgare [barley]
ref|XP_003574918.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    136   2e-33   
gb|EAZ04802.1|  hypothetical protein OsI_26976                          135   2e-33   Oryza sativa Indica Group [Indian rice]
dbj|BAJ96384.1|  predicted protein                                      136   2e-33   
gb|EMT07597.1|  33 kDa ribonucleoprotein, chloroplastic                 135   2e-33   
ref|XP_008811289.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    137   2e-33   
ref|NP_001060364.1|  Os07g0631900                                       135   2e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004501850.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    136   2e-33   
ref|NP_001050221.1|  Os03g0376600                                       135   3e-33   Oryza sativa Japonica Group [Japonica rice]
gb|KDP29121.1|  hypothetical protein JCGZ_16510                         135   3e-33   
ref|XP_011094656.1|  PREDICTED: 29 kDa ribonucleoprotein A, chlor...    135   3e-33   
ref|XP_007144372.1|  hypothetical protein PHAVU_007G150700g             135   3e-33   
emb|CDX95334.1|  BnaC04g28240D                                          136   3e-33   
gb|EAY90218.1|  hypothetical protein OsI_11785                          135   3e-33   Oryza sativa Indica Group [Indian rice]
gb|KDO81066.1|  hypothetical protein CISIN_1g021890mg                   136   3e-33   
ref|XP_002444599.1|  hypothetical protein SORBIDRAFT_07g024400          135   3e-33   Sorghum bicolor [broomcorn]
ref|XP_004304681.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    135   3e-33   
ref|XP_004136268.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    136   3e-33   
ref|XP_007162982.1|  hypothetical protein PHAVU_001G196700g             136   3e-33   
ref|XP_006846809.1|  hypothetical protein AMTR_s00148p00072380          135   3e-33   
ref|NP_001130287.1|  uncharacterized protein LOC100191381               135   4e-33   Zea mays [maize]
ref|XP_006472543.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    135   4e-33   
ref|XP_010684074.1|  PREDICTED: ribonucleoprotein At2g37220, chlo...    135   5e-33   
gb|ACG34122.1|  ribonucleoprotein                                       135   5e-33   Zea mays [maize]
ref|XP_004974183.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    135   5e-33   
ref|XP_003554474.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    135   7e-33   
ref|XP_009373525.1|  PREDICTED: 29 kDa ribonucleoprotein A, chlor...    134   7e-33   
ref|XP_006660380.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    135   9e-33   
ref|XP_010436014.1|  PREDICTED: 29 kDa ribonucleoprotein A, chlor...    135   9e-33   
gb|KEH35015.1|  31 kDa ribonucleoprotein                                134   1e-32   
ref|XP_003521499.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    135   1e-32   
ref|XP_010247638.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    135   1e-32   
ref|XP_010421828.1|  PREDICTED: 30S ribosomal protein 2, chloropl...    134   1e-32   
gb|ABK24055.1|  unknown                                                 134   1e-32   Picea sitchensis
ref|NP_001149184.1|  LOC100282806                                       134   1e-32   Zea mays [maize]
ref|XP_008442930.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    134   2e-32   
gb|ACF82264.1|  unknown                                                 133   2e-32   Zea mays [maize]
gb|EPS70093.1|  hypothetical protein M569_04668                         133   2e-32   
emb|CAD18921.1|  RNA-binding protein precursor                          134   2e-32   Persea americana
ref|XP_004497514.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    134   2e-32   
ref|NP_001150253.1|  ribonucleoprotein                                  133   2e-32   Zea mays [maize]
ref|XP_006288345.1|  hypothetical protein CARUB_v10001593mg             134   2e-32   
ref|NP_001062481.2|  Os08g0557100                                       130   2e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004958419.1|  PREDICTED: ribonucleoprotein At2g37220, chlo...    132   2e-32   
ref|XP_011013921.1|  PREDICTED: ribonucleoprotein At2g37220, chlo...    133   2e-32   
ref|XP_008466190.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    133   3e-32   
ref|XP_009589536.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    133   3e-32   
gb|AFK44430.1|  unknown                                                 133   3e-32   
gb|KGN59223.1|  hypothetical protein Csa_3G782700                       134   3e-32   
ref|XP_004136521.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    134   3e-32   
gb|KHN48247.1|  Ribonucleoprotein, chloroplastic                        132   4e-32   
ref|NP_001239665.1|  uncharacterized protein LOC100790280               132   4e-32   
gb|KHN07969.1|  31 kDa ribonucleoprotein, chloroplastic                 132   4e-32   
ref|XP_004501684.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    132   5e-32   
ref|NP_199836.1|  chloroplast RNA-binding protein 31B                   132   6e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003562626.1|  PREDICTED: ribonucleoprotein At2g37220, chlo...    132   7e-32   
ref|XP_009770625.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    132   7e-32   
ref|XP_002865780.1|  hypothetical protein ARALYDRAFT_918033             132   7e-32   
ref|XP_009342961.1|  PREDICTED: 29 kDa ribonucleoprotein A, chlor...    132   7e-32   
ref|XP_011074215.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    131   8e-32   
gb|AFW61755.1|  ribonucleoprotein                                       131   1e-31   
emb|CDY23210.1|  BnaA04g05490D                                          132   1e-31   
ref|XP_007028003.1|  Chloroplast RNA-binding protein 33                 132   1e-31   
ref|XP_008369683.1|  PREDICTED: 29 kDa ribonucleoprotein A, chlor...    131   1e-31   
dbj|BAJ87427.1|  predicted protein                                      131   1e-31   
gb|KHG03704.1|  33 kDa ribonucleoprotein, chloroplastic                 132   1e-31   
dbj|BAD09078.1|  putative nucleic acid-binding protein                  132   1e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010312344.1|  PREDICTED: 29 kDa ribonucleoprotein B, chlor...    131   1e-31   
gb|EAZ07975.1|  hypothetical protein OsI_30233                          132   1e-31   Oryza sativa Indica Group [Indian rice]
tpg|DAA63746.1|  TPA: hypothetical protein ZEAMMB73_977373              130   1e-31   
ref|XP_010026026.1|  PREDICTED: 29 kDa ribonucleoprotein A, chlor...    131   1e-31   
ref|XP_009384983.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    132   1e-31   
ref|XP_009409107.1|  PREDICTED: 29 kDa ribonucleoprotein A, chlor...    130   1e-31   
dbj|BAA06520.1|  RNA-binding protein cp31                               131   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001240946.1|  uncharacterized protein LOC100812934               130   2e-31   
ref|XP_009139461.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    131   2e-31   
ref|XP_006857647.1|  hypothetical protein AMTR_s00061p00142700          131   2e-31   
ref|XP_002461076.1|  hypothetical protein SORBIDRAFT_02g040260          130   2e-31   Sorghum bicolor [broomcorn]
ref|XP_010530167.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    131   2e-31   
dbj|BAA06521.1|  RNA-binding protein cp31                               131   2e-31   Arabidopsis thaliana [mouse-ear cress]
gb|KDP41428.1|  hypothetical protein JCGZ_15835                         131   2e-31   
gb|EMT13836.1|  33 kDa ribonucleoprotein, chloroplastic                 132   2e-31   
gb|AAK95304.1|AF410318_1  AT4g24770/F22K18_30                           131   3e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004246655.1|  PREDICTED: 29 kDa ribonucleoprotein A, chlor...    130   3e-31   
ref|XP_010455318.1|  PREDICTED: 29 kDa ribonucleoprotein A, chlor...    130   3e-31   
ref|NP_194208.1|  ribonucleoprotein RBP31                               131   3e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010553318.1|  PREDICTED: ribonucleoprotein At2g37220, chlo...    130   3e-31   
gb|AAA18379.1|  RNA-binding protein 2                                   130   3e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009370331.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    130   4e-31   
ref|NP_001289491.1|  29 kDa ribonucleoprotein A, chloroplastic          129   4e-31   
ref|XP_009371733.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    130   4e-31   
ref|XP_011048542.1|  PREDICTED: ribonucleoprotein At2g37220, chlo...    129   4e-31   
ref|XP_010250975.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    130   4e-31   
ref|XP_008219352.1|  PREDICTED: 29 kDa ribonucleoprotein B, chlor...    130   4e-31   
ref|NP_001275094.1|  single-stranded DNA binding protein precursor      130   4e-31   
ref|XP_006403809.1|  hypothetical protein EUTSA_v10010548mg             130   5e-31   
ref|NP_001078360.1|  RNA recognition motif-containing protein           128   5e-31   Arabidopsis thaliana [mouse-ear cress]
emb|CAA43420.1|  RNA binding protein                                    130   6e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002323470.1|  29 kDa ribonucleoprotein                           129   6e-31   Populus trichocarpa [western balsam poplar]
ref|XP_010106985.1|  33 kDa ribonucleoprotein                           130   6e-31   
ref|XP_009136674.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    130   7e-31   
gb|EPS59981.1|  hypothetical protein M569_14824                         129   7e-31   
ref|XP_010926579.1|  PREDICTED: 29 kDa ribonucleoprotein A, chlor...    129   7e-31   
ref|XP_008797077.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    130   8e-31   
ref|XP_011040450.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    130   8e-31   
emb|CDY71165.1|  BnaCnng71670D                                          129   9e-31   
dbj|BAD43393.1|  putative protein                                       129   1e-30   Arabidopsis thaliana [mouse-ear cress]
gb|ABK24573.1|  unknown                                                 129   1e-30   Picea sitchensis
ref|NP_192643.2|  RNA recognition motif-containing protein              129   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010482334.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    128   1e-30   
tpg|DAA59581.1|  TPA: hypothetical protein ZEAMMB73_267259              130   1e-30   
ref|XP_002867645.1|  RNA-binding protein cp31                           129   1e-30   
ref|XP_008789424.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    128   1e-30   
ref|XP_006280900.1|  hypothetical protein CARUB_v10026893mg             129   1e-30   
ref|XP_009596607.1|  PREDICTED: 29 kDa ribonucleoprotein A, chlor...    128   1e-30   
ref|XP_010035949.1|  PREDICTED: 29 kDa ribonucleoprotein A, chlor...    129   1e-30   
emb|CDX90605.1|  BnaA03g41760D                                          129   1e-30   
ref|XP_007223173.1|  hypothetical protein PRUPE_ppa009133mg             129   1e-30   
ref|XP_002519525.1|  ribonucleoprotein, chloroplast, putative           128   1e-30   Ricinus communis
emb|CDY08947.1|  BnaC08g11770D                                          128   1e-30   
gb|ABK25016.1|  unknown                                                 128   1e-30   Picea sitchensis
gb|KHG05127.1|  29 kDa ribonucleoprotein B, chloroplastic               128   2e-30   
emb|CDX75120.1|  BnaC09g25620D                                          128   2e-30   
gb|ADE77701.1|  unknown                                                 128   2e-30   
gb|EMS52114.1|  31 kDa ribonucleoprotein, chloroplastic                 126   2e-30   
emb|CDY34309.1|  BnaA01g14120D                                          128   2e-30   
ref|XP_008230489.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    129   2e-30   
ref|XP_006433911.1|  hypothetical protein CICLE_v10001605mg             129   2e-30   
ref|XP_007136284.1|  hypothetical protein PHAVU_009G033600g             128   2e-30   
ref|XP_006363666.1|  PREDICTED: 29 kDa ribonucleoprotein B, chlor...    128   2e-30   
emb|CDY24846.1|  BnaA08g14640D                                          128   2e-30   
tpg|DAA59580.1|  TPA: hypothetical protein ZEAMMB73_267259              127   2e-30   
ref|XP_009137471.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    128   3e-30   
ref|XP_006292182.1|  hypothetical protein CARUB_v10018388mg             129   3e-30   
ref|XP_007215709.1|  hypothetical protein PRUPE_ppa008913mg             128   3e-30   
emb|CDY29078.1|  BnaC07g32840D                                          128   3e-30   
gb|EYU44836.1|  hypothetical protein MIMGU_mgv1a011418mg                127   3e-30   
ref|XP_009109240.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    127   3e-30   
ref|XP_011094245.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    128   3e-30   
gb|EPS68161.1|  hypothetical protein M569_06611                         125   3e-30   
ref|XP_003523114.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    127   3e-30   
ref|XP_010907351.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    128   3e-30   
ref|XP_010927551.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    128   4e-30   
ref|XP_010433726.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    127   4e-30   
ref|XP_006397214.1|  hypothetical protein EUTSA_v10028847mg             127   4e-30   
ref|XP_009763024.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    127   4e-30   
ref|XP_004296531.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    127   4e-30   
ref|XP_009113528.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    127   5e-30   
ref|XP_002306558.1|  RNA recognition motif-containing family protein    127   5e-30   Populus trichocarpa [western balsam poplar]
emb|CDY48060.1|  BnaA09g22980D                                          127   5e-30   
ref|XP_006413386.1|  hypothetical protein EUTSA_v10025809mg             127   5e-30   
ref|XP_010448520.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    127   5e-30   
gb|EAZ38747.1|  hypothetical protein OsJ_23149                          125   6e-30   
dbj|BAJ85374.1|  predicted protein                                      127   6e-30   
ref|XP_009138497.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    127   7e-30   
ref|XP_006661552.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    126   7e-30   
ref|XP_006430047.1|  hypothetical protein CICLE_v10012204mg             127   7e-30   
ref|XP_006481614.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    127   7e-30   
gb|KDO81067.1|  hypothetical protein CISIN_1g021890mg                   126   7e-30   
ref|XP_009589241.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    127   8e-30   
gb|KDO70644.1|  hypothetical protein CISIN_1g020607mg                   127   8e-30   
gb|KFK34485.1|  hypothetical protein AALP_AA5G151800                    127   8e-30   
ref|XP_006284198.1|  hypothetical protein CARUB_v10005352mg             126   9e-30   
gb|ABR25700.1|  chloroplast 28 kDa ribonucleoprotein                    123   9e-30   
ref|XP_010442501.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    126   9e-30   
ref|XP_009348657.1|  PREDICTED: multiple RNA-binding domain-conta...    126   9e-30   
ref|XP_011012428.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    127   1e-29   
ref|XP_002318093.2|  hypothetical protein POPTR_0012s09200g             127   1e-29   
ref|XP_010248714.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    127   1e-29   
ref|XP_010026954.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    127   1e-29   
ref|XP_008379549.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    126   1e-29   
ref|XP_002876141.1|  RNA-binding protein cp33                           126   1e-29   
gb|ABF60862.1|  GRSF                                                    124   1e-29   
ref|XP_002872360.1|  hypothetical protein ARALYDRAFT_489706             126   1e-29   
ref|XP_010441738.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    125   1e-29   
ref|XP_009592488.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    126   1e-29   
ref|XP_002281642.1|  PREDICTED: 29 kDa ribonucleoprotein A, chlor...    125   1e-29   
ref|XP_010521484.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    126   1e-29   
gb|EMT07115.1|  29 kDa ribonucleoprotein B, chloroplastic               129   1e-29   
ref|XP_010515700.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    126   2e-29   
ref|XP_006838974.1|  hypothetical protein AMTR_s00002p00271280          125   2e-29   
ref|XP_010111667.1|  31 kDa ribonucleoprotein                           126   2e-29   
gb|KEH24256.1|  33 kDa ribonucleoprotein                                126   2e-29   
ref|XP_002264127.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    125   2e-29   
gb|AAL32533.1|  ubiquitin / ribosomal protein CEP52                     126   2e-29   
ref|XP_010058980.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    126   2e-29   
ref|XP_006848957.1|  hypothetical protein AMTR_s00166p00060690          126   2e-29   
ref|XP_009777467.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    125   2e-29   
ref|XP_010650156.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    125   2e-29   
emb|CDY11032.1|  BnaA03g46910D                                          125   2e-29   
emb|CDX92651.1|  BnaC07g39090D                                          125   2e-29   
emb|CAA06469.1|  cp31AHv protein                                        125   2e-29   
ref|XP_004494258.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    125   2e-29   
gb|KFK29018.1|  hypothetical protein AALP_AA7G078100                    125   2e-29   
ref|XP_010426855.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    125   2e-29   
ref|XP_008464495.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    124   3e-29   
ref|XP_004299163.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    125   3e-29   
ref|XP_003578663.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    125   3e-29   
ref|XP_002298568.1|  hypothetical protein POPTR_0001s35830g             124   3e-29   
ref|NP_190806.1|  chloroplast RNA-binding protein 33                    125   3e-29   
dbj|BAA06523.1|  RNA-binding protein cp33                               125   3e-29   
ref|XP_008387118.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    126   3e-29   
ref|XP_010107527.1|  29 kDa ribonucleoprotein B                         125   3e-29   
emb|CBI34828.3|  unnamed protein product                                124   3e-29   
gb|EYU18105.1|  hypothetical protein MIMGU_mgv1a009876mg                125   3e-29   
ref|XP_008350217.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    126   3e-29   
ref|XP_009629671.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    124   4e-29   
ref|XP_009795960.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    124   4e-29   
ref|NP_001063946.1|  Os09g0565200                                       125   4e-29   
ref|NP_001105347.1|  nucleic acid binding protein1                      124   4e-29   
sp|P19682.1|ROC3_NICSY  RecName: Full=28 kDa ribonucleoprotein, c...    124   4e-29   
emb|CDP06746.1|  unnamed protein product                                129   4e-29   
ref|XP_010438970.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    124   4e-29   
sp|P49313.1|ROC1_NICPL  RecName: Full=30 kDa ribonucleoprotein, c...    124   4e-29   
ref|XP_006428771.1|  hypothetical protein CICLE_v10012331mg             124   4e-29   
ref|XP_009362797.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    126   4e-29   
ref|XP_010677550.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    125   5e-29   
dbj|BAA22411.1|  Ps16 protein                                           124   5e-29   
ref|XP_004299682.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    124   5e-29   
ref|XP_010503983.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    125   6e-29   
ref|XP_010940712.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    124   6e-29   
gb|EPS64023.1|  hypothetical protein M569_10758                         124   6e-29   
gb|ACJ85270.1|  unknown                                                 124   6e-29   
ref|XP_004236291.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    124   7e-29   
gb|KEH35016.1|  31 kDa ribonucleoprotein                                123   7e-29   
gb|AES60425.2|  RNA-binding (RRM/RBD/RNP motif) family protein          124   7e-29   
ref|XP_011029743.1|  PREDICTED: 29 kDa ribonucleoprotein, chlorop...    123   7e-29   
ref|XP_002311696.1|  RNA-binding protein RNP1 precursor                 123   7e-29   
ref|XP_004161367.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    124   7e-29   
ref|XP_001767211.1|  predicted protein                                  121   8e-29   
ref|XP_004984246.1|  PREDICTED: ribonucleoprotein At2g37220, chlo...    123   8e-29   
ref|XP_006351431.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    124   8e-29   
ref|XP_004138078.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    124   9e-29   
ref|XP_004956173.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    123   1e-28   
ref|XP_006348449.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    124   1e-28   
ref|XP_002314506.1|  RNA-binding protein RNP1 precursor                 123   1e-28   
gb|KHG05903.1|  31 kDa ribonucleoprotein, chloroplastic -like pro...    124   1e-28   
ref|XP_002270233.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    124   1e-28   
gb|KDP31006.1|  hypothetical protein JCGZ_11382                         124   1e-28   
ref|XP_011101833.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    123   1e-28   
ref|XP_001769447.1|  predicted protein                                  121   1e-28   
gb|KHG27068.1|  31 kDa ribonucleoprotein, chloroplastic -like pro...    124   1e-28   
ref|XP_003557886.1|  PREDICTED: ribonucleoprotein At2g37220, chlo...    122   1e-28   
gb|EYU22218.1|  hypothetical protein MIMGU_mgv1a010790mg                123   1e-28   
ref|XP_011011471.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    122   1e-28   
ref|XP_007037796.1|  31-kDa RNA binding protein                         123   1e-28   
ref|XP_007209411.1|  hypothetical protein PRUPE_ppa009286mg             123   2e-28   
ref|XP_008239362.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    123   2e-28   
emb|CAD18922.1|  RNA-binding protein precursor                          123   2e-28   
ref|XP_006381446.1|  29 kDa ribonucleoprotein                           122   2e-28   
ref|XP_007027346.1|  RNA-binding family protein isoform 1               121   2e-28   
ref|XP_003590174.1|  31 kDa ribonucleoprotein                           124   2e-28   
emb|CBI14910.3|  unnamed protein product                                122   2e-28   
ref|XP_010555517.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    123   2e-28   
gb|KHG08630.1|  28 kDa ribonucleoprotein, chloroplastic                 122   2e-28   
gb|KGN63520.1|  Ribonucleoprotein                                       124   2e-28   
ref|XP_009387705.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    122   3e-28   
ref|XP_007137988.1|  hypothetical protein PHAVU_009G171500g             122   3e-28   
gb|ACU23303.1|  unknown                                                 122   4e-28   
ref|XP_002278832.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    122   4e-28   
ref|XP_008360771.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    122   4e-28   
ref|XP_002511286.1|  ribonucleoprotein, chloroplast, putative           122   4e-28   
gb|KHN08962.1|  28 kDa ribonucleoprotein, chloroplastic                 122   4e-28   
ref|XP_006294745.1|  hypothetical protein CARUB_v10023790mg             121   4e-28   
ref|XP_003526568.2|  PREDICTED: 30 kDa ribonucleoprotein, chlorop...    122   4e-28   
ref|XP_010549094.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    120   4e-28   
ref|XP_007155499.1|  hypothetical protein PHAVU_003G206700g             122   5e-28   
ref|XP_010529882.1|  PREDICTED: ribonucleoprotein At2g37220, chlo...    121   5e-28   
emb|CAN61277.1|  hypothetical protein VITISV_002607                     123   5e-28   
gb|AAA18380.1|  RNA-binding protein 3                                   117   6e-28   
ref|XP_004228672.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    122   7e-28   
ref|XP_002321649.2|  RNA-binding family protein                         121   7e-28   
emb|CDP15100.1|  unnamed protein product                                121   7e-28   
ref|NP_181259.1|  chloroplast RNA binding protein                       120   8e-28   
gb|AAM66970.1|  putative RNA-binding protein                            120   8e-28   
ref|XP_010932264.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    121   1e-27   
ref|XP_004497803.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    122   1e-27   
ref|XP_011041444.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    120   1e-27   
ref|XP_009133135.1|  PREDICTED: ribonucleoprotein At2g37220, chlo...    120   1e-27   
ref|XP_008374364.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    120   1e-27   
emb|CDY46764.1|  BnaA03g17080D                                          120   1e-27   
emb|CDX74978.1|  BnaA05g07240D                                          120   1e-27   
ref|XP_009143521.1|  PREDICTED: ribonucleoprotein At2g37220, chlo...    120   1e-27   
ref|XP_002513981.1|  ribonucleoprotein, chloroplast, putative           120   1e-27   
gb|EPS60926.1|  hypothetical protein M569_13875                         117   1e-27   
ref|XP_009333915.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    120   1e-27   
gb|EAY88000.1|  hypothetical protein OsI_09422                          120   2e-27   
emb|CDY70564.1|  BnaAnng34160D                                          119   2e-27   
ref|XP_003522779.1|  PREDICTED: 29 kDa ribonucleoprotein A, chlor...    120   2e-27   
ref|NP_001048500.1|  Os02g0815200                                       120   2e-27   
gb|KHN27373.1|  28 kDa ribonucleoprotein, chloroplastic                 120   2e-27   
ref|XP_010528152.1|  PREDICTED: ribonucleoprotein At2g37220, chlo...    119   2e-27   
ref|XP_010509364.1|  PREDICTED: ribonucleoprotein At2g37220, chlo...    119   2e-27   
ref|NP_001151728.1|  ribonucleoprotein A                                119   2e-27   
ref|XP_010516981.1|  PREDICTED: ribonucleoprotein At2g37220, chlo...    119   2e-27   
ref|XP_001779557.1|  predicted protein                                  117   2e-27   
ref|XP_008442929.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    120   3e-27   
ref|XP_006392197.1|  hypothetical protein EUTSA_v10023650mg             118   3e-27   
ref|XP_010102930.1|  31 kDa ribonucleoprotein                           119   3e-27   
gb|EYU34456.1|  hypothetical protein MIMGU_mgv1a010534mg                119   3e-27   
ref|XP_006410902.1|  hypothetical protein EUTSA_v10017023mg             119   3e-27   
ref|XP_008351536.1|  PREDICTED: LOW QUALITY PROTEIN: 33 kDa ribon...    120   3e-27   
emb|CDO99317.1|  unnamed protein product                                119   3e-27   
gb|ABK25816.1|  unknown                                                 118   4e-27   
ref|XP_009113259.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    118   4e-27   
dbj|BAJ86334.1|  predicted protein                                      118   5e-27   
ref|XP_002461966.1|  hypothetical protein SORBIDRAFT_02g011330          118   5e-27   
ref|XP_010069100.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    118   6e-27   
ref|XP_008340667.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    119   6e-27   
ref|XP_006476920.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    119   6e-27   
ref|XP_010505299.1|  PREDICTED: ribonucleoprotein At2g37220, chlo...    118   6e-27   
ref|XP_006420345.1|  hypothetical protein CICLE_v10005487mg             118   6e-27   
ref|XP_009402710.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    119   6e-27   
ref|XP_006439972.1|  hypothetical protein CICLE_v10020731mg             119   6e-27   
ref|XP_010541810.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    119   6e-27   
ref|XP_010264869.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    118   7e-27   
emb|CAA66479.1|  RNA- or ssDNA-binding protein                          118   7e-27   
ref|XP_010695994.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    118   7e-27   
ref|XP_009141639.1|  PREDICTED: ribonucleoprotein At2g37220, chlo...    118   8e-27   
emb|CAA41023.1|  28kD RNA binding protein                               116   8e-27   
sp|P28644.1|ROC1_SPIOL  RecName: Full=28 kDa ribonucleoprotein, c...    116   8e-27   
gb|KDP36099.1|  hypothetical protein JCGZ_08743                         118   8e-27   
ref|XP_009357971.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    118   8e-27   
ref|XP_009401203.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    117   9e-27   
emb|CDX91345.1|  BnaC04g08050D                                          117   9e-27   
gb|ACL53183.1|  unknown                                                 117   1e-26   
ref|XP_007145349.1|  hypothetical protein PHAVU_007G231600g             117   1e-26   
ref|XP_008807478.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    117   1e-26   
gb|KHN05811.1|  31 kDa ribonucleoprotein, chloroplastic                 114   2e-26   
ref|XP_006660491.1|  PREDICTED: 30S ribosomal protein 2, chloropl...    116   2e-26   
emb|CDY30922.1|  BnaC09g14840D                                          116   2e-26   
ref|XP_006489625.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    117   2e-26   
ref|XP_003577917.1|  PREDICTED: 30S ribosomal protein 2, chloropl...    115   2e-26   
gb|AFK34861.1|  unknown                                                 116   2e-26   
ref|XP_003602847.1|  Multiple RNA-binding domain-containing protein     116   2e-26   
ref|XP_004303408.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    117   2e-26   
ref|XP_011005610.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    117   3e-26   
emb|CAA74889.1|  ribonucleoprotein                                      116   3e-26   
ref|XP_002881497.1|  hypothetical protein ARALYDRAFT_482714             116   3e-26   
gb|ABK96373.1|  unknown                                                 115   3e-26   
emb|CAN61133.1|  hypothetical protein VITISV_039575                     121   3e-26   
ref|XP_002314019.1|  hypothetical protein POPTR_0009s07030g             115   3e-26   
ref|XP_004515855.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    116   3e-26   
ref|XP_006649164.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    115   3e-26   
emb|CDX79724.1|  BnaC03g20600D                                          116   3e-26   
ref|XP_007035265.1|  RNA-binding family protein                         116   4e-26   
ref|XP_002528350.1|  ribonucleoprotein, chloroplast, putative           115   4e-26   
gb|EMT29116.1|  31 kDa ribonucleoprotein, chloroplastic                 114   5e-26   
ref|XP_011091341.1|  PREDICTED: 29 kDa ribonucleoprotein A, chlor...    115   5e-26   
gb|KFK40824.1|  hypothetical protein AALP_AA2G046300                    114   6e-26   
gb|KEH31746.1|  31 kDa ribonucleoprotein                                115   6e-26   
ref|NP_001062760.1|  Os09g0279500                                       114   7e-26   
gb|EMT04407.1|  30S ribosomal protein 2, chloroplastic                  112   8e-26   
ref|XP_004134038.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    114   9e-26   
ref|XP_011042571.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    115   9e-26   
ref|XP_002462099.1|  hypothetical protein SORBIDRAFT_02g018650          114   1e-25   
gb|AFK47384.1|  unknown                                                 115   1e-25   
gb|ABR16796.1|  unknown                                                 116   1e-25   
dbj|BAJ93016.1|  predicted protein                                      113   1e-25   
gb|AFK43359.1|  unknown                                                 115   1e-25   
dbj|BAG09558.1|  chloroplast RNA binding protein                        114   1e-25   
ref|XP_011072001.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    115   1e-25   
ref|XP_010236731.1|  PREDICTED: 33 kDa ribonucleoprotein, chlorop...    114   2e-25   
ref|XP_009383818.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    114   2e-25   
ref|XP_002886641.1|  hypothetical protein ARALYDRAFT_475310             113   2e-25   
ref|XP_010667102.1|  PREDICTED: 28 kDa ribonucleoprotein, chlorop...    114   2e-25   
ref|XP_003525605.1|  PREDICTED: 31 kDa ribonucleoprotein, chlorop...    114   2e-25   
ref|XP_007202103.1|  hypothetical protein PRUPE_ppa007596mg             115   2e-25   
gb|KDP39809.1|  hypothetical protein JCGZ_04908                         113   2e-25   
ref|XP_006428770.1|  hypothetical protein CICLE_v10012331mg             113   2e-25   
ref|XP_004956457.1|  PREDICTED: 30S ribosomal protein 2, chloropl...    112   2e-25   



>ref|XP_009778082.1| PREDICTED: 28 kDa ribonucleoprotein, chloroplastic [Nicotiana 
sylvestris]
Length=287

 Score =   283 bits (725),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 156/242 (64%), Positives = 188/242 (78%), Gaps = 4/242 (2%)
 Frame = -3

Query  993  FSKPLRLQISPNYPTLSLKSLMRSLPSLASTKLKTSHILRCStveeqavvaveteqEKTP  814
            F   +RL+ S +YP +SLKSL+  LP    ++ + SH L CSTVEE AV   E + EK  
Sbjct  29   FPNSVRLENSTHYPNVSLKSLLWPLP--LPSRNQWSHQLHCSTVEEVAVQEKEEKTEKIQ  86

Query  813  KPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAE  634
            + N RRKLFVLNLPWSL V D+K LF + G VEDVE IKTK+G+NRGFAFVTM+SGEEA+
Sbjct  87   RSNQRRKLFVLNLPWSLTVPDIKTLFAESGIVEDVEIIKTKDGKNRGFAFVTMSSGEEAQ  146

Query  633  AAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDG--RYKLYVSNLAWKARSTHLR  460
            AAI K +SYEL GR IRVE++K+FKKP  +PPP  P  G  R+KLYVSNLAWK RSTHLR
Sbjct  147  AAIDKLDSYELLGRIIRVEFAKRFKKPAGAPPPSTPPRGETRHKLYVSNLAWKVRSTHLR  206

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            + FS N NP+S RVVF+NASG++AGYGFV+F TKEEAEAA+S+ DG EL+GRPIRLK SE
Sbjct  207  DFFSTNHNPVSVRVVFDNASGRAAGYGFVSFDTKEEAEAALSAYDGKELMGRPIRLKFSE  266

Query  279  KN  274
            K+
Sbjct  267  KD  268



>ref|XP_004245902.1| PREDICTED: 28 kDa ribonucleoprotein, chloroplastic [Solanum lycopersicum]
Length=285

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 152/243 (63%), Positives = 187/243 (77%), Gaps = 6/243 (2%)
 Frame = -3

Query  993  FSKPLRLQISPNYPTLSLKSLMRSLPSLASTKLKTSHILRCStveeqavvaveteqEKTP  814
            F   ++LQ   +   LSLKS++  LP L S K  T   L CS VE    V V+ E+ + P
Sbjct  27   FPNSIKLQNYNHSLNLSLKSILYPLP-LPSRKQCTQ--LHCSAVEVTEPVTVQEEKTEKP  83

Query  813  -KPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEA  637
             K N RRKLFVLNLPWSL V+D+K +F +CG V+DVE IKTK+G++RGFAFVTM+SGEEA
Sbjct  84   QKNNQRRKLFVLNLPWSLTVADIKNIFAECGIVDDVEIIKTKDGKSRGFAFVTMSSGEEA  143

Query  636  EAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDG--RYKLYVSNLAWKARSTHL  463
            +AAI K +SYE+SGR IRVE++K+FKKP  +PPP  P  G  R+KLYVSNLAWK RST L
Sbjct  144  QAAIDKLDSYEVSGRIIRVEFAKRFKKPPGAPPPSTPPQGEARHKLYVSNLAWKVRSTQL  203

Query  462  RELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
            RE FSAN NPISARVVF+NASG++AGYGFV F TKE+AEAA+S++DG EL+GRPIRLK S
Sbjct  204  REFFSANNNPISARVVFDNASGRAAGYGFVTFDTKEQAEAALSALDGKELMGRPIRLKFS  263

Query  282  EKN  274
            E++
Sbjct  264  ERD  266



>ref|XP_011082360.1| PREDICTED: 29 kDa ribonucleoprotein, chloroplastic [Sesamum indicum]
Length=297

 Score =   269 bits (688),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 146/240 (61%), Positives = 183/240 (76%), Gaps = 9/240 (4%)
 Frame = -3

Query  981  LRLQISPNYPTLSLKSLMRSLPSLASTKLKTSHILRC---StveeqavvaveteqEKTPK  811
            +R  IS + P   LK    +LP L+      SH ++C           V VE E E++ K
Sbjct  33   VRFGISLSPPAALLKFTQYNLPFLS-----PSHPIKCPGFQCHSSLESVTVEEEVEESGK  87

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEA  631
            P  RRKLFVLNLPWS +V+D+K+LFG+CGTV DVE IK K+G+NRGFAFVTM+SGEEA+A
Sbjct  88   PESRRKLFVLNLPWSFSVADIKKLFGECGTVADVEIIKQKDGKNRGFAFVTMSSGEEAQA  147

Query  630  AIQKFNSYELSGRTIRVEYSKKFKKPIR-SpppppPRDGRYKLYVSNLAWKARSTHLREL  454
            AI+K++SYEL GR IRV+++++FKKP R SP   PP + R+KLYVSNLAWK RS +LR+ 
Sbjct  148  AIEKYDSYELVGRIIRVQFARRFKKPTRASPVVTPPGETRHKLYVSNLAWKVRSNNLRDF  207

Query  453  FSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEKN  274
            FS+NFNP+S RVVF+N SG+SAGYGFV+F TKEEAE+AIS++DG ELLGRPIRLK SEKN
Sbjct  208  FSSNFNPVSVRVVFDNPSGRSAGYGFVSFATKEEAESAISALDGKELLGRPIRLKFSEKN  267



>ref|XP_006352864.1| PREDICTED: 28 kDa ribonucleoprotein, chloroplastic-like [Solanum 
tuberosum]
Length=284

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 150/245 (61%), Positives = 188/245 (77%), Gaps = 12/245 (5%)
 Frame = -3

Query  993  FSKPLRLQISPNYPTLSLKSLMRSLPSLASTKLKTSHILRCStveeqavvaveteqEKTP  814
            F   ++LQ S +   LSLKS+   LP L+  +    H   CS VE    V V+ E+ KT 
Sbjct  28   FPNSIKLQNSNHSLNLSLKSI---LPLLSRKQCSQLH---CSAVEVTEPVTVQEEE-KTE  80

Query  813  KP---NLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGE  643
            KP   NLRRKLFVLNLPWSL V D+K +F +CG V+DVE IKT++G++RGFAFVTM+SGE
Sbjct  81   KPQKNNLRRKLFVLNLPWSLTVPDIKNIFAECGIVDDVEIIKTEDGKSRGFAFVTMSSGE  140

Query  642  EAEAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDG--RYKLYVSNLAWKARST  469
            EA+AAI K +SYE+ GR IRVE++K+FKKP  +PPP  P  G  R+KLYVSNLAWK RST
Sbjct  141  EAQAAIDKLDSYEVLGRIIRVEFAKRFKKPPGAPPPSTPPQGEARHKLYVSNLAWKVRST  200

Query  468  HLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLK  289
             LRE FSAN+NPISARV+F+NASG++AGYGFV+F TKE+AEAA+S++DG EL+GRPIRLK
Sbjct  201  QLREFFSANYNPISARVIFDNASGRAAGYGFVSFDTKEQAEAAVSALDGKELMGRPIRLK  260

Query  288  MSEKN  274
             SE++
Sbjct  261  FSERD  265



>ref|XP_010053618.1| PREDICTED: 28 kDa ribonucleoprotein, chloroplastic [Eucalyptus 
grandis]
 gb|KCW77961.1| hypothetical protein EUGRSUZ_D02207 [Eucalyptus grandis]
Length=303

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 162/185 (88%), Gaps = 2/185 (1%)
 Frame = -3

Query  822  KTPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGE  643
            +T + N+++KL+V+NLPWSL+V D+K LFGQCGT +DVE IK K+G++RGFAFVTM+SGE
Sbjct  98   ETQEQNIKKKLYVVNLPWSLSVQDIKNLFGQCGTAKDVEIIKQKDGRSRGFAFVTMSSGE  157

Query  642  EAEAAIQKFNSYELSGRTIRVEYSKKFKKPIRSppppp--PRDGRYKLYVSNLAWKARST  469
            EA+A ++KF+S+E+SGR IRVE++K+F++P   PPP     ++ R+KLYVSNLAWKARST
Sbjct  158  EAQAVVEKFDSFEVSGRIIRVEFAKRFRRPPPPPPPNVPPAKETRHKLYVSNLAWKARST  217

Query  468  HLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLK  289
            HLRELFS NFNP+S+RVVFE+ SG+SAGYGFV+F T+EEAEAAIS++DG EL+GRP+RLK
Sbjct  218  HLRELFSENFNPVSSRVVFESPSGRSAGYGFVSFATREEAEAAISALDGKELMGRPLRLK  277

Query  288  MSEKN  274
             SE+N
Sbjct  278  FSERN  282



>gb|KHG14110.1| 33 kDa ribonucleoprotein, chloroplastic [Gossypium arboreum]
Length=287

 Score =   258 bits (659),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 147/246 (60%), Positives = 181/246 (74%), Gaps = 15/246 (6%)
 Frame = -3

Query  993  FSKPLRL-----QISPNYPTLSLKSLMRSLPSLASTKLKTSHILRCStveeqavvavete  829
            ++KP RL      IS + P LS      S+  L ST+ K S  L CST++E ++ A    
Sbjct  27   YAKPSRLSSLTSHISKSTPLLSHNF---SISPLISTQKKLSFQL-CSTLQEVSLEAETD-  81

Query  828  qEKTPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMAS  649
              KT K N++RKLFVLNLPWS  V+D+K+LFGQCGTV+DVE IK K+G++R FAFVTMAS
Sbjct  82   --KTQKSNVKRKLFVLNLPWSYTVADIKDLFGQCGTVKDVEIIKQKDGRSRNFAFVTMAS  139

Query  648  GEEAEAAIQKFNSYELSGRTIRVEYSKKFKKPI--RSpppppPRDGRYKLYVSNLAWKAR  475
            GEEA+AAI K +S E+SGR IRVE+S++ KKP    S P  P R+ R+KLYVSNLAWK R
Sbjct  140  GEEAQAAIDKLDSLEVSGRIIRVEFSRRLKKPSPPSSEPIVPSRETRHKLYVSNLAWKVR  199

Query  474  STHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIR  295
            S HLRE FSA FNP+S RVVF N SG+SAGYGFV+F T EEAEAA+S++DG EL+ RPIR
Sbjct  200  SIHLREFFSA-FNPVSVRVVFSNPSGQSAGYGFVSFATMEEAEAAVSTLDGKELMDRPIR  258

Query  294  LKMSEK  277
            LK SE+
Sbjct  259  LKFSER  264



>emb|CDP13040.1| unnamed protein product [Coffea canephora]
Length=289

 Score =   258 bits (659),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 156/182 (86%), Gaps = 2/182 (1%)
 Frame = -3

Query  816  PKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEA  637
            P+ N +RKLFVLNLPWS  V+D+K LF +CGTV DVE IK K+G+NRGFAFVTMASGEEA
Sbjct  90   PQTNQKRKLFVLNLPWSFTVADIKNLFAECGTVTDVEIIKQKDGKNRGFAFVTMASGEEA  149

Query  636  EAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPR-DGRYKLYVSNLAWKARSTHLR  460
            +AAI+KF+S+ELSGR IRVE +K+FKKP RSPP  P R +  +KLY SNLAWK RS+HL+
Sbjct  150  QAAIKKFDSHELSGRIIRVELAKRFKKPSRSPPEVPSRGETCHKLYASNLAWKVRSSHLK  209

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            E FSA ++P+SARVVF++ SG+SAGYGF++F TKEEAEAAISS++G ELLGRPI+LK S+
Sbjct  210  EFFSA-YSPVSARVVFDSPSGRSAGYGFISFATKEEAEAAISSLEGKELLGRPIKLKFSQ  268

Query  279  KN  274
            KN
Sbjct  269  KN  270



>ref|XP_004301780.1| PREDICTED: 33 kDa ribonucleoprotein, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=299

 Score =   258 bits (658),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 142/247 (57%), Positives = 178/247 (72%), Gaps = 9/247 (4%)
 Frame = -3

Query  993  FSKPLRLQISPNYPTLSLKSLMRSLPSLASTKLKTSHILRCStveeqavvaveteqE---  823
            F KPL L++    P +S   L+ S P + + KL  S  L CS V+E      E  ++   
Sbjct  24   FPKPLNLRLPSFIPPISHNFLLSSPPLIPARKL--SFELLCSAVQEITTQEEEQAEQESA  81

Query  822  --KTPKP-NLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMA  652
              KT K  NL+RKL+V+NLPWSL V+D+K LFGQCG V+DVE IK  +G+NRGFAFVTMA
Sbjct  82   EEKTQKQQNLKRKLYVVNLPWSLTVADIKTLFGQCGHVKDVEIIKQMDGRNRGFAFVTMA  141

Query  651  SGEEAEAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARS  472
            SGEEA+A I KF+S ELSGRT++VE++K+FKKP   P  P  ++ RYKLYVSNLAWKARS
Sbjct  142  SGEEAQAVIDKFDSQELSGRTVKVEFAKQFKKPTPRPSTPKVQETRYKLYVSNLAWKARS  201

Query  471  THLRELFSANF-NPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIR  295
            +HLR+  S NF  P+SARVVF+  SGKS GYGFV+F   EEAE AIS+++G EL+GRP+ 
Sbjct  202  SHLRDFVSLNFKTPVSARVVFDGPSGKSVGYGFVSFARMEEAEEAISALNGQELMGRPVT  261

Query  294  LKMSEKN  274
            LK SEKN
Sbjct  262  LKFSEKN  268



>emb|CBI33876.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   254 bits (650),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 153/186 (82%), Gaps = 4/186 (2%)
 Frame = -3

Query  822  KTPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGE  643
            +T +PN +RKLFVLNLPWSL+V D+K LFG+CGTV DVE IK K+G++RG+AFVTM SGE
Sbjct  51   QTQEPNQKRKLFVLNLPWSLSVVDIKNLFGECGTVTDVEIIKQKDGRSRGYAFVTMDSGE  110

Query  642  EAEAAIQKFNSYELSGRTIRVEYSKKFKK----PIRSpppppPRDGRYKLYVSNLAWKAR  475
            EA+A ++KF+SYELSGR IRVE++K+FKK    P   P  PP  + R+KLYVSNLAWK R
Sbjct  111  EAQAVVEKFDSYELSGRIIRVEFAKRFKKPSPPPPPPPAGPPAGETRHKLYVSNLAWKVR  170

Query  474  STHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIR  295
            STHLRE FS+NFNP+S RVVF++ SG+S GYGF +F TKEEAEAAIS++DG EL+GRP+ 
Sbjct  171  STHLREFFSSNFNPVSVRVVFDSPSGRSGGYGFASFATKEEAEAAISALDGKELMGRPVH  230

Query  294  LKMSEK  277
            LK S K
Sbjct  231  LKFSVK  236



>ref|XP_002279685.1| PREDICTED: ribonucleoprotein At2g37220, chloroplastic [Vitis 
vinifera]
Length=288

 Score =   255 bits (651),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 153/187 (82%), Gaps = 4/187 (2%)
 Frame = -3

Query  822  KTPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGE  643
            +T +PN +RKLFVLNLPWSL+V D+K LFG+CGTV DVE IK K+G++RG+AFVTM SGE
Sbjct  81   QTQEPNQKRKLFVLNLPWSLSVVDIKNLFGECGTVTDVEIIKQKDGRSRGYAFVTMDSGE  140

Query  642  EAEAAIQKFNSYELSGRTIRVEYSKKFKK----PIRSpppppPRDGRYKLYVSNLAWKAR  475
            EA+A ++KF+SYELSGR IRVE++K+FKK    P   P  PP  + R+KLYVSNLAWK R
Sbjct  141  EAQAVVEKFDSYELSGRIIRVEFAKRFKKPSPPPPPPPAGPPAGETRHKLYVSNLAWKVR  200

Query  474  STHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIR  295
            STHLRE FS+NFNP+S RVVF++ SG+S GYGF +F TKEEAEAAIS++DG EL+GRP+ 
Sbjct  201  STHLREFFSSNFNPVSVRVVFDSPSGRSGGYGFASFATKEEAEAAISALDGKELMGRPVH  260

Query  294  LKMSEKN  274
            LK S K 
Sbjct  261  LKFSVKT  267



>gb|KDO39068.1| hypothetical protein CISIN_1g044184mg [Citrus sinensis]
Length=275

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 151/184 (82%), Gaps = 1/184 (1%)
 Frame = -3

Query  822  KTPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGE  643
            +T K N+RRKL+V NLPWS +V+++K LF  CGTV DVE IK K G+NR FAFVTMAS E
Sbjct  71   QTQKQNIRRKLYVFNLPWSFSVAEIKNLFAPCGTVVDVEIIKHKGGKNRNFAFVTMASPE  130

Query  642  EAEAAIQKFNSYELSGRTIRVEYSKKFKKP-IRSpppppPRDGRYKLYVSNLAWKARSTH  466
            EA+AA+ +F++ E+SGR IRVE++KKFKKP  +     P R+ ++KLYVSNL+WK RSTH
Sbjct  131  EAQAAVNQFDTQEVSGRIIRVEFAKKFKKPRPQRSASAPARETQHKLYVSNLSWKVRSTH  190

