BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79648_g1_i1 len=251 path=[229:0-250]

Length=251
                                                                      Score     E

dbj|BAD99220.1|  polypeptide with an integrase domain                 94.7    9e-21   Petunia x hybrida [garden petunia]
ref|XP_009595927.1|  PREDICTED: uncharacterized protein LOC104092120  92.0    9e-20   
ref|XP_010324126.1|  PREDICTED: uncharacterized protein LOC104648502  89.0    4e-19   
gb|AAD25646.1|  putative retroelement pol polyprotein                 91.3    6e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010312989.1|  PREDICTED: uncharacterized protein LOC104644607  90.5    1e-18   
ref|XP_007032202.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  89.7    1e-18   
ref|XP_009784856.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  90.5    1e-18   
ref|XP_009796454.1|  PREDICTED: uncharacterized protein LOC104243030  89.0    2e-18   
ref|XP_009802374.1|  PREDICTED: uncharacterized protein LOC104247922  85.9    3e-18   
ref|XP_009771994.1|  PREDICTED: uncharacterized protein LOC104222458  89.0    3e-18   
emb|CAN63908.1|  hypothetical protein VITISV_044218                   89.4    3e-18   Vitis vinifera
ref|XP_009605677.1|  PREDICTED: uncharacterized protein LOC104100204  87.8    5e-18   
gb|AAF79879.1|AC000348_32  T7N9.5                                     88.6    5e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CAN68148.1|  hypothetical protein VITISV_035665                   88.6    6e-18   Vitis vinifera
ref|XP_004499523.1|  PREDICTED: uncharacterized protein LOC101509950  85.5    7e-18   
emb|CAN65820.1|  hypothetical protein VITISV_042324                   88.2    7e-18   Vitis vinifera
ref|XP_004235138.1|  PREDICTED: uncharacterized protein LOC101243773  87.8    7e-18   
ref|XP_009778056.1|  PREDICTED: uncharacterized protein LOC104227505  87.4    7e-18   
emb|CAN71595.1|  hypothetical protein VITISV_010143                   87.8    9e-18   Vitis vinifera
ref|XP_003599760.1|  Peptide transporter PTR2                         87.8    9e-18   
ref|XP_003599761.1|  Peptide transporter PTR2                         87.8    9e-18   
ref|XP_003605102.1|  Peptide transporter PTR2                         87.8    1e-17   
ref|XP_004240625.1|  PREDICTED: uncharacterized protein LOC101261123  87.4    1e-17   
ref|XP_009612658.1|  PREDICTED: uncharacterized protein LOC104105930  87.0    1e-17   
gb|ACB45089.1|  putative polyprotein                                  87.0    1e-17   Solanum habrochaites
ref|XP_009774503.1|  PREDICTED: uncharacterized protein LOC104224521  85.9    1e-17   
emb|CAN59949.1|  hypothetical protein VITISV_043423                   87.0    2e-17   Vitis vinifera
ref|XP_009591989.1|  PREDICTED: uncharacterized protein LOC104088926  86.7    2e-17   
ref|XP_004231154.1|  PREDICTED: uncharacterized protein LOC101251936  86.3    2e-17   
emb|CAA19696.1|  putative LTR retrotransposon (fragment)              83.2    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009623631.1|  PREDICTED: uncharacterized protein LOC104114778  85.9    4e-17   
emb|CDP21887.1|  unnamed protein product                              85.1    4e-17   
ref|XP_010436765.1|  PREDICTED: uncharacterized protein LOC104720575  82.4    5e-17   
gb|AAC67205.1|  putative retroelement pol polyprotein                 85.5    6e-17   Arabidopsis thaliana [mouse-ear cress]
emb|CAN82526.1|  hypothetical protein VITISV_028058                   85.5    6e-17   Vitis vinifera
dbj|BAA97287.1|  retroelement pol polyprotein-like                    85.5    6e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010692573.1|  PREDICTED: uncharacterized protein LOC104905670  85.1    7e-17   
emb|CAN65308.1|  hypothetical protein VITISV_002323                   84.7    1e-16   Vitis vinifera
ref|XP_010323506.1|  PREDICTED: uncharacterized protein LOC104648273  84.0    1e-16   
gb|AAD26943.1|  putative retroelement pol polyprotein                 84.3    2e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AAD41979.1|  putative retroelement pol polyprotein                 84.3    2e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AAB61111.1|  Strong similarity to Zea mays retrotransposon Hop...  84.0    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010424680.1|  PREDICTED: uncharacterized protein LOC104709822  84.0    2e-16   
ref|XP_010542220.1|  PREDICTED: uncharacterized protein LOC104815...  83.6    2e-16   
emb|CAN73696.1|  hypothetical protein VITISV_038483                   84.0    2e-16   Vitis vinifera
ref|XP_009631565.1|  PREDICTED: uncharacterized protein LOC104121310  82.4    3e-16   
ref|XP_009781844.1|  PREDICTED: uncharacterized protein LOC104230679  82.4    3e-16   
ref|XP_010317833.1|  PREDICTED: uncharacterized protein LOC104646241  82.8    4e-16   
ref|XP_006359484.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...  83.2    5e-16   
gb|AAF69161.1|AC007915_13  F27F5.19                                   82.8    5e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004228785.1|  PREDICTED: uncharacterized protein LOC101255821  82.8    5e-16   
