BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79737_g1_i1 len=711 path=[1:0-710]

Length=711
                                                                      Score     E

ref|XP_009617824.1|  PREDICTED: olee1-like protein                      166   2e-47   
ref|XP_009773994.1|  PREDICTED: olee1-like protein                      155   2e-43   
ref|XP_007025385.1|  Olee1-like protein                                 144   6e-39   
gb|EYU43331.1|  hypothetical protein MIMGU_mgv1a014984mg                144   6e-39   
sp|Q8LGR0.1|CHE1_CHEAL  RecName: Full=Pollen allergen Che a 1; Al...    144   7e-39   Chenopodium album [lamb's-quarters]
ref|XP_007212169.1|  hypothetical protein PRUPE_ppa012463mg             143   9e-39   
ref|XP_010686203.1|  PREDICTED: pollen allergen Che a 1                 143   1e-38   
ref|XP_010057097.1|  PREDICTED: olee1-like protein                      143   1e-38   
ref|XP_009759546.1|  PREDICTED: olee1-like protein                      143   2e-38   
ref|XP_011079002.1|  PREDICTED: olee1-like protein                      141   4e-38   
gb|AAX93750.1|  pollen allergen Cro s 1                                 141   4e-38   Crocus sativus [saffron crocus]
ref|XP_011075462.1|  PREDICTED: olee1-like protein                      141   5e-38   
emb|CDX99789.1|  BnaC05g22110D                                          141   6e-38   
ref|XP_010103032.1|  hypothetical protein L484_005787                   140   1e-37   
ref|XP_009115274.1|  PREDICTED: pollen-specific protein-like At4g...    140   2e-37   
ref|XP_010481521.1|  PREDICTED: pollen-specific protein-like At4g...    140   3e-37   
gb|KFK28529.1|  hypothetical protein AALP_AA7G008600                    139   5e-37   
sp|O49813.1|OLEE1_BETPN  RecName: Full=Olee1-like protein; Flags:...    139   6e-37   Betula pendula [white birch]
ref|XP_011085997.1|  PREDICTED: olee1-like protein                      137   1e-36   
ref|XP_009608960.1|  PREDICTED: olee1-like protein                      137   2e-36   
ref|XP_006414083.1|  hypothetical protein EUTSA_v10026398mg             137   2e-36   
gb|KFK31513.1|  hypothetical protein AALP_AA6G122400                    137   2e-36   
gb|ADK22842.1|  Sal k 5                                                 137   2e-36   
emb|CDX77620.1|  BnaC07g18740D                                          137   2e-36   
ref|XP_011075627.1|  PREDICTED: olee1-like protein                      137   3e-36   
ref|NP_567562.1|  pollen Ole e 1 allergen and extensin family pro...    137   3e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010441660.1|  PREDICTED: pollen-specific protein-like At4g...    137   4e-36   
gb|KGN49303.1|  hypothetical protein Csa_6G519560                       136   5e-36   
ref|XP_004134662.1|  PREDICTED: olee1-like protein-like                 136   5e-36   
ref|XP_009101556.1|  PREDICTED: pollen-specific protein-like At4g...    136   5e-36   
ref|XP_006398273.1|  hypothetical protein EUTSA_v10001051mg             136   6e-36   
ref|XP_009114385.1|  PREDICTED: pollen-specific protein-like At4g...    135   1e-35   
ref|XP_006284941.1|  hypothetical protein CARUB_v10006240mg             135   1e-35   
ref|XP_010549400.1|  PREDICTED: pollen-specific protein-like At4g...    135   1e-35   
emb|CDY01556.1|  BnaC07g35460D                                          135   1e-35   
emb|CDX99452.1|  BnaC01g11000D                                          135   1e-35   
ref|XP_009348994.1|  PREDICTED: olee1-like protein                      135   1e-35   
ref|XP_002863445.1|  hypothetical protein ARALYDRAFT_494394             135   2e-35   
ref|XP_010434511.1|  PREDICTED: pollen-specific protein-like At4g...    135   2e-35   
ref|XP_009108374.1|  PREDICTED: pollen-specific protein-like At4g...    135   2e-35   
ref|XP_010494740.1|  PREDICTED: pollen-specific protein-like At4g...    135   2e-35   
ref|XP_006304746.1|  hypothetical protein CARUB_v10012122mg             134   2e-35   
emb|CDY52214.1|  BnaAnng11370D                                          134   2e-35   
ref|XP_010496255.1|  PREDICTED: pollen-specific protein-like At4g...    134   3e-35   
ref|XP_008371469.1|  PREDICTED: olee1-like protein                      134   3e-35   
ref|XP_009132011.1|  PREDICTED: pollen-specific protein-like At4g...    134   3e-35   
ref|XP_004233077.1|  PREDICTED: major pollen allergen Lig v 1-like      134   3e-35   
ref|XP_009136942.1|  PREDICTED: pollen-specific protein-like At4g...    134   3e-35   
ref|XP_010439832.1|  PREDICTED: pollen-specific protein-like At4g...    134   3e-35   
ref|XP_008383629.1|  PREDICTED: olee1-like protein                      134   4e-35   
ref|XP_009352776.1|  PREDICTED: olee1-like protein                      134   5e-35   
ref|XP_007148052.1|  hypothetical protein PHAVU_006G176500g             134   5e-35   
gb|KHG25858.1|  Olee1-like protein                                      133   5e-35   
ref|XP_006281481.1|  hypothetical protein CARUB_v10027565mg             133   1e-34   
ref|XP_003546028.1|  PREDICTED: olee1-like protein-like                 132   1e-34   
ref|NP_568650.1|  pollen_Ole_e_I-domain containing protein              133   1e-34   Arabidopsis thaliana [mouse-ear cress]
gb|ACU23617.1|  unknown                                                 132   1e-34   Glycine max [soybeans]
ref|XP_010540511.1|  PREDICTED: pollen-specific protein-like At4g...    132   2e-34   
ref|XP_008225283.1|  PREDICTED: olee1-like protein                      132   2e-34   
ref|XP_002870034.1|  pollen ole e 1 allergen and extensin family ...    132   2e-34   
emb|CDY65576.1|  BnaC09g52000D                                          132   2e-34   
ref|NP_174209.1|  pollen Ole e 1 allergen and extensin family pro...    132   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004134927.1|  PREDICTED: olee1-like protein-like                 132   3e-34   
ref|XP_006415610.1|  hypothetical protein EUTSA_v10008921mg             132   3e-34   
dbj|BAB09316.1|  Ole e I (main olive allergen)-like protein             132   3e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009128814.1|  PREDICTED: pollen-specific protein-like At4g...    132   3e-34   
emb|CDX87759.1|  BnaC02g31900D                                          132   3e-34   
emb|CDY69202.1|  BnaCnng62360D                                          131   4e-34   
gb|KFK44745.1|  hypothetical protein AALP_AA1G297400                    131   4e-34   
ref|XP_009102877.1|  PREDICTED: pollen-specific protein-like At4g...    131   5e-34   
ref|XP_010499433.1|  PREDICTED: pollen-specific protein-like At4g...    131   5e-34   
ref|XP_010460686.1|  PREDICTED: pollen-specific protein-like At4g...    130   1e-33   
ref|XP_010277041.1|  PREDICTED: anther-specific protein LAT52           130   1e-33   
ref|XP_010529196.1|  PREDICTED: pollen-specific protein-like At4g...    130   1e-33   
ref|XP_002522577.1|  Pollen allergen Che a 1 precursor, putative        130   1e-33   Ricinus communis
ref|XP_010478273.1|  PREDICTED: pollen-specific protein-like At4g...    130   2e-33   
gb|AAM65838.1|  Ole e I (main olive allergen)-like protein              129   2e-33   Arabidopsis thaliana [mouse-ear cress]
gb|AFK47865.1|  unknown                                                 129   3e-33   
ref|XP_003541705.1|  PREDICTED: olee1-like protein-like                 129   3e-33   
ref|XP_002273294.1|  PREDICTED: olee1-like protein                      129   4e-33   Vitis vinifera
ref|XP_008439742.1|  PREDICTED: olee1-like protein isoform X1           129   4e-33   
ref|XP_004485892.1|  PREDICTED: olee1-like protein-like                 128   4e-33   
ref|XP_010538209.1|  PREDICTED: pollen-specific protein-like At4g...    128   6e-33   
ref|XP_010518802.1|  PREDICTED: pollen-specific protein-like At4g...    128   6e-33   
ref|XP_009109686.1|  PREDICTED: pollen-specific protein-like At4g...    128   7e-33   
ref|XP_011080816.1|  PREDICTED: major pollen allergen Ole e 1-like      127   8e-33   
emb|CAA16739.1|  pollen-specific protein - like                         136   9e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004251892.1|  PREDICTED: anther-specific protein LAT52-like      127   9e-33   
ref|XP_002523378.1|  Anther-specific protein LAT52 precursor, put...    127   9e-33   Ricinus communis
ref|XP_008439743.1|  PREDICTED: olee1-like protein isoform X2           127   9e-33   
emb|CDY43319.1|  BnaC03g58910D                                          127   1e-32   
gb|AFK46977.1|  unknown                                                 127   2e-32   
ref|XP_009602640.1|  PREDICTED: anther-specific protein LAT52-like      125   5e-32   
ref|XP_006358942.1|  PREDICTED: anther-specific protein LAT52-like      124   2e-31   
ref|XP_009604804.1|  PREDICTED: anther-specific protein LAT52           124   3e-31   
gb|KHG10520.1|  Olee1-like protein                                      124   3e-31   
ref|XP_009778120.1|  PREDICTED: anther-specific protein LAT52-like      123   5e-31   
gb|EPS70684.1|  hypothetical protein M569_04073                         123   7e-31   
gb|ACJ83911.1|  unknown                                                 122   1e-30   Medicago truncatula
gb|AFB73931.1|  LAT52-like protein                                      121   2e-30   
gb|AFB73932.1|  LAT52-like protein                                      120   4e-30   
ref|XP_006360048.1|  PREDICTED: anther-specific protein LAT52-like      120   4e-30   
ref|XP_011101379.1|  PREDICTED: olee1-like protein                      121   5e-30   
ref|XP_008450951.1|  PREDICTED: olee1-like protein                      120   6e-30   
ref|XP_009794171.1|  PREDICTED: anther-specific protein LAT52           119   1e-29   
ref|XP_004144129.1|  PREDICTED: olee1-like protein-like                 119   1e-29   
ref|XP_008467237.1|  PREDICTED: olee1-like protein                      119   2e-29   
ref|XP_011029563.1|  PREDICTED: olee1-like protein                      119   2e-29   
ref|XP_004143635.1|  PREDICTED: olee1-like protein-like                 119   2e-29   
ref|XP_002316866.1|  pollen Ole e 1 allergen and extensin family ...    118   4e-29   Populus trichocarpa [western balsam poplar]
ref|XP_004248244.1|  PREDICTED: anther-specific protein LAT52           117   9e-29   
ref|XP_007021723.1|  Pollen Ole e 1 allergen and extensin family ...    117   1e-28   
ref|XP_006370166.1|  pollen Ole e 1 allergen and extensin family ...    115   3e-28   
ref|XP_011078225.1|  PREDICTED: pollen allergen Che a 1-like            116   3e-28   
ref|XP_006857531.1|  hypothetical protein AMTR_s00061p00032820          115   4e-28   
ref|XP_011006522.1|  PREDICTED: olee1-like protein                      114   7e-28   
gb|KCW69946.1|  hypothetical protein EUGRSUZ_F03264                     115   8e-28   
ref|XP_011070069.1|  PREDICTED: anther-specific protein LAT52-like      114   9e-28   
ref|XP_010941451.1|  PREDICTED: pollen-specific protein C13-like        114   1e-27   
ref|XP_010062811.1|  PREDICTED: olee1-like protein                      115   1e-27   
ref|XP_002890794.1|  hypothetical protein ARALYDRAFT_336019             120   2e-27   
ref|XP_004293940.1|  PREDICTED: olee1-like protein-like                 112   6e-27   
ref|XP_004244268.1|  PREDICTED: anther-specific protein LAT52-like      112   7e-27   
ref|XP_006348395.1|  PREDICTED: anther-specific protein LAT52-like      112   7e-27   
gb|KDP32532.1|  hypothetical protein JCGZ_14735                         111   1e-26   
gb|ACF82695.1|  unknown                                                 111   1e-26   Zea mays [maize]
ref|XP_010261236.1|  PREDICTED: pollen-specific protein C13-like        111   2e-26   
ref|XP_006652233.1|  PREDICTED: pollen-specific protein C13-like        111   2e-26   
ref|XP_008226528.1|  PREDICTED: olee1-like protein                      110   2e-26   
pir||S43242  allergen-like protein Syr v I isoform 1 - Syringa vu...    110   3e-26
gb|ACG33223.1|  pollen-specific protein C13 precursor                   110   4e-26   Zea mays [maize]
ref|NP_001148343.1|  LOC100281953 precursor                             110   5e-26   Zea mays [maize]
emb|CAH66537.1|  H0209H04.4                                             109   1e-25   Oryza sativa [red rice]
gb|EYU26327.1|  hypothetical protein MIMGU_mgv1a015422mg                108   1e-25   
sp|O82015.2|LIGV1_LIGVU  RecName: Full=Major pollen allergen Lig ...    108   1e-25   Ligustrum vulgare [prim]
ref|NP_001052674.1|  Os04g0398700                                       108   1e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009334049.1|  PREDICTED: olee1-like protein                      108   1e-25   
gb|AEW90946.1|  pollen-specific protein F8-4                            108   2e-25   
ref|XP_009761932.1|  PREDICTED: anther-specific protein LAT52-like      108   2e-25   
gb|ABP58635.1|  major pollen allergen Ole e 1                           107   2e-25   Olea europaea
ref|NP_001105351.1|  pollen-specific protein C13 precursor              108   2e-25   Zea mays [maize]
gb|EAY93952.1|  hypothetical protein OsI_15725                          108   3e-25   Oryza sativa Indica Group [Indian rice]
gb|AAN76546.1|AF393475_1  LLP-B3 protein                                107   3e-25   Lilium longiflorum [Easter lily]
ref|XP_003581152.1|  PREDICTED: pollen-specific protein C13-like        107   4e-25   
ref|XP_010317514.1|  PREDICTED: olee1-like protein                      106   5e-25   
pir||B53806  major allergen OLE5c - common olive                        107   5e-25
emb|CAA73037.1|  Ole e 1.0103 protein                                   107   5e-25   Olea europaea
ref|XP_007213539.1|  hypothetical protein PRUPE_ppa019680mg             107   5e-25   
ref|XP_011101449.1|  PREDICTED: olee1-like protein                      107   5e-25   
emb|CAA73038.1|  Ole e 1.0102 protein                                   106   5e-25   Olea europaea
pir||S43244  allergen-like protein Syr v I isoform 3 - Syringa vu...    106   6e-25
ref|XP_010269200.1|  PREDICTED: pollen-specific protein C13-like        107   6e-25   
ref|XP_009598969.1|  PREDICTED: anther-specific protein LAT52-like      107   7e-25   
emb|CDP16229.1|  unnamed protein product                                107   7e-25   
sp|P19963.2|ALL1_OLEEU  RecName: Full=Major pollen allergen Ole e...    106   1e-24   Olea europaea
ref|XP_006472638.1|  PREDICTED: pollen-specific protein C13-like        106   1e-24   
gb|KDO80906.1|  hypothetical protein CISIN_1g031458mg                   105   1e-24   
gb|EYU45018.1|  hypothetical protein MIMGU_mgv1a015317mg                105   2e-24   
emb|CAA73036.1|  Ole e 1 protein                                        105   2e-24   Olea europaea
emb|CAA54819.1|  major allergen                                         105   2e-24   Ligustrum vulgare [prim]
ref|XP_006434027.1|  hypothetical protein CICLE_v10002743mg             105   2e-24   
gb|ABP58633.1|  major pollen allergen Ole e 1                           105   2e-24   Olea europaea
ref|XP_011098227.1|  PREDICTED: anther-specific protein LAT52-like      105   2e-24   
gb|ABP58636.1|  major pollen allergen Ole e 1                           105   2e-24   Olea europaea
ref|XP_008359333.1|  PREDICTED: olee1-like protein                      105   3e-24   
gb|ABP58632.1|  major pollen allergen Ole e 1                           104   3e-24   Olea europaea
ref|XP_002268073.1|  PREDICTED: pollen-specific protein C13             105   3e-24   Vitis vinifera
gb|KHG13789.1|  Anther-specific LAT52                                   105   4e-24   
gb|AEW90948.1|  pollen-specific protein F8-6                            105   4e-24   
gb|ABP58634.1|  major pollen allergen Ole e 1                           104   4e-24   Olea europaea
gb|KDP46869.1|  hypothetical protein JCGZ_24078                         104   5e-24   
ref|XP_002513885.1|  Pollen-specific protein C13 precursor, putative    104   5e-24   Ricinus communis
pir||C53806  major allergen OLE1c - common olive (fragment)             104   5e-24
gb|AEK85661.1|  major pollen allergen Ole e1                            103   5e-24   
pir||S43243  allergen-like protein Syr v I isoform 2 - Syringa vu...    103   5e-24
ref|XP_009342278.1|  PREDICTED: olee1-like protein                      104   5e-24   
ref|XP_011016068.1|  PREDICTED: pollen-specific protein C13-like        104   6e-24   
ref|XP_009340070.1|  PREDICTED: olee1-like protein                      104   6e-24   
ref|NP_001131377.1|  uncharacterized protein LOC100192702 precursor     104   6e-24   Zea mays [maize]
ref|XP_008775180.1|  PREDICTED: pollen-specific protein C13-like        104   7e-24   
gb|AEK85663.1|  major pollen allergen Ole e1                            103   7e-24   
gb|AEK85660.1|  major pollen allergen Ole e1                            103   7e-24   
ref|XP_009403224.1|  PREDICTED: pollen-specific protein C13-like        103   8e-24   
ref|XP_003566418.1|  PREDICTED: major pollen allergen Lol p 11-like     104   8e-24   
ref|NP_001150330.1|  pollen allergen Phl p 11 precursor                 103   9e-24   Zea mays [maize]
ref|XP_010538956.1|  PREDICTED: major pollen allergen Lol p 11          103   9e-24   
ref|XP_010535648.1|  PREDICTED: major pollen allergen Lol p 11-like     103   1e-23   
ref|XP_002447728.1|  hypothetical protein SORBIDRAFT_06g014740          103   1e-23   Sorghum bicolor [broomcorn]
gb|AAQ83588.1|  allergen Fra e 1                                        103   1e-23   Fraxinus excelsior
emb|CDP06002.1|  unnamed protein product                                103   2e-23   
gb|AAN18042.1|  major pollen allergen Ole e 1                           102   2e-23   Olea europaea
gb|ABK92993.1|  unknown                                                 102   2e-23   Populus trichocarpa [western balsam poplar]
ref|XP_008378536.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          104   2e-23   
gb|AEK85659.1|  major pollen allergen Ole e1                            102   2e-23   
pir||E53806  major allergen OLE17 - common olive (fragment)             102   2e-23
gb|ABK94215.1|  unknown                                                 102   3e-23   Populus trichocarpa [western balsam poplar]
emb|CDO96791.1|  unnamed protein product                                101   3e-23   
ref|XP_002392460.1|  hypothetical protein MPER_07958                    102   3e-23   Moniliophthora perniciosa FA553
gb|AAQ07442.1|  major pollen allergen Ole e 1                           101   3e-23   Olea europaea
gb|EPS72638.1|  hypothetical protein M569_02120                         102   3e-23   
ref|XP_002301038.1|  pollen Ole e 1 allergen and extensin family ...    102   3e-23   Populus trichocarpa [western balsam poplar]
gb|AAQ10267.1|  major pollen allergen Ole e 1                           101   4e-23   Olea europaea
ref|XP_009402012.1|  PREDICTED: pollen-specific protein C13-like        102   4e-23   
ref|XP_010942359.1|  PREDICTED: major pollen allergen Lol p 11-like     102   4e-23   
gb|AFW77548.1|  pollen allergen Phl p 11                                102   4e-23   
ref|XP_008376286.1|  PREDICTED: pollen-specific protein C13-like        102   5e-23   
ref|XP_010942360.1|  PREDICTED: pollen allergen Phl p 11-like           102   5e-23   
pir||G53806  major allergen OLE26 - common olive (fragment)             101   5e-23
ref|XP_010060161.1|  PREDICTED: protein DOWNSTREAM OF FLC               102   5e-23   
gb|AAQ10269.1|  major pollen allergen Ole e 1                           100   5e-23   Olea europaea
ref|XP_006464247.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          102   5e-23   
pir||F53806  major allergen OLE19 - common olive (fragment)             101   6e-23
dbj|BAK06698.1|  predicted protein                                      102   6e-23   
ref|XP_011006159.1|  PREDICTED: pollen-specific protein C13-like        101   6e-23   
pir||I53806  major allergen OLE16 - common olive (fragment)             100   9e-23
ref|XP_006344595.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          101   9e-23   
gb|KHG12773.1|  Olee1-like protein                                      102   9e-23   
ref|XP_002307393.1|  pollen Ole e 1 allergen and extensin family ...    100   1e-22   Populus trichocarpa [western balsam poplar]
ref|XP_009409254.1|  PREDICTED: major pollen allergen Lol p 11-like     101   1e-22   
ref|XP_006428158.1|  hypothetical protein CICLE_v10027141mg             103   1e-22   
ref|XP_010321468.1|  PREDICTED: LOW QUALITY PROTEIN: major pollen...    100   2e-22   
gb|AAQ08188.1|  major pollen allergen Ole e 1                         99.8    2e-22   Olea europaea
ref|XP_009386950.1|  PREDICTED: pollen-specific protein C13-like        100   2e-22   
gb|AAO41983.1|  unknown protein                                       98.6    3e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AAB32652.2|  main olive allergen                                   98.6    4e-22   Olea europaea
gb|KDP21093.1|  hypothetical protein JCGZ_21564                         100   4e-22   
pir||H53806  major allergen OLE6 - common olive (fragment)            99.0    4e-22
ref|XP_008797140.1|  PREDICTED: major pollen allergen Lol p 11-like   99.8    4e-22   
ref|XP_009383585.1|  PREDICTED: pollen-specific protein C13-like      99.8    4e-22   
ref|XP_006366520.1|  PREDICTED: olee1-like protein-like               99.4    4e-22   
gb|ABC86745.1|  pollen-specific protein                               99.4    4e-22   Vitis pseudoreticulata
emb|CAA78897.1|  pollen specific gene                                 99.8    4e-22   Oryza sativa [red rice]
ref|XP_008348540.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        99.4    5e-22   
ref|XP_004975466.1|  PREDICTED: pollen-specific protein C13-like      99.4    5e-22   
ref|XP_009421183.1|  PREDICTED: pollen-specific protein C13-like      99.4    5e-22   
gb|ADI55168.1|  AS1                                                   99.8    5e-22   
emb|CDP16230.1|  unnamed protein product                              99.0    7e-22   
gb|AAQ10277.1|  major pollen allergen Ole e 1                         97.8    8e-22   Olea europaea
ref|XP_002533139.1|  Pollen-specific protein C13 precursor, putative  98.6    9e-22   Ricinus communis
gb|AAQ10274.1|  major pollen allergen Ole e 1                         97.8    9e-22   Olea europaea
gb|AEK85658.1|  major pollen allergen Ole e1                          97.8    1e-21   
ref|XP_010527375.1|  PREDICTED: major pollen allergen Lol p 11-like   98.6    1e-21   
ref|XP_002440811.1|  hypothetical protein SORBIDRAFT_09g007260        98.6    1e-21   Sorghum bicolor [broomcorn]
gb|AAQ08947.1|  allergen Fra e 1.0101                                 98.2    1e-21   Fraxinus excelsior
ref|XP_007206364.1|  hypothetical protein PRUPE_ppa017800mg           98.2    1e-21   
ref|XP_008245042.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        98.2    1e-21   
ref|XP_009764546.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        98.2    1e-21   
ref|XP_008363638.1|  PREDICTED: olee1-like protein                    98.2    1e-21   
gb|AAV74343.1|  Fra e 1.0102 major allergen                           97.8    1e-21   Fraxinus excelsior
gb|AEK85662.1|  major pollen allergen Ole e1                          97.4    1e-21   
ref|XP_004489034.1|  PREDICTED: olee1-like protein-like               98.2    1e-21   
ref|XP_008234688.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        98.2    1e-21   
ref|XP_006664913.1|  PREDICTED: pollen allergen Phl p 11-like         97.8    2e-21   
ref|XP_002454899.1|  hypothetical protein SORBIDRAFT_03g001020        97.4    3e-21   Sorghum bicolor [broomcorn]
pir||A38968  major allergen OLE20 - common olive (fragment)           96.3    3e-21
gb|AAQ10272.1|  major pollen allergen Ole e 1                         96.3    3e-21   Olea europaea
gb|AAO22132.1|  major pollen allergen Ole e 1                         96.3    3e-21   Olea europaea
ref|XP_009396935.1|  PREDICTED: pollen-specific protein C13-like      97.1    4e-21   
ref|XP_010676978.1|  PREDICTED: major pollen allergen Lol p 11-like   97.1    4e-21   
ref|XP_008234009.1|  PREDICTED: pollen-specific protein C13           96.3    7e-21   
ref|XP_003634471.1|  PREDICTED: pollen-specific protein C13           96.3    7e-21   
ref|XP_009408781.1|  PREDICTED: pollen-specific protein C13-like      96.3    7e-21   
ref|XP_002310579.1|  hypothetical protein POPTR_0007s05750g           95.9    7e-21   Populus trichocarpa [western balsam poplar]
ref|XP_004960638.1|  PREDICTED: pollen allergen Phl p 11-like         96.3    8e-21   
ref|XP_010436385.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        95.9    9e-21   
ref|XP_009147847.1|  PREDICTED: pollen-specific protein-like At4g...  94.4    1e-20   
ref|XP_010521200.1|  PREDICTED: major pollen allergen Lol p 11        95.5    1e-20   
gb|EAZ45758.1|  hypothetical protein OsJ_30442                        95.1    1e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008782123.1|  PREDICTED: pollen-specific protein C13-like      95.5    2e-20   
ref|XP_007225977.1|  hypothetical protein PRUPE_ppa012675mg           94.7    2e-20   
ref|XP_008445353.1|  PREDICTED: protein DOWNSTREAM OF FLC             94.7    2e-20   
ref|XP_011101376.1|  PREDICTED: pollen allergen Che a 1-like isof...  95.1    2e-20   
ref|NP_001057857.1|  Os06g0556600                                     94.7    3e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006289520.1|  hypothetical protein CARUB_v10003061mg           94.4    3e-20   
ref|XP_004150698.1|  PREDICTED: pollen-specific protein C13-like      94.0    4e-20   
ref|XP_011030966.1|  PREDICTED: protein DOWNSTREAM OF FLC             94.0    4e-20   
ref|XP_009366359.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        94.0    4e-20   
dbj|BAD46623.1|  putative Pollen specific protein C13 precursor       94.0    5e-20   Oryza sativa Japonica Group [Japonica rice]
gb|EYU31033.1|  hypothetical protein MIMGU_mgv1a015328mg              94.0    5e-20   
gb|EEC85106.1|  hypothetical protein OsI_32490                        94.0    5e-20   
ref|NP_001064001.1|  Os09g0572800                                     94.0    5e-20   
gb|ABP58637.1|  major pollen allergen Ole e 1                         93.2    5e-20   
gb|EPS62385.1|  hypothetical protein M569_12405                       93.2    6e-20   
ref|XP_009760524.1|  PREDICTED: pollen-specific protein C13-like      93.2    8e-20   
ref|XP_009600627.1|  PREDICTED: major pollen allergen Lol p 11-like   93.2    8e-20   
ref|XP_006661014.1|  PREDICTED: pollen-specific protein C13-like      93.2    8e-20   
gb|KHN19737.1|  Pollen-specific protein C13                           93.2    1e-19   
ref|XP_010455288.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        92.8    1e-19   
ref|NP_001238723.1|  uncharacterized protein LOC100499710 precursor   92.8    1e-19   
ref|XP_007136225.1|  hypothetical protein PHAVU_009G028900g           92.8    1e-19   
gb|AAQ10273.1|  major pollen allergen Ole e 1                         91.7    1e-19   
ref|XP_006838264.1|  hypothetical protein AMTR_s00103p00069180        91.7    2e-19   
gb|AFK42345.1|  unknown                                               92.4    2e-19   
ref|XP_009134109.1|  PREDICTED: pollen-specific protein C13           92.0    2e-19   
ref|XP_011102257.1|  PREDICTED: olee1-like protein                    92.4    2e-19   
ref|XP_011101377.1|  PREDICTED: olee1-like protein isoform X2         92.0    2e-19   
ref|XP_007018845.1|  Pollen-specific protein C13, putative            92.0    3e-19   
emb|CDY05022.1|  BnaC03g28200D                                        91.7    3e-19   
ref|XP_006645671.1|  PREDICTED: pollen allergen Phl p 11-like         91.7    3e-19   
emb|CDY12288.1|  BnaA09g24880D                                        91.7    3e-19   
gb|AAT08700.1|  pollen-specific protein                               92.0    3e-19   
ref|XP_011090511.1|  PREDICTED: major pollen allergen Lol p 11-like   91.7    3e-19   
ref|XP_004500607.1|  PREDICTED: pollen-specific protein C13-like      91.3    4e-19   
gb|KDP32694.1|  hypothetical protein JCGZ_11986                       91.3    5e-19   
ref|XP_009797814.1|  PREDICTED: major pollen allergen Lol p 11-like   90.9    5e-19   
ref|NP_001148443.1|  pollen allergen Phl p 11 precursor               90.9    7e-19   
gb|AAQ10280.1|  major pollen allergen Ole e 1                         89.7    9e-19   
ref|NP_567338.1|  protein SAH7                                        90.5    9e-19   
ref|XP_002307104.1|  hypothetical protein POPTR_0005s08000g           90.1    1e-18   
ref|XP_008453801.1|  PREDICTED: major pollen allergen Lol p 11-like   90.1    1e-18   
gb|ADM76653.1|  extensin-like protein                                 89.7    1e-18   
ref|XP_004971474.1|  PREDICTED: pollen allergen Phl p 11-like         90.1    1e-18   
ref|XP_006468202.1|  PREDICTED: LOW QUALITY PROTEIN: olee1-like p...  88.6    2e-18   
ref|XP_006661725.1|  PREDICTED: pollen-specific protein C13-like      90.1    2e-18   
ref|XP_008343344.1|  PREDICTED: LOW QUALITY PROTEIN: olee1-like p...  88.6    2e-18   
gb|AFK37732.1|  unknown                                               89.4    2e-18   
ref|XP_004237415.1|  PREDICTED: pollen-specific protein C13           89.4    2e-18   
ref|XP_010025486.1|  PREDICTED: protein DOWNSTREAM OF FLC             89.7    2e-18   
gb|EMT13715.1|  Pollen allergen Phl p 11                              89.7    2e-18   
gb|AAM08621.1|AC107314_12  Putative Pollen specific protein C13 p...  89.7    2e-18   
ref|XP_009622218.1|  PREDICTED: pollen-specific protein C13-like      89.4    2e-18   
gb|AEW90941.1|  group 11 grass pollen allergen F7-4                   89.4    2e-18   
gb|AAQ10281.1|  major pollen allergen Ole e 1                         88.2    3e-18   
gb|KHN36879.1|  Olee1-like protein                                    89.0    3e-18   
dbj|BAK07321.1|  predicted protein                                    89.0    3e-18   
ref|XP_010424432.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        90.9    3e-18   
ref|XP_002459879.1|  hypothetical protein SORBIDRAFT_02g012930        89.0    3e-18   
ref|NP_001064462.2|  Os10g0371000                                     89.4    4e-18   
dbj|BAJ86956.1|  predicted protein                                    89.0    4e-18   
gb|AAO22133.1|  major pollen allergen Ole e 1                         87.8    4e-18   
gb|EMS61378.1|  Pollen-specific protein C13                           88.2    4e-18   
gb|AAF16869.1|AF109693_1  allergen-like protein BRSn20                88.2    5e-18   
ref|XP_004146873.1|  PREDICTED: pollen allergen Che a 1-like          88.2    5e-18   
gb|AAQ10279.1|  major pollen allergen Ole e 1                         87.4    5e-18   
sp|Q7M1X5.1|LOLB_LOLPR  RecName: Full=Major pollen allergen Lol p...  87.4    6e-18   
gb|AEW90942.1|  group 11 grass pollen allergen F7-6                   88.2    6e-18   
gb|AFK47744.1|  unknown                                               87.8    8e-18   
gb|AEW90943.1|  group 11 grass pollen allergen F8-6                   87.8    9e-18   
ref|XP_003565925.1|  PREDICTED: pollen allergen Phl p 11              87.8    1e-17   
ref|XP_006397273.1|  hypothetical protein EUTSA_v10029031mg           87.0    1e-17   
ref|XP_006442530.1|  hypothetical protein CICLE_v10024378mg           87.0    1e-17   
gb|EMS52933.1|  hypothetical protein TRIUR3_31283                     87.4    1e-17   
ref|NP_001235303.1|  uncharacterized protein LOC100306199 precursor   87.0    2e-17   
gb|KFK32118.1|  hypothetical protein AALP_AA6G200700                  87.0    2e-17   
ref|XP_004289324.1|  PREDICTED: pollen-specific protein C13-like      87.0    2e-17   
ref|XP_011097595.1|  PREDICTED: major pollen allergen Lol p 11-like   86.7    2e-17   
ref|XP_010911793.1|  PREDICTED: pollen-specific protein C13-like      87.0    2e-17   
gb|EYU24008.1|  hypothetical protein MIMGU_mgv1a015363mg              86.3    2e-17   
ref|NP_001237189.1|  uncharacterized protein LOC100305566 precursor   86.3    3e-17   
ref|XP_006355373.1|  PREDICTED: pollen-specific protein C13-like      86.3    3e-17   
gb|AEW90940.1|  group 11 grass pollen allergen F7-1                   86.3    3e-17   
gb|KEH38613.1|  pollen Ole e I family allergen                        86.3    3e-17   
sp|P82242.2|PLAL1_PLALA  RecName: Full=Major pollen allergen Pla ...  85.1    4e-17   
gb|KHG30321.1|  Anther-specific LAT52                                 85.9    4e-17   
sp|Q8H6L7.1|PHLB_PHLPR  RecName: Full=Pollen allergen Phl p 11; A...  85.5    4e-17   
ref|XP_007149397.1|  hypothetical protein PHAVU_005G066800g           85.5    5e-17   
gb|ACJ86286.1|  unknown                                               85.5    7e-17   
ref|XP_003573867.1|  PREDICTED: pollen-specific protein C13           85.5    7e-17   
ref|XP_004959259.1|  PREDICTED: pollen-specific protein C13-like      85.1    7e-17   
ref|XP_008803750.1|  PREDICTED: pollen-specific protein C13           85.1    8e-17   
ref|XP_004983223.1|  PREDICTED: pollen-specific protein C13-like      85.1    8e-17   
ref|XP_010916905.1|  PREDICTED: pollen-specific protein C13-like      84.7    1e-16   
ref|XP_003638771.1|  Pollen allergen Phl p                            84.3    1e-16   
ref|NP_001146979.1|  LOC100280588 precursor                           84.7    1e-16   
emb|CDP01424.1|  unnamed protein product                              84.3    1e-16   
ref|XP_010680579.1|  PREDICTED: major pollen allergen Lol p 11-like   84.0    2e-16   
ref|XP_010090546.1|  hypothetical protein L484_016596                 84.3    2e-16   
ref|XP_004299638.1|  PREDICTED: pollen allergen Phl p 11-like         82.0    3e-16   
ref|XP_010547621.1|  PREDICTED: protein DOWNSTREAM OF FLC             83.2    3e-16   
ref|XP_007048005.1|  Pollen-specific protein C13, putative            83.2    4e-16   
ref|XP_006601773.1|  PREDICTED: uncharacterized protein LOC100527...  82.8    4e-16   
emb|CAC41634.1|  plantain pollen major allergen, Pla l 1.0102         82.4    4e-16   
ref|XP_002872410.1|  hypothetical protein ARALYDRAFT_489767           82.8    4e-16   
ref|XP_002489221.1|  hypothetical protein SORBIDRAFT_0012s014630      83.2    5e-16   
ref|XP_010105888.1|  hypothetical protein L484_021545                 83.2    5e-16   
gb|ACG32277.1|  pollen-specific protein C13 precursor                 82.8    6e-16   
emb|CAC41635.1|  plantain pollen major allergen, Pla l 1.0103         81.6    7e-16   
ref|XP_007149396.1|  hypothetical protein PHAVU_005G066700g           82.0    9e-16   
gb|AEW90945.1|  group 11 grass pollen allergen R1-2                   81.6    1e-15   
ref|XP_007153183.1|  hypothetical protein PHAVU_003G013900g           80.9    2e-15   
gb|AAM78187.1|  putative SAH7 protein                                 79.3    4e-15   
gb|KDO56621.1|  hypothetical protein CISIN_1g041753mg                 79.0    4e-15   
gb|AAM78185.1|  putative SAH7 protein                                 79.0    5e-15   
gb|ADM76665.1|  extensin-like protein                                 79.7    5e-15   
ref|XP_009789881.1|  PREDICTED: olee1-like protein                    80.1    5e-15   
gb|ABK22573.1|  unknown                                               79.7    5e-15   
gb|ABK21930.1|  unknown                                               79.7    6e-15   
gb|EPS69662.1|  hypothetical protein M569_05103                       79.7    6e-15   
gb|EAZ04544.1|  hypothetical protein OsI_26693                        79.0    8e-15   
gb|AFK44177.1|  unknown                                               78.2    1e-14   
ref|XP_007141147.1|  hypothetical protein PHAVU_008G171500g           78.2    2e-14   
gb|ADM76637.1|  extensin-like protein                                 77.4    3e-14   
ref|XP_007153182.1|  hypothetical protein PHAVU_003G013800g           77.4    4e-14   
gb|AAM78186.1|  putative SAH7 protein                                 76.3    5e-14   
gb|EAZ40496.1|  hypothetical protein OsJ_24951                        76.6    5e-14   
emb|CDX88408.1|  BnaC06g38520D                                        77.0    6e-14   
gb|AFO38383.1|  putative pollen-specific protein C13                  77.4    7e-14   
ref|XP_009106450.1|  PREDICTED: protein DOWNSTREAM OF FLC             76.6    7e-14   
ref|XP_008343324.1|  PREDICTED: olee1-like protein                    75.5    8e-14   
ref|NP_001175282.1|  Os07g0590500                                     76.6    8e-14   
emb|CDX87484.1|  BnaA07g33890D                                        76.3    1e-13   
ref|XP_003543768.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        75.9    1e-13   
gb|AAM78189.1|  putative SAH7 protein                                 73.9    3e-13   
ref|XP_006302909.1|  hypothetical protein CARUB_v10021044mg           74.7    4e-13   
gb|KHG18492.1|  Anther-specific LAT52                                 74.3    5e-13   
ref|XP_004502439.1|  PREDICTED: pollen-specific protein C13-like      73.9    6e-13   
gb|KEH38612.1|  pollen Ole e I family allergen                        73.2    1e-12   
gb|AFW82075.1|  hypothetical protein ZEAMMB73_949741                  71.6    2e-12   
ref|NP_177927.1|  pollen Ole e 1 allergen and extensin family pro...  72.4    2e-12   
gb|AAM78188.1|  putative SAH7 protein                                 71.2    3e-12   
gb|KFK42186.1|  hypothetical protein AALP_AA2G222600                  72.0    3e-12   
ref|XP_006390031.1|  hypothetical protein EUTSA_v10019236mg           70.9    7e-12   
gb|KHN44330.1|  Pollen-specific protein C13                           69.7    9e-12   
ref|XP_010472003.1|  PREDICTED: major pollen allergen Lol p 11-like   70.5    1e-11   
ref|XP_002889170.1|  pollen ole e 1 allergen and extensin family ...  70.5    1e-11   
ref|XP_010416770.1|  PREDICTED: major pollen allergen Lol p 11-like   70.5    1e-11   
ref|XP_009794836.1|  PREDICTED: pollen-specific protein C13-like      68.6    2e-11   
ref|XP_008381078.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        69.3    2e-11   
ref|XP_010906302.1|  PREDICTED: pollen-specific protein C13-like      68.6    2e-11   
gb|AAN60344.1|  unknown                                               68.9    3e-11   
gb|ACJ86288.1|  unknown                                               68.9    3e-11   
ref|XP_010428908.1|  PREDICTED: major pollen allergen Lol p 11-like   68.2    7e-11   
ref|XP_003596420.1|  Pollen allergen Che a                            67.8    8e-11   
ref|XP_003601984.1|  Pollen-specific protein C13                      67.4    9e-11   
ref|XP_002887714.1|  pollen ole e 1 allergen and extensin family ...  66.6    2e-10   
ref|XP_009413179.1|  PREDICTED: pollen-specific protein C13-like      64.7    4e-10   
ref|XP_008391140.1|  PREDICTED: olee1-like protein                    63.9    8e-10   
gb|ACK44512.1|  AT5G10130-like protein                                65.1    8e-10   
ref|XP_003596434.1|  Major pollen allergen Lol p                      64.7    8e-10   
gb|AAF17689.1|AC009243_16  F28K19.26                                  67.4    1e-09   
gb|EMT21854.1|  hypothetical protein F775_27590                       63.9    1e-09   
ref|XP_008238496.1|  PREDICTED: olee1-like protein                    64.3    2e-09   
gb|AAZ67595.1|  80A08_10                                              63.9    2e-09   
ref|XP_003596438.1|  Major pollen allergen Lol p                      63.9    2e-09   
ref|XP_008240860.1|  PREDICTED: olee1-like protein                    64.7    2e-09   
ref|XP_010453035.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        63.9    2e-09   
ref|XP_009122085.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        63.9    2e-09   
gb|ACQ44229.1|  putative pollen Ole e 1 allergen and extensin fam...  63.5    2e-09   
emb|CDY40079.1|  BnaC02g00510D                                        63.5    2e-09   
ref|NP_196575.1|  pollen_Ole_e_I-domain containing protein            62.8    5e-09   
ref|XP_010422886.1|  PREDICTED: protein DOWNSTREAM OF FLC             62.4    7e-09   
ref|XP_006288804.1|  hypothetical protein CARUB_v10002136mg           62.0    8e-09   
gb|KDO44647.1|  hypothetical protein CISIN_1g045131mg                 61.2    8e-09   
ref|XP_010491667.1|  PREDICTED: protein DOWNSTREAM OF FLC             62.0    8e-09   
ref|XP_002873440.1|  pollen ole e 1 allergen and extensin family ...  62.0    9e-09   
ref|XP_008225290.1|  PREDICTED: olee1-like protein                    62.0    1e-08   
emb|CDX85777.1|  BnaA02g00360D                                        61.6    1e-08   
ref|XP_009125327.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        61.6    1e-08   
ref|XP_003596443.1|  Major pollen allergen Lol p                      62.8    1e-08   
ref|XP_008231068.1|  PREDICTED: uncharacterized protein LOC103330298  61.2    2e-08   
gb|KEH15235.1|  pollen protein Ole E I-like protein                   61.2    2e-08   
ref|XP_009378008.1|  PREDICTED: uncharacterized protein LOC103966560  61.2    2e-08   
ref|XP_008357485.1|  PREDICTED: uncharacterized protein LOC103421237  60.8    9e-08   
ref|XP_007208803.1|  hypothetical protein PRUPE_ppa024703mg           59.3    1e-07   
emb|CDY21640.1|  BnaC09g46520D                                        58.5    1e-07   
ref|XP_007210061.1|  hypothetical protein PRUPE_ppa018487mg           58.9    1e-07   
ref|XP_006399503.1|  hypothetical protein EUTSA_v10014875mg           58.5    1e-07   
ref|XP_006373238.1|  hypothetical protein POPTR_0017s09980g           58.5    2e-07   
ref|XP_003596436.1|  Major pollen allergen Lol p                      57.8    3e-07   
ref|XP_007208811.1|  hypothetical protein PRUPE_ppa024778mg           57.8    3e-07   
gb|KHF98099.1|  Major pollen allergen Lol p 11                        57.4    4e-07   
gb|KDO83115.1|  hypothetical protein CISIN_1g019417mg                 59.3    4e-07   
ref|XP_006438816.1|  hypothetical protein CICLE_v10032019mg           59.3    4e-07   
gb|EMS67079.1|  hypothetical protein TRIUR3_25214                     56.2    5e-07   
ref|XP_002299330.2|  hypothetical protein POPTR_0001s13450g           58.2    8e-07   
ref|XP_010024180.1|  PREDICTED: major pollen allergen Ole e 1-like    56.6    8e-07   
gb|ABN50034.1|  putative Ole e 1-like protein                         54.7    9e-07   
gb|ACU17694.1|  unknown                                               56.2    1e-06   
ref|XP_010656997.1|  PREDICTED: extensin                              57.8    2e-06   
ref|XP_003549067.1|  PREDICTED: major pollen allergen Ole e 1-like    55.5    2e-06   
ref|XP_008341256.1|  PREDICTED: uncharacterized protein LOC103404151  55.5    3e-06   
ref|XP_007215048.1|  hypothetical protein PRUPE_ppa012112mg           55.1    4e-06   
ref|XP_011036125.1|  PREDICTED: leucine-rich repeat extensin-like...  55.5    1e-05   
emb|CDY21637.1|  BnaC09g46550D                                        53.5    1e-05   
ref|NP_001237949.1|  uncharacterized protein LOC100527053             52.0    1e-05   
ref|XP_004492161.1|  PREDICTED: major pollen allergen Ole e 1-like    53.1    2e-05   
gb|KDP41800.1|  hypothetical protein JCGZ_26818                       52.4    2e-05   
emb|CAN66813.1|  hypothetical protein VITISV_011139                   54.3    3e-05   
ref|XP_003622081.1|  hypothetical protein MTR_7g027020                52.4    3e-05   
ref|NP_001235830.1|  uncharacterized protein LOC100500029 precursor   52.4    3e-05   
emb|CDY14639.1|  BnaC02g24740D                                        51.6    4e-05   
emb|CBI21319.3|  unnamed protein product                              52.0    5e-05   
ref|XP_010250610.1|  PREDICTED: uncharacterized protein LOC104592812  52.0    5e-05   
gb|KHG27745.1|  Pollen-specific C13                                   51.6    5e-05   
gb|ABK26139.1|  unknown                                               53.1    5e-05   
gb|ACN41080.1|  unknown                                               53.1    6e-05   
ref|XP_002300128.1|  hypothetical protein POPTR_0001s33380g           51.6    6e-05   
ref|XP_002512897.1|  conserved hypothetical protein                   51.6    6e-05   
emb|CDP13383.1|  unnamed protein product                              53.1    6e-05   
gb|AFK43957.1|  unknown                                               51.6    6e-05   
ref|XP_011098921.1|  PREDICTED: uncharacterized protein LOC105177...  51.6    6e-05   
ref|XP_002272595.1|  PREDICTED: pollen-specific protein-like At4g...  51.6    6e-05   
ref|XP_010679984.1|  PREDICTED: pollen-specific protein-like At4g...  51.2    9e-05   
ref|XP_002990583.1|  hypothetical protein SELMODRAFT_448085           52.8    1e-04   
gb|KHF99541.1|  Major pollen allergen Pla l 1                         49.7    1e-04   
ref|XP_010110924.1|  hypothetical protein L484_005655                 50.4    2e-04   
ref|XP_007043885.1|  Pollen Ole e 1 allergen and extensin family ...  52.0    2e-04   
ref|XP_007161686.1|  hypothetical protein PHAVU_001G089800g           50.1    2e-04   
gb|EPS61737.1|  hypothetical protein M569_13059                       49.7    3e-04   
ref|XP_009378267.1|  PREDICTED: major pollen allergen Lig v 1-like    48.9    3e-04   