Query  465  LRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKM  286
            LRE FSANFNP+S++VVFE+  G+SAGYGFV+F TKEEAEAAISS+DG EL+GRP+RLK 
Sbjct  191  LREFFSANFNPVSSKVVFESNEGRSAGYGFVSFATKEEAEAAISSLDGKELMGRPLRLKF  250

Query  285  SEKN  274
             +KN
Sbjct  251  GQKN  254



>ref|XP_010273155.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic [Nelumbo 
nucifera]
Length=284

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 147/177 (83%), Gaps = 1/177 (1%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            R+KLFVLNLPW  +V+D+K LFG+CGTV DVE IK K+G+NRGFAFVTM+SGEEA A + 
Sbjct  87   RKKLFVLNLPWRFSVADIKNLFGECGTVNDVEVIKQKDGRNRGFAFVTMSSGEEARAVVD  146

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSppppp-PRDGRYKLYVSNLAWKARSTHLRELFSA  445
            KF+SYELSGR IRVE++K+  KP R  P      + R+K+YVSNLAWK RS+HLRE FSA
Sbjct  147  KFDSYELSGRIIRVEFAKRLNKPSRPRPEGAPVGETRHKIYVSNLAWKVRSSHLREFFSA  206

Query  444  NFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEKN  274
             F P+SARVVF++ SG+SAGYGFV+F T+EEAE+AISS+DG ELLGRP+RLK S+KN
Sbjct  207  GFTPVSARVVFDSPSGRSAGYGFVSFATREEAESAISSLDGKELLGRPLRLKFSQKN  263



>ref|XP_006428430.1| hypothetical protein CICLE_v10012439mg [Citrus clementina]
 ref|XP_006428431.1| hypothetical protein CICLE_v10012439mg [Citrus clementina]
 ref|XP_006428432.1| hypothetical protein CICLE_v10012439mg [Citrus clementina]
 ref|XP_006491727.1| PREDICTED: ribonucleoprotein At2g37220, chloroplastic-like isoform 
X1 [Citrus sinensis]
 ref|XP_006491728.1| PREDICTED: ribonucleoprotein At2g37220, chloroplastic-like isoform 
X2 [Citrus sinensis]
 ref|XP_006491729.1| PREDICTED: ribonucleoprotein At2g37220, chloroplastic-like isoform 
X3 [Citrus sinensis]
 gb|ESR41670.1| hypothetical protein CICLE_v10012439mg [Citrus clementina]
 gb|ESR41671.1| hypothetical protein CICLE_v10012439mg [Citrus clementina]
 gb|ESR41672.1| hypothetical protein CICLE_v10012439mg [Citrus clementina]
Length=275

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 151/184 (82%), Gaps = 1/184 (1%)
 Frame = -3

Query  822  KTPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGE  643
            +T K N+RRK++V NLPWS +V+++K LF  CGTV DVE IK K G+NR FAFVTMAS E
Sbjct  71   QTQKQNIRRKIYVFNLPWSFSVAEIKNLFAPCGTVVDVEIIKHKGGKNRNFAFVTMASPE  130

Query  642  EAEAAIQKFNSYELSGRTIRVEYSKKFKKP-IRSpppppPRDGRYKLYVSNLAWKARSTH  466
            EA+AA+ +F++ E+SGR IRVE++KKFKKP  +     P R+ ++KLYVSNL+WK RSTH
Sbjct  131  EAQAAVNQFDTQEVSGRIIRVEFAKKFKKPRPQRSASAPARETQHKLYVSNLSWKVRSTH  190

Query  465  LRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKM  286
            LRE FSANFNP+S++VVFE+  G+SAGYGFV+F TKEEAEAAISS+DG EL+GRP+RLK 
Sbjct  191  LREFFSANFNPVSSKVVFESNEGRSAGYGFVSFATKEEAEAAISSLDGKELMGRPLRLKF  250

Query  285  SEKN  274
             +KN
Sbjct  251  GQKN  254



>ref|XP_007039474.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 gb|EOY23975.1| RNA-binding family protein isoform 1 [Theobroma cacao]
Length=281

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 153/184 (83%), Gaps = 2/184 (1%)
 Frame = -3

Query  822  KTPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGE  643
            KT K N++RKLFVLNLPWS  V+D+K+LFGQCG V DVE IK K+G++R FAFVTMASGE
Sbjct  80   KTQKSNVKRKLFVLNLPWSYTVADIKDLFGQCGNVTDVEIIKQKDGRSRNFAFVTMASGE  139

Query  642  EAEAAIQKFNSYELSGRTIRVEYSKKFKKPIRS-pppppPRDGRYKLYVSNLAWKARSTH  466
            EA+AA+ K +S+E+S R IRVE++++FKKP  S  P  PPR+  +KLYVSNLAWK RS+H
Sbjct  140  EAQAAVDKLDSHEVSARIIRVEFARRFKKPSPSPQPIVPPRETHHKLYVSNLAWKVRSSH  199

Query  465  LRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKM  286
            LRE FSA FNP++ARV+F   SG+SAGYGFV+F TKEEA+AAIS+++G EL+ RP+RLK 
Sbjct  200  LREFFSA-FNPVAARVIFGTPSGQSAGYGFVSFATKEEADAAISTLNGKELMDRPLRLKF  258

Query  285  SEKN  274
            SE+N
Sbjct  259  SERN  262



>ref|XP_002527668.1| ribonucleoprotein, chloroplast, putative [Ricinus communis]
 gb|EEF34739.1| ribonucleoprotein, chloroplast, putative [Ricinus communis]
Length=278

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 150/183 (82%), Gaps = 1/183 (1%)
 Frame = -3

Query  822  KTPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGE  643
            +T +   +RKL+V NLPWSL+V D+K LFGQCGTV DVE IK K G++RGFAFVT+ASGE
Sbjct  75   ETQETTQKRKLYVFNLPWSLSVVDIKNLFGQCGTVTDVEIIKQKNGRSRGFAFVTLASGE  134

Query  642  EAEAAIQKFNSYELSGRTIRVEYSKKFKKPIRSppp-ppPRDGRYKLYVSNLAWKARSTH  466
            EA+AAI K +S+E+SGR IRVE++K+ K P    P     R+ R+K+YVSNLAWK RSTH
Sbjct  135  EAQAAIDKLDSHEVSGRIIRVEFAKRLKPPSPPSPTGTSARETRHKIYVSNLAWKVRSTH  194

Query  465  LRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKM  286
            LRE FS NF+P+S+RVVF++ +G+S+GYGFV+F T+EEAEAAIS++DG EL+GRP+RLK 
Sbjct  195  LREFFSTNFSPVSSRVVFDSPTGRSSGYGFVSFATREEAEAAISALDGKELMGRPLRLKF  254

Query  285  SEK  277
            S++
Sbjct  255  SDR  257



>ref|XP_006294626.1| hypothetical protein CARUB_v10023663mg [Capsella rubella]
 gb|EOA27524.1| hypothetical protein CARUB_v10023663mg [Capsella rubella]
Length=318

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 153/185 (83%), Gaps = 5/185 (3%)
 Frame = -3

Query  822  KTPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGE  643
            +T K NL+RKLFV NLPWS++V D+ +LF QCGTV +VE I+ K+G+NRGFAFVTMASGE
Sbjct  86   ETQKSNLKRKLFVFNLPWSMSVHDISDLFRQCGTVNNVEIIRQKDGKNRGFAFVTMASGE  145

Query  642  EAEAAIQKFNSYELSGRTIRVEYSKKFKKPI----RSpppppPRDGRYKLYVSNLAWKAR  475
            EA+AA+ KF+++E+SGR IRV ++++FKKP      + P PPP D R+KLYVSNLAWKAR
Sbjct  146  EAQAAVDKFDAFEVSGRIIRVNFARRFKKPTPKPPNALPSPPPGDTRHKLYVSNLAWKAR  205

Query  474  STHLRELFS-ANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPI  298
            STHLRELF+ A+FNP+SARVVF +  G+S+GYGFV+F T+EEAE AI+ +DG E++GRPI
Sbjct  206  STHLRELFTAADFNPVSARVVFADPEGRSSGYGFVSFATREEAENAITKLDGKEIMGRPI  265

Query  297  RLKMS  283
             LK S
Sbjct  266  ILKFS  270



>ref|XP_002879549.1| hypothetical protein ARALYDRAFT_482506 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55808.1| hypothetical protein ARALYDRAFT_482506 [Arabidopsis lyrata subsp. 
lyrata]
Length=308

 Score =   246 bits (627),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 152/185 (82%), Gaps = 5/185 (3%)
 Frame = -3

Query  822  KTPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGE  643
            +T K NL+RKLFV NLPWS++V+D+ ELFGQCGTV +VE I+ K+G+NRGFAFVTMASGE
Sbjct  87   ETQKSNLKRKLFVFNLPWSMSVNDISELFGQCGTVNNVEIIRQKDGKNRGFAFVTMASGE  146

Query  642  EAEAAIQKFNSYELSGRTIRVEYSKKFKKPI----RSpppppPRDGRYKLYVSNLAWKAR  475
            EA+AAI KF++ ++SGR I V ++++FKKP        P PPP D R+KLYVSNLAWKAR
Sbjct  147  EAQAAIDKFDTSQVSGRIISVNFARRFKKPTPKPPNDLPSPPPGDTRHKLYVSNLAWKAR  206

Query  474  STHLRELFSA-NFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPI  298
            STHLRELF+A +FNP+SARVVF +  G+S+GYGFV+F T+EEAE AI+ +DG E++GRPI
Sbjct  207  STHLRELFTASDFNPVSARVVFADPEGRSSGYGFVSFATREEAEDAIAKLDGKEIMGRPI  266

Query  297  RLKMS  283
             LK S
Sbjct  267  ILKFS  271



>gb|EYU34147.1| hypothetical protein MIMGU_mgv1a010436mg [Erythranthe guttata]
Length=312

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 149/183 (81%), Gaps = 7/183 (4%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            RRKLFVLNLPW+ +V D+K+LFG+CG V+DVE IK K+G++RGFAFVTMA+GEEA+AAI 
Sbjct  85   RRKLFVLNLPWAFSVVDIKKLFGECGVVDDVEIIKQKDGKSRGFAFVTMATGEEAQAAIL  144

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPR------DGRYKLYVSNLAWKARSTHLR  460
            K++S+ELS R IRVE++K+FK+PIR+             + R+KLYVSNL WK RST LR
Sbjct  145  KYDSHELSDRIIRVEFAKQFKRPIRTTDSVVSSSSIPAGETRHKLYVSNLGWKVRSTDLR  204

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLK-MS  283
            E FS+ F P+S +VVF++ SGKSAGYGFV+F TKEEA++AIS ++GTELLGRP+RLK  S
Sbjct  205  EFFSSKFKPLSVKVVFDSPSGKSAGYGFVSFATKEEADSAISQLNGTELLGRPVRLKAAS  264

Query  282  EKN  274
            EKN
Sbjct  265  EKN  267


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 47/81 (58%), Gaps = 1/81 (1%)
 Frame = -3

Query  816  PKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFI-KTKEGQNRGFAFVTMASGEE  640
            P    R KL+V NL W +  +D++E F        V+ +  +  G++ G+ FV+ A+ EE
Sbjct  181  PAGETRHKLYVSNLGWKVRSTDLREFFSSKFKPLSVKVVFDSPSGKSAGYGFVSFATKEE  240

Query  639  AEAAIQKFNSYELSGRTIRVE  577
            A++AI + N  EL GR +R++
Sbjct  241  ADSAISQLNGTELLGRPVRLK  261


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 43/82 (52%), Gaps = 1/82 (1%)
 Frame = -3

Query  522  DGRYKLYVSNLAWKARSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEA  343
            D R KL+V NL W      +++LF      +    + +   GKS G+ FV   T EEA+A
Sbjct  83   DNRRKLFVLNLPWAFSVVDIKKLF-GECGVVDDVEIIKQKDGKSRGFAFVTMATGEEAQA  141

Query  342  AISSIDGTELLGRPIRLKMSEK  277
            AI   D  EL  R IR++ +++
Sbjct  142  AILKYDSHELSDRIIRVEFAKQ  163



>ref|NP_181084.1| RNA-binding (RRM/RBD/RNP motifs) family protein [Arabidopsis 
thaliana]
 gb|AAC36180.1| putative chloroplast RNA binding protein precursor [Arabidopsis 
thaliana]
 gb|AAK68739.1| putative chloroplast RNA binding protein precursor [Arabidopsis 
thaliana]
 gb|AAN15684.1| putative chloroplast RNA binding protein precursor [Arabidopsis 
thaliana]
 gb|AEC09106.1| RNA-binding (RRM/RBD/RNP motifs) family protein [Arabidopsis 
thaliana]
Length=308

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 151/185 (82%), Gaps = 5/185 (3%)
 Frame = -3

Query  822  KTPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGE  643
            +T   NL+RKLFV NLPWS++V+D+ ELFGQCGTV +VE I+ K+G+NRGFAFVTMASGE
Sbjct  87   ETQNSNLKRKLFVFNLPWSMSVNDISELFGQCGTVNNVEIIRQKDGKNRGFAFVTMASGE  146

Query  642  EAEAAIQKFNSYELSGRTIRVEYSKKFKKPI----RSpppppPRDGRYKLYVSNLAWKAR  475
            EA+AAI KF+++++SGR I V ++++FKKP        P P P D R+KLYVSNLAWKAR
Sbjct  147  EAQAAIDKFDTFQVSGRIISVSFARRFKKPTPKSPNDLPSPAPGDTRHKLYVSNLAWKAR  206

Query  474  STHLRELFS-ANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPI  298
            STHLRELF+ A+FNP+SARVVF +  G+S+GYGFV+F T+EEAE AI+ ++G E++GRPI
Sbjct  207  STHLRELFTAADFNPVSARVVFADPEGRSSGYGFVSFATREEAENAITKLNGKEIMGRPI  266

Query  297  RLKMS  283
             LK S
Sbjct  267  TLKFS  271



>ref|XP_009371216.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic [Pyrus x 
bretschneideri]
Length=298

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 170/238 (71%), Gaps = 3/238 (1%)
 Frame = -3

Query  984  PLRLQISPNYPTLSLKSLMRSLPSLASTKLKTSHILRCStveeqavvaveteqEKTPKPN  805
            PL+L I  + P  SL  L+     + + KL+    L CS VEE      +   E++ + N
Sbjct  34   PLKLHIPNSTPPNSLDFLLSGPRRIPTRKLRFE--LLCSAVEEITAEEEKAAVEESQQQN  91

Query  804  LRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAI  625
             +RKL+V+NLPWSL V D+K LFG+CGTV+DVE IK + G++RGFAFVTM SGEEA A I
Sbjct  92   QKRKLYVVNLPWSLTVVDIKNLFGECGTVKDVEIIKQQNGKSRGFAFVTMDSGEEALAVI  151

Query  624  QKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSA  445
             KF+S+E+SGRTIR+E++K+FKKP   P  P   + RYKLYVSNL WK RS+HLR+  S 
Sbjct  152  DKFHSHEVSGRTIRIEFAKQFKKPSPPPSNPQIGETRYKLYVSNLGWKVRSSHLRDFVSQ  211

Query  444  NFN-PISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEKN  274
            NF  P+SARVVF   SGKS GYGF++F TKEEAEAAISS+ G EL+GRPI LK SEKN
Sbjct  212  NFKVPVSARVVFSGPSGKSGGYGFLSFTTKEEAEAAISSLQGKELMGRPINLKFSEKN  269



>ref|XP_009141485.1| PREDICTED: 28 kDa ribonucleoprotein, chloroplastic [Brassica 
rapa]
Length=304

 Score =   243 bits (621),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 152/184 (83%), Gaps = 4/184 (2%)
 Frame = -3

Query  822  KTPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGE  643
            +T K NL+RKLFV NLPWS++V+D+ +LFGQCGTV  VE IK K+G+NRGFAFVTM+SGE
Sbjct  82   ETQKENLKRKLFVFNLPWSMSVNDISQLFGQCGTVSSVEIIKQKDGKNRGFAFVTMSSGE  141

Query  642  EAEAAIQKFNSYELSGRTIRVEYSKKFKKPI---RSpppppPRDGRYKLYVSNLAWKARS  472
            EA++A+ KF+S+++SGR IRV ++K+FKKP     +  PP  ++ R+KLYVSNLAWKARS
Sbjct  142  EAQSAVDKFDSFQVSGRIIRVSFAKRFKKPTVKPPNALPPSTQETRHKLYVSNLAWKARS  201

Query  471  THLRELFS-ANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIR  295
            THLRE F+ A+FN +SARVVF +  G+++GYGFV+F T+EEAEAAIS +DG EL+GRPI 
Sbjct  202  THLREFFTAADFNLVSARVVFADPGGRASGYGFVSFPTREEAEAAISKMDGKELMGRPIS  261

Query  294  LKMS  283
            LK S
Sbjct  262  LKFS  265



>ref|XP_010509618.1| PREDICTED: 31 kDa ribonucleoprotein, chloroplastic-like [Camelina 
sativa]
Length=321

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 152/185 (82%), Gaps = 5/185 (3%)
 Frame = -3

Query  822  KTPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGE  643
            +T K NL+RKLFV NLPWS++V D+ +LF QCGTV +VE I+ K+G+NRGFAFVTMASGE
Sbjct  91   ETQKSNLKRKLFVFNLPWSMSVHDISDLFRQCGTVNNVEIIRQKDGKNRGFAFVTMASGE  150

Query  642  EAEAAIQKFNSYELSGRTIRVEYSKKFKKPI----RSpppppPRDGRYKLYVSNLAWKAR  475
            EA+AA+ KF+++E+SGR IRV ++++FKKP      + P PP  + R+KLY+SNLAWKAR
Sbjct  151  EAQAAVDKFDAFEVSGRIIRVNFARRFKKPTPKQPNALPSPPAGETRHKLYISNLAWKAR  210

Query  474  STHLRELFS-ANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPI  298
            STHLRELF+ A+FNP+SARVVF +  G+S+GYGFV+F T+EEAE AI+ +DG E++GRPI
Sbjct  211  STHLRELFTAADFNPVSARVVFADPEGRSSGYGFVSFATREEAEDAITKLDGKEIMGRPI  270

Query  297  RLKMS  283
             LK S
Sbjct  271  ILKFS  275



>gb|ABK96729.1| unknown [Populus trichocarpa x Populus deltoides]
Length=294

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 143/181 (79%), Gaps = 5/181 (3%)
 Frame = -3

Query  807  NLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAA  628
            NL+RKLFV+NLPWS +V D+K+LFGQCGTV DVE IK K G++RGFAFVTM +GEEA+AA
Sbjct  91   NLKRKLFVVNLPWSFSVVDIKDLFGQCGTVSDVEIIKQKNGRSRGFAFVTMTTGEEAQAA  150

Query  627  IQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRD-----GRYKLYVSNLAWKARSTHL  463
            I KFNS E+SGR IRVE++K+ ++P     P  P D      R+KLY+SNLAWK R +HL
Sbjct  151  IDKFNSLEVSGRIIRVEFAKRLRRPPSPRLPGTPADIPAGETRHKLYISNLAWKVRGSHL  210

Query  462  RELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
            RE FS N NP+S+RVVF+  +G+S+GYGFV+F T+EEA AAIS+  G EL+GRPIRLK S
Sbjct  211  REFFSTNCNPVSSRVVFDGPAGRSSGYGFVSFATREEAVAAISAFSGKELMGRPIRLKFS  270

Query  282  E  280
            E
Sbjct  271  E  271


 Score = 57.4 bits (137),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 46/84 (55%), Gaps = 1/84 (1%)
 Frame = -3

Query  816  PKPNLRRKLFVLNLPWSLAVSDVKELFG-QCGTVEDVEFIKTKEGQNRGFAFVTMASGEE  640
            P    R KL++ NL W +  S ++E F   C  V          G++ G+ FV+ A+ EE
Sbjct  188  PAGETRHKLYISNLAWKVRGSHLREFFSTNCNPVSSRVVFDGPAGRSSGYGFVSFATREE  247

Query  639  AEAAIQKFNSYELSGRTIRVEYSK  568
            A AAI  F+  EL GR IR+++S+
Sbjct  248  AVAAISAFSGKELMGRPIRLKFSE  271


 Score = 50.8 bits (120),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/80 (33%), Positives = 45/80 (56%), Gaps = 1/80 (1%)
 Frame = -3

Query  516  RYKLYVSNLAWKARSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAI  337
            + KL+V NL W      +++LF      +S   + +  +G+S G+ FV   T EEA+AAI
Sbjct  93   KRKLFVVNLPWSFSVVDIKDLF-GQCGTVSDVEIIKQKNGRSRGFAFVTMTTGEEAQAAI  151

Query  336  SSIDGTELLGRPIRLKMSEK  277
               +  E+ GR IR++ +++
Sbjct  152  DKFNSLEVSGRIIRVEFAKR  171



>ref|XP_006368391.1| 33 kDa ribonucleoprotein [Populus trichocarpa]
 gb|ERP64960.1| 33 kDa ribonucleoprotein [Populus trichocarpa]
Length=294

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 143/181 (79%), Gaps = 5/181 (3%)
 Frame = -3

Query  807  NLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAA  628
            NL+RKLFV+NLPWS +V D+K+LFGQCGTV DVE IK K G++RGFAFVTM +GEEA+AA
Sbjct  91   NLKRKLFVVNLPWSFSVVDIKDLFGQCGTVSDVEIIKQKNGRSRGFAFVTMTTGEEAQAA  150

Query  627  IQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRD-----GRYKLYVSNLAWKARSTHL  463
            I KFNS E+SGR IRVE++K+ ++P     P  P D      R+KLY+SNLAWK R +HL
Sbjct  151  IDKFNSLEVSGRIIRVEFAKRLRRPPSPRLPGTPADIPAGETRHKLYISNLAWKVRGSHL  210

Query  462  RELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
            RE FS N NP+S+RVVF+  +G+S+GYGFV+F T+EEA AAIS+  G EL+GRPIRLK S
Sbjct  211  REFFSTNCNPVSSRVVFDGPAGRSSGYGFVSFATREEAVAAISAFSGKELMGRPIRLKFS  270

Query  282  E  280
            E
Sbjct  271  E  271


 Score = 57.4 bits (137),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 46/84 (55%), Gaps = 1/84 (1%)
 Frame = -3

Query  816  PKPNLRRKLFVLNLPWSLAVSDVKELFG-QCGTVEDVEFIKTKEGQNRGFAFVTMASGEE  640
            P    R KL++ NL W +  S ++E F   C  V          G++ G+ FV+ A+ EE
Sbjct  188  PAGETRHKLYISNLAWKVRGSHLREFFSTNCNPVSSRVVFDGPAGRSSGYGFVSFATREE  247

Query  639  AEAAIQKFNSYELSGRTIRVEYSK  568
            A AAI  F+  EL GR IR+++S+
Sbjct  248  AVAAISAFSGKELMGRPIRLKFSE  271


 Score = 50.8 bits (120),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/80 (33%), Positives = 45/80 (56%), Gaps = 1/80 (1%)
 Frame = -3

Query  516  RYKLYVSNLAWKARSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAI  337
            + KL+V NL W      +++LF      +S   + +  +G+S G+ FV   T EEA+AAI
Sbjct  93   KRKLFVVNLPWSFSVVDIKDLF-GQCGTVSDVEIIKQKNGRSRGFAFVTMTTGEEAQAAI  151

Query  336  SSIDGTELLGRPIRLKMSEK  277
               +  E+ GR IR++ +++
Sbjct  152  DKFNSLEVSGRIIRVEFAKR  171



>gb|KFK36447.1| hypothetical protein AALP_AA4G125700 [Arabis alpina]
Length=317

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 152/185 (82%), Gaps = 5/185 (3%)
 Frame = -3

Query  822  KTPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGE  643
            +T K NLRRKLFV NLPWSL+++D+ +LFGQCGTV +VE IK K+G+NRGFAFVTMASGE
Sbjct  80   ETHKSNLRRKLFVYNLPWSLSINDISKLFGQCGTVSNVEIIKQKDGKNRGFAFVTMASGE  139

Query  642  EAEAAIQKFNSYELSGRTIRVEYSKKFKKPI----RSpppppPRDGRYKLYVSNLAWKAR  475
            EA+AA+ KF+S+++SGR IRV ++K+FKKP      + P   P + R+KLYVSNLAWKAR
Sbjct  140  EAQAAVDKFDSFQVSGRIIRVNFAKRFKKPTPKLPNALPFISPGETRHKLYVSNLAWKAR  199

Query  474  STHLRELFS-ANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPI  298
            STHLRE F+ A+FN +SARVVF +  G+++GYGFV+F T+EEAEAAIS ++G EL+GRP+
Sbjct  200  STHLREFFTAADFNLVSARVVFADPEGRASGYGFVSFPTREEAEAAISKLNGKELMGRPV  259

Query  297  RLKMS  283
             LK S
Sbjct  260  SLKFS  264



>ref|XP_010505047.1| PREDICTED: 28 kDa ribonucleoprotein, chloroplastic-like [Camelina 
sativa]
Length=323

 Score =   241 bits (616),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 152/185 (82%), Gaps = 5/185 (3%)
 Frame = -3

Query  822  KTPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGE  643
            +T K NL+RKLFV NLPWS++V D+ +LF QCGTV +VE I+ K+G+NRGFAFVTMASGE
Sbjct  90   ETQKSNLKRKLFVFNLPWSMSVHDISDLFRQCGTVNNVEIIRQKDGKNRGFAFVTMASGE  149

Query  642  EAEAAIQKFNSYELSGRTIRVEYSKKFKKPI----RSpppppPRDGRYKLYVSNLAWKAR  475
            EA+AA+ KF+++E+SGR IRV ++++FKKP      + P PP  + R+KLY+SNLAWKAR
Sbjct  150  EAQAAVDKFDAFEVSGRIIRVNFARRFKKPTPKPPNALPSPPAGETRHKLYISNLAWKAR  209

Query  474  STHLRELFS-ANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPI  298
            STHLRELF+ A+FNP+SARVVF +  G+S+GYGFV+F T+EEAE AI+ +DG E++GRPI
Sbjct  210  STHLRELFTAADFNPVSARVVFADPEGRSSGYGFVSFVTREEAEDAITKLDGKEIMGRPI  269

Query  297  RLKMS  283
             LK S
Sbjct  270  ILKFS  274



>ref|XP_007209418.1| hypothetical protein PRUPE_ppa009362mg [Prunus persica]
 gb|EMJ10617.1| hypothetical protein PRUPE_ppa009362mg [Prunus persica]
Length=295

 Score =   241 bits (614),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 135/243 (56%), Positives = 170/243 (70%), Gaps = 4/243 (2%)
 Frame = -3

Query  990  SKPLRLQISPNYPTLSLKSLMRSLPSLASTKLKTSHI-LRCStveeqavvaveteqEKT-  817
            S  L+L IS + P +S   L  S P + +   +     L CS V+E        E++   
Sbjct  32   STSLKLHISNSIPPISRNFLYSSPPCILNNPTRKPFFELMCSAVQEVTAEEEAVEEKAEE  91

Query  816  -PKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEE  640
                NL+RKL+V+NLPWSL V D+K LFG+CGTV DVE IK   G++RGFAFVTMASGEE
Sbjct  92   TQTQNLKRKLYVVNLPWSLTVVDIKNLFGECGTVTDVEIIKQPNGKSRGFAFVTMASGEE  151

Query  639  AEAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLR  460
            A+A I+KF+S+E+  RTIRVE++K+FKKP   PP P   + RYKLYVSNL WK RS+HLR
Sbjct  152  AQAVIEKFHSHEVLDRTIRVEFAKQFKKPSPPPPNPQIVETRYKLYVSNLGWKVRSSHLR  211

Query  459  ELFSANFN-PISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
            +  S NF  P+SARVVF   SGKS GYGF++F TKEEAE+AISS++G EL+GRP+ LK S
Sbjct  212  DFVSENFKVPVSARVVFSGPSGKSGGYGFLSFATKEEAESAISSLNGKELMGRPLNLKFS  271

Query  282  EKN  274
            EKN
Sbjct  272  EKN  274



>ref|XP_010088249.1| 31 kDa ribonucleoprotein [Morus notabilis]
 gb|EXB32996.1| 31 kDa ribonucleoprotein [Morus notabilis]
Length=295

 Score =   240 bits (613),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 143/179 (80%), Gaps = 1/179 (1%)
 Frame = -3

Query  807  NLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAA  628
            N +RKL+V+NLPWSL V D+K LFGQCGTV DVE IK K+G+NRGFAFVTMA GEEA+A 
Sbjct  91   NQKRKLYVVNLPWSLTVVDIKSLFGQCGTVTDVEIIKQKDGRNRGFAFVTMACGEEAQAV  150

Query  627  IQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPR-DGRYKLYVSNLAWKARSTHLRELF  451
            I +FN  ++SGR I++E +K+FKKP    PP P   +  +KLYVSN+ WK RSTHLR+  
Sbjct  151  IDRFNLQDVSGRIIKIELAKQFKKPSPPRPPGPQPGETTHKLYVSNIEWKVRSTHLRDFV  210

Query  450  SANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEKN  274
            S NF P+SARVVF+   G+SAGYGFV+F T+EEAEAAISS+DG EL+GRP+RLK SEKN
Sbjct  211  SENFKPVSARVVFDGPKGRSAGYGFVSFATREEAEAAISSLDGKELMGRPLRLKFSEKN  269



>ref|XP_010538381.1| PREDICTED: 33 kDa ribonucleoprotein, chloroplastic [Tarenaya 
hassleriana]
Length=285

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/240 (53%), Positives = 175/240 (73%), Gaps = 10/240 (4%)
 Frame = -3

Query  990  SKPLRLQISPNYPTLSLKSLMRSLPSLASTKLKTSHILRCStveeqavvaveteqEKTPK  811
            S  L L+I   YP+LS     R+LP L      +  ++       +   ++E + + T  
Sbjct  28   STVLNLRIRSFYPSLS-----RNLP-LCPGGGHSRRLVSALCSVAEEETSLEEKTDGTQN  81

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEA  631
             N+++KLFV NLPWS++V+D+ ELFGQCGTV DVE IK K+G+NRGFAF+TM+SGEEA+A
Sbjct  82   TNVKKKLFVFNLPWSMSVNDISELFGQCGTVSDVEIIKQKDGKNRGFAFITMSSGEEAQA  141

Query  630  AIQKFNSYELSGRTIRVEYSKKFKKPIRSppppp---PRDGRYKLYVSNLAWKARSTHLR  460
            A+ KF++Y++SGR IRV +S++FKKP  +P PPP    R+ R+KLY+SNLAWKARSTHLR
Sbjct  142  AVDKFDAYQVSGRIIRVSFSRRFKKPRPAPTPPPPPGSRETRHKLYISNLAWKARSTHLR  201

Query  459  ELF-SANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
            + F +A+ NP+S +VVF+   G++AGYGFV+F T+EEAE AIS ++G EL+GRPI LK S
Sbjct  202  DFFAAADLNPVSVKVVFDTPEGRAAGYGFVSFATREEAETAISKLNGKELMGRPISLKFS  261



>emb|CDY62421.1| BnaA06g39370D [Brassica napus]
Length=304

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 151/184 (82%), Gaps = 4/184 (2%)
 Frame = -3

Query  822  KTPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGE  643
            +T K NL+RKLFV NLPWS++V+D+ +LFGQCGTV  VE IK K+G+NRGFAFVTM+SGE
Sbjct  82   ETQKENLKRKLFVFNLPWSMSVNDISQLFGQCGTVSSVEIIKQKDGKNRGFAFVTMSSGE  141

Query  642  EAEAAIQKFNSYELSGRTIRVEYSKKFKKPI---RSpppppPRDGRYKLYVSNLAWKARS  472
            EA++A+ KF+S+++SGR IRV ++K+FKKP     +  PP  ++ R+KLYVSNLAWKARS
Sbjct  142  EAQSAVDKFDSFQVSGRIIRVSFAKRFKKPTVKPPNALPPSTQETRHKLYVSNLAWKARS  201

Query  471  THLRELFS-ANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIR  295
            THLRE F+ A+FN +SARVVF +  G+++GYGFV+F ++EEAE AIS +DG EL+GRPI 
Sbjct  202  THLREFFTAADFNLVSARVVFADPGGRASGYGFVSFPSREEAEDAISKLDGKELMGRPIS  261

Query  294  LKMS  283
            LK S
Sbjct  262  LKFS  265



>ref|XP_010516718.1| PREDICTED: 28 kDa ribonucleoprotein, chloroplastic-like [Camelina 
sativa]
Length=324

 Score =   239 bits (611),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 152/185 (82%), Gaps = 5/185 (3%)
 Frame = -3

Query  822  KTPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGE  643
            +T K NL+RKLFV NLPWS++V D+ +LF QCGTV +VE I+ K+G+NRGFAFVTMASGE
Sbjct  91   ETKKSNLKRKLFVFNLPWSMSVHDISDLFRQCGTVNNVEIIRQKDGKNRGFAFVTMASGE  150

Query  642  EAEAAIQKFNSYELSGRTIRVEYSKKFKKPI----RSpppppPRDGRYKLYVSNLAWKAR  475
            EA+AA+ KF+++E+SGR IRV ++++FKKP      + P PP  + R+KLY+SNLAWKAR
Sbjct  151  EAQAAVDKFDAFEVSGRIIRVNFARRFKKPTPKPPNNLPTPPAGETRHKLYISNLAWKAR  210

Query  474  STHLRELFS-ANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPI  298
            STHLRELF+ A+FNP+SARVVF +  G+S+GYGFV+F T+EEAE AI+ ++G E++GRPI
Sbjct  211  STHLRELFTAADFNPVSARVVFADPEGRSSGYGFVSFVTREEAEDAITKLNGKEIMGRPI  270

Query  297  RLKMS  283
             LK S
Sbjct  271  ILKFS  275



>ref|XP_008238232.1| PREDICTED: 28 kDa ribonucleoprotein, chloroplastic isoform X1 
[Prunus mume]
Length=319

 Score =   239 bits (610),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 144/179 (80%), Gaps = 2/179 (1%)
 Frame = -3

Query  807  NLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAA  628
            NL+RKL+ +NLPWSL V D+K LFG+CGTV DVE IK   G++RGFAFVTMASGEEA+A 
Sbjct  121  NLKRKLYAVNLPWSLTVVDIKNLFGECGTVTDVEIIKQPNGKSRGFAFVTMASGEEAQAV  180

Query  627  IQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFS  448
            I+KF+S+E+  RTIRVE++K+FKKP   PPP    + RYKLYVSNL WK RS+HLR+  S
Sbjct  181  IEKFHSHEVLDRTIRVEFAKQFKKP-SPPPPTQIVETRYKLYVSNLGWKVRSSHLRDFVS  239

Query  447  ANFN-PISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEKN  274
             NF  P+SARVVF   SGKS GYGF++F TKEEAE+AISS++G EL+GRP+ LK SEKN
Sbjct  240  ENFKVPVSARVVFSGPSGKSGGYGFLSFATKEEAESAISSLNGKELMGRPLNLKFSEKN  298



>ref|XP_008238233.1| PREDICTED: 33 kDa ribonucleoprotein, chloroplastic isoform X2 
[Prunus mume]
Length=294

 Score =   238 bits (607),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 144/179 (80%), Gaps = 2/179 (1%)
 Frame = -3

Query  807  NLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAA  628
            NL+RKL+ +NLPWSL V D+K LFG+CGTV DVE IK   G++RGFAFVTMASGEEA+A 
Sbjct  96   NLKRKLYAVNLPWSLTVVDIKNLFGECGTVTDVEIIKQPNGKSRGFAFVTMASGEEAQAV  155

Query  627  IQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFS  448
            I+KF+S+E+  RTIRVE++K+FKKP   PPP    + RYKLYVSNL WK RS+HLR+  S
Sbjct  156  IEKFHSHEVLDRTIRVEFAKQFKKP-SPPPPTQIVETRYKLYVSNLGWKVRSSHLRDFVS  214

Query  447  ANFN-PISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEKN  274
             NF  P+SARVVF   SGKS GYGF++F TKEEAE+AISS++G EL+GRP+ LK SEKN
Sbjct  215  ENFKVPVSARVVFSGPSGKSGGYGFLSFATKEEAESAISSLNGKELMGRPLNLKFSEKN  273



>ref|XP_010695564.1| PREDICTED: 31 kDa ribonucleoprotein, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=318

 Score =   239 bits (609),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 149/178 (84%), Gaps = 2/178 (1%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            +RKL+V+NLP+SL+  D+K++F +CG V+DVE I+ K+G+NRGF FVTMASG++A+A I 
Sbjct  93   KRKLYVVNLPFSLSPDDLKKIFSECGIVKDVELIRDKDGKNRGFGFVTMASGDDAQAVID  152

Query  621  KFNSYELSGRTIRVEYSKKFKKP-IRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSA  445
            KF+S ELSGR IRVE++++ KKP  + P  P  ++ R+KLYVSNL WKARSTHLRE FS+
Sbjct  153  KFHSKELSGRAIRVEFARRLKKPRPQPPSVPAVKETRHKLYVSNLQWKARSTHLREFFSS  212

Query  444  NFNPISARVVFE-NASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEKN  274
            +F P+SARV+FE N SG+SAGYGFV+F T+EEAEAAIS+ DG ELLGRP+RLK SE+N
Sbjct  213  SFTPVSARVIFESNPSGRSAGYGFVSFSTREEAEAAISNFDGKELLGRPVRLKFSEQN  270



>ref|XP_008373580.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic [Malus domestica]
Length=298

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 169/240 (70%), Gaps = 3/240 (1%)
 Frame = -3

Query  990  SKPLRLQISPNYPTLSLKSLMRSLPSLASTKLKTSHILRCStveeqavvaveteqEKTPK  811
            S PL+L +  + P  SL  L+     + + KL+    L CS VEE      +   E+  +
Sbjct  32   SAPLKLHMPNSTPPNSLNFLLSGPRRIPTRKLRFE--LLCSAVEEITAEEEKAAVEEGQQ  89

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEA  631
             N +RKL+V+NLPWSL V D+K LFG+CGTV+DVE IK + G++RGFAFVTM SGEEA+A
Sbjct  90   QNQKRKLYVVNLPWSLTVVDIKNLFGECGTVKDVEIIKQQNGKSRGFAFVTMDSGEEAQA  149

Query  630  AIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELF  451
             I KF+S+E+ GRTIR+E++K+FKKP   P  P   + RYKLYVSNL WK RS+HLR+  
Sbjct  150  VIDKFHSHEVLGRTIRIEFAKQFKKPSPPPSNPQIGETRYKLYVSNLGWKVRSSHLRDFV  209

Query  450  SANFN-PISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEKN  274
            S NF  P+SARVVF   SGKS GYGF++F TKEEAEAAISS+ G EL+GR I LK SEKN
Sbjct  210  SENFKVPVSARVVFSGPSGKSGGYGFLSFTTKEEAEAAISSLQGKELMGRLINLKFSEKN  269



>ref|XP_004148763.1| PREDICTED: 29 kDa ribonucleoprotein B, chloroplastic-like [Cucumis 
sativus]
Length=282

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 132/239 (55%), Positives = 175/239 (73%), Gaps = 5/239 (2%)
 Frame = -3

Query  984  PLRLQISPNYPTLSLKSLMRSLP-SLASTKLKTSHILRCStveeqavvaveteqEKTPKP  808
            P++L+IS + P LSL       P S  S++ +      CS ++E  +     E +     
Sbjct  28   PIKLRISFSSPLLSLNPTTPISPTSFNSSRNRGGGARLCSALQEVTLEEASEENQDV---  84

Query  807  NLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAA  628
            N +RKL++ NLPWSL+V D+KELFGQCGTV DVE IK K G++RGFAFVTMAS +EA+AA
Sbjct  85   NQKRKLYIFNLPWSLSVVDIKELFGQCGTVSDVEIIKQKNGRSRGFAFVTMASPDEAQAA  144

Query  627  IQKFNSYELSGRTIRVEYSKKF-KKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELF  451
            IQKF+S E+SGR I+VE++K+  K P   PP PPP +   KLYVSNLAWK RS +LR+ F
Sbjct  145  IQKFDSQEISGRVIKVEFAKRLKKPPPPKPPGPPPGETVNKLYVSNLAWKVRSNNLRDFF  204

Query  450  SANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEKN  274
            S NFNPI+ARVVF++ +G+SAGYGFV+F T+EEA+ A+SS++G EL+GRP+RLK SE+N
Sbjct  205  SENFNPIAARVVFDSPAGRSAGYGFVSFATREEAQTALSSLEGKELMGRPLRLKFSERN  263



>ref|XP_004164674.1| PREDICTED: 31 kDa ribonucleoprotein, chloroplastic-like [Cucumis 
sativus]
 gb|KGN55743.1| hypothetical protein Csa_3G009490 [Cucumis sativus]
Length=288

 Score =   236 bits (601),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 132/239 (55%), Positives = 175/239 (73%), Gaps = 5/239 (2%)
 Frame = -3

Query  984  PLRLQISPNYPTLSLKSLMRSLP-SLASTKLKTSHILRCStveeqavvaveteqEKTPKP  808
            P++L+IS + P LSL       P S  S++ +      CS ++E  +     E +     
Sbjct  34   PIKLRISFSSPLLSLNPTTPISPTSFNSSRNRGGGARLCSALQEVTLEEASEENQDV---  90

Query  807  NLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAA  628
            N +RKL++ NLPWSL+V D+KELFGQCGTV DVE IK K G++RGFAFVTMAS +EA+AA
Sbjct  91   NQKRKLYIFNLPWSLSVVDIKELFGQCGTVSDVEIIKQKNGRSRGFAFVTMASPDEAQAA  150

Query  627  IQKFNSYELSGRTIRVEYSKKF-KKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELF  451
            IQKF+S E+SGR I+VE++K+  K P   PP PPP +   KLYVSNLAWK RS +LR+ F
Sbjct  151  IQKFDSQEISGRVIKVEFAKRLKKPPPPKPPGPPPGETVNKLYVSNLAWKVRSNNLRDFF  210

Query  450  SANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEKN  274
            S NFNPI+ARVVF++ +G+SAGYGFV+F T+EEA+ A+SS++G EL+GRP+RLK SE+N
Sbjct  211  SENFNPIAARVVFDSPAGRSAGYGFVSFATREEAQTALSSLEGKELMGRPLRLKFSERN  269



>ref|XP_003534278.1| PREDICTED: 29 kDa ribonucleoprotein, chloroplastic-like [Glycine 
max]
Length=282

 Score =   235 bits (600),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 153/184 (83%), Gaps = 4/184 (2%)
 Frame = -3

Query  816  PKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEA  637
            P  N++ KL+V+NL WSL  +D+ +LF QCGTV DVE IK+K+G+++G+AFVTMASGEEA
Sbjct  68   PTDNVK-KLYVVNLSWSLTAADITDLFAQCGTVTDVEIIKSKDGRSKGYAFVTMASGEEA  126

Query  636  EAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDG--RYKLYVSNLAWKARSTHL  463
            +AA+ KF+SYELSGR IRVE +K+ KKP   PPPP PR G  R+ +Y SNLAWKARSTHL
Sbjct  127  QAAVDKFDSYELSGRIIRVELAKRLKKPPSLPPPPGPRPGETRHVIYASNLAWKARSTHL  186

Query  462  RELFSANF-NPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKM  286
            R++F+ NF  P SARVVF++ SG+SAGYGFV+F T+E+AEAAIS++DG EL+GRP+RLK 
Sbjct  187  RQVFTENFKTPSSARVVFDSPSGRSAGYGFVSFLTREDAEAAISTVDGKELMGRPLRLKF  246

Query  285  SEKN  274
            SEKN
Sbjct  247  SEKN  250



>gb|KHN38931.1| 31 kDa ribonucleoprotein, chloroplastic [Glycine soja]
Length=282

 Score =   235 bits (600),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 153/184 (83%), Gaps = 4/184 (2%)
 Frame = -3

Query  816  PKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEA  637
            P  N++ KL+V+NL WSL  +D+ +LF QCGTV DVE IK+K+G+++G+AFVTMASGEEA
Sbjct  68   PTDNVK-KLYVVNLSWSLTAADITDLFAQCGTVTDVEIIKSKDGRSKGYAFVTMASGEEA  126

Query  636  EAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDG--RYKLYVSNLAWKARSTHL  463
            +AA+ KF+SYELSGR IRVE +K+ KKP   PPPP PR G  R+ +Y SNLAWKARSTHL
Sbjct  127  QAAVDKFDSYELSGRIIRVELAKRLKKPPSLPPPPGPRPGETRHVIYASNLAWKARSTHL  186

Query  462  RELFSANF-NPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKM  286
            R++F+ NF  P SARVVF++ SG+SAGYGFV+F T+E+AEAAIS++DG EL+GRP+RLK 
Sbjct  187  RQVFAENFKTPSSARVVFDSPSGRSAGYGFVSFLTREDAEAAISTVDGKELMGRPLRLKF  246

Query  285  SEKN  274
            SEKN
Sbjct  247  SEKN  250



>gb|KHG07756.1| 33 kDa ribonucleoprotein, chloroplastic [Gossypium arboreum]
Length=276

 Score =   234 bits (598),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/185 (61%), Positives = 146/185 (79%), Gaps = 4/185 (2%)
 Frame = -3

Query  822  KTPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGE  643
            KT KPN++RKLFVLNLPW+  V D+K+LFGQ G V+DVE IK  +G++R FAFVTMASG+
Sbjct  71   KTQKPNVKRKLFVLNLPWAFTVDDIKDLFGQYGNVKDVEIIKQTDGKSRNFAFVTMASGD  130

Query  642  EAEAAIQKFNSYELSGRTIRVEYSKKFKKPIRSppppp---PRDGRYKLYVSNLAWKARS  472
            EA+AA+   +S+E+SGR I+VE++K+ K+P  +   P     R+ R+K+YVSNL WK RS
Sbjct  131  EAQAAVDNLDSHEVSGRIIKVEFAKRLKRPSPASSKPIVLPSRETRHKVYVSNLNWKVRS  190

Query  471  THLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRL  292
            +HLRE FS  FNP+SARV+F   SG+SAGYGFV+F TKEEAEAAIS+++G EL+ RP+RL
Sbjct  191  SHLREFFST-FNPVSARVIFGTPSGQSAGYGFVSFATKEEAEAAISTLNGKELMDRPLRL  249

Query  291  KMSEK  277
            K S K
Sbjct  250  KFSVK  254



>ref|XP_008448669.1| PREDICTED: 31 kDa ribonucleoprotein, chloroplastic [Cucumis melo]
Length=285

 Score =   234 bits (598),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 154/184 (84%), Gaps = 1/184 (1%)
 Frame = -3