ref|XP_010322961.1|  PREDICTED: uncharacterized protein LOC104648099  82.4    6e-16   
ref|XP_010495376.1|  PREDICTED: uncharacterized protein LOC104772464  82.4    6e-16   
gb|ABE88096.1|  Integrase, catalytic region                           81.6    8e-16   Medicago truncatula
ref|XP_009785772.1|  PREDICTED: uncharacterized protein LOC104233988  80.9    9e-16   
gb|AEJ72555.1|  putative retroelement polyprotein                     82.0    9e-16   
ref|XP_010412743.1|  PREDICTED: uncharacterized protein LOC104699096  81.6    1e-15   
ref|XP_010542100.1|  PREDICTED: uncharacterized protein LOC104815417  81.3    1e-15   
ref|XP_010414406.1|  PREDICTED: uncharacterized protein LOC104700...  80.5    1e-15   
emb|CAN62906.1|  hypothetical protein VITISV_043610                   81.6    1e-15   Vitis vinifera
dbj|BAB10503.1|  retroelement pol polyprotein-like                    81.6    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010670882.1|  PREDICTED: uncharacterized protein LOC104887829  80.9    1e-15   
ref|XP_009348351.1|  PREDICTED: uncharacterized protein LOC103939989  81.3    1e-15   
ref|XP_010325686.1|  PREDICTED: uncharacterized protein LOC104649000  81.3    2e-15   
ref|XP_010436828.1|  PREDICTED: uncharacterized protein LOC104720645  80.9    2e-15   
emb|CAN83125.1|  hypothetical protein VITISV_015109                   81.3    2e-15   Vitis vinifera
ref|XP_004498431.1|  PREDICTED: uncharacterized protein LOC101490285  80.9    2e-15   
ref|XP_009801985.1|  PREDICTED: uncharacterized protein LOC104247620  80.9    2e-15   
ref|XP_004149403.1|  PREDICTED: uncharacterized protein LOC101215551  80.1    2e-15   
ref|XP_010025850.1|  PREDICTED: uncharacterized protein LOC104416112  81.3    2e-15   
ref|XP_007023091.1|  Uncharacterized protein TCM_027093               80.9    2e-15   
ref|XP_004250863.1|  PREDICTED: uncharacterized protein LOC101267084  80.5    2e-15   
dbj|BAB10837.1|  retroelement pol polyprotein-like                    80.9    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010325276.1|  PREDICTED: uncharacterized protein LOC101260366  77.0    2e-15   
gb|AAD23883.1|  putative retroelement pol polyprotein                 80.9    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008778555.1|  PREDICTED: uncharacterized protein LOC103698337  80.5    2e-15   
gb|AAG09097.1|AC009323_8  Putative retroelement polyprotein           80.9    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010692480.1|  PREDICTED: uncharacterized protein LOC104905592  80.9    2e-15   
ref|XP_009128559.1|  PREDICTED: uncharacterized protein LOC103853393  80.5    2e-15   
ref|XP_004229082.1|  PREDICTED: uncharacterized protein LOC101247852  79.7    3e-15   
emb|CAN81026.1|  hypothetical protein VITISV_023317                   80.5    3e-15   Vitis vinifera
emb|CAN75292.1|  hypothetical protein VITISV_014745                   80.5    3e-15   Vitis vinifera
ref|XP_009804044.1|  PREDICTED: uncharacterized protein LOC104249333  79.7    4e-15   
ref|XP_011079197.1|  PREDICTED: uncharacterized protein LOC105162774  79.0    4e-15   
ref|XP_004955256.1|  PREDICTED: uncharacterized protein LOC101756543  78.6    4e-15   
emb|CAA72989.1|  unnamed protein product                              80.1    5e-15   Brassica oleracea
gb|KHN05285.1|  Retrovirus-related Pol polyprotein from transposo...  80.1    5e-15   
ref|XP_004149623.1|  PREDICTED: uncharacterized protein LOC101211618  79.7    6e-15   
ref|XP_009614489.1|  PREDICTED: uncharacterized protein LOC104107402  79.0    6e-15   
emb|CAN76546.1|  hypothetical protein VITISV_010420                   79.7    6e-15   Vitis vinifera
ref|XP_010463099.1|  PREDICTED: uncharacterized protein LOC104743749  79.3    7e-15   
gb|AAD19784.1|  putative retroelement pol polyprotein                 79.3    9e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004498023.1|  PREDICTED: uncharacterized protein LOC101511025  79.0    9e-15   
ref|XP_009109940.1|  PREDICTED: uncharacterized protein LOC103835509  79.0    9e-15   
gb|KHN01991.1|  Retrovirus-related Pol polyprotein from transposo...  79.0    1e-14   
ref|XP_010424200.1|  PREDICTED: uncharacterized protein LOC104709252  77.8    1e-14   
ref|XP_004246827.1|  PREDICTED: uncharacterized protein LOC101260567  78.6    1e-14   
ref|XP_009612717.1|  PREDICTED: uncharacterized protein LOC104105976  78.6    1e-14   
ref|XP_010030630.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  79.0    1e-14   
ref|XP_010513552.1|  PREDICTED: uncharacterized protein LOC104789576  78.6    1e-14   
emb|CAN83990.1|  hypothetical protein VITISV_018454                   78.6    1e-14   Vitis vinifera
ref|XP_010682952.1|  PREDICTED: uncharacterized protein LOC104897713  78.2    1e-14   
gb|AAB87099.1|  putative retroelement pol polyprotein                 78.2    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010677195.1|  PREDICTED: uncharacterized protein LOC104892872  77.8    2e-14   
ref|XP_010474506.1|  PREDICTED: uncharacterized protein LOC104754043  77.8    2e-14   