>ref|XP_009617824.1| PREDICTED: olee1-like protein [Nicotiana tomentosiformis]
Length=171

 Score =   166 bits (419),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 118/172 (69%), Gaps = 5/172 (3%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            M K  + +LIA+ I L S++G++ A+     ++++ V G VYCD CRA F  R+++ MPG
Sbjct  1    MTKSGAIILIASAICLFSLIGITQAQ----AQAQFHVEGKVYCDFCRALFENRLSKPMPG  56

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            A+V+L+C N+T++ VT ++EG+TDKNG+Y L  E DH EDEIC +  +KS KEDCSE+  
Sbjct  57   AEVRLQCRNSTDDSVTLTVEGQTDKNGVYSLLVERDH-EDEICEMILMKSSKEDCSEIPN  115

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGE  121
            +  AKE  R+T+T+NNG+    R  NP+ F+K +    CAEVFKEL  +P E
Sbjct  116  EGHAKESARITITSNNGMAETIRHANPLFFVKKEAAPECAEVFKELELLPEE  167



>ref|XP_009773994.1| PREDICTED: olee1-like protein [Nicotiana sylvestris]
Length=173

 Score =   155 bits (393),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 117/172 (68%), Gaps = 3/172 (2%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            M K  + +LI++V+ L S++G++ A+  A   +++ V G VYCD CRA F  R+++ M G
Sbjct  1    MTKSGAIILISSVVCLFSLIGITQAQAQAQ--AQFHVEGKVYCDFCRALFENRLSKPMAG  58

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            A+V+L+C N T++ VT ++EG+TDKNG+Y L  E DH EDEIC +  +KS  EDCSE+  
Sbjct  59   AEVRLQCRNNTDDSVTLTVEGQTDKNGVYSLLVERDH-EDEICEMILMKSSMEDCSEIPN  117

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGE  121
            +  AKE  R+T+T+NNG+   TR  NP+ F+K +    CAEVFKEL  +P E
Sbjct  118  EGHAKESARITITSNNGMAETTRHANPLFFVKKQAAPECAEVFKELELLPEE  169



>ref|XP_007025385.1| Olee1-like protein [Theobroma cacao]
 gb|EOY28007.1| Olee1-like protein [Theobroma cacao]
Length=170

 Score =   144 bits (362),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 110/162 (68%), Gaps = 5/162 (3%)
 Frame = -1

Query  624  QSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVK  445
            ++   +A+ +  +S+LG+  A+ P     ++ V G VYCD CRA+FVT++++ M GA+V+
Sbjct  6    KAIFFLASALCFLSLLGIVDAQAP----EQFFVEGKVYCDNCRAQFVTKISKYMAGAQVR  61

Query  444  LECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWA  265
            LEC +     +TYS++GETD++G YH++ EGDH E+EIC V  V+S   +CSE+ K+ + 
Sbjct  62   LECRDREGGDITYSVDGETDESGTYHIKVEGDH-EEEICEVSLVQSSDPECSEIDKENFL  120

Query  264  KEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKEL  139
            ++  R++LT  +G+ +D+R  NP+ F+  KP+  C EV +EL
Sbjct  121  RKSARISLTKYSGITSDSRLANPLGFMVKKPLPECTEVLREL  162



>gb|EYU43331.1| hypothetical protein MIMGU_mgv1a014984mg [Erythranthe guttata]
Length=171

 Score =   144 bits (362),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 107/172 (62%), Gaps = 5/172 (3%)
 Frame = -1

Query  633  AKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGA  454
            +  Q A+L A  + L+S+ G  GA+  AA  +++ V G VYC+VCR  F+ ++++ M GA
Sbjct  3    SATQIAILFAGALCLLSLPG--GAQSNAAA-TKFSVEGDVYCEVCRTNFINKLSQPMAGA  59

Query  453  KVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKD  274
             V+L+C   T   +TYSLEG TD  G YHL  EGDH EDE C +  V+S + DC+ V  +
Sbjct  60   TVRLQCKGETEGNITYSLEGITDDKGQYHLTVEGDHGEDE-CEITLVRSSRPDCNVVPDE  118

Query  273  MWA-KEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGE  121
             WA K  +R+TLT N+G   +TRK NP+ F K K    CA++FKEL   P E
Sbjct  119  GWATKPTSRITLTKNSGFHDNTRKANPLGFTKKKADPQCAQLFKELEINPEE  170



>sp|Q8LGR0.1|CHE1_CHEAL RecName: Full=Pollen allergen Che a 1; AltName: Allergen=Che 
a 1; Flags: Precursor [Chenopodium album]
 gb|AAL07319.1| Che a 1 allergen precursor [Chenopodium album]
Length=168

 Score =   144 bits (362),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 104/166 (63%), Gaps = 6/166 (4%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAK Q+  L+   + ++S+ GV+ A      ++ +KV G VYCD CR +F+TR++  M G
Sbjct  1    MAKCQAVFLLVGALCVLSLAGVANA-----AENHFKVQGMVYCDTCRIQFMTRISTIMEG  55

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            A VKLEC N T    T+  E  TDK G Y +   GD  ED+IC ++ VKSP  +CSEV  
Sbjct  56   ATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVNGDF-EDDICEIELVKSPNSECSEVSH  114

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKEL  139
            D++AK+  +V+LT+NNG  +D R  N + F++ +P+  C EV KEL
Sbjct  115  DVYAKQSAKVSLTSNNGEASDIRSANALGFMRKEPLKECPEVLKEL  160



>ref|XP_007212169.1| hypothetical protein PRUPE_ppa012463mg [Prunus persica]
 gb|EMJ13368.1| hypothetical protein PRUPE_ppa012463mg [Prunus persica]
Length=168

 Score =   143 bits (361),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 103/170 (61%), Gaps = 7/170 (4%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MA   S +++A+ +  +S+LG       A       V G VYCD CR +F+TR++E + G
Sbjct  1    MATKSSGIVLASALCFLSLLGF------AYCADNLSVDGLVYCDNCRIQFMTRISEPLQG  54

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            A VKLEC +     VT S E +TD+ G Y +  EGDH+E E+C V  VKSP++DCSEV  
Sbjct  55   ATVKLECRDREGGTVTLSSETDTDEQGRYQIPVEGDHEE-EVCEVLLVKSPRDDCSEVST  113

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
            D  AK   R++LT NNG+    R  NP+ FLKT+P A CAEV KEL   P
Sbjct  114  DSHAKLSARISLTNNNGIAGPHRIPNPLGFLKTEPDAKCAEVLKELGLTP  163



>ref|XP_010686203.1| PREDICTED: pollen allergen Che a 1 [Beta vulgaris subsp. vulgaris]
Length=169

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 109/175 (62%), Gaps = 8/175 (5%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MA+VQ+  L+A V+ ++S+ GV+      A  + +KV G VYCD CR +F+TRV+  M G
Sbjct  1    MARVQTIFLLAGVLSVLSLAGVA-----YAATNHFKVQGMVYCDTCRIQFITRVSTMMEG  55

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            A V+LEC N T    T+  E  TDK GMY +  +GD+ ED+IC +   KS   +C+++  
Sbjct  56   ATVRLECRNITAGTETFKSEAITDKLGMYSINVDGDY-EDDICEIVLAKSSNNECTDISH  114

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKE--LHYIPGEN  118
            D++AK+  +V+LT+NNG  +D R  N + F++  P+  C EV KE  L+ +P  N
Sbjct  115  DVYAKQAAKVSLTSNNGESSDVRSANALGFMRKTPLPECPEVLKELDLYDVPAAN  169



>ref|XP_010057097.1| PREDICTED: olee1-like protein [Eucalyptus grandis]
 gb|KCW74109.1| hypothetical protein EUGRSUZ_E02748 [Eucalyptus grandis]
Length=168

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 99/157 (63%), Gaps = 1/157 (1%)
 Frame = -1

Query  609  IAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLN  430
            + A+IFL S L          G SR+ V G VYCD CR +F+T+V++ MP AKV+LEC +
Sbjct  5    LQAIIFLASALSFLSLLGAVYGDSRFFVEGKVYCDTCRTQFITKVSKDMPDAKVRLECKD  64

Query  429  TTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTR  250
                 VTYS+EG TD  GMY L  +G+H E+EIC +  VKS +  C EV  D + ++  R
Sbjct  65   REGGSVTYSIEGVTDNTGMYRLPVDGEH-EEEICEIVLVKSSQPGCEEVSNDPFLRKTAR  123

Query  249  VTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKEL  139
            ++LT NNG+ T  R+ NP+ ++K + +  CA+V +EL
Sbjct  124  ISLTKNNGMATPVRQANPLGYMKNESLPECADVLREL  160



>ref|XP_009759546.1| PREDICTED: olee1-like protein [Nicotiana sylvestris]
Length=172

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 109/171 (64%), Gaps = 8/171 (5%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGA-EKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMP  460
            MAK  + +   +VI L S+LG++ A EKP     ++ V G VYCD CR+ F T +++ + 
Sbjct  1    MAK-SAVIFFVSVICLFSILGLTQAYEKP-----QFIVEGIVYCDPCRSAFKTNLSQPLA  54

Query  459  GAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVI  280
            GA V+L+C +   E+VT ++  +T+  G YHL  EGDH E+EIC     KSPKEDCSE+ 
Sbjct  55   GAGVRLQCRHPETEEVTITIASQTNSTGYYHLLVEGDH-ENEICETYLTKSPKEDCSEIP  113

Query  279  KDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
             ++  KE +RVTLT NNG+  + R+ N + FL  K  + CA+ FK++ YIP
Sbjct  114  DEVHTKESSRVTLTNNNGMAGNLREANALFFLAKKSSSECAQEFKDMQYIP  164



>ref|XP_011079002.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=165

 Score =   141 bits (356),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 106/167 (63%), Gaps = 10/167 (6%)
 Frame = -1

Query  636  MAKV-QSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMP  460
            MA++ Q A+++AA    +S++ V+ +  P     ++ V G VYC+VCRA F  R +E M 
Sbjct  1    MARLTQVAIILAAAFCFLSLVDVADSHAP-----KFIVDGKVYCEVCRANFTNRYSEPMA  55

Query  459  GAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVI  280
            GAKVKLEC N   E VTY+LEGET++ G+Y L AEGDH ED +C V  +KS   DC+EV 
Sbjct  56   GAKVKLECKNEVTESVTYTLEGETNEKGVYTLTAEGDHGED-LCAVTLLKSSMADCAEVP  114

Query  279  KDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKEL  139
             +  A E   VTLT NNG   + R  NP+ F + + +  CAE+FKEL
Sbjct  115  DEKPAAE---VTLTLNNGFHDEFRHANPLTFTRKEALPECAELFKEL  158



>gb|AAX93750.1| pollen allergen Cro s 1 [Crocus sativus]
Length=168

 Score =   141 bits (356),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 103/166 (62%), Gaps = 6/166 (4%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            M K Q+  L+   + ++S+ GV+ A      ++ +KV G VYCD CR +F+TRV+  M G
Sbjct  1    MGKCQAVFLLVGALCVLSLAGVANA-----AENHFKVQGMVYCDTCRIQFMTRVSTIMEG  55

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            A VKLEC N T    T+  E  TDK G Y +   GD  +D+IC ++ VKSP  +CSEV  
Sbjct  56   ATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVHGDF-QDDICEIELVKSPNSECSEVSH  114

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKEL  139
            D++AK+  +V+LT+NNG  +D R  N + F++ +P+  C EV KEL
Sbjct  115  DVYAKQSAKVSLTSNNGEASDIRSANALGFMRKEPLKECPEVLKEL  160



>ref|XP_011075462.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=163

 Score =   141 bits (356),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 101/166 (61%), Gaps = 10/166 (6%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MA+     +I AV   +  L V+ +  P     ++ V G VYC+VCRA F  R +E MPG
Sbjct  1    MARFTQVAIILAVA--LCFLDVAASHAP-----KFVVDGKVYCEVCRANFTNRYSEPMPG  53

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKVKLEC N   EKVTY+LEGET+  G+Y L AEGDH  +++C V  VKS   DC+E+  
Sbjct  54   AKVKLECKNEVTEKVTYTLEGETNDKGVYTLTAEGDHGSEDLCAVTLVKSSMADCAEIPD  113

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKEL  139
            +  A E   VTLT NNG   + R  NP+ F + + +  CAE+FKEL
Sbjct  114  EKPAAE---VTLTLNNGFHDEFRHANPLAFTRKEALPECAELFKEL  156



>emb|CDX99789.1| BnaC05g22110D [Brassica napus]
Length=171

 Score =   141 bits (356),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 112/171 (65%), Gaps = 5/171 (3%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAK     L +A+ F  ++L +  A+  A    R+ +TG+VYCD CR +FVTR+++ + G
Sbjct  1    MAKFFIVFLASALCF-TTLLHLVAAD--ADDFDRFNITGSVYCDTCRVQFVTRLSKFLEG  57

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKVKLEC +  N+ VT + E  TDK+G Y +E  GDH E+E+C +  V+SP  +C EV  
Sbjct  58   AKVKLECKSRVNQTVTLTKEAVTDKDGKYQMEVMGDH-EEELCEIILVQSPDAECGEVNN  116

Query  276  DMWAKEFTRVTLTANNGLVTD-TRKVNPILFLKTKPIAVCAEVFKELHYIP  127
            + + +   R++LTAN+G+V++  R +NP+ F++  P+A C +VFKEL  +P
Sbjct  117  EEFLRNAARISLTANDGIVSNEIRTINPLGFMRKTPLADCPQVFKELGIVP  167



>ref|XP_010103032.1| hypothetical protein L484_005787 [Morus notabilis]
 gb|EXB94630.1| hypothetical protein L484_005787 [Morus notabilis]
Length=166

 Score =   140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 104/166 (63%), Gaps = 6/166 (4%)
 Frame = -1

Query  624  QSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVK  445
            +S ++IA+ +  +S+LG +  + P        V G VYCD CRA+FVT+V+  + GAKV+
Sbjct  3    KSVIIIASALCFMSLLGFAYCDTP-----HLIVEGRVYCDTCRAQFVTKVSNYIKGAKVR  57

Query  444  LECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWA  265
            LEC  +    VTYS +G TD++G Y +  +GDH E+E+C VK VKS   DCSE+  D + 
Sbjct  58   LECRESEGGSVTYSNDGVTDESGTYRIAVDGDH-EEEVCEVKLVKSSVPDCSEISNDPYN  116

Query  264  KEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
            K   RV+LT+NNG+ +  R+ NP+ FLK   +  C EV +EL   P
Sbjct  117  KLNARVSLTSNNGITSPVRQANPLGFLKKNSLPECPEVLRELGITP  162



>ref|XP_009115274.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
Length=171

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 111/171 (65%), Gaps = 5/171 (3%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAK     L +A+ F  ++L +  A+  A    R+ +TG+VYCD CR +FVTR+++ + G
Sbjct  1    MAKFFIVFLASALCF-TTLLHLVAAD--ADDFDRFNITGSVYCDTCRVQFVTRLSKFLEG  57

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKVKLEC +  N+ VT + E  TDK+G Y +E  GDH E+E+C    V+SP  +C EV  
Sbjct  58   AKVKLECKSRVNQTVTLTKEAVTDKDGKYQMEVMGDH-EEELCEFILVQSPDAECGEVNN  116

Query  276  DMWAKEFTRVTLTANNGLVTD-TRKVNPILFLKTKPIAVCAEVFKELHYIP  127
            + + +   R++LTAN+G+V++  R +NP+ F++  P+A C +VFKEL  +P
Sbjct  117  EEFLRNAARISLTANDGIVSNEIRTINPLGFMRKTPLADCPQVFKELGIVP  167



>ref|XP_010481521.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=174

 Score =   140 bits (352),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 106/162 (65%), Gaps = 6/162 (4%)
 Frame = -1

Query  597  IFLVSMLGVSGAEKPAAGKS----RYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLN  430
             F+VS L +S     AA  +    R+++ G+VYCD CR +FVTR+++ + GAKVKLEC N
Sbjct  10   FFIVSALCLSSLACFAAADADEFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRN  69

Query  429  TTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTR  250
             TN  VT + E  TDK+G Y +E  GDH E+E+C +  V+SP   CS+V K+ + +   +
Sbjct  70   RTNGTVTLTKEAVTDKSGSYKMEVTGDH-EEEVCELVLVESPDSGCSDVSKEAYLRNAAK  128

Query  249  VTLTANNGLVT-DTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
            ++LTAN+G+V+ +TR VNP+ F+   P A CA  FKE+  +P
Sbjct  129  ISLTANDGIVSHETRIVNPLGFMVKTPSADCAAAFKEIGIVP  170



>gb|KFK28529.1| hypothetical protein AALP_AA7G008600 [Arabis alpina]
Length=173

 Score =   139 bits (350),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 107/164 (65%), Gaps = 4/164 (2%)
 Frame = -1

Query  615  LLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLEC  436
             L  + + L S+ GV+ A+  A    R+++ G+VYCD CR +FVTR+++ + GAKVKLEC
Sbjct  9    FLFVSAVCLSSLAGVAVAD--ADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLEC  66

Query  435  LNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEF  256
             + TN  +T + E  TDK G Y +E  GDH E+E+C +  V+SP   CS+V K+ + +  
Sbjct  67   RSRTNGTITLTKEAVTDKTGSYKMEVTGDH-EEEVCELVLVQSPDSGCSDVSKEAYLRNA  125

Query  255  TRVTLTANNGLVT-DTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
             +++LTAN+G+V+ +TR VNP+ F+   P+A C   FKEL  +P
Sbjct  126  AKISLTANDGIVSHETRIVNPLGFMVQTPLADCPAAFKELGIVP  169



>sp|O49813.1|OLEE1_BETPN RecName: Full=Olee1-like protein; Flags: Precursor [Betula pendula]
 emb|CAA74365.1| putative Ole e 1 protein [Betula pendula]
Length=166

 Score =   139 bits (349),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 106/175 (61%), Gaps = 9/175 (5%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAK  S ++ A  +  +S+LG + +E      SR+ V G VYCD CR +FVT+++  M G
Sbjct  1    MAK--SIIIQAPALCFLSLLGFAYSE------SRFFVEGKVYCDNCRTQFVTKLSTYMKG  52

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKV LEC N     + YS + ETDK+G Y +  +GDH E+EIC +   KS   DCSEV K
Sbjct  53   AKVSLECRNREGGTLIYSSDSETDKSGTYRIPVDGDH-EEEICEIALKKSSDPDCSEVSK  111

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGENVH  112
            D + K+  R++LT NNG+ T  R  NP+ F+K KP+  CA+  +EL   P + + 
Sbjct  112  DPFLKKSARISLTKNNGISTPVRLANPLGFMKKKPLPECAKALRELGMNPDDVIQ  166



>ref|XP_011085997.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=170

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 100/164 (61%), Gaps = 7/164 (4%)
 Frame = -1

Query  615  LLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLEC  436
             L A V+ L+ + GV+ A  P      + V G VYC+VCR  F+ +++E MPGAKVKLEC
Sbjct  10   FLFAGVLCLLCLPGVARATAP-----EFFVVGEVYCEVCRLNFINKLSEPMPGAKVKLEC  64

Query  435  LNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWA-KE  259
                   +TY+ EGET++ G Y L+ EGDH+E+E CG+  VKS + DC+E+  + WA K 
Sbjct  65   KGEEAGNITYTQEGETNEGGQYRLKVEGDHEEEE-CGITLVKSSRADCNEIPDEGWASKP  123

Query  258  FTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
             + +TLT NNG    +R  NP+ F K K    CAE+ KEL   P
Sbjct  124  SSLITLTKNNGFHGSSRYANPLGFTKKKANPECAELIKELEINP  167



>ref|XP_009608960.1| PREDICTED: olee1-like protein [Nicotiana tomentosiformis]
Length=172

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 106/171 (62%), Gaps = 8/171 (5%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGA-EKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMP  460
            MAK  + +   + I L S+LG++ A EKP     ++ V G VYCD CR+ F T +++ + 
Sbjct  1    MAK-SAVIFFVSAICLFSLLGLTQASEKP-----QFIVEGIVYCDPCRSAFKTNLSQPLA  54

Query  459  GAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVI  280
            GA V+L+C +   E+VT ++  ET+  G YHL  EGDH E+EIC     KS KEDCSE+ 
Sbjct  55   GAGVRLQCRHPETEEVTITIASETNTTGYYHLLVEGDH-ENEICETYLTKSSKEDCSEIP  113

Query  279  KDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
             ++  KE +RVTLT NNG+  + R+ N + FL     + CA+ FK++ YIP
Sbjct  114  DEVHTKESSRVTLTNNNGIAGNLREANALFFLAKNASSECAQEFKDMQYIP  164



>ref|XP_006414083.1| hypothetical protein EUTSA_v10026398mg [Eutrema salsugineum]
 gb|ESQ55536.1| hypothetical protein EUTSA_v10026398mg [Eutrema salsugineum]
Length=172

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 105/165 (64%), Gaps = 6/165 (4%)
 Frame = -1

Query  606  AAVIFLVSMLGVSGAEKPAAGKS----RYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLE  439
            A   F VS + +S     A   +    R+++ G+VYCD CR +FVTR+++ + GAKVKLE
Sbjct  5    AIFFFFVSAVCLSSLAGKALADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLE  64

Query  438  CLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKE  259
            C +  N  VT + E  TDK+G Y +E  GDH E+E+C +  V+SP   CS+V K+ + + 
Sbjct  65   CRSRANGTVTLTKEAVTDKSGSYRMEVTGDH-EEEVCELVLVQSPDSGCSDVSKEAYLRN  123

Query  258  FTRVTLTANNGLVT-DTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
              +++LTAN+G+V+ +TR VNP+ F+   P+A CA  FKEL  +P
Sbjct  124  AAKISLTANDGIVSHETRIVNPLGFMVKTPLADCAAAFKELGIVP  168



>gb|KFK31513.1| hypothetical protein AALP_AA6G122400 [Arabis alpina]
Length=173

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 109/170 (64%), Gaps = 4/170 (2%)
 Frame = -1

Query  633  AKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGA  454
            +K   +  + + + L S+ G + A+  A    R+++ G+VYCD CR +FVTR+++ + GA
Sbjct  3    SKAIFSFFVVSAVCLSSLAGFASAD--ADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGA  60

Query  453  KVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKD  274
            KVKLEC + TN  +T + E  TDK G Y +E  GDH E+E+C +  V+SP   CS+V ++
Sbjct  61   KVKLECRSRTNGTITLTKEAVTDKTGSYKMEVTGDH-EEEVCELVLVQSPDSGCSDVSQE  119

Query  273  MWAKEFTRVTLTANNGLVT-DTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
             + +   +++LTAN+G+V+ +TR VNP+ F+   P+A C   FKEL  +P
Sbjct  120  AYLRNAAKISLTANDGIVSHETRIVNPLGFMVKTPLADCPAAFKELGIVP  169



>gb|ADK22842.1| Sal k 5, partial [Salsola kali]
Length=151

 Score =   137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = -1

Query  558  KPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKN  379
            K   G + Y V G VYCD CR +F+TRV+  M GA V L+C N T    T+  E  TDK 
Sbjct  1    KGKGGHNLYHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKL  60

Query  378  GMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVN  199
            GMY ++ +GDH ED+IC +  VKSP ++CSE+  D+++++  +VTLT+NNG  +D R  N
Sbjct  61   GMYTIKVDGDH-EDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNAN  119

Query  198  PILFLKTKPIAVCAEVFKEL--HYIPG  124
             + FLK  P+  C EV KEL  + +PG
Sbjct  120  ALGFLKKAPLPECPEVLKELDMYDVPG  146



>emb|CDX77620.1| BnaC07g18740D [Brassica napus]
Length=174

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 108/165 (65%), Gaps = 4/165 (2%)
 Frame = -1

Query  618  ALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLE  439
            +L I + + L S+ G + A+  A     +++ G+VYCD CR +FVTR+++ + GAKVKLE
Sbjct  9    SLFIVSTVCLSSLAGFTAAD--ADDFDIFQIQGSVYCDTCRVQFVTRLSQFLEGAKVKLE  66

Query  438  CLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKE  259
            C + TN  +T + E  TDK+G Y +E  GDH E+E+C +  V+SP   CS+V K+ + + 
Sbjct  67   CRSRTNGTLTLTKEAVTDKSGSYKIEVTGDH-EEEVCELVLVQSPDSGCSDVSKEAYLRN  125

Query  258  FTRVTLTANNGLVT-DTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
              +++LTAN+G+V+ +TR VNP+ F+   P+A C   FKEL  +P
Sbjct  126  AAKISLTANDGIVSHETRIVNPLGFMVKTPLADCPAAFKELGIVP  170



>ref|XP_011075627.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=163

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 104/167 (62%), Gaps = 12/167 (7%)
 Frame = -1

Query  636  MAKV-QSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMP  460
            MAK+ Q A+++AA +     L V+ +  P     ++ V G VYC+VCRA F  R ++ M 
Sbjct  1    MAKLTQVAIILAAAL---CFLDVAASLAP-----KFVVDGKVYCEVCRANFTNRYSKPMA  52

Query  459  GAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVI  280
            GAKVKLEC N   EKVTY+LEGET+  G+Y L AEGDH  +++C V  VKS   DC+E+ 
Sbjct  53   GAKVKLECKNEVTEKVTYTLEGETNDKGVYTLTAEGDHGSEDLCAVTLVKSSMADCAEIP  112

Query  279  KDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKEL  139
             +  A E   VTLT NNG   + R  NP+ F + + +  CAE+FKEL
Sbjct  113  DEKPAAE---VTLTLNNGFHDEFRHANPLAFTRKEALPECAELFKEL  156



>ref|NP_567562.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 sp|Q6NMJ2.1|OLE96_ARATH RecName: Full=Pollen-specific protein-like At4g18596; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAS47674.1| At4g18596 [Arabidopsis thaliana]
 dbj|BAD94719.1| pollen-specific protein - like [Arabidopsis thaliana]
 gb|AEE84066.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
Length=172

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 107/171 (63%), Gaps = 4/171 (2%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MA         + + L S+ GV+ A+  A    R+++ G+VYCD CR +FVTR+++ + G
Sbjct  1    MASKAIFFFFVSAVCLSSLAGVAIAD--ADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEG  58

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKVKLEC + TN  VT + E  TDK G Y +E  GDH E+E+C +  V+SP   CS+V K
Sbjct  59   AKVKLECRSRTNGTVTLTKEAVTDKTGSYRMEVTGDH-EEEVCELVLVESPDSGCSDVSK  117

Query  276  DMWAKEFTRVTLTANNGLVT-DTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
            + + +   +++LTAN+G+V+ +TR VNP+ F+   P A C   FKEL  +P
Sbjct  118  EAYLRNAAKISLTANDGIVSHETRIVNPLGFMVQTPSAECPAAFKELGIVP  168