Query  822  KTPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGE  643
            +T   N ++KL++ NLPWSL+V D+KELFGQCGTV DVE IK K G++RGFAFVTMAS +
Sbjct  83   ETQDVNQKKKLYIFNLPWSLSVVDIKELFGQCGTVSDVEIIKQKNGRSRGFAFVTMASPD  142

Query  642  EAEAAIQKFNSYELSGRTIRVEYSKKFKK-PIRSpppppPRDGRYKLYVSNLAWKARSTH  466
            EA+AAIQKF+S E+SGR I+VE++K+FK+ P   PP PPP +   KLYVSNLAWK RS++
Sbjct  143  EAQAAIQKFDSQEISGRVIKVEFAKRFKRPPPPKPPGPPPGETVNKLYVSNLAWKVRSSN  202

Query  465  LRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKM  286
            LR+ FS +FNPI+ARVVF++ SG+SAGYGFV+F T+EEA+ A+SS++G EL+GRP+RLK 
Sbjct  203  LRDFFSESFNPIAARVVFDSPSGRSAGYGFVSFATREEAQTALSSLEGKELMGRPLRLKF  262

Query  285  SEKN  274
            SE++
Sbjct  263  SERS  266



>ref|XP_011018552.1| PREDICTED: 28 kDa ribonucleoprotein, chloroplastic [Populus euphratica]
Length=293

 Score =   234 bits (598),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 145/180 (81%), Gaps = 4/180 (2%)
 Frame = -3

Query  807  NLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAA  628
            NL+RKLFV+NLPWS +V+D+K+LFGQCGTV DVE IK K G++RGFAFVTM +GEEA+AA
Sbjct  91   NLKRKLFVVNLPWSFSVADIKDLFGQCGTVSDVEIIKQKNGRSRGFAFVTMTTGEEAQAA  150

Query  627  IQKFNSYELSGRTIRVEYSKKFKKPIR----SpppppPRDGRYKLYVSNLAWKARSTHLR  460
            I KFNS E+SGR IRVE++K+ ++P      +P   P  + R+KLY+SNLAWK R +HLR
Sbjct  151  IDKFNSLEVSGRIIRVEFAKRLRRPPPRLPGTPADIPAGETRHKLYISNLAWKVRGSHLR  210

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            E FS N NP+S+RVVF+  +G+S+GYGFV+F T+EEA AAIS+  G EL+GRPIRLK SE
Sbjct  211  EFFSTNCNPVSSRVVFDGPAGRSSGYGFVSFATREEAVAAISAFSGKELMGRPIRLKFSE  270


 Score = 57.0 bits (136),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 46/84 (55%), Gaps = 1/84 (1%)
 Frame = -3

Query  816  PKPNLRRKLFVLNLPWSLAVSDVKELFG-QCGTVEDVEFIKTKEGQNRGFAFVTMASGEE  640
            P    R KL++ NL W +  S ++E F   C  V          G++ G+ FV+ A+ EE
Sbjct  187  PAGETRHKLYISNLAWKVRGSHLREFFSTNCNPVSSRVVFDGPAGRSSGYGFVSFATREE  246

Query  639  AEAAIQKFNSYELSGRTIRVEYSK  568
            A AAI  F+  EL GR IR+++S+
Sbjct  247  AVAAISAFSGKELMGRPIRLKFSE  270



>ref|XP_006410699.1| hypothetical protein EUTSA_v10016986mg [Eutrema salsugineum]
 gb|ESQ52152.1| hypothetical protein EUTSA_v10016986mg [Eutrema salsugineum]
Length=306

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 149/185 (81%), Gaps = 5/185 (3%)
 Frame = -3

Query  822  KTPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGE  643
            +T K N +RKLFV NLPWS++V+D+ ELFGQCG V +VE IK K+G+NRGFAFVTMASGE
Sbjct  81   ETQKSNQKRKLFVFNLPWSMSVNDISELFGQCGMVYNVEIIKQKDGKNRGFAFVTMASGE  140

Query  642  EAEAAIQKFNSYELSGRTIRVEYSKKFKKPI----RSpppppPRDGRYKLYVSNLAWKAR  475
            +A+AAI K +++++SGR IRV ++K+FKKP      + P   P + R+KLYVSNLAWKAR
Sbjct  141  DAQAAIDKLDTFQVSGRIIRVNFAKRFKKPTPKPPNALPYASPGETRHKLYVSNLAWKAR  200

Query  474  STHLRELFS-ANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPI  298
            STHLRE F+ A+FN +SARVVF +  G+++GYGFV+F T+EEAEAAI+ ++G EL+GRPI
Sbjct  201  STHLREFFTAADFNLVSARVVFADPQGRASGYGFVSFPTREEAEAAIAKLNGKELMGRPI  260

Query  297  RLKMS  283
             LK S
Sbjct  261  SLKFS  265



>gb|KDP29602.1| hypothetical protein JCGZ_19129 [Jatropha curcas]
Length=287

 Score =   233 bits (593),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 149/176 (85%), Gaps = 2/176 (1%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            +RKL+V+NLPWSL+V+D+K LFGQCGTV DVE IK K G++RGFAFVTMASGEEA+A + 
Sbjct  90   KRKLYVVNLPWSLSVADIKILFGQCGTVTDVEVIKQKNGRSRGFAFVTMASGEEAQAVVD  149

Query  621  KFNSYELSGRTIRVEYSKKF-KKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSA  445
            KF+S+E+SGR IRVEY+K+F K     PP  PP++ R+KLYVSN+ WK R+ +LRE FSA
Sbjct  150  KFDSHEISGRIIRVEYAKRFKKPSPPPPPGAPPKETRHKLYVSNIGWKVRANNLREFFSA  209

Query  444  -NFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
             NF P+S+RVVF++ +G+S+GYGFV+F T+EEAEAAIS++DG EL+GRP+RLK SE
Sbjct  210  NNFTPVSSRVVFDSPTGRSSGYGFVSFVTREEAEAAISALDGKELMGRPLRLKFSE  265



>ref|XP_010933475.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic [Elaeis 
guineensis]
Length=301

 Score =   233 bits (593),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 143/177 (81%), Gaps = 2/177 (1%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            R+KL+V+NLPW+   +D+K+LFGQCGTVE VE IK K G++RGFAFVTMAS EEA AAI 
Sbjct  103  RQKLYVVNLPWNFLAADIKKLFGQCGTVESVEIIKQKNGKSRGFAFVTMASEEEALAAID  162

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSppp--ppPRDGRYKLYVSNLAWKARSTHLRELFS  448
            K +SYEL GR IRVE++K F+KP   PPP      D + K+YVSNL+WKARS +L+E FS
Sbjct  163  KLDSYELMGRIIRVEFAKSFRKPPSPPPPPGATAVDMQQKIYVSNLSWKARSVNLKEFFS  222

Query  447  ANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
            A F P+SARVVFEN SG+SAGYGFVAF TKEEA+AAIS +DG EL+GRP+RLK+ +K
Sbjct  223  AKFKPLSARVVFENPSGRSAGYGFVAFATKEEADAAISELDGKELMGRPVRLKLRQK  279



>ref|XP_004512519.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic-like [Cicer 
arietinum]
Length=278

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 151/178 (85%), Gaps = 3/178 (2%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            ++KL V NLPWSL+V+D+K+LF QCGTV DVE IK+K+G+ RG+AFVTM SGEEA+AA+ 
Sbjct  79   KKKLCVFNLPWSLSVTDIKDLFAQCGTVIDVEIIKSKDGKGRGYAFVTMDSGEEAKAAVD  138

Query  621  KFNSYELSGRTIRVEYSKKFKK--PIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFS  448
            KF++Y +SGR IRVE++K+FKK  P  S P PPP + RY +Y SNL WKARSTHLR++F+
Sbjct  139  KFDAYVISGRIIRVEFAKRFKKPPPPPSRPSPPPSEARYVIYASNLTWKARSTHLRDVFT  198

Query  447  ANF-NPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
             NF +P+SARVVFE+ +G+SAGYGFV++ T EEAEAAIS+++G EL+GRP+R+K+SEK
Sbjct  199  ENFKSPVSARVVFESPAGRSAGYGFVSYHTMEEAEAAISALEGKELMGRPLRVKISEK  256



>ref|NP_001242808.1| uncharacterized protein LOC100793319 [Glycine max]
 gb|ACU20232.1| unknown [Glycine max]
Length=289

 Score =   230 bits (587),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 149/183 (81%), Gaps = 4/183 (2%)
 Frame = -3

Query  816  PKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEA  637
            P  N++ KL+V+NL WSL  +D+ +LF Q GTV DVE IK+K+G+++G+AFVTMASGEEA
Sbjct  75   PTDNVK-KLYVVNLSWSLTAADINDLFAQSGTVTDVEIIKSKDGRSKGYAFVTMASGEEA  133

Query  636  EAAIQKFNSYELSGRTIRVEYSKKFKK--PIRSpppppPRDGRYKLYVSNLAWKARSTHL  463
            +AA+ KF+SYELSGR IRVE +K+FKK      PP P P + R+ +Y SNLAWKARSTHL
Sbjct  134  QAAVDKFDSYELSGRIIRVELAKRFKKPPSPPPPPGPRPGETRHVIYASNLAWKARSTHL  193

Query  462  RELFSANF-NPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKM  286
            R+LF+ NF  P SARVVF++ SG+SAGYGFV+F TKE+AEAAIS++DG EL+GRP+RLK 
Sbjct  194  RQLFAENFKTPSSARVVFDSPSGRSAGYGFVSFLTKEDAEAAISTVDGKELMGRPLRLKF  253

Query  285  SEK  277
            SEK
Sbjct  254  SEK  256



>gb|KHN04874.1| 31 kDa ribonucleoprotein, chloroplastic [Glycine soja]
Length=289

 Score =   230 bits (587),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 149/183 (81%), Gaps = 4/183 (2%)
 Frame = -3

Query  816  PKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEA  637
            P  N++ KL+V+NL WSL  +D+ +LF Q GTV DVE IK+K+G+++G+AFVTMASGEEA
Sbjct  75   PTDNVK-KLYVVNLSWSLTAADINDLFAQSGTVTDVEIIKSKDGRSKGYAFVTMASGEEA  133

Query  636  EAAIQKFNSYELSGRTIRVEYSKKFKK--PIRSpppppPRDGRYKLYVSNLAWKARSTHL  463
            +AA+ KF+SYELSGR IRVE +K+FKK      PP P P + R+ +Y SNLAWKARSTHL
Sbjct  134  QAAVDKFDSYELSGRIIRVELAKRFKKPPSPPPPPGPRPGETRHVIYASNLAWKARSTHL  193

Query  462  RELFSANF-NPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKM  286
            R+LF+ NF  P SARVVF++ SG+SAGYGFV+F TKE+AEAAIS++DG EL+GRP+RLK 
Sbjct  194  RQLFAENFKTPSSARVVFDSPSGRSAGYGFVSFLTKEDAEAAISTVDGKELMGRPLRLKF  253

Query  285  SEK  277
            SEK
Sbjct  254  SEK  256



>ref|XP_007039475.1| RNA-binding family protein isoform 2 [Theobroma cacao]
 gb|EOY23976.1| RNA-binding family protein isoform 2 [Theobroma cacao]
Length=248

 Score =   227 bits (578),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 140/168 (83%), Gaps = 2/168 (1%)
 Frame = -3

Query  822  KTPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGE  643
            KT K N++RKLFVLNLPWS  V+D+K+LFGQCG V DVE IK K+G++R FAFVTMASGE
Sbjct  80   KTQKSNVKRKLFVLNLPWSYTVADIKDLFGQCGNVTDVEIIKQKDGRSRNFAFVTMASGE  139

Query  642  EAEAAIQKFNSYELSGRTIRVEYSKKFKKPIRS-pppppPRDGRYKLYVSNLAWKARSTH  466
            EA+AA+ K +S+E+S R IRVE++++FKKP  S  P  PPR+  +KLYVSNLAWK RS+H
Sbjct  140  EAQAAVDKLDSHEVSARIIRVEFARRFKKPSPSPQPIVPPRETHHKLYVSNLAWKVRSSH  199

Query  465  LRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDG  322
            LRE FSA FNP++ARV+F   SG+SAGYGFV+F TKEEA+AAIS+++G
Sbjct  200  LREFFSA-FNPVAARVIFGTPSGQSAGYGFVSFATKEEADAAISTLNG  246



>ref|XP_009384706.1| PREDICTED: 28 kDa ribonucleoprotein, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=292

 Score =   228 bits (581),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 144/179 (80%), Gaps = 2/179 (1%)
 Frame = -3

Query  807  NLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAA  628
             +RRK++V+NLPW  +  D+++LF QCGTV+DVE IK K G++RGFAFVTMASGEEA  A
Sbjct  94   EIRRKVYVVNLPWDFSAPDIEKLFAQCGTVKDVEIIKQKSGKSRGFAFVTMASGEEARTA  153

Query  627  IQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPR-DGRYKLYVSNLAWKARSTHLRELF  451
            + K ++YEL+GR IRVE++K F+KP  SPPP     + R+K+YVSNLAWKARS +L+E F
Sbjct  154  VDKLDAYELTGRIIRVEFAKSFRKPPPSPPPGAVAIEPRHKIYVSNLAWKARSVNLKEFF  213

Query  450  SANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEKN  274
               F P+SARVVFEN +G+SAGYGFV F TKEEAEAAIS +DG ELLGRP+RL++S++ 
Sbjct  214  E-KFKPLSARVVFENPTGRSAGYGFVGFATKEEAEAAISELDGKELLGRPVRLRISQRT  271



>gb|AFK48727.1| unknown [Lotus japonicus]
Length=285

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 146/178 (82%), Gaps = 2/178 (1%)
 Frame = -3

Query  804  LRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAI  625
            +++KL+V NLPWS++ +D+K+LFGQCGTV DVE I+ K+G+ +G+AFVTMASGEEA+AA+
Sbjct  84   IKKKLYVFNLPWSMSAADIKDLFGQCGTVTDVEIIRGKDGRGKGYAFVTMASGEEAQAAV  143

Query  624  QKFNSYELSGRTIRVEYSKKFKK-PIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFS  448
             KF++ ELSGR +RVE +K+FKK     PP PPP + R+ +Y SNLAWK RSTHLRE F+
Sbjct  144  DKFDTLELSGRILRVELAKRFKKPSPPGPPSPPPSEARHVIYASNLAWKVRSTHLREFFT  203

Query  447  ANFN-PISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
             NF  P+SAR+VF+  SGK+ GYGF+++ TKEEAEAAIS++DG EL+GR + LK+SEK
Sbjct  204  ENFKAPLSARIVFDTPSGKTTGYGFISYLTKEEAEAAISALDGKELMGRSLFLKISEK  261



>ref|XP_008786323.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic [Phoenix 
dactylifera]
Length=281

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 131/245 (53%), Positives = 169/245 (69%), Gaps = 8/245 (3%)
 Frame = -3

Query  993  FSKPLRLQISPNYPTLSLKSLMRSLPS-LASTKLKTS-HILRCStveeqavvaveteqEK  820
            FS+  +  IS   P LS  +L    PS L  +  +TS    RCS V++ A V  E + ++
Sbjct  17   FSRARKPGISHYTPALSFNTLF--FPSRLRVSDSETSLRFRRCSVVQDIAAVEDEKKGDE  74

Query  819  TP--KPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASG  646
                +   R+KL+V+NLPW+    D+++LFG+CGTVE VE IK K G++RGFAFV MAS 
Sbjct  75   KEEGRQENRQKLYVVNLPWNFLAPDIRKLFGECGTVESVEIIKQKNGKSRGFAFVMMASE  134

Query  645  EEAEAAIQKFNSYELSGRTIRVEYSKKFKKPIRSppp--ppPRDGRYKLYVSNLAWKARS  472
            EEA AAI K +SYEL GR IRVE++K  +KP   P P      D R K+YVSNL+WKARS
Sbjct  135  EEALAAIDKLDSYELMGRIIRVEFAKSLRKPPSPPSPPGATAADTRQKIYVSNLSWKARS  194

Query  471  THLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRL  292
             +L+E FSA F P+SARVVFE+ SG+SAGYGFVAF TKEEA+AAIS +DG EL+GRP+RL
Sbjct  195  ANLKEFFSAKFKPLSARVVFEDPSGRSAGYGFVAFATKEEADAAISELDGKELMGRPVRL  254

Query  291  KMSEK  277
            ++  K
Sbjct  255  RLRRK  259



>gb|AFK40547.1| unknown [Lotus japonicus]
Length=285

 Score =   219 bits (559),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 144/178 (81%), Gaps = 2/178 (1%)
 Frame = -3

Query  804  LRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAI  625
            +++KL+V  LPWS++ +D+K+LFGQCGTV DVE I+ K+G+ +G+AFVTMASGEEA+AA+
Sbjct  84   IKKKLYVFTLPWSMSAADIKDLFGQCGTVTDVEIIRGKDGRGKGYAFVTMASGEEAQAAV  143

Query  624  QKFNSYELSGRTIRVEYSKKFKK-PIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFS  448
             KF++ ELSGR +RVE +K+FKK     PP PPP + R+ +Y SNLAWK RSTHLRE F+
Sbjct  144  DKFDTLELSGRILRVELAKRFKKPSPPGPPSPPPSEARHVIYASNLAWKVRSTHLREFFT  203

Query  447  ANFN-PISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
             NF  P+SAR+VF+  SG + GYGF+++ TKEEAEAAIS++DG EL+GR + LK+SEK
Sbjct  204  ENFKAPLSARIVFDTPSGWATGYGFISYLTKEEAEAAISALDGKELMGRSLFLKISEK  261



>ref|XP_007158292.1| hypothetical protein PHAVU_002G140400g [Phaseolus vulgaris]
 gb|ESW30286.1| hypothetical protein PHAVU_002G140400g [Phaseolus vulgaris]
Length=290

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 149/192 (78%), Gaps = 11/192 (6%)
 Frame = -3

Query  822  KTPKP-----NLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVT  658
            KTP P     NL  KL+V NL WSL+ +D+K +F QCGTV DVE I+ ++G++ G+AFVT
Sbjct  67   KTPGPTQPTDNLT-KLYVANLSWSLSPADIKGIFAQCGTVTDVEIIRNRKGRHMGYAFVT  125

Query  657  MASGEEAEAAIQKFNSYELSGRTIRVEYSKKFKK----PIRSpppppPRDGRYKLYVSNL  490
            M SGEEA+ A+ KF+S ELSGR IRVE +K FKK    P   PPPP PR+ R+ LYVSNL
Sbjct  126  MDSGEEAQVAVDKFDSSELSGRIIRVELAKTFKKPPPPPPPPPPPPQPRETRHVLYVSNL  185

Query  489  AWKARSTHLRELFSANF-NPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTEL  313
            AWKARSTHLR++F+ NF  P+SARVVF++ + +SAGYGFV+F TKE+AEAAIS++DG E+
Sbjct  186  AWKARSTHLRQVFTENFKTPVSARVVFDSPAKRSAGYGFVSFLTKEDAEAAISNVDGKEI  245

Query  312  LGRPIRLKMSEK  277
            +GRP+RL  SEK
Sbjct  246  MGRPLRLSFSEK  257



>ref|XP_003612875.1| 31 kDa ribonucleoprotein [Medicago truncatula]
 gb|AES95833.1| RNA-binding (RRM/RBD/RNP motif) family protein [Medicago truncatula]
Length=324

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 145/178 (81%), Gaps = 1/178 (1%)
 Frame = -3

Query  807  NLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAA  628
            N+++ L V NLPWSL+  D+K+LFGQCGTV DVE IK+K+G+ +G+ FVTM SGE A+AA
Sbjct  93   NVKKNLIVFNLPWSLSKPDIKDLFGQCGTVIDVEIIKSKDGKGKGYTFVTMDSGEGAQAA  152

Query  627  IQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFS  448
            + KFN+ E+SGR +RVE++K FKKP   PP P P++ RY +Y SNLAWKARSTHLR++F+
Sbjct  153  VDKFNATEISGRILRVEFAKGFKKPRPPPPAPTPKEARYVIYASNLAWKARSTHLRDIFT  212

Query  447  ANF-NPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
             NF  P+SARVVF+   GKSAGYGFV++ T+EEAEAAIS++ G ELLGRP+ +K+SE+
Sbjct  213  ENFKTPVSARVVFQVPGGKSAGYGFVSYHTEEEAEAAISALQGKELLGRPLLVKISER  270



>ref|XP_004976651.1| PREDICTED: 33 kDa ribonucleoprotein, chloroplastic-like isoform 
X2 [Setaria italica]
Length=277

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 141/174 (81%), Gaps = 4/174 (2%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            RRKL+V NLPWS+   +V++LF QCGTV+DVE IK K+G+NRGFAFVTM++ EEA AA++
Sbjct  70   RRKLYVANLPWSVPAPEVEKLFAQCGTVKDVELIKGKDGRNRGFAFVTMSTAEEAAAAVE  129

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSAN  442
            K NS+E+ GR I+VE+SK F+KP  +PPP    + R+KLYVSNL WKAR+ +++E FS  
Sbjct  130  KLNSHEVMGRKIKVEFSKSFRKPAPTPPPGTIIE-RHKLYVSNLPWKARAPNVKEFFS-K  187

Query  441  FNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            FNP+SA V+F+N  GK+AGYGFV+FGTKEEAEAA+S +DG EL+GRP+RL   E
Sbjct  188  FNPLSANVIFDN--GKAAGYGFVSFGTKEEAEAALSELDGKELMGRPVRLNWKE  239



>gb|AFK40024.1| unknown [Medicago truncatula]
Length=324

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 144/178 (81%), Gaps = 1/178 (1%)
 Frame = -3

Query  807  NLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAA  628
            N+++ L V NLPWSL+  D+K+LFGQCGTV DVE IK+K+G+ +G+ FVTM SGE A+AA
Sbjct  93   NVKKNLIVFNLPWSLSKPDIKDLFGQCGTVIDVEIIKSKDGKGKGYTFVTMDSGEGAQAA  152

Query  627  IQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFS  448
            + KFN+ E+SGR +RVE++K FKKP   PP P P++ RY +Y SNLAWKARSTHLR++F+
Sbjct  153  VDKFNATEISGRILRVEFAKGFKKPRPPPPAPTPKEARYVIYASNLAWKARSTHLRDIFT  212

Query  447  ANF-NPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
             NF  P+SARVVF+   GKSAGYGFV++ T+EEAEAAI ++ G ELLGRP+ +K+SE+
Sbjct  213  ENFKTPVSARVVFQVPGGKSAGYGFVSYHTEEEAEAAIFALQGKELLGRPLLVKISER  270



>ref|XP_006838538.1| hypothetical protein AMTR_s00002p00197820 [Amborella trichopoda]
 gb|ERN01107.1| hypothetical protein AMTR_s00002p00197820 [Amborella trichopoda]
Length=280

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 134/175 (77%), Gaps = 3/175 (2%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            +RKL+  NLPW+ + +D++ LFGQCG V+DV+ IK K G++RGFAF+TM S EEA AAI 
Sbjct  87   KRKLYAENLPWTFSANDLRNLFGQCGAVKDVDIIKHKNGKSRGFAFITMDSTEEAVAAID  146

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSAN  442
            KF+SYEL GR IRV+++K+ K P    P     D  YK+Y +NL WK RS+HLRE F A 
Sbjct  147  KFDSYELMGRIIRVQFAKRMKPP---RPDNMVMDTNYKIYATNLTWKVRSSHLREFFMAT  203

Query  441  FNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
             +P+SARVVF++ SGKSAGYGF+ + TKEEAEAAI+  +G EL+GRP+RL++S++
Sbjct  204  TSPVSARVVFDSPSGKSAGYGFIGYATKEEAEAAIAEFNGKELMGRPLRLQLSQR  258



>ref|XP_006652723.1| PREDICTED: 31 kDa ribonucleoprotein, chloroplastic-like [Oryza 
brachyantha]
Length=292

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 140/171 (82%), Gaps = 2/171 (1%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            RRKL+V N+PWSL   ++++LF QCG V+DVE IK K+G+ +GFAFVTM++ EEA AA++
Sbjct  81   RRKLYVANIPWSLPAPEIEKLFAQCGAVKDVEVIKGKDGKKKGFAFVTMSTTEEAAAAVE  140

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSAN  442
            K NS ++ GRTIRVE+SK F+KP   PPP    + R+KLYVSNL WKAR+ +++E F+  
Sbjct  141  KLNSLDVMGRTIRVEFSKSFRKPAPPPPPGTIVE-RHKLYVSNLPWKARAPNMKEFFT-K  198

Query  441  FNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLK  289
            FNP+SA+VVF++ SGKSAGYGFV+FGTKEEAEAA+S +DG EL+GRP+RL+
Sbjct  199  FNPLSAKVVFDSPSGKSAGYGFVSFGTKEEAEAALSELDGKELMGRPVRLR  249


 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            R KL+V NLPW     ++KE F +   +       +  G++ G+ FV+  + EEAEAA+ 
Sbjct  175  RHKLYVSNLPWKARAPNMKEFFTKFNPLSAKVVFDSPSGKSAGYGFVSFGTKEEAEAALS  234

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRS  544
            + +  EL GR +R+ + +     + S
Sbjct  235  ELDGKELMGRPVRLRWRQNTDDTVDS  260



>ref|NP_001147738.1| plastid-specific 30S ribosomal protein 2 [Zea mays]
 gb|ACG28526.1| plastid-specific 30S ribosomal protein 2 [Zea mays]
 tpg|DAA36256.1| TPA: plastid-specific 30S ribosomal protein 2 [Zea mays]
Length=272

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 138/174 (79%), Gaps = 4/174 (2%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            RRKL+V NLPWS    ++++LF Q GTV+DVE IK K+G+NRGFAFVTM++ EEA AA  
Sbjct  65   RRKLYVANLPWSFPAPEIEKLFAQHGTVKDVEVIKGKDGRNRGFAFVTMSTAEEAAAAAD  124

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSAN  442
            K NS+++ GRTI+VE+SK F++P   PPP    + R+KLYVSNL WKAR+ +++E F AN
Sbjct  125  KLNSHDVMGRTIKVEFSKSFRRPAPPPPPGTIIE-RHKLYVSNLPWKARAPNVKEFF-AN  182

Query  441  FNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            FNP+SA V+F+N  GK+AGYGFV+FGTKEEAEAA++ +DG ELLGRP+RL   E
Sbjct  183  FNPLSANVIFDN--GKAAGYGFVSFGTKEEAEAALTELDGKELLGRPVRLNWRE  234



>ref|XP_002448426.1| hypothetical protein SORBIDRAFT_06g026990 [Sorghum bicolor]
 gb|EES12754.1| hypothetical protein SORBIDRAFT_06g026990 [Sorghum bicolor]
Length=278

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 134/170 (79%), Gaps = 7/170 (4%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            RRKL+V NLPWS    ++++LF Q GTV+DVE IK K+G+NRGFAFVTM++ EEA AA +
Sbjct  74   RRKLYVANLPWSFPAPEIEKLFAQHGTVKDVEVIKGKDGRNRGFAFVTMSTTEEAAAAAE  133

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSAN  442
            K NS+++ GRTI+VE+S+ F+KP   PP       R+KLYVSNL WKAR+ +++E F A 
Sbjct  134  KLNSHDVMGRTIKVEFSRSFRKPAPLPPIIE----RHKLYVSNLPWKARAPNVKEFF-AK  188

Query  441  FNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRL  292
            FNP+SA V+F+N  GK+AGY FV+FGTKEEAEAA++ +DG EL+GRP+RL
Sbjct  189  FNPLSANVIFDN--GKAAGYCFVSFGTKEEAEAALTELDGKELMGRPVRL  236



>gb|EAY95360.1| hypothetical protein OsI_17193 [Oryza sativa Indica Group]
Length=290

 Score =   188 bits (478),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 137/171 (80%), Gaps = 3/171 (2%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            RRKL+V N+PWS    ++++LF QCG V+DVE IK K+G+ +GFAFVTMA+ EEA AA++
Sbjct  79   RRKLYVANIPWSFPAPEIEKLFAQCGAVKDVEVIKGKDGKKKGFAFVTMATAEEAAAAVE  138

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSAN  442
            K NS ++ GRTIRVE+SK F+KP   PP       R+KLYVSNL WKAR+ +++E F + 
Sbjct  139  KLNSLDVMGRTIRVEFSKSFRKPAPPPPGTILE--RHKLYVSNLPWKARAPNMKE-FCSK  195

Query  441  FNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLK  289
            FNP+SA+VVF++ SGKSAGYGFV+FGTKEEAEAA++ +DG EL+GRP+RL+
Sbjct  196  FNPLSAKVVFDSPSGKSAGYGFVSFGTKEEAEAALTELDGKELMGRPVRLR  246


 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 42/76 (55%), Gaps = 0/76 (0%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            R KL+V NLPW     ++KE   +   +       +  G++ G+ FV+  + EEAEAA+ 
Sbjct  172  RHKLYVSNLPWKARAPNMKEFCSKFNPLSAKVVFDSPSGKSAGYGFVSFGTKEEAEAALT  231

Query  621  KFNSYELSGRTIRVEY  574
            + +  EL GR +R+ +
Sbjct  232  ELDGKELMGRPVRLRW  247



>ref|NP_001053710.1| Os04g0591000 [Oryza sativa Japonica Group]
 emb|CAE04874.2| OSJNBa0086O06.22 [Oryza sativa Japonica Group]
 dbj|BAF15624.1| Os04g0591000 [Oryza sativa Japonica Group]
 dbj|BAG93196.1| unnamed protein product [Oryza sativa Japonica Group]
Length=291

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 139/171 (81%), Gaps = 2/171 (1%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            RRKL+V N+PWS    ++++LF QCG V+DVE IK K+G+ +GFAFVTMA+ EEA AA++
Sbjct  79   RRKLYVANIPWSFPAPEIEKLFAQCGAVKDVEVIKGKDGKKKGFAFVTMATAEEAAAAVE  138

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSAN  442
            K NS ++ GRTIRVE+SK F+KP   PPP    + R+KLYVSNL WKAR+ +++E FS  
Sbjct  139  KLNSLDVMGRTIRVEFSKSFRKPAPPPPPGTILE-RHKLYVSNLPWKARAPNMKEFFS-K  196

Query  441  FNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLK  289
            FNP+SA+VVF++ SGKSAGYGFV+FGTKEEAEAA++ +DG EL+GRP+RL+
Sbjct  197  FNPLSAKVVFDSPSGKSAGYGFVSFGTKEEAEAALTELDGKELMGRPVRLR  247


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            R KL+V NLPW     ++KE F +   +       +  G++ G+ FV+  + EEAEAA+ 
Sbjct  173  RHKLYVSNLPWKARAPNMKEFFSKFNPLSAKVVFDSPSGKSAGYGFVSFGTKEEAEAALT  232

Query  621  KFNSYELSGRTIRVEYSK  568
            + +  EL GR +R+ + +
Sbjct  233  ELDGKELMGRPVRLRWRQ  250



>emb|CAH67960.1| OSIGBa0142I02-OSIGBa0101B20.3 [Oryza sativa Indica Group]
Length=291

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 139/171 (81%), Gaps = 2/171 (1%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            RRKL+V N+PWS    ++++LF QCG V+DVE IK K+G+ +GFAFVTMA+ EEA AA++
Sbjct  79   RRKLYVANIPWSFPAPEIEKLFAQCGAVKDVEVIKGKDGKKKGFAFVTMATAEEAAAAVE  138

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSAN  442
            K NS ++ GRTIRVE+SK F+KP   PPP    + R+KLYVSNL WKAR+ +++E FS  
Sbjct  139  KLNSLDVMGRTIRVEFSKSFRKPAPPPPPGTILE-RHKLYVSNLPWKARAPNMKEFFS-K  196

Query  441  FNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLK  289
            FNP+SA+VVF++ SGKSAGYGFV+FGTKEEAEAA++ +DG EL+GRP+RL+
Sbjct  197  FNPLSAKVVFDSPSGKSAGYGFVSFGTKEEAEAALTELDGKELMGRPVRLR  247


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            R KL+V NLPW     ++KE F +   +       +  G++ G+ FV+  + EEAEAA+ 
Sbjct  173  RHKLYVSNLPWKARAPNMKEFFSKFNPLSAKVVFDSPSGKSAGYGFVSFGTKEEAEAALT  232

Query  621  KFNSYELSGRTIRVEYSK  568
            + +  EL GR +R+ + +
Sbjct  233  ELDGKELMGRPVRLRWRQ  250



>ref|XP_004976650.1| PREDICTED: 33 kDa ribonucleoprotein, chloroplastic-like isoform 
X1 [Setaria italica]
Length=322

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 141/219 (64%), Gaps = 49/219 (22%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVE----------------------------  706
            RRKL+V NLPWS+   +V++LF QCGTV+DVE                            
Sbjct  70   RRKLYVANLPWSVPAPEVEKLFAQCGTVKDVEVRAASPVFEEKKCNAACRGEPSRRALDF  129

Query  705  -----------------FIKTKEGQNRGFAFVTMASGEEAEAAIQKFNSYELSGRTIRVE  577
                              IK K+G+NRGFAFVTM++ EEA AA++K NS+E+ GR I+VE
Sbjct  130  SVAIRLFEKSACVCLVKLIKGKDGRNRGFAFVTMSTAEEAAAAVEKLNSHEVMGRKIKVE  189

Query  576  YSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSANFNPISARVVFENASG  397
            +SK F+KP  +PPP    + R+KLYVSNL WKAR+ +++E FS  FNP+SA V+F+N  G
Sbjct  190  FSKSFRKPAPTPPPGTIIE-RHKLYVSNLPWKARAPNVKEFFS-KFNPLSANVIFDN--G  245

Query  396  KSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            K+AGYGFV+FGTKEEAEAA+S +DG EL+GRP+RL   E
Sbjct  246  KAAGYGFVSFGTKEEAEAALSELDGKELMGRPVRLNWKE  284


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 47/86 (55%), Gaps = 7/86 (8%)
 Frame = -3

Query  819  TPKPNL---RRKLFVLNLPWSLAVSDVKELFGQCGTVE-DVEFIKTKEGQNRGFAFVTMA  652
            TP P     R KL+V NLPW     +VKE F +   +  +V F     G+  G+ FV+  
Sbjct  200  TPPPGTIIERHKLYVSNLPWKARAPNVKEFFSKFNPLSANVIF---DNGKAAGYGFVSFG  256

Query  651  SGEEAEAAIQKFNSYELSGRTIRVEY  574
            + EEAEAA+ + +  EL GR +R+ +
Sbjct  257  TKEEAEAALSELDGKELMGRPVRLNW  282



>ref|XP_003580456.1| PREDICTED: 33 kDa ribonucleoprotein, chloroplastic [Brachypodium 
distachyon]
 ref|XP_010240337.1| PREDICTED: 33 kDa ribonucleoprotein, chloroplastic [Brachypodium 
distachyon]
Length=286

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 128/168 (76%), Gaps = 4/168 (2%)
 Frame = -3

Query  792  LFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQKFN  613
            L+V NLPW+L   ++++LF +CG V+DV+ IK K+G+ RGFAFVTM S EEA AA++KFN
Sbjct  82   LYVANLPWTLPAVEIEKLFAECGVVKDVQVIKMKDGRKRGFAFVTMGSAEEAAAAVEKFN  141

Query  612  SYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSANFNP  433
            SY++ GR I+VE+SK F+KP     P      R+KLYVSNLAWKARS+ ++  FS  FNP
Sbjct  142  SYDVMGRIIKVEFSKTFRKPAPPRIPSTIF-ARHKLYVSNLAWKARSSDIKAFFS-QFNP  199

Query  432  ISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLK  289
            ISA VVF++   KSAGYGFV+F TKE+AEAA+S ++G ELL RP+ L+
Sbjct  200  ISANVVFDDK--KSAGYGFVSFQTKEDAEAALSELNGKELLERPVLLR  245



>dbj|BAJ98479.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=266

 Score =   182 bits (462),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 133/174 (76%), Gaps = 4/174 (2%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            RRKLFV N+P++ + ++ ++LF +CG V+DVE IK K+G+ RGFAFVTMA+ EEA A ++
Sbjct  59   RRKLFVGNMPFTFSAAETEKLFAECGVVKDVEVIKMKDGRKRGFAFVTMATAEEAAAVVE  118

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSAN  442
            KF+ ++++GR I+VE+SK F+KP     P      +YKLYVSNLAWKARS  L+E FS  
Sbjct  119  KFDGHDINGRVIKVEFSKSFRKPAPPSSPDTIV-AKYKLYVSNLAWKARSADLKEFFS-Q  176

Query  441  FNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            FNP+SA +VF++   KSAGYGFV+FGTKEEAEAA+S ++G EL+ RP+ L+  E
Sbjct  177  FNPVSANIVFDDR--KSAGYGFVSFGTKEEAEAALSELNGKELMERPVILRWRE  228



>dbj|BAJ86328.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=285

 Score =   182 bits (463),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 133/174 (76%), Gaps = 4/174 (2%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            RRKLFV N+P++ + ++ ++LF +CG V+DVE IK K+G+ RGFAFVTMA+ EEA A ++
Sbjct  78   RRKLFVGNMPFTFSAAETEKLFAECGVVKDVEVIKMKDGRKRGFAFVTMATAEEAAAVVE  137

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSAN  442
            KF+ ++++GR I+VE+SK F+KP     P      +YKLYVSNLAWKARS  L+E FS  
Sbjct  138  KFDGHDINGRVIKVEFSKSFRKPAPPSSPDTIV-AKYKLYVSNLAWKARSADLKEFFS-Q  195

Query  441  FNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            FNP+SA +VF++   KSAGYGFV+FGTKEEAEAA+S ++G EL+ RP+ L+  E
Sbjct  196  FNPVSANIVFDDR--KSAGYGFVSFGTKEEAEAALSELNGKELMERPVILRWRE  247



>ref|XP_006827955.1| hypothetical protein AMTR_s00008p00202090 [Amborella trichopoda]
 gb|ERM95371.1| hypothetical protein AMTR_s00008p00202090 [Amborella trichopoda]
Length=309

 Score =   172 bits (437),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 122/186 (66%), Gaps = 18/186 (10%)
 Frame = -3

Query  804  LRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAI  625
            L+ +L+V NLPW+    D+K LF QCG V DVE +K K G+NRG AFV M+S +EA AA+
Sbjct  87   LKTRLYVTNLPWTCTSEDIKNLFQQCGAVIDVELMKFKAGRNRGMAFVMMSSEDEALAAL  146

Query  624  QKFNSYELSGRTIRVEY------------SKKFKKPIRSpppppPRDGRYKLYVSNLAWK  481
             K NSYE  GRTI+ E             SKK   P+ +       + R+K+YV NL W+
Sbjct  147  VKLNSYEFGGRTIKAELAKKAKKISPSVSSKKISPPVGTV------ETRHKVYVGNLDWR  200

Query  480  ARSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRP  301
             RS+ LRE F+ + N +SARVV+    GK AGYGFV+F +KE+AEAA+++++G EL GR 
Sbjct  201  VRSSDLREFFTKHSNALSARVVYGGTKGKPAGYGFVSFASKEDAEAAVATLEGKELNGRS  260

Query  300  IRLKMS  283
            +RL+++
Sbjct  261  LRLRIA  266


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 45/79 (57%), Gaps = 1/79 (1%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFI-KTKEGQNRGFAFVTMASGEEAEAAI  625
            R K++V NL W +  SD++E F +         +    +G+  G+ FV+ AS E+AEAA+
Sbjct  189  RHKVYVGNLDWRVRSSDLREFFTKHSNALSARVVYGGTKGKPAGYGFVSFASKEDAEAAV  248

Query  624  QKFNSYELSGRTIRVEYSK  568
                  EL+GR++R+  ++
Sbjct  249  ATLEGKELNGRSLRLRIAR  267



>gb|EMT28681.1| 33 kDa ribonucleoprotein, chloroplastic [Aegilops tauschii]
Length=200

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 125/166 (75%), Gaps = 4/166 (2%)
 Frame = -3

Query  777  LPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQKFNSYELS  598
            +P++ + ++ ++LF +CG V+DVE IK K+G+ RGFAFVTMA+ EEA AA +KF+ +++ 
Sbjct  1    MPFTFSAAETEKLFAECGVVKDVEVIKMKDGRKRGFAFVTMATAEEAAAAAEKFDGHDVM  60

Query  597  GRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSANFNPISARV  418
            GR I+VE+SK F+KP   P P      +YKLYVSNLAWKARS  L+E F   FNP+SA +
Sbjct  61   GRIIKVEFSKSFRKPAPPPSPDTIV-AKYKLYVSNLAWKARSADLKEFF-LQFNPVSANI  118

Query  417  VFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            VFE+   KSAGYGFV+FGTKEEAEAA++ ++G EL+ RP+ L+  E
Sbjct  119  VFEDR--KSAGYGFVSFGTKEEAEAALTELNGKELMERPVILRWRE  162



>ref|XP_010942624.1| PREDICTED: 29 kDa ribonucleoprotein B, chloroplastic isoform 
X1 [Elaeis guineensis]
 ref|XP_010942625.1| PREDICTED: 29 kDa ribonucleoprotein B, chloroplastic isoform 
X1 [Elaeis guineensis]
Length=289

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 119/171 (70%), Gaps = 3/171 (2%)
 Frame = -3

Query  804  LRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAI  625
            +R++L   N+PW+    D+++LF Q GTV DVE       +NRG AFVTMAS EEA AA+
Sbjct  82   VRKRLIAQNIPWTCTAEDIRKLFEQHGTVIDVELSMYNRTRNRGLAFVTMASEEEAVAAL  141

Query  624  QKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSA  445
               NSYEL GR I+VE+++  KK   +   P P   ++ ++V NL+W+ RS  LRELF+A
Sbjct  142  NNLNSYELDGRVIKVEFARSLKKDSSAATIPVP---KFNVFVGNLSWRVRSRDLRELFNA  198

Query  444  NFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRL  292
            + N +SA V+F++   +SAGYGFV+F +KEEAEAAI++ +G +L+GRP+ L
Sbjct  199  SGNVLSAEVIFQSNPRRSAGYGFVSFASKEEAEAAIATYNGKKLMGRPVNL  249


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 44/75 (59%), Gaps = 1/75 (1%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFI-KTKEGQNRGFAFVTMASGEEAEAAIQK  619
             +FV NL W +   D++ELF   G V   E I ++   ++ G+ FV+ AS EEAEAAI  
Sbjct  177  NVFVGNLSWRVRSRDLRELFNASGNVLSAEVIFQSNPRRSAGYGFVSFASKEEAEAAIAT  236

Query  618  FNSYELSGRTIRVEY  574
            +N  +L GR + + +
Sbjct  237  YNGKKLMGRPVNLAF  251



>ref|XP_008775879.1| PREDICTED: 31 kDa ribonucleoprotein, chloroplastic [Phoenix dactylifera]
Length=309

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 114/170 (67%), Gaps = 3/170 (2%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            R++L   N+PW+    D++ +F + GTV DVE       +NRG AFVTMAS EEA AA+ 
Sbjct  103  RKRLIAQNIPWTCTAEDIRNIFEKHGTVTDVELSMYNSTRNRGLAFVTMASEEEALAALN  162

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSAN  442
              NSY+L GR I+VE+++  KK             +Y ++V NLAW+ RS  LRELF+A+
Sbjct  163  NLNSYDLDGRVIKVEFARSLKK---DSSVAMVPVSKYNVFVGNLAWRVRSHDLRELFNAS  219

Query  441  FNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRL  292
             N +SA VVF++   +SAGYGFV+F +KEEAEAAI++ +G +L+GRPI L
Sbjct  220  GNVLSAEVVFQSNPRRSAGYGFVSFASKEEAEAAIATFNGKKLMGRPINL  269


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = -3

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFI-KTKEGQNRGFAFVTMASGEEAE  634
            P  +  +FV NL W +   D++ELF   G V   E + ++   ++ G+ FV+ AS EEAE
Sbjct  192  PVSKYNVFVGNLAWRVRSHDLRELFNASGNVLSAEVVFQSNPRRSAGYGFVSFASKEEAE  251

Query  633  AAIQKFNSYELSGRTIRVEYSK  568
            AAI  FN  +L GR I + + K
Sbjct  252  AAIATFNGKKLMGRPINLAFGK  273



>ref|XP_009340208.1| PREDICTED: 33 kDa ribonucleoprotein, chloroplastic-like, partial 
[Pyrus x bretschneideri]
Length=164

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 99/128 (77%), Gaps = 0/128 (0%)
 Frame = -3

Query  822  KTPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGE  643
            K+ + N +RKL+V NLPWSL V D+K LFG+CGTV+D+E IK + G++RGFAFVTM SGE
Sbjct  29   KSQQQNQKRKLYVGNLPWSLTVVDIKNLFGECGTVQDIEIIKQQNGKSRGFAFVTMDSGE  88

Query  642  EAEAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHL  463
            EA AAI KF+S E+ GRTIR+E++K+FKKP   PP P   + RYKLYVSNL WK RS+HL
Sbjct  89   EALAAIDKFHSREMLGRTIRIEFTKQFKKPSPLPPNPQVGETRYKLYVSNLGWKVRSSHL  148

Query  462  RELFSANF  439
            R+  S  F
Sbjct  149  RDFVSEIF  156


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 41/78 (53%), Gaps = 1/78 (1%)
 Frame = -3

Query  510  KLYVSNLAWKARSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISS  331
            KLYV NL W      ++ LF      +    + +  +GKS G+ FV   + EEA AAI  
Sbjct  38   KLYVGNLPWSLTVVDIKNLF-GECGTVQDIEIIKQQNGKSRGFAFVTMDSGEEALAAIDK  96

Query  330  IDGTELLGRPIRLKMSEK  277
                E+LGR IR++ +++
Sbjct  97   FHSREMLGRTIRIEFTKQ  114



>ref|XP_009417600.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic [Musa acuminata 
subsp. malaccensis]
 ref|XP_009417601.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=272

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 117/173 (68%), Gaps = 5/173 (3%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            R +L   N+PW+    D++ LF + G V DVE       +NRG AFVTMAS EEA AA+ 
Sbjct  76   RTRLIAQNVPWTCTPDDIRTLFSKHGNVVDVELSMYNSSRNRGLAFVTMASEEEALAALS  135

Query  621  KFNSYELSGRTIRVEYSKKFKK-PIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSA  445
              NSY+L GR I+VE+++  KK P+ +  P P    +Y ++V NL W+ RS  LRELFS 
Sbjct  136  HLNSYDLDGRVIKVEFARSVKKAPVVAAGPVP----KYNVFVGNLTWRVRSRDLRELFSG  191

Query  444  NFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKM  286
            + N +SA V+F++   +SAGYGFV+F +KEEAEAAI++++G +L+GR IRL +
Sbjct  192  SGNILSAEVIFQSNPRRSAGYGFVSFASKEEAEAAITTLNGNKLMGRRIRLVL  244