ref|XP_010325229.1|  PREDICTED: uncharacterized protein LOC104648889  77.4    3e-14   
ref|XP_009123624.1|  PREDICTED: uncharacterized protein LOC103848474  77.0    3e-14   
gb|AAG50751.1|AC079733_19  polyprotein, putative                      77.4    3e-14   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10743.1|  retroelement pol polyprotein-like                    77.4    4e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009123006.1|  PREDICTED: uncharacterized protein LOC103847675  77.4    4e-14   
ref|XP_010473846.1|  PREDICTED: uncharacterized protein LOC104753269  77.0    4e-14   
ref|XP_009597751.1|  PREDICTED: uncharacterized protein LOC104093673  76.3    4e-14   
ref|XP_010526682.1|  PREDICTED: retrovirus-related Pol polyprotei...  77.0    4e-14   
ref|XP_010526684.1|  PREDICTED: retrovirus-related Pol polyprotei...  77.0    4e-14   
emb|CAN82960.1|  hypothetical protein VITISV_004472                   75.9    5e-14   Vitis vinifera
ref|XP_010259176.1|  PREDICTED: uncharacterized protein LOC104598693  76.3    5e-14   
ref|XP_010526683.1|  PREDICTED: retrovirus-related Pol polyprotei...  76.6    5e-14   
emb|CAN80320.1|  hypothetical protein VITISV_034560                   77.0    6e-14   Vitis vinifera
gb|EPS62921.1|  hypothetical protein M569_11867                       77.0    6e-14   
ref|XP_010526681.1|  PREDICTED: retrovirus-related Pol polyprotei...  77.0    6e-14   
ref|XP_010526678.1|  PREDICTED: retrovirus-related Pol polyprotei...  77.0    6e-14   
gb|ABH07899.1|  putative polyprotein                                  77.0    6e-14   Solanum lycopersicum
emb|CAN81016.1|  hypothetical protein VITISV_025518                   77.0    6e-14   Vitis vinifera
ref|XP_010526680.1|  PREDICTED: retrovirus-related Pol polyprotei...  76.6    6e-14   
dbj|BAA97099.1|  retroelement pol polyprotein-like                    76.6    6e-14   Arabidopsis thaliana [mouse-ear cress]
emb|CAN74794.1|  hypothetical protein VITISV_041689                   76.3    7e-14   Vitis vinifera
emb|CAN71267.1|  hypothetical protein VITISV_017889                   76.6    8e-14   Vitis vinifera
emb|CAN79936.1|  hypothetical protein VITISV_033548                   76.3    9e-14   Vitis vinifera
ref|XP_004233950.1|  PREDICTED: uncharacterized protein LOC101265997  76.3    9e-14   
emb|CAN71164.1|  hypothetical protein VITISV_031057                   76.3    1e-13   Vitis vinifera
ref|XP_004231364.1|  PREDICTED: uncharacterized protein LOC101245809  75.9    1e-13   
ref|XP_009775421.1|  PREDICTED: uncharacterized protein LOC104225345  74.7    1e-13   
emb|CAA18107.1|  LTR retrotransposon like protein                     75.9    1e-13   Arabidopsis thaliana [mouse-ear cress]
gb|AAD24600.1|  putative retroelement pol polyprotein                 75.9    1e-13   Arabidopsis thaliana [mouse-ear cress]
emb|CAN79492.1|  hypothetical protein VITISV_033373                   75.9    2e-13   Vitis vinifera
ref|XP_010274487.1|  PREDICTED: uncharacterized protein LOC104609798  74.7    2e-13   
emb|CAN60374.1|  hypothetical protein VITISV_001215                   75.5    2e-13   Vitis vinifera
ref|XP_009596841.1|  PREDICTED: uncharacterized protein LOC104092864  75.1    2e-13   
ref|XP_010667912.1|  PREDICTED: uncharacterized protein LOC104884908  75.5    2e-13   
ref|XP_010665586.1|  PREDICTED: uncharacterized protein LOC104882867  75.1    2e-13   
emb|CAN61929.1|  hypothetical protein VITISV_014855                   75.5    2e-13   Vitis vinifera
emb|CAN63642.1|  hypothetical protein VITISV_038695                   75.1    2e-13   Vitis vinifera
ref|XP_009602905.1|  PREDICTED: uncharacterized protein LOC104097976  75.1    2e-13   
emb|CAN75041.1|  hypothetical protein VITISV_027174                   75.1    2e-13   Vitis vinifera
ref|XP_010675539.1|  PREDICTED: uncharacterized protein LOC104891530  75.1    2e-13   
ref|XP_010412617.1|  PREDICTED: uncharacterized protein LOC104698945  75.1    2e-13   
ref|XP_010675125.1|  PREDICTED: uncharacterized protein LOC104891164  74.7    3e-13   
ref|XP_010412990.1|  PREDICTED: uncharacterized protein LOC104699374  75.1    3e-13   
emb|CAN70907.1|  hypothetical protein VITISV_015933                   73.2    3e-13   Vitis vinifera
emb|CAN70361.1|  hypothetical protein VITISV_033646                   74.7    3e-13   Vitis vinifera
emb|CAN74229.1|  hypothetical protein VITISV_000584                   74.7    3e-13   Vitis vinifera
emb|CAN79142.1|  hypothetical protein VITISV_040460                   74.7    3e-13   Vitis vinifera
emb|CAN83290.1|  hypothetical protein VITISV_018945                   74.3    3e-13   Vitis vinifera
gb|AAT58770.1|  putative polyprotein                                  74.7    3e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009613779.1|  PREDICTED: uncharacterized protein LOC104106841  74.3    3e-13   
ref|XP_007034104.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  74.3    4e-13   
ref|XP_010317367.1|  PREDICTED: uncharacterized protein LOC101266092  71.6    4e-13   
ref|XP_009760003.1|  PREDICTED: uncharacterized protein LOC104212438  72.4    4e-13   