>ref|XP_010441660.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=174

 Score =   137 bits (344),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 107/165 (65%), Gaps = 4/165 (2%)
 Frame = -1

Query  618  ALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLE  439
            +  I + + L S+ G + A+       R+++ G+VYCD CR +FVTR+++ + GAKVKLE
Sbjct  9    SFFIVSAVCLSSLAGFAAADADDF--DRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLE  66

Query  438  CLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKE  259
            C N TN  VT + E  TDK+G Y +E  GDH E+E+C +  V+SP   CS+V K+ + + 
Sbjct  67   CRNRTNGTVTLTKEAVTDKSGSYKMEVTGDH-EEEVCELVLVESPDSGCSDVSKEAYLRN  125

Query  258  FTRVTLTANNGLVT-DTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
              +++LTAN+G+V+ +TR VNP+ F+   P A CA  FKE+  +P
Sbjct  126  AAKISLTANDGIVSHETRIVNPLGFMVKTPSADCAAAFKEIGIVP  170



>gb|KGN49303.1| hypothetical protein Csa_6G519560 [Cucumis sativus]
Length=168

 Score =   136 bits (343),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 109/171 (64%), Gaps = 13/171 (8%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAK  + +L++A+ FL S L ++      + K R+ + G VYCD CR +F TRV++ +PG
Sbjct  1    MAKSCAIILVSALCFL-SFLDIA-----LSSKDRFFIEGKVYCDTCRIQFFTRVSKYLPG  54

Query  456  AKVKLEC---LNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSE  286
            AKVKL C    N  NE  T++ EG TDKNG+Y +E +GDH E+EIC V  ++S  E+CS+
Sbjct  55   AKVKLVCREEANAGNE--TFTGEGVTDKNGVYKIEVDGDH-EEEICEVSVLESADEECSD  111

Query  285  VIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHY  133
            +  D +   F RV++T NNG++   R+ NP+ FLK   +  C EV +EL +
Sbjct  112  IPTDGYG-HFARVSITGNNGIINPVRQANPLGFLKKDALPQCKEVLRELGF  161



>ref|XP_004134662.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 ref|XP_004172168.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
Length=168

 Score =   136 bits (342),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 109/171 (64%), Gaps = 13/171 (8%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAK  + +L++A+ FL S L ++      + K R+ + G VYCD CR +F TRV++ +PG
Sbjct  1    MAKSCAIILVSALCFL-SFLDIA-----LSSKDRFFIEGKVYCDTCRIQFFTRVSKYLPG  54

Query  456  AKVKLEC---LNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSE  286
            AKVKL C    N  NE  T++ EG TDKNG+Y +E +GDH E+EIC V  ++S  E+CS+
Sbjct  55   AKVKLVCREEANAGNE--TFTGEGVTDKNGVYKIEVDGDH-EEEICEVSLLESADEECSD  111

Query  285  VIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHY  133
            +  D +   F RV++T NNG++   R+ NP+ FLK   +  C EV +EL +
Sbjct  112  IPTDGYG-HFARVSITGNNGIINPVRQANPLGFLKKDALPQCKEVLRELGF  161



>ref|XP_009101556.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
Length=174

 Score =   136 bits (343),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 108/165 (65%), Gaps = 4/165 (2%)
 Frame = -1

Query  618  ALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLE  439
            +L I + + L S+ G + A+  A     +++ G+VYCD CR +FVTR+++ + GAKVKLE
Sbjct  9    SLFIVSTVCLSSLAGFTAAD--ADDFDIFQIQGSVYCDTCRVQFVTRLSQFLEGAKVKLE  66

Query  438  CLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKE  259
            C + TN  +T + E  TDK+G Y +E  GDH E+E+C +  V+SP   CS+V K+ + + 
Sbjct  67   CRSRTNGTLTLTKEAVTDKSGSYKMEVTGDH-EEEVCELVLVQSPDIGCSDVSKEAYLRN  125

Query  258  FTRVTLTANNGLVT-DTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
              +++LTAN+G+V+ +TR VNP+ F+   P+A C   FKEL  +P
Sbjct  126  AAKISLTANDGIVSHETRIVNPLGFMVKTPLADCPAAFKELGIVP  170



>ref|XP_006398273.1| hypothetical protein EUTSA_v10001051mg [Eutrema salsugineum]
 gb|ESQ39726.1| hypothetical protein EUTSA_v10001051mg [Eutrema salsugineum]
Length=174

 Score =   136 bits (342),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 107/165 (65%), Gaps = 4/165 (2%)
 Frame = -1

Query  618  ALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLE  439
            +  + A + L S+ G + A+       R+++ G+VYCD CR +FVTR+++ + GAKVKLE
Sbjct  9    SFFVVAAVCLSSLAGFAAADADDF--DRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLE  66

Query  438  CLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKE  259
            C + TN  +T + E  TDK+G Y +E  GDH E+E+C +  V+SP   CS V K+ + + 
Sbjct  67   CRSRTNGTLTLTKEAVTDKSGSYKMEVTGDH-EEEVCELVLVQSPDSGCSNVSKEAYLRN  125

Query  258  FTRVTLTANNGLVT-DTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
              +++LTAN+G+V+ +TR VNP+ F+   P+A CA  FKEL  +P
Sbjct  126  AAKISLTANDGIVSHETRIVNPLGFMVKTPLADCAAAFKELGIVP  170



>ref|XP_009114385.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
Length=174

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 106/165 (64%), Gaps = 4/165 (2%)
 Frame = -1

Query  618  ALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLE  439
            +  + +V+ L S+ G S A+  A    R+++ G+VYCD CR +FVTR+++ + GAKVKLE
Sbjct  9    SFFVVSVVCLSSLAGFSAAD--ADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLE  66

Query  438  CLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKE  259
            C + TN  +  + E  TDK G Y +E  GDH E+E+C +  V+SP   CS+V ++ + + 
Sbjct  67   CRSRTNGTLALTKEAVTDKTGSYMMEVTGDH-EEEVCELVLVQSPDSGCSDVSEEAYLRN  125

Query  258  FTRVTLTANNGLVT-DTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
              +++LTAN+G+V+ +TR VNP+ F+   P A C   FKEL  +P
Sbjct  126  AAKISLTANDGIVSHETRIVNPLGFMVKTPSADCPAAFKELGIVP  170



>ref|XP_006284941.1| hypothetical protein CARUB_v10006240mg [Capsella rubella]
 gb|EOA17839.1| hypothetical protein CARUB_v10006240mg [Capsella rubella]
Length=172

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 107/171 (63%), Gaps = 4/171 (2%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MA         + + L S+ GV+ A+  A    R+++ G+VYCD CR +FVTR+++ + G
Sbjct  1    MASKAIFFFFVSAVCLSSLAGVAIAD--ADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEG  58

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKVKLEC +  N  VT + E  TDK+G Y +E  GDH E+E+C +  ++SP  DCS+V K
Sbjct  59   AKVKLECRSRVNGTVTLTEEAVTDKSGSYKMEVAGDH-EEEVCELVLLESPDSDCSDVSK  117

Query  276  DMWAKEFTRVTLTANNGLVT-DTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
            + +     +++LTAN+G+V+ +TR VNP+ F+   P A C   FKEL  +P
Sbjct  118  EAYLHNAAKISLTANDGIVSHETRIVNPLGFMVKTPSAECPAAFKELGIVP  168



>ref|XP_010549400.1| PREDICTED: pollen-specific protein-like At4g18596 [Tarenaya hassleriana]
Length=171

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 97/147 (66%), Gaps = 2/147 (1%)
 Frame = -1

Query  564  AEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETD  385
            A   A    R+ + G+VYCD CR +F+TR+++ + GAKVKLEC N  N+ VT + E  TD
Sbjct  22   ASADADDFDRFHIKGSVYCDTCRVQFITRLSKFLEGAKVKLECKNRVNQTVTLTKEAVTD  81

Query  384  KNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTD-TR  208
            K+G Y +E  GDH E+E+C +   +SP  +CSE+  + + +   R++LTAN+G+V++ TR
Sbjct  82   KSGNYEMEVMGDH-EEEVCEIVLGESPDAECSEINNEEFTRNAARISLTANDGIVSNETR  140

Query  207  KVNPILFLKTKPIAVCAEVFKELHYIP  127
             VNP+ F++  P+  C E FKEL  +P
Sbjct  141  SVNPLGFMRKTPLGDCPEAFKELGIVP  167



>emb|CDY01556.1| BnaC07g35460D [Brassica napus]
Length=172

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 107/171 (63%), Gaps = 4/171 (2%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MA         + + L S+ GV+ A+  A     +++ G+VYCD CR +FVTR+++ + G
Sbjct  1    MATKAIFFFFVSAVCLSSLAGVANAD--ADDFDSFQIQGSVYCDTCRVQFVTRLSQFLEG  58

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKVKLEC + TN  VT + E  TDK+G Y +E  GDH E+E+C +  ++SP   CS+V  
Sbjct  59   AKVKLECRSRTNGTVTLTKEAVTDKSGSYKMEVTGDH-EEEVCELVLLQSPDSGCSDVST  117

Query  276  DMWAKEFTRVTLTANNGLVT-DTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
            + + +   +V+LTAN+G+V+ +TR VNP+ F+   P+A C   FKEL  +P
Sbjct  118  EAYLRNAAKVSLTANDGIVSHETRIVNPLGFMVKTPLADCPAAFKELGIVP  168



>emb|CDX99452.1| BnaC01g11000D [Brassica napus]
Length=172

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 104/165 (63%), Gaps = 6/165 (4%)
 Frame = -1

Query  606  AAVIFLVSMLGVSGAEKPAAGKS----RYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLE  439
            A   F VS + +S     A   +    R+++ G+VYCD CR +FVTR+++ + GAKVKLE
Sbjct  5    AIFFFFVSAVCLSSLAGKAVADADDFDRFQIQGSVYCDTCRVQFVTRLSQFLEGAKVKLE  64

Query  438  CLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKE  259
            C + TN  VT + E  TDK+G Y +E  GDH E+E+C +  ++SP   CS+V K+ + + 
Sbjct  65   CRSRTNGTVTLTKEAVTDKSGSYKMEVTGDH-EEEVCELVLLQSPDSGCSDVSKEAYLRN  123

Query  258  FTRVTLTANNGLVT-DTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
              +V+LTAN+G+V+ +TR VNP+ F+   P A C   FKEL  +P
Sbjct  124  AAKVSLTANDGIVSHETRIVNPLGFMVKTPSADCPAAFKELGIVP  168



>ref|XP_009348994.1| PREDICTED: olee1-like protein [Pyrus x bretschneideri]
Length=172

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 103/174 (59%), Gaps = 8/174 (5%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MA   S  L++A+ FL S++GV      A       V G VYCD CR +FVTR++E + G
Sbjct  1    MANSNSIFLVSALCFL-SLVGV------AYCGETLNVHGIVYCDNCRIQFVTRISETLKG  53

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKV+LEC      K+T S E +TD  G Y +  EGDH E+E+C V  VKSPKEDCSE+  
Sbjct  54   AKVRLECRENEGGKITLSKEADTDDLGTYSIPVEGDH-EEEVCEVILVKSPKEDCSEISN  112

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGENV  115
            ++  K   R++LT +NG+    R  NP+ F+K +    CAEV KEL   P  ++
Sbjct  113  ELHVKLSARISLTNHNGITGPHRMANPLGFMKKEVDPKCAEVLKELGLTPDGDI  166



>ref|XP_002863445.1| hypothetical protein ARALYDRAFT_494394 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39704.1| hypothetical protein ARALYDRAFT_494394 [Arabidopsis lyrata subsp. 
lyrata]
Length=174

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 95/138 (69%), Gaps = 2/138 (1%)
 Frame = -1

Query  537  RYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEA  358
            R+++ G+VYCD CR +FVTR+++ + GAKVKLEC + TN  VT + E  TDK G Y +E 
Sbjct  34   RFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTVTLTKEAVTDKTGSYKMEV  93

Query  357  EGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVT-DTRKVNPILFLK  181
             GDH E+E+C +  V+SP   CS+V K+ + +   +++LTAN+G+V+ +TR VNP+ F+ 
Sbjct  94   TGDH-EEEVCELVLVQSPDSGCSDVSKEAYLRNAAKISLTANDGIVSHETRIVNPLGFMV  152

Query  180  TKPIAVCAEVFKELHYIP  127
              P+A C   FKEL  +P
Sbjct  153  QTPLADCPAAFKELGIVP  170



>ref|XP_010434511.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=172

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 108/171 (63%), Gaps = 4/171 (2%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MA         + + L S+ GV+ A+  A    R+++ G+VYCD CR +FVTR+++ + G
Sbjct  1    MASKAIFFFFVSAVCLSSLAGVAIAD--ADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEG  58

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKVKLEC +  N  VT + E  TDK+G Y +E  GDH E+E+C +  V+SP  +CS+V K
Sbjct  59   AKVKLECRSRVNGTVTLTKEAVTDKSGSYKMEVTGDH-EEEVCELVLVESPNSECSDVSK  117

Query  276  DMWAKEFTRVTLTANNGLVT-DTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
            + + +   +++LTAN+G+V+ +TR VNP+ F+   P A C   FKE+  +P
Sbjct  118  EAYLRNAAKISLTANDGIVSHETRIVNPLGFMVKTPSAECPAAFKEIGIVP  168



>ref|XP_009108374.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDY34057.1| BnaC03g62750D [Brassica napus]
 emb|CDX76511.1| BnaA08g08890D [Brassica napus]
Length=171

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 103/164 (63%), Gaps = 6/164 (4%)
 Frame = -1

Query  603  AVIFLVSMLGVSGAEKPAAGKS----RYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLEC  436
            A+ F VS L +S     A   +     +K+ G+VYCD CR +FVTR+++ + GAKVKLEC
Sbjct  5    AIFFFVSALCLSSLAGKAMADADDFDSFKIQGSVYCDTCRVQFVTRLSKFLEGAKVKLEC  64

Query  435  LNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEF  256
             + TN  V  + E  TDK+G Y +E  GDH E+E+C +  ++SP   CS+V +D + +  
Sbjct  65   RSRTNGTVALTKEAVTDKSGSYTMEVTGDH-EEEVCELVLLQSPDSACSDVSQDAYLRNA  123

Query  255  TRVTLTANNGLVT-DTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
             +V+LTAN+G+V+ +TR VNP+ F+   P A C   FKEL  +P
Sbjct  124  AKVSLTANDGIVSHETRIVNPLGFMVKTPSAECPAAFKELGIVP  167



>ref|XP_010494740.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=174

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 107/165 (65%), Gaps = 4/165 (2%)
 Frame = -1

Query  618  ALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLE  439
            +  I + + L S+ G + A+       R+++ G+VYCD CR +FVTR+++ + GAKVKLE
Sbjct  9    SFFIVSAVCLSSLAGFAAADADDL--DRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLE  66

Query  438  CLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKE  259
            C + TN  VT + E  TDK+G Y +E  GDH E+E+C +  V+SP   CS+V K+ + + 
Sbjct  67   CRSRTNGTVTLTKEAVTDKSGSYKMEVTGDH-EEEVCELVLVESPDSGCSDVSKEAYLRN  125

Query  258  FTRVTLTANNGLVT-DTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
              +++LTAN+G+V+ +TR VNP+ F+   P A CA  FKE+  +P
Sbjct  126  AAKISLTANDGIVSHETRIVNPLGFMVKTPSADCAAAFKEIGIVP  170



>ref|XP_006304746.1| hypothetical protein CARUB_v10012122mg [Capsella rubella]
 gb|EOA37644.1| hypothetical protein CARUB_v10012122mg [Capsella rubella]
Length=171

 Score =   134 bits (338),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 108/171 (63%), Gaps = 5/171 (3%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAK     L +A+ F  +++  + A+  A    R+ + G+VYCD CR +F+TR+++ + G
Sbjct  1    MAKFFIVFLASALCF-TTLVHFTAAD--ADDFDRFHIKGSVYCDTCRVQFITRLSKFLEG  57

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKVKLEC    N+ VT + E  TDK G Y +E  GDH E+E+C +  ++SP  +C EV  
Sbjct  58   AKVKLECKGRENQTVTLTKEAVTDKAGNYQMEVMGDH-EEEVCEIVLLQSPDAECGEVNN  116

Query  276  DMWAKEFTRVTLTANNGLVTD-TRKVNPILFLKTKPIAVCAEVFKELHYIP  127
              + +   R++LTAN+G+V++ TR +NP+ F++  P+A C + FKEL  +P
Sbjct  117  QEFLRNAARISLTANDGIVSNETRTINPLGFMRKTPLAECPQAFKELGIVP  167



>emb|CDY52214.1| BnaAnng11370D [Brassica napus]
Length=174

 Score =   134 bits (338),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 106/165 (64%), Gaps = 4/165 (2%)
 Frame = -1

Query  618  ALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLE  439
            +  + +V+ L S+ G S A+  A    R+++ G+VYCD CR +FVTR+++ + GAKVKLE
Sbjct  9    SFFVVSVVCLSSLPGFSAAD--ADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLE  66

Query  438  CLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKE  259
            C + TN  +  + E  TDK G Y +E  GDH E+E+C +  V+SP   CS+V ++ + + 
Sbjct  67   CRSRTNGTLALTKEAVTDKTGSYMMEVTGDH-EEEVCELVLVQSPDSGCSDVSEEAYLRN  125

Query  258  FTRVTLTANNGLVT-DTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
              +++LTAN+G+V+ +TR VNP+ F+   P A C   FKEL  +P
Sbjct  126  AAKISLTANDGIVSHETRIVNPLGFMVKTPSADCPAAFKELGIVP  170



>ref|XP_010496255.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=172

 Score =   134 bits (338),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 105/165 (64%), Gaps = 6/165 (4%)
 Frame = -1

Query  606  AAVIFLVSMLGVSGAEKPAAGKS----RYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLE  439
            A   FLVS + +S     A   +    R+++ G+VYCD CR +FVTR+++ + GAKVKLE
Sbjct  5    AIFFFLVSAVCLSSLASVAVADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLE  64

Query  438  CLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKE  259
            C +  N  VT + E  TDK+G Y +E  GDH E+E+C +  V+SP  +CS+V K+ + + 
Sbjct  65   CRSRVNGTVTLTKEAVTDKSGSYKMEVTGDH-EEEVCELVLVESPDSECSDVSKEAYLRN  123

Query  258  FTRVTLTANNGLVT-DTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
              +++LTAN+G+V+ +TR VNP+ F+   P A C   FKE+  +P
Sbjct  124  AAKISLTANDGIVSHETRIVNPLGFMVKTPSAECPAAFKEIGIVP  168



>ref|XP_008371469.1| PREDICTED: olee1-like protein [Malus domestica]
Length=172

 Score =   134 bits (338),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 103/174 (59%), Gaps = 8/174 (5%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MA   S +L++A+ FL S+ GV      A       V G VYCD CR +FVTR++E + G
Sbjct  1    MANSNSIVLVSALCFL-SLAGV------AYCGETLNVHGIVYCDNCRIQFVTRISETLKG  53

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKV+LEC      K+T S E +TD  G Y +  EGDH E+E+C V  VKSPKEDCSE+  
Sbjct  54   AKVRLECRENEGGKITLSKEADTDDLGTYSIPVEGDH-EEEVCEVILVKSPKEDCSEISN  112

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGENV  115
            ++  K   R++LT +NG+    R  NP+ F+K +    CAEV KEL   P  ++
Sbjct  113  ELHVKLSARISLTNHNGITGPHRMANPLGFMKKEVDPKCAEVLKELGLTPDGDI  166



>ref|XP_009132011.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDX78874.1| BnaA01g09410D [Brassica napus]
Length=172

 Score =   134 bits (338),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 104/165 (63%), Gaps = 6/165 (4%)
 Frame = -1

Query  606  AAVIFLVSMLGVSGAEKPAAGKS----RYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLE  439
            A   F VS + +S     A   +    R+++ G+VYCD CR +FVTR+++ + GAKVKLE
Sbjct  5    AIFFFFVSAVCLSSLAGKAVADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLE  64

Query  438  CLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKE  259
            C + TN  VT + E  TDK+G Y +E  GDH E+E+C +  ++SP   CS+V K+ + + 
Sbjct  65   CRSRTNGTVTLTKEAVTDKSGSYKMEVTGDH-EEEVCELVLLQSPDSGCSDVSKEAYLRN  123

Query  258  FTRVTLTANNGLVT-DTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
              +V+LTAN+G+V+ +TR VNP+ F+   P A C   FKEL  +P
Sbjct  124  AAKVSLTANDGIVSHETRIVNPLGFMVKTPSADCPAAFKELGIVP  168



>ref|XP_004233077.1| PREDICTED: major pollen allergen Lig v 1-like [Solanum lycopersicum]
Length=175

 Score =   134 bits (338),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 102/163 (63%), Gaps = 2/163 (1%)
 Frame = -1

Query  615  LLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLEC  436
            + IA+ I L S+LG++ A +  + K ++ + G VYCD CR+ F T ++E +  A+V ++C
Sbjct  7    IFIASAICLFSLLGITQANE-ESDKYQFILEGMVYCDPCRSIFKTNLSEPVVDARVGMQC  65

Query  435  LNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEF  256
             +   E+VT ++   T+  G YH+  EGDH E+EIC    +KSPKEDCSE+  +   +E 
Sbjct  66   RHPETERVTITVTASTNSTGYYHMLIEGDH-ENEICETYLIKSPKEDCSEIPTEGHTREL  124

Query  255  TRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
            +RVTLT+ NG+    R+ NP+ FL  K    C + FKE+ Y+P
Sbjct  125  SRVTLTSKNGIAGKNRESNPLFFLTKKVAPECQQEFKEMEYLP  167



>ref|XP_009136942.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDY53995.1| BnaA03g58200D [Brassica napus]
Length=171

 Score =   134 bits (337),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 106/167 (63%), Gaps = 4/167 (2%)
 Frame = -1

Query  624  QSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVK  445
            ++     + + L S+ GV+ A+  A     +++ G+VYCD CR +FVTR+++ + GAKVK
Sbjct  4    KAIFFFVSAVCLSSLAGVANAD--ADDFDSFQIQGSVYCDTCRVQFVTRLSQFLEGAKVK  61

Query  444  LECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWA  265
            LEC + TN  VT + E  TDK+G Y +E  GDH E+E+C +  + SP   CS+V  + + 
Sbjct  62   LECRSRTNGTVTLTKEAVTDKSGSYKMEVTGDH-EEEVCELVLLHSPDSGCSDVSTEAYL  120

Query  264  KEFTRVTLTANNGLVT-DTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
            +   +V+LTAN+G+V+ +TR VNP+ F+   P+A C   FKEL  +P
Sbjct  121  RNAAKVSLTANDGIVSHETRIVNPLGFMVKTPLADCPAAFKELGIVP  167



>ref|XP_010439832.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=172

 Score =   134 bits (337),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 108/171 (63%), Gaps = 4/171 (2%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MA         + + L S+ GV+ A+  A    R+++ G+VYCD CR +F+TR+++ + G
Sbjct  1    MASKAIFFFFVSAVCLSSLAGVAIAD--ADDFDRFQIQGSVYCDTCRVQFITRLSKFLEG  58

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKVKLEC +  N  VT + E  TDK+G Y +E  GDH E+E+C +  V+SP  +CS+V K
Sbjct  59   AKVKLECRSRVNGTVTLTKEAVTDKSGSYKMEVTGDH-EEEVCELVLVESPDSECSDVSK  117

Query  276  DMWAKEFTRVTLTANNGLVT-DTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
            + + +   +++LTAN+G+V+ +TR VNP+ F+   P A C   FKE+  +P
Sbjct  118  EAYLRNAAKISLTANDGIVSHETRIVNPLGFMVKTPSAECPAAFKEIGIVP  168



>ref|XP_008383629.1| PREDICTED: olee1-like protein [Malus domestica]
Length=184

 Score =   134 bits (338),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 104/170 (61%), Gaps = 8/170 (5%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MA   S +L++A+ FL S++GV      A       V G VYCD CR +F TR++E + G
Sbjct  1    MANSNSIVLVSALCFL-SLIGV------AYSTETLNVHGIVYCDNCRTQFFTRISEPLTG  53

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKV+LEC  +   KVT + E +T++ G Y +  EGDH E+E+C V  VKSPKEDCSE+  
Sbjct  54   AKVRLECRESEGGKVTLTKEXDTEELGTYSIPVEGDH-EEEVCEVILVKSPKEDCSEISN  112

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
            ++ AK   R++LT +NG+    R  NP+ F+K +    CAEV KEL   P
Sbjct  113  ELHAKLSARISLTNHNGITGPHRMANPLGFMKKEVDPRCAEVLKELGLTP  162



>ref|XP_009352776.1| PREDICTED: olee1-like protein [Pyrus x bretschneideri]
Length=180

 Score =   134 bits (337),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 104/170 (61%), Gaps = 8/170 (5%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MA   S +L++A+ FL S++GV      A       V G VYCD CR +F TR++E + G
Sbjct  1    MANSNSIVLVSALCFL-SLIGV------AYCAETLNVHGIVYCDNCRTQFFTRISEPLTG  53

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKV+LEC  +   KVT + E +T++ G Y +  EGDH E+E+C V  VKSPKEDCSE+  
Sbjct  54   AKVRLECRESEGGKVTLTKEADTEELGTYSIPVEGDH-EEEVCEVILVKSPKEDCSEISN  112

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
            ++ AK   R++LT +NG+    R  NP+ F+K +    CAEV KEL   P
Sbjct  113  ELHAKLSARISLTNHNGITGPHRMANPLGFMKKEVDPRCAEVLKELGLTP  162



>ref|XP_007148052.1| hypothetical protein PHAVU_006G176500g [Phaseolus vulgaris]
 gb|ESW20046.1| hypothetical protein PHAVU_006G176500g [Phaseolus vulgaris]
Length=169

 Score =   134 bits (336),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 104/167 (62%), Gaps = 9/167 (5%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAK    +L +A+ FL S LG       A+ + R+ V GTVYCD CR +F+TR++E + G
Sbjct  1    MAKSAIIILASALCFL-SFLG------SASARDRFFVEGTVYCDTCRVQFLTRMSEFLEG  53

Query  456  AKVKLECLNTTNEK-VTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVI  280
            A V++ C    N K VT+  E  TD  G Y +E +GDH+ED  C V  VKSP+ DCSEV 
Sbjct  54   AAVRVMCSQVDNAKNVTFDKETVTDALGSYKMEVDGDHEEDN-CQVTLVKSPRPDCSEVD  112

Query  279  KDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKEL  139
            K+ + ++  R+++T NNG+V+  R+ NP+ FLK   +  C ++ KEL
Sbjct  113  KESYLQQAARISITKNNGIVSPIRQANPLGFLKKDRLPGCQDLLKEL  159



>gb|KHG25858.1| Olee1-like protein [Gossypium arboreum]
Length=166

 Score =   133 bits (335),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 106/169 (63%), Gaps = 8/169 (5%)
 Frame = -1

Query  636  MAKV-QSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMP  460
            MAK  Q AL+  A+  L S++G + A    +  +++ V G VYCD CR +F T+++E +P
Sbjct  1    MAKASQRALVSMAICLLSSLVGFAYA---GSLSNKFVVLGKVYCDTCRVEFETKLSEPIP  57

Query  459  GAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVI  280
            GAKVKLEC    +E VTYS E ETD NG+Y +  EGDH E++IC V  V SP+ DC+E  
Sbjct  58   GAKVKLECRKEGDETVTYSHEAETDANGVYKIPVEGDH-EEQICAVSTVSSPRADCNE--  114

Query  279  KDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHY  133
              M A E  +V LT+++GL   +RK N + F K   +  CA+V KE+ +
Sbjct  115  -KMEAFEKAQVELTSDDGLAEPSRKANNLGFKKKVAVPGCAQVLKEMGF  162



>ref|XP_006281481.1| hypothetical protein CARUB_v10027565mg [Capsella rubella]
 gb|EOA14379.1| hypothetical protein CARUB_v10027565mg [Capsella rubella]
Length=174

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 106/165 (64%), Gaps = 4/165 (2%)
 Frame = -1

Query  618  ALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLE  439
            +  I + I L S+ G + A+   +   R+++ G+VYCD CR +F+TR+++ + GAKVKLE
Sbjct  9    SFFIVSAICLSSLAGFAAADADDS--DRFQIQGSVYCDTCRVQFITRLSKFLEGAKVKLE  66

Query  438  CLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKE  259
            C + TN  VT + E  TDK G Y +E  GDH E+E+C +  V+SP   CS+V K+ + + 
Sbjct  67   CRSRTNGTVTLTKEAVTDKTGSYMMEVTGDH-EEEVCELVLVESPDSGCSDVSKEAYLRN  125

Query  258  FTRVTLTANNGLVT-DTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
              +++LTAN+G+V+ +TR VNP+ F+   P A C   FKEL  +P
Sbjct  126  AAKISLTANDGIVSHETRIVNPLGFMVMTPSADCPAAFKELGIVP  170



>ref|XP_003546028.1| PREDICTED: olee1-like protein-like [Glycine max]
 gb|KHN18912.1| Olee1-like protein [Glycine soja]
Length=169

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 99/157 (63%), Gaps = 2/157 (1%)
 Frame = -1

Query  606  AAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNT  427
            AA+I L S L        A  + R+ V GTVYCD CR +F+T+++E + GA V++ C   
Sbjct  4    AAIIILASTLCFLSFLGSAYARDRFMVEGTVYCDTCRVQFLTKLSEILEGATVRVTCSQV  63

Query  426  TNEK-VTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTR  250
             N K VT+S E  TD +G Y +E EGDH+ED  C V  +KSP+ DCSE+ ++   ++  R
Sbjct  64   DNAKNVTFSKEAVTDASGSYKVEVEGDHEED-TCEVTLLKSPRPDCSEIDRESHLQQAAR  122

Query  249  VTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKEL  139
            +++T NNG+V+  R+ NP+ FLK   +  CA++ KEL
Sbjct  123  ISITKNNGIVSPLRQANPLGFLKKDRLPGCADLLKEL  159



>ref|NP_568650.1| pollen_Ole_e_I-domain containing protein [Arabidopsis thaliana]
 dbj|BAD43611.1| Ole e I (main olive allergen)-like protein [Arabidopsis thaliana]
 gb|ABR46194.1| At5g45880 [Arabidopsis thaliana]
 gb|AED95311.1| pollen_Ole_e_I-domain containing protein [Arabidopsis thaliana]
Length=174

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 94/138 (68%), Gaps = 2/138 (1%)
 Frame = -1

Query  537  RYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEA  358
            R+++ G+VYCD CR +FVTR+++ + GAKVKLEC + TN  +T + E  TDK G Y +E 
Sbjct  34   RFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTITLTKEAVTDKTGSYKMEV  93

Query  357  EGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVT-DTRKVNPILFLK  181
             GDH E+E+C +  V+SP   CS+V  + + +   +++LTAN+G+V+ +TR VNP+ F+ 
Sbjct  94   TGDH-EEEVCELVLVQSPDSGCSDVSTEAYLRNAAKISLTANDGIVSHETRIVNPLGFMV  152

Query  180  TKPIAVCAEVFKELHYIP  127
              P+A C   FKEL  +P
Sbjct  153  QTPLADCPAAFKELGIVP  170



>gb|ACU23617.1| unknown [Glycine max]
Length=169

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 99/157 (63%), Gaps = 2/157 (1%)
 Frame = -1

Query  606  AAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNT  427
            AA+I L S L        A  + R+ V GTVYCD CR +F+T+++E + GA V++ C   
Sbjct  4    AAIIILASTLCFLSFLGSAYARDRFMVEGTVYCDTCRVQFLTKLSEILEGATVRVTCSQV  63

Query  426  TNEK-VTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTR  250
             N K VT+S E  TD +G Y +E EGDH+ED  C V  +KSP+ DCSE+ ++   ++  R
Sbjct  64   DNAKNVTFSKEAVTDASGSYKVEVEGDHEED-TCEVTLLKSPRPDCSEIDRESHLQQAAR  122

Query  249  VTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKEL  139
            +++T NNG+V+  R+ NP+ FLK   +  CA++ KEL
Sbjct  123  ISITKNNGIVSPFRQANPLGFLKKDRLPGCADLLKEL  159



>ref|XP_010540511.1| PREDICTED: pollen-specific protein-like At4g18596 [Tarenaya hassleriana]
Length=170

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 111/171 (65%), Gaps = 6/171 (4%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAK+   LL+A+ + L ++  V+ A   A    R+ + G+VYCD CR +F TR+++ + G
Sbjct  1    MAKL--ILLVASALCLATL--VNFAAADADDFDRFHIKGSVYCDTCRVQFFTRLSKFLEG  56

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKVKLEC N  N+ VT + E  TDK+G Y +   GDH EDE+C +   +SP  +CS++  
Sbjct  57   AKVKLECKNIDNQTVTLTKEAVTDKSGNYEMVVMGDH-EDEVCEIVLAESPDTECSDINN  115

Query  276  DMWAKEFTRVTLTANNGLVTD-TRKVNPILFLKTKPIAVCAEVFKELHYIP  127
            + + +   R++LTAN+G+V++ TR VNP+ F++  P++ C + F+EL  +P
Sbjct  116  EEFTRNAARISLTANDGIVSNETRTVNPLGFMRRTPLSDCPKAFEELGIVP  166



>ref|XP_008225283.1| PREDICTED: olee1-like protein [Prunus mume]
Length=168

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 101/170 (59%), Gaps = 7/170 (4%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MA   S +++A+ +  +S+LG       A       V G VYCD CR +F+TR++E + G
Sbjct  1    MATKSSGIVLASALCFLSLLGF------AYCADNLSVDGLVYCDSCRIQFMTRISEALQG  54

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKVKLEC +     +T S E ETD+ G Y +  EGDH+E+    V  VKSP++DCSE+  
Sbjct  55   AKVKLECRDREGGTITLSSETETDEQGRYQIPVEGDHEEEVC-EVVLVKSPRDDCSEIST  113

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
            D  AK   R++LT NNG+    R  NP+ FLK +P A CAEV KEL   P
Sbjct  114  DSHAKLSARISLTNNNGIAGPHRIPNPLGFLKKEPDAQCAEVLKELGLTP  163



>ref|XP_002870034.1| pollen ole e 1 allergen and extensin family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH46293.1| pollen ole e 1 allergen and extensin family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=173

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 102/162 (63%), Gaps = 6/162 (4%)
 Frame = -1

Query  597  IFLVSMLGVSGAEKPAAGKS----RYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLN  430
             F VS + +S   + A   +    R+++ G+VYCD CR +FVTR+++ + GAKVKLEC +
Sbjct  9    FFFVSAVCLSSLARVAIADADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRS  68

Query  429  TTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTR  250
             TN  VT + E  TDK G Y +E  GDH E+E+C +  V+SP   CS+V K+ + +   +
Sbjct  69   RTNGTVTLTKEAVTDKTGSYRMEVTGDH-EEEVCELVLVESPDSGCSDVSKEAYLRNAAK  127

Query  249  VTLTANNGLVT-DTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
            ++LTAN+G+V+ +TR VNP+ F+   P   C   FKEL  +P
Sbjct  128  ISLTANDGIVSHETRIVNPLGFMVKTPSPECPAAFKELGIVP  169



>emb|CDY65576.1| BnaC09g52000D [Brassica napus]
Length=174

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 101/156 (65%), Gaps = 4/156 (3%)
 Frame = -1

Query  591  LVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKV  412
            L S+ G S A+  A    R+++ G+VYCD CR +FVTR+++ + GAKVKLEC + TN  +
Sbjct  18   LSSLAGFSAAD--ADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTL  75

Query  411  TYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTAN  232
              + E  TDK G Y +E  GDH E+E+C +  V+SP   CS+V ++ + +   +++LTAN
Sbjct  76   ALTKEAVTDKTGSYMMEVTGDH-EEEVCQLVLVQSPDSGCSDVSEEAYLRNAAKISLTAN  134

Query  231  NGLVT-DTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
            +G+V+ +TR VNP+ F+   P A C   FKEL  +P
Sbjct  135  DGIVSHETRIVNPLGFMVKTPSADCPAAFKELGIVP  170



>ref|NP_174209.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 gb|AAF88123.1|AC021043_16 Similar to major allergen OLE5c [Arabidopsis thaliana]
 gb|AEE31049.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
Length=171

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 108/171 (63%), Gaps = 5/171 (3%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAK     L +A+ F  +++  + A+  A    ++ + G+VYCD CR +F+TR+++ + G
Sbjct  1    MAKFFIVFLASALCF-TTLVHFTAAD--ADDFDKFHIKGSVYCDTCRVQFITRISKFLEG  57

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKVKLEC    N+ VT + E  TD  G Y +E  GDH E+E+C +  ++SP  +C +V  
Sbjct  58   AKVKLECKGRENQTVTLTKEAVTDNAGNYQMEVMGDH-EEEVCEIVLLQSPDPECGDVNN  116

Query  276  DMWAKEFTRVTLTANNGLVTD-TRKVNPILFLKTKPIAVCAEVFKELHYIP  127
              + +   R++LTAN+G+V++ TR +NP+ F++  P+A C +VFKEL  +P
Sbjct  117  QEFLRNAARISLTANDGIVSNETRTINPLGFMRKTPLAECPQVFKELGIVP  167