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 46/83 (55%), Gaps = 1/83 (1%)
 Frame = -3

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFI-KTKEGQNRGFAFVTMASGEEAE  634
            P  +  +FV NL W +   D++ELF   G +   E I ++   ++ G+ FV+ AS EEAE
Sbjct  165  PVPKYNVFVGNLTWRVRSRDLRELFSGSGNILSAEVIFQSNPRRSAGYGFVSFASKEEAE  224

Query  633  AAIQKFNSYELSGRTIRVEYSKK  565
            AAI   N  +L GR IR+   K 
Sbjct  225  AAITTLNGNKLMGRRIRLVLGKD  247



>gb|ACG27691.1| ribonucleoprotein [Zea mays]
Length=341

 Score =   155 bits (391),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 115/187 (61%), Gaps = 4/187 (2%)
 Frame = -3

Query  822  KTPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASG  646
            + P+ +   +LFV NLP++    ++ ++F + G V+D + I  K   ++RGFAFVTMA+ 
Sbjct  104  RPPRGDDPGRLFVGNLPYTYTSEELAQVFSEAGRVDDAQIIYDKVTNRSRGFAFVTMATA  163

Query  645  EEAEAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPR---DGRYKLYVSNLAWKAR  475
            EEA  AIQ F+   L GRT RV Y +  +   R       R   DG YK+Y  NL W  R
Sbjct  164  EEAAKAIQMFDGALLGGRTARVNYPEVPRGGERRTVTMSGRRRDDGTYKIYAGNLGWGVR  223

Query  474  STHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIR  295
            +  LR +F      + ARV+FE  +G+S G+GFV+F T E+A+AA+ S+DG EL GRP+R
Sbjct  224  ADTLRNVFEGRAGLLDARVIFERETGRSRGFGFVSFSTAEDAQAALESLDGVELEGRPLR  283

Query  294  LKMSEKN  274
            L ++E+N
Sbjct  284  LSLAEQN  290


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELF-GQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQK  619
            K++  NL W +    ++ +F G+ G ++     + + G++RGF FV+ ++ E+A+AA++ 
Sbjct  212  KIYAGNLGWGVRADTLRNVFEGRAGLLDARVIFERETGRSRGFGFVSFSTAEDAQAALES  271

Query  618  FNSYELSGRTIRVEYSKKFKKP  553
             +  EL GR +R+  +++   P
Sbjct  272  LDGVELEGRPLRLSLAEQNPPP  293



>gb|ACJ85486.1| unknown [Medicago truncatula]
Length=213

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -3

Query  807  NLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAA  628
            N+++ L V NLPWSL+  D+K+LFGQCGTV DVE IK+K+G+ +G+ FVTM SGE A+AA
Sbjct  93   NVKKNLIVFNLPWSLSKPDIKDLFGQCGTVIDVEIIKSKDGKGKGYTFVTMDSGEGAQAA  152

Query  627  IQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFS  448
            + KFN+ E+SGR +RVE++K FKKP   PP P P++ RY +Y SNLAWKARSTHLR++F+
Sbjct  153  VDKFNATEISGRILRVEFAKGFKKPRPPPPAPTPKEARYVIYASNLAWKARSTHLRDIFT  212



>ref|XP_004955488.1| PREDICTED: 33 kDa ribonucleoprotein, chloroplastic-like [Setaria 
italica]
Length=339

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 110/178 (62%), Gaps = 4/178 (2%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            +LFV NLP++    ++ + F + G V+D + I  K   ++RGFAFVTMA+ EEA  AIQ 
Sbjct  112  RLFVGNLPYTFTSDELNDAFSEAGRVDDAQIIYDKVTNRSRGFAFVTMATAEEAAKAIQM  171

Query  618  FNSYELSGRTIRVEYSKKFKKPIRSpppppPR---DGRYKLYVSNLAWKARSTHLRELFS  448
            F+   L GRT RV Y +  +   R       R   DG YK+Y  NL W  R+  LR +F 
Sbjct  172  FDGALLGGRTARVNYPEVPRGGERRTVTMDGRRRDDGTYKIYAGNLGWGVRADALRSVFE  231

Query  447  ANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEKN  274
                 + ARV+FE  +G+S G+GFV+F T E+A+AA+ ++DG EL GRP+RL ++E+N
Sbjct  232  GQTGLLDARVIFERETGRSRGFGFVSFRTAEDAQAALEALDGVELEGRPLRLSLAEQN  289


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELF-GQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQK  619
            K++  NL W +    ++ +F GQ G ++     + + G++RGF FV+  + E+A+AA++ 
Sbjct  211  KIYAGNLGWGVRADALRSVFEGQTGLLDARVIFERETGRSRGFGFVSFRTAEDAQAALEA  270

Query  618  FNSYELSGRTIRVEYSKKFKKP  553
             +  EL GR +R+  +++   P
Sbjct  271  LDGVELEGRPLRLSLAEQNPPP  292



>ref|XP_010266776.1| PREDICTED: 30S ribosomal protein 2, chloroplastic [Nelumbo nucifera]
 ref|XP_010266785.1| PREDICTED: 30S ribosomal protein 2, chloroplastic [Nelumbo nucifera]
Length=302

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 114/180 (63%), Gaps = 8/180 (4%)
 Frame = -3

Query  804  LRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAI  625
            ++ +L   N+PW+    D++ LF + GTVEDVE     + +NRG AFVTM S EEA AA+
Sbjct  97   IQTRLIAQNVPWTCTSEDIRNLFEKHGTVEDVELSMHNKTRNRGLAFVTMGSEEEALAAL  156

Query  624  QKFNSYELSGRTIRVEYSKKFKK--PIRSpppppPRDGRYKLYVSNLAWKARSTHLRELF  451
                + E  GR ++V Y+K  KK   +R  P       ++ ++V NL+W+ RS  LRE F
Sbjct  157  TNLEAQEFQGRVLKVNYAKSLKKKPSVRPEPVI-----KHNVFVGNLSWRVRSRDLREFF  211

Query  450  -SANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEKN  274
             S   N +SA V+F++   KS GYGFV+F + EEAEAAIS+  G +L+GRP+RL +S+++
Sbjct  212  GSGTGNVVSAEVIFQSNPRKSTGYGFVSFSSPEEAEAAISAFSGKKLMGRPVRLALSKRD  271


 Score = 60.8 bits (146),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 52/86 (60%), Gaps = 2/86 (2%)
 Frame = -3

Query  816  PKPNLRRKLFVLNLPWSLAVSDVKELFGQ-CGTVEDVEFI-KTKEGQNRGFAFVTMASGE  643
            P+P ++  +FV NL W +   D++E FG   G V   E I ++   ++ G+ FV+ +S E
Sbjct  185  PEPVIKHNVFVGNLSWRVRSRDLREFFGSGTGNVVSAEVIFQSNPRKSTGYGFVSFSSPE  244

Query  642  EAEAAIQKFNSYELSGRTIRVEYSKK  565
            EAEAAI  F+  +L GR +R+  SK+
Sbjct  245  EAEAAISAFSGKKLMGRPVRLALSKR  270



>ref|XP_002285735.1| PREDICTED: 28 kDa ribonucleoprotein, chloroplastic [Vitis vinifera]
 ref|XP_010664354.1| PREDICTED: 28 kDa ribonucleoprotein, chloroplastic [Vitis vinifera]
 ref|XP_010664355.1| PREDICTED: 28 kDa ribonucleoprotein, chloroplastic [Vitis vinifera]
 emb|CBI19207.3| unnamed protein product [Vitis vinifera]
Length=294

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 112/180 (62%), Gaps = 10/180 (6%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            R +L   N+PW+    D++ LF + GTV DVE     + +NRG AF++M S EEA AA+ 
Sbjct  88   RTRLIAQNIPWTCTAQDIRSLFEKYGTVLDVELSMHNKTRNRGLAFISMGSPEEALAALS  147

Query  621  KFNSYELSGRTIRVEYSKKFKK----PIRSpppppPRDGRYKLYVSNLAWKARSTHLREL  454
               SYEL GR I+V Y+   KK    PI+  P  P     Y L+++NL ++AR+  LRE 
Sbjct  148  NLESYELEGRAIKVNYANPQKKKPSSPIQHKPVTP-----YNLFIANLPYQARAKDLREF  202

Query  453  FSA-NFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
            FS+ N N +SA V+F     +S+GYGFV+FG+KEEA+ A+SS  G   +GRP+R+  S +
Sbjct  203  FSSGNCNVVSAEVIFHENPRRSSGYGFVSFGSKEEADTALSSFQGQMFMGRPLRVARSRR  262


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 42/88 (48%), Gaps = 2/88 (2%)
 Frame = -3

Query  813  KPNLRRKLFVLNLPWSLAVSDVKELF--GQCGTVEDVEFIKTKEGQNRGFAFVTMASGEE  640
            KP     LF+ NLP+     D++E F  G C  V           ++ G+ FV+  S EE
Sbjct  178  KPVTPYNLFIANLPYQARAKDLREFFSSGNCNVVSAEVIFHENPRRSSGYGFVSFGSKEE  237

Query  639  AEAAIQKFNSYELSGRTIRVEYSKKFKK  556
            A+ A+  F      GR +RV  S++F K
Sbjct  238  ADTALSSFQGQMFMGRPLRVARSRRFVK  265



>emb|CAN61580.1| hypothetical protein VITISV_008033 [Vitis vinifera]
Length=294

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 112/180 (62%), Gaps = 10/180 (6%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            R +L   N+PW+    D++ LF + GTV DVE     + +NRG AF++M S EEA AA+ 
Sbjct  88   RTRLIAQNIPWTCTAQDIRSLFEKYGTVLDVELSMHNKTRNRGLAFISMGSPEEALAALS  147

Query  621  KFNSYELSGRTIRVEYSKKFKK----PIRSpppppPRDGRYKLYVSNLAWKARSTHLREL  454
               SYEL GR I+V Y+   KK    PI+  P  P     Y L+++NL ++AR+  LRE 
Sbjct  148  NLESYELEGRAIKVNYANPQKKKPSSPIQHKPVTP-----YNLFIANLPYQARAKDLREF  202

Query  453  FSA-NFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
            FS+ N N +SA V+F     +S+GYGFV+FG+KEEA+ A+SS  G   +GRP+R+  S +
Sbjct  203  FSSGNCNVVSAEVIFHENPRRSSGYGFVSFGSKEEADTALSSFQGQMFMGRPLRVARSRR  262


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 42/88 (48%), Gaps = 2/88 (2%)
 Frame = -3

Query  813  KPNLRRKLFVLNLPWSLAVSDVKELF--GQCGTVEDVEFIKTKEGQNRGFAFVTMASGEE  640
            KP     LF+ NLP+     D++E F  G C  V           ++ G+ FV+  S EE
Sbjct  178  KPVTPYNLFIANLPYQARAKDLREFFSSGNCNVVSAEVIFHENPRRSSGYGFVSFGSKEE  237

Query  639  AEAAIQKFNSYELSGRTIRVEYSKKFKK  556
            A+ A+  F      GR +RV  S++F K
Sbjct  238  ADTALSSFQGQMFMGRPLRVARSRRFVK  265



>ref|NP_001140274.1| ribonucleoprotein [Zea mays]
 gb|ACF83480.1| unknown [Zea mays]
 tpg|DAA59582.1| TPA: ribonucleoprotein [Zea mays]
Length=341

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 114/187 (61%), Gaps = 4/187 (2%)
 Frame = -3

Query  822  KTPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASG  646
            + P+ +   +LFV NLP++    ++ ++F + G V+D + I  K   ++RGFAFVTMA+ 
Sbjct  104  RPPRGDDPGRLFVGNLPYTYTSEELAQVFSEAGRVDDAQIIYDKVTNRSRGFAFVTMATA  163

Query  645  EEAEAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPR---DGRYKLYVSNLAWKAR  475
            EEA  AIQ F+   L GRT RV Y +  +   R       R   DG YK+Y  NL W  R
Sbjct  164  EEAAKAIQMFDGALLGGRTARVNYPEVPRGGERRTVTMSGRRRDDGTYKIYAGNLGWGVR  223

Query  474  STHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIR  295
            +  LR +F      + ARV+FE  +G+S G+GFV+F T E+A+AA+ S+DG EL GR +R
Sbjct  224  ADTLRNVFEGRAGLLDARVIFERETGRSRGFGFVSFSTAEDAQAALESLDGVELEGRSLR  283

Query  294  LKMSEKN  274
            L ++E+N
Sbjct  284  LSLAEQN  290


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELF-GQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQK  619
            K++  NL W +    ++ +F G+ G ++     + + G++RGF FV+ ++ E+A+AA++ 
Sbjct  212  KIYAGNLGWGVRADTLRNVFEGRAGLLDARVIFERETGRSRGFGFVSFSTAEDAQAALES  271

Query  618  FNSYELSGRTIRVEYSKKFKKP  553
             +  EL GR++R+  +++   P
Sbjct  272  LDGVELEGRSLRLSLAEQNPPP  293



>ref|XP_002461480.1| hypothetical protein SORBIDRAFT_02g003310 [Sorghum bicolor]
 gb|EER98001.1| hypothetical protein SORBIDRAFT_02g003310 [Sorghum bicolor]
Length=338

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 110/177 (62%), Gaps = 4/177 (2%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            +LFV NLP++    ++ ++F + G V+D + I  K   ++RGFAFVTMA+ EEA  AIQ 
Sbjct  111  RLFVGNLPYTYTSEELAQVFAEAGRVDDAQIIYDKVTNRSRGFAFVTMATAEEAAKAIQM  170

Query  618  FNSYELSGRTIRVEYSKKFKKPIRSpppppPR---DGRYKLYVSNLAWKARSTHLRELFS  448
            F+   L GRT RV Y +  +   R       R   DG YK+Y  NL W  R+  LR +F 
Sbjct  171  FDGALLGGRTARVNYPEVPRGGERRTVTMAGRRRDDGTYKIYAGNLGWGVRADTLRNVFE  230

Query  447  ANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
                 + ARV+FE  +G+S G+GFV+F T E+A+AA+ ++DG EL GRP+RL ++E+
Sbjct  231  GRAGLLDARVIFERETGRSRGFGFVSFRTAEDAQAALEALDGVELEGRPLRLSLAEQ  287



>ref|XP_008442686.1| PREDICTED: 29 kDa ribonucleoprotein, chloroplastic [Cucumis melo]
Length=276

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 111/181 (61%), Gaps = 6/181 (3%)
 Frame = -3

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAE  634
            P+L  KLFV NLP+S+  + +  LF   G VE VE I  K  G++RGF FVTM++ +E E
Sbjct  90   PDL--KLFVGNLPFSVDSAQLAGLFESAGQVERVEVIYDKTTGKSRGFGFVTMSTVDEVE  147

Query  633  AAIQKFNSYELSGRTIRVEYS---KKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHL  463
            AA Q+FN YEL GR++RV Y    K+   P R        D R +++VSNLAW      L
Sbjct  148  AAAQQFNGYELDGRSLRVNYGPPPKRDDSPFRGSRNASRFDNRNRVHVSNLAWGVDDLTL  207

Query  462  RELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
              LF  + N + A+VV++  SG+S G+GFV + + EE   AI S++G +L+GR IR+  +
Sbjct  208  ENLFREHGNVLEAKVVYDRDSGRSRGFGFVTYNSAEEVNNAIQSLNGVDLVGRSIRVTQA  267

Query  282  E  280
            E
Sbjct  268  E  268



>ref|XP_006658290.1| PREDICTED: 33 kDa ribonucleoprotein, chloroplastic-like, partial 
[Oryza brachyantha]
Length=344

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 111/181 (61%), Gaps = 7/181 (4%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            +LFV NLP+S+   ++ + F + G V++V+ I  K   ++RGFAFVTMA+ EEA  AIQ 
Sbjct  115  RLFVGNLPYSMTSGELSQAFSEAGRVDNVQIIYDKVTDRSRGFAFVTMATAEEATKAIQM  174

Query  618  FNSYELSGRTIRVEYSKKFKKPIRSpppppPR------DGRYKLYVSNLAWKARSTHLRE  457
            F+   L GRT RV + +  +   R+             DG YK+Y  NL W  R+  LR 
Sbjct  175  FDGALLGGRTARVNFPEVPRGGERTAAAAARGSSSRRDDGTYKIYAGNLGWSVRADSLRA  234

Query  456  LFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
             F      + ARV+FE  +G+S G+GFV+F T ++A+AA+ ++DG EL GRP+RL M+E+
Sbjct  235  AFEGRPGLLDARVIFERDTGRSRGFGFVSFATAQDAQAALEALDGVELEGRPLRLSMAEQ  294

Query  276  N  274
            N
Sbjct  295  N  295



>gb|KHF99254.1| 29 kDa ribonucleoprotein B, chloroplastic [Gossypium arboreum]
Length=290

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 116/174 (67%), Gaps = 2/174 (1%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQKF  616
            +L   N+PWS  V D++ LF + GTV DVE     + +NRG AFV+MAS EEA AA+   
Sbjct  89   RLIAQNVPWSCTVEDIRSLFEKYGTVVDVELSMHNKTRNRGLAFVSMASPEEALAALNNL  148

Query  615  NSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSAN-F  439
             SYEL GRT+R+ Y+K  KK    P  P P    + L+V+NL+++ R+ HL+E FS+   
Sbjct  149  ESYELEGRTLRLNYAKPKKKKAAPPEKPKPVPA-FNLFVANLSYEVRAKHLKEFFSSEGA  207

Query  438  NPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
            N +SA V+F ++  KS+GYGFV+F +K+EA+AA+SS  G   +GRPIR++ S +
Sbjct  208  NVVSAEVIFHDSPRKSSGYGFVSFKSKKEADAAMSSFQGKMFMGRPIRVQRSRQ  261



>ref|NP_001062073.1| Os08g0483200 [Oryza sativa Japonica Group]
 dbj|BAD09298.1| putative RNA-binding protein cp33 [Oryza sativa Japonica Group]
 dbj|BAF23987.1| Os08g0483200 [Oryza sativa Japonica Group]
 gb|EAZ07391.1| hypothetical protein OsI_29641 [Oryza sativa Indica Group]
 gb|EAZ43115.1| hypothetical protein OsJ_27706 [Oryza sativa Japonica Group]
 dbj|BAG90783.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92838.1| unnamed protein product [Oryza sativa Japonica Group]
Length=269

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 110/177 (62%), Gaps = 4/177 (2%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            R +L   N+PW     D++ LFG+ G+V DVE       +NRG AFVTM S EEA +A+ 
Sbjct  72   RTRLIAQNIPWDCTADDMRALFGKHGSVVDVELSMYNSTRNRGLAFVTMGSEEEALSALN  131

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSAN  442
              NS  L+ RTI+V++++  KK    P  P P   ++ ++V NL W+ RS HLRELF++ 
Sbjct  132  HLNSTTLNDRTIKVDFTRSRKKQYVVPSAPMP---KHSVFVGNLTWRVRSRHLRELFAST  188

Query  441  FNPISARVVFENASG-KSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEKN  274
                S  VVF   S  +SAGYGFV+F +KE AEAAIS+ +GT+L+GR I +   + N
Sbjct  189  PGVQSVEVVFHTTSPRRSAGYGFVSFSSKEAAEAAISTFNGTKLMGRSINVMFKDDN  245


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 45/81 (56%), Gaps = 2/81 (2%)
 Frame = -3

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVE--FIKTKEGQNRGFAFVTMASGEEA  637
            P  +  +FV NL W +    ++ELF     V+ VE  F  T   ++ G+ FV+ +S E A
Sbjct  161  PMPKHSVFVGNLTWRVRSRHLRELFASTPGVQSVEVVFHTTSPRRSAGYGFVSFSSKEAA  220

Query  636  EAAIQKFNSYELSGRTIRVEY  574
            EAAI  FN  +L GR+I V +
Sbjct  221  EAAISTFNGTKLMGRSINVMF  241



>ref|XP_010264653.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic-like [Nelumbo 
nucifera]
 ref|XP_010264654.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic-like [Nelumbo 
nucifera]
Length=274

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 113/181 (62%), Gaps = 6/181 (3%)
 Frame = -3

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAE  634
            P+L  KLFV NLP+S+  + +  LF Q G VE VE I  K  G++RGF FVTM++ EE E
Sbjct  89   PDL--KLFVGNLPFSVDSAKLAALFEQAGNVEMVEVIYDKITGRSRGFGFVTMSTVEEVE  146

Query  633  AAIQKFNSYELSGRTIRVEYSKKFKK---PIRSpppppPRDGRYKLYVSNLAWKARSTHL  463
            +A+Q+FN YEL GR +RV   +  ++   P R P      D  +++YV NL+W      L
Sbjct  147  SAVQQFNGYELQGRALRVNSGRPPRREDYPTRGPRGGASFDAPHRVYVGNLSWGVDDLAL  206

Query  462  RELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
              LFS     + A+VV++  SG+S G+GFV + + E+   AISS++G +L GRPIR+ M+
Sbjct  207  ETLFSEQGKVMEAKVVYDRESGRSRGFGFVTYSSAEDVNNAISSLNGADLNGRPIRVTMA  266

Query  282  E  280
            E
Sbjct  267  E  267



>gb|EAZ31815.1| hypothetical protein OsJ_15973 [Oryza sativa Japonica Group]
Length=234

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 106/128 (83%), Gaps = 2/128 (2%)
 Frame = -3

Query  672  FAFVTMASGEEAEAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSN  493
            FAFVTMA+ EEA AA++K NS ++ GRTIRVE+SK F+KP   PPP    + R+KLYVSN
Sbjct  65   FAFVTMATAEEAAAAVEKLNSLDVMGRTIRVEFSKSFRKPAPPPPPGTILE-RHKLYVSN  123

Query  492  LAWKARSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTEL  313
            L WKAR+ +++E FS  FNP+SA+VVF++ SGKSAGYGFV+FGTKEEAEAA++ +DG EL
Sbjct  124  LPWKARAPNMKEFFS-KFNPLSAKVVFDSPSGKSAGYGFVSFGTKEEAEAALTELDGKEL  182

Query  312  LGRPIRLK  289
            +GRP+RL+
Sbjct  183  MGRPVRLR  190


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            R KL+V NLPW     ++KE F +   +       +  G++ G+ FV+  + EEAEAA+ 
Sbjct  116  RHKLYVSNLPWKARAPNMKEFFSKFNPLSAKVVFDSPSGKSAGYGFVSFGTKEEAEAALT  175

Query  621  KFNSYELSGRTIRVEYSK  568
            + +  EL GR +R+ + +
Sbjct  176  ELDGKELMGRPVRLRWRQ  193



>ref|XP_006660227.1| PREDICTED: 33 kDa ribonucleoprotein, chloroplastic-like [Oryza 
brachyantha]
Length=352

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 112/178 (63%), Gaps = 6/178 (3%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            R +L   N+PW     D++ LFG+ G+V DVE       +NRG AFVTM S EEA +A+ 
Sbjct  155  RTRLIAQNIPWDCTADDMRALFGKHGSVVDVELSMYNSSRNRGLAFVTMGSEEEALSALN  214

Query  621  KFNSYELSGRTIRVEYSKKFKK-PIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSA  445
              NS  L+ RTI+V++++  KK P+    P P    ++ ++V NL W+ RS HLRELF++
Sbjct  215  NLNSTTLNDRTIKVDFARSRKKRPVVPSAPMP----KHSVFVGNLTWRVRSRHLRELFAS  270

Query  444  NFNPISARVVFENASG-KSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEKN  274
            N    S  V+F   S  +SAGYGFV+F +KE AEAAIS+ +GT+L+GR I +   + N
Sbjct  271  NPGLQSVEVIFHTTSPRRSAGYGFVSFSSKEAAEAAISTFNGTKLMGRSINVMFKDDN  328


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 48/91 (53%), Gaps = 2/91 (2%)
 Frame = -3

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFI--KTKEGQNRGFAFVTMASGEEA  637
            P  +  +FV NL W +    ++ELF     ++ VE I   T   ++ G+ FV+ +S E A
Sbjct  244  PMPKHSVFVGNLTWRVRSRHLRELFASNPGLQSVEVIFHTTSPRRSAGYGFVSFSSKEAA  303

Query  636  EAAIQKFNSYELSGRTIRVEYSKKFKKPIRS  544
            EAAI  FN  +L GR+I V +     K  +S
Sbjct  304  EAAISTFNGTKLMGRSINVMFKDDNAKKNKS  334



>ref|XP_004137828.1| PREDICTED: 29 kDa ribonucleoprotein, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004156563.1| PREDICTED: 29 kDa ribonucleoprotein, chloroplastic-like [Cucumis 
sativus]
 gb|KGN58963.1| hypothetical protein Csa_3G740070 [Cucumis sativus]
Length=278

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 107/182 (59%), Gaps = 7/182 (4%)
 Frame = -3

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAE  634
            P+L  KLFV NLP+++  + +  LF   G VE VE I  K  G++RGF FVTM++  E E
Sbjct  91   PDL--KLFVGNLPFTVDSAQLAGLFESAGQVERVEVIYDKTTGRSRGFGFVTMSTVGEVE  148

Query  633  AAIQKFNSYELSGRTIRVEYS----KKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTH  466
            AA Q+FN YEL GR +RV Y     K+     R        D R +++VSNLAW      
Sbjct  149  AAAQQFNGYELDGRLLRVNYGPPPPKRDDSSFRGSRNASRFDNRNRVHVSNLAWGVDDLT  208

Query  465  LRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKM  286
            L  LF    N + A+VV++  SGKS G+GFV + + EE   AI S+DG +L GRPIR+  
Sbjct  209  LENLFREKGNVLEAKVVYDRDSGKSRGFGFVTYNSAEEVNEAIQSLDGVDLDGRPIRVTQ  268

Query  285  SE  280
            +E
Sbjct  269  AE  270



>ref|XP_010253722.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic-like [Nelumbo 
nucifera]
Length=293

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 112/181 (62%), Gaps = 6/181 (3%)
 Frame = -3

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAE  634
            P+L  KLFV NLP+S+  + +  LF Q G VE VE I  K+ G++RGF FVTM++ EE E
Sbjct  108  PDL--KLFVGNLPFSVDSAGLAGLFEQAGNVEMVEVIYDKQTGRSRGFGFVTMSTVEEVE  165

Query  633  AAIQKFNSYELSGRTIRVEYSKKFKK---PIRSpppppPRDGRYKLYVSNLAWKARSTHL  463
            AA+Q+FN YEL GR IRV      +K     R        +  +++YV NL+W      L
Sbjct  166  AAVQQFNGYELEGRAIRVNSGPPPRKEEFSSRGSRGGTSFEAPHRVYVGNLSWGVDDLAL  225

Query  462  RELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
              LFS     + A+VV++  SG+S G+GFV + + E+ + AISS+DG +L GRPIR+ ++
Sbjct  226  ESLFSEQGKVMEAKVVYDRQSGRSKGFGFVTYSSAEDVDNAISSLDGADLNGRPIRVSVA  285

Query  282  E  280
            E
Sbjct  286  E  286



>ref|XP_010101007.1| 28 kDa ribonucleoprotein [Morus notabilis]
 gb|EXB86655.1| 28 kDa ribonucleoprotein [Morus notabilis]
Length=605

 Score =   148 bits (373),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 115/175 (66%), Gaps = 2/175 (1%)
 Frame = -3

Query  804  LRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAI  625
            L+ +L+  N+PW+    D++ LF + GTVEDVE     + +NRG AFVTM S EEA AA+
Sbjct  404  LKNRLYAQNVPWNCTPEDIRALFEKYGTVEDVELSMFNKTRNRGLAFVTMGSPEEALAAL  463

Query  624  QKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELF-S  448
                SYEL GR I+++Y++  KK + + P  P  +  + L+V+NL+++AR+  LRE F S
Sbjct  464  NNLQSYELDGRVIKIDYARLRKKKV-TTPMQPKPEVTFNLFVANLSFEARAKDLREFFNS  522

Query  447  ANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
               + +SA V+F     +S GYGFVAF +K+EAEAA+S++ G   +GRPIR+  S
Sbjct  523  EGHSVVSAEVIFHENPRRSLGYGFVAFKSKKEAEAALSAVQGKIFMGRPIRVARS  577



>ref|XP_004237950.1| PREDICTED: 28 kDa ribonucleoprotein, chloroplastic [Solanum lycopersicum]
 ref|XP_010320189.1| PREDICTED: 28 kDa ribonucleoprotein, chloroplastic [Solanum lycopersicum]
Length=278

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 116/178 (65%), Gaps = 2/178 (1%)
 Frame = -3

Query  807  NLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAA  628
            +L+R++   N PW+ + +D++ LF + GTVED+E     + ++RG  FVTM S EEA+A 
Sbjct  78   SLKRRVLAQNAPWTYSANDLRPLFEKYGTVEDIEVAMYNKTRSRGLVFVTMGSHEEAKAV  137

Query  627  IQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFS  448
            ++   +YEL GR +R+ ++K  K    S PPP      + L+V+NL ++ARS  L E F 
Sbjct  138  LENLEAYELEGRPLRLAWAKP-KTEKPSSPPPSKPLPIHNLFVANLHFEARSNDLLEFFK  196

Query  447  AN-FNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
            AN  N +SA V+F +   +SAGYGFV+  TKEEA+AA+SS DG E +GR IR+  S++
Sbjct  197  ANGANVVSAEVIFNDNPRRSAGYGFVSLNTKEEADAALSSFDGKEFMGRAIRVAQSKR  254



>ref|XP_006363306.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic-like [Solanum 
tuberosum]
Length=284

 Score =   142 bits (359),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 115/178 (65%), Gaps = 2/178 (1%)
 Frame = -3

Query  807  NLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAA  628
            +L+R++   N PW+   +D++ LF + GTVED+E     + ++RG  FVTM S EEA+A 
Sbjct  84   SLKRRVLAQNAPWTYTANDLRPLFEKYGTVEDIEVAMYNKTRSRGLVFVTMGSHEEAKAV  143

Query  627  IQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFS  448
            ++   +YEL GR +R+ ++K  K    S PPP      + L+V+NL ++ARS  L E F 
Sbjct  144  LENLEAYELEGRPLRLTWAKP-KIEKPSSPPPSKPLPIHNLFVANLHFEARSNDLLEFFK  202

Query  447  AN-FNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
            AN  N +SA V+F +   +SAGYGFV+  TKEEA+AA+SS DG E +GR IR+  S++
Sbjct  203  ANGANVVSAEVIFNDNPRRSAGYGFVSLNTKEEADAALSSFDGKEFMGRAIRVAQSKR  260



>ref|XP_003557582.1| PREDICTED: 33 kDa ribonucleoprotein, chloroplastic [Brachypodium 
distachyon]
Length=354

 Score =   144 bits (363),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 111/183 (61%), Gaps = 9/183 (5%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            +++V NLP++   +++  +F + G+V+DV+ I  K   ++RGFAFVTMA+ EEA  A+Q 
Sbjct  122  RIYVGNLPYTFTAAELTSVFSEAGSVDDVQIIYDKITDRSRGFAFVTMATAEEAAKAVQM  181

Query  618  FNSYELSGRTIRVEYSKKFKKPIRS--------pppppPRDGRYKLYVSNLAWKARSTHL  463
            FN   L GRTIRV + +  +   R+               DG YK+Y  NL W  R+  L
Sbjct  182  FNGALLGGRTIRVNFPEVPRGGERAVASAAAAKTSLRVVDDGTYKVYAGNLGWGVRADAL  241

Query  462  RELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
            +  F      + +RV+FE  +G+S G+GFV+F T E+A AAI ++DG EL GRP+RL ++
Sbjct  242  KTAFEGQPGLLGSRVIFERDTGRSRGFGFVSFQTLEDANAAIQAMDGVELDGRPLRLSLA  301

Query  282  EKN  274
             +N
Sbjct  302  SQN  304



>gb|EYU36476.1| hypothetical protein MIMGU_mgv1a011581mg [Erythranthe guttata]
Length=277

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 111/174 (64%), Gaps = 2/174 (1%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQKF  616
            +L + N+PW+    D++ L  + GTV D+EF    + +NRG AFVTM S EEA AA+   
Sbjct  86   RLLLQNVPWTCTADDIRPLVEKFGTVVDIEFSMYNKSRNRGLAFVTMGSHEEAVAALTSL  145

Query  615  NSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSA-NF  439
            NS E  GR +++ ++K  KK   S    P     + LYV+NL ++AR+  LR+ F+A N 
Sbjct  146  NSSEFEGRVLQLNWAKP-KKVKPSTVAEPKPLPVHNLYVTNLPFQARAKDLRDFFNADNA  204

Query  438  NPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
            N +SA ++F++   +SAGYGFV+F TK EAEAA+++  G E +GR IR+  S++
Sbjct  205  NVVSAEIIFQDTPRRSAGYGFVSFNTKAEAEAALTAFQGKEFMGRSIRVAFSKR  258


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 46/87 (53%), Gaps = 2/87 (2%)
 Frame = -3

Query  816  PKPNLRRKLFVLNLPWSLAVSDVKELF-GQCGTVEDVEFI-KTKEGQNRGFAFVTMASGE  643
            PKP     L+V NLP+     D+++ F      V   E I +    ++ G+ FV+  +  
Sbjct  173  PKPLPVHNLYVTNLPFQARAKDLRDFFNADNANVVSAEIIFQDTPRRSAGYGFVSFNTKA  232

Query  642  EAEAAIQKFNSYELSGRTIRVEYSKKF  562
            EAEAA+  F   E  GR+IRV +SK+F
Sbjct  233  EAEAALTAFQGKEFMGRSIRVAFSKRF  259



>ref|XP_007018692.1| RNA-binding family protein, putative [Theobroma cacao]
 gb|EOY15917.1| RNA-binding family protein, putative [Theobroma cacao]
Length=290

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 114/176 (65%), Gaps = 2/176 (1%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            + +L   N+PW+    D++ LF + GTV DVE     + +NRG AFV+MAS EEA AA+ 
Sbjct  85   KTRLIAQNVPWTCTTEDIRSLFEKYGTVVDVELSMHNKARNRGLAFVSMASPEEALAALN  144

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSAN  442
               SYE  GRT+R+ Y+K  KK   +PP  P     + L+V+NL+++AR+ HL+E FS+ 
Sbjct  145  NLESYEFEGRTLRLNYAKPKKK-RPAPPEKPKPVPAFNLFVANLSYEARAKHLKEFFSSE  203

Query  441  -FNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
              N +SA V+F     KS+GYGFV+F +K+EA+AA+S+  G   +GRPIR+  S +
Sbjct  204  GANVVSAEVIFHENPRKSSGYGFVSFKSKKEADAAMSAFQGKMFMGRPIRVARSRQ  259



>ref|XP_011077346.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic-like [Sesamum 
indicum]
Length=277

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 109/183 (60%), Gaps = 8/183 (4%)
 Frame = -3

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAE  634
            P+L  KLFV NLP+S+  + +  LF Q G V+ VE I  K  G++RGF FVTM++ EE E
Sbjct  90   PDL--KLFVGNLPFSVDSAGLAGLFEQAGNVQMVEVIYDKMSGRSRGFGFVTMSTIEEVE  147

Query  633  AAIQKFNSYELSGRTIRVEY----SKKFKKPIRSpppppPR-DGRYKLYVSNLAWKARST  469
            AA +KFN YEL GR +RV      SK+   P R  P      D   ++YV NLAW   + 
Sbjct  148  AAAEKFNGYELEGRVLRVNSGPPPSKRENSPFRGGPRGGTNSDNTNRVYVGNLAWGVDNL  207

Query  468  HLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLK  289
             L  LFS   N   ARVV++  SG+S G+GFV +   EE   AI S+DG +L GRPIR+ 
Sbjct  208  ALETLFSEQGNVKEARVVYDRESGRSRGFGFVTYSCAEEVNNAIESLDGVDLNGRPIRVS  267

Query  288  MSE  280
             +E
Sbjct  268  PAE  270



>emb|CDP20861.1| unnamed protein product [Coffea canephora]
Length=302

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 114/177 (64%), Gaps = 4/177 (2%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            + ++   N+PW+  V D++ LF + GTV D+E     + +NRG AFVTMAS EEA AA +
Sbjct  104  KTRILAQNVPWTSTVDDLRPLFEKYGTVVDIELSMYNKTRNRGLAFVTMASHEEALAAFR  163

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPRD-GRYKLYVSNLAWKARSTHLRELFSA  445
               SY+  GR +++ ++K   K I+   PP P+    + L+V+NL + AR+  L+E F+A
Sbjct  164  NLESYDYQGRVLKLNWAK--PKKIKPATPPKPKTLPIHNLFVANLHFAARAKDLKEFFNA  221

Query  444  NF-NPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
            N  N +SA ++FE+   +SAGYGFV+F TKEEAEAA+    G E +GRPIR+  S +
Sbjct  222  NNGNVVSAEIIFEDNPRRSAGYGFVSFNTKEEAEAALVGFKGKEFMGRPIRVARSRR  278


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 48/92 (52%), Gaps = 4/92 (4%)
 Frame = -3

Query  816  PKPNLR--RKLFVLNLPWSLAVSDVKELF-GQCGTVEDVEFI-KTKEGQNRGFAFVTMAS  649
            PKP       LFV NL ++    D+KE F    G V   E I +    ++ G+ FV+  +
Sbjct  191  PKPKTLPIHNLFVANLHFAARAKDLKEFFNANNGNVVSAEIIFEDNPRRSAGYGFVSFNT  250

Query  648  GEEAEAAIQKFNSYELSGRTIRVEYSKKFKKP  553
             EEAEAA+  F   E  GR IRV  S++F +P
Sbjct  251  KEEAEAALVGFKGKEFMGRPIRVARSRRFLRP  282



>gb|AAA79045.1| 24 kDa RNA binding protein, partial [Spinacia oleracea]
Length=220

 Score =   139 bits (349),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 111/179 (62%), Gaps = 4/179 (2%)
 Frame = -3

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAE  634
            P+L  K+FV NLP+++  +++  LFG  GTVE VE I  K  G++RGF FVTM+S EE E
Sbjct  36   PDL--KIFVGNLPFNVDSAELAGLFGAAGTVEMVEVIYDKLTGRSRGFGFVTMSSVEEVE  93

Query  633  AAIQKFNSYELSGRTIRV-EYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRE  457
            AA Q+FN+YEL GRT+RV E S K     R            +++V NL+WK     L+ 
Sbjct  94   AAAQQFNNYELDGRTLRVTEDSHKDMTLPRVESECDSFGSSNRVHVGNLSWKVDDDALKT  153

Query  456  LFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            LFS   + + A+V+++  +G+S G+GFV + +  E   AI S+DG +L GR IR+  +E
Sbjct  154  LFSETGDVVEAKVIYDRDTGRSRGFGFVTYNSANEVNTAIESLDGVDLNGRSIRVTAAE  212



>gb|KHN48430.1| 33 kDa ribonucleoprotein, chloroplastic [Glycine soja]
Length=275

 Score =   140 bits (352),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 77/193 (40%), Positives = 118/193 (61%), Gaps = 10/193 (5%)
 Frame = -3

Query  822  KTPKPNLRR-----KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFV  661
            + P+PN        +LFV NLP+SL  S + + FG+ G V  VE +      ++RGFAFV
Sbjct  75   QKPEPNASHTNQSSRLFVGNLPYSLLSSQLAQRFGEAGNVVSVEIVYDDIMDRSRGFAFV  134

Query  660  TMASGEEAEAAIQKFNSYELSGRTIRVEYS---KKFKKPIRSpppppPRDGRYKLYVSNL  490
            TM S E+AE AI+ F+  E+ GR ++V ++   K+ K+ +         D  +K+Y  NL
Sbjct  135  TMGSMEDAERAIRMFDGSEIGGRIMKVNFTAIPKRGKRLVMGSNYRGFVDSPHKIYAGNL  194

Query  489  AWKARSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELL  310
             W   S  LR+ F+     +SA+V++E  SG+S GYGFV+F T E+ EAA++S++G E+ 
Sbjct  195  GWGLTSQDLRDAFAEQPGFLSAKVIYERNSGRSRGYGFVSFETAEDVEAALNSMNGVEVQ  254

Query  309  GRPIRLKM-SEKN  274
            GRP+RL + ++KN
Sbjct  255  GRPLRLNLATDKN  267



>ref|NP_001058927.1| Os07g0158300 [Oryza sativa Japonica Group]
 dbj|BAC84331.1| putative RNA-binding protein [Oryza sativa Japonica Group]
 dbj|BAF20841.1| Os07g0158300 [Oryza sativa Japonica Group]
 gb|EAZ02828.1| hypothetical protein OsI_24955 [Oryza sativa Indica Group]
 dbj|BAG90394.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96944.1| unnamed protein product [Oryza sativa Japonica Group]
Length=348

 Score =   141 bits (356),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 111/181 (61%), Gaps = 7/181 (4%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            +LFV NLP+++   ++ + F + G V++V+ I  K   ++RGFAFVTMA+ EEA  AIQ 
Sbjct  119  RLFVGNLPYTMTSGEISQTFSEAGRVDNVQIIYDKVTDRSRGFAFVTMATAEEAATAIQM  178

Query  618  FNSYELSGRTIRVEYSKKFKKPIRSpppppP------RDGRYKLYVSNLAWKARSTHLRE  457
            FN   L GRT RV Y +  +   R+             DG +K+Y  NL W  R+  LR 
Sbjct  179  FNGALLGGRTARVNYPEVPRGGERAVGSAAATRENRRDDGTFKIYAGNLGWGVRADALRA  238

Query  456  LFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
             F      + ARV+FE  SG+S G+GFV+F T E+A+AA+ ++DG EL GRP+RL M+E+
Sbjct  239  AFEGQPGLLDARVIFERDSGRSRGFGFVSFRTAEDAQAALEALDGVELEGRPLRLSMAEQ  298

Query  276  N  274
            N
Sbjct  299  N  299



>ref|XP_004973720.1| PREDICTED: 28 kDa ribonucleoprotein, chloroplastic-like [Setaria 
italica]
Length=274

 Score =   139 bits (351),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 109/180 (61%), Gaps = 4/180 (2%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            R +L   N+PW     D++ LF + G+V  VE       +NRG AFVTM S EEA AA+ 
Sbjct  71   RTRLVAQNIPWDYTGDDMRALFEKHGSVVGVELSMYNASKNRGLAFVTMGSEEEALAALN  130

Query  621  KFNSYELSGRTIRVEYS---KKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELF  451
              NS  L  R I+V+++   KK  K ++ P        +Y L+V NL W+ R+ HLRELF
Sbjct  131  NLNSTTLDDRKIKVDFARPRKKQPKQVKQPVVVSDSTEKYILFVGNLTWRVRNRHLRELF  190

Query  450  SANFNPISARVVFENASG-KSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEKN  274
            ++    +SA V+F   +  +SAGY FV+F +KE AEAAISS++G +L+GRPI +   E++
Sbjct  191  ASAPGVLSAEVIFHTTTPRRSAGYAFVSFSSKEAAEAAISSLNGQKLMGRPINVMFKEES  250



>emb|CAA11894.1| cp33Hv [Hordeum vulgare subsp. vulgare]
Length=344

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 109/183 (60%), Gaps = 9/183 (5%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            +++V NLP++   +++   F + G+V+DV+ I  K   ++RGFAFVTMA+ EEA  A+Q 
Sbjct  109  RIYVGNLPYTFTAAELTAAFSEAGSVDDVQIIYDKITDRSRGFAFVTMATAEEAAKAVQM  168

Query  618  FNSYELSGRTIRVEYSK--------KFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHL  463
            FN   L GRT+RV + +             +         DG YK+Y  NL W  R+  L
Sbjct  169  FNGALLGGRTVRVNFPEVPRGGERAVASAAVARTSLRVVDDGTYKVYAGNLGWGVRADAL  228

Query  462  RELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
            +  F      + ARV+FE  +G+S G+GFV+F T ++A+AA+ ++DG EL GRP+RL ++
Sbjct  229  KTAFEGQPGLVGARVIFERDTGRSRGFGFVSFHTIQDAKAALQAMDGVELDGRPLRLSLA  288

Query  282  EKN  274
             +N
Sbjct  289  AQN  291



>dbj|BAJ87580.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=344

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 109/183 (60%), Gaps = 9/183 (5%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            +++V NLP++   +++   F + G+V+DV+ I  K   ++RGFAFVTMA+ EEA  A+Q 
Sbjct  109  RIYVGNLPYTFTAAELTAAFSEAGSVDDVQIIYDKITDRSRGFAFVTMATAEEAAKAVQM  168

Query  618  FNSYELSGRTIRVEYSK--------KFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHL  463
            FN   L GRT+RV + +             +         DG YK+Y  NL W  R+  L
Sbjct  169  FNGALLGGRTVRVNFPEVPRGGERAVASAAVARTSLRVVDDGTYKVYAGNLGWGVRADAL  228

Query  462  RELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
            +  F      + ARV+FE  +G+S G+GFV+F T ++A+AA+ ++DG EL GRP+RL ++
Sbjct  229  KTAFEGQPGLVGARVIFERDTGRSRGFGFVSFHTIQDAKAALQAMDGVELDGRPLRLSLA  288

Query  282  EKN  274
             +N
Sbjct  289  AQN  291



>ref|XP_008243948.1| PREDICTED: ribonucleoprotein At2g37220, chloroplastic [Prunus 
mume]
 ref|XP_008243949.1| PREDICTED: ribonucleoprotein At2g37220, chloroplastic [Prunus 
mume]
Length=276

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 107/181 (59%), Gaps = 6/181 (3%)
 Frame = -3

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAE  634
            P+L  KLFV NLP+S+  + +  LF   G VE VE I  K  G++RGF FVTM+S +EAE
Sbjct  91   PDL--KLFVGNLPFSVDSAQLAGLFESAGNVEMVEVIYDKTTGRSRGFGFVTMSSVQEAE  148

Query  633  AAIQKFNSYELSGRTIRVEYSK---KFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHL  463
             A ++ N YEL GR +RV Y     + +   R        D   +LYV NLAW   +  L
Sbjct  149  GAARQLNGYELDGRALRVNYGPPPPRSEDSFRGARGGGGSDSSNRLYVGNLAWGVDNLAL  208

Query  462  RELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
              LFS     + A+VV++  SG+S G+GFV +GT +E  +AI S+DG +L GR IR+  +
Sbjct  209  ENLFSEQGKVLEAKVVYDRDSGRSRGFGFVTYGTADEMNSAIESLDGVDLNGRSIRVTAA  268

Query  282  E  280
            E
Sbjct  269  E  269



>ref|XP_010675723.1| PREDICTED: 28 kDa ribonucleoprotein, chloroplastic [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010675731.1| PREDICTED: 28 kDa ribonucleoprotein, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=289