emb|CAN75186.1|  hypothetical protein VITISV_001913                   73.9    4e-13   Vitis vinifera
ref|XP_009602511.1|  PREDICTED: uncharacterized protein LOC104097618  73.9    4e-13   
emb|CAN77868.1|  hypothetical protein VITISV_001383                   73.9    4e-13   Vitis vinifera
dbj|BAB01972.1|  copia-like retrotransposable element                 74.3    4e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010260173.1|  PREDICTED: uncharacterized protein LOC104599359  73.9    5e-13   
emb|CAN72268.1|  hypothetical protein VITISV_017854                   73.9    5e-13   Vitis vinifera
ref|XP_007029159.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  73.2    5e-13   
ref|XP_008338000.1|  PREDICTED: uncharacterized protein LOC103401070  73.9    5e-13   
ref|XP_010690733.1|  PREDICTED: uncharacterized protein LOC104904233  73.6    5e-13   
emb|CAN67970.1|  hypothetical protein VITISV_025093                   73.9    5e-13   Vitis vinifera
emb|CAN62394.1|  hypothetical protein VITISV_021305                   73.9    6e-13   Vitis vinifera
ref|XP_010420948.1|  PREDICTED: uncharacterized protein LOC104706448  73.6    6e-13   
ref|XP_008372204.1|  PREDICTED: uncharacterized protein LOC103435597  73.9    6e-13   
emb|CAN67587.1|  hypothetical protein VITISV_036279                   73.2    9e-13   Vitis vinifera
ref|XP_010677705.1|  PREDICTED: uncharacterized protein LOC104893304  73.2    9e-13   
ref|NP_001174869.1|  Os06g0583500                                     69.3    1e-12   
ref|XP_004243080.1|  PREDICTED: uncharacterized protein LOC101259058  72.8    1e-12   
ref|XP_010695294.1|  PREDICTED: uncharacterized protein LOC104907962  72.4    2e-12   
ref|XP_009144811.1|  PREDICTED: uncharacterized protein LOC103868473  72.4    2e-12   
gb|AAG10817.1|AC011808_5  Putative retroelement polyprotein           72.8    2e-12   Arabidopsis thaliana [mouse-ear cress]
emb|CAN62271.1|  hypothetical protein VITISV_010713                   72.0    2e-12   Vitis vinifera
ref|XP_010696216.1|  PREDICTED: uncharacterized protein LOC104908765  71.2    2e-12   
emb|CAN67539.1|  hypothetical protein VITISV_021584                   72.4    2e-12   Vitis vinifera
ref|XP_008387850.1|  PREDICTED: uncharacterized protein LOC103450292  72.0    2e-12   
gb|AFN88207.1|  integrase core domain containing protein              72.0    2e-12   
emb|CAN64955.1|  hypothetical protein VITISV_029829                   72.0    3e-12   Vitis vinifera
ref|XP_010671949.1|  PREDICTED: uncharacterized protein LOC104888623  71.6    3e-12   
emb|CAN69870.1|  hypothetical protein VITISV_032283                   71.6    3e-12   Vitis vinifera
emb|CAD39831.3|  OSJNBa0079F16.4                                      72.0    3e-12   Oryza sativa [red rice]
ref|XP_009144144.1|  PREDICTED: uncharacterized protein LOC103867808  71.2    3e-12   
ref|XP_010412622.1|  PREDICTED: uncharacterized protein LOC104698950  71.2    3e-12   
gb|AAR88589.1|  putative copia-like retrotransposon protein           71.6    3e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010683416.1|  PREDICTED: uncharacterized protein LOC104898103  71.2    3e-12   
gb|EEE55237.1|  hypothetical protein OsJ_03115                        68.9    4e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010484894.1|  PREDICTED: uncharacterized protein LOC104763183  71.6    4e-12   
ref|XP_010669433.1|  PREDICTED: uncharacterized protein LOC104886664  70.9    4e-12   
emb|CAN75466.1|  hypothetical protein VITISV_025054                   71.6    4e-12   Vitis vinifera
ref|XP_008465178.1|  PREDICTED: uncharacterized protein LOC103502842  70.1    4e-12   
emb|CAN67362.1|  hypothetical protein VITISV_001157                   71.6    4e-12   Vitis vinifera
emb|CAN79175.1|  hypothetical protein VITISV_001884                   71.6    4e-12   Vitis vinifera
emb|CAN82483.1|  hypothetical protein VITISV_006799                   71.2    4e-12   Vitis vinifera
gb|EMT17614.1|  DNA-directed RNA polymerase I subunit RPA2            71.6    4e-12   
ref|XP_010688568.1|  PREDICTED: uncharacterized protein LOC104902479  71.2    4e-12   
gb|ABG00000.1|  retrotransposon protein, putative, Ty1-copia subc...  71.6    5e-12   Oryza sativa Japonica Group [Japonica rice]
emb|CAN68682.1|  hypothetical protein VITISV_024814                   71.2    5e-12   Vitis vinifera
ref|XP_009761987.1|  PREDICTED: uncharacterized protein LOC104214079  70.1    5e-12   
emb|CAN67245.1|  hypothetical protein VITISV_008680                   71.2    5e-12   Vitis vinifera
emb|CAN63081.1|  hypothetical protein VITISV_016842                   71.2    5e-12   Vitis vinifera
emb|CAN80566.1|  hypothetical protein VITISV_029672                   71.2    6e-12   Vitis vinifera
gb|AAC33963.1|  contains similarity to reverse transcriptases (Pf...  70.9    6e-12   Arabidopsis thaliana [mouse-ear cress]
gb|EEC72737.1|  hypothetical protein OsI_06355                        70.1    6e-12   Oryza sativa Indica Group [Indian rice]
emb|CAN75564.1|  hypothetical protein VITISV_032580                   70.9    6e-12   Vitis vinifera