>ref|XP_004134927.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 ref|XP_004172170.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 gb|KGN49302.1| hypothetical protein Csa_6G519550 [Cucumis sativus]
Length=168

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 106/171 (62%), Gaps = 13/171 (8%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAK  + +L++A+ FL S L ++      + K R+ + G VYCD CR +F TRV++ +PG
Sbjct  1    MAKSCAIILVSALCFL-SFLDIA-----LSSKDRFFIEGKVYCDTCRIQFFTRVSKYLPG  54

Query  456  AKVKLEC---LNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSE  286
            AKVKL C    N  NE  T++ EG TDKNG+Y +E +GDH E+EIC V  ++S    C E
Sbjct  55   AKVKLVCREEANAGNE--TFTGEGVTDKNGVYKIEVDGDH-EEEICEVSLLESADTGCGE  111

Query  285  VIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHY  133
            +  D +   F RV++T NNG++   R+ NP+ F+K   +  C EV +EL +
Sbjct  112  IPTDGYG-HFARVSITGNNGIINPVRQANPLGFMKKDALPQCKEVLRELGF  161



>ref|XP_006415610.1| hypothetical protein EUTSA_v10008921mg [Eutrema salsugineum]
 gb|ESQ33963.1| hypothetical protein EUTSA_v10008921mg [Eutrema salsugineum]
Length=171

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 93/138 (67%), Gaps = 2/138 (1%)
 Frame = -1

Query  537  RYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEA  358
            R+ + G+VYCD CR +FVTR+++ + GAKVKLEC    N+ VT + E  TDK G Y +E 
Sbjct  31   RFHIKGSVYCDTCRVQFVTRLSKFLEGAKVKLECKGRENQTVTLTKEAVTDKAGNYQMEV  90

Query  357  EGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTD-TRKVNPILFLK  181
             GDH E+E+C +  V SP  +CS+V    + +   RV+LTAN+G+V++ TR +NP+ F++
Sbjct  91   MGDH-EEEVCEIVLVHSPDAECSDVNNQEFLRNAARVSLTANDGIVSNETRTINPLGFMR  149

Query  180  TKPIAVCAEVFKELHYIP  127
              P+A C + F+EL  +P
Sbjct  150  KTPLADCPQAFQELGIVP  167



>dbj|BAB09316.1| Ole e I (main olive allergen)-like protein [Arabidopsis thaliana]
Length=168

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 94/138 (68%), Gaps = 2/138 (1%)
 Frame = -1

Query  537  RYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEA  358
            R+++ G+VYCD CR +FVTR+++ + GAKVKLEC + TN  +T + E  TDK G Y +E 
Sbjct  28   RFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTITLTKEAVTDKTGSYKMEV  87

Query  357  EGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVT-DTRKVNPILFLK  181
             GDH E+E+C +  V+SP   CS+V  + + +   +++LTAN+G+V+ +TR VNP+ F+ 
Sbjct  88   TGDH-EEEVCELVLVQSPDSGCSDVSTEAYLRNAAKISLTANDGIVSHETRIVNPLGFMV  146

Query  180  TKPIAVCAEVFKELHYIP  127
              P+A C   FKEL  +P
Sbjct  147  QTPLADCPAAFKELGIVP  164



>ref|XP_009128814.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDY06029.1| BnaA09g37510D [Brassica napus]
Length=174

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 107/165 (65%), Gaps = 4/165 (2%)
 Frame = -1

Query  618  ALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLE  439
            + L+ + + L S+ G + A+        +++ G+VYCD CR +FVTR+++ + GAKVKLE
Sbjct  9    SFLVVSTVCLFSLAGFAAADADDF--DLFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLE  66

Query  438  CLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKE  259
            C + TN  +T + E  TDK+G Y +E  GDH E+E+C +  V+SP   CS+V K+ + + 
Sbjct  67   CRSRTNGTLTLTKEAVTDKSGSYKMEVTGDH-EEEVCELVLVQSPDSGCSDVSKEAYLRN  125

Query  258  FTRVTLTANNGLVT-DTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
              +++LTAN+G+V+ +TR VNP+ F+   P+A C   FKEL  +P
Sbjct  126  AAKISLTANDGIVSHETRIVNPLGFMVKTPLADCPAAFKELGIVP  170



>emb|CDX87759.1| BnaC02g31900D [Brassica napus]
Length=174

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 95/137 (69%), Gaps = 2/137 (1%)
 Frame = -1

Query  534  YKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAE  355
            +++ G+VYCD CR +FVTR+++ + GAKVKLEC + TN  +T + E  TDK+G Y +E  
Sbjct  35   FQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTLTLTKEAVTDKSGSYKMEVT  94

Query  354  GDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVT-DTRKVNPILFLKT  178
            GDH E+E+C +  V+SP   CS+V K+ + +   +++LTAN+G+V+ +TR VNP+ F+  
Sbjct  95   GDH-EEEVCELVLVQSPDSGCSDVSKEAYLRNAAKISLTANDGIVSHETRIVNPLGFMVK  153

Query  177  KPIAVCAEVFKELHYIP  127
             P+A C   FKEL  +P
Sbjct  154  TPLADCPAAFKELGIVP  170



>emb|CDY69202.1| BnaCnng62360D [Brassica napus]
Length=171

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 94/138 (68%), Gaps = 2/138 (1%)
 Frame = -1

Query  537  RYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEA  358
            R+ + G+VYCD CR +F+TR+++ + GAKVKLEC    N+ VT + E  TDK+G Y +E 
Sbjct  31   RFHIKGSVYCDTCRVQFMTRLSKVLEGAKVKLECKGRENQTVTLTKEAMTDKDGNYEMEV  90

Query  357  EGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTD-TRKVNPILFLK  181
             GDH E+E+C +  V+SP  +C +V    + +   R++LTAN+G+V++ TR +NP+ F++
Sbjct  91   MGDH-EEEVCEIILVQSPDAECGDVNNQEFLRNAARISLTANDGIVSNETRTINPLGFMR  149

Query  180  TKPIAVCAEVFKELHYIP  127
              P+A C + FKEL  +P
Sbjct  150  KTPLADCPQAFKELGIVP  167



>gb|KFK44745.1| hypothetical protein AALP_AA1G297400 [Arabis alpina]
Length=171

 Score =   131 bits (329),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 93/138 (67%), Gaps = 2/138 (1%)
 Frame = -1

Query  537  RYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEA  358
            R+ + G+VYCD CR +FVTRV++ + GAKVKLEC    N+ VT + E  TD  G Y +E 
Sbjct  31   RFHIKGSVYCDTCRVQFVTRVSKFLEGAKVKLECKGRENQTVTLTKEAVTDNAGNYQMEV  90

Query  357  EGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTD-TRKVNPILFLK  181
             GDH E+E+C +  V+SP  +C ++    + +   R++LTAN+G+V++ TR +NP+ F++
Sbjct  91   MGDH-EEEVCEIVLVQSPDPECGDINNQEFLRNAARISLTANDGIVSNETRTINPLGFMR  149

Query  180  TKPIAVCAEVFKELHYIP  127
              P+  C++VFKEL  +P
Sbjct  150  KNPLEDCSQVFKELGIVP  167



>ref|XP_009102877.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDY15649.1| BnaA07g08200D [Brassica napus]
Length=171

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 94/138 (68%), Gaps = 2/138 (1%)
 Frame = -1

Query  537  RYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEA  358
            R+ + G+VYCD CR +F+TR+++ + GAKVKLEC    N+ VT + E  TDK+G Y +E 
Sbjct  31   RFHIKGSVYCDTCRVQFMTRLSKVLEGAKVKLECKGRENQTVTLTKEAMTDKDGNYEMEV  90

Query  357  EGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTD-TRKVNPILFLK  181
             GDH E+E+C +  V+SP  +C +V    + +   R++LTAN+G+V++ TR +NP+ F++
Sbjct  91   MGDH-EEEVCEIILVQSPDAECGDVNNQEFLRNAARISLTANDGIVSNETRTINPLGFMR  149

Query  180  TKPIAVCAEVFKELHYIP  127
              P+A C + FKEL  +P
Sbjct  150  KTPLADCPQAFKELGIVP  167



>ref|XP_010499433.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=171

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 104/171 (61%), Gaps = 5/171 (3%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAK     L +A+ F      V+ A   A    R+ + G+VYCD CR +F+TR+++ + G
Sbjct  1    MAKFFIVFLASAICFTTL---VNFAAADADDFDRFHIKGSVYCDTCRVQFMTRLSKFLEG  57

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKVKLEC    N+ VT + E  TD  G Y +E  GDH E+E+C +  V+SP  +C EV  
Sbjct  58   AKVKLECKGRENQTVTLTKEAVTDSAGNYQMEVMGDH-EEELCEIVLVQSPDPECGEVNN  116

Query  276  DMWAKEFTRVTLTANNGLVTD-TRKVNPILFLKTKPIAVCAEVFKELHYIP  127
              + +   R++LTAN+G+V++ TR +NP+ F++  P+A C + FKEL  +P
Sbjct  117  QEFLRNAARISLTANDGIVSNETRTINPLGFMRKTPLADCPQAFKELGIVP  167



>ref|XP_010460686.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=171

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 103/171 (60%), Gaps = 5/171 (3%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAK     L +A+ F      V  A   A    R+ + G+VYCD CR +F+TR+++ + G
Sbjct  1    MAKFFIVFLASAICFTTL---VHFAAADADDFDRFHIKGSVYCDTCRVQFMTRLSKFLEG  57

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKVKLEC    N+ VT + E  TD  G Y +E  GDH E+E+C +  V+SP  +C EV  
Sbjct  58   AKVKLECKGRENQTVTLTKEAVTDSAGNYQMEVMGDH-EEELCEIVLVQSPDPECGEVNN  116

Query  276  DMWAKEFTRVTLTANNGLVTD-TRKVNPILFLKTKPIAVCAEVFKELHYIP  127
              + +   R++LTAN+G+V++ TR +NP+ F++  P+A C + FKEL  +P
Sbjct  117  QEFLRNAARISLTANDGIVSNETRTINPLGFMRKTPLADCPQAFKELGIVP  167



>ref|XP_010277041.1| PREDICTED: anther-specific protein LAT52 [Nelumbo nucifera]
Length=165

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 93/141 (66%), Gaps = 4/141 (3%)
 Frame = -1

Query  537  RYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEA  358
            ++ V G VYCD CR +F T+++E + GAKV+LEC +  N+ V YS+EGETD  G+Y L  
Sbjct  29   QFFVQGKVYCDTCRTQFETKLSEPISGAKVRLECRSRENDDVAYSVEGETDTTGIYKLPV  88

Query  357  EGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKT  178
            EG H+ED IC VK + SP++DCSE    +   +  RV L++NNG+ + +R  N + F+  
Sbjct  89   EGSHEED-ICEVKLLSSPRKDCSEPAPGL---DHARVLLSSNNGISSASRFANSLGFMVL  144

Query  177  KPIAVCAEVFKELHYIPGENV  115
            KPI  C++V KEL  +PG  +
Sbjct  145  KPIEGCSDVLKELGLLPGMKI  165



>ref|XP_010529196.1| PREDICTED: pollen-specific protein-like At4g18596 [Tarenaya hassleriana]
Length=173

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 108/171 (63%), Gaps = 3/171 (2%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            M +   ALL+A+ + L  + G + A        R+++ G+VYCD CR +F+TR+++ + G
Sbjct  1    MERKAIALLMASAVCLSYVAGFAAAADADD-LDRFQIQGSVYCDTCRVQFITRLSKFLQG  59

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKV+LEC N  N  +T S E  TD++G + +E  GDH E+E+C +  V+SP +DCSEV K
Sbjct  60   AKVRLECKNRVNGTLTVSKEAVTDESGSFLMEVTGDH-EEEVCEIVLVESPDKDCSEVSK  118

Query  276  DMWAKEFTRVTLTANNGLVTD-TRKVNPILFLKTKPIAVCAEVFKELHYIP  127
            + + +   +++LTAN+G+V++ TR VNP+ F+   P   C   FKEL   P
Sbjct  119  EAFLRNAAKISLTANDGIVSNETRIVNPLGFMVKTPSTECPAAFKELGIKP  169



>ref|XP_002522577.1| Pollen allergen Che a 1 precursor, putative [Ricinus communis]
 gb|EEF39877.1| Pollen allergen Che a 1 precursor, putative [Ricinus communis]
Length=171

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 99/164 (60%), Gaps = 8/164 (5%)
 Frame = -1

Query  615  LLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLEC  436
              +A+ I  + +L +      A G+S + V G VYCD CR +F+T+    + GA+V+LEC
Sbjct  10   FFLASAICFLCLLSI------AHGESHFTVEGKVYCDTCRVQFITKATSYIKGARVRLEC  63

Query  435  LNTTNE-KVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKE  259
             +      +T+S E ETD  G YH+   G+H+E E+C + P+KSP  DC+E+ +D + K+
Sbjct  64   KDREGGGAITFSAEAETDATGTYHIPVNGEHEE-ELCEIIPLKSPDPDCNEINQDPFVKK  122

Query  258  FTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
              ++TLT +NG+ + TR  NPI FLK + +  C+ + +E+   P
Sbjct  123  AAQITLTNHNGIASPTRSANPIGFLKQQAVPECSGILREMGITP  166



>ref|XP_010478273.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=171

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 103/171 (60%), Gaps = 5/171 (3%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAK     L +A+ F      V  A   A    R+ + G+VYCD CR +F+TR+++ + G
Sbjct  1    MAKFFIVFLASAICFTTL---VHFAAADADDFDRFHIKGSVYCDTCRVQFMTRLSKFLEG  57

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKVKLEC    N+ VT + E  TD  G Y +E  GDH E+E+C +  V+SP  +C EV  
Sbjct  58   AKVKLECKGRENQTVTLTKEAVTDSAGNYEMEVMGDH-EEELCEIVLVQSPDPECGEVNN  116

Query  276  DMWAKEFTRVTLTANNGLVTD-TRKVNPILFLKTKPIAVCAEVFKELHYIP  127
              + +   R++LTAN+G+V++ TR +NP+ F++  P+A C + FKEL  +P
Sbjct  117  QEFLRNAARISLTANDGIVSNETRTINPLGFMRKTPLADCPQAFKELGIVP  167



>gb|AAM65838.1| Ole e I (main olive allergen)-like protein [Arabidopsis thaliana]
Length=174

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 93/138 (67%), Gaps = 2/138 (1%)
 Frame = -1

Query  537  RYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEA  358
            R+++ G+VYCD CR +FVTR+++ + GAKVKLEC + TN  +T + E  TDK G Y +E 
Sbjct  34   RFQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTITLTKEAVTDKTGSYKMEV  93

Query  357  EGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVT-DTRKVNPILFLK  181
             GDH E+E+C +  V+SP   CS+V  + + +   +++LTAN+G+V+ +TR VNP+ F+ 
Sbjct  94   TGDH-EEEVCELVLVQSPDSGCSDVSTEAYLRNAAKISLTANDGIVSHETRIVNPLGFMV  152

Query  180  TKPIAVCAEVFKELHYIP  127
               +A C   FKEL  +P
Sbjct  153  QTXLADCPAAFKELGIVP  170



>gb|AFK47865.1| unknown [Lotus japonicus]
Length=168

 Score =   129 bits (323),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 101/162 (62%), Gaps = 6/162 (4%)
 Frame = -1

Query  624  QSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVK  445
            +S + +A+ +  +S+LG        +   R+ V G VYCD CR +F+T+++E + GA V+
Sbjct  3    KSIIFLASALCFLSVLG-----SVYSDDDRFFVEGVVYCDTCRTQFITKLSEFLEGATVR  57

Query  444  LECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWA  265
            +EC    N  VT++ E  TD  G Y +E +GDH E+E+C V  VKSP+ DCSE+  D   
Sbjct  58   VECKEEGNGSVTFTKEVVTDAKGSYKVEVDGDH-EEELCQVVLVKSPRSDCSEIDSDSHL  116

Query  264  KEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKEL  139
            ++  ++++T NNG+V+  R  NP+ FLK + +  CA+V KEL
Sbjct  117  EQAAKISITKNNGIVSPVRAANPLGFLKKERLPGCADVLKEL  158



>ref|XP_003541705.1| PREDICTED: olee1-like protein-like [Glycine max]
 gb|KHN08444.1| Olee1-like protein [Glycine soja]
Length=169

 Score =   129 bits (323),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 103/167 (62%), Gaps = 9/167 (5%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAK    +L + + FL S LG       A  + R+ V GTVYCD CR +F+T+++E + G
Sbjct  1    MAKTTIIILASTLCFL-SFLG------SAYARDRFMVEGTVYCDTCRVQFLTKLSEFLEG  53

Query  456  AKVKLECLNTTNEK-VTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVI  280
            A V++ C    N K VT+S E  TD +G Y +E +GDH+ED  C V  +KSP+ DCSEV 
Sbjct  54   ATVRVVCSQVDNAKNVTFSKEAVTDASGSYKVEVDGDHEED-TCEVTLLKSPRADCSEVD  112

Query  279  KDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKEL  139
            ++   ++  R+++T NNG+V+  R+ NP+ FLK   +  C ++ KEL
Sbjct  113  QESHLQQAARISITKNNGIVSPIRQANPLGFLKKDRLPGCLDLLKEL  159



>ref|XP_002273294.1| PREDICTED: olee1-like protein [Vitis vinifera]
 emb|CBI30683.3| unnamed protein product [Vitis vinifera]
Length=168

 Score =   129 bits (323),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 103/161 (64%), Gaps = 1/161 (1%)
 Frame = -1

Query  609  IAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLN  430
            + AVIFL + L     +     +  + V G VYCD CR +F+TRV+E +PGAKV+LEC +
Sbjct  5    LQAVIFLAAALCFFSFQASVRAEPHFFVKGQVYCDTCRIQFITRVSEYVPGAKVRLECRD  64

Query  429  TTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTR  250
                 VTYS++GETD+ G Y L  EG+H+E+    V+ +KS K +CSE+ + ++A+   R
Sbjct  65   REGGSVTYSIDGETDETGSYRLPVEGEHEEEVC-EVQLIKSSKPECSEISRGVFARRSAR  123

Query  249  VTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
            ++L +NNG+ +  R  NP+ FLK + ++ C EV KEL  +P
Sbjct  124  ISLASNNGMASSDRLANPLGFLKQESLSECPEVLKELGILP  164



>ref|XP_008439742.1| PREDICTED: olee1-like protein isoform X1 [Cucumis melo]
 ref|XP_008439744.1| PREDICTED: olee1-like protein isoform X3 [Cucumis melo]
Length=168

 Score =   129 bits (323),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 106/171 (62%), Gaps = 13/171 (8%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAK  + +L++A+ FL S L ++      + K R+ + G VYCD CR +F TRV++ +PG
Sbjct  1    MAKSCAIILVSALCFL-SFLDIA-----LSSKDRFFIEGKVYCDTCRIQFFTRVSKYLPG  54

Query  456  AKVKLEC---LNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSE  286
            AKVKL C    N  NE  T++ E  TDKNG+Y +E +GDH E+EIC V  ++S  ++CS 
Sbjct  55   AKVKLVCREEANAGNE--TFTGEAVTDKNGVYKIEVDGDH-EEEICEVSLLESADKECSG  111

Query  285  VIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHY  133
            +  D +   F RV++T NNG+    R+ NP+ FL+   +  C EV +EL +
Sbjct  112  IPTDGYG-HFARVSITGNNGITNPVRQANPLGFLRKDALPQCKEVLRELGF  161



>ref|XP_004485892.1| PREDICTED: olee1-like protein-like [Cicer arietinum]
Length=165

 Score =   128 bits (322),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 101/166 (61%), Gaps = 10/166 (6%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAK  + +LI+ + FL S  G            R+ V G VYCD CR +F+T++ E M G
Sbjct  1    MAK-STIILISTLCFL-SFFG------SVYCNDRFFVEGVVYCDTCRTQFITKLTEFMEG  52

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            A V++EC    N  VT+S E  TD +G Y +E +GDH EDE+C +   KSP++DCSEV  
Sbjct  53   ATVRMEC-KEDNGTVTFSKEAVTDASGTYRVEVDGDH-EDEVCEITLAKSPRKDCSEVDS  110

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKEL  139
            D   ++  R+++T NNG+V+  R  NP+ FLK + +  CA+V K+L
Sbjct  111  DSHLEQAARISITNNNGIVSPLRTANPLGFLKKERLPGCADVLKDL  156



>ref|XP_010538209.1| PREDICTED: pollen-specific protein-like At4g18596 [Tarenaya hassleriana]
Length=170

 Score =   128 bits (322),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 108/171 (63%), Gaps = 6/171 (4%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAKV     +A+ + L ++  V+ A   A     + + G+VYCD CR +F+TR+++ + G
Sbjct  1    MAKV--IFFLASALCLATL--VNFAAADADDFDTFHIKGSVYCDTCRVQFITRLSKFLEG  56

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKVKLEC N  N+ VT   E  TDK+G Y +   GDH E+E+C +  V+SP+ +C E+  
Sbjct  57   AKVKLECKNRVNQTVTLVEEAVTDKSGNYEMVVTGDH-EEEVCEIVLVESPEAECREINN  115

Query  276  DMWAKEFTRVTLTANNGLVTD-TRKVNPILFLKTKPIAVCAEVFKELHYIP  127
            + + +   R++LTAN+G+V++ TR VNP+ F++  P+  C + FKEL  +P
Sbjct  116  EEFLRNAARISLTANDGIVSNETRTVNPLGFMRNTPLPDCPKAFKELDIVP  166



>ref|XP_010518802.1| PREDICTED: pollen-specific protein-like At4g18596 [Tarenaya hassleriana]
Length=172

 Score =   128 bits (322),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 107/171 (63%), Gaps = 4/171 (2%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MA     LL+A+ I +  ++G + A+       R+++ G+VYCD CR +F+TR+++ + G
Sbjct  1    MASKGMVLLMASAICVSYVVGFAAADADDL--DRFQIQGSVYCDTCRVQFITRLSKFLQG  58

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKV+LEC N     +T S E  TD  G + ++  GDH E+E+C +  V+SP ++CS+V K
Sbjct  59   AKVRLECKNRVTGALTVSKEAVTDDTGSFLMQVTGDH-EEEVCEIMLVESPDQECSDVSK  117

Query  276  DMWAKEFTRVTLTANNGLVTD-TRKVNPILFLKTKPIAVCAEVFKELHYIP  127
            D + +   +V+LTAN+G+V++ TR VNP+ F+   P A C   F+EL   P
Sbjct  118  DAYLRNAAKVSLTANDGIVSNETRIVNPLGFMVKTPSADCPAAFQELGITP  168



>ref|XP_009109686.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDX90169.1| BnaA08g18150D [Brassica napus]
Length=171

 Score =   128 bits (321),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 93/138 (67%), Gaps = 2/138 (1%)
 Frame = -1

Query  537  RYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEA  358
            R+ + G+VYCD CR +F+TR+++ + GAKVKLEC    N+ VT + E  TDK+G Y +  
Sbjct  31   RFHIKGSVYCDTCRVQFMTRLSKVLEGAKVKLECKARENQTVTLTKEAVTDKDGKYEMVV  90

Query  357  EGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTD-TRKVNPILFLK  181
             GDH E+E+C +  V+SP  +C EV    + +   R++LTAN+G+V++  R +NP+ F++
Sbjct  91   MGDH-EEEVCEIILVESPDAECGEVNNQEFLRNAARISLTANDGIVSNEVRTINPLGFMR  149

Query  180  TKPIAVCAEVFKELHYIP  127
              P+A C +VFKEL  +P
Sbjct  150  KTPLADCPQVFKELGIVP  167



>ref|XP_011080816.1| PREDICTED: major pollen allergen Ole e 1-like [Sesamum indicum]
Length=166

 Score =   127 bits (320),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 94/163 (58%), Gaps = 7/163 (4%)
 Frame = -1

Query  612  LIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECL  433
            L A  + L+    V  A  P      + V G VYC+VCR  F+ +++E MPGAKVKLEC 
Sbjct  7    LFAGALCLLCFSSVVRATTP-----EFFVVGEVYCEVCRINFINKLSEPMPGAKVKLECR  61

Query  432  NTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWA-KEF  256
                  +TY+ EG T++ G Y L+ EGDH+E+E CG+  VKS + DC E+  + WA K  
Sbjct  62   GEETGNITYTQEGVTNEAGQYRLKVEGDHEEEE-CGITLVKSGRADCDEIPNEGWASKPS  120

Query  255  TRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
            + +TLT NNG    +R  NP+ F K K    CAE+ KEL   P
Sbjct  121  SLITLTKNNGFHGSSRYANPLGFTKKKANHECAELIKELEIDP  163



>emb|CAA16739.1| pollen-specific protein - like [Arabidopsis thaliana]
 emb|CAB78861.1| pollen-specific protein-like [Arabidopsis thaliana]
Length=842

 Score =   136 bits (343),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 107/171 (63%), Gaps = 4/171 (2%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MA         + + L S+ GV+ A+  A    R+++ G+VYCD CR +FVTR+++ + G
Sbjct  274  MASKAIFFFFVSAVCLSSLAGVAIAD--ADDFDRFQIQGSVYCDTCRVQFVTRLSKFLEG  331

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKVKLEC + TN  VT + E  TDK G Y +E  GDH E+E+C +  V+SP   CS+V K
Sbjct  332  AKVKLECRSRTNGTVTLTKEAVTDKTGSYRMEVTGDH-EEEVCELVLVESPDSGCSDVSK  390

Query  276  DMWAKEFTRVTLTANNGLVT-DTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
            + + +   +++LTAN+G+V+ +TR VNP+ F+   P A C   FKEL  +P
Sbjct  391  EAYLRNAAKISLTANDGIVSHETRIVNPLGFMVQTPSAECPAAFKELGIVP  441



>ref|XP_004251892.1| PREDICTED: anther-specific protein LAT52-like [Solanum lycopersicum]
Length=161

 Score =   127 bits (320),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 94/161 (58%), Gaps = 4/161 (2%)
 Frame = -1

Query  603  AVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTT  424
            A++ L ++  +      A  +  +KV GTVYCD CR +F TR++E + GAKVKL C +  
Sbjct  4    AILVLSALCSILAFANFAQCQEAFKVEGTVYCDTCRVQFQTRISEYIEGAKVKLTCRDME  63

Query  423  NEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVT  244
             EKVTY+ E  TDKNG Y +EA GDH E E+C V  V+SP+EDC +        E +RV 
Sbjct  64   TEKVTYTAEALTDKNGKYTIEASGDH-EKELCDVGVVQSPREDCKD---PAIGFENSRVV  119

Query  243  LTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGE  121
             + N G+   TR  NP+ F+K + +  C +V  EL   P E
Sbjct  120  CSNNVGMHNPTRYANPLFFMKKETLPDCKDVLDELGLFPLE  160



>ref|XP_002523378.1| Anther-specific protein LAT52 precursor, putative [Ricinus communis]
 gb|EEF38957.1| Anther-specific protein LAT52 precursor, putative [Ricinus communis]
Length=166

 Score =   127 bits (320),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 101/166 (61%), Gaps = 10/166 (6%)
 Frame = -1

Query  612  LIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECL  433
            LIA+ +   S+L        A   +   V G VYCD CR +F T+++E +PG +VKLEC 
Sbjct  10   LIASALCFSSLL------SSALATAGLYVEGKVYCDTCRVEFETKLSEVIPGTRVKLECK  63

Query  432  NTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFT  253
            N  N  +TY++EG TD +G+Y L  EG+H+ED +C VK +KS K DC+E  K +   +  
Sbjct  64   NRENNTLTYAVEGVTDASGIYRLPVEGEHEED-LCEVKLIKSGKPDCAEAFKSV---DHA  119

Query  252  RVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGENV  115
            RV LT N G+V  TR  NP+ F+K K    C +V +++ ++P +N+
Sbjct  120  RVLLTHNVGVVQPTRYTNPLGFMKQKASPECGKVLQDMGFVPLDNL  165



>ref|XP_008439743.1| PREDICTED: olee1-like protein isoform X2 [Cucumis melo]
Length=168

 Score =   127 bits (320),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 106/171 (62%), Gaps = 13/171 (8%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAK  + +L++A+ FL S L ++      + K R+ + G VYCD CR +F TRV++ +PG
Sbjct  1    MAKSCAIILVSALCFL-SFLDIA-----LSSKDRFFIEGKVYCDTCRIQFFTRVSKYLPG  54

Query  456  AKVKLEC---LNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSE  286
            AKVKL C    N  NE  T++ E  TDKNG+Y +E +GDH E+EIC V  ++S  + C E
Sbjct  55   AKVKLVCREEANAGNE--TFTGEAVTDKNGVYKIEVDGDH-EEEICEVSLLESGDKGCGE  111

Query  285  VIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHY  133
            +  D +   F RV++T NNG++   R+ NP+ F K + +  C EV +EL +
Sbjct  112  IPTDGYG-HFARVSITGNNGIIDPVRQANPLGFKKKEALPQCKEVLRELGF  161



>emb|CDY43319.1| BnaC03g58910D [Brassica napus]
Length=171

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 92/138 (67%), Gaps = 2/138 (1%)
 Frame = -1

Query  537  RYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEA  358
            R+ + G+VYCD CR +F+TR+++ + GAKVKLEC    N+ VT + E  TDK G Y +  
Sbjct  31   RFHIKGSVYCDTCRVQFMTRLSKVLEGAKVKLECKGRENQTVTLTKEAVTDKEGKYEMVV  90

Query  357  EGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTD-TRKVNPILFLK  181
             GDH E+E+C +  V+SP  +C EV    + +   R++LTAN+G+V++  R +NP+ F++
Sbjct  91   MGDH-EEEVCEIILVESPDAECGEVNNQEFLRNAARISLTANDGIVSNEVRTINPLGFMR  149

Query  180  TKPIAVCAEVFKELHYIP  127
              P+A C +VFKEL  +P
Sbjct  150  KTPLADCPQVFKELGIVP  167



>gb|AFK46977.1| unknown [Lotus japonicus]
Length=168

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 102/167 (61%), Gaps = 10/167 (6%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAK    ++ A+ +  ++++G       A  + R+ + GTVYCD CR +F+TRV+E M G
Sbjct  1    MAKY--TIIAASALCFLTLVG------SAYSQDRFFIEGTVYCDTCRTQFLTRVSEFMSG  52

Query  456  AKVKLECL-NTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVI  280
            A V + C       KVT+S E  TD NGMY +  +GDH EDE+C VK +KS + DCSEV 
Sbjct  53   ATVGVVCRERDAGAKVTFSKEAVTDANGMYSVAVDGDH-EDEVCEVKLLKSSRADCSEVD  111

Query  279  KDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKEL  139
             +   ++ +R+++T NNG+V+  R  NP+ FLKT+ +  C  +  +L
Sbjct  112  TESHLEQASRISITNNNGIVSPVRTANPLGFLKTERLPECGHILLQL  158



>ref|XP_009602640.1| PREDICTED: anther-specific protein LAT52-like [Nicotiana tomentosiformis]
Length=163

 Score =   125 bits (315),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 102/172 (59%), Gaps = 11/172 (6%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAK   A+L+ + + +++ +  +      A      V G+VYCD CR +F T+++E + G
Sbjct  1    MAK---AILLLSAVCILAFVNFAQCHDSQA----INVEGSVYCDTCRVQFQTKLSEYIEG  53

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            A V+L C +   EK TYS+EG TDKNG Y ++ EGDH E+E+C V  VKSP+EDC E   
Sbjct  54   ATVRLACKDIETEKETYSVEGVTDKNGKYIIKVEGDH-ENELCEVSIVKSPREDCKE---  109

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGE  121
                 E +RV  +AN G+   TR  NP+ F+KT+ ++ C +V  EL   P E
Sbjct  110  SAIGFENSRVVCSANVGIHNPTRYANPLFFMKTEAVSGCKDVLDELGLFPLE  161



>ref|XP_006358942.1| PREDICTED: anther-specific protein LAT52-like [Solanum tuberosum]
Length=161

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 92/161 (57%), Gaps = 4/161 (2%)
 Frame = -1

Query  603  AVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTT  424
            A++ L ++  +      A     +KV GTVYCD CR +F T+++E + GAKV+L C +  
Sbjct  4    AILVLSALCSILAFANFAQSHEVFKVEGTVYCDTCRVQFQTKISENIEGAKVQLTCRDME  63

Query  423  NEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVT  244
             EKVTY+ E  TDK+G Y +EA GDH E E+C V  + SP+EDC E        E TRV 
Sbjct  64   TEKVTYTTEALTDKDGKYTIEATGDH-EKELCDVGVIHSPREDCKE---PAIGFENTRVV  119

Query  243  LTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGE  121
             + N G+   TR  NP+ F+K + +  C +V  EL   P E
Sbjct  120  CSNNVGMHNPTRYANPLFFMKKESLPGCKDVLDELGLFPLE  160



>ref|XP_009604804.1| PREDICTED: anther-specific protein LAT52 [Nicotiana tomentosiformis]
Length=161

 Score =   124 bits (310),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 94/161 (58%), Gaps = 4/161 (2%)
 Frame = -1

Query  603  AVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTT  424
            A++ L ++  V+ A         + V G VYCD CR +F T+++E + GA V+L+C N +
Sbjct  4    AIVLLSALCIVALANFAHCRPQVFDVEGKVYCDTCRVQFETKLSENVEGATVRLQCRNIS  63

Query  423  NEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVT  244
             E  T+S+EG TDK+G Y L  EGDH +D+IC V  VKSP+EDC E +      E  R+ 
Sbjct  64   TETETFSVEGVTDKDGKYKLTVEGDH-QDDICEVTVVKSPREDCKESVT---GYEKARIE  119

Query  243  LTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGE  121
             + N G+    R  NP+ F+KT+ ++ C EV  EL   P E
Sbjct  120  CSDNVGIHNAVRYANPLFFMKTEAVSGCKEVLDELGLFPLE  160



>gb|KHG10520.1| Olee1-like protein [Gossypium arboreum]
Length=180

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 105/170 (62%), Gaps = 8/170 (5%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAKVQ   L++  I L ++LG++ A  P   + ++ V G VYCD CR +F T++++ + G
Sbjct  1    MAKVQQITLVSLAICLSTLLGLAAAANP---EEKFIVEGRVYCDTCRVEFETKISQPIKG  57

Query  456  AKVKLECLNTTNEK-VTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVI  280
            A VKLEC N TNEK V++S +  TD+ G Y +E +GDH EDEIC V  VKSP+ DC+E  
Sbjct  58   ASVKLECRNITNEKIVSHSQDVVTDEAGGYKIEVKGDH-EDEICEVSLVKSPRADCNEPT  116

Query  279  KDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYI  130
             ++W K   RV LT  +G+    R  N + ++K + +  C +V  E+ Y 
Sbjct  117  -EVWRK--ARVVLTKADGVSGTYRFANNLGYMKKEALPECKKVLTEMGYF  163



>ref|XP_009778120.1| PREDICTED: anther-specific protein LAT52-like [Nicotiana sylvestris]
Length=163

 Score =   123 bits (308),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 101/172 (59%), Gaps = 11/172 (6%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAK   A+L+ + + +++ +  +      A      V G+VYCD CR +F T+++E + G
Sbjct  1    MAK---AILLLSAVCILAFVNFAQCHDSQA----INVEGSVYCDTCRVQFQTKLSEYIEG  53

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            A V+L C +   EK TYS+EG TDKNG Y ++ EGDH E+E+C V  VKSP+EDC E   
Sbjct  54   ATVRLACKDIETEKETYSVEGVTDKNGKYIIKVEGDH-ENELCEVSIVKSPREDCKE---  109

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGE  121
                 E +RV  + N G+   TR  NP+ F+KT+ ++ C +V  EL   P E
Sbjct  110  PAIGFENSRVVCSGNVGIHNPTRYANPLFFMKTEAVSGCKDVLDELGLFPLE  161



>gb|EPS70684.1| hypothetical protein M569_04073 [Genlisea aurea]
Length=170

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 94/167 (56%), Gaps = 4/167 (2%)
 Frame = -1

Query  624  QSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVK  445
             SA ++A  IF  +++  +  +   A    + V G V+C+VCR  F+ R++E M GA V+
Sbjct  3    NSAQIVA--IFAGALILFALGDTAVATDPEFFVQGQVFCEVCRTNFINRLSEPMEGATVR  60

Query  444  LECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWA  265
            LEC       +T+ +EG TD  G Y L+A GDH EDE C V  VKS + DC E   + WA
Sbjct  61   LECRGDNVGNITFGIEGVTDAGGNYKLKATGDH-EDEDCQVTLVKSSRLDCQETPSEGWA  119

Query  264  KE-FTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
             +  +++T+T NNG   D R  NP+ F K +    C E+FKEL   P
Sbjct  120  MQPSSKITITKNNGFHDDIRHANPLGFTKKERDPACQELFKELQINP  166



>gb|ACJ83911.1| unknown [Medicago truncatula]
 gb|ACJ86228.1| unknown [Medicago truncatula]
 gb|AFK43996.1| unknown [Medicago truncatula]
 gb|KEH36588.1| pollen Ole e I family allergen [Medicago truncatula]
Length=168