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 111/178 (62%), Gaps = 10/178 (6%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQKF  616
            +L   N+PW+    +++ LF   GTV DVE     + +NRG AFV M S EEA  A+ K 
Sbjct  82   RLLAQNVPWTATPDEIRALFQNYGTVVDVELSMHSKTRNRGLAFVEMGSVEEAAEALAKL  141

Query  615  NSYELSGRTIRVEYSK----KFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELF-  451
             S+E  GRT+R+ Y+K    K   P++S P        Y L+V+NL++ AR+  L+E F 
Sbjct  142  ESFEFEGRTLRLSYAKPKKEKVSPPVQSKPAVV-----YNLFVANLSFAARAKDLKEFFQ  196

Query  450  SANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
            SA  + +SA ++F     KS+GYGFV+F TK+EA+ A++S +G EL+GRPIR+  S++
Sbjct  197  SAGSDVVSAEIIFNENPRKSSGYGFVSFKTKKEADEALTSFEGKELMGRPIRVARSKR  254


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 52/101 (51%), Gaps = 3/101 (3%)
 Frame = -3

Query  813  KPNLRRKLFVLNLPWSLAVSDVKELFGQCGT-VEDVEFIKTKEG-QNRGFAFVTMASGEE  640
            KP +   LFV NL ++    D+KE F   G+ V   E I  +   ++ G+ FV+  + +E
Sbjct  170  KPAVVYNLFVANLSFAARAKDLKEFFQSAGSDVVSAEIIFNENPRKSSGYGFVSFKTKKE  229

Query  639  AEAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDG  517
            A+ A+  F   EL GR IRV  SK+F K + S       DG
Sbjct  230  ADEALTSFEGKELMGRPIRVARSKRFVK-LESEINTVSEDG  269



>ref|XP_004497644.1| PREDICTED: 33 kDa ribonucleoprotein, chloroplastic-like [Cicer 
arietinum]
Length=313

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 111/182 (61%), Gaps = 4/182 (2%)
 Frame = -3

Query  807  NLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEA  631
            N   +LFV NLP+SL+ S + ELFG+ G V  VE +      ++RGFAFVTM + E+AE 
Sbjct  104  NQSTRLFVGNLPFSLSSSQLAELFGEAGNVLSVEIVYDDFTDRSRGFAFVTMGNVEDAEE  163

Query  630  AIQKFNSYELSGRTIRV---EYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLR  460
            AI+ F+  ++ GR I+V   E  K  KK ++        D  +KLY  NL W   S  LR
Sbjct  164  AIRMFDGTKVGGRVIKVNFPEVPKVGKKALKGSNYRGYVDSPHKLYAGNLGWDLTSKDLR  223

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            + F+     +SA+VV+E  + KS GYGFV+F T ++ EAA++++ G E+ GRP+RL ++ 
Sbjct  224  KAFAKQPGLLSAKVVYERHNAKSRGYGFVSFETADDVEAALNAMSGVEVQGRPLRLNLAA  283

Query  279  KN  274
             N
Sbjct  284  DN  285



>ref|XP_003590324.1| 33 kDa ribonucleoprotein [Medicago truncatula]
 gb|AES60575.1| RNA recognition motif [Medicago truncatula]
Length=311

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 111/179 (62%), Gaps = 4/179 (2%)
 Frame = -3

Query  798  RKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQ  622
            R+LFV NLP+SL+ S + +LFG+ G V  VE +      ++RGFAFVTM + E+AE AI+
Sbjct  108  RRLFVGNLPFSLSSSQLAQLFGEAGNVVSVEILYDDITNRSRGFAFVTMGNVEDAEEAIR  167

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPR---DGRYKLYVSNLAWKARSTHLRELF  451
             F+   + GR I+V + +      R       R   D  +K+Y  NL W   S +LR+ F
Sbjct  168  MFDGTTVGGRAIKVNFPEVPIVGKRVQMGSTYRGYVDSPHKIYAGNLGWDMTSQYLRKAF  227

Query  450  SANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEKN  274
            +     +SA+VV+E  +GKS GYGFV+F T E+ E A+S+++G E+ GRP+RLK++  N
Sbjct  228  AKQPGLLSAKVVYERNNGKSRGYGFVSFETAEDVEVALSAMNGVEVQGRPLRLKLAVDN  286



>gb|ACR36437.1| unknown [Zea mays]
Length=262

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 109/173 (63%), Gaps = 1/173 (1%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            ++FV NLP+S+  + +  LF Q G+VE VE I  K  G++RGF FVTM+S EE E A+ +
Sbjct  82   RVFVGNLPFSVDSAQLAGLFEQAGSVEMVEVIYDKLTGRSRGFGFVTMSSVEEVEVAVDQ  141

Query  618  FNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSANF  439
            FN Y L GR++RV       +   S  P  PR    ++YV NL+W   ++ L  LFS   
Sbjct  142  FNGYVLDGRSLRVNSGPPPPRDRSSRSPQRPRGDANRVYVGNLSWGVDNSALANLFSEQG  201

Query  438  NPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
              + AR++++  SG+S G+GFV +G+ EE E AIS++DG +L GR IR+ ++E
Sbjct  202  EVLEARIIYDRESGRSRGFGFVTYGSAEEVENAISNLDGADLDGRQIRVTVAE  254



>ref|XP_002465205.1| hypothetical protein SORBIDRAFT_01g034120 [Sorghum bicolor]
 gb|EER92203.1| hypothetical protein SORBIDRAFT_01g034120 [Sorghum bicolor]
Length=262

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 110/173 (64%), Gaps = 3/173 (2%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            ++FV NLP+S+  + +  LF Q G+VE VE I  K  G++RGF FVTM+S +E EAA+++
Sbjct  84   RVFVGNLPFSVDSAQLAGLFEQAGSVEMVEVIYDKLTGRSRGFGFVTMSSVQEVEAAVEQ  143

Query  618  FNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSANF  439
            FN Y L GR++RV        P        PR    ++YV NL+W   ++ L  LFS   
Sbjct  144  FNGYVLDGRSLRVNSGPP--PPRDPSSQRGPRGDANRVYVGNLSWGVDNSALANLFSEQG  201

Query  438  NPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
              + AR+V++  SG+S G+GFV +G+ EE E AIS++DG++L GR IR+ ++E
Sbjct  202  EVLEARIVYDRESGRSRGFGFVTYGSAEEVENAISNLDGSDLDGRQIRVTVAE  254



>gb|KHG00077.1| 29 kDa ribonucleoprotein A, chloroplastic [Gossypium arboreum]
Length=279

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 108/183 (59%), Gaps = 10/183 (5%)
 Frame = -3

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAE  634
            P+L  KLFV NLP+S+  + +  LFG  G V+ VE I  K  G++RGF FVTM++ EE E
Sbjct  94   PDL--KLFVGNLPFSVDSAQLAGLFGSAGNVQMVEVIYDKVTGRSRGFGFVTMSTTEEVE  151

Query  633  AAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRY-----KLYVSNLAWKARST  469
            AA Q+FN YEL GR +RV        P R    P  R G       ++YV NL+W     
Sbjct  152  AAAQQFNGYELEGRALRVNSGPP--PPRREEFSPRARGGSTMGASNRVYVGNLSWGVDDL  209

Query  468  HLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLK  289
             L  LFS     + A+VV++  SG+S G+GFV + + EE + A+ + +G EL GRPIR+ 
Sbjct  210  ALETLFSEQGKVVEAKVVYDRESGRSRGFGFVTYNSSEEVDGAVKTFNGVELDGRPIRVS  269

Query  288  MSE  280
            ++E
Sbjct  270  VAE  272



>gb|EPS60671.1| hypothetical protein M569_14131, partial [Genlisea aurea]
Length=213

 Score =   135 bits (341),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 110/179 (61%), Gaps = 7/179 (4%)
 Frame = -3

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAE  634
            P+L  KL+V NLP+++  + +  LF Q G VE VE I  KE G++RGF FVTM++  EAE
Sbjct  33   PDL--KLYVGNLPFNVDSATLAGLFEQAGNVEMVEVIYDKESGRSRGFGFVTMSTIREAE  90

Query  633  AAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGR-YKLYVSNLAWKARSTHLRE  457
             A Q+FN YE  GR +RV        P R+    PPR     K++V NLAW    + L  
Sbjct  91   TAAQQFNGYEYQGRALRVNAGPP---PPRNNNEAPPRSSSSNKVHVGNLAWGVDDSALEA  147

Query  456  LFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            LFS   +   A VV++  SG+S G+GFV +G++EE   AI S+DGT+L GRPIR+  +E
Sbjct  148  LFSEQGDVKEATVVYDRESGRSRGFGFVTYGSREEVNNAIRSLDGTDLNGRPIRVSAAE  206



>ref|XP_007205644.1| hypothetical protein PRUPE_ppa009295mg [Prunus persica]
 gb|EMJ06843.1| hypothetical protein PRUPE_ppa009295mg [Prunus persica]
Length=298

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 107/181 (59%), Gaps = 6/181 (3%)
 Frame = -3

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAE  634
            P+L  KLFV NLP+S+  + +  LF   G VE VE I  K  G++RGF FVTM+S +EAE
Sbjct  113  PDL--KLFVGNLPFSVDSAQLAGLFESAGNVEMVEVIYDKTTGRSRGFGFVTMSSVQEAE  170

Query  633  AAIQKFNSYELSGRTIRVEYSK---KFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHL  463
             A ++ N YEL GR +RV Y     + +   R        D   +LYV NLAW   +  L
Sbjct  171  GAARQLNGYELDGRALRVNYGPPPPRSEDSFRGARGGGGSDSSNRLYVGNLAWGVDNLAL  230

Query  462  RELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
              LFS     + A+VV++  SG+S G+GFV +GT +E  +A+ S+DG +L GR IR+  +
Sbjct  231  ENLFSEQGKVLEAKVVYDRDSGRSRGFGFVTYGTADEMNSAMESLDGVDLNGRSIRVTAA  290

Query  282  E  280
            E
Sbjct  291  E  291



>gb|EMS58171.1| 33 kDa ribonucleoprotein, chloroplastic [Triticum urartu]
Length=357

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 108/183 (59%), Gaps = 9/183 (5%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            +++V NLP++   +++   F + G+V+DV+ I  K   ++RGFAFVTMA+ EEA  A+Q 
Sbjct  114  RIYVGNLPYTFTAAELTAAFSEAGSVDDVQIIYDKITDRSRGFAFVTMATAEEAAKAVQM  173

Query  618  FNSYELSGRTIRVEYSK--------KFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHL  463
            FN   L GRT+RV + +             +         DG YK+Y  NL W  R+  L
Sbjct  174  FNGALLGGRTVRVNFPEVPRGGERAVASAAVARTSLRVVDDGTYKVYAGNLGWGVRADAL  233

Query  462  RELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
            +  F      + ARV+FE  +G+S G+GFV+F T E+A+A + ++DG EL GRP+RL ++
Sbjct  234  KTAFERQPGLVGARVIFERDTGRSRGFGFVSFQTIEDAKAVLQAMDGVELDGRPLRLSLA  293

Query  282  EKN  274
             +N
Sbjct  294  AQN  296



>ref|NP_001148607.1| ribonucleoprotein A precursor [Zea mays]
 gb|ACG32214.1| ribonucleoprotein A [Zea mays]
Length=264

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 110/173 (64%), Gaps = 1/173 (1%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            ++FV NLP+S+  + +  LF Q G+VE VE I  K  G++RGF FVTM+S EE E A+ +
Sbjct  84   RVFVGNLPFSVDSAQLAGLFEQAGSVEMVEVIYDKLTGRSRGFGFVTMSSVEEVEVAVDQ  143

Query  618  FNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSANF  439
            FN Y L GR++RV       +   SP P  PR    ++YV NL+W   ++ L  LFS   
Sbjct  144  FNGYVLDGRSLRVNSGPPPPRDRSSPSPQRPRGDANRVYVGNLSWGVDNSALANLFSEQG  203

Query  438  NPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
              + AR++++  SG+S G+GFV +G+ EE E AIS++DG +L GR IR+ ++E
Sbjct  204  EVLEARIIYDRESGRSRGFGFVTYGSAEEVENAISNLDGADLDGRQIRVTVAE  256



>ref|XP_004304439.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=277

 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 109/190 (57%), Gaps = 18/190 (9%)
 Frame = -3

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAE  634
            P+L  KLFV NLP+++  + + ELF   G VE VE I  K  G++RGF FVTM+S +E E
Sbjct  85   PDL--KLFVGNLPFTVDSAQLAELFEGAGNVEMVEVIYDKTTGRSRGFGFVTMSSAQEVE  142

Query  633  AAIQKFNSYELSGRTIRVEYSKKFKKPIRSppp------------ppPRDGRYKLYVSNL  490
            AA ++FN YEL GR +RV Y      P R+                   D   +LYV NL
Sbjct  143  AAARQFNGYELDGRALRVNYGPP---PPRTEDSFRGARGGSPRGGGGYGDSSNRLYVGNL  199

Query  489  AWKARSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELL  310
            AW   +  L  LF+     + A+VVF+  SG+S G+GFV +G+ EE  +AI S+DG +L 
Sbjct  200  AWGVDNLALENLFNEQGKVLEAKVVFDRDSGRSRGFGFVTYGSAEEMNSAIESLDGVDLG  259

Query  309  GRPIRLKMSE  280
            GR IR+  +E
Sbjct  260  GRSIRVTAAE  269



>gb|ACO71288.1| cp31BHv [Triticum aestivum]
Length=170

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 109/173 (63%), Gaps = 11/173 (6%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAEAAIQK  619
            K++V NLP+ +    + +LF Q G VE  E I  +E GQ+RGF FVTM++ EEA+ AI+ 
Sbjct  4    KVYVGNLPYDVDSERLAQLFDQAGVVEVAEVIYNRESGQSRGFGFVTMSTIEEADKAIET  63

Query  618  FNSYELSGRTIRV----EYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELF  451
            FN Y++SGR + V    +   + ++P R           ++ YV NL W+A  + L +LF
Sbjct  64   FNRYDISGRLLNVNRAAQRGSRVERPPRQFASS------FRAYVGNLPWQAEDSRLVQLF  117

Query  450  SANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRL  292
            S +   ++A VV++  +G+S G+GFV   +KE+ ++AIS++DG E+ GRP+R+
Sbjct  118  SEHGEVVNATVVYDRETGRSRGFGFVTMASKEDLDSAISALDGQEMDGRPLRV  170



>ref|XP_006433910.1| hypothetical protein CICLE_v10001605mg [Citrus clementina]
 gb|ESR47150.1| hypothetical protein CICLE_v10001605mg [Citrus clementina]
Length=363

 Score =   139 bits (350),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 112/180 (62%), Gaps = 10/180 (6%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            + +L   N+PW+    D++ LF Q GTV DVE     + +NRG AFVTM S +EA AA+ 
Sbjct  157  KTRLVAQNVPWTSTHEDIRALFEQHGTVLDVELSMHSKNRNRGLAFVTMGSPDEATAALN  216

Query  621  KFNSYELSGRTIRVEYSKKFKK----PIRSpppppPRDGRYKLYVSNLAWKARSTHLREL  454
               SYE  GRT++V Y+K  KK    P++  P        + L+++NL+++AR+  LRE 
Sbjct  217  NLESYEFEGRTLKVNYAKIKKKNPFPPVQPKPF-----ATFNLFIANLSFEARAKDLREF  271

Query  453  F-SANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
            F S  ++ +SA V+F +   +SAGYGFV+F +K+ AEAAIS+  G   +GRP+R+  S +
Sbjct  272  FISEGWDVVSAEVIFHDNPRRSAGYGFVSFKSKKVAEAAISAFQGKLFMGRPLRVAPSRQ  331



>tpg|DAA45554.1| TPA: ribonucleoprotein A [Zea mays]
Length=262

 Score =   136 bits (343),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 110/173 (64%), Gaps = 1/173 (1%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            ++FV NLP+S+  + +  LF Q G+VE VE I  K  G++RGF FVTM+S EE E A+ +
Sbjct  82   RVFVGNLPFSVDSAQLAGLFEQAGSVEMVEVIYDKLTGRSRGFGFVTMSSVEEVEVAVDQ  141

Query  618  FNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSANF  439
            FN Y L GR++RV       +   SP P  PR    ++YV NL+W   ++ L  LFS   
Sbjct  142  FNGYVLDGRSLRVNSGPPPPRDRSSPSPQRPRGDANRVYVGNLSWGVDNSALANLFSEQG  201

Query  438  NPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
              + AR++++  SG+S G+GFV +G+ EE E AIS++DG +L GR IR+ ++E
Sbjct  202  EVLEARIIYDRESGRSRGFGFVTYGSAEEVENAISNLDGADLDGRQIRVTVAE  254



>gb|ABR26075.1| chloroplast 29 kDa ribonucleoprotein [Oryza sativa Indica Group]
Length=205

 Score =   135 bits (339),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 107/177 (60%), Gaps = 5/177 (3%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAEAAIQK  619
            K+FV NLP+S+  + +  LF Q G+VE VE +  ++ G++RGF FVTM++ EEA AAI++
Sbjct  22   KVFVGNLPFSVDSAQLAGLFEQAGSVEMVEVVYDRQTGRSRGFGFVTMSTAEEAGAAIEQ  81

Query  618  FNSYELSGRTIRVEYS----KKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELF  451
            FN Y   GR +RV       +    P          D   KLYV NLAW   ++ L  LF
Sbjct  82   FNGYTFQGRPLRVNSGPPPPRDDFAPRSPRGGGSNFDSSNKLYVGNLAWGVDNSTLENLF  141

Query  450  SANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            S     + A+V+++  SG+S G+GFV +G+ EE   AIS++DG +L GR IR+ ++E
Sbjct  142  SEQGTVLDAKVIYDRESGRSRGFGFVTYGSAEEVNNAISNLDGVDLDGRQIRVTVAE  198



>gb|ABK26841.1| unknown [Picea sitchensis]
Length=347

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 114/178 (64%), Gaps = 7/178 (4%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAEAAIQK  619
            KL+V NLP+ +    + ++F + G VE VE I  +  G++RGFAFVTM++ EEAEAAI+K
Sbjct  160  KLYVGNLPFDIDSEGLAKMFDESGVVEMVEVIYDRSSGRSRGFAFVTMSTVEEAEAAIKK  219

Query  618  FNSYELSGRTIRVEYS-----KKFKKPIRSpppppP-RDGRYKLYVSNLAWKARSTHLRE  457
            FN +E+ GR++RV +      +  + P RSP       D  +K+YV NLAW   S  LRE
Sbjct  220  FNGFEIDGRSLRVNFPEVPRLQNGRSPARSPSNFGGFVDSPHKVYVGNLAWSVTSETLRE  279

Query  456  LFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
              +   N + A+V+ +  +G+S G+GFV+F ++ E EAA+S +DG E+ GR IR+ ++
Sbjct  280  ALNGKGNVLGAKVIQDRETGRSRGFGFVSFSSEAEVEAAVSEMDGLEVEGRSIRVNVA  337



>ref|XP_006650133.1| PREDICTED: ribonucleoprotein At2g37220, chloroplastic-like [Oryza 
brachyantha]
Length=262

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 110/173 (64%), Gaps = 3/173 (2%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            ++FV NLP+S+  + +  LF Q G+VE VE I  K  G++RGF FVTM++ EE EAA+++
Sbjct  84   RVFVGNLPFSVDSAQLAGLFEQAGSVEMVEVIYDKLTGRSRGFGFVTMSTVEEVEAAVEQ  143

Query  618  FNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSANF  439
            FN + L GR++RV        P     P  PR    ++YV NL+W   +  L  LFS   
Sbjct  144  FNGHILDGRSLRVNSGPP--PPREQSSPRAPRGEANRVYVGNLSWGVDNAALANLFSGEG  201

Query  438  NPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
              + AR++++  SG+S G+GFV +G+ EE E A+S++DGT+L GR IR+ ++E
Sbjct  202  EVLEARIIYDRESGRSRGFGFVTYGSAEEVENAVSNLDGTDLDGRQIRVTVAE  254



>ref|XP_006658862.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic-like, partial 
[Oryza brachyantha]
Length=211

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 111/179 (62%), Gaps = 9/179 (5%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAEAAIQK  619
            K+FV NLP+S+  + +  LF Q G+VE VE +  ++ G++RGF FVTM+S EEA AA+++
Sbjct  28   KVFVGNLPFSVDSAQLAGLFEQAGSVEMVEVVYDRQTGRSRGFGFVTMSSSEEAGAAVEQ  87

Query  618  FNSYELSGRTIRVEYS-----KKFK-KPIRSpppppPRDGRYKLYVSNLAWKARSTHLRE  457
            FN Y   GR +RV         +F  +P R        D   K+YV NL+W   ++ L  
Sbjct  88   FNGYTFQGRPLRVNSGPPPARDEFSPRPPRGGGNNF--DSSNKVYVGNLSWGVDNSTLEN  145

Query  456  LFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            LFS   N + A+V+++  SG+S G+GFV +G+ EE   AIS++DG +L GR IR+ ++E
Sbjct  146  LFSEQGNVLDAKVIYDRESGRSRGFGFVTYGSAEEVTNAISNLDGVDLDGRQIRVTVAE  204



>gb|ABK22250.1| unknown [Picea sitchensis]
Length=355

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 114/178 (64%), Gaps = 7/178 (4%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAEAAIQK  619
            KL+V NLP+ +    + ++F + G VE VE I  +  G++RGFAFVTM++ EEAEAAI+K
Sbjct  168  KLYVGNLPFDIDSEGLAKMFDESGVVEMVEVIYDRSSGRSRGFAFVTMSTVEEAEAAIKK  227

Query  618  FNSYELSGRTIRVEYS-----KKFKKPIRSpppppP-RDGRYKLYVSNLAWKARSTHLRE  457
            FN +E+ GR++RV +      +  + P RSP       D  +K+YV NLAW   S  LRE
Sbjct  228  FNGFEIDGRSLRVNFPEVPRLQNGRSPARSPSNFGGFVDSPHKVYVGNLAWSVTSETLRE  287

Query  456  LFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
              +   N + A+V+ +  +G+S G+GFV+F ++ E EAA+S +DG E+ GR IR+ ++
Sbjct  288  ALNGKGNVLGAKVIQDRETGRSRGFGFVSFSSEAEVEAAVSEMDGLEVEGRSIRVNVA  345



>ref|XP_009387302.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=275

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 109/181 (60%), Gaps = 6/181 (3%)
 Frame = -3

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAE  634
            P+L  KLFV NLP+S   S +  LF + G VE VE I  K+ G++RGF FVTM++ EE E
Sbjct  90   PDL--KLFVGNLPFSFDSSQLAGLFQRAGNVEMVEVIYDKQTGKSRGFGFVTMSTVEEVE  147

Query  633  AAIQKFNSYELSGRTIRVEYS---KKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHL  463
            AA Q+FN Y L GR +RV      +K + P R        D   ++YV NL+W      L
Sbjct  148  AATQQFNGYTLEGRPLRVNSGPPPRKDEFPSRGFRAGGNLDMANRVYVGNLSWGIDDLAL  207

Query  462  RELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
              LFS     + A+VV++  SG+S G+GFV + + EE E AI S++GT+L GR IR+ ++
Sbjct  208  ETLFSEQGKVLEAKVVYDRESGRSRGFGFVTYSSAEEVENAIQSLNGTDLDGRSIRVTVA  267

Query  282  E  280
            E
Sbjct  268  E  268



>ref|XP_003535181.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic [Glycine 
max]
Length=275

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 89/246 (36%), Positives = 136/246 (55%), Gaps = 21/246 (9%)
 Frame = -3

Query  975  LQISPNYPTLSLKSLMRSLPSLASTKLKTSHILRCStveeqavvaveteqEKTPKPNLRR  796
            L ++PN   +S+ ++     +L+S++    H++  S+   Q           +  P+L  
Sbjct  31   LSLTPNNKPISISAVFLKPTTLSSSRF-VPHVV-VSSDLGQEEDTFSDGDGPSFSPDL--  86

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAEAAIQK  619
            KLFV NLP+++  + + ELF   G VE VE I  K  G++RGF FVTM+S EEAEAA Q+
Sbjct  87   KLFVGNLPFNVDSAQLAELFESAGNVEVVEVIYDKTTGRSRGFGFVTMSSVEEAEAAAQQ  146

Query  618  FNSYELSGRTIRVEYSKKFKKPIRSpppppPR-------------DGRYKLYVSNLAWKA  478
            FN YEL GR +RV        P R+   P  R             D   +++VSNLAW  
Sbjct  147  FNGYELDGRALRVNSGPP---PARNESAPRFRGGSSFGSRGGGPSDSENRVHVSNLAWGV  203

Query  477  RSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPI  298
             +  L+ LF    N + ARV+++  SG+S G+GFV F + +E  +AI S++G +L GR I
Sbjct  204  DNVALKSLFREQGNVLEARVIYDRESGRSRGFGFVTFSSPDEVNSAIQSLNGVDLNGRAI  263

Query  297  RLKMSE  280
            R+ +++
Sbjct  264  RVSLAD  269



>dbj|BAK08134.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=283

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 114/184 (62%), Gaps = 11/184 (6%)
 Frame = -3

Query  819  TPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGE  643
            T +P    K++V NLP+ +    + +LF Q G VE  E I  +E GQ+RGF FVTM++ E
Sbjct  98   TAEPPEEAKVYVGNLPYDVDSERLAQLFDQAGVVEVAEVIYNRESGQSRGFGFVTMSTIE  157

Query  642  EAEAAIQKFNSYELSGRTIRV----EYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKAR  475
            EA+ AI+ FN Y++SGR + V    +   + ++P R           ++ YV NL W+A 
Sbjct  158  EADKAIETFNRYDISGRLLNVNRAAQRGSRVERPPRQFASS------FRAYVGNLPWQAE  211

Query  474  STHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIR  295
             + L ++FS +   ++A +V++  +G+S G+GFV   +KE+ ++AIS++DG E+ GRP+R
Sbjct  212  DSRLVQMFSEHGEVVNATIVYDRETGRSRGFGFVTMASKEDLDSAISALDGQEMDGRPLR  271

Query  294  LKMS  283
            + ++
Sbjct  272  VNVA  275



>ref|XP_002445992.1| hypothetical protein SORBIDRAFT_07g029220 [Sorghum bicolor]
 gb|EES15487.1| hypothetical protein SORBIDRAFT_07g029220 [Sorghum bicolor]
Length=266

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 107/177 (60%), Gaps = 1/177 (1%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            R +L   N+PW     +++ LF   G+V  VE       +NRG AFVTM S E+A AA+ 
Sbjct  71   RTRLVAQNIPWDSTADEMRALFQTHGSVVGVELSMYSASKNRGLAFVTMGSEEDALAALT  130

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSAN  442
              NS  L+ R I+V++++  KK  + P        +Y ++V NL W+ R+ HLRELF++ 
Sbjct  131  HLNSTILNDRKIKVDFARPRKKQPKQPVVVSNPMEKYIVFVGNLTWRVRNRHLRELFASA  190

Query  441  FNPISARVVFENASG-KSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEKN  274
               ISA V+F   +  +SAGY FV+F +KE AEAAIS+ +G  L+GRPI + + ++N
Sbjct  191  PGVISAEVIFHTTTPRRSAGYAFVSFSSKETAEAAISAFNGKILMGRPINVMLKDEN  247



>emb|CAA11893.1| cp31BHv [Hordeum vulgare subsp. vulgare]
Length=283

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 113/184 (61%), Gaps = 11/184 (6%)
 Frame = -3

Query  819  TPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGE  643
            T +P    K++V NLP+ +    + +LF Q G VE  E I  KE GQ+RGF FVTM++ E
Sbjct  98   TAEPPEEAKVYVGNLPYDVDSERLAQLFDQAGVVEVAEVIYNKESGQSRGFGFVTMSTIE  157

Query  642  EAEAAIQKFNSYELSGRTIRV----EYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKAR  475
            EA+ AI+ FN Y +SGR + V    +   + ++P R           ++ YV NL W+A 
Sbjct  158  EADKAIETFNRYNISGRLLNVNRAAQRGSRVERPPRQFASS------FRAYVGNLPWQAE  211

Query  474  STHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIR  295
             + L ++FS +   ++A +V++  +G+S G+GFV   +KE+ ++AIS++DG E+ GRP+R
Sbjct  212  DSRLVQMFSEHGEVVNATIVYDRETGRSRGFGFVTMASKEDLDSAISALDGQEMDGRPLR  271

Query  294  LKMS  283
            + ++
Sbjct  272  VNVA  275



>ref|XP_003574918.1| PREDICTED: 28 kDa ribonucleoprotein, chloroplastic-like [Brachypodium 
distachyon]
Length=286

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 111/181 (61%), Gaps = 11/181 (6%)
 Frame = -3

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAE  634
            P    K++V NLP+ +    + +LF Q G VE  E I  +E GQ+RGF FVTM++ EEA+
Sbjct  104  PPEEAKVYVGNLPYDVDSERLAQLFDQAGVVEVAEVIYNRESGQSRGFGFVTMSTIEEAD  163

Query  633  AAIQKFNSYELSGRTIRV----EYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTH  466
             AI+ FN Y++SGR + V    +   + ++P R           ++ YV NL W+A  + 
Sbjct  164  KAIEMFNRYDISGRLLNVNRAAQRGSRVERPPRQFASA------FRAYVGNLPWQAEDSR  217

Query  465  LRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKM  286
            L +LFS +   ++A VV++  +G+S G+GFV   +KEE + AIS++DG EL GRP+R+ +
Sbjct  218  LVQLFSEHGEVLNATVVYDRETGRSRGFGFVTMASKEELDDAISALDGQELDGRPLRVNV  277

Query  285  S  283
            +
Sbjct  278  A  278



>gb|EAZ04802.1| hypothetical protein OsI_26976 [Oryza sativa Indica Group]
Length=259

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 107/177 (60%), Gaps = 5/177 (3%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAEAAIQK  619
            K+FV NLP+S+  + +  LF Q G+VE VE +  ++ G++RGF FVTM++ EEA AA+++
Sbjct  76   KVFVGNLPFSVDSAQLAGLFEQAGSVEMVEVVYDRQTGRSRGFGFVTMSTAEEAGAAVEQ  135

Query  618  FNSYELSGRTIRVEYSKKFKK----PIRSpppppPRDGRYKLYVSNLAWKARSTHLRELF  451
            FN Y   GR +RV       +    P          D   KLYV NLAW   ++ L  LF
Sbjct  136  FNGYTFQGRPLRVNSGPPPPRDDFAPRSPRGGGSNFDSSNKLYVGNLAWGVDNSTLENLF  195

Query  450  SANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            S     + A+V+++  SG+S G+GFV +G+ EE   AIS++DG +L GR IR+ ++E
Sbjct  196  SEQGTVLDAKVIYDRESGRSRGFGFVTYGSAEEVNNAISNLDGVDLDGRQIRVTVAE  252



>dbj|BAJ96384.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=283

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 114/184 (62%), Gaps = 11/184 (6%)
 Frame = -3

Query  819  TPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGE  643
            T +P    K++V NLP+ +    + +LF Q G VE  E I  +E GQ+RGF FVTM++ E
Sbjct  98   TAEPPEEAKVYVGNLPYDVDSERLAQLFDQAGVVEVAEVIYNRESGQSRGFGFVTMSTIE  157

Query  642  EAEAAIQKFNSYELSGRTIRV----EYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKAR  475
            EA+ AI+ FN Y++SGR + V    +   + ++P R           ++ YV NL W+A 
Sbjct  158  EADKAIETFNRYDISGRLLNVNRAAQRGSRVERPPRRFASS------FRAYVGNLPWQAE  211

Query  474  STHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIR  295
             + L ++FS +   ++A +V++  +G+S G+GFV   +KE+ ++AIS++DG E+ GRP+R
Sbjct  212  DSRLVQMFSEHGEVVNATIVYDRETGRSRGFGFVTMASKEDLDSAISALDGQEMDGRPLR  271

Query  294  LKMS  283
            + ++
Sbjct  272  VNVA  275



>gb|EMT07597.1| 33 kDa ribonucleoprotein, chloroplastic [Aegilops tauschii]
Length=278

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 107/175 (61%), Gaps = 4/175 (2%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            + +L  +N+PW     D++ LF + GTV DVE       +NRG AFVTM S EEA +A++
Sbjct  80   KTRLIAMNIPWDFTPDDIRVLFEKQGTVVDVELSMHSSKKNRGLAFVTMGSEEEALSALK  139

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSAN  442
              N   ++ RTI+V+++K  KK    P  P  ++    ++V NL W+ RS HLRELF++ 
Sbjct  140  NLNLSTVNDRTIKVDFAKPKKKQPAVPSAPVEKN---VVFVGNLTWRVRSRHLRELFAST  196

Query  441  FNPISARVVFENASG-KSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
                S  V+F   +  +SAGY FV+F +KEEAEAAIS+ +G EL+GR I +   E
Sbjct  197  PGVQSVEVIFHTTTPRRSAGYAFVSFSSKEEAEAAISTFNGKELMGRSINVMFKE  251


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 47/81 (58%), Gaps = 2/81 (2%)
 Frame = -3

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFI--KTKEGQNRGFAFVTMASGEEA  637
            P  +  +FV NL W +    ++ELF     V+ VE I   T   ++ G+AFV+ +S EEA
Sbjct  169  PVEKNVVFVGNLTWRVRSRHLRELFASTPGVQSVEVIFHTTTPRRSAGYAFVSFSSKEEA  228

Query  636  EAAIQKFNSYELSGRTIRVEY  574
            EAAI  FN  EL GR+I V +
Sbjct  229  EAAISTFNGKELMGRSINVMF  249



>ref|XP_008811289.1| PREDICTED: 33 kDa ribonucleoprotein, chloroplastic [Phoenix dactylifera]
Length=326

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 113/183 (62%), Gaps = 6/183 (3%)
 Frame = -3

Query  822  KTPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASG  646
            K+ +P    +L+V NLP+S+  + + E+FGQ GTVE VE I  +   ++RGFAFVTM S 
Sbjct  99   KSVRPRDAARLYVGNLPFSMTPTQLAEVFGQAGTVETVEVIYDRVTDRSRGFAFVTMGSV  158

Query  645  EEAEAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPR-----DGRYKLYVSNLAWK  481
            EEA  AI+ F+  ++ GR ++V + +  +   R    P  R     D  +K+Y  NL W 
Sbjct  159  EEANEAIRMFDGSQVGGRIVKVNFPEVPRGGEREVMGPRMRTRGYIDSPHKIYAGNLGWT  218

Query  480  ARSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRP  301
              S  LR  F+A    + A+V+FE  +G+S G+GFV+F + +EA+AA+ +++G E+ GRP
Sbjct  219  VTSEDLRIAFAAQPGILGAKVIFERDTGRSRGFGFVSFASAKEAQAAMETMNGVEVEGRP  278

Query  300  IRL  292
            +RL
Sbjct  279  LRL  281


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 42/77 (55%), Gaps = 0/77 (0%)
 Frame = -3

Query  510  KLYVSNLAWKARSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISS  331
            +LYV NL +    T L E+F       +  V+++  + +S G+ FV  G+ EEA  AI  
Sbjct  108  RLYVGNLPFSMTPTQLAEVFGQAGTVETVEVIYDRVTDRSRGFAFVTMGSVEEANEAIRM  167

Query  330  IDGTELLGRPIRLKMSE  280
             DG+++ GR +++   E
Sbjct  168  FDGSQVGGRIVKVNFPE  184



>ref|NP_001060364.1| Os07g0631900 [Oryza sativa Japonica Group]
 dbj|BAC10140.1| putative 29 kDa ribonucleoprotein A, chloroplast precursor [Oryza 
sativa Japonica Group]
 dbj|BAF22278.1| Os07g0631900 [Oryza sativa Japonica Group]
 gb|EAZ40768.1| hypothetical protein OsJ_25244 [Oryza sativa Japonica Group]
Length=264

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 107/177 (60%), Gaps = 5/177 (3%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAEAAIQK  619
            K+FV NLP+S+  + +  LF Q G+VE VE +  ++ G++RGF FVTM++ EEA AA+++
Sbjct  81   KVFVGNLPFSVDSAQLAGLFEQAGSVEMVEVVYDRQTGRSRGFGFVTMSTAEEAGAAVEQ  140

Query  618  FNSYELSGRTIRVEYSKKFKK----PIRSpppppPRDGRYKLYVSNLAWKARSTHLRELF  451
            FN Y   GR +RV       +    P          D   KLYV NLAW   ++ L  LF
Sbjct  141  FNGYTFQGRPLRVNSGPPPPRDDFAPRSPRGGGSNFDSSNKLYVGNLAWGVDNSTLENLF  200

Query  450  SANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            S     + A+V+++  SG+S G+GFV +G+ EE   AIS++DG +L GR IR+ ++E
Sbjct  201  SEQGTVLDAKVIYDRESGRSRGFGFVTYGSAEEVNNAISNLDGVDLDGRQIRVTVAE  257



>ref|XP_004501850.1| PREDICTED: 31 kDa ribonucleoprotein, chloroplastic-like [Cicer 
arietinum]
Length=297

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 115/181 (64%), Gaps = 2/181 (1%)
 Frame = -3

Query  813  KPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEA  637
            +P+   KLFV NLP+ +    +  LF Q GTVE  E I  +E  Q+RGF FVTM++ EEA
Sbjct  110  EPSEDAKLFVGNLPYDVDSEKLAMLFEQAGTVEIAEVIYNRETDQSRGFGFVTMSTVEEA  169

Query  636  EAAIQKFNSYELSGRTIRV-EYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLR  460
            E+A++KFNSY+  GR + V + S K  +P R+  PP   +   ++YV NL W+  ++ L 
Sbjct  170  ESAVEKFNSYDYDGRPLTVNKASPKGSRPERAERPPRSFEPVIRVYVGNLPWEVDNSRLE  229

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            ++FS +   +SARVV++  +G+S G+GFV    ++E   AI+++DG  L GR IR+ ++E
Sbjct  230  QVFSEHGKVVSARVVYDRDTGRSRGFGFVTMSDEKEMNDAIAALDGQSLEGRTIRVSVAE  289

Query  279  K  277
             
Sbjct  290  D  290



>ref|NP_001050221.1| Os03g0376600 [Oryza sativa Japonica Group]
 gb|AAL82527.1|AC084766_13 putative ribonucleoprotein [Oryza sativa Japonica Group]
 gb|ABF96225.1| RNA recognition motif family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12135.1| Os03g0376600 [Oryza sativa Japonica Group]
 gb|EAZ27101.1| hypothetical protein OsJ_11032 [Oryza sativa Japonica Group]
 dbj|BAG91046.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG98727.1| unnamed protein product [Oryza sativa Japonica Group]
Length=265

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 108/173 (62%), Gaps = 3/173 (2%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            ++FV NLP+S+  + +  LF Q G+VE VE I  K  G++RGF FVTM+S EE EAA+++
Sbjct  87   RVFVGNLPFSVDSAQLAGLFEQAGSVEMVEVIYDKLTGRSRGFGFVTMSSVEEVEAAVEQ  146

Query  618  FNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSANF  439
            FN Y L GR++RV        P        PR    ++YV NL+W   +  L  LFS   
Sbjct  147  FNGYILDGRSLRVNSGPP--PPREQSSQRAPRGEANRVYVGNLSWGVDNAALANLFSGEG  204

Query  438  NPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
              + A+V+++  SG+S G+GFV +G+ EE E A+S++DG ++ GR IR+ ++E
Sbjct  205  EVLEAKVIYDRESGRSRGFGFVTYGSAEEVENAVSNLDGADMDGRQIRVTVAE  257



>gb|KDP29121.1| hypothetical protein JCGZ_16510 [Jatropha curcas]
Length=285

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 110/183 (60%), Gaps = 8/183 (4%)
 Frame = -3

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAE  634
            P+L  KLFV NLP+S+  + +  LF   G VE VE I  K  G++RGF FVTM++ +E E
Sbjct  97   PDL--KLFVGNLPFSVDSAQLAGLFESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAQEVE  154

Query  633  AAIQKFNSYELSGRTIRVEYSKKFKKPI-----RSpppppPRDGRYKLYVSNLAWKARST  469
            AA Q+FN YEL GR +RV      +K       +SP      D   +L++ NL+W   + 
Sbjct  155  AAAQQFNGYELEGRALRVNAGPPPQKESSFSRSQSPRSGGSYDSANRLHIGNLSWGVDNM  214

Query  468  HLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLK  289
             L  LFS +   + ARVV++  SG+S G+GFV + + EE E AI  ++G EL GRPIR+ 
Sbjct  215  ALENLFSGHGKVMEARVVYDRESGRSRGFGFVTYSSAEEVENAIEFLNGAELDGRPIRVS  274

Query  288  MSE  280
            ++E
Sbjct  275  VAE  277



>ref|XP_011094656.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic [Sesamum 
indicum]
Length=277

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 107/184 (58%), Gaps = 9/184 (5%)
 Frame = -3

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAE  634
            P+L  KLFV NLP+++  + +  LF Q G VE VE I  K  G++RGF FVTM++ EE E
Sbjct  89   PDL--KLFVGNLPFTVDSAALAGLFEQAGNVEMVEVIYDKFSGRSRGFGFVTMSTVEETE  146

Query  633  AAIQKFNSYELSGRTIRVEYS---KKFKKPIRSpppppPR---DGRYKLYVSNLAWKARS  472
            AA Q+FN YEL GR +RV       K + P         R   D   KLYV NLAW   +
Sbjct  147  AAAQQFNGYELQGRVLRVNSGPPPAKSENPSFRGARGRERTSYDSTNKLYVGNLAWGVDN  206

Query  471  THLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRL  292
              L  LFS   N   ARVV++  SG+S G+GFV + + EE  +AI  +DG +L GR IR+
Sbjct  207  LALETLFSEQGNVKEARVVYDKESGRSRGFGFVTYSSAEEVNSAIEELDGMDLHGRAIRV  266

Query  291  KMSE  280
              +E
Sbjct  267  SPAE  270



>ref|XP_007144372.1| hypothetical protein PHAVU_007G150700g [Phaseolus vulgaris]
 gb|ESW16366.1| hypothetical protein PHAVU_007G150700g [Phaseolus vulgaris]
Length=275

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 84/242 (35%), Positives = 132/242 (55%), Gaps = 16/242 (7%)
 Frame = -3

Query  975  LQISPNYPTLSLKSLMRSLPSLASTKLKTSHILRCStveeqavvaveteqEKTPKPNLRR  796
            L ++PN   +S+ ++    P+L+   L +  + R +   E           ++  P+L  
Sbjct  31   LSLTPNTKPISISNVFLK-PTLS---LSSRFLPRVAVSSEYDQEEGTFSSGQSFSPDL--  84

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAEAAIQK  619
            KLFV NLP+S+  + + E+F   G VE VE I  K  G++RGF FVTM+S EE EAA+Q+
Sbjct  85   KLFVGNLPFSVDSAQLAEIFENAGNVEVVEVIYDKTTGRSRGFGFVTMSSVEEVEAAVQQ  144

Query  618  FNSYELSGRTIRV---------EYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTH  466
            FN YEL GR ++V         E + +F+            D   K++VSNLAW   +  
Sbjct  145  FNGYELDGRALKVNAGPPPARNESTSRFRSSPPRGGGGDFSDSENKVHVSNLAWGVDNGT  204

Query  465  LRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKM  286
            L   F      + ARV+++  SG+S G+GFV + + +E  +AI S+DG +L GR IR+ +
Sbjct  205  LESFFGEYGKVLEARVIYDRDSGRSRGFGFVTYSSADEVSSAIQSLDGVDLNGRAIRVAL  264

Query  285  SE  280
            ++
Sbjct  265  AD  266



>emb|CDX95334.1| BnaC04g28240D [Brassica napus]
Length=303

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 110/179 (61%), Gaps = 8/179 (4%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            +L+V NLP+++  S++ +LFGQ GTV DV+ +  K   ++RGF FVTM S EEA+ AIQ 
Sbjct  95   RLYVGNLPYTITSSELSQLFGQAGTVVDVQIVHNKVTDRSRGFGFVTMGSIEEAQEAIQM  154

Query  618  FNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGR-------YKLYVSNLAWKARSTHLR  460
            FN+ ++ GRT++V + +  +   R       RD         +KLY  NL W   S  L+
Sbjct  155  FNTSQIGGRTVKVNFPEVPRGGEREVMRAKIRDSNRSYVDSPHKLYAGNLGWNLTSQGLK  214

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
            + F      + A+VV+E  SG+S G+GFV+F T ++ ++A+ +++G E+ GR +RL M+
Sbjct  215  DAFGDQPGVLGAKVVYERDSGRSRGFGFVSFETAQDLQSAMCAMNGVEVEGRELRLNMA  273



>gb|EAY90218.1| hypothetical protein OsI_11785 [Oryza sativa Indica Group]
Length=265

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 108/173 (62%), Gaps = 3/173 (2%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            ++FV NLP+S+  + +  LF Q G+VE VE I  K  G++RGF FVTM+S EE EAA+++
Sbjct  87   RVFVGNLPFSVDSAQLAGLFEQAGSVEMVEVIYDKLTGRSRGFGFVTMSSVEEVEAAVEQ  146

Query  618  FNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSANF  439
            FN Y L GR++RV        P        PR    ++YV NL+W   +  L  LFS   
Sbjct  147  FNGYILDGRSLRVNSGPP--PPREQSSRRAPRGEANRVYVGNLSWGVDNAALANLFSGEG  204

Query  438  NPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
              + A+V+++  SG+S G+GFV +G+ EE E A+S++DG ++ GR IR+ ++E
Sbjct  205  EVLEAKVIYDRESGRSRGFGFVTYGSAEEVENAVSNLDGADMDGRQIRVTVAE  257



>gb|KDO81066.1| hypothetical protein CISIN_1g021890mg [Citrus sinensis]
Length=306

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 111/180 (62%), Gaps = 10/180 (6%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            + +L   N+PW+    D++ LF Q GTV D+E     + +NRG AFVTM S +EA AA+ 
Sbjct  100  KTRLVAQNVPWTSTHEDIRALFEQHGTVLDIELSMHSKNRNRGLAFVTMGSPDEATAALN  159

Query  621  KFNSYELSGRTIRVEYSKKFKK----PIRSpppppPRDGRYKLYVSNLAWKARSTHLREL  454
               SYE  GRT++V Y+K  KK    P++  P        + L+++NL+++AR+  LRE 
Sbjct  160  NLESYEFEGRTLKVNYAKIKKKNPFPPVQPKPF-----ATFNLFIANLSFEARAKDLREF  214

Query  453  F-SANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
            F S  ++ +SA V+F +   +SAGYGFV+F +K+ AE AIS+  G   +GRP+R+  S +
Sbjct  215  FISEGWDVVSAEVIFHDNPRRSAGYGFVSFKSKKVAETAISAFQGKLFMGRPLRVAPSRQ  274