ref|XP_010674610.1|  PREDICTED: uncharacterized protein LOC104890733  70.1    7e-12   
gb|ABA92122.1|  retrotransposon protein, putative, Ty1-copia subc...  70.5    7e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EEE52905.1|  hypothetical protein OsJ_35506                        70.5    7e-12   Oryza sativa Japonica Group [Japonica rice]
emb|CAN83378.1|  hypothetical protein VITISV_011333                   70.5    8e-12   Vitis vinifera
ref|NP_001067439.2|  Os11g0199800                                     70.5    8e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAK92587.1|AC074354_21  Putative retroelement                      70.5    8e-12   Oryza sativa [red rice]
gb|ABW74573.1|  putative pol polyprotein                              70.5    8e-12   Boechera divaricarpa
ref|XP_007030765.1|  Uncharacterized protein TCM_026511               70.5    8e-12   
emb|CAD39834.1|  OSJNBa0079F16.1                                      70.9    8e-12   Oryza sativa [red rice]
gb|AAL79695.1|AC087599_14  putative gag-pol polyprotein               70.5    9e-12   Oryza sativa [red rice]
emb|CAN62623.1|  hypothetical protein VITISV_001656                   70.5    9e-12   Vitis vinifera
gb|ABA99153.1|  retrotransposon protein, putative, Ty1-copia subc...  70.5    9e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAX96737.1|  retrotransposon protein, putative, Ty1-copia sub-...  70.5    1e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008672007.1|  PREDICTED: uncharacterized protein LOC100191...  67.4    1e-11   
emb|CAN60593.1|  hypothetical protein VITISV_023128                   70.5    1e-11   Vitis vinifera
emb|CAN71773.1|  hypothetical protein VITISV_002508                   70.1    1e-11   Vitis vinifera
emb|CAN69647.1|  hypothetical protein VITISV_022133                   70.5    1e-11   Vitis vinifera
ref|XP_007014929.1|  Uncharacterized protein TCM_040529               70.5    1e-11   
emb|CAN68902.1|  hypothetical protein VITISV_031323                   70.1    1e-11   Vitis vinifera
ref|XP_010242510.1|  PREDICTED: uncharacterized protein LOC104586844  70.1    1e-11   
ref|XP_007027939.1|  Uncharacterized protein TCM_022873               69.7    1e-11   
emb|CAN67447.1|  hypothetical protein VITISV_031398                   70.1    1e-11   Vitis vinifera
emb|CAN63530.1|  hypothetical protein VITISV_038849                   70.1    1e-11   Vitis vinifera
gb|AAT47108.1|  putative polyprotein                                  70.1    1e-11   Oryza sativa Japonica Group [Japonica rice]
emb|CAN72168.1|  hypothetical protein VITISV_004170                   70.1    1e-11   Vitis vinifera
emb|CAN68461.1|  hypothetical protein VITISV_037728                   69.3    1e-11   Vitis vinifera
gb|ABA96719.2|  retrotransposon protein, putative, unclassified       70.1    1e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009610755.1|  PREDICTED: uncharacterized protein LOC104104389  69.3    1e-11   
emb|CAN80469.1|  hypothetical protein VITISV_008623                   70.1    1e-11   Vitis vinifera
ref|XP_010684008.1|  PREDICTED: uncharacterized protein LOC104898610  69.7    1e-11   
ref|XP_009781907.1|  PREDICTED: uncharacterized protein LOC104230728  69.7    1e-11   
emb|CAN64580.1|  hypothetical protein VITISV_002159                   70.1    1e-11   Vitis vinifera
emb|CAN83937.1|  hypothetical protein VITISV_042335                   69.3    1e-11   Vitis vinifera
ref|XP_011085911.1|  PREDICTED: uncharacterized protein LOC105167794  68.6    1e-11   
emb|CAN70029.1|  hypothetical protein VITISV_010388                   69.7    2e-11   Vitis vinifera
ref|XP_009590306.1|  PREDICTED: uncharacterized protein LOC104087513  66.6    2e-11   
emb|CAN74984.1|  hypothetical protein VITISV_035210                   70.1    2e-11   Vitis vinifera
emb|CAN72886.1|  hypothetical protein VITISV_019713                   69.7    2e-11   Vitis vinifera
emb|CAN67119.1|  hypothetical protein VITISV_017483                   69.7    2e-11   Vitis vinifera
emb|CAN60609.1|  hypothetical protein VITISV_036599                   69.7    2e-11   Vitis vinifera
emb|CAN72663.1|  hypothetical protein VITISV_031849                   69.3    2e-11   Vitis vinifera
emb|CAN59964.1|  hypothetical protein VITISV_022757                   69.7    2e-11   Vitis vinifera
emb|CAN76679.1|  hypothetical protein VITISV_034325                   69.7    2e-11   Vitis vinifera
gb|ABA97008.1|  retrotransposon protein, putative, Ty1-copia subc...  69.7    2e-11   Oryza sativa Japonica Group [Japonica rice]
emb|CAN68802.1|  hypothetical protein VITISV_008809                   69.7    2e-11   Vitis vinifera
emb|CAN62538.1|  hypothetical protein VITISV_031159                   69.7    2e-11   Vitis vinifera
emb|CAN76032.1|  hypothetical protein VITISV_040150                   69.7    2e-11   Vitis vinifera
emb|CAN81385.1|  hypothetical protein VITISV_012324                   69.7    2e-11   Vitis vinifera
emb|CAN82928.1|  hypothetical protein VITISV_025045                   69.7    2e-11   Vitis vinifera
emb|CAN64765.1|  hypothetical protein VITISV_009574                   69.7    2e-11   Vitis vinifera