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 97/155 (63%), Gaps = 6/155 (4%)
 Frame = -1

Query  600  VIFLVSMLGVSGAEKPAAGKS-RYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTT  424
            ++F +  L   G+   A  KS R+ V G VYCD CR +F+TR+ E + GA V++EC    
Sbjct  8    LVFTLCFLSFLGS---AYSKSDRFFVEGVVYCDTCRTQFITRLTEFIEGATVRVEC-KED  63

Query  423  NEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVT  244
            N  +T++ E  TDK+G Y +E +GDH EDE C V   KSP++DCSEV  +   ++  R++
Sbjct  64   NGTLTFNKEATTDKSGKYSVEIDGDH-EDETCEVILCKSPRKDCSEVDSEAHLQQAARIS  122

Query  243  LTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKEL  139
            +T NNG+V+  R  +P+ FLK + +  C EV KEL
Sbjct  123  VTNNNGIVSPVRAASPLGFLKKERLPKCGEVLKEL  157



>gb|AFB73931.1| LAT52-like protein [Lycium barbarum]
Length=161

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 91/161 (57%), Gaps = 4/161 (2%)
 Frame = -1

Query  603  AVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTT  424
            A++ L ++  V+ A         + V G VYCD CR +F T++++ + GA VKL+C N T
Sbjct  4    AIVLLSALCIVALANFAHCHPEVFDVEGKVYCDTCRVQFETKLSQNIEGATVKLQCRNIT  63

Query  423  NEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVT  244
             E  T+S+EG TDK+G Y L  EGDH +D+IC V  VKSP+EDC E +      E  R+ 
Sbjct  64   TETETFSVEGVTDKDGKYKLTVEGDH-QDDICEVTVVKSPREDCKEAVS---GYEKARIE  119

Query  243  LTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGE  121
             + N G+    R  NP+ F+K + +  C E   EL   P E
Sbjct  120  CSDNVGMHNAVRYANPLFFMKAEAVEGCKEALDELGLFPLE  160



>gb|AFB73932.1| LAT52-like protein [Lycium barbarum]
Length=161

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 92/164 (56%), Gaps = 5/164 (3%)
 Frame = -1

Query  609  IAAVIFLVSMLGVSGAEKPAAGKSR-YKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECL  433
            +A  I L+S L ++     A      + V G VYCD CR +F T++++ + GA VKL+C 
Sbjct  1    MAKAIVLLSALCIAALANFAHCHPEVFDVEGKVYCDTCRVQFETKLSQNIEGATVKLQCR  60

Query  432  NTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFT  253
            N T E  T+S+EG TDK+G Y L  EGDH +D+IC V  VKSP+EDC E +      E  
Sbjct  61   NITTETETFSVEGVTDKDGKYKLTVEGDH-QDDICEVTVVKSPREDCKEAVS---GYEKA  116

Query  252  RVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGE  121
            R+  + N G+    R  NP+ F+K + +  C E   EL   P E
Sbjct  117  RIECSDNVGMHNAVRYANPLFFMKAEAVEGCKEALDELGLFPLE  160



>ref|XP_006360048.1| PREDICTED: anther-specific protein LAT52-like [Solanum tuberosum]
Length=161

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 92/164 (56%), Gaps = 5/164 (3%)
 Frame = -1

Query  609  IAAVIFLVSMLGVSGAEKPAAGKSR-YKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECL  433
            +A  I L+S L +      A   S  + V G VYCD CR +F T+++E + GA VKL+C 
Sbjct  1    MAKAILLLSALCIVALANFAHCHSEVFDVEGKVYCDTCRVQFETKLSENLDGATVKLQCR  60

Query  432  NTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFT  253
            N + E  T+S+EG TDK+G Y L  +GDH E++IC V  VKSP+EDC E +      E  
Sbjct  61   NISTEAETFSVEGVTDKDGKYKLTVDGDH-ENDICEVTVVKSPREDCKESVS---GYEKA  116

Query  252  RVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGE  121
            R+  + N G+    R  NP+ F+K + +  C E   EL   P E
Sbjct  117  RIECSNNVGIHNAVRYANPLFFMKAESVQGCKEALDELGLFPLE  160



>ref|XP_011101379.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=176

 Score =   121 bits (303),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 97/164 (59%), Gaps = 8/164 (5%)
 Frame = -1

Query  624  QSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVK  445
            Q A+++A  +  +S+  V+ +E P     ++ V G V+C+VCR  F+ + +  MP A+VK
Sbjct  7    QVAIILAGALCFLSLADVANSEVP-----QFIVKGKVFCEVCRLNFINKFSHPMPKAEVK  61

Query  444  LECLNTTNEKVTYSLE-GETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEV-IKDM  271
            LEC +    KV Y L  G+T+ NG Y L AEGDH E EIC V  VKS + DC+E+   D 
Sbjct  62   LECRDEGTGKVMYRLTGGQTNDNGEYTLYAEGDHGE-EICEVTLVKSSQHDCAEIPTDDS  120

Query  270  WAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKEL  139
              K+   +TLT NNG   + R  NP+ F + K +  CA++ KEL
Sbjct  121  GEKQAAEITLTVNNGFHDNIRLANPLSFTRKKALPKCAKLLKEL  164



>ref|XP_008450951.1| PREDICTED: olee1-like protein [Cucumis melo]
Length=165

 Score =   120 bits (301),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 94/160 (59%), Gaps = 2/160 (1%)
 Frame = -1

Query  612  LIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECL  433
            +  + I L+S L        A+ K ++ V G VYCD CR +F T+V++ + GA VKLEC 
Sbjct  1    MTKSTIILISALCFVSLFYLASSKDQFFVEGKVYCDTCRVQFFTKVSKFLKGATVKLECK  60

Query  432  NTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFT  253
                  VT + E  TDK+G Y +EA+GDH E+E+C V  VKS   DC E+ K+ +    +
Sbjct  61   EIEGGSVTLNKEAVTDKSGKYSIEADGDH-EEEVCEVSLVKSVDPDCDEISKEGYGHT-S  118

Query  252  RVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHY  133
            RVT+T N+G+    R  NP+ FLK + +  C EV +EL +
Sbjct  119  RVTITNNSGITNPVRLANPLAFLKKEKLPECKEVLRELGF  158



>ref|XP_009794171.1| PREDICTED: anther-specific protein LAT52 [Nicotiana sylvestris]
Length=161

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 93/161 (58%), Gaps = 4/161 (2%)
 Frame = -1

Query  603  AVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTT  424
            A++ L ++  V+ A         + V G VYCD CR +F T+++E + GA V+L+C N +
Sbjct  4    AILLLSALCIVALANFAHCHPQVFDVEGKVYCDTCRVQFETKLSENVEGATVRLQCRNIS  63

Query  423  NEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVT  244
             E  T+S+EG TDK+G Y L  EGDH +D+IC V  VKSP+EDC E +      E  R+ 
Sbjct  64   TEIETFSVEGVTDKDGKYKLTVEGDH-QDDICEVTVVKSPREDCKEAVT---GYEKARIE  119

Query  243  LTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGE  121
             + N G+    R  N + F+K++ ++ C EV  EL   P E
Sbjct  120  CSDNVGIHNAVRYANALFFMKSEAVSGCKEVLDELGLFPLE  160



>ref|XP_004144129.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 ref|XP_004171680.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 gb|KGN66323.1| hypothetical protein Csa_1G597700 [Cucumis sativus]
Length=165

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 93/157 (59%), Gaps = 2/157 (1%)
 Frame = -1

Query  603  AVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTT  424
            + I LVS L        A+ K ++ V G VYCD CR +F T+V++ + GA VKLEC    
Sbjct  4    STIILVSALCFISLFHLASCKDQFFVEGKVYCDTCRVQFFTKVSKFLEGATVKLECKEIE  63

Query  423  NEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVT  244
               VT   E  TDK+G Y +EA+GDH E+E+C V  +KS   DC E+ K+ +    +RVT
Sbjct  64   GGSVTLDKEAVTDKSGKYSIEADGDH-EEEVCEVSLMKSVDPDCDEISKEGYGHT-SRVT  121

Query  243  LTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHY  133
            +T N+G+    R  NP+ FLK + ++ C EV +EL +
Sbjct  122  ITNNSGITNPVRLANPLAFLKKEKLSECKEVLRELGF  158



>ref|XP_008467237.1| PREDICTED: olee1-like protein [Cucumis melo]
Length=166

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 100/168 (60%), Gaps = 9/168 (5%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAK  S +L+ + + L+S+L V+ ++K      R+ V G VYCD CR +F T+ ++ + G
Sbjct  1    MAK--SMILLVSALSLMSLLNVAFSQK-----DRFLVEGKVYCDACRVQFFTKASKFLEG  53

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            A VKL C       VT S E  TDK G Y +EA+GDH E+E+C V  VKS   DCSE+  
Sbjct  54   ATVKLVCKEIEGGSVTLSKEAVTDKTGSYSIEADGDH-EEELCEVTLVKSNDPDCSEISL  112

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHY  133
            + + +   RV++T N+G+    R  NP+ F+K + +  C E+ +EL +
Sbjct  113  EKY-EHMARVSITNNSGITNPVRHANPLAFMKKEKLPECKEILRELGF  159



>ref|XP_011029563.1| PREDICTED: olee1-like protein [Populus euphratica]
Length=166

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 91/158 (58%), Gaps = 4/158 (3%)
 Frame = -1

Query  594  FLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEK  415
            F+ + L  S     A       V G VYCD CR +F T++++ +PGAKVKL C N  N  
Sbjct  10   FVSTALCFSSVLISAYAADYLDVEGKVYCDTCRVEFQTKISDALPGAKVKLACNNRENGT  69

Query  414  VTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTA  235
            +TY++EG TD  G Y L   GDH+ED IC V+ V+SP+ DC+E  K +   +  R+ LT 
Sbjct  70   LTYTVEGSTDSRGTYRLPVAGDHEED-ICEVRLVESPRADCNEPFKSV---DSARILLTK  125

Query  234  NNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGE  121
            N G+V   R  N + ++K      CA+V +E+ ++P E
Sbjct  126  NVGVVNSLRYANALGYMKKVAQPECAKVLEEMGFLPVE  163



>ref|XP_004143635.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 ref|XP_004168700.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 gb|KGN50408.1| hypothetical protein Csa_5G172880 [Cucumis sativus]
Length=166

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 98/168 (58%), Gaps = 9/168 (5%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAK  S +L  + + L S+L V+ ++K      R+ V G VYCD CR +F T+ ++ + G
Sbjct  1    MAK--SIILFVSALSLFSLLNVAYSQK-----DRFLVEGKVYCDACRVQFFTKASKFLEG  53

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            A VKL C       VT S E  TDK G Y +EA+GDH+ED +C V  VKS   DCSE+  
Sbjct  54   ATVKLVCKEIEGGSVTLSKEAVTDKTGSYSIEADGDHEED-LCEVTLVKSNDPDCSEISL  112

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHY  133
            + + +   RV++T N+G+    R  NP+ F+K + +  C EV +EL +
Sbjct  113  EKY-EHMARVSITNNSGITNPVRHANPLAFMKKEKLPECKEVLRELGF  159



>ref|XP_002316866.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
 gb|EEE97478.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
Length=164

 Score =   118 bits (295),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 93/158 (59%), Gaps = 4/158 (3%)
 Frame = -1

Query  594  FLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEK  415
            F+ + L  S     A       V G VYCD CR +F T++++ +PGAKVKL C N  N  
Sbjct  10   FVATALCFSSVLISAYAADYLDVEGKVYCDTCRVEFQTKISDAIPGAKVKLVCNNRENGT  69

Query  414  VTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTA  235
            +TY++EG TD +G Y L   GDH+ED IC V+ V+SP+ DC+E  K +   +  R+ LT 
Sbjct  70   LTYTVEGTTDSSGTYRLPVVGDHEED-ICEVRLVESPRADCNEPFKSV---DSARILLTK  125

Query  234  NNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGE  121
            N G+V + R  N + ++K      CA+V +E+ ++P E
Sbjct  126  NVGVVDNLRYANALGYMKKVAQPECAKVLEEMGFLPVE  163



>ref|XP_004248244.1| PREDICTED: anther-specific protein LAT52 [Solanum lycopersicum]
 sp|P13447.1|LAT52_SOLLC RecName: Full=Anther-specific protein LAT52; Flags: Precursor 
[Solanum lycopersicum]
 emb|CAA33854.1| LAT52 [Solanum lycopersicum]
Length=161

 Score =   117 bits (292),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 65/164 (40%), Positives = 91/164 (55%), Gaps = 5/164 (3%)
 Frame = -1

Query  609  IAAVIFLVSMLGVSGAEKPAAGKSR-YKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECL  433
            +A  I L+S L +      A  +   + V G VYCD CR +F T+++E + GA VKL+C 
Sbjct  1    MAKAIVLLSALCILALANFAHCRPEVFDVEGKVYCDTCRVQFETKLSENLEGATVKLQCR  60

Query  432  NTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFT  253
            N + E  T+S+EG TDK+G Y L   GDH E++IC V  VKSP+EDC E +      E  
Sbjct  61   NISTEAETFSVEGVTDKDGKYKLTVNGDH-ENDICEVTVVKSPREDCKESVS---GYEKA  116

Query  252  RVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGE  121
            R+  + N G+    R  NP+ F+K + +  C E   EL   P E
Sbjct  117  RIECSDNVGIHNAVRFANPLFFMKAESVQGCKEALDELGLFPLE  160



>ref|XP_007021723.1| Pollen Ole e 1 allergen and extensin family protein, putative 
[Theobroma cacao]
 gb|EOY13248.1| Pollen Ole e 1 allergen and extensin family protein, putative 
[Theobroma cacao]
Length=162

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 97/161 (60%), Gaps = 5/161 (3%)
 Frame = -1

Query  606  AAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLN-  430
            A++I LVS+     +      +  + V G VYCD CR +F TR+++ + GA V LEC + 
Sbjct  4    ASLIALVSLAICLSSLSFTYAEDTFFVEGKVYCDTCRVEFETRLSQPIKGATVILECRDR  63

Query  429  TTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTR  250
            T    +TYS E  TD++G Y +  +GDH E+EIC V+ VKSP+EDC+E + + W +   R
Sbjct  64   TVGGSITYSQESVTDESGKYRIPVQGDH-EEEICEVRVVKSPREDCNEFM-EAWQR--AR  119

Query  249  VTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
            V LT  NG+    R  N + FLK + +  CAEV +EL ++P
Sbjct  120  VLLTKKNGVSDPIRYANNLGFLKKEAVPGCAEVLEELGFLP  160



>ref|XP_006370166.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
 gb|ERP66735.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
Length=161

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 98/172 (57%), Gaps = 12/172 (7%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAK   +  IAA +   S L +S     A       V G VYCD CR +F T+++E +P 
Sbjct  1    MAK---SFTIAAFVLCFSSLLIS-----AYAADYLDVEGKVYCDPCRVEFQTKISEGIPA  52

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKVKL C N  N   TY++EG TD +G Y L   GDH ED+IC V+ V+S + DC+E  +
Sbjct  53   AKVKLVCNNRDNGTETYTVEGATDNSGTYRLPVAGDH-EDDICEVRLVESSRPDCNEPFR  111

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGE  121
             +   +  R+ LT N G+V  TR  N + ++K +    CA+V KE+ ++P E
Sbjct  112  SI---DSARILLTKNVGVVDKTRYPNALGYMKKEAQPECADVLKEMGFLPLE  160



>ref|XP_011078225.1| PREDICTED: pollen allergen Che a 1-like [Sesamum indicum]
Length=170

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 96/165 (58%), Gaps = 8/165 (5%)
 Frame = -1

Query  624  QSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVK  445
            Q A+++A  +  +S+  V+ ++ P      + V G VYCDVCR  F  + +E M GA+VK
Sbjct  6    QFAIILAGALCFLSLADVANSQGP-----EFIVKGMVYCDVCRVNFFNKFSEPMSGAQVK  60

Query  444  LECLNTTNEKVTYSLE-GETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMW  268
            LEC +  + KVTY +  GETD NG+Y L AEGDH   E+C V  VKS + +CSE+  D  
Sbjct  61   LECKDKESGKVTYRMTGGETDDNGIYTLPAEGDH-LGEVCEVTLVKSSRAECSEIPIDRS  119

Query  267  AKEFT-RVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELH  136
             K  T  VTL A +  + + R  NP++F + + +  C E  K++ 
Sbjct  120  GKSPTSEVTLVATSSFMDNIRLANPLVFTRKEALRKCIEFLKDVQ  164



>ref|XP_006857531.1| hypothetical protein AMTR_s00061p00032820 [Amborella trichopoda]
 gb|ERN18998.1| hypothetical protein AMTR_s00061p00032820 [Amborella trichopoda]
Length=159

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 91/164 (55%), Gaps = 12/164 (7%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MA+ Q  L +AAV+FL S     G   P      ++V G VYCD CRA F T     + G
Sbjct  1    MARSQ-LLSVAAVLFLFS--SALGTPTP-----NFEVEGRVYCDTCRAGFETSATTYIKG  52

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            + V+LEC +    ++TYS+EG TD  G Y L    D  + EIC V  V SP+  C    K
Sbjct  53   STVRLECKDRATHQLTYSIEGVTDATGTYRLPVSDDR-QHEICEVVVVSSPEAGCG---K  108

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFK  145
             M  +E  RV LT NNG+V++TR  N + FLK +P+  CAE+ K
Sbjct  109  AMLGRERARVLLTHNNGIVSNTRYANALAFLKDEPLPRCAELLK  152



>ref|XP_011006522.1| PREDICTED: olee1-like protein [Populus euphratica]
Length=161

 Score =   114 bits (286),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 97/172 (56%), Gaps = 12/172 (7%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAK   +  IAA +   S L +S     A       V G VYCD CR +F T+++E +P 
Sbjct  1    MAK---SFTIAAFVLCFSSLLIS-----AYAADYLNVEGKVYCDPCRVEFQTKISEGIPA  52

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKVKL C N  N   TY++EG TD +G Y L   GDH ED+IC ++ V+S + DC+E  +
Sbjct  53   AKVKLVCNNRDNGTETYTVEGATDSSGTYRLSVAGDH-EDDICEIRLVESSRPDCNEPFR  111

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGE  121
             +   +  ++ LT N G+V  TR  N + ++K +    CA V KE+ ++P E
Sbjct  112  SI---DSAKILLTKNAGVVDKTRYPNALGYMKKEAQPECANVLKEMGFLPLE  160



>gb|KCW69946.1| hypothetical protein EUGRSUZ_F03264 [Eucalyptus grandis]
Length=167

 Score =   115 bits (287),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 99/171 (58%), Gaps = 10/171 (6%)
 Frame = -1

Query  636  MAK-VQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMP  460
            MA+ +++A L+A  + L S+LG       A G  +  V G V+CD CR  F T+V+  + 
Sbjct  1    MARTLEAAALVATALCLSSLLGF------AYGHEKLDVVGKVFCDTCRVDFETKVSYGLA  54

Query  459  GAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVI  280
             +KV+LEC N T+  +T S E  TDK G Y LE EGDH E+EIC V+ ++S + +CS ++
Sbjct  55   DSKVRLECHNRTSGALTLSAEAVTDKTGEYRLEVEGDH-EEEICEVQLIESSEPECSSLL  113

Query  279  KDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
            +   A    RV LT  NG+    R  N + F K + +A CA+V  E+  +P
Sbjct  114  E--GAVHNARVALTNKNGVAQPARFANALAFAKKETLADCAQVLLEMGVLP  162



>ref|XP_011070069.1| PREDICTED: anther-specific protein LAT52-like [Sesamum indicum]
Length=161

 Score =   114 bits (286),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 89/157 (57%), Gaps = 4/157 (3%)
 Frame = -1

Query  609  IAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLN  430
            +A  + LVS L +  A    A K ++ V G VYCD CR +F T ++  + GA V+LEC +
Sbjct  1    MAKAVALVSALCILAAAVVDAHKEKFHVEGDVYCDPCRVQFETELSYNLAGATVRLECRD  60

Query  429  TTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTR  250
               + VTYS+EG T  +G Y L  +GDH++D IC V PVKSPK +CSE + D    E  +
Sbjct  61   IETKTVTYSMEGVTGSDGHYSLTVKGDHEKD-ICEVIPVKSPKAECSEPMGDY---ERAK  116

Query  249  VTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKEL  139
            +  T N+GL    R  NPI F+  + +  C  +   L
Sbjct  117  IECTENSGLHNPIRYANPIGFMTPEILPACGPILANL  153



>ref|XP_010941451.1| PREDICTED: pollen-specific protein C13-like [Elaeis guineensis]
Length=165

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 97/168 (58%), Gaps = 7/168 (4%)
 Frame = -1

Query  615  LLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLEC  436
            L++A++ F+ +++GV+ A    +    + VTG VYCD CRA FV    E + GAKV+LEC
Sbjct  4    LVLASLCFISALIGVADAVPTPS----FSVTGRVYCDTCRAGFVHEFTEYLGGAKVRLEC  59

Query  435  LNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEF  256
             +  + +V++S E  TDK G Y +    DH E EIC V  + SP+ DC E+  D   ++ 
Sbjct  60   RDYVSGQVSHSGEALTDKYGYYTITMSDDHQE-EICEVVLLDSPRYDCKEIPADH--RDR  116

Query  255  TRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGENVH  112
             RV LT NNG+ ++ R VN I +LK  P+  C  + +       ++++
Sbjct  117  ARVALTRNNGMSSEQRNVNAIGYLKDVPLPKCGPMLQRYALFTDDDIN  164



>ref|XP_010062811.1| PREDICTED: olee1-like protein [Eucalyptus grandis]
Length=196

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 99/171 (58%), Gaps = 10/171 (6%)
 Frame = -1

Query  636  MAK-VQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMP  460
            MA+ +++A L+A  + L S+LG       A G  +  V G V+CD CR  F T+V+  + 
Sbjct  30   MARTLEAAALVATALCLSSLLGF------AYGHEKLDVVGKVFCDTCRVDFETKVSYGLA  83

Query  459  GAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVI  280
             +KV+LEC N T+  +T S E  TDK G Y LE EGDH E+EIC V+ ++S + +CS ++
Sbjct  84   DSKVRLECHNRTSGALTLSAEAVTDKTGEYRLEVEGDH-EEEICEVQLIESSEPECSSLL  142

Query  279  KDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
            +   A    RV LT  NG+    R  N + F K + +A CA+V  E+  +P
Sbjct  143  E--GAVHNARVALTNKNGVAQPARFANALAFAKKETLADCAQVLLEMGVLP  191



>ref|XP_002890794.1| hypothetical protein ARALYDRAFT_336019 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67053.1| hypothetical protein ARALYDRAFT_336019 [Arabidopsis lyrata subsp. 
lyrata]
Length=621

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/151 (38%), Positives = 96/151 (64%), Gaps = 4/151 (3%)
 Frame = -1

Query  615  LLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLEC  436
            L +A+ +   +++  + A+  A    ++ + G+VYCD CR +F+TR+++ + GAKVKLEC
Sbjct  7    LFLASALCFTTLIHFTAAD--ADDFDKFHIKGSVYCDTCRVQFITRLSKFLEGAKVKLEC  64

Query  435  LNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEF  256
                N+ VT + E  TD  G Y +E  GDH E+E+C +  V+SP  +C EV    + +  
Sbjct  65   KGRENQTVTLTKEAVTDNAGNYQMEVMGDH-EEEVCEIVLVQSPDAECGEVNNQEFLRNA  123

Query  255  TRVTLTANNGLVT-DTRKVNPILFLKTKPIA  166
             R++LTAN+G+V+ +TR +NP+ F++  P+A
Sbjct  124  ARISLTANDGIVSNETRTINPLGFMRKTPLA  154



>ref|XP_004293940.1| PREDICTED: olee1-like protein-like [Fragaria vesca subsp. vesca]
Length=169

 Score =   112 bits (281),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 90/143 (63%), Gaps = 1/143 (1%)
 Frame = -1

Query  543  KSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHL  364
            K++ +V G V+CD CR +F+TR+ + + GAKVKLEC +  +  +TYS E ET++ G Y +
Sbjct  27   KAKLQVEGVVFCDSCRIQFITRIDKLIQGAKVKLECKDLDSGSITYSKEAETNEQGRYSI  86

Query  363  EAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFL  184
            E + DH+E+E   V  V SP EDC+++  ++  +   R++LT +NG+    R  NP+ F+
Sbjct  87   EVDSDHEEEEC-EVVLVSSPDEDCNQISHELHQQISARISLTQHNGIAGPVRIPNPLGFM  145

Query  183  KTKPIAVCAEVFKELHYIPGENV  115
            K +P   C +V KEL   P  NV
Sbjct  146  KKEPAPECPQVLKELGLTPDGNV  168



>ref|XP_004244268.1| PREDICTED: anther-specific protein LAT52-like [Solanum lycopersicum]
Length=169

 Score =   112 bits (280),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 90/158 (57%), Gaps = 4/158 (3%)
 Frame = -1

Query  603  AVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTT  424
            A+I L ++  ++ A    A    + V G V+CD CR  FVT ++  + GA V++ C +  
Sbjct  4    AIILLSTLCVLAVANFAVADVETFNVEGKVFCDTCRLGFVTSLSNTLEGATVRMTCKDME  63

Query  423  NEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVT  244
                T++ EG+TD  G Y L+ EGDH E++IC V  V SPK+DC EV+ DM      RV 
Sbjct  64   THNETFTTEGKTDGIGKYTLKVEGDH-ENDICEVTLVNSPKDDCKEVVPDMVNN---RVI  119

Query  243  LTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYI  130
             + N G+    R VNP+ + K KPI  CA++ +E+  +
Sbjct  120  CSKNVGMHNAVRFVNPLFYQKDKPIDGCAKLVEEMELV  157



>ref|XP_006348395.1| PREDICTED: anther-specific protein LAT52-like [Solanum tuberosum]
Length=169

 Score =   112 bits (280),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 88/158 (56%), Gaps = 4/158 (3%)
 Frame = -1

Query  603  AVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTT  424
            A+I L ++  ++ A    A    + V G V+CD CR  FVT ++  + GA V+L C +  
Sbjct  4    AIILLSALCVLAVANFAVADFEIFDVEGKVFCDTCRLGFVTSLSNTLEGATVRLTCKDME  63

Query  423  NEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVT  244
                T++ EG+TD  G Y L  EGDH E++IC V  V SPK+DC E++ DM      RV 
Sbjct  64   THNETFTTEGKTDYIGKYTLTVEGDH-ENDICEVTLVNSPKDDCKEIVPDMVNN---RVI  119

Query  243  LTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYI  130
             + N G+    R VNP+ F K KPI  C E+ +E+  +
Sbjct  120  CSKNVGMHNAVRFVNPLFFQKDKPINGCRELVEEMELV  157



>gb|KDP32532.1| hypothetical protein JCGZ_14735 [Jatropha curcas]
Length=165

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/168 (39%), Positives = 99/168 (59%), Gaps = 10/168 (6%)
 Frame = -1

Query  618  ALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLE  439
            A LIA+ +   S+   +      AG + + V G VYCDVCR +F T+++E + GA VKLE
Sbjct  8    AGLIASALCFSSLFSYA-----FAGANMF-VEGKVYCDVCRVEFETKLSEPIKGAVVKLE  61

Query  438  CLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKE  259
            C    N  +TY++EGETD  G+Y L  EG+H+ED IC V+ VKS   DC E  K   + +
Sbjct  62   CKIRENNTLTYAVEGETDPQGIYRLPVEGEHEED-ICEVRLVKSGMTDCIEPFK---STD  117

Query  258  FTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGENV  115
              R+ L+ N G+V  +R  NP+ ++K +    C +V  ++ ++P  +V
Sbjct  118  RARILLSQNVGVVQASRYANPLGYMKKEANPNCGQVLLDMGFLPNVDV  165



>gb|ACF82695.1| unknown [Zea mays]
 tpg|DAA38042.1| TPA: pollen-specific protein C13 [Zea mays]
Length=167

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 82/132 (62%), Gaps = 4/132 (3%)
 Frame = -1

Query  534  YKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAE  355
            Y + G VYCD CRA FVT V E + GAKV+LEC +    K+  S++G TD NG Y +E +
Sbjct  32   YVIQGRVYCDTCRAGFVTNVTEYIAGAKVRLECKHFGTGKLERSIDGVTDGNGTYTIELK  91

Query  354  GDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTK  175
              H+ED IC V  V+SP++DC +V  D   ++   V LT N G+  + R  NP+ +LK  
Sbjct  92   DSHEED-ICEVVLVESPRKDCDQVQAD---RDRAGVLLTRNVGISDNLRPANPLGYLKDV  147

Query  174  PIAVCAEVFKEL  139
            P+ +CA + K+L
Sbjct  148  PLPICASLLKQL  159



>ref|XP_010261236.1| PREDICTED: pollen-specific protein C13-like [Nelumbo nucifera]
Length=163

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 94/162 (58%), Gaps = 7/162 (4%)
 Frame = -1

Query  600  VIFLVSML-GVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTT  424
            V F + +L  +  A +PA  K+ + V G VYCD CRA F T     +PGA+V++EC +  
Sbjct  8    VFFALCVLPALVTAARPA--KNPFNVVGRVYCDTCRAGFETPATTYIPGARVRVECRDRD  65

Query  423  NEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVT  244
            N  + +S+EG TD  G Y+++   DH  D++C    V+S +EDC ++      +E   V 
Sbjct  66   NLNLLFSVEGVTDATGTYNIQVAEDHG-DQLCEAVLVRSSQEDCGKI---ESGRERANVV  121

Query  243  LTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGEN  118
            LT NNG+++D R  N + F+K +P+A CAE+ K+      EN
Sbjct  122  LTRNNGVLSDKRFANNMGFIKDQPLAGCAEILKQYQSEEYEN  163



>ref|XP_006652233.1| PREDICTED: pollen-specific protein C13-like [Oryza brachyantha]
Length=166

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/173 (37%), Positives = 95/173 (55%), Gaps = 8/173 (5%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MA +++  +I  ++F V    ++G+   A     Y V G VYCD CRA F T V E + G
Sbjct  1    MASLRTIPVIFGILFYV----LAGSTATATDAPDYLVQGRVYCDTCRAGFETNVTEYIKG  56

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKV+LEC +     +  +++G TD+ G Y +E +  H+ED IC V  VKSP  +C EV  
Sbjct  57   AKVRLECKHYGTGNIERAVDGVTDETGTYKIELKDSHEED-ICEVVLVKSPLANCGEV--  113

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGEN  118
                ++  RV LT N G+  + R  NP+ +LK  P+ VC E+ K+      +N
Sbjct  114  -QAERDRARVLLTRNVGICDNLRFANPLGYLKDIPLPVCGELLKQFDLTDDDN  165



>ref|XP_008226528.1| PREDICTED: olee1-like protein [Prunus mume]
Length=163

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 90/155 (58%), Gaps = 5/155 (3%)
 Frame = -1

Query  603  AVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTT  424
            +++ LV  L    +   A  K+   V G VYCD CR +F TR++  + GA V LEC    
Sbjct  6    SIVALVVALSCFCSLAYATTKTNLFVEGRVYCDPCRVQFETRLSVPLEGAVVALECRGRE  65

Query  423  NEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVT  244
            N  + Y+L+G+TDKNG+Y L A+ D  E++IC V+ V SP+ +C+    D +  E  RV 
Sbjct  66   NGTLAYTLQGKTDKNGIYSLPADEDM-EEQICEVRTVSSPRANCN----DHFDFERARVL  120

Query  243  LTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKEL  139
            LT NNG+ +  R  NP+ F++   +  C EV KEL
Sbjct  121  LTHNNGVKSMARYANPLGFMQNASVTECEEVLKEL  155



>pir||S43242 allergen-like protein Syr v I isoform 1 - Syringa vulgaris
Length=145

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 83/143 (58%), Gaps = 4/143 (3%)
 Frame = -1

Query  555  PAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNG  376
            P     ++ + G VYCD CRA+F+T ++E +PGA ++L+C +  N K+T++  G T   G
Sbjct  4    PQPPIPQFHIQGQVYCDTCRARFITELSEFIPGASIRLQCKDRENGKITFTEIGYTRAEG  63

Query  375  MYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNP  196
            +Y +  EGDH ++E C +  + S +EDC E+  + WAK   +  L   NG    TR +NP
Sbjct  64   LYSMLVEGDH-KNEFCEITLISSGREDCDEIPVEGWAKPSLKFKLNTVNGT---TRTINP  119

Query  195  ILFLKTKPIAVCAEVFKELHYIP  127
            I F K + +  C +V+ +L   P
Sbjct  120  IGFFKKEALPKCTQVYNKLGMYP  142



>gb|ACG33223.1| pollen-specific protein C13 precursor [Zea mays]
Length=167

 Score =   110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 81/132 (61%), Gaps = 4/132 (3%)
 Frame = -1

Query  534  YKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAE  355
            Y + G VYCD CRA FVT V E + GAKV+LEC +    K+  S++G TD NG Y +E +
Sbjct  32   YVIQGRVYCDTCRAGFVTNVTEYIAGAKVRLECKHFGTGKLERSIDGVTDANGTYTIELK  91

Query  354  GDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTK  175
              H+ED IC V  V+SP++DC +V  D   ++   V LT N G+  + R  NP+ + K  
Sbjct  92   DSHEED-ICEVVLVESPRKDCDQVQAD---RDRAGVLLTRNVGISDNLRPANPLGYFKDV  147

Query  174  PIAVCAEVFKEL  139
            P+ +CA + K+L
Sbjct  148  PLPICASLLKQL  159



>ref|NP_001148343.1| LOC100281953 precursor [Zea mays]
 gb|ACG30892.1| pollen-specific protein C13 precursor [Zea mays]
Length=167

 Score =   110 bits (274),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 81/132 (61%), Gaps = 4/132 (3%)
 Frame = -1

Query  534  YKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAE  355
            Y + G VYCD CRA FVT V E + GAKV+LEC +    K+  S++G TD NG Y  E +
Sbjct  32   YVIQGRVYCDTCRAGFVTNVTEYIAGAKVRLECKHFGTGKLERSIDGVTDGNGTYTXELK  91

Query  354  GDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTK  175
              H+ED IC V  V+SP++DC +V  D   ++   V LT N G+  + R  NP+ +LK  
Sbjct  92   DSHEED-ICEVVLVESPRKDCDQVQAD---RDRAGVLLTRNVGISDNLRPANPLGYLKDV  147

Query  174  PIAVCAEVFKEL  139
            P+ +CA + K+L
Sbjct  148  PLPICASLLKQL  159



>emb|CAH66537.1| H0209H04.4 [Oryza sativa Indica Group]
 gb|AFI71825.1| pollen specific protein [Oryza sativa]
Length=165

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/173 (36%), Positives = 95/173 (55%), Gaps = 9/173 (5%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MA +++  +I  ++F V     +  + P      Y V G VYCD CRA F T V E + G
Sbjct  1    MASLRTIPVIFGILFYVLASTATATDAP-----DYVVQGRVYCDTCRAGFETNVTEYIKG  55

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKV+LEC +   +KV  +++G TD+ G Y +E +  H+ED IC V  V SP  +CSE+  
Sbjct  56   AKVRLECKHFGTDKVERAIDGVTDETGTYKIELKDSHEED-ICEVVLVHSPLANCSEIEA  114

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGEN  118
            +   ++  RV LT N G+  + R  NP+ +LK  P+ VC  + K+      +N
Sbjct  115  E---RDRARVLLTRNVGICDNLRLANPLGYLKDIPLPVCGALLKQFDLADDDN  164



>gb|EYU26327.1| hypothetical protein MIMGU_mgv1a015422mg [Erythranthe guttata]
Length=158

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 95/166 (57%), Gaps = 13/166 (8%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAK  +  LI+A+ FL ++  V G +        + V G VYCD CR +F T +A+R+ G
Sbjct  1    MAK--TVALISALCFLAAV--VHGHQT-----EHFNVEGDVYCDPCRVQFETVLAQRLIG  51

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            A V+LEC +   + VTYS+EG T  NG Y L   GDH ++EIC V  VKSP+ DC E + 
Sbjct  52   ATVRLECRDLVKKAVTYSVEGVTGFNGHYSLPVVGDH-QNEICEVAVVKSPRPDCIEPMG  110

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKEL  139
            D +AK  +R++ T N+G     R  NPI F+    +  C  V  +L
Sbjct  111  D-FAK--SRISCTTNDGTHAAVRFANPIGFMTGAAVPQCTPVLFDL  153



>sp|O82015.2|LIGV1_LIGVU RecName: Full=Major pollen allergen Lig v 1; AltName: Allergen=Lig 
v 1 [Ligustrum vulgare]
 emb|CAA54818.1| major allergen [Ligustrum vulgare]
Length=145

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 84/143 (59%), Gaps = 4/143 (3%)
 Frame = -1

Query  555  PAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNG  376
            P    S++ + G VYCD CRA+F+T ++E +PGA V+L+C +  N KVT++  G T   G
Sbjct  4    PQPPVSQFYIQGQVYCDTCRARFITELSEFIPGAGVRLQCKDGENGKVTFTEVGYTKAEG  63

Query  375  MYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNP  196
            +Y++  E DH ++E C +  + S ++DC E+  + W K   +  L   NG    TR +NP
Sbjct  64   LYNMLIERDH-KNEFCEITLISSSRKDCDEIPTEGWVKPSLKFVLNTVNG---TTRTINP  119