>ref|XP_002444599.1| hypothetical protein SORBIDRAFT_07g024400 [Sorghum bicolor]
 gb|EES14094.1| hypothetical protein SORBIDRAFT_07g024400 [Sorghum bicolor]
Length=292

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 112/182 (62%), Gaps = 11/182 (6%)
 Frame = -3

Query  813  KPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEA  637
            +P    K++V NLP+ +    + +LF Q G VE  E I  +E GQ+RGF FVTM++ EEA
Sbjct  109  EPPEEAKVYVGNLPYDIDSEGLAQLFDQAGVVEVAEVIYNRETGQSRGFGFVTMSTIEEA  168

Query  636  EAAIQKFNSYELSGRTIRVEYSK----KFKKPIRSpppppPRDGRYKLYVSNLAWKARST  469
            + AI+ FN Y++SGR + V  +     + ++P R   P       ++ YV NL W+   +
Sbjct  169  DKAIEMFNRYDISGRLLNVNRASPRGTRMERPPRQFAPA------FRAYVGNLPWQVDDS  222

Query  468  HLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLK  289
             L +LFS +   ++A VV++  SG+S G+GFV   +KEE + AIS++DG EL GRP+R+ 
Sbjct  223  RLVQLFSEHGEVVNATVVYDRESGRSRGFGFVTMVSKEELDDAISALDGQELDGRPLRVN  282

Query  288  MS  283
            ++
Sbjct  283  VA  284



>ref|XP_004304681.1| PREDICTED: 31 kDa ribonucleoprotein, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=294

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 112/180 (62%), Gaps = 3/180 (2%)
 Frame = -3

Query  813  KPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEA  637
            +P    KL+V NLP+ +    +  +F + G VE  E I  +E  Q+RGF FVTM++ EEA
Sbjct  110  EPPEEAKLYVGNLPFDVDSERLANVFNEAGIVEIAEVIYNRETDQSRGFGFVTMSTVEEA  169

Query  636  EAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRE  457
            E A++ FN Y+L GR + V  +K   +  R   PP   +  Y++Y+ NL W+   + L +
Sbjct  170  EKAVEMFNRYDLGGRPLTV--NKAAPRGSRPERPPRVNEPSYRIYIGNLPWQVDDSRLEQ  227

Query  456  LFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
            +FS + N +SARVV++  +G+S G+GFV F T+ E E AI+++DG  L GR IR+ ++E+
Sbjct  228  VFSEHGNVVSARVVYDRETGRSRGFGFVQFSTEAEVEDAIAALDGQSLDGRTIRVNVAEE  287



>ref|XP_004136268.1| PREDICTED: 31 kDa ribonucleoprotein, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004160289.1| PREDICTED: 31 kDa ribonucleoprotein, chloroplastic-like [Cucumis 
sativus]
 gb|KGN60238.1| hypothetical protein Csa_3G889940 [Cucumis sativus]
Length=300

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 97/251 (39%), Positives = 141/251 (56%), Gaps = 15/251 (6%)
 Frame = -3

Query  993  FSKPLRLQISPNYP---TLSLKSLMRSLPSLASTKLKTSHIL-----RCStveeqavvav  838
            F  PL    +P+YP     +L S+ RS PSL ST +  S ++     R ST   Q     
Sbjct  24   FLAPLSCSQNPSYPINGDFNL-SISRSSPSLLSTSISHSPLISIRAKRTSTFVFQFASTS  82

Query  837  eteqEKTPKPN---LRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFA  667
            + E   +P       + +L   N+PW     D++ LF + GTV DVE     + +NRG A
Sbjct  83   QDEAVSSPSDTEEFSQTRLLAQNVPWDSTPEDIRSLFEKYGTVLDVELSMYNKIRNRGLA  142

Query  666  FVTMASGEEAEAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLA  487
            FVTM S EEA AA+    SYE  GRT+R+ Y+K  K+  +  PP  P+   + L+V+NL 
Sbjct  143  FVTMGSPEEALAALNNLESYEFEGRTLRLNYAKLKKE--KPSPPVKPKPVTFNLFVANLP  200

Query  486  WKARSTHLRELF-SANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELL  310
            + AR+  L+E F S + N +SA+++F     +S+GYGFVAF TK++AEAAIS   G   +
Sbjct  201  FDARAKDLKEFFDSGSGNVVSAQIIFNENPRRSSGYGFVAFKTKKDAEAAISEFQGKTFM  260

Query  309  GRPIRLKMSEK  277
            GR +R+  S++
Sbjct  261  GRSLRVARSKQ  271


 Score = 50.8 bits (120),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 44/82 (54%), Gaps = 2/82 (2%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQ-CGTVEDVEFIKTKEGQ-NRGFAFVTMASGEEAEAAIQ  622
             LFV NLP+     D+KE F    G V   + I  +  + + G+ FV   + ++AEAAI 
Sbjct  193  NLFVANLPFDARAKDLKEFFDSGSGNVVSAQIIFNENPRRSSGYGFVAFKTKKDAEAAIS  252

Query  621  KFNSYELSGRTIRVEYSKKFKK  556
            +F      GR++RV  SK+F K
Sbjct  253  EFQGKTFMGRSLRVARSKQFVK  274



>ref|XP_007162982.1| hypothetical protein PHAVU_001G196700g [Phaseolus vulgaris]
 gb|ESW34976.1| hypothetical protein PHAVU_001G196700g [Phaseolus vulgaris]
Length=317

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 109/180 (61%), Gaps = 8/180 (4%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            +L++ NLP+S+  S + ELF + GTV  VE +  +  G++RGFAFVTM S E+A+ AI+ 
Sbjct  109  RLYIGNLPFSITNSQLAELFAEAGTVASVEIVYDRVTGRSRGFAFVTMESVEDAKEAIRM  168

Query  618  FNSYELSGRTIRVEYSKKFKKPIRSpppppPRDG-------RYKLYVSNLAWKARSTHLR  460
            F+  ++ GRT +V + +  K   R       RD         YK+Y  NL W   S  LR
Sbjct  169  FDGSQVGGRTAKVNFPEVPKGGERLVMGAKIRDNYRGFVDSAYKIYCGNLGWGVNSQGLR  228

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            E F+     +SA+VV+E  SG+S G+GFV+F T E A AA+  ++G E+ GRP+RL ++E
Sbjct  229  EAFAEQPGILSAKVVYEKDSGRSRGFGFVSFTTAESAAAALDIMNGVEVQGRPLRLNIAE  288



>ref|XP_006846809.1| hypothetical protein AMTR_s00148p00072380 [Amborella trichopoda]
 gb|ERN08390.1| hypothetical protein AMTR_s00148p00072380 [Amborella trichopoda]
Length=272

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 110/181 (61%), Gaps = 9/181 (5%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAEAAIQK  619
            KLFV NLP+S+  + + ELF Q G VE VE I  K+ G++RGF FVTM++ EE EAA+Q+
Sbjct  85   KLFVGNLPFSVDSARLAELFEQAGNVEMVEVIYDKQTGRSRGFGFVTMSTVEEVEAAVQQ  144

Query  618  FNSYELSGRTIRVEY----SKKFKKPIRSpppppPR----DGRYKLYVSNLAWKARSTHL  463
            FN ++  GR +RV      ++    P  S     PR    D   ++YV NL+W      L
Sbjct  145  FNGHDFEGRQLRVNSGPPPARDEMSPRGSRGFDSPRPRSFDSPNRVYVGNLSWGVDDLAL  204

Query  462  RELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
              LFS     + A+VV++  SG+S G+GFV + T EE  +AIS+++G +L GRPIR+  +
Sbjct  205  ENLFSEQGKVMEAKVVYDRESGRSRGFGFVTYSTAEEVTSAISTLNGADLDGRPIRVTPA  264

Query  282  E  280
            E
Sbjct  265  E  265



>ref|NP_001130287.1| uncharacterized protein LOC100191381 [Zea mays]
 gb|ACF78461.1| unknown [Zea mays]
 tpg|DAA48687.1| TPA: ribonucleoprotein [Zea mays]
Length=289

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 112/182 (62%), Gaps = 11/182 (6%)
 Frame = -3

Query  813  KPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEA  637
            +P    K++V NLP+ +    + +LF Q G VE  E I  KE GQ+RGF FVTM++ EEA
Sbjct  106  EPPEEAKVYVGNLPYDIESEGLAQLFDQAGVVEVAEVIYNKETGQSRGFGFVTMSTIEEA  165

Query  636  EAAIQKFNSYELSGRTIRVEYSK----KFKKPIRSpppppPRDGRYKLYVSNLAWKARST  469
            + AI+ FN Y++SGR + V  +     + ++P R   P       ++ YV NL W+A  +
Sbjct  166  DKAIEMFNRYDISGRLLNVNRASPRGTRMERPPRQFAPA------FRAYVGNLPWQADDS  219

Query  468  HLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLK  289
             L +LFS     ++A VV++  +G+S G+GFV   +KEE + AIS++DG EL GRP+R+ 
Sbjct  220  RLVQLFSEYGEVVNAAVVYDRETGRSRGFGFVTMVSKEELDDAISALDGQELDGRPLRVN  279

Query  288  MS  283
            ++
Sbjct  280  VA  281



>ref|XP_006472543.1| PREDICTED: 31 kDa ribonucleoprotein, chloroplastic-like [Citrus 
sinensis]
Length=306

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 112/180 (62%), Gaps = 10/180 (6%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            + +L   N+PW+    D++ LF Q GTV D+E     + +NRG AFVTM S +EA AA+ 
Sbjct  100  KTRLVAQNVPWTSTHEDIRALFEQHGTVLDIELSMHSKNRNRGLAFVTMGSPDEATAALN  159

Query  621  KFNSYELSGRTIRVEYSKKFKK----PIRSpppppPRDGRYKLYVSNLAWKARSTHLREL  454
               SYE  GRT++V Y+K  KK    P++  P P      + L+++NL+++AR+  LRE 
Sbjct  160  NLESYEFEGRTLKVNYAKVKKKNPAPPVQPKPFPT-----FNLFIANLSFEARAKDLREF  214

Query  453  F-SANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
            F S  ++ +SA V+F +   +SAGYGFV+F +K+ AE AIS+  G   +GRP+R+  S +
Sbjct  215  FISEGWDVVSAEVIFHDNPRRSAGYGFVSFKSKKVAETAISAFQGKLFMGRPLRVAPSRQ  274



>ref|XP_010684074.1| PREDICTED: ribonucleoprotein At2g37220, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=279

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 114/188 (61%), Gaps = 14/188 (7%)
 Frame = -3

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAE  634
            P+L  KLFV NLP+++  SD+  LFG  GTVE VE I  K  G++RGF FVTM++ EE E
Sbjct  88   PDL--KLFVGNLPFNVDSSDLAGLFGSAGTVEMVEVIYDKLTGRSRGFGFVTMSTVEEVE  145

Query  633  AAIQKFNSYELSGRTIRV----------EYSKKFKKPIRSpppppPRDGRYKLYVSNLAW  484
            AA Q+FN YEL GR++RV          ++S +          P       +++V NL+W
Sbjct  146  AAAQQFNGYELDGRSLRVNAGPPPPKRDDFSPRGGAGGSRGGGPGFGSSN-RVHVGNLSW  204

Query  483  KARSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGR  304
            K     L+ LFS   + + A+V+++  SG+S G+GFV + + +E  +AI S+DG +L GR
Sbjct  205  KVDDAALKTLFSELGDVVEAKVIYDRDSGRSRGFGFVTYNSADEVNSAIESLDGVDLNGR  264

Query  303  PIRLKMSE  280
             IR+ ++E
Sbjct  265  SIRVTVAE  272



>gb|ACG34122.1| ribonucleoprotein [Zea mays]
Length=289

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 112/182 (62%), Gaps = 11/182 (6%)
 Frame = -3

Query  813  KPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEA  637
            +P    K++V NLP+ +    + +LF Q G VE  E I  KE GQ+RGF FVTM++ EEA
Sbjct  106  EPPEEAKVYVGNLPYDIESEGLAQLFDQAGVVEVAEVIYNKETGQSRGFGFVTMSTIEEA  165

Query  636  EAAIQKFNSYELSGRTIRVEYSK----KFKKPIRSpppppPRDGRYKLYVSNLAWKARST  469
            + AI+ FN Y++SGR + V  +     + ++P R   P       ++ YV NL W+A  +
Sbjct  166  DKAIEMFNRYDISGRLLNVNRASPRGTRMERPPRQFAPA------FRAYVGNLPWQADDS  219

Query  468  HLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLK  289
             L +LFS     ++A VV++  +G+S G+GFV   +KEE + AIS++DG EL GRP+R+ 
Sbjct  220  RLVQLFSEYGEVVNAAVVYDRETGRSRGFGFVTMVSKEELDDAISALDGQELDGRPLRVN  279

Query  288  MS  283
            ++
Sbjct  280  VA  281



>ref|XP_004974183.1| PREDICTED: 31 kDa ribonucleoprotein, chloroplastic-like [Setaria 
italica]
Length=296

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 111/182 (61%), Gaps = 11/182 (6%)
 Frame = -3

Query  813  KPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEA  637
            +P    K++V NLP+ L    + +LF Q G VE  E I  +E GQ+RGF FVTM++ EEA
Sbjct  113  EPPEEAKVYVGNLPYDLDSEGLAQLFDQAGVVEVAEVIYNRETGQSRGFGFVTMSTIEEA  172

Query  636  EAAIQKFNSYELSGRTIRVEYSK----KFKKPIRSpppppPRDGRYKLYVSNLAWKARST  469
            + AI+ FN Y++SGR + V  +     + ++P R           ++ YV NL W+   +
Sbjct  173  DKAIEMFNRYDISGRLLNVNRASPRGTRMERPPRQFASA------FRAYVGNLPWQVDDS  226

Query  468  HLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLK  289
             L ++FS +   ++A VV++  +G+S G+GFV   +KEE + AIS++DG EL GRP+R+ 
Sbjct  227  RLVQVFSEHGEVVNASVVYDRETGRSRGFGFVTMASKEELDDAISALDGQELDGRPLRVN  286

Query  288  MS  283
            ++
Sbjct  287  VA  288



>ref|XP_003554474.1| PREDICTED: 33 kDa ribonucleoprotein, chloroplastic-like [Glycine 
max]
 gb|KHN43605.1| 33 kDa ribonucleoprotein, chloroplastic [Glycine soja]
Length=317

 Score =   135 bits (340),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 112/180 (62%), Gaps = 8/180 (4%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            +L+V NLP+S+  S++ ELFG+ GTV  VE +  +   ++RGFAFVTM S E+A+ AI+ 
Sbjct  109  RLYVGNLPYSITNSELGELFGEAGTVASVEIVYDRVTDRSRGFAFVTMGSVEDAKEAIRM  168

Query  618  FNSYELSGRTIRVEYSKKFKKPIR----SpppppPR---DGRYKLYVSNLAWKARSTHLR  460
            F+  ++ GRT++V + +  K   R    S      R   D  +K+Y  NL W   S  LR
Sbjct  169  FDGSQVGGRTVKVNFPEVPKGGERLVMGSKILNSYRGFVDSPHKIYAGNLGWGLTSQGLR  228

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            E F+     +SA+V++E  SG+S G+GFV+F T E A AA+  ++G E+ GRP+RL ++E
Sbjct  229  EAFAEQPGVLSAKVIYERDSGRSRGFGFVSFETAESARAALDIMNGVEVQGRPLRLNLAE  288



>ref|XP_009373525.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009373526.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic-like [Pyrus 
x bretschneideri]
Length=277

 Score =   134 bits (338),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 107/189 (57%), Gaps = 13/189 (7%)
 Frame = -3

Query  819  TPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGE  643
            +P+P    KLFV NLP+S+  + +  +F   G VE VE I  K  G++RGF FVTM+S +
Sbjct  86   SPEP----KLFVGNLPFSVDSAQLAGIFESAGNVEMVEVIYDKTTGRSRGFGFVTMSSVQ  141

Query  642  EAEAAIQKFNSYELSGRTIRVEY--------SKKFKKPIRSpppppPRDGRYKLYVSNLA  487
            EAE+A ++ N YEL GR +RV Y           F+            D   +LYV NLA
Sbjct  142  EAESAARQLNGYELDGRALRVNYGPPPPRTEDSSFRGARGPRGGGGGYDSNNRLYVGNLA  201

Query  486  WKARSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLG  307
            W   +  L  LFS     + A+VVF+  SG+S G+GFV + T +E  +AI S+DG +L G
Sbjct  202  WGVDNLALENLFSEQGKVLEAKVVFDRDSGRSRGFGFVTYDTADEMNSAIESLDGVDLNG  261

Query  306  RPIRLKMSE  280
            R IR+  +E
Sbjct  262  RSIRVSAAE  270



>ref|XP_006660380.1| PREDICTED: 31 kDa ribonucleoprotein, chloroplastic-like [Oryza 
brachyantha]
Length=305

 Score =   135 bits (339),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 111/176 (63%), Gaps = 11/176 (6%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAEAAIQK  619
            K++V NLP+ +    + +LF Q G VE  E I  +E GQ+RGF FVTM++ EEA+ AI+ 
Sbjct  128  KVYVGNLPYDVDSEGLAQLFDQAGVVEVAEVIYNRETGQSRGFGFVTMSTVEEADKAIEM  187

Query  618  FNSYELSGRTIRVEYSK----KFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELF  451
             N Y++SGR + V  +     + ++P R   P       ++ YV NL W+   + L +LF
Sbjct  188  LNRYDISGRLLNVNRASPRGSRVERPPRQFAPA------FRAYVGNLPWQVDDSRLLQLF  241

Query  450  SANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
            S +   ++A+VV++  SG+S G+GFV+  +KEE + AIS++DG EL GRP+R+ ++
Sbjct  242  SEHGEVVNAQVVYDRESGRSRGFGFVSMASKEELDDAISALDGQELDGRPLRVNVA  297



>ref|XP_010436014.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic-like [Camelina 
sativa]
Length=304

 Score =   135 bits (339),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 110/176 (63%), Gaps = 1/176 (1%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            + +L   N+PW+    D++ LF + G+V D+E    K+ +NRG  F+ M S EEA  A++
Sbjct  92   KTRLIAQNVPWAATPEDIRTLFEKYGSVVDIEMSMHKKERNRGLVFIEMGSPEEAATALK  151

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSAN  442
               SYE  GR ++V+Y+K  KK   +P   P     + L+V+NLA++AR+ HL+E F A+
Sbjct  152  SLESYEYEGRRLKVDYAKAKKKKTYAPREKPSEVPTFNLFVANLAFEARAKHLKEFFDAD  211

Query  441  F-NPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
              N +S  V+F     +S+GYGFV+F TK++AEAAI    G + +GRPIRL  S++
Sbjct  212  TGNVVSTEVIFHENPRRSSGYGFVSFKTKKQAEAAIIEFQGKDFMGRPIRLARSKQ  267



>gb|KEH35015.1| 31 kDa ribonucleoprotein [Medicago truncatula]
Length=291

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 114/181 (63%), Gaps = 2/181 (1%)
 Frame = -3

Query  813  KPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQ-NRGFAFVTMASGEEA  637
            +P    KLFV N P+ +    +  LFGQ GTVE  E I  ++   +RGF FVTM++ EEA
Sbjct  104  EPPEDAKLFVGNFPFDVDSEKLAMLFGQAGTVEIAEVIYNRQTDLSRGFGFVTMSTVEEA  163

Query  636  EAAIQKFNSYELSGRTIRV-EYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLR  460
            E+A++KFN Y+ +GR++ V + S K  +P R+   P   +   ++YV+NLAW+  ++ L 
Sbjct  164  ESAVEKFNGYDYNGRSLVVNKASPKGSRPERTERAPRTFEPVLRIYVANLAWEVDNSRLE  223

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            ++FS +   +SARVV++  +G+S G+GFV    + E   AI+++DG  L GR IR+ ++E
Sbjct  224  QVFSEHGKIVSARVVYDRETGRSRGFGFVTMSDETEMNDAIAALDGQSLEGRTIRVSVAE  283

Query  279  K  277
             
Sbjct  284  D  284



>ref|XP_003521499.1| PREDICTED: 33 kDa ribonucleoprotein, chloroplastic-like isoform 
X1 [Glycine max]
 gb|KHN22601.1| 33 kDa ribonucleoprotein, chloroplastic [Glycine soja]
Length=314

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 111/180 (62%), Gaps = 8/180 (4%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            +L+V NLP+S+  S + ELFG+ GTV  VE +  +   ++RGFAFVTM + E+A+ AI+ 
Sbjct  106  RLYVGNLPYSITNSALAELFGEAGTVASVEIMYDRVTDRSRGFAFVTMGNVEDAKEAIRM  165

Query  618  FNSYELSGRTIRVEYSKKFKKPIRSpppppPR-------DGRYKLYVSNLAWKARSTHLR  460
            F+  ++ GRT++V + +  K   R       R       D  +K+Y  NL W   S  LR
Sbjct  166  FDGSQVGGRTVKVNFPEVPKGGERLVMGSKIRNSYRGFVDSPHKIYAGNLGWGLTSQGLR  225

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            E F+     +SA+V++E  SG+S G+GFV+F T E A+AA+  ++G E+ GRP+RL ++E
Sbjct  226  EAFAEQPGVLSAKVIYERDSGRSRGFGFVSFETAESAQAALDIMNGVEVQGRPLRLNLAE  285



>ref|XP_010247638.1| PREDICTED: 33 kDa ribonucleoprotein, chloroplastic [Nelumbo nucifera]
Length=319

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 113/180 (63%), Gaps = 8/180 (4%)
 Frame = -3

Query  798  RKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQ  622
            R+L+V NLP+S+  S + E+F + G V+ VE I  +   ++RGFAFVTM S ++A+ AI+
Sbjct  109  RRLYVGNLPFSMTSSHLAEVFSEAGQVDAVEIIYDRVTDRSRGFAFVTMGSAQDAKEAIR  168

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPR-------DGRYKLYVSNLAWKARSTHL  463
             F+  ++ GR+++V + +  +   R    P  R       D  +K+Y  NL+W   S  L
Sbjct  169  MFDGSQVGGRSVKVNFPEVPRGGEREVMGPKIRNSYRGFIDSAHKIYAGNLSWGLASQGL  228

Query  462  RELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
            ++ F+     +SA+V+FE  SG+S G+GFV F + EEA++A+ S+DG E+ GRP+RL M+
Sbjct  229  KDAFADQPGLLSAKVIFERDSGRSRGFGFVTFASAEEAQSALESMDGVEVEGRPLRLNMA  288


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = -3

Query  510  KLYVSNLAWKARSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISS  331
            +LYV NL +   S+HL E+FS      +  ++++  + +S G+ FV  G+ ++A+ AI  
Sbjct  110  RLYVGNLPFSMTSSHLAEVFSEAGQVDAVEIIYDRVTDRSRGFAFVTMGSAQDAKEAIRM  169

Query  330  IDGTELLGRPIRLKMSE  280
             DG+++ GR +++   E
Sbjct  170  FDGSQVGGRSVKVNFPE  186


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 46/83 (55%), Gaps = 1/83 (1%)
 Frame = -3

Query  798  RKLFVLNLPWSLAVSDVKELFG-QCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
             K++  NL W LA   +K+ F  Q G +      +   G++RGF FVT AS EEA++A++
Sbjct  212  HKIYAGNLSWGLASQGLKDAFADQPGLLSAKVIFERDSGRSRGFGFVTFASAEEAQSALE  271

Query  621  KFNSYELSGRTIRVEYSKKFKKP  553
              +  E+ GR +R+  + +   P
Sbjct  272  SMDGVEVEGRPLRLNMAAERASP  294



>ref|XP_010421828.1| PREDICTED: 30S ribosomal protein 2, chloroplastic [Camelina sativa]
 ref|XP_010421829.1| PREDICTED: 30S ribosomal protein 2, chloroplastic [Camelina sativa]
Length=302

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 110/176 (63%), Gaps = 1/176 (1%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            + +L   N+PW+    D++ LF + G+V D+E    K+ +NRG  F+ M S EEA  A++
Sbjct  88   KTRLIAQNVPWAATPEDIRSLFEKYGSVVDIEMSMHKKERNRGLVFIEMGSPEEAATALK  147

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSAN  442
               SYE  GR ++V+Y+K  KK   +P   P     + L+V+NLA++AR+ HL+E F A+
Sbjct  148  SLESYEYEGRRLKVDYAKAKKKKTYAPREKPSAVPTFNLFVANLAFEARAKHLKEFFDAD  207

Query  441  F-NPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
              N +S  V+F     +S+GYGFV+F TK++AEAAI    G + +GRPIRL  S++
Sbjct  208  TGNVVSTEVIFHENPRRSSGYGFVSFKTKKQAEAAIIEFQGKDFMGRPIRLARSKQ  263



>gb|ABK24055.1| unknown [Picea sitchensis]
Length=299

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 114/188 (61%), Gaps = 10/188 (5%)
 Frame = -3

Query  819  TPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGE  643
            +P  NL  K+FV NLPWS+  +++ ELF   G V  VE I  ++ G++RGFAFVTMA+  
Sbjct  108  SPSANL--KVFVGNLPWSVDSAELAELFKDSGDVTMVEVIYDRQTGRSRGFAFVTMATQA  165

Query  642  EAEAAIQKFNSYELSGRTIRVEYSKKFKKP-------IRSpppppPRDGRYKLYVSNLAW  484
            +A+ A++KFN YE  GRT+RV       K         R+  P    +   +++V NL W
Sbjct  166  DADEAVEKFNGYEYQGRTLRVNSGPPPPKDSFAPRGGFRNEKPSGNYNSANRVFVGNLPW  225

Query  483  KARSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGR  304
             A    L +LFS +   + A+VV++  +G+S G+GFV   + +E E AISS+DG+++ GR
Sbjct  226  GADDLSLEQLFSDHGKVMEAKVVYDRETGRSRGFGFVTLSSPQEIEEAISSLDGSDMDGR  285

Query  303  PIRLKMSE  280
             I++ ++E
Sbjct  286  QIKVTLAE  293



>ref|NP_001149184.1| LOC100282806 [Zea mays]
 gb|ACG34487.1| ribonucleoprotein [Zea mays]
Length=286

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 112/182 (62%), Gaps = 11/182 (6%)
 Frame = -3

Query  813  KPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEA  637
            +P    K++V NLP+ +    + ++F Q G VE  E I  +E GQ+RGF FVTM++ EEA
Sbjct  103  EPPEEAKVYVGNLPYDVDSEGLAQIFDQAGVVEVAEVIYNRETGQSRGFGFVTMSTVEEA  162

Query  636  EAAIQKFNSYELSGRTIRVEYSK----KFKKPIRSpppppPRDGRYKLYVSNLAWKARST  469
            + AI+ FN Y++SGR + V  +     + ++P R   P       ++ YV NL W+   +
Sbjct  163  DKAIEMFNRYDISGRLLNVNRASSRGTRMERPQRQFAPA------FRAYVGNLPWQVDDS  216

Query  468  HLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLK  289
             L +LFS +   + A+VV++  +G+S G+GFV+  +KEE   AIS++DG EL GRP+R+ 
Sbjct  217  RLVQLFSEHGEVVDAKVVYDRETGRSRGFGFVSMVSKEELNDAISALDGQELDGRPLRVN  276

Query  288  MS  283
            ++
Sbjct  277  VA  278



>ref|XP_008442930.1| PREDICTED: 33 kDa ribonucleoprotein, chloroplastic isoform X2 
[Cucumis melo]
Length=321

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 110/179 (61%), Gaps = 8/179 (4%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            KL++ NLP+++  S + E+F + G V  V+ I  K   ++RGFAFVTMA+ EEA+ AI+ 
Sbjct  114  KLYIGNLPYAMTSSQLSEVFAEAGQVVSVQVIYDKVTDRSRGFAFVTMATLEEAKEAIRM  173

Query  618  FNSYELSGRTIRVEY-------SKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLR  460
            F+  ++ GRT+RV +        K+   P          D  +K+Y  NL W   S  LR
Sbjct  174  FDGSQIGGRTVRVNFPEVPRGGEKEVMGPKIRSSYNKFVDSPHKIYAGNLGWGLTSQSLR  233

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
            + F      +SA+V+++ ASGKS G+GFV+F T E+AE+A+ S++G E+ GRP+RL ++
Sbjct  234  DAFENQPGILSAKVIYDRASGKSRGFGFVSFETAEDAESALESMNGVEVEGRPLRLNIA  292


 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = -3

Query  510  KLYVSNLAWKARSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISS  331
            KLY+ NL +   S+ L E+F+     +S +V+++  + +S G+ FV   T EEA+ AI  
Sbjct  114  KLYIGNLPYAMTSSQLSEVFAEAGQVVSVQVIYDKVTDRSRGFAFVTMATLEEAKEAIRM  173

Query  330  IDGTELLGRPIRLKMSE  280
             DG+++ GR +R+   E
Sbjct  174  FDGSQIGGRTVRVNFPE  190



>gb|ACF82264.1| unknown [Zea mays]
 tpg|DAA47753.1| TPA: ribonucleoprotein [Zea mays]
Length=275

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 105/177 (59%), Gaps = 1/177 (1%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            + +L   N+PW     +++ LF   G+V  VE       +NRG AFVTM S EEA AA+ 
Sbjct  70   KTRLVAQNIPWDCTADEMRALFESHGSVVGVELSMYSANKNRGLAFVTMGSEEEALAALT  129

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSAN  442
              NS  L+ R I+V++++  KK  + P        +Y ++V NL W+ R+ HLRELF++ 
Sbjct  130  HLNSTILNDRKIKVDFARPRKKQPKQPAVVSDDTEKYVVFVGNLTWRVRNRHLRELFASA  189

Query  441  FNPISARVVFENASG-KSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEKN  274
               +SA V+F   +  +SAGY FV+F +KE A AAIS+ +G  L+GRPI +   ++N
Sbjct  190  PGVVSAEVIFHTTTPRRSAGYAFVSFSSKESAGAAISAFNGKILMGRPINVMFKDEN  246



>gb|EPS70093.1| hypothetical protein M569_04668, partial [Genlisea aurea]
Length=263

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/175 (39%), Positives = 107/175 (61%), Gaps = 4/175 (2%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            R +L V N+PW+    D++ LF   G+V ++EF    + +NRG AFVTMAS EEA AA+ 
Sbjct  79   RTRLLVQNVPWTCTADDIQPLFENYGSVIEIEFSMYNKTRNRGLAFVTMASHEEALAALN  138

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSAN  442
               S E  GR +++ ++K  K+  ++          + L+V+NL ++AR   L++ F+A 
Sbjct  139  SLESTEFEGRVLKLNWAKPKKEKNKTGVVITQPLPVHNLFVANLPFEARPKDLKDFFNA-  197

Query  441  FNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
               +SA V++     + AGYGFV+F TKEEA+AA++S    E +GRPIR+  S++
Sbjct  198  ---VSAEVIYNENPRRPAGYGFVSFYTKEEADAALTSFQAKEFMGRPIRVARSKR  249



>emb|CAD18921.1| RNA-binding protein precursor [Persea americana]
Length=300

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 110/181 (61%), Gaps = 3/181 (2%)
 Frame = -3

Query  816  PKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEE  640
            P P    KLFV NLP+ +    + ELF Q GTVE  E I  +E  Q+RGF FVTM++ EE
Sbjct  115  PLPPEEAKLFVGNLPYDVDHQALAELFDQAGTVEVAEVIYNRETDQSRGFGFVTMSTVEE  174

Query  639  AEAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLR  460
            AE A++ FN Y+++GR + V  +K   +  R   PP   +  +++YV NL W+     L 
Sbjct  175  AEKAVEMFNRYDINGRLLTV--NKAAPRGARVDRPPRAFEPAFRMYVGNLPWQVDDARLE  232

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            ++FS +   + ARVV++  +G+S G+GFV   T+ E + AI+++DG  L GR IR+ ++E
Sbjct  233  QVFSEHGKVVEARVVYDRETGRSRGFGFVTMSTQTELDDAIAALDGQSLDGRAIRVNVAE  292

Query  279  K  277
             
Sbjct  293  D  293



>ref|XP_004497514.1| PREDICTED: 31 kDa ribonucleoprotein, chloroplastic-like isoform 
X1 [Cicer arietinum]
Length=284

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 86/257 (33%), Positives = 132/257 (51%), Gaps = 23/257 (9%)
 Frame = -3

Query  993  FSKPLRLQISPNYPTLSLKSLMRSLPSLASTKLKTSHILRCStveeqavvaveteqEKTP  814
            FS      I+PN+   S+ S     P+L+   L    + R +   E        +  +TP
Sbjct  25   FSSHPSFSINPNFKPFSISS-ASVRPTLS---LSYRFVSRVAVSSEFDQQEDTFDDGETP  80

Query  813  KPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEA  637
              +   +LFV NLP+S+  + + E+F   G VE VE I  K  G++RGF FVTM+S EE 
Sbjct  81   NYSSNLRLFVGNLPFSVDSAQLAEIFENAGNVEMVEVIYDKTTGRSRGFGFVTMSSAEEV  140

Query  636  EAAIQKFNSYELSGRTIRVEY---------SKKFKKPIRSpppppPR---------DGRY  511
            EAA Q+FN YE+ GR +RV           + +F +  R       R         D   
Sbjct  141  EAAAQQFNGYEVDGRALRVNAGPPPPPRSENSRFGENTRFGDNSRFRGGSPRGGSSDSDN  200

Query  510  KLYVSNLAWKARSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISS  331
            +++V NLAW   ++ L  LF  +   + A+V+++  SG+S G+GFV F + +E  +AI S
Sbjct  201  RVHVGNLAWGVDNSALESLFGGHGTVLEAKVIYDRESGRSRGFGFVTFSSPDEVNSAIQS  260

Query  330  IDGTELLGRPIRLKMSE  280
            +DG +L GR IR+  ++
Sbjct  261  LDGVDLNGRAIRVSTAD  277



>ref|NP_001150253.1| ribonucleoprotein [Zea mays]
 gb|ACG38384.1| ribonucleoprotein [Zea mays]
Length=275

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 105/177 (59%), Gaps = 1/177 (1%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            + +L   N+PW     +++ LF   G+V  VE       +NRG AFVTM S EEA AA+ 
Sbjct  70   KTRLVAQNIPWDCTADEMRALFESHGSVVGVELSMYSANKNRGLAFVTMGSEEEALAALT  129

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSAN  442
              NS  L+ R I+V++++  KK  + P        +Y ++V NL W+ R+ HLRELF++ 
Sbjct  130  HLNSTILNDRKIKVDFARPRKKQPKQPAVVSDATEKYVVFVGNLTWRVRNRHLRELFASA  189

Query  441  FNPISARVVFENASG-KSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEKN  274
               +SA V+F   +  +SAGY FV+F +KE A AAIS+ +G  L+GRPI +   ++N
Sbjct  190  PGVVSAEVIFHTTTPRRSAGYAFVSFSSKESAGAAISAFNGKILMGRPINVMFKDEN  246



>ref|XP_006288345.1| hypothetical protein CARUB_v10001593mg [Capsella rubella]
 ref|XP_006288346.1| hypothetical protein CARUB_v10001593mg [Capsella rubella]
 gb|EOA21243.1| hypothetical protein CARUB_v10001593mg [Capsella rubella]
 gb|EOA21244.1| hypothetical protein CARUB_v10001593mg [Capsella rubella]
Length=297

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 109/176 (62%), Gaps = 1/176 (1%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            + +L   N+PW+    D++ LF + G V D+E    K+ +NRG  F+ M S EEA  A++
Sbjct  83   KTRLIAQNVPWAATPEDIRSLFEKYGNVVDIEMSMHKKERNRGLVFIEMGSPEEAAEALK  142

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSAN  442
               SYE  GR ++V+Y+K  KK   +P   P     + L+V+NLA++AR+ HL+E F A+
Sbjct  143  ALESYEYEGRRLKVDYAKAKKKKTYAPREKPSPVPTFNLFVANLAFEARAKHLKEFFDAD  202

Query  441  F-NPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
              N +S  V+F     +S+GYGFV+F TK++AEAAI    G + +GRPIRL  S++
Sbjct  203  TGNVVSTEVIFHENPRRSSGYGFVSFKTKKQAEAAIIEFQGKDFMGRPIRLARSKQ  258



>ref|NP_001062481.2| Os08g0557100 [Oryza sativa Japonica Group]
 dbj|BAF24395.2| Os08g0557100, partial [Oryza sativa Japonica Group]
Length=194

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 110/176 (63%), Gaps = 11/176 (6%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAEAAIQK  619
            K++V NLP+ +    + +LF Q G VE  E I  +E GQ+RGF FVTM++ EEA+ AI+ 
Sbjct  17   KVYVGNLPYDVDSEGLAQLFEQAGVVEVAEVIYNRETGQSRGFGFVTMSTIEEADKAIEM  76

Query  618  FNSYELSGRTIRVEYS----KKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELF  451
             N Y+++GR + V  +     + ++P R   P       ++ YV NL W+   + L +LF
Sbjct  77   LNRYDINGRLLNVNRAAPRGSRVERPPRQFAPA------FRAYVGNLPWQVDDSRLLQLF  130

Query  450  SANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
            S +   ++A VV++  SG+S G+GFV+  +KEE + AIS++DG EL GRP+R+ ++
Sbjct  131  SEHGEVVNASVVYDRESGRSRGFGFVSMASKEELDDAISALDGQELDGRPLRVNVA  186



>ref|XP_004958419.1| PREDICTED: ribonucleoprotein At2g37220, chloroplastic-like [Setaria 
italica]
Length=265

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 106/180 (59%), Gaps = 8/180 (4%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            KLFV NLP+S+  + +  LF Q G+VE VE +  +  G++RGF FVTM+S EEA AA+++
Sbjct  79   KLFVGNLPFSVDSAQLAGLFEQAGSVEMVEVVYDRMTGRSRGFGFVTMSSAEEAGAAVEQ  138

Query  618  FNSYELSGRTIRVEY-------SKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLR  460
            FN Y   GR +RV             + P          D   K+YV NL+W   ++ L 
Sbjct  139  FNGYTFQGRPLRVNSGPPPPRDDSAPRAPRGGGGGGNFVDSGNKVYVGNLSWGVDNSTLE  198

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
             LFS     + A+V+++  SG+S G+GFV +G+ EE   AIS++DG +L GR IR+ ++E
Sbjct  199  NLFSEQGQVLDAKVIYDRESGRSRGFGFVTYGSAEEVNNAISNLDGIDLDGRQIRVTVAE  258



>ref|XP_011013921.1| PREDICTED: ribonucleoprotein At2g37220, chloroplastic-like [Populus 
euphratica]
Length=273

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 106/176 (60%), Gaps = 4/176 (2%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            KLFV NLP+++  + +  LF   G VE VE I  K  G++RGF FVTMA+ EE EAA ++
Sbjct  91   KLFVGNLPFNVDSARLAGLFETAGNVEMVEVIYDKVTGRSRGFGFVTMATIEEVEAATKQ  150

Query  618  FNSYELSGRTIRVEYSKKFKKPI---RSpppppPRDGRYKLYVSNLAWKARSTHLRELFS  448
            FN YEL GRT+RV +    +K     R P      D   ++YV NL+W   +  L  LF 
Sbjct  151  FNGYELDGRTLRVNFGPPPQKESSFSRGPRGGETFDSGNRVYVGNLSWNVDNLALETLFR  210

Query  447  ANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
                 + ARVV++  SG+S G+GFV + + EE + AI S++G EL GR IR+ ++E
Sbjct  211  EKGRVMDARVVYDRDSGRSRGFGFVTYSSAEEVDNAIDSLNGAELDGRAIRVSVAE  266



>ref|XP_008466190.1| PREDICTED: 31 kDa ribonucleoprotein, chloroplastic [Cucumis melo]
Length=301

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 95/252 (38%), Positives = 141/252 (56%), Gaps = 16/252 (6%)
 Frame = -3

Query  993  FSKPLRLQISPNYP---TLSLKSLMRSLPSLASTKLKTSHIL-----RCStveeqavvav  838
            F  PL    +P+YP     +L S+ RS PSL ST +  + ++     R S    Q     
Sbjct  24   FLAPLSCSQNPSYPINGDFNL-SVSRSSPSLLSTSICHNPLISIMAKRTSKFVFQFASTS  82

Query  837  eteqEKTPKPNL----RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGF  670
            + E   +   ++    R +L   N+PW     D++ LF + GTV DVE     + +NRG 
Sbjct  83   QDEAVSSSPSDIEEFSRTRLLAQNVPWDSTPEDIRSLFEKYGTVLDVELSMYNKIRNRGL  142

Query  669  AFVTMASGEEAEAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNL  490
            AFVTM S EEA AA+    SYE  GRT+R+ Y+K  K+  +  PP  P+   + L+V+NL
Sbjct  143  AFVTMGSPEEALAALNNLESYEFEGRTLRLNYAKLKKE--KPSPPVKPKPVTFNLFVANL  200

Query  489  AWKARSTHLRELF-SANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTEL  313
             ++AR+  LRE F S + N +SA+++F     +S+GYGFVAF  K++AEAAIS   G   
Sbjct  201  PFEARAKDLREFFDSGSGNVVSAQIIFHENPRRSSGYGFVAFKAKKDAEAAISEFQGKTF  260

Query  312  LGRPIRLKMSEK  277
            +GR +R+  S++
Sbjct  261  MGRSLRVARSKQ  272



>ref|XP_009589536.1| PREDICTED: 28 kDa ribonucleoprotein, chloroplastic [Nicotiana 
tomentosiformis]
Length=293

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 112/177 (63%), Gaps = 3/177 (2%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            R ++   N PW+    D++ LF + GTV D+E     + ++RG  FVTM S EEA+A ++
Sbjct  94   RTRILAQNTPWTSTADDLRPLFEKYGTVMDIEVAMYNKTRSRGLVFVTMGSHEEAKAVLE  153

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSAN  442
               +YEL GR +R+ ++K  K    S PPP      + ++V+NL ++ARS  L E F AN
Sbjct  154  NLEAYELEGRPLRLAWAKP-KTVKPSSPPPSKPLPVHNVFVANLHFEARSKDLMEFFKAN  212

Query  441  -FNPISARVVFENASG-KSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
              + +SA V+F N +  +SAGYGFV+F TK EA+AA+SS +G E +GRPIR+  S++
Sbjct  213  GADVVSAEVIFNNDNPRRSAGYGFVSFNTKVEADAALSSFEGKEFMGRPIRVAHSKR  269



>gb|AFK44430.1| unknown [Medicago truncatula]
Length=291

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 113/181 (62%), Gaps = 2/181 (1%)
 Frame = -3

Query  813  KPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQ-NRGFAFVTMASGEEA  637
            +P    KLFV N P+ +    +  LFGQ GTVE  E I  ++   +RGF FVTM + EEA
Sbjct  104  EPPEDAKLFVGNFPFDVDSEKLAMLFGQAGTVEIAEVIYNRQTDLSRGFGFVTMNTVEEA  163

Query  636  EAAIQKFNSYELSGRTIRV-EYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLR  460
            E+A++KFN Y+ +GR++ V + S K  +P R+   P   +   ++YV+NLAW+  ++ L 
Sbjct  164  ESAVEKFNGYDYNGRSLVVNKASPKGSRPERTERAPRTFEPVLRIYVANLAWEVDNSRLE  223

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            ++FS +   +SARVV++  +G+S G+GFV    + E   AI+++DG  L GR IR+ ++E
Sbjct  224  QVFSEHGKIVSARVVYDRETGRSRGFGFVTMSDETEMNDAIAALDGQSLEGRTIRVSVAE  283

Query  279  K  277
             
Sbjct  284  D  284



>gb|KGN59223.1| hypothetical protein Csa_3G782700 [Cucumis sativus]
Length=323

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 113/180 (63%), Gaps = 10/180 (6%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            KL++ NLP+++  S + E+F + G V  V+ I  K   ++RGFAFVTMA+ EEA+ AI+ 
Sbjct  116  KLYIGNLPYAMTSSQLSEVFAEAGHVVSVQVIYDKVTDRSRGFAFVTMATLEEAKEAIRM  175

Query  618  FNSYELSGRTIRVEY-------SKKFKKP-IRSpppppPRDGRYKLYVSNLAWKARSTHL  463
            F+  ++ GRT+RV +        K+   P IRS       D  +K+Y  NL W   S  L
Sbjct  176  FDGSQIGGRTVRVNFPEVPRGGEKEVMGPRIRSSYNKFV-DSPHKIYAGNLGWGLTSQSL  234

Query  462  RELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
            R+ F      +SA+++++ ASGKS G+GFV+F T E+AE+A+ S++G E+ GRP+RL ++
Sbjct  235  RDAFENQPGILSAKIIYDRASGKSRGFGFVSFETAEDAESALESMNGVEVEGRPLRLNIA  294


 Score = 60.5 bits (145),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -3

Query  510  KLYVSNLAWKARSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISS  331
            KLY+ NL +   S+ L E+F+   + +S +V+++  + +S G+ FV   T EEA+ AI  
Sbjct  116  KLYIGNLPYAMTSSQLSEVFAEAGHVVSVQVIYDKVTDRSRGFAFVTMATLEEAKEAIRM  175

Query  330  IDGTELLGRPIRLKMSE  280
             DG+++ GR +R+   E
Sbjct  176  FDGSQIGGRTVRVNFPE  192



>ref|XP_004136521.1| PREDICTED: 33 kDa ribonucleoprotein, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004171108.1| PREDICTED: 33 kDa ribonucleoprotein, chloroplastic-like [Cucumis 
sativus]
Length=323

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 113/180 (63%), Gaps = 10/180 (6%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            KL++ NLP+++  S + E+F + G V  V+ I  K   ++RGFAFVTMA+ EEA+ AI+ 
Sbjct  116  KLYIGNLPYAMTSSQLSEVFAEAGHVVSVQVIYDKVTDRSRGFAFVTMATLEEAKEAIRM  175

Query  618  FNSYELSGRTIRVEY-------SKKFKKP-IRSpppppPRDGRYKLYVSNLAWKARSTHL  463
            F+  ++ GRT+RV +        K+   P IRS       D  +K+Y  NL W   S  L
Sbjct  176  FDGSQIGGRTVRVNFPEVPRGGEKEVMGPRIRSSYNKFV-DSPHKIYAGNLGWGLTSQSL  234

Query  462  RELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
            R+ F      +SA+++++ ASGKS G+GFV+F T E+AE+A+ S++G E+ GRP+RL ++
Sbjct  235  RDAFENQPGILSAKIIYDRASGKSRGFGFVSFETAEDAESALESMNGVEVEGRPLRLNIA  294