emb|CAN66087.1|  hypothetical protein VITISV_044185                   69.3    2e-11   Vitis vinifera
emb|CAN63881.1|  hypothetical protein VITISV_039357                   69.7    2e-11   Vitis vinifera
emb|CAN67317.1|  hypothetical protein VITISV_019719                   69.7    2e-11   Vitis vinifera
emb|CAN60149.1|  hypothetical protein VITISV_016363                   69.3    2e-11   Vitis vinifera
emb|CAN61179.1|  hypothetical protein VITISV_032292                   69.3    2e-11   Vitis vinifera
emb|CAN80547.1|  hypothetical protein VITISV_010898                   69.3    2e-11   Vitis vinifera
emb|CAN60498.1|  hypothetical protein VITISV_027869                   69.7    2e-11   Vitis vinifera
emb|CAN71185.1|  hypothetical protein VITISV_014270                   69.3    2e-11   Vitis vinifera
emb|CAN65410.1|  hypothetical protein VITISV_040416                   69.7    2e-11   Vitis vinifera
ref|XP_010675988.1|  PREDICTED: uncharacterized protein LOC104891900  69.3    2e-11   
emb|CAN66125.1|  hypothetical protein VITISV_044030                   69.3    2e-11   Vitis vinifera
emb|CAN78598.1|  hypothetical protein VITISV_001332                   69.3    2e-11   Vitis vinifera
emb|CAN76332.1|  hypothetical protein VITISV_006269                   69.3    2e-11   Vitis vinifera
emb|CAN75744.1|  hypothetical protein VITISV_040125                   69.3    2e-11   Vitis vinifera
emb|CAN63955.1|  hypothetical protein VITISV_034255                   69.3    2e-11   Vitis vinifera
emb|CAN61011.1|  hypothetical protein VITISV_038445                   69.3    2e-11   Vitis vinifera
emb|CAN80771.1|  hypothetical protein VITISV_027574                   69.3    2e-11   Vitis vinifera
emb|CAN72440.1|  hypothetical protein VITISV_039162                   69.3    2e-11   Vitis vinifera
emb|CAN67992.1|  hypothetical protein VITISV_015686                   69.3    2e-11   Vitis vinifera
emb|CAN78715.1|  hypothetical protein VITISV_030863                   69.3    2e-11   
emb|CAN62317.1|  hypothetical protein VITISV_026526                   68.9    2e-11   
gb|AAT07563.1|  putative polyprotein                                  69.3    2e-11   
emb|CAN74286.1|  hypothetical protein VITISV_036410                   69.3    2e-11   
emb|CAN73074.1|  hypothetical protein VITISV_032386                   69.3    2e-11   
ref|XP_010436367.1|  PREDICTED: uncharacterized protein LOC104720097  68.9    2e-11   
emb|CAN80753.1|  hypothetical protein VITISV_003323                   69.3    2e-11   
emb|CAN62535.1|  hypothetical protein VITISV_041880                   69.3    2e-11   
emb|CAN81217.1|  hypothetical protein VITISV_020309                   69.3    2e-11   
emb|CAN71436.1|  hypothetical protein VITISV_039529                   69.3    2e-11   
ref|XP_009619091.1|  PREDICTED: uncharacterized protein LOC104111161  68.9    2e-11   
emb|CAN81139.1|  hypothetical protein VITISV_018760                   69.3    2e-11   
emb|CAN76965.1|  hypothetical protein VITISV_043961                   69.3    2e-11   
emb|CAH67640.1|  H0102C09.1                                           69.3    3e-11   
emb|CAN67076.1|  hypothetical protein VITISV_042382                   68.9    3e-11   
ref|XP_004516485.1|  PREDICTED: uncharacterized protein LOC101509602  68.6    3e-11   
emb|CAE04295.2|  OSJNBa0083I11.5                                      68.9    3e-11   
emb|CAN79281.1|  hypothetical protein VITISV_034553                   68.6    3e-11   
ref|XP_009588195.1|  PREDICTED: uncharacterized protein LOC104085776  68.2    3e-11   
ref|XP_010672345.1|  PREDICTED: uncharacterized protein LOC104888929  68.6    3e-11   
ref|XP_008450155.1|  PREDICTED: uncharacterized protein LOC103491828  68.2    3e-11   
ref|XP_010676001.1|  PREDICTED: uncharacterized protein LOC104891911  68.2    3e-11   
emb|CAN62074.1|  hypothetical protein VITISV_001619                   68.6    4e-11   
emb|CAN76645.1|  hypothetical protein VITISV_004685                   68.6    4e-11   
emb|CAN73272.1|  hypothetical protein VITISV_013115                   68.6    4e-11   
emb|CAN83015.1|  hypothetical protein VITISV_041694                   68.6    4e-11   
emb|CAN69804.1|  hypothetical protein VITISV_017631                   68.6    4e-11   
gb|AAC67200.1|  putative retroelement pol polyprotein                 68.6    4e-11   
emb|CAN82171.1|  hypothetical protein VITISV_040546                   68.6    4e-11   
gb|AAO17005.1|  Putative gag-pol polyprotein                          68.6    5e-11   
ref|XP_009610721.1|  PREDICTED: uncharacterized protein LOC104104361  67.8    5e-11   
emb|CAN63730.1|  hypothetical protein VITISV_030286                   68.6    5e-11   
emb|CAN81362.1|  hypothetical protein VITISV_013815                   68.6    5e-11   
gb|ABA96076.1|  retrotransposon protein, putative, unclassified       68.2    5e-11   
ref|XP_009335215.1|  PREDICTED: uncharacterized protein LOC103927954  68.6    5e-11   
emb|CAN79148.1|  hypothetical protein VITISV_004343                   68.2    5e-11   
ref|XP_010321261.1|  PREDICTED: uncharacterized protein LOC104647531  67.8    5e-11   