Query  195  ILFLKTKPIAVCAEVFKELHYIP  127
            + FLK + +  C +VF +L   P
Sbjct  120  LGFLKKEVLPKCPQVFNKLGMYP  142



>ref|NP_001052674.1| Os04g0398700 [Oryza sativa Japonica Group]
 emb|CAE05158.2| OSJNBa0039C07.14 [Oryza sativa Japonica Group]
 dbj|BAF14588.1| Os04g0398700 [Oryza sativa Japonica Group]
 gb|EAZ30594.1| hypothetical protein OsJ_14643 [Oryza sativa Japonica Group]
Length=165

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 95/173 (55%), Gaps = 9/173 (5%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MA +++  +I  ++F V     +  + P      Y V G VYCD CRA F T V E + G
Sbjct  1    MASLRTIPVIFGILFYVLASTATATDAP-----DYVVQGRVYCDTCRAGFETNVTEYIKG  55

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKV+LEC +   +KV  +++G TD+ G Y +E +  H+ED IC V  V SP  +CSE+  
Sbjct  56   AKVRLECKHFGTDKVERAIDGVTDETGTYKIELKDSHEED-ICEVVLVHSPLANCSEIEA  114

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGEN  118
            +   ++  RV LT N G+  + R  NP+ +LK  P+ +C  + K+      +N
Sbjct  115  E---RDRARVLLTRNVGICDNLRLANPLGYLKDIPLPICGALLKQFDLADDDN  164



>ref|XP_009334049.1| PREDICTED: olee1-like protein [Pyrus x bretschneideri]
Length=166

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 99/167 (59%), Gaps = 10/167 (6%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVS-MLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMP  460
            MAK   AL IAA+  ++S    ++ A + AA ++ + V G VYCD CR +F TR++  + 
Sbjct  1    MAK---ALGIAALFVILSCFYSLAYATRGAATRTLF-VEGKVYCDPCRVQFETRLSTPID  56

Query  459  GAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVI  280
            GA V LEC +  N  + Y +EG+TDKNG+Y L    +  E++IC V+ V+SP ++C+   
Sbjct  57   GATVALECRSRENGTIVYVVEGKTDKNGIYSLATHKEF-EEQICEVRTVRSPTDECA---  112

Query  279  KDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKEL  139
             D +  E  R+ LT NNG+    R  NP+ F+K +  + C  V KEL
Sbjct  113  -DHFDIERARILLTHNNGVNALARYANPLGFMKKESTSECEAVLKEL  158



>gb|AEW90946.1| pollen-specific protein F8-4 [Secale cereale x Triticum turgidum 
subsp. durum]
 gb|AEW90947.1| pollen-specific protein F8-5 [Secale cereale x Triticum turgidum 
subsp. durum]
Length=165

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 96/162 (59%), Gaps = 5/162 (3%)
 Frame = -1

Query  621  SALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKL  442
            ++L I +VI +V++  ++G    A     Y V G VYCD CRA F T V E + GAKV+L
Sbjct  2    ASLRILSVIAVVAIFALAGTAV-ANDLPDYIVQGRVYCDTCRAGFETNVTEYIKGAKVRL  60

Query  441  ECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAK  262
            EC     EKV  S++G TD+ G Y +E +  H ED IC +  V+SP  +C+E I+D+  +
Sbjct  61   ECKRFGTEKVERSIDGVTDETGTYKIELKDSHPED-ICEMVLVQSPLANCNE-IQDL--R  116

Query  261  EFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELH  136
            +   + L+ N G+  + R  NP+ +LK KP+ VC ++ K  +
Sbjct  117  DRAEIVLSRNVGISDNIRMANPLGYLKDKPLPVCPDLLKTFN  158



>ref|XP_009761932.1| PREDICTED: anther-specific protein LAT52-like [Nicotiana sylvestris]
Length=164

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 86/155 (55%), Gaps = 4/155 (3%)
 Frame = -1

Query  603  AVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTT  424
            A++ L ++  ++ A    A    + V G V+CD CR  F T ++E + GA V+L C +  
Sbjct  4    AIVLLSALCVLAIANFAVAEPEVFDVEGRVFCDTCRLGFATSLSEAIQGATVRLTCRDIE  63

Query  423  NEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVT  244
                TYS EG+TD  G Y L  EGDH E++IC V  V SP+EDC E++ ++      RV 
Sbjct  64   THNETYSTEGKTDMIGKYTLTVEGDH-ENDICEVTVVNSPREDCKEIVSELVKG---RVV  119

Query  243  LTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKEL  139
             + N G+    R  NP+ F K KP+  C E+ +E+
Sbjct  120  CSKNVGMHNAVRFTNPLFFQKDKPVPGCKELVEEM  154



>gb|ABP58635.1| major pollen allergen Ole e 1 [Olea europaea]
Length=140

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 80/138 (58%), Gaps = 4/138 (3%)
 Frame = -1

Query  540  SRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLE  361
            S++ + G VYCD CRA+F+T ++E +PGA V+L+C +  N  +T++  G T   G+Y + 
Sbjct  4    SQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCRDGENGSITFTEVGSTRAEGLYSML  63

Query  360  AEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLK  181
             E DH +DE C +  + S ++DC E+  + W K   +  L   NG    TR VNP+ F K
Sbjct  64   IERDH-KDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGT---TRTVNPLGFFK  119

Query  180  TKPIAVCAEVFKELHYIP  127
             + +  C +VF +L   P
Sbjct  120  KEALPKCPQVFNKLGMYP  137



>ref|NP_001105351.1| pollen-specific protein C13 precursor [Zea mays]
 sp|P33050.1|PSC13_MAIZE RecName: Full=Pollen-specific protein C13; Flags: Precursor [Zea 
mays]
 gb|AAB23277.1| pollen specific protein [Zea mays]
 gb|AFW58125.1| male-gametophyte specific1 [Zea mays]
 prf||2209273A Zm13
Length=170

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 93/168 (55%), Gaps = 8/168 (5%)
 Frame = -1

Query  636  MAKVQS-ALLIAAVIF-LVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERM  463
            MA V + A   AAVI  L  +L  + A+ P      Y + G VYCD CRA FVT V E +
Sbjct  1    MASVPAPATTTAAVILCLCVVLSCAAADDP--NLPDYVIQGRVYCDTCRAGFVTNVTEYI  58

Query  462  PGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEV  283
             GAKV+LEC +    K+  +++G TD  G Y +E +  H+ED IC V  V SP++DC EV
Sbjct  59   AGAKVRLECKHFGTGKLERAIDGVTDATGTYTIELKDSHEED-ICQVVLVASPRKDCDEV  117

Query  282  IKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKEL  139
                  ++   V LT N G+    R  NP+ + K  P+ VCA + K+L
Sbjct  118  ---QALRDRAGVLLTRNVGISDSLRPANPLGYFKDVPLPVCAALLKQL  162



>gb|EAY93952.1| hypothetical protein OsI_15725 [Oryza sativa Indica Group]
Length=165

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 93/166 (56%), Gaps = 9/166 (5%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MA +++  +I  ++F V     +  + P      Y V G VYCD CRA F T V E + G
Sbjct  1    MASLRTIPVIFGILFYVLASTATATDAP-----DYVVQGRVYCDTCRAGFETNVTEYIKG  55

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKV+LEC +   +KV  +++G TD+ G Y +E +  H+ED IC V  V SP  +CSE+  
Sbjct  56   AKVRLECKHFGTDKVERAIDGVTDETGTYKIELKDSHEED-ICEVVLVHSPLANCSEIEA  114

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKEL  139
            +   ++  RV LT N G+  + R  NP+ +LK  P+ VC  + K+ 
Sbjct  115  E---RDRARVLLTRNVGICDNLRLANPLGYLKDIPLPVCGALLKQF  157



>gb|AAN76546.1|AF393475_1 LLP-B3 protein [Lilium longiflorum]
Length=160

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 79/130 (61%), Gaps = 4/130 (3%)
 Frame = -1

Query  534  YKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAE  355
            + V G VYCD CRA F T +   + GAKVKLEC +  N+ + +++EG T+  G Y ++ E
Sbjct  28   FIVEGRVYCDSCRAGFETNITTYIEGAKVKLECRHFDNDSIAHTVEGVTNSTGTYSIQLE  87

Query  354  GDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTK  175
             DH E EIC V  V SP  DC+E+  D   ++  RVTLT NNG+ +  R  N + FL+ +
Sbjct  88   NDH-ESEICEVVLVSSPIFDCNEIDYD---RDRARVTLTNNNGIDSPIRYANSLGFLQEQ  143

Query  174  PIAVCAEVFK  145
            P  +C ++ K
Sbjct  144  PDIICGDLLK  153



>ref|XP_003581152.1| PREDICTED: pollen-specific protein C13-like [Brachypodium distachyon]
Length=171

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 90/161 (56%), Gaps = 5/161 (3%)
 Frame = -1

Query  621  SALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKL  442
            S  +++AV   V M G++G    A     Y V G VYCD CRA F T V   + GAKV+L
Sbjct  3    SLRILSAVALAVIMAGLAGTSD-AVDLPDYIVQGRVYCDTCRAGFETNVTTYIKGAKVRL  61

Query  441  ECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAK  262
            EC     EKV  +L+G TD+ G Y +E +  H ED IC V  ++SP  DC+++      +
Sbjct  62   ECKRFGTEKVERALDGVTDETGTYKIELKDSHPED-ICEVVLIQSPLADCNKI---QALR  117

Query  261  EFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKEL  139
            +  RV LT N G+  + R  N + +LK  P+ VCA++ K+ 
Sbjct  118  DRARVELTRNIGISDNLRLANSLGYLKDVPLPVCAQLLKQF  158



>ref|XP_010317514.1| PREDICTED: olee1-like protein [Solanum lycopersicum]
Length=119

 Score =   106 bits (264),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 75/111 (68%), Gaps = 1/111 (1%)
 Frame = -1

Query  459  GAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVI  280
            GA+V+L+C N T + +T +++G+TD++G Y L  E DH ED+IC +   KSP +DC+E+ 
Sbjct  4    GAEVQLQCKNQTTDAITATVDGKTDEHGFYELLVEHDH-EDDICEMMLKKSPMDDCTEIP  62

Query  279  KDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
             +  A+E  R+T+T NNG+V  TR  NP+ FLK +    C EVFKEL  +P
Sbjct  63   HERNAQESARITITNNNGIVDTTRHANPLFFLKKEASPECDEVFKELELLP  113



>pir||B53806 major allergen OLE5c - common olive
Length=145

 Score =   107 bits (266),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 81/143 (57%), Gaps = 4/143 (3%)
 Frame = -1

Query  555  PAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNG  376
            P    S++ + G VYCD CRA+F+T ++E +PGA V+L+C +  N  +T++  G T   G
Sbjct  4    PQPPVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTRAEG  63

Query  375  MYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNP  196
            +Y +  E DH +DE C +  + S ++DC E+  + W K   +  L   NG    TR +NP
Sbjct  64   LYSMLIERDH-KDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGT---TRTINP  119

Query  195  ILFLKTKPIAVCAEVFKELHYIP  127
            + F K + +  C +VF +L   P
Sbjct  120  LGFFKKEALPKCPQVFNKLGMYP  142



>emb|CAA73037.1| Ole e 1.0103 protein [Olea europaea]
Length=146

 Score =   107 bits (266),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 84/143 (59%), Gaps = 4/143 (3%)
 Frame = -1

Query  555  PAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNG  376
            P    S++ + G VYCD CRA F+T ++E +PGA V+L+C +  N  VT++  G T   G
Sbjct  5    PQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTRAEG  64

Query  375  MYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNP  196
            +Y +  E DH ++E C +  + S ++DC+E+  + WAK   +  L+  NG    TR VNP
Sbjct  65   LYSMLVERDH-KNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGT---TRTVNP  120

Query  195  ILFLKTKPIAVCAEVFKELHYIP  127
            + F K + +  CA+V+ +L   P
Sbjct  121  LGFYKKEALPKCAQVYNKLGMYP  143



>ref|XP_007213539.1| hypothetical protein PRUPE_ppa019680mg [Prunus persica]
 gb|EMJ14738.1| hypothetical protein PRUPE_ppa019680mg [Prunus persica]
Length=163

 Score =   107 bits (267),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 83/138 (60%), Gaps = 5/138 (4%)
 Frame = -1

Query  552  AAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGM  373
            A  KS   V G VYCD CR +F TR++  + GA V LEC    N  + Y+L+G+TDKNG+
Sbjct  23   ATTKSNLFVEGRVYCDPCRVQFETRLSVPLEGAVVALECRGRENGTLAYTLQGKTDKNGI  82

Query  372  YHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPI  193
            Y L  + D  E++IC V+ V SP+ +C+E     +  E  RV LT NNG+ +  R  NP+
Sbjct  83   YSLPTDEDM-EEQICEVRTVSSPRANCNE----HFEFERARVLLTYNNGVKSMARYANPL  137

Query  192  LFLKTKPIAVCAEVFKEL  139
             F++ + +  C +V KEL
Sbjct  138  GFMQKESVTECEQVLKEL  155



>ref|XP_011101449.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=171

 Score =   107 bits (267),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 98/165 (59%), Gaps = 10/165 (6%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MA++  A+++A  + L+S+  ++ A++P     ++ V G V+C+VCRA F+ + ++ M G
Sbjct  1    MARL--AIVLAGALCLLSLAQLANAQEP-----QFIVKGRVFCEVCRANFINKFSKPMVG  53

Query  456  AKVKLECLNTTNEKVTYSLEGE-TDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVI  280
            A+VKLEC +  +  VTYSL G  T+  G Y L AEGDH E E C V  VKS + DC+E+ 
Sbjct  54   AEVKLECRDEESGMVTYSLTGGVTNDKGEYRLAAEGDH-EAEYCEVTLVKSSEPDCAEIP  112

Query  279  KDMWAK-EFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVF  148
             D   +     +TLTANNG     R  N + F K + +  C E++
Sbjct  113  VDGLGEIPAAEITLTANNGFHDTFRHANALFFTKKEAMPQCEELY  157



>emb|CAA73038.1| Ole e 1.0102 protein [Olea europaea]
Length=146

 Score =   106 bits (265),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 83/143 (58%), Gaps = 4/143 (3%)
 Frame = -1

Query  555  PAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNG  376
            P    S++ + G VYCD CRA F+T ++E +PGA V+L+C +  N  VT++  G T   G
Sbjct  5    PQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTRAEG  64

Query  375  MYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNP  196
            +Y +  E DH ++E C +  + S ++DC+E+  + WAK   +  L   NG    TR VNP
Sbjct  65   LYSMLVERDH-KNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILNTVNGT---TRTVNP  120

Query  195  ILFLKTKPIAVCAEVFKELHYIP  127
            + F K + +  CA+V+ +L   P
Sbjct  121  LRFYKKEALPKCAQVYNKLGMYP  143



>pir||S43244 allergen-like protein Syr v I isoform 3 - Syringa vulgaris
Length=145

 Score =   106 bits (265),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 82/143 (57%), Gaps = 4/143 (3%)
 Frame = -1

Query  555  PAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNG  376
            P     ++ + G VYCD CRA+F+T ++E +PGA ++L+C +  N K+T++  G T   G
Sbjct  4    PQPPVPQFHIQGQVYCDTCRARFITELSEFIPGASIRLQCKDGENGKITFTEIGYTRAEG  63

Query  375  MYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNP  196
            +Y +  EGDH ++E C +  + S ++DC E+  + W K   +  L   NG    TR +NP
Sbjct  64   LYSMLVEGDH-KNEFCEITLISSGRKDCDEIPVEGWVKPSLKFKLNTVNGT---TRTINP  119

Query  195  ILFLKTKPIAVCAEVFKELHYIP  127
            I F K + +  C +V+ +L   P
Sbjct  120  IGFFKKEALPKCTQVYNKLGMYP  142



>ref|XP_010269200.1| PREDICTED: pollen-specific protein C13-like [Nelumbo nucifera]
Length=159

 Score =   107 bits (266),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 82/143 (57%), Gaps = 6/143 (4%)
 Frame = -1

Query  564  AEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETD  385
            A +PA  ++ + V G VYCD CRA F T     +PGAKV++EC +     + +S++G TD
Sbjct  19   AARPA--RNPFTVFGKVYCDNCRAGFETSATTYIPGAKVRVECRDRDTLNLLFSVDGVTD  76

Query  384  KNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRK  205
              G Y ++   DH ED++C    V SP+ DCS V      +E  RV LT  NG+ +D R 
Sbjct  77   STGSYKIQVAEDH-EDQLCESVLVSSPQNDCSAV---EPGRERARVILTRGNGIASDNRY  132

Query  204  VNPILFLKTKPIAVCAEVFKELH  136
             N + F+K +P+  CAE+ K+  
Sbjct  133  ANSLGFIKDQPLPGCAEIMKQYQ  155



>ref|XP_009598969.1| PREDICTED: anther-specific protein LAT52-like [Nicotiana tomentosiformis]
Length=164

 Score =   107 bits (266),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 85/155 (55%), Gaps = 4/155 (3%)
 Frame = -1

Query  603  AVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTT  424
            A++ L ++  ++ A    A    + V G V+CD CR  F T ++E + GA V L C +  
Sbjct  4    AIVLLSALCFLAIANFAVAEPEVFDVEGRVFCDTCRLGFATSLSEVIQGATVGLTCRDIE  63

Query  423  NEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVT  244
                TYS EG+TD  G Y L  EGDH E++IC V  V SP+EDC E++ ++      RV 
Sbjct  64   THNETYSTEGKTDMIGKYTLTVEGDH-ENDICEVTVVNSPREDCKEIVSELVKG---RVV  119

Query  243  LTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKEL  139
             + N G+    R  NP+ F K KP+  C E+ +E+
Sbjct  120  CSKNVGMHNAVRFTNPLFFQKDKPVPGCKELVEEM  154



>emb|CDP16229.1| unnamed protein product [Coffea canephora]
Length=161

 Score =   107 bits (266),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 89/164 (54%), Gaps = 5/164 (3%)
 Frame = -1

Query  609  IAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLN  430
            +A  + +VS L        A  +  + V G VYCD CR +F T +++ + GA+V+L+C  
Sbjct  1    MAKAVAVVSALCFLALASLAHAQEAFTVKGRVYCDPCRVEFQTSLSKSIEGAEVELQCRV  60

Query  429  TTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTR  250
              N  VT S +  TD NG Y L A+GDH E+EIC V  V SP ++C+      +A+   R
Sbjct  61   RENGTVTVSQKATTDANGNYELSAQGDH-EEEICEVVSVSSPSQECNV----PFAENKAR  115

Query  249  VTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGEN  118
            V LT NNG+    R  N + +  TK    C  + +E+ YIP EN
Sbjct  116  VLLTQNNGVQGTDRYANALGYKTTKTNPDCKAILQEMGYIPDEN  159



>sp|P19963.2|ALL1_OLEEU RecName: Full=Major pollen allergen Ole e 1; AltName: Full=Allergen 
Ole e I; AltName: Allergen=Ole e 1 [Olea europaea]
Length=145

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 83/143 (58%), Gaps = 4/143 (3%)
 Frame = -1

Query  555  PAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNG  376
            P    S++ + G VYCD CRA F+T ++E +PGA ++L+C +  N  VT++  G T   G
Sbjct  4    PQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEG  63

Query  375  MYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNP  196
            +Y +  E DH ++E C +  + S ++DC+E+  + WAK   +  L   NG    TR VNP
Sbjct  64   LYSMLVERDH-KNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGT---TRTVNP  119

Query  195  ILFLKTKPIAVCAEVFKELHYIP  127
            + F K + +  CA+V+ +L   P
Sbjct  120  LGFFKKEALPKCAQVYNKLGMYP  142



>ref|XP_006472638.1| PREDICTED: pollen-specific protein C13-like [Citrus sinensis]
Length=159

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 91/164 (55%), Gaps = 12/164 (7%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MA++   LLIA  +    +  V    KP      + V G VYCD C+A F T     + G
Sbjct  1    MARI--LLLIALCVLPALVSAVRPNPKP------FSVEGRVYCDTCQAGFETPATTYIAG  52

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKVK+EC +  + +V YS EG+TD  G Y +    DH +D++C    V SP+ DC  V  
Sbjct  53   AKVKVECKDRKSMQVVYSREGKTDSTGTYKILVSEDH-QDQLCDAVLVSSPQNDCKTVAP  111

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFK  145
                +E +RV LT+ NG+ ++TR  N + F+K +P++ CAEV +
Sbjct  112  ---GRERSRVILTSYNGISSETRYANSMGFMKAEPMSGCAEVLR  152



>gb|KDO80906.1| hypothetical protein CISIN_1g031458mg [Citrus sinensis]
Length=159

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 89/160 (56%), Gaps = 10/160 (6%)
 Frame = -1

Query  624  QSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVK  445
            ++ LLIA  +    +  V    KP      + V G VYCD C+A F T     + GAKVK
Sbjct  3    RTLLLIALCVLPALVSAVRPNPKP------FSVEGRVYCDTCQAGFETPATTYIAGAKVK  56

Query  444  LECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWA  265
            +EC +  + +V YS EG+TD  G Y +    DH +D++C    V SP+ DC  V      
Sbjct  57   VECKDRKSMQVVYSREGKTDSTGTYKILVSEDH-QDQLCDAVLVSSPQNDCKTVAP---G  112

Query  264  KEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFK  145
            +E +RV LT+ NG+ ++TR  N + F+K +P++ CAEV +
Sbjct  113  RERSRVILTSYNGISSETRYANSMGFMKAEPMSGCAEVLR  152



>gb|EYU45018.1| hypothetical protein MIMGU_mgv1a015317mg [Erythranthe guttata]
Length=161

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 82/135 (61%), Gaps = 4/135 (3%)
 Frame = -1

Query  543  KSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHL  364
            ++ + + G VYCD CR +F T +++R+PGA V+LEC N   + VTYS+EG T+ +G Y L
Sbjct  27   RNVFNIEGDVYCDPCRVQFHTELSKRIPGATVRLECQNEETKAVTYSVEGLTNADGHYSL  86

Query  363  EAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFL  184
              +GDH++D +C VK +KSP  +CSE + D+     +R+  T N G+ +  R  NPI F+
Sbjct  87   RVDGDHEKD-VCVVKAIKSPIAECSEPMTDVRE---SRIVCTNNIGMHSAVRFANPIGFM  142

Query  183  KTKPIAVCAEVFKEL  139
                   C  V ++ 
Sbjct  143  TKVGSPQCIPVLQDF  157



>emb|CAA73036.1| Ole e 1 protein [Olea europaea]
Length=146

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 82/143 (57%), Gaps = 4/143 (3%)
 Frame = -1

Query  555  PAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNG  376
            P    S++ + G VYCD CR++F+T ++E +PGA V+L+C    N  +T++  G T   G
Sbjct  5    PQPPVSQFHIQGQVYCDTCRSRFITELSEFIPGASVRLQCREKENGDITFTEIGYTRAEG  64

Query  375  MYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNP  196
            +Y +  E DH ++E C +  + S ++DC E+  + WAK   +  L   NG    TR VNP
Sbjct  65   LYSMLVERDH-KNEFCEITLISSGRKDCDEIPIEGWAKPSLKFILNTVNG---TTRTVNP  120

Query  195  ILFLKTKPIAVCAEVFKELHYIP  127
            + F K + +  CA+V+ +L   P
Sbjct  121  LGFFKKEALPKCAQVYNKLGMYP  143



>emb|CAA54819.1| major allergen [Ligustrum vulgare]
Length=145

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 82/143 (57%), Gaps = 4/143 (3%)
 Frame = -1

Query  555  PAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNG  376
            P    S++ + G VYCD CRA+F+T ++E +PGA V+L+C +  N K+T++  G T   G
Sbjct  4    PQPPVSQFYIQGQVYCDTCRARFITELSEFIPGAGVRLQCKDGENGKITFTEVGYTRAEG  63

Query  375  MYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNP  196
            +Y +  E DH ++E C +  + S ++DC E+  + W K   +  L   NG    TR +NP
Sbjct  64   LYSMLIERDH-KNEFCEITLLSSSRKDCDEIPIEGWVKPSLKFMLNTVNG---TTRTINP  119

Query  195  ILFLKTKPIAVCAEVFKELHYIP  127
            + F K + +  C +VF +L   P
Sbjct  120  LGFFKKEALPKCPQVFNKLGMYP  142



>ref|XP_006434027.1| hypothetical protein CICLE_v10002743mg [Citrus clementina]
 gb|ESR47267.1| hypothetical protein CICLE_v10002743mg [Citrus clementina]
Length=159

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 89/160 (56%), Gaps = 10/160 (6%)
 Frame = -1

Query  624  QSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVK  445
            ++ LLIA  +    +  V    KP      + V G VYCD C+A F T     + GAKVK
Sbjct  3    RTLLLIALCVLPALVSAVRPNTKP------FSVEGRVYCDTCQAGFETPATTYIAGAKVK  56

Query  444  LECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWA  265
            +EC +  + +V YS EG+TD  G Y +    DH +D++C    + SP+ DC  V      
Sbjct  57   VECKDRKSMQVVYSREGKTDSTGTYKILVSEDH-QDQLCDAVLISSPQNDCKTVAP---G  112

Query  264  KEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFK  145
            +E +RV LT+ NG+ ++TR  N + F+K +P++ CAEV +
Sbjct  113  RERSRVILTSYNGISSETRYANSMGFMKAEPMSGCAEVLR  152



>gb|ABP58633.1| major pollen allergen Ole e 1 [Olea europaea]
Length=140

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 81/138 (59%), Gaps = 4/138 (3%)
 Frame = -1

Query  540  SRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLE  361
            S++ + G VYCD CRA F+T ++E +PGA V+L+C    N  +T++  G T   G+Y + 
Sbjct  4    SQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCREKKNGDITFTEVGYTRAEGLYSML  63

Query  360  AEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLK  181
             E DH ++E C +  + S ++DC+E+  + WAK   +  L   NG    TR +NP+ F K
Sbjct  64   VERDH-KNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILNTVNG---TTRTINPLGFYK  119

Query  180  TKPIAVCAEVFKELHYIP  127
             + +  CA+V+ +L   P
Sbjct  120  KEALPKCAQVYNKLDMYP  137



>ref|XP_011098227.1| PREDICTED: anther-specific protein LAT52-like [Sesamum indicum]
Length=163

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 89/159 (56%), Gaps = 6/159 (4%)
 Frame = -1

Query  609  IAAVIFLVSMLGVSGAEKPA--AGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLEC  436
            +A  + LVS L +         A K ++ V G VYCD CR +F T ++  + GA V++EC
Sbjct  1    MAKAVALVSALCILAVSVVVVHAHKEKFYVEGDVYCDPCRVQFETELSYHIAGAMVRVEC  60

Query  435  LNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEF  256
             +   +K+T+S+EG T  +G Y +   GDH++D IC V P +SPK +CSE + D    E 
Sbjct  61   RDIETKKITFSMEGVTGSDGHYSIMVTGDHEKD-ICEVIPTRSPKNECSEPMGDY---ER  116

Query  255  TRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKEL  139
             +V  T N+GL    R  NP+ F+  K +  CA +  +L
Sbjct  117  AKVECTENSGLHNTIRYANPVGFMTPKVLPECAPILADL  155



>gb|ABP58636.1| major pollen allergen Ole e 1 [Olea europaea]
Length=140

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 81/138 (59%), Gaps = 4/138 (3%)
 Frame = -1

Query  540  SRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLE  361
            S++ + G VYCD CRA F+T ++E +PGA V+L+C    N  +T++  G T   G+Y + 
Sbjct  4    SQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCREKKNGDITFTEVGYTRAEGLYSML  63

Query  360  AEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLK  181
             E DH ++E C +  + S ++DC+E+  + WAK   +  L   NG    TR +NP+ F K
Sbjct  64   VERDH-KNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILNTVNG---TTRTINPLGFYK  119

Query  180  TKPIAVCAEVFKELHYIP  127
             + +  CA+V+ +L   P
Sbjct  120  KEALPKCAQVYNKLGMYP  137



>ref|XP_008359333.1| PREDICTED: olee1-like protein [Malus domestica]
Length=166

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 88/166 (53%), Gaps = 8/166 (5%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAK      IAA+   +S           A      V G VYCD CR +F TR++  + G
Sbjct  1    MAKASG---IAALFVTLSCFYSLAYATTGADIETLFVEGKVYCDPCRVQFETRLSTPLDG  57

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            A V LEC +  N  + Y+LEG+TDKNG+Y L A+ +  E++IC V+ V SP  DC+    
Sbjct  58   ATVALECRSRENGTMVYTLEGKTDKNGIYSLPADKNF-EEQICEVRTVSSPTGDCA----  112

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKEL  139
            D +  E  R+ LT NNG+    R  NP+ F+K +    C  V KEL
Sbjct  113  DHFDIEKARILLTHNNGVKAMARYANPLGFMKKESTTECEAVLKEL  158



>gb|ABP58632.1| major pollen allergen Ole e 1 [Olea europaea]
Length=140

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 81/138 (59%), Gaps = 4/138 (3%)
 Frame = -1

Query  540  SRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLE  361
            S++ + G +YCD CR++F+T ++E +PGA V+L+C    N  +T++  G T   G+Y + 
Sbjct  4    SQFHIQGQIYCDTCRSRFITELSEFIPGASVRLQCREKENGDITFTEIGYTRAEGLYSML  63

Query  360  AEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLK  181
             E DH ++E C +  + S ++DC E+  + WAK   +  L   NG    TR VNP+ F K
Sbjct  64   VERDH-KNEFCEITLISSGRKDCDEIPIEGWAKPSLKFILNTVNG---TTRTVNPLGFFK  119

Query  180  TKPIAVCAEVFKELHYIP  127
             + +  CA+V+ +L   P
Sbjct  120  KEALPKCAQVYNKLGMYP  137



>ref|XP_002268073.1| PREDICTED: pollen-specific protein C13 [Vitis vinifera]
 emb|CBI33037.3| unnamed protein product [Vitis vinifera]
Length=159

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 93/167 (56%), Gaps = 12/167 (7%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAK+   + IA  + LV +       KP      + + G VYCD CRA F T     + G
Sbjct  1    MAKL--LMSIALCLLLVYVSEARPMRKP------FVLHGRVYCDTCRAGFETSATTYIAG  52

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            A+V++EC +  + ++ YS+EG TD  G Y      DH  D++C    VKSP+ DC++V  
Sbjct  53   ARVRIECKDRNSLQLVYSVEGVTDSTGTYKFSIADDHG-DQMCDAVLVKSPQPDCAKVDA  111

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELH  136
                ++ +R++LT +NGLV+DTR  N + F+K +P + C ++ K+  
Sbjct  112  ---GRDRSRLSLTRSNGLVSDTRFANAMGFMKDEPASGCTQLLKQYQ  155



>gb|KHG13789.1| Anther-specific LAT52 [Gossypium arboreum]
Length=188

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 92/163 (56%), Gaps = 6/163 (4%)
 Frame = -1

Query  615  LLIAAVIFLVSMLGVSGAEKPAAGKS-RYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLE  439
             +IA + F +S+         AA ++  Y V G VYCD CR +F T+++E + GA VKLE
Sbjct  5    FIIALLCFTISVSSSLNYSYGAAEENMHYMVVGHVYCDTCRVEFETKLSEPISGAVVKLE  64

Query  438  CLNTTNEKVTY-SLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAK  262
            C N TNE +T+ S E   D +G YH+  EGD++E + C V  V+SP+ DCS+   + W K
Sbjct  65   CRNRTNEAITFQSSEIVADSHGDYHIIVEGDYEESD-CDVALVRSPRADCSDP-TEAWRK  122

Query  261  EFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHY  133
              +RV LT  +GL    R  N + F K   +  C  + KE+ Y
Sbjct  123  --SRVVLTTFDGLSNKLRFANNLGFKKDIALPQCTRILKEMGY  163



>gb|AEW90948.1| pollen-specific protein F8-6 [Secale cereale x Triticum turgidum 
subsp. durum]
Length=165

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 95/162 (59%), Gaps = 5/162 (3%)
 Frame = -1

Query  621  SALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKL  442
            ++L I +VI +V++  ++G    A     Y V G VYCD CRA F T V E + GAKV+L
Sbjct  2    ASLRILSVIAVVAIFALAGTAV-ANDLPDYIVQGRVYCDTCRAGFETNVTEYIKGAKVRL  60

Query  441  ECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAK  262
            EC     EKV  S++G TD+ G Y +E +  H ED IC +  V+SP  +C+E I+D+  +
Sbjct  61   ECKRFGTEKVECSIDGVTDETGTYKIELKDSHPED-ICEMVLVQSPLANCNE-IQDL--R  116

Query  261  EFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELH  136
            +   + L+   G+  + R  NP+ +LK KP+ VC ++ K  +
Sbjct  117  DRAEIVLSRYVGISDNIRMANPLGYLKDKPLPVCPDLLKTFN  158



>gb|ABP58634.1| major pollen allergen Ole e 1 [Olea europaea]
Length=140

 Score =   104 bits (259),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 81/138 (59%), Gaps = 4/138 (3%)
 Frame = -1

Query  540  SRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLE  361
            S++ + G VYCD CRA F+T ++E +PGA ++L+C +  N  VT++  G T   G+Y + 
Sbjct  4    SQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSML  63

Query  360  AEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLK  181
             E DH ++E C +  + S ++DC+E+  + W K   +  L   NG    TR VNP+ F K
Sbjct  64   VERDH-KNEFCEITLISSGRKDCNEIPTEGWVKPSLKFILNTVNG---TTRTVNPLGFFK  119

Query  180  TKPIAVCAEVFKELHYIP  127
             + +  CA+V+ +L   P
Sbjct  120  KEALPKCAQVYNKLGMYP  137



>gb|KDP46869.1| hypothetical protein JCGZ_24078 [Jatropha curcas]
Length=159

 Score =   104 bits (260),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 55/158 (35%), Positives = 85/158 (54%), Gaps = 5/158 (3%)
 Frame = -1

Query  609  IAAVIFLVSMLGVSGAEKPAAGKSR-YKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECL  433
            +A  +FL   L +       +   R + V G VYCD CR  F T     +PGAKV++ECL
Sbjct  1    MAKWVFLFFALSLCAVPSLVSAHRRPFFVHGRVYCDTCRCGFETNKTTYIPGAKVRIECL  60

Query  432  NTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFT  253
            +  N ++ YS+EG+TD  G Y ++ + DH +D+ C    V SP+ +C         +   
Sbjct  61   DRVNSQLKYSIEGKTDSTGTYRIKVKDDH-QDQFCYAVLVSSPQANCKTADP---GRSRA  116

Query  252  RVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKEL  139
             V LT +NG V+D    N + + + +P++ CAE+ KEL
Sbjct  117  EVILTRSNGAVSDLHFANSMGYFRYQPMSGCAELVKEL  154



>ref|XP_002513885.1| Pollen-specific protein C13 precursor, putative [Ricinus communis]
 gb|EEF48468.1| Pollen-specific protein C13 precursor, putative [Ricinus communis]
Length=159

 Score =   104 bits (260),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 92/161 (57%), Gaps = 9/161 (6%)
 Frame = -1

Query  618  ALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLE  439
            A+L+ A+  L +++    A +PA  ++ ++V G VYCD CRA F T     + GAKV++E
Sbjct  4    AILLLALCVLPALVA---AARPA--RNPFEVEGRVYCDTCRAGFETSKTTYVAGAKVRVE  58

Query  438  CLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKE  259
            C +    ++ YS EG TD  G Y +  + DH +D++C    V SP+ DC   +K    ++
Sbjct  59   CKDRKTMELVYSKEGTTDSTGTYRIHVDEDH-QDQLCDAMLVSSPQHDC---MKPSSGRD  114

Query  258  FTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELH  136
              RV LT NNG+V++ R  N I F+K   ++ C E+ ++  
Sbjct  115  RARVILTNNNGIVSNKRYANSIGFMKEDAMSGCFELLRQYQ  155



>pir||C53806 major allergen OLE1c - common olive (fragment)
Length=145

 Score =   104 bits (259),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 80/143 (56%), Gaps = 4/143 (3%)
 Frame = -1

Query  555  PAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNG  376
            P    S++ V G VYCD CR +F+T  +E +PGA V+L+C +  N K+T++  G T   G
Sbjct  4    PQPPISQFYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTRAEG  63

Query  375  MYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNP  196
            +Y +  E DH ++E C +  + S ++DC E+  + W K   +  L   NG    TR +NP
Sbjct  64   LYSMLIERDH-KNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGT---TRTINP  119

Query  195  ILFLKTKPIAVCAEVFKELHYIP  127
            + F K + +  C +VF +L   P
Sbjct  120  LGFFKKEALPKCPQVFNKLGMYP  142



>gb|AEK85661.1| major pollen allergen Ole e1 [Olea europaea]
Length=140

 Score =   103 bits (258),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 81/138 (59%), Gaps = 4/138 (3%)
 Frame = -1

Query  540  SRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLE  361
            S++ + G VYCD CRA F+T ++E +PGA ++L+C +  N  VT++  G T   G+Y + 
Sbjct  4    SQFHIQGLVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSML  63