 Score = 60.5 bits (145),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -3

Query  510  KLYVSNLAWKARSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISS  331
            KLY+ NL +   S+ L E+F+   + +S +V+++  + +S G+ FV   T EEA+ AI  
Sbjct  116  KLYIGNLPYAMTSSQLSEVFAEAGHVVSVQVIYDKVTDRSRGFAFVTMATLEEAKEAIRM  175

Query  330  IDGTELLGRPIRLKMSE  280
             DG+++ GR +R+   E
Sbjct  176  FDGSQIGGRTVRVNFPE  192



>gb|KHN48247.1| Ribonucleoprotein, chloroplastic [Glycine soja]
Length=279

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 112/192 (58%), Gaps = 20/192 (10%)
 Frame = -3

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAE  634
            P+L  KLFV NLP+++  + + ELF   G VE VE I  K  G++RGF FVTM+S EEAE
Sbjct  87   PDL--KLFVGNLPFNVDSAQLAELFESAGNVEVVEVIYDKTTGRSRGFGFVTMSSVEEAE  144

Query  633  AAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPR-------------DGRYKLYVSN  493
            AA Q+FN YEL GR++RV        P R+   P  R             D   +++V N
Sbjct  145  AAAQQFNGYELDGRSLRVNSGPP---PARNESAPRFRGGSSFGSRGGGPSDSENRVHVGN  201

Query  492  LAWKARSTHLRELFSANFNPI-SARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTE  316
            LAW      L  LF      +  ARV+++  SG+S G+GFV FG+ +E ++AI S+DG +
Sbjct  202  LAWGVDDVALESLFREQGKKVLEARVIYDRESGRSRGFGFVTFGSPDEVKSAIQSLDGVD  261

Query  315  LLGRPIRLKMSE  280
            L GR IR+ +++
Sbjct  262  LNGRAIRVSLAD  273



>ref|NP_001239665.1| uncharacterized protein LOC100790280 [Glycine max]
 gb|ACU22730.1| unknown [Glycine max]
Length=290

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 108/180 (60%), Gaps = 1/180 (1%)
 Frame = -3

Query  813  KPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEA  637
            +P    KLFV NLP+ +    +  LF Q GTVE  E I  +E  Q+RGF FVTM++ EEA
Sbjct  104  EPPEEAKLFVGNLPYDVDSQKLAMLFEQAGTVEIAEVIYNRETDQSRGFGFVTMSTVEEA  163

Query  636  EAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRE  457
            E+A++KFN Y++ GR + V  +         PPP    +    +YV NL W   +T L++
Sbjct  164  ESAVEKFNRYDIDGRLLTVNKASPRGTRPERPPPRRSFESSLSIYVGNLPWDVDNTRLKQ  223

Query  456  LFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
            +FS + N ++ARVV++  SG+S G+GFV    + E   A++++DG  L GR I++ ++E 
Sbjct  224  IFSKHGNVVNARVVYDRESGRSRGFGFVTMSDETEMNDAVAALDGESLDGRAIKVSVAED  283



>gb|KHN07969.1| 31 kDa ribonucleoprotein, chloroplastic [Glycine soja]
Length=290

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 108/180 (60%), Gaps = 1/180 (1%)
 Frame = -3

Query  813  KPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEA  637
            +P    KLFV NLP+ +    +  LF Q GTVE  E I  +E  Q+RGF FVTM++ EEA
Sbjct  104  EPPEEAKLFVGNLPYDVDSQKLAMLFEQAGTVEIAEVIYNRETDQSRGFGFVTMSTVEEA  163

Query  636  EAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRE  457
            E+A++KFN Y++ GR + V  +         PPP    +    +YV NL W   +T L++
Sbjct  164  ESAVEKFNRYDIDGRLLTVNKASPRGTRPERPPPRRSFESSLSIYVGNLPWDVDNTRLKQ  223

Query  456  LFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
            +FS + N ++ARVV++  SG+S G+GFV    + E   A++++DG  L GR I++ ++E 
Sbjct  224  IFSKHGNVVNARVVYDRESGRSRGFGFVTMSDETEMNDAVAALDGESLDGRAIKVSVAED  283



>ref|XP_004501684.1| PREDICTED: 28 kDa ribonucleoprotein, chloroplastic-like [Cicer 
arietinum]
Length=287

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 108/180 (60%), Gaps = 11/180 (6%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            R +L   N+PW+    D++ LF Q G V DVE  +  + +NRG AFV M+S EEA AA  
Sbjct  84   RTRLLAQNVPWTSTAEDIRSLFEQHGKVLDVELSRYNKNRNRGLAFVEMSSPEEALAAFN  143

Query  621  KFNSYELSGRTIRVEYS----KKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLREL  454
               SYE  GR I ++Y+    +K   P++  P        + L+V+NL+++ARS  LRE 
Sbjct  144  SLESYEFEGRVIHLKYAWPKKEKTPPPVKQNPIT------FNLFVANLSYEARSKDLREF  197

Query  453  F-SANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
            F S +   +SA V+F     + +GYGFV+F +K+EA  A+S+ +G   +GRPIR+K S++
Sbjct  198  FDSGSGRVVSAEVIFNENPRRPSGYGFVSFKSKKEATEALSAFEGKNFMGRPIRVKPSKR  257



>ref|NP_199836.1| chloroplast RNA-binding protein 31B [Arabidopsis thaliana]
 sp|Q9FGS0.1|CP31B_ARATH RecName: Full=RNA-binding protein CP31B, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAB09396.1| RNA-binding protein-like [Arabidopsis thaliana]
 gb|AAK63972.1| AT5g50250/K6A12_11 [Arabidopsis thaliana]
 gb|AAL76138.1| AT5g50250/K6A12_11 [Arabidopsis thaliana]
 gb|AED95918.1| chloroplast RNA-binding protein 31B [Arabidopsis thaliana]
Length=289

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 108/181 (60%), Gaps = 3/181 (2%)
 Frame = -3

Query  816  PKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEE  640
            P+P    KLFV NLP+ +    +  LF Q GTVE  E I  ++  Q+RGF FVTM++ EE
Sbjct  107  PEPPEEAKLFVGNLPYDVDSQALAMLFEQAGTVEISEVIYNRDTDQSRGFGFVTMSTVEE  166

Query  639  AEAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLR  460
            AE A++KFNS+E++GR  R+  ++   +  R    P   D  +++YV NL W   S  L 
Sbjct  167  AEKAVEKFNSFEVNGR--RLTVNRAAPRGSRPERQPRVYDAAFRIYVGNLPWDVDSGRLE  224

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
             LFS +   + ARVV +  +G+S G+GFV    + E   AI+++DG  L GR I++ ++E
Sbjct  225  RLFSEHGKVVDARVVSDRETGRSRGFGFVQMSNENEVNVAIAALDGQNLEGRAIKVNVAE  284

Query  279  K  277
            +
Sbjct  285  E  285



>ref|XP_003562626.1| PREDICTED: ribonucleoprotein At2g37220, chloroplastic-like [Brachypodium 
distachyon]
Length=275

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 109/182 (60%), Gaps = 10/182 (5%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            KLFV NLP+++  + +  LF Q G+VE VE +  +  G++RGF FVTM++ EE  AA+++
Sbjct  85   KLFVGNLPFTVDSAQLAGLFEQAGSVEMVEVVYDRMTGRSRGFGFVTMSTAEEVSAAVEQ  144

Query  618  FNSYELSGRTIRV---------EYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTH  466
            FN Y   GR +RV         E++ +  + +         D   KLYV NL+W   ++ 
Sbjct  145  FNGYTFQGRPLRVNSGPPPPRDEFAPRTPRGMGGGGGGGSFDSGNKLYVGNLSWGVDNST  204

Query  465  LRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKM  286
            L  LFS     + A+V+++  SG+S G+GFV +G+ +E   AIS++DG +L GR IR+ +
Sbjct  205  LENLFSEQGKVLDAKVIYDRDSGRSRGFGFVTYGSADEVNNAISNLDGVDLDGRQIRVTV  264

Query  285  SE  280
            +E
Sbjct  265  AE  266



>ref|XP_009770625.1| PREDICTED: 28 kDa ribonucleoprotein, chloroplastic [Nicotiana 
sylvestris]
Length=293

 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 112/177 (63%), Gaps = 3/177 (2%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            R ++   N PW+    D++ LF + GTV D+E     + ++RG  FVTM S EEA+A I+
Sbjct  94   RTRILAQNAPWTSTADDLRPLFEKYGTVMDIEVAMYNKTRSRGLVFVTMGSHEEAKAVIE  153

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSAN  442
               +YEL GR +R+ ++K  K    S PPP      + ++V+NL ++ARS  L E F AN
Sbjct  154  NLEAYELEGRPLRLAWAKP-KTVKPSSPPPSKPLPVHNVFVANLHFEARSKDLMEFFKAN  212

Query  441  -FNPISARVVFENASG-KSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
              + +SA V+F + +  +SAGYGFV+F TK EA+AA+SS +G E +GRPIR+  S++
Sbjct  213  GADVVSAEVIFNSDNPRRSAGYGFVSFNTKVEADAALSSFEGKEFMGRPIRVAHSKR  269



>ref|XP_002865780.1| hypothetical protein ARALYDRAFT_918033 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42039.1| hypothetical protein ARALYDRAFT_918033 [Arabidopsis lyrata subsp. 
lyrata]
Length=291

 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 112/184 (61%), Gaps = 5/184 (3%)
 Frame = -3

Query  822  KTPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASG  646
            K P+P    KLFV NLP+ +    +  LF Q GTVE  E I  ++  Q+RGF FVTM++ 
Sbjct  105  KFPEPPEEAKLFVGNLPYDVDSQALAMLFEQAGTVEISEVIYNRDTDQSRGFGFVTMSTV  164

Query  645  EEAEAAIQKFNSYELSGRTIRVEYSK-KFKKPIRSpppppPRDGRYKLYVSNLAWKARST  469
            EEA+ A++KFN YE++GR + V  +  +  +P R P      D  +++YV NL W   + 
Sbjct  165  EEAKKAVEKFNRYEVNGRLLTVNIAAPRGSRPERQPRQY---DAAFRIYVGNLPWDVDND  221

Query  468  HLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLK  289
             L+++FS +   + ARVV++  +G+S G+GFV    + E   AI+++DG  L GR I++ 
Sbjct  222  RLQQVFSEHGKVVDARVVYDRETGRSRGFGFVTMSNENEVNDAIAALDGQNLEGRAIKVN  281

Query  288  MSEK  277
            ++E+
Sbjct  282  VAEE  285



>ref|XP_009342961.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic-like [Pyrus 
x bretschneideri]
Length=280

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 106/186 (57%), Gaps = 11/186 (6%)
 Frame = -3

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAE  634
            P+L  KLFV NLP+S+  + +  +F   G V+ VE I  K  G++RGF FVTM+S +EAE
Sbjct  90   PDL--KLFVGNLPFSVDSAQLAGIFESAGNVQMVEVIYDKTTGRSRGFGFVTMSSVQEAE  147

Query  633  AAIQKFNSYELSGRTIRVEY--------SKKFKKPIRSpppppPRDGRYKLYVSNLAWKA  478
            +A ++ N YEL GR +RV Y           F+            D   +LYV NLAW  
Sbjct  148  SAARQLNGYELDGRALRVNYGPPPPRTEDSSFRGARGPRGGGGGYDSNNRLYVGNLAWGV  207

Query  477  RSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPI  298
             +  L  LFS     + A+VV++  SG+S G+GFV + T +E  +AI S+DG +L GR I
Sbjct  208  DNLALENLFSEQGKVLEAKVVYDRDSGRSRGFGFVTYDTADEMNSAIESLDGVDLNGRSI  267

Query  297  RLKMSE  280
            R+  +E
Sbjct  268  RVTAAE  273



>ref|XP_011074215.1| PREDICTED: 28 kDa ribonucleoprotein, chloroplastic-like [Sesamum 
indicum]
Length=269

 Score =   131 bits (330),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 108/185 (58%), Gaps = 20/185 (11%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            + +L V N+PW+  V D++ LF   GTV D+EF    + +NRG AFVTM S EEA AA+ 
Sbjct  77   KTRLLVQNVPWTCTVDDIRPLFANYGTVVDIEFSMYNKTKNRGLAFVTMGSHEEALAALN  136

Query  621  KFNSYELSGRTIRVEYSKKFK---------KPIRSpppppPRDGRYKLYVSNLAWKARST  469
               S E  GR +++ ++K  K         KP+            + L+V+NL ++A + 
Sbjct  137  NLESTEFEGRVLKLNWAKPKKKKPSSLPQPKPLPV----------HNLFVANLPFQAGAN  186

Query  468  HLRELFSA-NFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRL  292
             L+  F+A N N +SA V+F++   +SAGYGFV+F TK EAEAA++   G E +GR IR+
Sbjct  187  DLKNFFNADNANVVSAEVIFQDNPRRSAGYGFVSFNTKAEAEAALAIFQGKEFMGRAIRV  246

Query  291  KMSEK  277
              S +
Sbjct  247  ARSRR  251


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 44/87 (51%), Gaps = 2/87 (2%)
 Frame = -3

Query  816  PKPNLRRKLFVLNLPWSLAVSDVKELF-GQCGTVEDVEFI-KTKEGQNRGFAFVTMASGE  643
            PKP     LFV NLP+    +D+K  F      V   E I +    ++ G+ FV+  +  
Sbjct  166  PKPLPVHNLFVANLPFQAGANDLKNFFNADNANVVSAEVIFQDNPRRSAGYGFVSFNTKA  225

Query  642  EAEAAIQKFNSYELSGRTIRVEYSKKF  562
            EAEAA+  F   E  GR IRV  S++F
Sbjct  226  EAEAALAIFQGKEFMGRAIRVARSRRF  252



>gb|AFW61755.1| ribonucleoprotein [Zea mays]
Length=286

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 112/182 (62%), Gaps = 11/182 (6%)
 Frame = -3

Query  813  KPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEA  637
            +P    K++V NLP+ +    + ++F Q G VE  E I  +E GQ+RGF FVTM++ EEA
Sbjct  103  EPPEEAKVYVGNLPYDVDSEGLAQIFDQAGVVEVAEVIYNRETGQSRGFGFVTMSTVEEA  162

Query  636  EAAIQKFNSYELSGRTIRVEYSK----KFKKPIRSpppppPRDGRYKLYVSNLAWKARST  469
            + AI+ F+ Y++SGR + V  +     + ++P R   P       ++ YV NL W+   +
Sbjct  163  DKAIEMFSRYDISGRLLNVNRASSRGTRMERPQRQFAPA------FRAYVGNLPWQVDDS  216

Query  468  HLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLK  289
             L +LFS +   + A+VV++  +G+S G+GFV+  +KEE   AIS++DG EL GRP+R+ 
Sbjct  217  RLVQLFSEHGEVVDAKVVYDRETGRSRGFGFVSMVSKEELNDAISALDGQELDGRPLRVN  276

Query  288  MS  283
            ++
Sbjct  277  VA  278



>emb|CDY23210.1| BnaA04g05490D [Brassica napus]
Length=311

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 113/181 (62%), Gaps = 8/181 (4%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            +L+V NLP+++  S++ +LFGQ GTV DV+ +  K   ++RGF FVTM + EEA+ AIQ 
Sbjct  105  RLYVGNLPYTITSSELSQLFGQAGTVVDVQIVYDKVTDRSRGFGFVTMGTIEEAKEAIQM  164

Query  618  FNSYELSGRTIRVEYSKKFKKPIRSpppppPR-------DGRYKLYVSNLAWKARSTHLR  460
            FN+ ++ GRT++V + +  +   R       R       D  +KLY  NL W   S  L+
Sbjct  165  FNTSQIGGRTVKVNFPEVPRGGEREVLRAKIRGSNRSYVDSPHKLYAGNLGWNLTSQGLK  224

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            + F+     + A+VV+E  SG+S G+GFV+F + ++ ++A+S+++G E+ GR +RL ++ 
Sbjct  225  DAFADQPGVLGAKVVYERDSGRSRGFGFVSFESAQDLQSAMSAMNGVEVEGRELRLNLAS  284

Query  279  K  277
            +
Sbjct  285  E  285



>ref|XP_007028003.1| Chloroplast RNA-binding protein 33 [Theobroma cacao]
 gb|EOY08505.1| Chloroplast RNA-binding protein 33 [Theobroma cacao]
Length=340

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 114/179 (64%), Gaps = 8/179 (4%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            +L+V NLP+S+  S++ E+F + G V +VE +  +   ++RGFAFVTMAS ++A+ AI+ 
Sbjct  131  RLYVGNLPYSMTSSELSEIFNEAGRVANVEIVYDRVTDRSRGFAFVTMASVDDAKEAIRL  190

Query  618  FNSYELSGRTIRVEYSKKFKKPIRSpppppPR-------DGRYKLYVSNLAWKARSTHLR  460
            F+  ++ GRT++V + +  +   R    P  R       D  YK+Y  NL W   S  LR
Sbjct  191  FDGSQVGGRTVKVNFPEVPRGGEREVMGPKIRRGYKSFLDSPYKIYAGNLGWGVTSQGLR  250

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
            + F++    +SA+V++E  +G+S G+GFV+F + E  EAA+++++G E+ GRP+RL M+
Sbjct  251  DAFASQPGLLSAKVIYERDTGRSRGFGFVSFESAETVEAALNAMNGVEVEGRPLRLNMA  309



>ref|XP_008369683.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic [Malus domestica]
 ref|XP_008369684.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic [Malus domestica]
 ref|XP_008369686.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic [Malus domestica]
Length=275

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 108/191 (57%), Gaps = 18/191 (9%)
 Frame = -3

Query  819  TPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGE  643
            +P+P    KLFV NLP+S+  + +  +F   G VE VE I  K  G++RGF FVTM++ +
Sbjct  85   SPEP----KLFVGNLPFSVDSAQLAGIFESAGNVEMVEVIYDKTTGRSRGFGFVTMSNVQ  140

Query  642  EAEAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppp----------pPRDGRYKLYVSN  493
            EAE+A ++ N YEL GR +RV Y      P R+                 D   +LYV N
Sbjct  141  EAESAARQLNGYELDGRALRVNYGPP---PPRTEDSSFRGARGPRGGGGYDSNNRLYVGN  197

Query  492  LAWKARSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTEL  313
            LAW   +  L  LFS     + A+VVF+  SG+S G+GFV + T +E  +AI S+DG +L
Sbjct  198  LAWGVDNLALENLFSEQGKVLEAKVVFDRDSGRSRGFGFVTYDTADEMNSAIESLDGVDL  257

Query  312  LGRPIRLKMSE  280
             GR IR+  +E
Sbjct  258  NGRSIRVSAAE  268



>dbj|BAJ87427.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91733.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=278

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 108/182 (59%), Gaps = 10/182 (5%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            K+FV NLP+++  + +  LF Q G+VE VE +  +  G++RGF FVTM S EE  AA+++
Sbjct  88   KVFVGNLPFTVDSAQLAGLFEQAGSVEMVEVVYDRMTGRSRGFGFVTMGSVEEVAAAVEQ  147

Query  618  FNSYELSGRTIRV---------EYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTH  466
            FN Y   GR +RV         E++ +  + +         D   KLYV NL+W   ++ 
Sbjct  148  FNGYTFQGRPLRVNSGPPPPRDEFAPRTPRAMGGGGGGGSFDSANKLYVGNLSWGVDNST  207

Query  465  LRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKM  286
            L  LFS     + A+V+++  SG+S G+GFV +G+ +E   AIS++DG +L GR IR+ +
Sbjct  208  LENLFSEQGKVLDAKVIYDRDSGRSRGFGFVTYGSADEVNNAISNLDGVDLDGRQIRVTV  267

Query  285  SE  280
            +E
Sbjct  268  AE  269



>gb|KHG03704.1| 33 kDa ribonucleoprotein, chloroplastic [Gossypium arboreum]
Length=327

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 113/179 (63%), Gaps = 8/179 (4%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            KL+V NLP+S+  S++ E+F + G+V  VE +  +   ++RGF FVTM S +EA+ AI+ 
Sbjct  123  KLYVGNLPYSMTSSELTEIFSEAGSVAKVEIVYDRVTDRSRGFGFVTMGSVDEAKEAIRL  182

Query  618  FNSYELSGRTIRVEYSKKFKKPIRSpppppPR-------DGRYKLYVSNLAWKARSTHLR  460
            F+  ++ GRT++V + +  K   R    P  R       D  YK+Y  NL W+  S  LR
Sbjct  183  FDGSQVGGRTVKVNFPEVPKGGEREVMGPRIRRSYTSFIDSPYKIYAGNLGWRVTSEGLR  242

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
            + F++    +SA+V++E  +G+S G+GF++F + E  E+A+++++G E+ GRP+RL M+
Sbjct  243  DAFASQPGLLSAKVIYEKDTGRSRGFGFISFESAETVESALTAMNGVEVEGRPLRLNMA  301


 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = -3

Query  510  KLYVSNLAWKARSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISS  331
            KLYV NL +   S+ L E+FS   +     +V++  + +S G+GFV  G+ +EA+ AI  
Sbjct  123  KLYVGNLPYSMTSSELTEIFSEAGSVAKVEIVYDRVTDRSRGFGFVTMGSVDEAKEAIRL  182

Query  330  IDGTELLGRPIRLKMSE  280
             DG+++ GR +++   E
Sbjct  183  FDGSQVGGRTVKVNFPE  199



>dbj|BAD09078.1| putative nucleic acid-binding protein [Oryza sativa Japonica 
Group]
 gb|EAZ43633.1| hypothetical protein OsJ_28256 [Oryza sativa Japonica Group]
 dbj|BAG92121.1| unnamed protein product [Oryza sativa Japonica Group]
Length=305

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 110/176 (63%), Gaps = 11/176 (6%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAEAAIQK  619
            K++V NLP+ +    + +LF Q G VE  E I  +E GQ+RGF FVTM++ EEA+ AI+ 
Sbjct  128  KVYVGNLPYDVDSEGLAQLFEQAGVVEVAEVIYNRETGQSRGFGFVTMSTIEEADKAIEM  187

Query  618  FNSYELSGRTIRVEYS----KKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELF  451
             N Y+++GR + V  +     + ++P R   P       ++ YV NL W+   + L +LF
Sbjct  188  LNRYDINGRLLNVNRAAPRGSRVERPPRQFAPA------FRAYVGNLPWQVDDSRLLQLF  241

Query  450  SANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
            S +   ++A VV++  SG+S G+GFV+  +KEE + AIS++DG EL GRP+R+ ++
Sbjct  242  SEHGEVVNASVVYDRESGRSRGFGFVSMASKEELDDAISALDGQELDGRPLRVNVA  297



>ref|XP_010312344.1| PREDICTED: 29 kDa ribonucleoprotein B, chloroplastic-like [Solanum 
lycopersicum]
Length=291

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 110/195 (56%), Gaps = 19/195 (10%)
 Frame = -3

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAE  634
            P+L  KLFV NLP+S+  + + ELF + G VE VE I  K  G++RGF FVTM+S  E E
Sbjct  92   PDL--KLFVGNLPFSVDSATLAELFERAGNVEMVEVIYDKLTGRSRGFGFVTMSSKAEVE  149

Query  633  AAIQKFNSYELSGRTIRVEYSKKFKKPIRS-----------pppppPRDGRY-----KLY  502
            AA Q+FN YE+ GR +RV      +K   S                 R GR      ++Y
Sbjct  150  AAEQQFNGYEIDGRALRVNSGPAPEKRENSFGGGRGGRSENSSYGGARGGRNFDSSNRVY  209

Query  501  VSNLAWKARSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDG  322
            V NL+W      LRELFS     +  +VV++  SG+S G+GFV F + +E   AI S++G
Sbjct  210  VGNLSWGVDDLSLRELFSDQGKVVDCKVVYDRDSGRSRGFGFVTFSSAQEVNKAIDSLNG  269

Query  321  TELLGRPIRLKMSEK  277
             +L GRPIR+  +E+
Sbjct  270  FDLDGRPIRVSAAEE  284



>gb|EAZ07975.1| hypothetical protein OsI_30233 [Oryza sativa Indica Group]
Length=306

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 110/176 (63%), Gaps = 11/176 (6%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAEAAIQK  619
            K++V NLP+ +    + +LF Q G VE  E I  +E GQ+RGF FVTM++ EEA+ AI+ 
Sbjct  129  KVYVGNLPYDVDSEGLAQLFEQAGVVEVAEVIYNRETGQSRGFGFVTMSTIEEADKAIEM  188

Query  618  FNSYELSGRTIRVEYS----KKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELF  451
             N Y+++GR + V  +     + ++P R   P       ++ YV NL W+   + L +LF
Sbjct  189  LNRYDINGRLLNVNRAAPRGSRVERPPRQFAPA------FRAYVGNLPWQVDDSRLLQLF  242

Query  450  SANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
            S +   ++A VV++  SG+S G+GFV+  +KEE + AIS++DG EL GRP+R+ ++
Sbjct  243  SEHGEVVNASVVYDRESGRSRGFGFVSMASKEELDDAISALDGQELDGRPLRVNVA  298



>tpg|DAA63746.1| TPA: hypothetical protein ZEAMMB73_977373 [Zea mays]
Length=267

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 108/185 (58%), Gaps = 15/185 (8%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            KLFV NLP+S+  + +  LF Q G+VE VE +  +  G++RGF FVTM+S EEA AA+++
Sbjct  78   KLFVGNLPFSVDSAQLAGLFEQAGSVEMVEVVYDRMTGRSRGFGFVTMSSAEEAGAAVEQ  137

Query  618  FNSYELSGRTIRVEYSKKFKKPIRSpppppPR------------DGRYKLYVSNLAWKAR  475
            FN Y   GR +RV        P     P  PR            D   K+YV NLAW   
Sbjct  138  FNGYTFQGRPLRVNCGPP--PPRDGSAPRAPRGGGGGGGGGSFVDSGNKVYVGNLAWGVD  195

Query  474  STHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIR  295
            ++ L  LFS     + A+V+++  SG+S G+GFV +G+ EE   AIS++DG +L GR IR
Sbjct  196  NSTLENLFSEQGQVLDAKVIYDRDSGRSRGFGFVTYGSAEEVNNAISNLDGIDLDGRQIR  255

Query  294  LKMSE  280
            + ++E
Sbjct  256  VTVAE  260


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 48/84 (57%), Gaps = 3/84 (4%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAEAAIQK  619
            K++V NL W +  S ++ LF + G V D + I  ++ G++RGF FVT  S EE   AI  
Sbjct  184  KVYVGNLAWGVDNSTLENLFSEQGQVLDAKVIYDRDSGRSRGFGFVTYGSAEEVNNAISN  243

Query  618  FNSYELSGRTIRVEYSKKFKKPIR  547
             +  +L GR IRV  ++   KP R
Sbjct  244  LDGIDLDGRQIRVTVAE--SKPRR  265


 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 44/83 (53%), Gaps = 4/83 (5%)
 Frame = -3

Query  525  RDGRY----KLYVSNLAWKARSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTK  358
            +DG +    KL+V NL +   S  L  LF    +     VV++  +G+S G+GFV   + 
Sbjct  69   QDGEFSEDLKLFVGNLPFSVDSAQLAGLFEQAGSVEMVEVVYDRMTGRSRGFGFVTMSSA  128

Query  357  EEAEAAISSIDGTELLGRPIRLK  289
            EEA AA+   +G    GRP+R+ 
Sbjct  129  EEAGAAVEQFNGYTFQGRPLRVN  151



>ref|XP_010026026.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic [Eucalyptus 
grandis]
 gb|KCW83088.1| hypothetical protein EUGRSUZ_B00046 [Eucalyptus grandis]
 gb|KCW83089.1| hypothetical protein EUGRSUZ_B00046 [Eucalyptus grandis]
Length=307

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 112/175 (64%), Gaps = 4/175 (2%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQKF  616
            +L   N+PW+    DV+ LF + GTV +VE     + +NRG AFV M S EEA  A+   
Sbjct  105  RLIAQNVPWTCTAEDVRSLFEKHGTVVEVELSMHNKMRNRGLAFVEMGSAEEALNALNSL  164

Query  615  NSYELSGRTIRVEYSKKFKKPIRSpppppPRD-GRYKLYVSNLAWKARSTHLRELFSANF  439
             S E  GR ++V Y+K  KK  +SPPP  PR    + L+++NL+++AR+  LRE F A  
Sbjct  165  ESSEFEGRVLKVNYAKLRKK--KSPPPAQPRPIATFNLFIANLSYEARAKDLREFFDAGS  222

Query  438  NPI-SARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
              + SA V+F +   +S+GYGFV+F +K+EAEAA+++ +G + +GRP+R+  S++
Sbjct  223  GKVASAEVIFHDNPRRSSGYGFVSFKSKKEAEAALTTFEGKDFMGRPLRVARSKQ  277



>ref|XP_009384983.1| PREDICTED: 33 kDa ribonucleoprotein, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=326

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 111/178 (62%), Gaps = 6/178 (3%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQ-NRGFAFVTMASGEEAEAAIQK  619
            +L+V NLP+++  +++ E+F + GTVE VE +  +  + +RGFAFVTMAS EEA  AI+ 
Sbjct  121  RLYVGNLPFTMTPAELAEVFSEAGTVETVEVVYDRVTERSRGFAFVTMASVEEANEAIRM  180

Query  618  FNSYELSGRTIRVEYSKKFKKPIRSpppppPR-----DGRYKLYVSNLAWKARSTHLREL  454
            F+  ++ GRT++V + +  +   R    P  R     D  YK+Y  NL W   S  LR+ 
Sbjct  181  FDGSQVGGRTVKVNFPEVPRGGEREVLGPRMRSRGFVDSPYKVYAGNLGWSLTSQALRDA  240

Query  453  FSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            F +    + A+V+F+  +G+S G+GFV F + EE +AAI +++G  + GRP+RL ++E
Sbjct  241  FFSQPGLLGAKVIFDRDTGRSRGFGFVTFASAEECQAAIEAMNGVVVEGRPLRLSLAE  298



>ref|XP_009409107.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=273

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 108/176 (61%), Gaps = 4/176 (2%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            KLFV NLP+S+  + +  LF + G VE VE I  K  G++RGF FVTM++  E EAAI++
Sbjct  91   KLFVGNLPFSVDSAQLAGLFQRAGNVEMVEVIYDKLTGKSRGFGFVTMSTINEVEAAIKQ  150

Query  618  FNSYELSGRTIRVEYSKKFKK---PIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFS  448
            FN Y L GR++RV      ++   P +        +   K+YV NL+W   +  L  LFS
Sbjct  151  FNGYTLEGRSLRVNSGPPPRREEFPSKGFRTVSNLEAANKVYVGNLSWGVDNLALETLFS  210

Query  447  ANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
                 + A+VV++  SG+S G+GFV + + EE + AI+S++GT+L GR IR+ ++E
Sbjct  211  EQGKVLEAKVVYDRESGRSRGFGFVTYSSAEEVDNAIASLNGTDLNGRSIRVTVAE  266



>dbj|BAA06520.1| RNA-binding protein cp31 [Arabidopsis thaliana]
Length=314

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 109/181 (60%), Gaps = 3/181 (2%)
 Frame = -3

Query  816  PKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEE  640
            P+P+   KLFV NL + +    +  LF Q GTVE  E I  +E  Q+RGF FVTM+S +E
Sbjct  129  PEPSEEAKLFVGNLAYDVNSQALAMLFEQAGTVEIAEVIYNRETDQSRGFGFVTMSSVDE  188

Query  639  AEAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLR  460
            AE A++KFN Y+L+GR + V  +K   +  R    P   +  +++YV NL W   +  L 
Sbjct  189  AETAVEKFNRYDLNGRLLTV--NKAAPRGSRPERAPRVYEPAFRVYVGNLPWDVDNGRLE  246

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            +LFS +   + ARVV++  +G+S G+GFV     +E   AIS++DG  L GR IR+ ++E
Sbjct  247  QLFSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDELNEAISALDGQNLEGRAIRVNVAE  306

Query  279  K  277
            +
Sbjct  307  E  307



>ref|NP_001240946.1| uncharacterized protein LOC100812934 [Glycine max]
 gb|ACU20155.1| unknown [Glycine max]
Length=279

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 109/187 (58%), Gaps = 18/187 (10%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAEAAIQK  619
            KLFV NLP+S+  + + ELF   G VE VE I  K  G++RGF FVTM+S EEAEAA ++
Sbjct  90   KLFVGNLPFSVDSARLAELFESAGNVEVVEVIYDKTTGRSRGFGFVTMSSVEEAEAAAKQ  149

Query  618  FNSYELSGRTIRVEYSKKFKKPIRSpppppPR-------------DGRYKLYVSNLAWKA  478
            FN YEL GR++RV        P R+   P  R             D   +++V NLAW  
Sbjct  150  FNGYELDGRSLRVNSGPP---PARNESAPRFRGGSSFGSRGGGPSDSENRVHVGNLAWGV  206

Query  477  RSTHLRELFSANFNPI-SARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRP  301
                L  LF      +  ARV+++  SG+S G+GFV FG+ +E ++AI S+DG +L GR 
Sbjct  207  DDVALESLFREQGKKVLEARVIYDRESGRSRGFGFVTFGSPDEVKSAIQSLDGVDLNGRA  266

Query  300  IRLKMSE  280
            IR+ +++
Sbjct  267  IRVSLAD  273



>ref|XP_009139461.1| PREDICTED: 33 kDa ribonucleoprotein, chloroplastic [Brassica 
rapa]
Length=309

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 113/181 (62%), Gaps = 8/181 (4%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            +L+V NLP+++  S++ +LFGQ GTV DV+ +  K   ++RGF FVTM + EEA+ AIQ 
Sbjct  103  RLYVGNLPYTITSSELSQLFGQAGTVVDVQIVYDKVTDRSRGFGFVTMGTIEEAKEAIQM  162

Query  618  FNSYELSGRTIRVEYSKKFKKPIRSpppppPR-------DGRYKLYVSNLAWKARSTHLR  460
            FN+ ++ GRT++V + +  +   R       R       D  +KLY  NL W   S  L+
Sbjct  163  FNTSQIGGRTVKVNFPEVPRGGEREVLRAKIRGSNRSYVDSPHKLYAGNLGWNLTSQGLK  222

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            + F+     + A+VV+E  SG++ G+GFV+F + ++ ++A+S+++G E+ GR +RL ++ 
Sbjct  223  DAFADQPGALGAKVVYERDSGRARGFGFVSFESAQDLQSAMSAMNGVEVEGRELRLNLAS  282

Query  279  K  277
            +
Sbjct  283  E  283



>ref|XP_006857647.1| hypothetical protein AMTR_s00061p00142700 [Amborella trichopoda]
 gb|ERN19114.1| hypothetical protein AMTR_s00061p00142700 [Amborella trichopoda]
Length=306

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 105/174 (60%), Gaps = 4/174 (2%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAEAAIQK  619
            KLFV NLP+ L    + ELF + G VE  E I  +E  Q+RGF FVTM++ EEAE A++ 
Sbjct  129  KLFVGNLPYDLDSEKLAELFDKAGVVEIAEIIYNRETDQSRGFGFVTMSTVEEAEKAVET  188

Query  618  FNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSANF  439
             + YEL+GR + V  +      ++S       +  YK+YV NL W+     L ++F+ + 
Sbjct  189  LHRYELNGRLLTVNKASARGSRMQSVGEL---EPSYKIYVGNLPWQVDDARLEQVFAEHG  245

Query  438  NPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
            N + ARVV++  SG+S G+GFV   T+ E +  I+++DG  L GR IR+ ++E+
Sbjct  246  NVVDARVVYDRESGRSRGFGFVKMSTRSELDDVIAALDGQSLDGRSIRVNVAEE  299



>ref|XP_002461076.1| hypothetical protein SORBIDRAFT_02g040260 [Sorghum bicolor]
 gb|EER97597.1| hypothetical protein SORBIDRAFT_02g040260 [Sorghum bicolor]
Length=268

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 105/183 (57%), Gaps = 11/183 (6%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            KLFV NLP+S+  + +  LF Q G+VE VE +  +  G++RGF FVTM+S EEA AA+++
Sbjct  79   KLFVGNLPFSVDSAQLAGLFEQAGSVEMVEVVYDRMTGRSRGFGFVTMSSAEEAGAAVEQ  138

Query  618  FNSYELSGRTIRVEYS----------KKFKKPIRSpppppPRDGRYKLYVSNLAWKARST  469
            FN Y   GR +RV             +  +            D   K+YV NLAW   ++
Sbjct  139  FNGYTFQGRPLRVNCGPPPPRDESAPRAPRGGGGGGGGGSFVDSANKVYVGNLAWGVDNS  198

Query  468  HLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLK  289
             L  LFS     + A+V+++  SG+S G+GFV +GT  E   AIS++DG +L GR IR+ 
Sbjct  199  TLENLFSEQGQVLDAKVIYDRESGRSRGFGFVTYGTAAEVNNAISNLDGIDLDGRQIRVT  258

Query  288  MSE  280
            ++E
Sbjct  259  VAE  261



>ref|XP_010530167.1| PREDICTED: 28 kDa ribonucleoprotein, chloroplastic [Tarenaya 
hassleriana]
Length=307

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 113/176 (64%), Gaps = 2/176 (1%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            + +L   N+PW+    D++ LF + G V D+E     + +NRG AF+ M S EEA +A++
Sbjct  100  KSRLIAQNVPWTSTPEDIRSLFEKYGNVVDIEVSMHNKSRNRGLAFIEMGSPEEAASALR  159

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELF-SA  445
               SY+  GR +++ Y+K+ K    +PP  P     + L+V+NL+++AR+ +L+E F S 
Sbjct  160  NLESYQYEGRVLKINYAKR-KTEKPAPPAKPNPVPTFNLFVANLSFEARAKNLKEFFDSG  218

Query  444  NFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
            + N +SA ++F +   +S+GYGFV+F TK++AEAA++   G E +GRPIR+  S++
Sbjct  219  SGNVVSAEIIFHDNPRRSSGYGFVSFKTKKQAEAALNDFQGKEFMGRPIRVARSKQ  274



>dbj|BAA06521.1| RNA-binding protein cp31 [Arabidopsis thaliana]
Length=304

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 109/181 (60%), Gaps = 3/181 (2%)
 Frame = -3

Query  816  PKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEE  640
            P+P+   KLFV NL + +    +  LF Q GTVE  E I  +E  Q+RGF FVTM+S +E
Sbjct  119  PEPSEEAKLFVGNLAYDVNSQALAMLFEQAGTVEIAEVIYNRETDQSRGFGFVTMSSVDE  178

Query  639  AEAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLR  460
            AE A++KFN Y+L+GR + V  +K   +  R    P   +  +++YV NL W   +  L 
Sbjct  179  AETAVEKFNRYDLNGRLLTV--NKAAPRGSRPERAPRVYEPAFRVYVGNLPWDVDNGRLE  236

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            +LFS +   + ARVV++  +G+S G+GFV     +E   AIS++DG  L GR IR+ ++E
Sbjct  237  QLFSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDELNEAISALDGQNLEGRAIRVNVAE  296

Query  279  K  277
            +
Sbjct  297  E  297



>gb|KDP41428.1| hypothetical protein JCGZ_15835 [Jatropha curcas]
Length=300

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 112/176 (64%), Gaps = 3/176 (2%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            R ++   N+PW+    D++ LF + GTV DVE     + +NRG AFVTM S EEA+AA++
Sbjct  97   RTRVLAQNIPWTCTPEDIRTLFEKFGTVMDVELSMHNKTRNRGLAFVTMGSAEEADAAVK  156

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSAN  442
               SYE  GRT+R+ Y+K  KK  +  PPPP     + L+V+NL ++A+   L+E F+A 
Sbjct  157  NLESYEFEGRTLRINYAKIKKK--KETPPPPKPGPTFNLFVANLPFEAKEKELKEFFNAE  214

Query  441  -FNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
              + +SA +++ +   + +GYGFVAF TK++A+ A+S+  G   +GRPIR+  S +
Sbjct  215  GTDVVSAEIIYHDNPRRPSGYGFVAFKTKKQADDALSAFTGKIFMGRPIRVARSRQ  270



>gb|EMT13836.1| 33 kDa ribonucleoprotein, chloroplastic [Aegilops tauschii]
Length=359

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/194 (37%), Positives = 109/194 (56%), Gaps = 20/194 (10%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            +++V NLP++   +++   F + G+V+DV+ I  K   ++RGFAFVTMA+ EEA  A+Q 
Sbjct  115  RIYVGNLPYTFTAAELTAAFSEAGSVDDVQIIYDKITDRSRGFAFVTMATAEEAAKAVQM  174

Query  618  FNSYELSGRTIRVEYSK--------KFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHL  463
            FN   L GRT+RV + +             +         DG YK+Y  NL W  R+  L
Sbjct  175  FNGALLGGRTVRVNFPEVPRGGERAVASAAVARTSLRLVDDGTYKVYAGNLGWGVRADAL  234

Query  462  RELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDG-----------TE  316
            +  F      + ARV+FE  +G+S G+GFV+F T E+A+AA+ ++DG            E
Sbjct  235  KTAFERQPGLVGARVIFERDTGRSRGFGFVSFQTIEDAKAALQAMDGVEQGYQVFLVIVE  294

Query  315  LLGRPIRLKMSEKN  274
            L GRP+RL ++ +N
Sbjct  295  LDGRPLRLSLAAQN  308



>gb|AAK95304.1|AF410318_1 AT4g24770/F22K18_30 [Arabidopsis thaliana]
 gb|AAN28804.1| At4g24770/F22K18_30 [Arabidopsis thaliana]
Length=329

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 109/181 (60%), Gaps = 3/181 (2%)
 Frame = -3

Query  816  PKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEE  640
            P+P+   KLFV NL + +    +  LF Q GTVE  E I  +E  Q+RGF FVTM+S +E
Sbjct  144  PEPSEEAKLFVGNLAYDVNSQALAMLFEQAGTVEIAEVIYNRETDQSRGFGFVTMSSVDE  203

Query  639  AEAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLR  460
            AE A++KFN Y+L+GR + V  +K   +  R    P   +  +++YV NL W   +  L 
Sbjct  204  AETAVEKFNRYDLNGRLLTV--NKAAPRGSRPERAPRVYEPAFRVYVGNLPWDVDNGRLE  261

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            +LFS +   + ARVV++  +G+S G+GFV     +E   AIS++DG  L GR IR+ ++E
Sbjct  262  QLFSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDELNEAISALDGQNLEGRAIRVNVAE  321

Query  279  K  277
            +
Sbjct  322  E  322



>ref|XP_004246655.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic [Solanum 
lycopersicum]
Length=290

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/191 (40%), Positives = 106/191 (55%), Gaps = 12/191 (6%)
 Frame = -3

Query  822  KTPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASG  646
            +   P+L  K+FV NLP+S+  + + ELF + G VE VE I  K  G++RGF FVTM+S 
Sbjct  94   RNANPDL--KIFVGNLPFSVDSAYLAELFERAGDVEMVEVIYDKLTGRSRGFGFVTMSSK  151

Query  645  EEAEAAIQKFNSYELSGRTIRV---------EYSKKFKKPIRSpppppPRDGRYKLYVSN  493
            E  EAA Q+FN YE+ GR +RV         E S       +        D   ++YV N
Sbjct  152  EAVEAACQQFNGYEIDGRALRVNSGPAPPKRENSFGGNSSYQGGRGGGSMDSSNRVYVGN  211

Query  492  LAWKARSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTEL  313
            LAW      L  LFS     + A+VV++  SG+S G+GFV + + +E   AI S+DG +L
Sbjct  212  LAWSVDQQQLETLFSEQGKVVDAKVVYDRDSGRSRGFGFVTYSSAQEVNDAIESLDGVDL  271

Query  312  LGRPIRLKMSE  280
             GR IR+  +E
Sbjct  272  GGRAIRVSPAE  282



>ref|XP_010455318.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic-like [Camelina 
sativa]
 ref|XP_010455319.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic-like [Camelina 
sativa]
Length=309

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 110/176 (63%), Gaps = 1/176 (1%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            + +L   N+PW+    D++ LF + G+V D+E    K+ +NRG  F+ M S EEA  A+Q
Sbjct  96   KTRLIAQNVPWAATPEDIRSLFEKYGSVVDIEMSMHKKERNRGLVFIEMGSPEEAATALQ  155

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSAN  442
               S+E  GR ++V+Y+K  KK   +P   P     + L+V+NLA++AR+ HL+E F A+
Sbjct  156  SLESFEYEGRRLKVDYAKAKKKKTYTPREKPSAVPTFNLFVANLAFEARAKHLKEFFDAD  215

Query  441  F-NPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
              N +S  V+F     +S+GYGFV+F TK++AEAAI    G + +GRPIRL  S++
Sbjct  216  TGNVVSTEVIFHENPRRSSGYGFVSFKTKKQAEAAIIEFQGKDFMGRPIRLARSKQ  271



>ref|NP_194208.1| ribonucleoprotein RBP31 [Arabidopsis thaliana]
 sp|Q04836.1|CP31A_ARATH RecName: Full=31 kDa ribonucleoprotein, chloroplastic; AltName: 
Full=RNA-binding protein 1/2/3; Short=AtRBP33; AltName: Full=RNA-binding 
protein CP31A; AltName: Full=RNA-binding protein 
RNP-T; AltName: Full=RNA-binding protein cp31; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAA46347.1| RNA-binding protein [Arabidopsis thaliana]
 gb|AAA32860.1| 31 kDa RNA binding protein [Arabidopsis thaliana]
 gb|AAA18378.1| RNA-binding protein 1 [Arabidopsis thaliana]
 emb|CAA22986.1| RNA-binding protein RNP-T precursor [Arabidopsis thaliana]
 emb|CAB79387.1| RNA-binding protein RNP-T precursor [Arabidopsis thaliana]
 gb|AEE84954.1| ribonucleoprotein [Arabidopsis thaliana]
 prf||1921382A RNA-binding protein
Length=329

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 109/181 (60%), Gaps = 3/181 (2%)
 Frame = -3

Query  816  PKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEE  640
            P+P+   KLFV NL + +    +  LF Q GTVE  E I  +E  Q+RGF FVTM+S +E
Sbjct  144  PEPSEEAKLFVGNLAYDVNSQALAMLFEQAGTVEIAEVIYNRETDQSRGFGFVTMSSVDE  203

Query  639  AEAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLR  460
            AE A++KFN Y+L+GR + V  +K   +  R    P   +  +++YV NL W   +  L 
Sbjct  204  AETAVEKFNRYDLNGRLLTV--NKAAPRGSRPERAPRVYEPAFRVYVGNLPWDVDNGRLE  261

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            +LFS +   + ARVV++  +G+S G+GFV     +E   AIS++DG  L GR IR+ ++E
Sbjct  262  QLFSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDELNEAISALDGQNLEGRAIRVNVAE  321