ref|XP_010690723.1|  PREDICTED: uncharacterized protein LOC104904224  67.8    5e-11   
emb|CAN63782.1|  hypothetical protein VITISV_010855                   67.8    5e-11   
emb|CAN67762.1|  hypothetical protein VITISV_040650                   68.2    5e-11   
ref|XP_010278082.1|  PREDICTED: uncharacterized protein LOC104612388  68.2    5e-11   
emb|CAN73924.1|  hypothetical protein VITISV_041509                   68.2    5e-11   
emb|CAN72018.1|  hypothetical protein VITISV_001841                   68.2    5e-11   
ref|XP_010113352.1|  Retrovirus-related Pol polyprotein from tran...  68.6    5e-11   
ref|XP_008654354.1|  PREDICTED: uncharacterized protein LOC100193...  67.8    6e-11   
ref|XP_008654353.1|  PREDICTED: uncharacterized protein LOC100193...  67.8    6e-11   
gb|AAK26118.1|AC084406_1  putative gag-pol polyprotein                68.2    6e-11   
ref|NP_001173583.1|  Os03g0680566                                     68.2    6e-11   
gb|AAG51258.1|AC025782_3  Ty1/copia-element polyprotein               67.8    6e-11   
gb|ABF98209.1|  retrotransposon protein, putative, Ty1-copia subc...  68.2    6e-11   
ref|XP_008654352.1|  PREDICTED: uncharacterized protein LOC100193...  67.8    6e-11   
emb|CAN82075.1|  hypothetical protein VITISV_016661                   67.8    7e-11   
emb|CAN60274.1|  hypothetical protein VITISV_024841                   67.8    7e-11   
emb|CAN79422.1|  hypothetical protein VITISV_002126                   67.8    7e-11   
emb|CAN74310.1|  hypothetical protein VITISV_037517                   67.8    7e-11   
emb|CAN67449.1|  hypothetical protein VITISV_031400                   67.8    7e-11   
emb|CAN61272.1|  hypothetical protein VITISV_039063                   67.8    8e-11   
emb|CAN81712.1|  hypothetical protein VITISV_038973                   67.8    9e-11   
ref|XP_009759202.1|  PREDICTED: uncharacterized protein LOC104211777  64.7    9e-11   
gb|AAT38747.2|  Polyprotein, putative                                 67.4    9e-11   
ref|XP_009757051.1|  PREDICTED: uncharacterized protein LOC104209975  67.0    9e-11   
ref|XP_010683397.1|  PREDICTED: uncharacterized protein LOC104898087  67.4    9e-11   
emb|CAN71931.1|  hypothetical protein VITISV_013418                   67.0    1e-10   
ref|NP_001175469.1|  Os08g0248500                                     67.4    1e-10   
gb|AAN05503.1|  Putative gag-pol polyprotein                          67.4    1e-10   
emb|CAE03128.3|  OJ000114_01.9                                        67.4    1e-10   
gb|AAG60200.1|AC084763_20  putative gag-pol polyprotein               67.4    1e-10   
emb|CAN82105.1|  hypothetical protein VITISV_002577                   67.4    1e-10   
ref|XP_003621710.1|  Receptor-like protein kinase                     67.4    1e-10   
gb|ABA98049.1|  retrotransposon protein, putative, Ty1-copia subc...  67.4    1e-10   
ref|XP_010273338.1|  PREDICTED: uncharacterized protein LOC104608907  67.4    1e-10   
emb|CAN82851.1|  hypothetical protein VITISV_027998                   67.4    1e-10   
gb|AAD32906.1|  putative retroelement pol polyprotein                 67.0    1e-10   
emb|CAN80930.1|  hypothetical protein VITISV_005279                   67.4    1e-10   
emb|CAN77122.1|  hypothetical protein VITISV_013624                   67.0    1e-10   
ref|XP_007028485.1|  Uncharacterized protein TCM_024324               63.9    1e-10   
emb|CAN62266.1|  hypothetical protein VITISV_025647                   67.0    1e-10   
gb|ABI34342.1|  Polyprotein, putative                                 67.0    1e-10   
emb|CAN79221.1|  hypothetical protein VITISV_038587                   66.6    1e-10   
gb|EEE57553.1|  hypothetical protein OsJ_07890                        66.2    1e-10   
emb|CAN66416.1|  hypothetical protein VITISV_044133                   67.0    1e-10   
emb|CAN69184.1|  hypothetical protein VITISV_004341                   67.0    1e-10   
emb|CAN64963.1|  hypothetical protein VITISV_002891                   67.0    2e-10   
dbj|BAG98101.1|  unnamed protein product                              66.2    2e-10   
ref|XP_011070152.1|  PREDICTED: uncharacterized protein LOC105155865  66.6    2e-10   
ref|XP_010424226.1|  PREDICTED: uncharacterized protein LOC104709284  66.2    2e-10   
emb|CAN70229.1|  hypothetical protein VITISV_024789                   66.6    2e-10   
emb|CAN68235.1|  hypothetical protein VITISV_037104                   67.0    2e-10   
emb|CAN72710.1|  hypothetical protein VITISV_018096                   66.6    2e-10   
emb|CAN69307.1|  hypothetical protein VITISV_001120                   66.6    2e-10   
ref|XP_009377534.1|  PREDICTED: uncharacterized protein LOC103966118  66.6    2e-10   
emb|CDN96898.1|  putative Ty-1 copia retrotransposon                  66.2    2e-10   
emb|CAN70669.1|  hypothetical protein VITISV_037506                   66.6    2e-10   
emb|CAN77072.1|  hypothetical protein VITISV_006213                   66.2    2e-10   
emb|CAN69597.1|  hypothetical protein VITISV_038518                   66.6    2e-10   