Query  360  AEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLK  181
             E DH ++E C +  + S ++DC+E+  + W K   +  L   NG    TR VNP+ F K
Sbjct  64   VERDH-KNEFCEITLISSGRKDCNEIPTEGWVKPSLKFILNTLNG---TTRTVNPLGFFK  119

Query  180  TKPIAVCAEVFKELHYIP  127
             + +  CA+V+ +L   P
Sbjct  120  KEALPKCAQVYNKLGMYP  137



>pir||S43243 allergen-like protein Syr v I isoform 2 - Syringa vulgaris
Length=145

 Score =   103 bits (258),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 82/143 (57%), Gaps = 4/143 (3%)
 Frame = -1

Query  555  PAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNG  376
            P     ++ + G VYCD CRA+F+T ++E +PGA ++L+C +  + K+T++  G T   G
Sbjct  4    PQPPVPQFHIQGQVYCDTCRARFITELSEFIPGAGIRLQCKDGEHGKITFTEIGYTRAEG  63

Query  375  MYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNP  196
            +Y +  EGDH ++E C +  + S ++DC E+  + W K   +  L   NG    TR +NP
Sbjct  64   LYSMLVEGDH-KNEFCEITLLSSSRKDCEEIPIEGWVKPSLKFILNTVNG---TTRTINP  119

Query  195  ILFLKTKPIAVCAEVFKELHYIP  127
            + F K + +  C +VF +L   P
Sbjct  120  LGFFKKEVLPKCPQVFNKLGMYP  142



>ref|XP_009342278.1| PREDICTED: olee1-like protein [Pyrus x bretschneideri]
Length=166

 Score =   104 bits (260),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 97/167 (58%), Gaps = 10/167 (6%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVS-MLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMP  460
            MAK   AL IAA+   +S    ++ A + AA ++ + V G VYCD CR +F TR++  + 
Sbjct  1    MAK---ALGIAALFVTLSCFYSLAYATRGAATRTLF-VEGKVYCDPCRVQFETRLSTPID  56

Query  459  GAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVI  280
            GA V LEC +  N  + Y +EG+TDKNG+Y L    +  E++IC V+ V+S  ++C+   
Sbjct  57   GATVALECRSRENGTIVYVVEGKTDKNGIYSLATHKEF-EEQICEVRTVRSSTDECA---  112

Query  279  KDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKEL  139
             D +  E  R+ LT NNG+    R  NP+ F+K +  + C  V KEL
Sbjct  113  -DHFDIERARILLTHNNGVNALARYANPLGFMKKESTSECEAVLKEL  158



>ref|XP_011016068.1| PREDICTED: pollen-specific protein C13-like [Populus euphratica]
 ref|XP_011027685.1| PREDICTED: pollen-specific protein C13 isoform X1 [Populus euphratica]
 ref|XP_011027686.1| PREDICTED: pollen-specific protein C13 isoform X2 [Populus euphratica]
Length=159

 Score =   104 bits (259),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 86/155 (55%), Gaps = 6/155 (4%)
 Frame = -1

Query  603  AVIFLVSMLGVSGAEKPAA--GKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLN  430
            A +FL+  L V  A   AA  G++ + V G VYCD C A F T     + G+KVK+EC +
Sbjct  2    ARVFLLLALCVLPALVSAARPGRNPFSVQGRVYCDTCHAGFETPKTTYIAGSKVKVECRD  61

Query  429  TTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTR  250
               + + YS EG TD  G Y +  + DH +D+IC    V SP++DCS        +E  R
Sbjct  62   RKTQDLVYSKEGTTDSTGTYIITVDEDH-KDQICDAMLVSSPRQDCSS---PSAGRERAR  117

Query  249  VTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFK  145
            V LT  NGLV+ TR  N + F+  +P++ C E+ +
Sbjct  118  VILTNYNGLVSTTRYANSMGFMAAQPMSGCTELLR  152



>ref|XP_009340070.1| PREDICTED: olee1-like protein [Pyrus x bretschneideri]
Length=166

 Score =   104 bits (260),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 77/130 (59%), Gaps = 5/130 (4%)
 Frame = -1

Query  528  VTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGD  349
            V G VYCD CR +F TR++  + GA V LEC +  N  + Y LEG+TDKNG+Y L A+ +
Sbjct  34   VEGKVYCDPCRVQFETRLSTPLDGATVALECRSRENGTMVYRLEGKTDKNGIYSLPADKN  93

Query  348  HDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPI  169
              E++IC V+ V SP  DC+    D +  E  R+ LT NNG+    R  NP+ F+K +  
Sbjct  94   F-EEQICEVRTVSSPTGDCA----DHFDIEKARILLTHNNGVKAMARYANPLGFMKKEST  148

Query  168  AVCAEVFKEL  139
              C  V KEL
Sbjct  149  PECEAVLKEL  158



>ref|NP_001131377.1| uncharacterized protein LOC100192702 precursor [Zea mays]
 gb|ACF79764.1| unknown [Zea mays]
 gb|AFW82076.1| hypothetical protein ZEAMMB73_949741 [Zea mays]
Length=164

 Score =   104 bits (259),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 90/150 (60%), Gaps = 6/150 (4%)
 Frame = -1

Query  591  LVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKV  412
            LV+++ V+ A   A G   + VTG +YCD CRA F T V+  + GA V++EC +  +++V
Sbjct  8    LVALVLVATAIAAAPGVG-FVVTGRIYCDNCRAGFETNVSHAIQGATVEMECRHFESQQV  66

Query  411  TYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTAN  232
                E  T   G Y +E  GDH +DEIC V+ +KSP+ DC+E+     +++  RV LT N
Sbjct  67   HDKAEATTGPGGWYRMEISGDH-QDEICDVRLLKSPEADCAEIDH---SRDRCRVPLTRN  122

Query  231  NGL-VTDTRKVNPILFLKTKPIAVCAEVFK  145
            +G+  +  R  NPI FL+ +P+  C E+ +
Sbjct  123  DGIKQSGVRYANPIAFLRKEPLPNCGELLR  152



>ref|XP_008775180.1| PREDICTED: pollen-specific protein C13-like [Phoenix dactylifera]
Length=168

 Score =   104 bits (259),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 90/157 (57%), Gaps = 8/157 (5%)
 Frame = -1

Query  612  LIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECL  433
            ++AA+  + ++LG++           + V G VYCD CRA FV    E + GAKV+LEC 
Sbjct  8    VLAALCLISALLGIADTTPTPT----FHVRGRVYCDTCRAGFVHEYTEYLEGAKVRLECK  63

Query  432  NTTNEKVTY-SLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEF  256
            +  + ++ + S E  TD NG Y ++   DH E E C V  V+SP++DC E+  D   +  
Sbjct  64   HYGSGEIAHRSEEAVTDGNGNYVIDITDDHQE-ETCEVVLVESPRDDCKEIPADHGIR--  120

Query  255  TRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFK  145
             RV LT+NNG+ ++ R+ NPI FL+  P+  C  + +
Sbjct  121  ARVMLTSNNGISSEWREANPIGFLRDAPLPKCGAMLQ  157



>gb|AEK85663.1| major pollen allergen Ole e1 [Olea europaea]
Length=141

 Score =   103 bits (257),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 81/138 (59%), Gaps = 4/138 (3%)
 Frame = -1

Query  540  SRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLE  361
            S++ + G VYCD CRA F+T ++E +PGA ++L+C +  N  VT++  G T   G+Y + 
Sbjct  5    SQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSML  64

Query  360  AEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLK  181
             E DH ++E C + P+ S ++D +E+  + W K   +  L   NG    TR VNP+ F K
Sbjct  65   VERDH-KNEFCEITPISSGRKDRNEIPTEGWVKPSLKFILNTLNG---TTRTVNPLGFFK  120

Query  180  TKPIAVCAEVFKELHYIP  127
             + +  CA+V+ +L   P
Sbjct  121  KEALPKCAQVYNKLGMYP  138



>gb|AEK85660.1| major pollen allergen Ole e1 [Olea europaea]
Length=140

 Score =   103 bits (257),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 81/138 (59%), Gaps = 4/138 (3%)
 Frame = -1

Query  540  SRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLE  361
            S+Y + G VYCD CRA F+T ++E +PGA ++L+C +  +  VT++  G T   G+Y + 
Sbjct  4    SQYHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKEDGDVTFTEVGYTRAEGLYSML  63

Query  360  AEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLK  181
             E DH ++E C +  + S ++DC+E+  + W K   +  L   NG    TR VNP+ F K
Sbjct  64   VERDH-KNEFCEITLISSGRKDCNEIPTEGWVKPSLKFILNTLNG---TTRTVNPLGFFK  119

Query  180  TKPIAVCAEVFKELHYIP  127
             + +  CA+V+ +L   P
Sbjct  120  KEALPKCAQVYNKLGMYP  137



>ref|XP_009403224.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=160

 Score =   103 bits (258),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 79/132 (60%), Gaps = 4/132 (3%)
 Frame = -1

Query  537  RYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEA  358
            ++ + G VYCD CRA F T V++ +PGAKVKL+C +   + + ++  G TD  G Y++E 
Sbjct  26   KFVIQGRVYCDTCRAGFETVVSQYIPGAKVKLQCRHYETDSIEHTAVGVTDGTGTYNIEV  85

Query  357  EGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKT  178
            E +H E+EIC V  V+SP   CSEV      +   RV +T  NGL +D R  N + FLK 
Sbjct  86   EDNH-EEEICEVSLVQSPVPGCSEV---SGTRNRARVLVTGRNGLASDVRYANSLGFLKD  141

Query  177  KPIAVCAEVFKE  142
            +P+  C  + ++
Sbjct  142  EPLKECGLLLQQ  153



>ref|XP_003566418.1| PREDICTED: major pollen allergen Lol p 11-like [Brachypodium 
distachyon]
Length=169

 Score =   104 bits (259),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 82/143 (57%), Gaps = 10/143 (7%)
 Frame = -1

Query  570  SGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGE  391
             G  KP      + VTG VYCD CRA F T  +  +PGA V++EC +    ++ +  E  
Sbjct  24   QGYSKPG-----FLVTGRVYCDTCRAGFETNASHSIPGAVVQMECRHFETNELHHKAEAT  78

Query  390  TDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGL-VTD  214
            TD  G Y +E   DH E EIC V  ++SP++DC+E+ K   +++  RV LT NNG+  + 
Sbjct  79   TDAQGWYKMEVGEDHQE-EICEVALLRSPEKDCAEIEK---SRDRCRVPLTRNNGIKQSG  134

Query  213  TRKVNPILFLKTKPIAVCAEVFK  145
             R  NPI F + +P+A C +V +
Sbjct  135  VRYANPIAFFRKEPLANCGDVLR  157



>ref|NP_001150330.1| pollen allergen Phl p 11 precursor [Zea mays]
 gb|ACG38668.1| pollen allergen Phl p 11 [Zea mays]
Length=165

 Score =   103 bits (258),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 90/156 (58%), Gaps = 8/156 (5%)
 Frame = -1

Query  609  IAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLN  430
            + A+I + + +       P+ G   + VTG VYCD CRA F T V+  + GA V++EC +
Sbjct  5    LVALILVATAVAAVATAAPSPG---FVVTGRVYCDNCRAGFETNVSHAIEGATVEMECRH  61

Query  429  TTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTR  250
              +++V    E  TD  G Y +E  GDH +DEIC V  +KSP+ DC+E+ +    +E  R
Sbjct  62   FESQEVHDKAEATTDAGGWYRMEISGDH-QDEICEVLLLKSPEADCAEIER---TRERCR  117

Query  249  VTLTANNGL-VTDTRKVNPILFLKTKPIAVCAEVFK  145
            V LT N+G+  +  R  NPI F + +P++ C E+ +
Sbjct  118  VPLTRNDGIRQSGIRYANPIAFFRKEPLSNCGELLR  153



>ref|XP_010538956.1| PREDICTED: major pollen allergen Lol p 11 [Tarenaya hassleriana]
Length=159

 Score =   103 bits (258),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 95/162 (59%), Gaps = 9/162 (6%)
 Frame = -1

Query  621  SALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKL  442
            +++++ A++ L +++    A +P   ++ + V G VYCD CRA F T  +  +PGA VKL
Sbjct  3    NSIVLMAILLLPTLVM---AARP--NRNPFVVRGRVYCDTCRAGFETPASTYIPGAVVKL  57

Query  441  ECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAK  262
            EC +  + ++ YS E  TD  G Y +    DH ED++C +  VKSP+  CS+V      +
Sbjct  58   ECKDRRSMELVYSHEARTDSTGAYKIWVNEDH-EDQLCDIMLVKSPQLGCSKVSH---GR  113

Query  261  EFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELH  136
            E  RVTLT  NG+ +D R VN + F + + ++ C+E+ ++  
Sbjct  114  ERARVTLTRYNGIASDDRYVNNMGFERDEALSGCSEIMRQYQ  155



>ref|XP_010535648.1| PREDICTED: major pollen allergen Lol p 11-like [Tarenaya hassleriana]
Length=166

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 87/173 (50%), Gaps = 7/173 (4%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MA++   +L+A  +     +    A  P   ++   V G  YCD CRA F T  +  +PG
Sbjct  1    MARLAVVMLMALCVLPALAMA---ARLPKVNRNTMVVEGRTYCDPCRAGFETSASYFIPG  57

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            A VKLEC +    +V Y+ E  TD NG Y      DH +DE+C VK VKSP  +C  +  
Sbjct  58   ATVKLECKDRKTMEVMYTDEATTDNNGCYKFFVHDDH-KDEMCDVKLVKSPDTNCPRISP  116

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGEN  118
                +E +RV L   NG+ + TR  N + F K +P   CAE+ K+      EN
Sbjct  117  ---GREQSRVILNHYNGIASQTRYANNMGFEKEEPDVFCAELLKQYQEFDEEN  166



>ref|XP_002447728.1| hypothetical protein SORBIDRAFT_06g014740 [Sorghum bicolor]
 gb|EES12056.1| hypothetical protein SORBIDRAFT_06g014740 [Sorghum bicolor]
Length=173

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 77/132 (58%), Gaps = 4/132 (3%)
 Frame = -1

Query  534  YKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAE  355
            Y + G VYCD CRA FVT V E M GAKV+LEC +    +V  +++G TD  G Y +E +
Sbjct  38   YVIQGRVYCDTCRAGFVTNVTEYMAGAKVRLECKHFGTGEVERAIDGVTDATGTYTIELK  97

Query  354  GDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTK  175
              H+ED IC V  V+SP++DC +       ++   V LT N G+    R  NP+ + K  
Sbjct  98   DSHEED-ICQVVLVQSPRKDCDQT---QPLRDRAGVLLTRNVGIADSLRPANPLGYFKDV  153

Query  174  PIAVCAEVFKEL  139
            P+ VCA + K+L
Sbjct  154  PLPVCAALLKQL  165



>gb|AAQ83588.1| allergen Fra e 1 [Fraxinus excelsior]
Length=146

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 83/143 (58%), Gaps = 4/143 (3%)
 Frame = -1

Query  555  PAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNG  376
            P    S++ + G VYCD CRA+F+T+++E + GA V+L+C +  N  VT++  G T   G
Sbjct  5    PQPPVSQFHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYTRGEG  64

Query  375  MYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNP  196
            +Y +  E DH ++E C +  + S ++DC+E+  + W K   +  L   NG    TR +NP
Sbjct  65   LYSMFVERDH-KNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNG---TTRTINP  120

Query  195  ILFLKTKPIAVCAEVFKELHYIP  127
            + F K + +  CA+V+ +L   P
Sbjct  121  LGFFKKEALPQCAQVYNKLGMYP  143



>emb|CDP06002.1| unnamed protein product [Coffea canephora]
Length=161

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 87/164 (53%), Gaps = 5/164 (3%)
 Frame = -1

Query  609  IAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLN  430
            +A  + +VS L        A  +  + V G VYCD CR +F T +++ + GA+V+L+C  
Sbjct  1    MAKAVAVVSALCFLALASLAHAQEAFTVKGRVYCDPCRVEFQTSLSKNIEGAEVELQCRV  60

Query  429  TTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTR  250
              N  VT S +  TD NG Y L  +GDH E+EIC V  V SP  +C+    +  A    R
Sbjct  61   RENGTVTVSQKATTDANGNYELSVQGDH-EEEICEVASVSSPSLECNVPFGENKA----R  115

Query  249  VTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGEN  118
            + LT NNG+    R  NP+ +  T+    C  + +E+ YIP EN
Sbjct  116  ILLTQNNGVQGTDRFANPLGYKTTEANPDCKPILQEMGYIPDEN  159



>gb|AAN18042.1| major pollen allergen Ole e 1, partial [Olea europaea]
 gb|AAN18043.1| major pollen allergen Ole e 1, partial [Olea europaea]
 gb|AAN18044.1| major pollen allergen Ole e 1, partial [Olea europaea]
Length=132

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 78/132 (59%), Gaps = 4/132 (3%)
 Frame = -1

Query  522  GTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHD  343
            G VYCD CRA F+T ++E +PGA V+L+C +  N  +T++  G T   G+Y +  E DH 
Sbjct  2    GQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDITFTEVGYTRAEGLYSMLVERDH-  60

Query  342  EDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAV  163
            ++E C +  + S ++DC+E+  + WAK   +  L   NG    TR VNP+ F K + +  
Sbjct  61   KNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILNTVNG---TTRTVNPLGFFKKEALPK  117

Query  162  CAEVFKELHYIP  127
            CA+V+ +L   P
Sbjct  118  CAQVYNKLGMYP  129



>gb|ABK92993.1| unknown [Populus trichocarpa]
Length=159

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 90/167 (54%), Gaps = 12/167 (7%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MA+V   L +  +  LVS      A +P  G++ + V G VYCD C A F T     + G
Sbjct  1    MARVFMLLALCVLPALVS------AARP--GRNTFSVQGLVYCDTCLAGFETPKTTYIAG  52

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            +KVK+EC +   + + YS EG TD  G Y +  + DH +D+IC    V SP++DCS    
Sbjct  53   SKVKVECRDRKTQDLVYSKEGTTDSTGKYIITVDEDH-KDQICDAMLVSSPRKDCSS---  108

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELH  136
                ++  RV LT+ NGLV+ TR  N + F+  +P++ C E+ +   
Sbjct  109  PSAGRDRARVILTSYNGLVSTTRYANSMGFMAAQPMSGCTELLRSYQ  155



>ref|XP_008378536.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Malus domestica]
Length=218

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 88/155 (57%), Gaps = 6/155 (4%)
 Frame = -1

Query  600  VIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTN  421
            +I L  +  ++ A +P   ++ + V G VYCD CRA + T+    + GAKV+LEC + T+
Sbjct  66   LIALCMLPALAAATRPM--RTPFTVEGKVYCDTCRAGYETKAITYIAGAKVRLECRDKTS  123

Query  420  EKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTL  241
              + Y+ EG TD  G Y +    DH  D+ C    V SP++DC+ V      +E  RV L
Sbjct  124  MALLYTKEGTTDSAGCYKIPVAEDH-LDQFCDAVLVSSPQKDCATVSP---GRERARVIL  179

Query  240  TANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELH  136
            TANNG+ +  R  N + F++T+ ++ C ++ KEL 
Sbjct  180  TANNGIASYNRFANAMGFMRTEALSGCTQILKELQ  214



>gb|AEK85659.1| major pollen allergen Ole e1 [Olea europaea]
Length=140

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 80/138 (58%), Gaps = 4/138 (3%)
 Frame = -1

Query  540  SRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLE  361
            S++ + G VYCD CRA F+T ++E +PGA ++L+C +  N  VT++  G T   G+Y + 
Sbjct  4    SQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSML  63

Query  360  AEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLK  181
             E DH ++E C +  +   ++DC+E+  + W K   +  L   NG    TR VNP+ F K
Sbjct  64   VERDH-KNEFCEITLISDGRKDCNEIPTEGWVKPSLKFILNTLNG---TTRTVNPLGFFK  119

Query  180  TKPIAVCAEVFKELHYIP  127
             + +  CA+V+ +L   P
Sbjct  120  KEALPKCAQVYNKLGMYP  137



>pir||E53806 major allergen OLE17 - common olive (fragment)
Length=136

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 79/137 (58%), Gaps = 4/137 (3%)
 Frame = -1

Query  537  RYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEA  358
            ++ + G VYCD C A+F+T ++E +PGA V+L+C    N  +T++  G T   G+Y +  
Sbjct  1    QFHIQGQVYCDTCHARFITELSEFIPGASVRLQCREKENGDITFTEIGYTRAEGLYSMLV  60

Query  357  EGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKT  178
            E DH ++E C +  + S ++DC E+  + WAK   +  L   NG    TR VNP+ F K 
Sbjct  61   ERDH-KNEFCEITLISSGRKDCDEIPIEGWAKPSLKFILNTVNG---TTRTVNPLGFFKK  116

Query  177  KPIAVCAEVFKELHYIP  127
            + +  CA+V+ +L   P
Sbjct  117  EALPKCAQVYNKLGMYP  133



>gb|ABK94215.1| unknown [Populus trichocarpa]
Length=159

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 90/167 (54%), Gaps = 12/167 (7%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MA+V   L +  +  LVS      A +P  G++ + V G VYCD C A F T     + G
Sbjct  1    MARVFMLLALCVLPALVS------AARP--GRNPFSVQGIVYCDTCLAGFETPKTTYIAG  52

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            +KVK+EC +   + + YS EG TD  G Y +  + DH +D+IC    V SP++DCS    
Sbjct  53   SKVKVECRDRKTQDLVYSKEGTTDSTGKYIITVDEDH-KDQICDAMLVSSPRKDCSS---  108

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELH  136
                ++  RV LT+ NGLV+ TR  N + F+  +P++ C E+ +   
Sbjct  109  PSAGRDRARVILTSYNGLVSTTRYANSMGFMAAQPMSGCTELLRSYQ  155



>emb|CDO96791.1| unnamed protein product [Coffea canephora]
Length=121

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 78/124 (63%), Gaps = 7/124 (6%)
 Frame = -1

Query  582  MLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAK-VKLECLNT--TNEKV  412
            M  +S A+   A   ++KV G VYCD CRA+   R++E MPG   V LE L        +
Sbjct  1    MFFISIAQ---AANPQFKVEGEVYCDKCRAQLKNRLSEPMPGTNFVYLEPLAPFFHARHL  57

Query  411  TYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTAN  232
            TYSLEG+T+ + +Y LE EGDH EDEIC    VKS K DCSE+ K   A+  +R++LTAN
Sbjct  58   TYSLEGQTEASTIYSLEVEGDH-EDEICEDVLVKSNKPDCSEIPKQGLAQASSRISLTAN  116

Query  231  NGLV  220
            NG+V
Sbjct  117  NGIV  120



>ref|XP_002392460.1| hypothetical protein MPER_07958 [Moniliophthora perniciosa FA553]
 gb|EEB93390.1| hypothetical protein MPER_07958 [Moniliophthora perniciosa FA553]
Length=160

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 83/147 (56%), Gaps = 6/147 (4%)
 Frame = -1

Query  576  GVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLE  397
             ++ A +PA  ++   VTG VYCD CRA F T  +  + GAKVK+EC + T+ K+ YS E
Sbjct  16   AIAFAARPA--RNPLTVTGKVYCDTCRAGFETPASTYIAGAKVKVECKDRTSMKLLYSQE  73

Query  396  GETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVT  217
              TD  G Y L    DH +D++C    + SP+ +C    K    ++  RV LT  NG+V+
Sbjct  74   ATTDSTGTYKLFVSEDH-QDQLCDAMLLSSPQPNCQ---KPAAGRDRARVILTRYNGIVS  129

Query  216  DTRKVNPILFLKTKPIAVCAEVFKELH  136
            DTR  N + F   +P+A C +V ++  
Sbjct  130  DTRYANNMGFEMDQPLAGCTQVLQQYQ  156



>gb|AAQ07442.1| major pollen allergen Ole e 1 [Olea europaea]
 gb|AAQ08186.1| major pollen allergen Ole e 1 [Olea europaea]
 gb|AAQ08187.1| major pollen allergen Ole e 1, partial [Olea europaea]
 gb|AAQ08189.1| major pollen allergen Ole e 1, partial [Olea europaea]
 gb|AAQ08190.1| major pollen allergen Ole e 1, partial [Olea europaea]
Length=132

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 78/131 (60%), Gaps = 4/131 (3%)
 Frame = -1

Query  519  TVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDE  340
            TVYCD CRA F+T ++E +PGA V+L+C +  N  +T++  G T   G+Y +  E DH +
Sbjct  3    TVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDITFTEVGYTRAEGLYSMLVERDH-K  61

Query  339  DEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVC  160
            +E C +  + S ++DC+E+  + WAK   +  L   NG    TR VNP+ F K + +  C
Sbjct  62   NEFCEITLISSGRKDCNEIPTEGWAKPSLKFILNTVNG---TTRTVNPLGFFKKEALPKC  118

Query  159  AEVFKELHYIP  127
            A+V+ +L   P
Sbjct  119  AQVYNKLGMYP  129



>gb|EPS72638.1| hypothetical protein M569_02120, partial [Genlisea aurea]
Length=161

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 95/165 (58%), Gaps = 11/165 (7%)
 Frame = -1

Query  624  QSALLIAAVIFLVSMLGVSGAEK---PAAGKSRY-KVTGTVYCDVCRAKFVTRVAERMPG  457
            ++  L+ +++F V  L ++ A K   PAA  +R+  V G VYCD CR +F+T ++ R+ G
Sbjct  3    KAVALVGSLLFCV--LAIAAAHKKPPPAAAHNRFFDVVGEVYCDPCRVQFMTELSRRLVG  60

Query  456  AKVKLECLNTTNEK-VTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVI  280
            A V+L+C    +   +TYS+EG+T  +G Y L+ +GDH+ D +C VK + SP+ DC+  +
Sbjct  61   ATVRLQCHRYNDTGCITYSVEGKTGFDGRYRLQVKGDHESD-LCFVKVIGSPRADCAVPM  119

Query  279  KDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFK  145
             D+     +R+  T N G+ +  R  NP+ F+       C  V K
Sbjct  120  TDVVE---SRIVCTKNVGISSPVRYANPLGFMTRAAAPRCLPVLK  161



>ref|XP_002301038.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
 gb|ABK93129.1| unknown [Populus trichocarpa]
 gb|ABK94485.1| unknown [Populus trichocarpa]
 gb|ABK95752.1| unknown [Populus trichocarpa]
 gb|EEE80311.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
Length=159

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 90/167 (54%), Gaps = 12/167 (7%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MA+V   L +  +  LVS      A +P  G++ + V G VYCD C A F T     + G
Sbjct  1    MARVFMLLALCVLPALVS------AARP--GRNPFSVQGLVYCDTCLAGFETPKTTYIAG  52

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            +KVK+EC +   + + YS EG TD  G Y +  + DH +D+IC    V SP++DCS    
Sbjct  53   SKVKVECRDRKTQDLVYSKEGTTDSTGKYIITVDEDH-KDQICDAMLVSSPRKDCSS---  108

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELH  136
                ++  RV LT+ NGLV+ TR  N + F+  +P++ C E+ +   
Sbjct  109  PSAGRDRARVILTSYNGLVSTTRYANSMGFMAAQPMSGCTELLRSYQ  155



>gb|AAQ10267.1| major pollen allergen Ole e 1, partial [Olea europaea]
 gb|AAQ10268.1| major pollen allergen Ole e 1, partial [Olea europaea]
Length=132

 Score =   101 bits (252),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 77/131 (59%), Gaps = 4/131 (3%)
 Frame = -1

Query  519  TVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDE  340
            TVYCD CRA F+T ++E +PGA V+L+C +  N  +T++  G T   G+Y +  E DH +
Sbjct  3    TVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDITFTEVGYTRAEGLYSMLVERDH-K  61

Query  339  DEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVC  160
            +E C +  + S ++DC E+  + WAK   +  L   NG    TR VNP+ F K + +  C
Sbjct  62   NEFCEITLISSGRKDCDEIPTEGWAKPSLKFILNTVNG---TTRTVNPLGFFKKEALPKC  118

Query  159  AEVFKELHYIP  127
            A+V+ +L   P
Sbjct  119  AQVYNKLGMYP  129



>ref|XP_009402012.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=160

 Score =   102 bits (253),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 75/122 (61%), Gaps = 4/122 (3%)
 Frame = -1

Query  537  RYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEA  358
            ++ + G VYCD CRA F T V++ + GAKVKL+C N   + V + +E  TD  G YH+E 
Sbjct  26   KFVIEGRVYCDTCRAGFQTAVSQYIAGAKVKLQCRNYETDAVEHLVEAVTDSTGTYHIEV  85

Query  357  EGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKT  178
            E  H E+EIC V  ++SP+  C+EV +   ++   R+ +T  +GL +D R  N + FLK 
Sbjct  86   EDSH-EEEICEVSLLQSPQPGCTEVAQ---SRNRARILVTGRSGLASDIRYANSLGFLKD  141

Query  177  KP  172
            +P
Sbjct  142  EP  143



>ref|XP_010942359.1| PREDICTED: major pollen allergen Lol p 11-like [Elaeis guineensis]
Length=174

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 98/175 (56%), Gaps = 13/175 (7%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPA------AGKSR-YKVTGTVYCDVCRAKFVTR  478
            MA++Q  LL   V+  +++ GV+ A   A      A K++ + +TG VYCD CRA F T 
Sbjct  1    MARLQ--LLPVFVMLSLTLSGVALAHDSATIISSEALKTKDFVLTGRVYCDTCRAGFETD  58

Query  477  VAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKE  298
            +   MPGAKV+LEC     +++TY  E  T  +GMY +    DH  D+ C V  VKS   
Sbjct  59   ITSSMPGAKVRLECKRYGTDELTYEAEATTQLSGMYQMIVPDDHSNDQ-CSVVLVKSSFN  117

Query  297  DCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHY  133
             C+E+      ++  R+TL  + GL++++R+ N + FL  +P+  C ++ ++  +
Sbjct  118  KCTEIEP---GRDRVRITLAQDGGLLSNSRQANALGFLIDEPLPSCGKLLQKYGF  169



>gb|AFW77548.1| pollen allergen Phl p 11 [Zea mays]
Length=165

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 80/131 (61%), Gaps = 5/131 (4%)
 Frame = -1

Query  534  YKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAE  355
            + VTG VYCD CRA F T V+  + GA V++EC +  +++V    E  TD  G Y +E  
Sbjct  27   FVVTGRVYCDNCRAGFETNVSHAIEGATVEMECRHFESQEVHDKAEATTDAGGWYRMEIS  86

Query  354  GDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGL-VTDTRKVNPILFLKT  178
            GDH +DEIC V  +KSP+ DC+E+ +    ++  RV LT N+G+  +  R  NPI F + 
Sbjct  87   GDH-QDEICEVLLLKSPEADCAEIER---TRDRCRVPLTRNDGIRQSGIRYANPIAFFRK  142

Query  177  KPIAVCAEVFK  145
            +P++ C E+ +
Sbjct  143  EPLSNCGELLR  153



>ref|XP_008376286.1| PREDICTED: pollen-specific protein C13-like [Malus domestica]
 ref|XP_008343323.1| PREDICTED: pollen-specific protein C13-like [Malus domestica]
 ref|XP_008353938.1| PREDICTED: pollen-specific protein C13-like [Malus domestica]
 ref|XP_009369651.1| PREDICTED: pollen-specific protein C13-like [Pyrus x bretschneideri]
Length=159

 Score =   102 bits (253),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 93/167 (56%), Gaps = 12/167 (7%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAK+   LLIA    L  +  ++ A +P   K+ + V G VYCD CRA + T+    + G
Sbjct  1    MAKL--VLLIA----LCVLPALAAATRPM--KTPFTVEGKVYCDTCRAGYETKAITYIAG  52

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKV+LEC + ++  + Y+ EG TD  G Y +    DH  D+ C    V SP++DC+ V  
Sbjct  53   AKVRLECRDKSSMALVYTKEGTTDSAGCYKIPVAEDH-LDQFCDAVLVSSPQKDCATVSP  111

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELH  136
                +E  RV LT  NG+ + TR  N + F++T+ ++ C ++ KEL 
Sbjct  112  ---GRERARVILTGYNGIASYTRFANAMGFMRTEALSGCTQILKELQ  155



>ref|XP_010942360.1| PREDICTED: pollen allergen Phl p 11-like [Elaeis guineensis]
Length=174

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 95/175 (54%), Gaps = 13/175 (7%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKP-------AAGKSRYKVTGTVYCDVCRAKFVTR  478
            MAK+Q   L   V+  +++ G++ A  P       A+    + + G VYCD CR  F T 
Sbjct  1    MAKLQ--FLPVFVMLSLTLAGIALAHDPVTNIIGEASKTKDFTLEGRVYCDTCRTGFETD  58

Query  477  VAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKE  298
            +   MPGAKV+LEC+    +++TY  E  TD  G+Y +    DH  D+ C V  VKS  +
Sbjct  59   LTTYMPGAKVRLECMRYGTDELTYKAEATTDFLGIYQMTVPDDHSNDQ-CSVVLVKSSLD  117

Query  297  DCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHY  133
            +C+E+      ++  R+TL  + GL+++ R+ N + +L  KP+  C ++ ++  +
Sbjct  118  NCTEIEP---GRDRVRITLAQDGGLLSNIRQANALGYLIDKPLLECGKLLQKYGF  169



>pir||G53806 major allergen OLE26 - common olive (fragment)
Length=136

 Score =   101 bits (251),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 78/137 (57%), Gaps = 4/137 (3%)
 Frame = -1

Query  537  RYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEA  358
            ++ + G VYCD CRA F+T ++E +PGA V+L+C    N  +T++  G T   G+Y +  
Sbjct  1    QFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLV  60

Query  357  EGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKT  178
            E DH ++E C +  + S  +DC+E+  + W K   +  L   NG    TR VNP+ F K 
Sbjct  61   ERDH-KNEFCEITLISSGSKDCNEIPTEGWGKPSLKFILNTVNG---TTRTVNPLGFYKK  116

Query  177  KPIAVCAEVFKELHYIP  127
            + +  CA+V+ +L   P
Sbjct  117  EALPKCAQVYNKLGMYP  133



>ref|XP_010060161.1| PREDICTED: protein DOWNSTREAM OF FLC [Eucalyptus grandis]
 gb|KCW66732.1| hypothetical protein EUGRSUZ_F00490 [Eucalyptus grandis]
Length=160

 Score =   102 bits (253),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 83/147 (56%), Gaps = 6/147 (4%)
 Frame = -1

Query  576  GVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLE  397
             ++ A +PA  ++   VTG VYCD CRA F T  +  + GAKVK+EC + T+ K+ YS E
Sbjct  16   AIAVAARPA--RNPLTVTGKVYCDTCRAGFETPASTYIAGAKVKVECKDRTSMKLLYSQE  73

Query  396  GETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVT  217
              TD  G Y L    DH +D++C    + SP+ +C    K    ++  RV LT  NG+V+
Sbjct  74   ATTDSTGTYKLFVSEDH-QDQLCDAMLLSSPQLNCQ---KPAAGRDRARVILTRYNGIVS  129

Query  216  DTRKVNPILFLKTKPIAVCAEVFKELH  136
            DTR  N + F   +P+A C +V ++  
Sbjct  130  DTRYANNMGFEMDQPLAGCTQVLQQYQ  156



>gb|AAQ10269.1| major pollen allergen Ole e 1, partial [Olea europaea]
 gb|AAQ10270.1| major pollen allergen Ole e 1, partial [Olea europaea]
 gb|AAQ10271.1| major pollen allergen Ole e 1, partial [Olea europaea]
Length=132

 Score =   100 bits (250),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 77/131 (59%), Gaps = 4/131 (3%)
 Frame = -1

Query  519  TVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDE  340
            TVYCD CRA F+T ++E +PGA V+L+C +  N  +T++  G T   G+Y +  E DH +
Sbjct  3    TVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDITFTEVGYTRAEGLYSMLVERDH-K  61

Query  339  DEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVC  160
            +E C +  + S ++DC E+  + WAK   +  L   NG    TR VNP+ F K + +  C
Sbjct  62   NEFCEITLISSGRKDCDEIPTEGWAKPSLKFILNTVNG---TTRTVNPLGFFKKEALPKC  118

Query  159  AEVFKELHYIP  127
            A+V+ +L   P
Sbjct  119  AQVYNKLGMYP  129



>ref|XP_006464247.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Citrus sinensis]
Length=161

 Score =   102 bits (253),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 79/140 (56%), Gaps = 6/140 (4%)
 Frame = -1

Query  534  YKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAE  355
            + + G VYCD CR  F T     + GA V++EC +  +  + YS++GETD  G Y++  +
Sbjct  25   FHIRGRVYCDTCRCGFETSATTYIQGAHVRIECKDRNSLNLKYSIDGETDSTGTYNIHVD  84

Query  354  GDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTK  175
            GDH +D+IC  K + SP  DC         +  ++V LT +NG V++    N + FLK +
Sbjct  85   GDH-QDQICYSKLISSPLADCKTADP---GRACSQVILTRSNGAVSNLHFANALGFLKAR  140