Query  279  K  277
            +
Sbjct  322  E  322



>ref|XP_010553318.1| PREDICTED: ribonucleoprotein At2g37220, chloroplastic-like [Tarenaya 
hassleriana]
 ref|XP_010553320.1| PREDICTED: ribonucleoprotein At2g37220, chloroplastic-like [Tarenaya 
hassleriana]
Length=291

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 109/189 (58%), Gaps = 14/189 (7%)
 Frame = -3

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAE  634
            P+L  KLFV NLP+S+  + + +LFG  G V+ VE I  K  G++RGF FVTM++ +E E
Sbjct  97   PDL--KLFVGNLPFSVDSAQLADLFGSVGNVQMVEVIYDKVTGRSRGFGFVTMSTVDEVE  154

Query  633  AAIQKFNSYELSGRTIRVE-----------YSKKFKKPIRSpppppPRDGRYKLYVSNLA  487
            AA Q+FN YE  GR +RV            +S+  +    S           ++YV NLA
Sbjct  155  AAAQQFNGYEFEGRPLRVNSGPPPPRREEPFSRGPRSSFPSSGSGSSSGPSSRVYVGNLA  214

Query  486  WKARSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLG  307
            W      L  +FS +   + ARV+++  SG+S G+GFV + + +E + AI S+DG +L G
Sbjct  215  WAVDDMALESMFSEHGKVVEARVIYDRDSGRSKGFGFVTYSSPQEVKNAIRSLDGVDLDG  274

Query  306  RPIRLKMSE  280
            R IR+ M+E
Sbjct  275  RQIRVSMAE  283



>gb|AAA18379.1| RNA-binding protein 2 [Arabidopsis thaliana]
Length=315

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 109/181 (60%), Gaps = 3/181 (2%)
 Frame = -3

Query  816  PKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEE  640
            P+P+   KLFV NL + +    +  LF Q GTVE  E I  +E  Q+RGF FVTM+S +E
Sbjct  130  PEPSEEAKLFVGNLAYDVNSQALAMLFEQAGTVEIAEVIYNRETDQSRGFGFVTMSSVDE  189

Query  639  AEAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLR  460
            AE A++KFN Y+L+GR + V  +K   +  R    P   +  +++YV NL W   +  L 
Sbjct  190  AETAVEKFNRYDLNGRLLTV--NKAAPRGSRPERAPRVYEPAFRVYVGNLPWDVDNGRLE  247

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            +LFS +   + ARVV++  +G+S G+GFV     +E   AIS++DG  L GR IR+ ++E
Sbjct  248  QLFSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDELNEAISALDGQNLEGRAIRVNVAE  307

Query  279  K  277
            +
Sbjct  308  E  308



>ref|XP_009370331.1| PREDICTED: 28 kDa ribonucleoprotein, chloroplastic-like [Pyrus 
x bretschneideri]
Length=299

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 110/178 (62%), Gaps = 11/178 (6%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAEAAIQK  619
            KL+V NLP+ +    +  LF   G VE  E I  +E  Q+RGF FVTM++ EEAE A++ 
Sbjct  121  KLYVGNLPYDVDSEKLANLFNDAGVVEIAEVIYNRETDQSRGFGFVTMSTVEEAEKAVEL  180

Query  618  FNSYELSGRTIRVEYS----KKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELF  451
            F+ Y++ GR + V  +     + ++PIR+       +  +++YV NL W+   + L ++F
Sbjct  181  FHRYDIGGRALTVNKAAPRGSRPERPIRT------NEPAFRIYVGNLPWQVDDSRLEQVF  234

Query  450  SANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
            S +   +SARVV++  SG+S G+GFV F ++ E + AI+++DG  L GR IR+ ++E+
Sbjct  235  SEHGKVVSARVVYDRESGRSRGFGFVTFSSETEVDDAIAALDGQSLDGRSIRVNVAEE  292



>ref|NP_001289491.1| 29 kDa ribonucleoprotein A, chloroplastic [Nicotiana sylvestris]
 ref|XP_009781507.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic [Nicotiana 
sylvestris]
 sp|Q08935.1|ROC1_NICSY RecName: Full=29 kDa ribonucleoprotein A, chloroplastic; AltName: 
Full=CP29A; Flags: Precursor [Nicotiana sylvestris]
 emb|CAA43427.1| 29kD A ribonucleoprotein [Nicotiana sylvestris]
Length=273

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 104/183 (57%), Gaps = 8/183 (4%)
 Frame = -3

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAE  634
            P+L  K+FV NLP+S   + + ELF + G VE VE I  K  G++RGF FVTM+S EE E
Sbjct  85   PDL--KIFVGNLPFSADSAALAELFERAGNVEMVEVIYDKLTGRSRGFGFVTMSSKEEVE  142

Query  633  AAIQKFNSYELSGRTIRVEYSKKFKK-----PIRSpppppPRDGRYKLYVSNLAWKARST  469
            AA Q+FN YEL GR +RV      +K                D   ++YV NLAW     
Sbjct  143  AACQQFNGYELDGRALRVNSGPPPEKRENSSFRGGSRGGGSFDSSNRVYVGNLAWGVDQD  202

Query  468  HLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLK  289
             L  LFS     + A+VV++  SG+S G+GFV + + EE   AI S+DG +L GR IR+ 
Sbjct  203  ALETLFSEQGKVVDAKVVYDRDSGRSRGFGFVTYSSAEEVNNAIESLDGVDLNGRAIRVS  262

Query  288  MSE  280
             +E
Sbjct  263  PAE  265



>ref|XP_009371733.1| PREDICTED: 28 kDa ribonucleoprotein, chloroplastic-like [Pyrus 
x bretschneideri]
Length=294

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 110/178 (62%), Gaps = 11/178 (6%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAEAAIQK  619
            KL+V NLP+ +    +  LF   G VE  E I  +E  Q+RGF FVTM++ EEAE A++ 
Sbjct  116  KLYVGNLPYDVDSEKLANLFNDAGVVEIAEVIYNRETDQSRGFGFVTMSTVEEAEKAVEL  175

Query  618  FNSYELSGRTIRVEYS----KKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELF  451
            F+ Y++ GR + V  +     + ++PIR+       +  +++YV NL W+   + L ++F
Sbjct  176  FHRYDIGGRALTVNKAAPRGSRPERPIRT------NEPAFRIYVGNLPWQVDDSRLEQVF  229

Query  450  SANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
            S +   +SARVV++  SG+S G+GFV F ++ E + AI+++DG  L GR IR+ ++E+
Sbjct  230  SEHGKVVSARVVYDRESGRSRGFGFVTFSSETEVDDAIAALDGQSLDGRSIRVNVAEE  287



>ref|XP_011048542.1| PREDICTED: ribonucleoprotein At2g37220, chloroplastic-like [Populus 
euphratica]
Length=276

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 109/183 (60%), Gaps = 8/183 (4%)
 Frame = -3

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAE  634
            P+L  +LFV NLP++++ + + +LF   G VE VE    K  G++RGF FVTM++ EE E
Sbjct  89   PDL--QLFVGNLPFNVSSAQLADLFKSAGNVEMVEVKYDKVTGRSRGFGFVTMSTIEEVE  146

Query  633  AAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRY-----KLYVSNLAWKARST  469
            AA Q+FN +EL GR +RV      ++       P  R G       ++YV NL+W   S+
Sbjct  147  AASQQFNGFELDGRPLRVNSGPPPQRETSFSRGPGARGGETIDSSNRVYVGNLSWNVDSS  206

Query  468  HLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLK  289
             L  LF      + ARVVF+  SG+S G+GFV + + EE E A+ S++G EL GR IR+ 
Sbjct  207  ALETLFREKGKVMDARVVFDRDSGRSKGFGFVTYSSAEEVEDAVDSLNGIELDGRAIRVS  266

Query  288  MSE  280
            ++E
Sbjct  267  VAE  269



>ref|XP_010250975.1| PREDICTED: 28 kDa ribonucleoprotein, chloroplastic-like [Nelumbo 
nucifera]
Length=330

 Score =   130 bits (328),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 110/181 (61%), Gaps = 3/181 (2%)
 Frame = -3

Query  816  PKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEE  640
            P+P    KLFV NLP+ L    + +LF Q G VE  E I  +E  Q+RGF FVTM + EE
Sbjct  145  PEPPEEAKLFVGNLPYDLDSEKLAQLFDQAGIVEVAEVIYNRETDQSRGFGFVTMRTVEE  204

Query  639  AEAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLR  460
            AE A++ FN Y+L+GR + V  +K   +  R   PP   +   ++YV NL W+  +  L 
Sbjct  205  AEKAVEMFNRYDLNGRLLTV--NKAAPRGSRPERPPRVFEPSLRIYVGNLPWQVDNARLE  262

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            ++FS +   + ARVV++  +G+S G+GFV   ++ E + AI+++DG  L GR IR+ ++E
Sbjct  263  QVFSEHGKVVDARVVYDRETGRSRGFGFVTMSSQTELDDAIAALDGQNLDGRAIRVNVAE  322

Query  279  K  277
            +
Sbjct  323  E  323



>ref|XP_008219352.1| PREDICTED: 29 kDa ribonucleoprotein B, chloroplastic [Prunus 
mume]
Length=305

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 106/169 (63%), Gaps = 2/169 (1%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQKF  616
            +L   N+PW+    D++ LF + GTV DVE     + +NRG AFVTM S EEA AA+   
Sbjct  99   RLLAQNVPWTCTPEDIRTLFEKYGTVVDVELAMYNKTRNRGLAFVTMGSPEEALAALNNL  158

Query  615  NSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELF-SANF  439
             S E+ GR I++ Y+K  K     PP   P+   + LYV NL ++ARS  L+ELF S + 
Sbjct  159  ESSEMEGRIIKMAYAKPKKT-KIPPPSSQPKPVTFNLYVENLPYEARSKDLKELFNSEDC  217

Query  438  NPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRL  292
            + ++A VVF+    +SAGYGFV F +K+EAEAA+S+  G  L+GR IR+
Sbjct  218  SVVTAEVVFQGNPRRSAGYGFVGFKSKKEAEAALSAFHGKLLMGRRIRV  266


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 46/89 (52%), Gaps = 3/89 (3%)
 Frame = -3

Query  816  PKPNLRRKLFVLNLPWSLAVSDVKELFG--QCGTVEDVEFIKTKEGQNRGFAFVTMASGE  643
            PKP +   L+V NLP+     D+KELF    C  V      +    ++ G+ FV   S +
Sbjct  187  PKP-VTFNLYVENLPYEARSKDLKELFNSEDCSVVTAEVVFQGNPRRSAGYGFVGFKSKK  245

Query  642  EAEAAIQKFNSYELSGRTIRVEYSKKFKK  556
            EAEAA+  F+   L GR IRV   K+F K
Sbjct  246  EAEAALSAFHGKLLMGRRIRVARGKQFVK  274



>ref|NP_001275094.1| single-stranded DNA binding protein precursor [Solanum tuberosum]
 gb|AAL39067.1|AF389431_1 single-stranded DNA binding protein precursor [Solanum tuberosum]
Length=289

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 76/191 (40%), Positives = 106/191 (55%), Gaps = 12/191 (6%)
 Frame = -3

Query  822  KTPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASG  646
            +   P+L  K+FV NLP+S+  + + ELF + G VE VE I  K  G++RGF FVTM+S 
Sbjct  93   RNANPDL--KIFVGNLPFSVDSAALAELFERAGDVEMVEVIYDKLTGRSRGFGFVTMSSK  150

Query  645  EEAEAAIQKFNSYELSGRTIRV---------EYSKKFKKPIRSpppppPRDGRYKLYVSN  493
            E  EAA Q+FN YE+ GR +RV         E S       +        D   ++YV N
Sbjct  151  EAVEAACQQFNGYEIDGRALRVNSGPAPPKRENSFGDNSSYQGGRGGGSMDSSNRVYVGN  210

Query  492  LAWKARSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTEL  313
            LAW      L  LFS     + A+VV++  SG+S G+GFV + + +E   AI S+DG +L
Sbjct  211  LAWSVDQQQLETLFSEQGKVVDAKVVYDRDSGRSRGFGFVTYSSAKEVNDAIESLDGVDL  270

Query  312  LGRPIRLKMSE  280
             GR IR+  +E
Sbjct  271  GGRAIRVSPAE  281



>ref|XP_006403809.1| hypothetical protein EUTSA_v10010548mg [Eutrema salsugineum]
 gb|ESQ45262.1| hypothetical protein EUTSA_v10010548mg [Eutrema salsugineum]
Length=322

 Score =   130 bits (327),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 112/181 (62%), Gaps = 8/181 (4%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            +L+V NLP+++  S++ ELFG+ G V DV+ +  K   ++RGF FVTM S EEA+ AIQ 
Sbjct  112  RLYVGNLPYTITSSELSELFGEAGNVVDVQIVYDKVTDRSRGFGFVTMGSIEEAKEAIQM  171

Query  618  FNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGR-------YKLYVSNLAWKARSTHLR  460
            FNS ++ GRT++V + +  +   R       RD         +K+Y  NL W   S  L+
Sbjct  172  FNSSQIGGRTVKVNFPEVPRGGEREVMRTKIRDTNRSYVDSPHKIYAGNLGWSLTSQGLK  231

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            + F+     + A+V++E  SG+S G+GF++F + ++ ++A+S+++G E+ GR +RL ++ 
Sbjct  232  DAFADQPGVLGAKVIYERNSGRSRGFGFISFESAQDVQSALSAMNGVEVEGRALRLNLAS  291

Query  279  K  277
            +
Sbjct  292  E  292



>ref|NP_001078360.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 gb|AEE82716.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=244

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 109/174 (63%), Gaps = 1/174 (1%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQKF  616
            +L   N+PW+    D++ LF + G+V D+E    K+ +NRG  F+ MAS EEA  A++  
Sbjct  35   RLIAQNVPWTSTPEDIRSLFEKYGSVIDIEMSMHKKERNRGLVFIEMASPEEAATALKSL  94

Query  615  NSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSANF-  439
             S E  GR ++V+Y+K  KK   +P   P     + L+V+NLA++AR+ HL+E F A+  
Sbjct  95   ESCEYEGRRLKVDYAKTKKKKTYAPRETPSPVPTFNLFVANLAFEARAKHLKEFFDADTG  154

Query  438  NPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
            N +S  V+F     +S+GYGFV+F TK++AEAA+    G + LGRPIRL  S++
Sbjct  155  NVVSTEVIFHENPRRSSGYGFVSFKTKKQAEAALIEFQGKDFLGRPIRLAKSKQ  208



>emb|CAA43420.1| RNA binding protein [Arabidopsis thaliana]
Length=310

 Score =   130 bits (326),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 109/181 (60%), Gaps = 3/181 (2%)
 Frame = -3

Query  816  PKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEE  640
            P+P+   KLFV NL + +    +  LF Q GTVE  E I  +E  Q+RGF FVTM+S +E
Sbjct  125  PEPSEEAKLFVGNLAYDVNSQALAMLFEQAGTVEIAEVIYNRETDQSRGFGFVTMSSVDE  184

Query  639  AEAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLR  460
            AE A++KFN Y+L+GR + V  +K   +  R    P   +  +++YV NL W   +  L 
Sbjct  185  AETAVEKFNRYDLNGRLLTV--NKAAPRGSRPERAPRVYEPAFRVYVGNLPWDVDNGRLE  242

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            +LFS +   + ARVV++  +G+S G+GFV     +E   AIS++DG  L GR IR+ ++E
Sbjct  243  QLFSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDELNEAISALDGQNLEGRAIRVNVAE  302

Query  279  K  277
            +
Sbjct  303  E  303



>ref|XP_002323470.1| 29 kDa ribonucleoprotein [Populus trichocarpa]
 gb|EEF05231.1| 29 kDa ribonucleoprotein [Populus trichocarpa]
Length=273

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 105/176 (60%), Gaps = 4/176 (2%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            KLFV NLP+++  + +  LF   G VE VE I  K  G++RGF FVTM + EE EAA ++
Sbjct  91   KLFVGNLPFNVDSARLAGLFETAGNVEMVEVIYDKVTGRSRGFGFVTMTTIEEVEAASKQ  150

Query  618  FNSYELSGRTIRVEYSKKFKKPI---RSpppppPRDGRYKLYVSNLAWKARSTHLRELFS  448
            FN YEL GRT+RV +    +K     R P      D   ++YV NL+W   +  L  LF 
Sbjct  151  FNGYELDGRTLRVNFGPPPQKESSFSRGPRGGETFDSGNRVYVGNLSWNVDNLALETLFR  210

Query  447  ANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
                 + A+VV++  SG+S G+GFV + + EE + AI S++G EL GR IR+ ++E
Sbjct  211  EKGRVMDAKVVYDRDSGRSRGFGFVTYSSAEEVDNAIDSLNGAELDGRAIRVSVAE  266



>ref|XP_010106985.1| 33 kDa ribonucleoprotein [Morus notabilis]
 gb|EXC12983.1| 33 kDa ribonucleoprotein [Morus notabilis]
Length=325

 Score =   130 bits (327),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 111/179 (62%), Gaps = 8/179 (4%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            +L+V NLP+S+  S + ++FG+ GTV  VE I  +   ++RGF FVTM S EEA+ AI+ 
Sbjct  116  RLYVGNLPYSMDSSQLAQVFGEAGTVFSVEVIYDRVTDRSRGFGFVTMGSVEEAQEAIRL  175

Query  618  FNSYELSGRTIRVEYSKKFKKPIRSpppppPR-------DGRYKLYVSNLAWKARSTHLR  460
            F+  ++ GRT++V + +  +   R    P  R       D  +K+Y  NL W   S  LR
Sbjct  176  FDGSQVGGRTVKVNFPQVPRGGEREVLGPKIRNMNKGYVDSPHKIYAGNLGWGLTSQDLR  235

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
            + F+     +SA+V++E  +G+S G+GFV+F T E +++A+ +++G E+ GRP+RL M+
Sbjct  236  DAFADQPGVLSAKVIYERDTGRSRGFGFVSFETAEASQSALDAMNGVEVQGRPLRLNMA  294


 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 45/77 (58%), Gaps = 0/77 (0%)
 Frame = -3

Query  510  KLYVSNLAWKARSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISS  331
            +LYV NL +   S+ L ++F       S  V+++  + +S G+GFV  G+ EEA+ AI  
Sbjct  116  RLYVGNLPYSMDSSQLAQVFGEAGTVFSVEVIYDRVTDRSRGFGFVTMGSVEEAQEAIRL  175

Query  330  IDGTELLGRPIRLKMSE  280
             DG+++ GR +++   +
Sbjct  176  FDGSQVGGRTVKVNFPQ  192



>ref|XP_009136674.1| PREDICTED: 33 kDa ribonucleoprotein, chloroplastic-like [Brassica 
rapa]
Length=313

 Score =   130 bits (326),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 111/181 (61%), Gaps = 8/181 (4%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            +L+V NLP+++  S++ +LFG+ G V DV+ +  K   ++RGF FVTM + EEA+ AIQ 
Sbjct  106  RLYVGNLPYTITASELSQLFGEAGNVVDVQIVYDKVTDRSRGFGFVTMGTIEEAKEAIQM  165

Query  618  FNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGR-------YKLYVSNLAWKARSTHLR  460
            FNS ++ GRT++V + +  +   R       RD         +K+Y  NL W   S  L+
Sbjct  166  FNSSQIGGRTVKVNFPEVPRGGEREVMRTKIRDSNKSYVDSPHKIYAGNLGWNLTSQGLK  225

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            + F      + A+V++E  SG+S G+GFV+F ++ E ++A+S+++G E+ GR +RL ++ 
Sbjct  226  DAFGDQPGVLGAKVIYERNSGRSRGFGFVSFESEGELQSALSAMNGVEVEGRALRLNLAS  285

Query  279  K  277
            +
Sbjct  286  E  286



>gb|EPS59981.1| hypothetical protein M569_14824, partial [Genlisea aurea]
Length=281

 Score =   129 bits (324),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 108/198 (55%), Gaps = 23/198 (12%)
 Frame = -3

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAE  634
            P+L  KLFV NLP+++  + + ELF Q G VE VE I  K  G++RGF FVTM + EEAE
Sbjct  81   PDL--KLFVGNLPFNVDSAGLAELFEQAGNVEMVEVIYDKASGRSRGFGFVTMTTVEEAE  138

Query  633  AAIQKFNSYELSGRTIRVEYSKKFKK--------------------PIRSpppppPRDGR  514
            AA Q+FN YE  GR +RV       +                    P +S       D  
Sbjct  139  AAAQQFNGYEFQGRPLRVNAGPPPSRNGSTFRGPRGSSSSRSNNGFPFQSTRTRSSFDRS  198

Query  513  YKLYVSNLAWKARSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAIS  334
             +++V NLAW   +  L  LF    N   A V+++  +G+S G+GFV +G++EE + AI 
Sbjct  199  NRVHVGNLAWGVDNLALETLFREQGNVKEATVIYDRETGRSKGFGFVTYGSREEVKNAIK  258

Query  333  SIDGTELLGRPIRLKMSE  280
            S+DG +L GR IR+  +E
Sbjct  259  SLDGIDLNGRSIRVSEAE  276



>ref|XP_010926579.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic [Elaeis 
guineensis]
Length=278

 Score =   129 bits (324),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 105/181 (58%), Gaps = 6/181 (3%)
 Frame = -3

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAE  634
            P+L  KLFV NLP+S+  + +  LF   G VE VE I  K  G++RGF FVTM++ EE E
Sbjct  93   PDL--KLFVGNLPFSVDSAQLAGLFQSAGNVEMVEVIYDKLTGKSRGFGFVTMSTVEEVE  150

Query  633  AAIQKFNSYELSGRTIRVEYSKKFKKPIRSpp---pppPRDGRYKLYVSNLAWKARSTHL  463
            AA+Q+FN Y L GR +RV       K   S          D   ++YV NLAW   +  L
Sbjct  151  AAVQQFNGYTLEGRMLRVNSGPPPPKDELSSKGFRTGGSFDAANRVYVGNLAWGVDNLAL  210

Query  462  RELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
              LFS     + A+VV++  +G+S G+GFV +   EE   AI+S++G +L GR IR+ ++
Sbjct  211  ETLFSEQGKVMEAKVVYDRETGRSRGFGFVTYSNAEEVNNAIASLNGVDLDGRSIRVTLA  270

Query  282  E  280
            E
Sbjct  271  E  271



>ref|XP_008797077.1| PREDICTED: 28 kDa ribonucleoprotein, chloroplastic-like [Phoenix 
dactylifera]
 ref|XP_008797085.1| PREDICTED: 28 kDa ribonucleoprotein, chloroplastic-like [Phoenix 
dactylifera]
Length=368

 Score =   130 bits (328),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 107/174 (61%), Gaps = 3/174 (2%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAEAAIQK  619
            KLFV NLP+ +    +  LF Q G VE  E I  +E  Q+RGF FVTM+S EEAE A++ 
Sbjct  190  KLFVGNLPYDIDSEKLAHLFDQAGIVEVAEVIYNRETDQSRGFGFVTMSSIEEAEKAVET  249

Query  618  FNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSANF  439
            F+ YEL+GR++ V  +K   +  R    P   +  +++YV NL W+     L ++FS + 
Sbjct  250  FHRYELNGRSLTV--NKAAPRGTRVERAPREFEPSFRVYVGNLPWQVDDARLEQVFSEHG  307

Query  438  NPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
              I ARVV++  +G+S G+GFV   +K E + AI+++DG  L GR +R+ ++E+
Sbjct  308  KVIDARVVYDRETGRSRGFGFVTMSSKNELDDAIAALDGQSLDGRALRVNVAEE  361



>ref|XP_011040450.1| PREDICTED: 28 kDa ribonucleoprotein, chloroplastic-like [Populus 
euphratica]
 ref|XP_011014651.1| PREDICTED: 28 kDa ribonucleoprotein, chloroplastic-like [Populus 
euphratica]
Length=327

 Score =   130 bits (326),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 108/180 (60%), Gaps = 3/180 (2%)
 Frame = -3

Query  813  KPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQ-NRGFAFVTMASGEEA  637
            +P    K+FV NLP+ +    +  LF Q GTVE  E I  +E   +RGF FVTM++ EE+
Sbjct  144  EPPEEAKIFVGNLPYDVDSEKLAMLFEQAGTVEIAEVIYNRETDTSRGFGFVTMSTVEES  203

Query  636  EAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRE  457
            E A++  + Y+L GR + V  +K   +  R   PP   +  Y++YV NL W   S  L +
Sbjct  204  EKAVEMLHRYDLDGRLLTV--NKAAPRGSRPERPPRVSEPGYRIYVGNLPWDVDSGRLEQ  261

Query  456  LFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
            +FS +   +SARVVF+  +G+S G+GFV   T+ E   AI+++DG  L GRPIR+ ++E+
Sbjct  262  IFSEHGKVVSARVVFDRETGRSRGFGFVTMSTENELNDAIAALDGQNLDGRPIRVNVAEE  321



>emb|CDY71165.1| BnaCnng71670D [Brassica napus]
Length=304

 Score =   129 bits (324),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 109/181 (60%), Gaps = 3/181 (2%)
 Frame = -3

Query  816  PKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEE  640
            P+P    KLFV NL + +    +  LF Q GTVE  E I  +E  Q+RGF FVTM++ EE
Sbjct  121  PEPPEEAKLFVGNLAYDVDSQALAMLFEQAGTVEIAEVIYNRETDQSRGFGFVTMSTVEE  180

Query  639  AEAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLR  460
            AE A++KFN Y+L+GR + V  +K   +  R    P   +  +++YV NL W+  +  L 
Sbjct  181  AETAVEKFNRYDLNGRALTV--NKAAPRGSRPERQPRVYEPAFRVYVGNLPWEVDNGRLE  238

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            ++FS +   + ARVV++  +G+S G+GFV    + E   AI+++DG  + GR IR+ ++E
Sbjct  239  QVFSEHGKVVEARVVYDRETGRSRGFGFVTMSNETELNDAIAALDGQNMEGRAIRVNVAE  298

Query  279  K  277
            +
Sbjct  299  E  299



>dbj|BAD43393.1| putative protein [Arabidopsis thaliana]
Length=304

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 110/176 (63%), Gaps = 1/176 (1%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            + +L   N+PW+    D++ LF + G+V D+E    K+ +NRG  F+ MAS EEA  A++
Sbjct  93   KTRLIAQNVPWTSTPEDIRSLFEKYGSVIDIEMSMHKKERNRGLVFIEMASPEEAATALK  152

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSAN  442
               S E  GR ++V+Y+K  KK   +P   P     + L+V+NLA++AR+ HL+E F A+
Sbjct  153  SLESCEYEGRRLKVDYAKTKKKKTYAPRETPSPVPTFNLFVANLAFEARAKHLKEFFDAD  212

Query  441  F-NPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
              N +S  V+F     +S+GYGFV+F TK++AEAA+    G + LGRPIRL  S++
Sbjct  213  TGNVVSTEVIFHENPRRSSGYGFVSFKTKKQAEAALIEFQGKDFLGRPIRLAKSKQ  268



>gb|ABK24573.1| unknown [Picea sitchensis]
Length=290

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 106/178 (60%), Gaps = 11/178 (6%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAEAAIQK  619
            KLFV NLP++L    + ELF   G V DV  I  +E G +RGF FVTM + EEAE  ++ 
Sbjct  114  KLFVGNLPFNLDNQQLGELFEGAGEVLDVNIITDRETGNSRGFGFVTMGTVEEAEKGVEL  173

Query  618  FNSYELSGRTIRVEYS----KKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELF  451
            FN + L GR + V  +     K ++P ++           K+YV NL W+A    L +LF
Sbjct  174  FNRHSLEGRLLTVNKAAPRGTKVERPSQAGSSTN------KIYVGNLPWQADDNSLLQLF  227

Query  450  SANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
            S +   + ARVV++  +G+S G+GFV + ++ E   AI+++DGT++ GRP+R+ ++E 
Sbjct  228  SEHGKVLEARVVYDRETGRSRGFGFVTYSSESEVNDAIAALDGTDMDGRPLRVNIAED  285



>ref|NP_192643.2| RNA recognition motif-containing protein [Arabidopsis thaliana]
 gb|AAR24688.1| At4g09040 [Arabidopsis thaliana]
 dbj|BAD42884.1| putative protein [Arabidopsis thaliana]
 dbj|BAD43435.1| putative protein [Arabidopsis thaliana]
 dbj|BAD43486.1| putative protein [Arabidopsis thaliana]
 dbj|BAD44079.1| putative protein [Arabidopsis thaliana]
 dbj|BAD94588.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE82715.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=304

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 110/176 (63%), Gaps = 1/176 (1%)
 Frame = -3

Query  801  RRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQ  622
            + +L   N+PW+    D++ LF + G+V D+E    K+ +NRG  F+ MAS EEA  A++
Sbjct  93   KTRLIAQNVPWTSTPEDIRSLFEKYGSVIDIEMSMHKKERNRGLVFIEMASPEEAATALK  152

Query  621  KFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELFSAN  442
               S E  GR ++V+Y+K  KK   +P   P     + L+V+NLA++AR+ HL+E F A+
Sbjct  153  SLESCEYEGRRLKVDYAKTKKKKTYAPRETPSPVPTFNLFVANLAFEARAKHLKEFFDAD  212

Query  441  F-NPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
              N +S  V+F     +S+GYGFV+F TK++AEAA+    G + LGRPIRL  S++
Sbjct  213  TGNVVSTEVIFHENPRRSSGYGFVSFKTKKQAEAALIEFQGKDFLGRPIRLAKSKQ  268



>ref|XP_010482334.1| PREDICTED: 31 kDa ribonucleoprotein, chloroplastic-like [Camelina 
sativa]
Length=266

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 107/180 (59%), Gaps = 4/180 (2%)
 Frame = -3

Query  816  PKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEE  640
            P+P    KLFV NLP+ +    +  LF Q GTVE  E I  ++  Q+RGF FVTM++ EE
Sbjct  81   PEPPEEAKLFVGNLPYDVDSQALAMLFEQAGTVEISEVIYNRDTDQSRGFGFVTMSTVEE  140

Query  639  AEAAIQKFNSYELSGRTIRVEYSK-KFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHL  463
            AE A+ KFN YE++GR + V  +  K  +P R P      D  +++YV NL W   +  L
Sbjct  141  AEKAVAKFNRYEVNGRLLTVNIAAPKGSRPERQPRVYD--DAAFRIYVGNLPWDVDNGRL  198

Query  462  RELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMS  283
             ++FS +   + ARVV++  +G+S G+GFV    + E   AI+++DG  L GR I++ ++
Sbjct  199  EQVFSEHGKVVDARVVYDRETGRSRGFGFVTMSNETELNDAIAALDGQNLEGRAIKVNVA  258



>tpg|DAA59581.1| TPA: hypothetical protein ZEAMMB73_267259 [Zea mays]
Length=385

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/231 (34%), Positives = 114/231 (49%), Gaps = 48/231 (21%)
 Frame = -3

Query  822  KTPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASG  646
            + P+ +   +LFV NLP++    ++ ++F + G V+D + I  K   ++RGFAFVTMA+ 
Sbjct  104  RPPRGDDPGRLFVGNLPYTYTSEELAQVFSEAGRVDDAQIIYDKVTNRSRGFAFVTMATA  163

Query  645  EEAEAAIQKFNSYE--------------------------------------------LS  598
            EEA  AIQ F+                                               L 
Sbjct  164  EEAAKAIQMFDGAVSTAPANWISTSTPHRIGILLLPMNVQACVLTSDRSLAHSSPMQLLG  223

Query  597  GRTIRVEYSKKFKKPIRSpppppPR---DGRYKLYVSNLAWKARSTHLRELFSANFNPIS  427
            GRT RV Y +  +   R       R   DG YK+Y  NL W  R+  LR +F      + 
Sbjct  224  GRTARVNYPEVPRGGERRTVTMSGRRRDDGTYKIYAGNLGWGVRADTLRNVFEGRAGLLD  283

Query  426  ARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEKN  274
            ARV+FE  +G+S G+GFV+F T E+A+AA+ S+DG EL GR +RL ++E+N
Sbjct  284  ARVIFERETGRSRGFGFVSFSTAEDAQAALESLDGVELEGRSLRLSLAEQN  334


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELF-GQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQK  619
            K++  NL W +    ++ +F G+ G ++     + + G++RGF FV+ ++ E+A+AA++ 
Sbjct  256  KIYAGNLGWGVRADTLRNVFEGRAGLLDARVIFERETGRSRGFGFVSFSTAEDAQAALES  315

Query  618  FNSYELSGRTIRVEYSKKFKKP  553
             +  EL GR++R+  +++   P
Sbjct  316  LDGVELEGRSLRLSLAEQNPPP  337



>ref|XP_002867645.1| RNA-binding protein cp31 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43904.1| RNA-binding protein cp31 [Arabidopsis lyrata subsp. lyrata]
Length=305

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 109/181 (60%), Gaps = 3/181 (2%)
 Frame = -3

Query  816  PKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEE  640
            P+P+   KLFV NL + +    +  LF Q GTVE  E I  +E  Q+RGF FVTM++ EE
Sbjct  121  PEPSEEAKLFVGNLAYDVDSQALAMLFEQAGTVEIAEVIYNRETDQSRGFGFVTMSTVEE  180

Query  639  AEAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLR  460
            AE A++KFN Y+L+GR + V  +K   +  R    P   +  +++YV NL W   +  L 
Sbjct  181  AETAVEKFNRYDLNGRLLTV--NKAAPRGSRPERAPRVYEPAFRVYVGNLPWDVDNGRLE  238

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            ++FS +   + ARVV++  +G+S G+GFV    + E   AI+++DG  + GR IR+ ++E
Sbjct  239  QVFSEHGKVVEARVVYDRETGRSRGFGFVTMSNENELNDAIAALDGQNMEGRAIRVNVAE  298

Query  279  K  277
            +
Sbjct  299  E  299



>ref|XP_008789424.1| PREDICTED: 31 kDa ribonucleoprotein, chloroplastic [Phoenix dactylifera]
Length=281

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 109/182 (60%), Gaps = 11/182 (6%)
 Frame = -3

Query  819  TPKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGE  643
            TP P    KL+  NLP++   + +  +  Q    E VE +  ++ G++RGFAFVTM+S E
Sbjct  103  TPAPQ-NTKLYFGNLPYNCDSAQLAGIIQQYANPEMVEVLYDRDTGRSRGFAFVTMSSVE  161

Query  642  EAEAAIQKFNSYELSGRTIRVEYSKKFK--KPIRSpppppPRDGRYKLYVSNLAWKARST  469
            + EA IQ  +  + SGRT+RV +S K K  +P+         +  YKL+V NL+W   S 
Sbjct  162  DCEAVIQNLDGSQYSGRTLRVNFSDKPKPKEPLYP-------ETDYKLFVGNLSWSVTSE  214

Query  468  HLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLK  289
             L ++F    N + ARV+++  SG+S GYGFV + TKEE +AA+  ++G EL GR +R+ 
Sbjct  215  SLTQVFQDYGNVVGARVLYDGDSGRSRGYGFVCYSTKEEMDAALQYLNGAELEGRAMRVS  274

Query  288  MS  283
            ++
Sbjct  275  LA  276


 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = -3

Query  510  KLYVSNLAWKARSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISS  331
            KLY  NL +   S  L  +     NP    V+++  +G+S G+ FV   + E+ EA I +
Sbjct  110  KLYFGNLPYNCDSAQLAGIIQQYANPEMVEVLYDRDTGRSRGFAFVTMSSVEDCEAVIQN  169

Query  330  IDGTELLGRPIRLKMSEK  277
            +DG++  GR +R+  S+K
Sbjct  170  LDGSQYSGRTLRVNFSDK  187



>ref|XP_006280900.1| hypothetical protein CARUB_v10026893mg [Capsella rubella]
 gb|EOA13798.1| hypothetical protein CARUB_v10026893mg [Capsella rubella]
Length=291

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 108/181 (60%), Gaps = 5/181 (3%)
 Frame = -3

Query  813  KPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEA  637
            +P    KLFV NLP+ +    +  LF Q GTVE  E I  ++  Q+RGF FVTM++ EEA
Sbjct  108  EPPEEAKLFVGNLPYDIDSQALAMLFEQAGTVEISEVIYNRDTDQSRGFGFVTMSTVEEA  167

Query  636  EAAIQKFNSYELSGRTIRVEYSK-KFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLR  460
            E A++KFN YE++GR + V  +  +  +P R P      D  +++YV NL W   +  L 
Sbjct  168  EKAVEKFNRYEVNGRLLTVNIAAPRGSRPERQPRVY---DAAFRIYVGNLPWDVDNGRLE  224

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            E+FS +   + ARVV +  +G+S G+GFV    + E   AI+++DG  L GR I++ ++E
Sbjct  225  EVFSVHGKVVDARVVCDRETGRSRGFGFVTMSNEAEVSEAIAALDGQNLEGRAIKVNVAE  284

Query  279  K  277
            +
Sbjct  285  E  285



>ref|XP_009596607.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic [Nicotiana 
tomentosiformis]
 ref|XP_009596608.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic [Nicotiana 
tomentosiformis]
Length=284

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 105/197 (53%), Gaps = 25/197 (13%)
 Frame = -3

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAE  634
            P+L  K+FV NLP+S   + + ELF + G VE VE I  K  G++RGF FVTM+S EE E
Sbjct  85   PDL--KIFVGNLPFSADSAALAELFERAGNVEMVEVIYDKLTGRSRGFGFVTMSSKEEVE  142

Query  633  AAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYK------------------  508
            AA Q+FN YEL GR +RV        P R        +  ++                  
Sbjct  143  AACQQFNGYELDGRALRVNAGPP---PERRENSSFRENSSFRENSSFRGGRGGGSFDSSN  199

Query  507  -LYVSNLAWKARSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISS  331
             +YV NLAW      L  LFS     + A+VV++  SG+S G+GFV + T EE   AI S
Sbjct  200  RVYVGNLAWGVDQDALETLFSEQGKVVDAKVVYDRDSGRSRGFGFVTYSTAEEVNNAIES  259

Query  330  IDGTELLGRPIRLKMSE  280
            +DG +L GR IR+  +E
Sbjct  260  LDGVDLNGRAIRVSPAE  276



>ref|XP_010035949.1| PREDICTED: 29 kDa ribonucleoprotein A, chloroplastic [Eucalyptus 
grandis]
 gb|KCW47459.1| hypothetical protein EUGRSUZ_K01243 [Eucalyptus grandis]
 gb|KCW47460.1| hypothetical protein EUGRSUZ_K01243 [Eucalyptus grandis]
Length=298

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 109/186 (59%), Gaps = 11/186 (6%)
 Frame = -3

Query  810  PNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAE  634
            P+L  KLFV NLP+++  + +  LF   G VE VE I  KE G++RGF FVTM++ EE E
Sbjct  108  PDL--KLFVGNLPFTVDSAQLAGLFESAGNVEMVEVIYDKETGRSRGFGFVTMSTAEEVE  165

Query  633  AAIQKFNSYELSGRTIRVEY----SKKFKKPIR----SpppppPRDGRYKLYVSNLAWKA  478
            AA Q+FN YEL GR +RV      +K+   P R            +   ++YV NL+W  
Sbjct  166  AAAQQFNGYELDGRPLRVNSGPPPAKRDGPPPRMGRGGSNFSNSSNSSNRVYVGNLSWGV  225

Query  477  RSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPI  298
                L  LFS     + A+VV++  SG+S G+GFV++G+ +E   AI S++G +L GR I
Sbjct  226  DDLALETLFSEQGRVLEAKVVYDRESGRSRGFGFVSYGSADEVNNAIDSLNGVDLNGRSI  285

Query  297  RLKMSE  280
            R+  +E
Sbjct  286  RVTHAE  291



>emb|CDX90605.1| BnaA03g41760D [Brassica napus]
Length=317

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 111/181 (61%), Gaps = 8/181 (4%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            +L+V NLP+++  S++ +LFG+ G V DV+ +  K   ++RGF FVTM + EEA+ AIQ 
Sbjct  106  RLYVGNLPYTITASELSQLFGEAGNVIDVQIVYDKVTDRSRGFGFVTMGTIEEAKEAIQM  165

Query  618  FNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGR-------YKLYVSNLAWKARSTHLR  460
            FNS ++ GRT++V + +  +   R       RD         +K+Y  NL W   S  L+
Sbjct  166  FNSSQIGGRTVKVNFPEVPRGGEREVMRTKIRDSNKSYVDSPHKIYAGNLGWNLTSQGLK  225

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            + F      + A+V++E  SG+S G+GFV+F ++ E ++A+S+++G E+ GR +RL ++ 
Sbjct  226  DAFGDQPGVLGAKVIYERNSGRSRGFGFVSFESEGELQSALSAMNGVEVEGRALRLNLAS  285

Query  279  K  277
            +
Sbjct  286  E  286



>ref|XP_007223173.1| hypothetical protein PRUPE_ppa009133mg [Prunus persica]
 gb|EMJ24372.1| hypothetical protein PRUPE_ppa009133mg [Prunus persica]
Length=305

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 105/169 (62%), Gaps = 2/169 (1%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKEGQNRGFAFVTMASGEEAEAAIQKF  616
            +L   N+PW+    D++ LF + GTV DVE     + +NRG AFVTM S EEA AA+   
Sbjct  99   RLLAQNVPWTCTPEDIRTLFEKYGTVVDVELAMYNKTRNRGLAFVTMGSPEEALAALNNL  158

Query  615  NSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELF-SANF  439
             S E+ GR I++ Y+K  K     PP   P+   + LYV NL + ARS  L+ELF S + 
Sbjct  159  ESSEMEGRIIKMAYAKPKKT-KIPPPSSQPKPVTFNLYVENLPYGARSKDLKELFNSEDC  217

Query  438  NPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRL  292
            + ++A VVF+    +SAGYGFV F +K+EAEAA+S+  G  L+GR IR+
Sbjct  218  SVVTAEVVFQGNPRRSAGYGFVGFKSKKEAEAALSAFHGKLLMGRRIRV  266


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 46/89 (52%), Gaps = 3/89 (3%)
 Frame = -3

Query  816  PKPNLRRKLFVLNLPWSLAVSDVKELFG--QCGTVEDVEFIKTKEGQNRGFAFVTMASGE  643
            PKP +   L+V NLP+     D+KELF    C  V      +    ++ G+ FV   S +
Sbjct  187  PKP-VTFNLYVENLPYGARSKDLKELFNSEDCSVVTAEVVFQGNPRRSAGYGFVGFKSKK  245

Query  642  EAEAAIQKFNSYELSGRTIRVEYSKKFKK  556
            EAEAA+  F+   L GR IRV   K+F K
Sbjct  246  EAEAALSAFHGKLLMGRRIRVARGKQFVK  274



>ref|XP_002519525.1| ribonucleoprotein, chloroplast, putative [Ricinus communis]
 gb|EEF42939.1| ribonucleoprotein, chloroplast, putative [Ricinus communis]
Length=280

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 103/186 (55%), Gaps = 19/186 (10%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTK-EGQNRGFAFVTMASGEEAEAAIQK  619
            KLFV NLP+++  + +  LF   G VE VE I  K  G++RGF FVTM+S +E EAA Q+
Sbjct  93   KLFVGNLPFNVDSAQLAGLFESAGNVEMVEVIYDKVTGRSRGFGFVTMSSIDEVEAAAQQ  152

Query  618  FNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRY-------------KLYVSNLAWKA  478
            FN YEL GR +RV        P         R  R+             +LYV NL+W  
Sbjct  153  FNGYELEGRALRVN-----SGPPPQRESSFSRSPRFGGGGGGGESLEGNRLYVGNLSWSV  207

Query  477  RSTHLRELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPI  298
             +  L   FS     + A+VV++  SG+S G+GFV + + EE E AI S++G EL GR I
Sbjct  208  DNLALESFFSEQGKVVDAKVVYDRESGRSRGFGFVTYSSAEEVENAIDSLNGAELDGRAI  267

Query  297  RLKMSE  280
            R+ ++E
Sbjct  268  RVSVAE  273



>emb|CDY08947.1| BnaC08g11770D [Brassica napus]
Length=290

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 108/181 (60%), Gaps = 3/181 (2%)
 Frame = -3

Query  816  PKPNLRRKLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEE  640
            P+P    KLFV NL + +    +  LF Q GTVE  E I  +E  Q+RGF FVTM+S EE
Sbjct  106  PEPPEEAKLFVGNLAYDVDSQALAMLFEQAGTVEIAEVIYDRETDQSRGFGFVTMSSVEE  165

Query  639  AEAAIQKFNSYELSGRTIRVEYSKKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLR  460
            AE A++KFN Y+L+GR + V  +K   +  R    P   +  +++YV NL W   +  L 
Sbjct  166  AETAVEKFNRYDLNGRLLTV--NKAAPRGSRPERQPRVYEPAFRVYVGNLPWDVDNGRLE  223

Query  459  ELFSANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSE  280
            ++FS +   + ARVV++  +G+S G+GFV    + E   AI+++DG  + GR IR+ ++E
Sbjct  224  QVFSEHGKVVEARVVYDRETGRSRGFGFVTMSNETELNDAIAALDGQNMEGRAIRVNVAE  283

Query  279  K  277
            +
Sbjct  284  E  284



>gb|ABK25016.1| unknown [Picea sitchensis]
Length=290

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 106/178 (60%), Gaps = 11/178 (6%)
 Frame = -3

Query  795  KLFVLNLPWSLAVSDVKELFGQCGTVEDVEFIKTKE-GQNRGFAFVTMASGEEAEAAIQK  619
            KLFV NLP++L    + ELF   G V DV  I  +E G +RGF FVTM + EEAE  ++ 
Sbjct  114  KLFVGNLPFNLDNQQLGELFEGAGEVLDVNIITDRETGNSRGFGFVTMGTVEEAEKGVEL  173

Query  618  FNSYELSGRTIRVEYS----KKFKKPIRSpppppPRDGRYKLYVSNLAWKARSTHLRELF  451
            FN + L GR + V  +     K ++P ++           K+YV NL W+A    L +LF
Sbjct  174  FNRHSLEGRLLTVNKAAPRGTKVERPSQAGSSTN------KIYVGNLPWQADDNSLLQLF  227

Query  450  SANFNPISARVVFENASGKSAGYGFVAFGTKEEAEAAISSIDGTELLGRPIRLKMSEK  277
            S +   + ARVV++  +G+S G+GFV + ++ E   AI+++DGT++ GRP+R+ ++E 
Sbjct  228  SEHGKVLEARVVYDRETGRSRGFGFVTYSSESEVNDAIAALDGTDMDGRPLRVNIAED  285



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2691533780576