Query  174  PIAVCAEVFKELHYIPGENV  115
            P+A C E+ K+  Y+P   +
Sbjct  141  PLAFCPELLKK--YLPQNEI  158



>pir||F53806 major allergen OLE19 - common olive (fragment)
Length=136

 Score =   101 bits (251),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 79/137 (58%), Gaps = 4/137 (3%)
 Frame = -1

Query  537  RYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEA  358
            ++ + G VYCD CRA F+  ++E +PGA V+L+C    N  +T++  G T   G+Y +  
Sbjct  1    QFHIQGQVYCDTCRAGFINELSEFIPGASVRLQCREKKNGDITFTEVGYTRAEGLYSMLV  60

Query  357  EGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKT  178
            E DH ++E C +  + S ++DC+E+  + WAK   +  L   NG    TR +NP+ F K 
Sbjct  61   ERDH-KNEFCEITLISSGRKDCNEIPIEGWAKPSLKFILNTVNG---TTRTINPLGFYKK  116

Query  177  KPIAVCAEVFKELHYIP  127
            + +  CA+V+ +L   P
Sbjct  117  EALPKCAQVYNKLGMYP  133



>dbj|BAK06698.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=167

 Score =   102 bits (253),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 92/163 (56%), Gaps = 11/163 (7%)
 Frame = -1

Query  621  SALLIAAVIFLVSMLGVSGAEKPAAGKSR----YKVTGTVYCDVCRAKFVTRVAERMPGA  454
            ++L I +VI +V++  ++     A    R    Y V G VYCD CRA F T V E + GA
Sbjct  2    ASLRILSVIAVVAIFALADT---AVANDRDLPDYIVQGRVYCDTCRAGFETNVTEYIKGA  58

Query  453  KVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKD  274
            KV+LEC     +K+  S++G TD++G Y +E +  H ED IC +  V+SP  +C+E+   
Sbjct  59   KVRLECRRFGTDKLERSIDGVTDESGTYKIELKDSHPED-ICEMVLVQSPLPNCNEI---  114

Query  273  MWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFK  145
               +    + L+ N G+  + R  NP+ +LK KP+ VC ++ K
Sbjct  115  QALRNRAEIVLSRNVGISDNIRLANPLGYLKDKPLPVCPDLLK  157



>ref|XP_011006159.1| PREDICTED: pollen-specific protein C13-like [Populus euphratica]
 ref|XP_011016058.1| PREDICTED: pollen-specific protein C13-like [Populus euphratica]
Length=159

 Score =   101 bits (252),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 80/140 (57%), Gaps = 6/140 (4%)
 Frame = -1

Query  564  AEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETD  385
            A +PA  ++ + V G+VYCD C A F T     + GAKV+LEC +   + + YS EG TD
Sbjct  19   AARPA--RNPFVVQGSVYCDTCLAGFETSKTTNIAGAKVRLECKDRKTQDLVYSKEGTTD  76

Query  384  KNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRK  205
              G Y +  + DH +D+IC    V SP++DC         ++  RV LT NNGLV+ TR 
Sbjct  77   STGKYTITVDEDH-KDQICDCMLVSSPRKDCRS---PSAGRDRARVILTNNNGLVSTTRY  132

Query  204  VNPILFLKTKPIAVCAEVFK  145
            VN + F+   P++ C E+ +
Sbjct  133  VNAMGFMAAHPMSGCTELLR  152



>pir||I53806 major allergen OLE16 - common olive (fragment)
Length=137

 Score =   100 bits (249),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 78/138 (57%), Gaps = 4/138 (3%)
 Frame = -1

Query  540  SRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLE  361
            S++ + G VYCD CRA+F+T ++E +PGA V+LEC +     +T++  G T   G+Y + 
Sbjct  1    SQFHIQGQVYCDTCRARFITELSEFIPGAGVRLECRDGEKGSITFTEVGYTRAEGLYSML  60

Query  360  AEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLK  181
             E DH ++E C +    S ++DC E+  + W K   +  L   NG    TR +NP+ F K
Sbjct  61   IERDH-KNEFCEITLASSSRKDCDEIPVEGWVKPSLKFKLNTVNG---TTRTINPLGFFK  116

Query  180  TKPIAVCAEVFKELHYIP  127
             + +  C +VF +L   P
Sbjct  117  KEVLPKCPQVFNKLGMYP  134



>ref|XP_006344595.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Solanum tuberosum]
Length=158

 Score =   101 bits (251),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 93/168 (55%), Gaps = 11/168 (7%)
 Frame = -1

Query  618  ALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLE  439
            A L+A   F + +L  S     A+  +   V G VYCD CR  F T     +P AKVK+E
Sbjct  2    ARLVA--FFAICLLSTS----IASASNPLLVEGKVYCDTCRCGFETPATTYLPDAKVKIE  55

Query  438  CLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKE  259
            C +   E+ TY++EG T+  G Y +  + D   D++C V  +KSP   C+   K    ++
Sbjct  56   CKSRITEEPTYTVEGVTNSQGEYSILVKSDRG-DDVCDVVLIKSPDPTCA---KPSAGRD  111

Query  258  FTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGENV  115
             +RVTLT NNG+++D    N + F++ +P+A C E+ ++ + +P E V
Sbjct  112  RSRVTLTRNNGMISDVYFANAMGFIRDEPLASCDEILRQ-YQVPDEQV  158



>gb|KHG12773.1| Olee1-like protein [Gossypium arboreum]
Length=187

 Score =   102 bits (253),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 96/170 (56%), Gaps = 11/170 (6%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLG-VSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMP  460
            MA +    +    IF+ S L  V GAE        Y V G VYCD CR +F T+++E + 
Sbjct  1    MANIPIIAIFCFTIFVSSSLNFVYGAENMT-----YIVVGHVYCDTCRVEFETKLSEPIG  55

Query  459  GAKVKLECLNTTNEKVTY-SLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEV  283
            GA VKLEC N T+ ++T+ S E  TD++G YH+  EGD++E + C V  V+SP  DC++ 
Sbjct  56   GAVVKLECRNRTDNQLTFQSQEIVTDEHGDYHIAVEGDYEESD-CDVALVRSPNPDCNDP  114

Query  282  IKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHY  133
              ++W    +RV LT  +G+  + R  N + F K   +  C +V +E+ Y
Sbjct  115  -SEIW--RISRVVLTTLDGVSGELRFANNLGFKKKVALPQCTQVLQEIGY  161



>ref|XP_002307393.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
 gb|ABK95954.1| unknown [Populus trichocarpa]
 gb|EEE94389.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
Length=159

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 80/140 (57%), Gaps = 6/140 (4%)
 Frame = -1

Query  564  AEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETD  385
            A +PA  ++ + V G+VYCD C A F T     + GAKV+LEC +   + + YS EG TD
Sbjct  19   AARPA--RNPFVVQGSVYCDTCLAGFETSKTTNIAGAKVRLECKDRKTQDLVYSKEGTTD  76

Query  384  KNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRK  205
              G Y +  + DH ED+IC    V SP++DC         ++  RV LT +NGLV+ TR 
Sbjct  77   STGKYTITVDEDH-EDQICDCMLVSSPRKDCRSP---SAGRDRARVILTNDNGLVSTTRY  132

Query  204  VNPILFLKTKPIAVCAEVFK  145
             N + F+  +P++ C E+ +
Sbjct  133  ANAMGFMAAQPMSGCTELLR  152



>ref|XP_009409254.1| PREDICTED: major pollen allergen Lol p 11-like [Musa acuminata 
subsp. malaccensis]
Length=168

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 87/164 (53%), Gaps = 8/164 (5%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            ++ V + L +A V+  +S+     A   A GK  + V G V+CD CRA F T V+    G
Sbjct  6    ISAVTAVLAVACVLPSLSV----AARNVAGGKQGFVVQGRVFCDTCRAGFETPVSTYTKG  61

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKV++EC +      T + EG TD  G Y++    +H E EIC    V SP+  C     
Sbjct  62   AKVRIECRSKATGAKTCNFEGTTDHTGTYNILVADEH-EHEICESMLVSSPESRCK---T  117

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFK  145
             +  +E  RV L+ NNG+ +DTR  N + F    P++VCAE+ K
Sbjct  118  PLQGRERARVFLSHNNGIASDTRYANSLGFQTDTPLSVCAELLK  161



>ref|XP_006428158.1| hypothetical protein CICLE_v10027141mg, partial [Citrus clementina]
 gb|ESR41398.1| hypothetical protein CICLE_v10027141mg, partial [Citrus clementina]
Length=250

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 76/132 (58%), Gaps = 4/132 (3%)
 Frame = -1

Query  534  YKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAE  355
            + + G VYCD CR  F T     + GA V++EC +  +  + YS++GETD  G Y++  +
Sbjct  25   FHIRGRVYCDTCRCGFETSATTYIQGAHVRIECKDRNSLNLKYSIDGETDSTGTYNIHVD  84

Query  354  GDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTK  175
            GDH +D+IC  K + SP  DC         +  ++V LT +NG V++    N + FLK +
Sbjct  85   GDH-QDQICYSKLISSPLADCKTADP---GRACSQVILTRSNGAVSNLHFANALGFLKAR  140

Query  174  PIAVCAEVFKEL  139
            P+A C E+ K+L
Sbjct  141  PLAFCPELLKKL  152



>ref|XP_010321468.1| PREDICTED: LOW QUALITY PROTEIN: major pollen allergen Lol p 11-like 
[Solanum lycopersicum]
Length=162

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 85/155 (55%), Gaps = 4/155 (3%)
 Frame = -1

Query  597  IFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNE  418
            +F+V ++  +     A     + V G VYCD CR  + T  ++ +PG++V++EC N    
Sbjct  7    LFVVCLVLFASINVSANFMDTFLVIGKVYCDTCRCGYETSASKYLPGSRVRIECKNRDTN  66

Query  417  KVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLT  238
             + Y++EG T+  G Y +    D   DE C V  ++S    C+E       ++ TRV LT
Sbjct  67   DLAYTVEGVTNSKGEYKILVNSDR-RDEFCDVVLIRSSDPMCAE---PNTGRDRTRVVLT  122

Query  237  ANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHY  133
            +NNG+V++TR  N + FL  +P+A C ++ K+  +
Sbjct  123  SNNGMVSNTRFANSLGFLYNEPLASCTKILKQYEF  157



>gb|AAQ08188.1| major pollen allergen Ole e 1, partial [Olea europaea]
Length=132

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 78/131 (60%), Gaps = 4/131 (3%)
 Frame = -1

Query  519  TVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDE  340
            TV+CD CRA F+T ++E +PGA V+L+C +  N  +T++  G T   G+Y +  E DH +
Sbjct  3    TVHCDTCRAGFITELSEFIPGASVRLQCKDKENGDITFTEVGYTRAEGLYSMLVERDH-K  61

Query  339  DEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVC  160
            +E C +  + S ++DC+E+  + WAK   +  L   NG    TR VNP+ F K + +  C
Sbjct  62   NEFCEITLISSGRKDCNEIPTEGWAKPSLKFILNTVNG---TTRTVNPLGFFKKEALPKC  118

Query  159  AEVFKELHYIP  127
            A+V+ +L   P
Sbjct  119  AQVYNKLGMYP  129



>ref|XP_009386950.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=166

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 74/133 (56%), Gaps = 3/133 (2%)
 Frame = -1

Query  543  KSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHL  364
            K  + V G V+CD CRA F T V+  + GA V++EC +      T S EG TD  G Y++
Sbjct  30   KRGFVVQGRVFCDTCRAGFETPVSTYIQGATVRVECRSEFTGAKTCSFEGTTDHTGTYNI  89

Query  363  EAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFL  184
              EG+HD+ EIC    V SP+  C   ++    +E   V L+ NNG+ +DTR  N + FL
Sbjct  90   LVEGEHDDHEICESLLVSSPESGCKTALQ---GRERAPVFLSHNNGIASDTRFANSLGFL  146

Query  183  KTKPIAVCAEVFK  145
            K   + VC E+ K
Sbjct  147  KDTSLPVCTELLK  159



>gb|AAO41983.1| unknown protein [Arabidopsis thaliana]
Length=115

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 73/112 (65%), Gaps = 2/112 (2%)
 Frame = -1

Query  459  GAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVI  280
            GAKVKLEC    N+ VT + E  TD  G Y +E  GDH E+E+C +  ++SP  +C +V 
Sbjct  1    GAKVKLECKGRENQTVTLTKEAVTDNAGNYQMEVMGDH-EEEVCEIVLLQSPDPECGDVN  59

Query  279  KDMWAKEFTRVTLTANNGLVTD-TRKVNPILFLKTKPIAVCAEVFKELHYIP  127
               + +   R++LTAN+G+V++ TR +NP+ F++  P+A C +VFKEL  +P
Sbjct  60   NQEFLRNAARISLTANDGIVSNETRTINPLGFMRKTPLAECPQVFKELGIVP  111



>gb|AAB32652.2| main olive allergen, partial [Olea europaea]
Length=130

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 75/130 (58%), Gaps = 4/130 (3%)
 Frame = -1

Query  516  VYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDED  337
            VYCD CRA F+T ++E +PGA V+L+C    N  +T++  G T   G+Y +  E DH ++
Sbjct  2    VYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDH-KN  60

Query  336  EICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCA  157
            E C +  + S  +DC+E+  + WAK   +  L   NG    TR VNP+ F K + +  CA
Sbjct  61   EFCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNG---TTRTVNPLGFFKKEALPKCA  117

Query  156  EVFKELHYIP  127
            +V+ +L   P
Sbjct  118  QVYNKLGMYP  127



>gb|KDP21093.1| hypothetical protein JCGZ_21564 [Jatropha curcas]
Length=221

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 69/219 (32%), Positives = 97/219 (44%), Gaps = 63/219 (29%)
 Frame = -1

Query  615  LLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLEC  436
            + +A+ I  +S+ G+      A G++++ V G VYCD CR +F+T+V   + GA V LEC
Sbjct  5    ICLASAICFLSLFGL------AYGEAKFNVEGVVYCDTCRVQFMTKVTTLIEGATVHLEC  58

Query  435  LNTTNEKVTY-SLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCS----------  289
             N T + +TY S E  TD  G Y +  EGDH EDE+C V  +KSP  DC+          
Sbjct  59   FNRTGDVLTYTSPEAVTDAAGKYSIPVEGDH-EDELCQVMLLKSPNPDCATVHLECFNRT  117

Query  288  ---------EVIKDMWAK------------------------------------EFTRVT  244
                     E + D   K                                    E   VT
Sbjct  118  GDVLTYTSPEAVTDAAGKYSIPVEGDHEDELCQVMLLKSPNPDCNEINKDPFVRESASVT  177

Query  243  LTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIP  127
            LT +NG+    R+ NP+ FLK + +  C EV +EL   P
Sbjct  178  LTNDNGIAGPAREANPLGFLKKEILPECPEVLRELGITP  216



>pir||H53806 major allergen OLE6 - common olive (fragment)
Length=136

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 77/137 (56%), Gaps = 4/137 (3%)
 Frame = -1

Query  537  RYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEA  358
            ++ + G VYCD CRA+F+T ++E +PGA V+LEC +     +T++  G T   G+Y +  
Sbjct  1    QFHIQGQVYCDTCRARFITELSEFIPGAGVRLECKDGGKGSITFTEVGYTRAEGLYSMLI  60

Query  357  EGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKT  178
            E DH ++E C +    S ++DC E+  + W K   +  L   NG    TR +NP+ F K 
Sbjct  61   ERDH-KNEFCEITLASSSRKDCDEIPVEGWVKPSLKFKLNTVNG---TTRTINPLGFFKK  116

Query  177  KPIAVCAEVFKELHYIP  127
            + +  C +VF +L   P
Sbjct  117  EVLPKCPQVFNKLGMYP  133



>ref|XP_008797140.1| PREDICTED: major pollen allergen Lol p 11-like [Phoenix dactylifera]
 ref|XP_008797142.1| PREDICTED: major pollen allergen Lol p 11-like [Phoenix dactylifera]
Length=174

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 78/130 (60%), Gaps = 4/130 (3%)
 Frame = -1

Query  522  GTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHD  343
            G VYCD CRA F T +   +PGAKV+LEC     ++VTY+ E  TD  G+Y +   GDH 
Sbjct  44   GHVYCDTCRAGFETDLTAYIPGAKVRLECTRYGTDEVTYAAEATTDLLGIYQIVVPGDHS  103

Query  342  EDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAV  163
            ED+ C V  +KS  ++C+E+      ++  RV L  + GL+++ R+ N + FL  +P+A 
Sbjct  104  EDQ-CSVVLMKSAVDNCTEI---KPGRDRARVVLAQDGGLLSNVRRANALGFLIAEPLAE  159

Query  162  CAEVFKELHY  133
            C ++ ++  +
Sbjct  160  CGKLLQKYGF  169



>ref|XP_009383585.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=169

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 78/141 (55%), Gaps = 4/141 (3%)
 Frame = -1

Query  564  AEKPAAGKSR-YKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGET  388
            A +  AG  R + V G V+CD CRA F T  +  + GAKV +EC +      T S +G T
Sbjct  25   AARDVAGIKRGFVVQGRVFCDTCRAGFETPASTYIRGAKVSVECRSRITGAKTCSFDGTT  84

Query  387  DKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTR  208
            D  G Y++    +HD+ EIC    V SP+  C  V++    +E  RV L+ NNG+ +DTR
Sbjct  85   DHTGTYNILIADEHDDHEICESVLVSSPESGCKTVLR---GRERARVFLSRNNGIASDTR  141

Query  207  KVNPILFLKTKPIAVCAEVFK  145
              N + F K  P+++C ++ K
Sbjct  142  FANSLGFTKDTPLSICTQLLK  162



>ref|XP_006366520.1| PREDICTED: olee1-like protein-like [Solanum tuberosum]
Length=162

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 91/168 (54%), Gaps = 11/168 (7%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAK+ ++ ++  V+F  + + VS     A     + V G VYCD CR  F T  +  +PG
Sbjct  1    MAKMITSFVVCLVLF--ASINVS-----ANFMDTFLVVGKVYCDTCRCGFETSASMYLPG  53

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            ++V++EC N     + Y++EG T+  G Y +    D   DE C V  ++S    C+E   
Sbjct  54   SRVRIECKNRDTNDLAYTVEGFTNSKGEYKILVNSDR-RDEFCDVVLIRSSDPMCAE---  109

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHY  133
                ++  RV LT+NNG+V++TR  N + FL  +P+A C ++ ++  +
Sbjct  110  PNTGRDRARVVLTSNNGMVSNTRFANSMGFLSNEPLASCTKILQQYEF  157



>gb|ABC86745.1| pollen-specific protein [Vitis pseudoreticulata]
Length=159

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 75/133 (56%), Gaps = 4/133 (3%)
 Frame = -1

Query  534  YKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAE  355
            + + G VYCD CRA F T     + GAKV++EC +  + ++ YS+EG TD  G Y +   
Sbjct  27   FVLQGRVYCDTCRAGFETSATTYIAGAKVRVECKDRNSMQLLYSIEGITDSTGTYKIMVT  86

Query  354  GDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTK  175
             DH ED++C    V SP+ DC+ V      ++   V LT  NG+V+D R  N + FLK  
Sbjct  87   EDH-EDQLCDAVLVSSPQSDCASVDP---GRDRAAVILTRYNGIVSDNRYANSMGFLKDH  142

Query  174  PIAVCAEVFKELH  136
            P++ C ++ ++  
Sbjct  143  PMSECTQLLQQYQ  155



>emb|CAA78897.1| pollen specific gene [Oryza sativa Indica Group]
Length=164

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 87/152 (57%), Gaps = 9/152 (6%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MA +++  +I  ++F V     +  + P      Y V G VYCD CRA+F T V E + G
Sbjct  1    MASLRTIPVIFGILFYVLASTATATDAP-----DYVVQGRVYCDTCRAEFETNVTEYIKG  55

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKV+LEC +   +KV  +++G TD+ G Y +E +  H+ED IC V  V SP  +CSE+  
Sbjct  56   AKVRLECKHFGTDKVERAIDGVTDETGTYKIELKDSHEED-ICEVVLVHSPLANCSEIEA  114

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLK  181
            +   ++  RV LT N G+  + R  NP+ +LK
Sbjct  115  E---RDRARVLLTRNVGICDNLRLANPLGYLK  143



>ref|XP_008348540.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Malus domestica]
Length=162

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 85/165 (52%), Gaps = 11/165 (7%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MA  +  +L+A  +FL  ++       P      + V G VYCD CR  F T     +PG
Sbjct  1    MAMSRVVVLLALCMFL-GLVSARTLGNP------FHVQGRVYCDTCRCGFETTATNYIPG  53

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            A+V++EC +    ++ YS+EGETD  G Y++  E DH ED+IC    V SP  DC     
Sbjct  54   ARVRIECKDRNTLQLAYSVEGETDSTGTYNILVEEDH-EDQICESVLVSSPISDCKSADP  112

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKE  142
                +    V +T  NG+V D R  N + F K +P+A C ++ ++
Sbjct  113  ---GRSRANVVVTRYNGVVKDKRYANNMGFFKNEPLAGCEKILEQ  154



>ref|XP_004975466.1| PREDICTED: pollen-specific protein C13-like [Setaria italica]
Length=163

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 86/160 (54%), Gaps = 7/160 (4%)
 Frame = -1

Query  621  SALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKL  442
            S  ++ AV   V   GV      A     + + G VYCD CRA F T V E + GAKV+L
Sbjct  3    SLRILPAVTVAVLFYGVVAV---ATNAPDFVIQGRVYCDTCRAGFQTNVTEYIKGAKVRL  59

Query  441  ECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAK  262
            EC +     V  +++G TD++G Y ++ +G H+ED IC V  ++SP++DC+EV       
Sbjct  60   ECKHFGTGAVERAIDGVTDESGFYTIKLKGGHEED-ICEVILIESPRKDCAEVPAH---S  115

Query  261  EFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKE  142
            +   V L  + G+  D R  NP+ + K  P+ VC  V KE
Sbjct  116  DRASVLLAKDAGISDDMRFPNPLGYFKDVPLPVCGAVLKE  155



>ref|XP_009421183.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=160

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 89/165 (54%), Gaps = 12/165 (7%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPG  457
            MAK+Q   ++AA+ F  ++ GV      A     +++ G VYCD CRA F T   + + G
Sbjct  1    MAKLQLLPVVAALCF--ALAGV------ALALPTFRIQGRVYCDKCRAGFETSATDYIEG  52

Query  456  AKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIK  277
            AKVKLEC       V  +    TD +G Y LE E +H E+EIC V  V+SP+  CSE+  
Sbjct  53   AKVKLECRQYDTGVVEQTATAVTDASGTYTLEVEDNH-EEEICEVVLVESPRPGCSEI--  109

Query  276  DMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKE  142
             M  ++  RV ++A +GL T  R  N + FL   P+  C  + ++
Sbjct  110  -MTGRDRARVLISAESGLTTSVRYANSLGFLNAAPLPECGLLLQK  153



>gb|ADI55168.1| AS1 [Gossypium hirsutum]
Length=182

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 95/175 (54%), Gaps = 10/175 (6%)
 Frame = -1

Query  636  MAKVQSALLIAAVIFLVSMLGVS-----GAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVA  472
            MAK     L++  I + S L  +          +  + R++V G VYCD CR +F T ++
Sbjct  1    MAKASVISLLSLFICIFSSLSFAYASAPAPAPSSNQQMRFEVLGHVYCDTCRVEFETSIS  60

Query  471  ERMPGAKVKLECLNTTNEKVTY-SLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKED  295
            E +PGA V+LEC N T+EK+TY S E      G Y ++  GD++E + C V  VKSP+ D
Sbjct  61   EPIPGATVRLECRNRTDEKITYQSPEITAGDKGNYKIQVTGDYEESD-CDVMLVKSPRAD  119

Query  294  CSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYI  130
            C++  ++ W K   RV LT  +G+  + R  N + F K + +  C +V  E+ Y 
Sbjct  120  CNDPTEE-WRK--ARVVLTTLDGVSGEIRFANNLGFKKKEALPECTKVLTEMGYF  171



>emb|CDP16230.1| unnamed protein product [Coffea canephora]
Length=161

 Score = 99.0 bits (245),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 87/164 (53%), Gaps = 5/164 (3%)
 Frame = -1

Query  609  IAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLN  430
            +A  + +VS L        A  +  + V G VYCD CR +F T +++ + GA+V+L+C  
Sbjct  1    MAKAVAVVSALCFLALASLAHAQEAFTVKGRVYCDPCRVEFQTSLSKSIEGAEVELQCRV  60

Query  429  TTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTR  250
              NE VT S + +TD  G Y L  +GDH E+EIC V  V SP ++C+    +  A    R
Sbjct  61   RENETVTVSQKAKTDAIGNYELSVQGDH-EEEICEVVSVSSPSQECNVPFGENKA----R  115

Query  249  VTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGEN  118
            V LT NNG+    R  N + +   +    C  V +E+ YIP E+
Sbjct  116  VLLTQNNGVQGTDRYANALGYKTAEANPDCKAVLQEMGYIPDED  159



>gb|AAQ10277.1| major pollen allergen Ole e 1, partial [Olea europaea]
Length=131

 Score = 97.8 bits (242),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 75/130 (58%), Gaps = 4/130 (3%)
 Frame = -1

Query  516  VYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDED  337
            VYCD CRA F+T ++E +PGA V+L+C +  N  +T++  G T   G+Y +  E DH ++
Sbjct  3    VYCDTCRAGFITELSEFIPGASVRLQCKDRENGDITFTEVGYTRAEGLYSMLVERDH-KN  61

Query  336  EICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCA  157
            E C +  + S ++DC E+  + W K   +  L   NG    TR VNP+ F K + +  CA
Sbjct  62   EFCEITLISSGRKDCDEIPTEGWVKPSLKFILNTVNGT---TRTVNPLGFFKKEALPKCA  118

Query  156  EVFKELHYIP  127
            +V+ +L   P
Sbjct  119  QVYNKLGMYP  128



>ref|XP_002533139.1| Pollen-specific protein C13 precursor, putative [Ricinus communis]
 gb|EEF29251.1| Pollen-specific protein C13 precursor, putative [Ricinus communis]
Length=161

 Score = 98.6 bits (244),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 76/132 (58%), Gaps = 4/132 (3%)
 Frame = -1

Query  534  YKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAE  355
            + + G VYCD CR  F T+    +PGA+V++EC + T  ++ YS+EGETD+ G Y++  E
Sbjct  29   FHIKGRVYCDTCRCGFETKKTTYIPGARVRIECEDRTTLRLKYSVEGETDETGTYNILVE  88

Query  354  GDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTK  175
             DH +D+IC    V SP   C+        +    V +T NNG ++D    N + FL+ +
Sbjct  89   DDH-QDQICYAALVSSPWPSCNTADP---GRSRAHVVVTRNNGAISDLHFANSMGFLRNQ  144

Query  174  PIAVCAEVFKEL  139
             ++ C E+ K+L
Sbjct  145  AMSGCTELVKQL  156



>gb|AAQ10274.1| major pollen allergen Ole e 1, partial [Olea europaea]
Length=131

 Score = 97.8 bits (242),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 76/131 (58%), Gaps = 4/131 (3%)
 Frame = -1

Query  519  TVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDE  340
            TV CD CRA F+T ++E +PGA V+L+C +  N  +T++  G T   G+Y +  E DH +
Sbjct  2    TVSCDTCRAGFITELSEFIPGASVRLQCKDKENGDITFTEVGYTRAEGLYSMLVERDH-K  60

Query  339  DEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVC  160
            +E C +  + S ++DC E+  + WAK   +  L   NG    TR VNP+ F K + +  C
Sbjct  61   NEFCEITLISSGRKDCDEIPTEGWAKPSLKFILNTVNGT---TRTVNPLGFFKKEALPKC  117

Query  159  AEVFKELHYIP  127
            A+V+ +L   P
Sbjct  118  AQVYNKLGMYP  128



>gb|AEK85658.1| major pollen allergen Ole e1 [Olea europaea]
Length=130

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 76/130 (58%), Gaps = 4/130 (3%)
 Frame = -1

Query  516  VYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDED  337
            VYCD CRA F+T ++E +PGA ++L+C +  N  VT++  G T   G+Y +  E DH ++
Sbjct  2    VYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSMLVERDH-KN  60

Query  336  EICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCA  157
            E C +  + S ++DC+E+  + W K   +  L   NG    TR VNP+ F K + +  CA
Sbjct  61   EFCEITLISSGRKDCNEIPTEGWVKPSLKFILNTLNG---TTRTVNPLGFFKKEALPKCA  117

Query  156  EVFKELHYIP  127
            +V+ +L   P
Sbjct  118  QVYNKLGMYP  127



>ref|XP_010527375.1| PREDICTED: major pollen allergen Lol p 11-like [Tarenaya hassleriana]
Length=165

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 84/166 (51%), Gaps = 11/166 (7%)
 Frame = -1

Query  594  FLVSMLGVSG-------AEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLEC  436
            F++ M+ +         A  P   ++   V G  YCD CRA F T  +  +PGA VKLEC
Sbjct  4    FVIMMMALCALPALAMAARHPKDNRNTMVVEGRTYCDPCRAGFETSASYFIPGATVKLEC  63

Query  435  LNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEF  256
             +     V YS E  TDK+G Y      DH +DE+C VK VKSP  +C  +      +E 
Sbjct  64   KDRKTMDVMYSDEAITDKDGCYKFFVHEDH-KDEMCDVKLVKSPDTNCPRISP---GREQ  119

Query  255  TRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELHYIPGEN  118
            ++V L   NG+ + TR  N + F K +P   CAE+ K+   +  E+
Sbjct  120  SQVILNHFNGIASQTRYANNMGFEKEEPDVFCAELMKQYQELDEED  165



>ref|XP_002440811.1| hypothetical protein SORBIDRAFT_09g007260 [Sorghum bicolor]
 gb|EES19241.1| hypothetical protein SORBIDRAFT_09g007260 [Sorghum bicolor]
Length=169

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 77/128 (60%), Gaps = 5/128 (4%)
 Frame = -1

Query  525  TGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDH  346
            TG +YCD CRA F T ++  + GA V++EC +  ++++    +  TD  G Y +E  GDH
Sbjct  34   TGRIYCDNCRAGFETNISHAIQGATVEMECRHFESQQIHDKAQATTDAGGWYKMEIAGDH  93

Query  345  DEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGL-VTDTRKVNPILFLKTKPI  169
             +DEIC V+ +KSP+ DC+E+  +   ++  RV LT N+G+  +  R  NPI F +  P+
Sbjct  94   -QDEICDVRLLKSPEADCAEIEVN---RDRCRVPLTGNDGIKQSGVRYANPIAFFRKDPL  149

Query  168  AVCAEVFK  145
              C E+ +
Sbjct  150  PNCGELLR  157



>gb|AAQ08947.1| allergen Fra e 1.0101 [Fraxinus excelsior]
Length=145

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 79/143 (55%), Gaps = 4/143 (3%)
 Frame = -1

Query  555  PAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNG  376
            P    S + V G VYCD CRA F+T ++E + GA V+L+C +  N KVT++  G T   G
Sbjct  4    PQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTRAEG  63

Query  375  MYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNP  196
            +Y +  E DH ++E C +  + S ++DC E+  + W K   +  L   NG    TR +NP
Sbjct  64   LYSMVIERDH-KNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNG---TTRTINP  119

Query  195  ILFLKTKPIAVCAEVFKELHYIP  127
            + F K + +  C +V+ +L   P
Sbjct  120  LGFFKKEVLPKCPQVYNKLGMYP  142



>ref|XP_007206364.1| hypothetical protein PRUPE_ppa017800mg [Prunus persica]
 gb|EMJ07563.1| hypothetical protein PRUPE_ppa017800mg [Prunus persica]
Length=160

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 83/160 (52%), Gaps = 5/160 (3%)
 Frame = -1

Query  609  IAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLN  430
            +A V+ L ++  + G        + + + G VYCD CR  F T     +PGA V++EC  
Sbjct  1    MAVVLLLFALCVLPGLVSARTLGNPFHIQGRVYCDTCRCGFETTATTYIPGATVRIECKY  60

Query  429  TTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTR  250
                ++ YS+EGETD  G Y++  E DH ED+IC    V SP  DC         ++   
Sbjct  61   RNTLQLAYSVEGETDATGTYNILVEDDH-EDQICESVLVSSPVNDCKSADP---GRKRAN  116

Query  249  VTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKE-LHY  133
            V +T  NG+V D    N + F K +P+A C E+ K+ L+Y
Sbjct  117  VVVTRYNGVVKDKHYANNMGFFKDQPLAGCEELLKQYLNY  156



>ref|XP_008245042.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Prunus mume]
Length=162

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 83/162 (51%), Gaps = 5/162 (3%)
 Frame = -1

Query  615  LLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLEC  436
            + I+ V+ L ++  + G        + + + G VYCD CR  F T     +PGA V++EC
Sbjct  1    MAISRVLLLFALCVLPGLVSARTLGNPFHIQGRVYCDTCRCGFETTATTYIPGATVRIEC  60

Query  435  LNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEF  256
                  ++ YS+EGETD  G Y++  E DH ED+IC    V SP  DC         +  
Sbjct  61   KYRNTLQLAYSVEGETDTTGTYNILVEDDH-EDQICESVLVSSPVNDCKSADP---GRNR  116

Query  255  TRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKE-LHY  133
              V +T  NG+V D    N + F K +P+A C E+ K+ L+Y
Sbjct  117  ANVVVTRYNGVVKDKHYANNMGFFKDQPLAGCEELLKQYLNY  158



>ref|XP_009764546.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Nicotiana sylvestris]
Length=161

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 87/161 (54%), Gaps = 7/161 (4%)
 Frame = -1

Query  618  ALLIAAVIFLVSMLGVSGAEKPAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLE  439
            A LIA   F + +L  S A     G   + V G  YCD CR  F T   + + GAKV++E
Sbjct  2    ARLIA--FFTLCLLSASVASATFTGNP-FLVKGKAYCDTCRCGFETPATKYLAGAKVRIE  58

Query  438  CLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKE  259
            C +   E  TY++EG T+  G Y++    D  +D  C V  VKSP   C+   K    ++
Sbjct  59   CRHRVIEASTYTVEGVTNSKGEYNILVNSDRGDDA-CDVILVKSPDRTCT---KPNAGRD  114

Query  258  FTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCAEVFKELH  136
             +RV LT NNG++++TR  N + FL+ +P++ C ++ ++  
Sbjct  115  RSRVILTRNNGMISNTRFANAMGFLRDEPLSSCTQILQQYQ  155



>ref|XP_008363638.1| PREDICTED: olee1-like protein [Malus domestica]
Length=163

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 75/130 (58%), Gaps = 5/130 (4%)
 Frame = -1

Query  528  VTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGD  349
            V G VYCD CR +F TR++  + GA V LEC +  N  + Y +EG+TDKNG+Y L A   
Sbjct  31   VEGKVYCDPCRVQFETRLSTPVDGATVALECRSRENGTIVYVVEGKTDKNGIYSL-ASHK  89

Query  348  HDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPI  169
              E++IC V+ V+SP + C+    D +  E  R+ LT NNG+    R  NP+ F+  +  
Sbjct  90   XFEEQICEVRTVRSPTDQCA----DHFDFERARILLTDNNGVNALARYANPLGFMTKEST  145

Query  168  AVCAEVFKEL  139
              C  V KEL
Sbjct  146  YECEAVLKEL  155



>gb|AAV74343.1| Fra e 1.0102 major allergen [Fraxinus excelsior]
Length=145

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 78/143 (55%), Gaps = 4/143 (3%)
 Frame = -1

Query  555  PAAGKSRYKVTGTVYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNG  376
            P    S + V G VYCD CRA F+T ++E + GA V+L+C    N KVT++  G T   G
Sbjct  4    PQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKEKENGKVTFTEVGYTRAEG  63

Query  375  MYHLEAEGDHDEDEICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNP  196
            +Y +  E DH ++E C +  + S ++DC E+  + W K   +  L   NG    TR +NP
Sbjct  64   LYSMVIERDH-KNEFCEIVLLSSSRKDCHEIPTEGWVKPSLKFILNTVNG---TTRTINP  119

Query  195  ILFLKTKPIAVCAEVFKELHYIP  127
            + F K + +  C +V+ +L   P
Sbjct  120  LGFFKKEALPKCPQVYNKLGMYP  142



>gb|AEK85662.1| major pollen allergen Ole e1 [Olea europaea]
Length=130

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 76/130 (58%), Gaps = 4/130 (3%)
 Frame = -1

Query  516  VYCDVCRAKFVTRVAERMPGAKVKLECLNTTNEKVTYSLEGETDKNGMYHLEAEGDHDED  337
            +YCD CRA F+T ++E +PGA ++L+C +  N  VT++  G T   G+Y +  E DH ++
Sbjct  2    IYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSMLVERDH-KN  60

Query  336  EICGVKPVKSPKEDCSEVIKDMWAKEFTRVTLTANNGLVTDTRKVNPILFLKTKPIAVCA  157
            E C +  + S ++DC+E+  + W K   +  L   NG    TR VNP+ F K + +  CA
Sbjct  61   EFCEITLISSGRKDCNEIPTEGWVKPSLKFILNTVNG---TTRTVNPLGFFKKEALPKCA  117

Query  156  EVFKELHYIP  127
            +V+ +L   P
Sbjct  118  QVYNKLGMYP  127



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1154079434412