ref|XP_008347438.1|  PREDICTED: uncharacterized protein LOC103410522  66.2    2e-10   
gb|AAK09230.1|AC084320_17  putative copia-like retrotransposon Ho...  66.2    2e-10   
emb|CAN75900.1|  hypothetical protein VITISV_033582                   66.2    2e-10   
emb|CAN73014.1|  hypothetical protein VITISV_007603                   66.2    2e-10   
emb|CAN82380.1|  hypothetical protein VITISV_021579                   66.2    3e-10   
gb|ABI34329.1|  Integrase core domain containing protein              66.2    3e-10   
emb|CAN73234.1|  hypothetical protein VITISV_033857                   66.2    3e-10   
ref|XP_010051209.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  66.2    3e-10   
emb|CAN79116.1|  hypothetical protein VITISV_002093                   65.9    3e-10   
emb|CAN76151.1|  hypothetical protein VITISV_012673                   65.9    3e-10   
emb|CAN66243.1|  hypothetical protein VITISV_015916                   65.9    3e-10   
emb|CAB10225.1|  retrovirus-related like polyprotein                  65.9    3e-10   
ref|XP_008651726.1|  PREDICTED: hypothetical protein isoform X1       65.9    3e-10   
gb|KHN06274.1|  Retrovirus-related Pol polyprotein from transposo...  65.9    3e-10   
dbj|BAG94704.1|  unnamed protein product                              65.9    3e-10   
gb|AAU90089.1|  putative polyprotein                                  65.9    3e-10   
ref|NP_001059837.1|  Os07g0528100                                     65.9    3e-10   
emb|CAN81355.1|  hypothetical protein VITISV_039158                   65.9    4e-10   
gb|ADB85253.1|  putative retrotransposon protein                      65.5    4e-10   
emb|CAN67925.1|  hypothetical protein VITISV_021168                   65.9    4e-10   
emb|CAN74104.1|  hypothetical protein VITISV_008952                   65.9    4e-10   
emb|CAN71748.1|  hypothetical protein VITISV_019194                   65.9    4e-10   
ref|XP_003376336.1|  retrovirus-related Pol polyprotein from tran...  65.5    4e-10   
gb|ABY49842.1|  hypothetical protein                                  65.9    4e-10   
emb|CAC95126.1|  gag-pol polyprotein                                  65.9    4e-10   
emb|CAN78464.1|  hypothetical protein VITISV_025101                   65.5    4e-10   
ref|XP_010268948.1|  PREDICTED: uncharacterized protein LOC104605761  65.5    4e-10   
emb|CAN77210.1|  hypothetical protein VITISV_000141                   65.5    4e-10   
ref|XP_003376808.1|  retrovirus-related Pol polyprotein from tran...  65.5    4e-10   
emb|CAN70109.1|  hypothetical protein VITISV_001696                   65.5    4e-10   
emb|CAN65095.1|  hypothetical protein VITISV_011639                   65.5    5e-10   
emb|CBL94154.1|  putative polyprotein (retrotrasposon protein)        65.5    5e-10   
emb|CAN81496.1|  hypothetical protein VITISV_031970                   65.5    5e-10   
emb|CDH30699.1|  putative Ty1-copia-like retrotransposon              65.1    5e-10   
emb|CAN68348.1|  hypothetical protein VITISV_032025                   65.5    5e-10   
ref|XP_009795207.1|  PREDICTED: uncharacterized protein LOC104241936  65.1    5e-10   
ref|XP_008348795.1|  PREDICTED: uncharacterized protein LOC103411964  65.1    5e-10   
ref|XP_008669041.1|  PREDICTED: uncharacterized protein LOC103646095  65.1    5e-10   
emb|CBL54154.1|  hypothetical protein                                 63.2    5e-10   
emb|CAN63649.1|  hypothetical protein VITISV_037657                   65.5    5e-10   
ref|WP_039533890.1|  hypothetical protein                             62.0    5e-10   
emb|CAN67418.1|  hypothetical protein VITISV_005919                   65.1    5e-10   
gb|AAC61290.1|  putative retroelement pol polyprotein                 65.1    6e-10   
ref|XP_006826143.1|  hypothetical protein AMTR_s05704p00000690        64.3    6e-10   
emb|CAN71759.1|  hypothetical protein VITISV_020777                   65.1    6e-10   
emb|CAN74847.1|  hypothetical protein VITISV_028741                   65.1    6e-10   
emb|CAN70298.1|  hypothetical protein VITISV_001396                   65.1    6e-10   
ref|XP_010646662.1|  PREDICTED: retrovirus-related Pol polyprotei...  63.9    6e-10   
ref|XP_002459747.1|  hypothetical protein SORBIDRAFT_02g009798        63.2    6e-10   
gb|KFD67386.1|  hypothetical protein M514_20422                       64.7    7e-10   
emb|CAN60366.1|  hypothetical protein VITISV_031870                   65.1    7e-10   
emb|CAN73484.1|  hypothetical protein VITISV_029448                   64.7    7e-10   
emb|CAN73941.1|  hypothetical protein VITISV_013119                   64.3    7e-10   
emb|CAN75051.1|  hypothetical protein VITISV_020117                   65.1    7e-10   
emb|CAN70756.1|  hypothetical protein VITISV_014702                   65.1    7e-10   
emb|CAN69998.1|  hypothetical protein VITISV_006839                   64.7    7e-10   
ref|XP_008674201.1|  PREDICTED: uncharacterized protein LOC100279...  65.1    7e-10   
emb|CAN82610.1|  hypothetical protein VITISV_021745                   64.7    7e-10   
ref|NP_001172702.1|  Os01g0909600                                     63.5    8e-10   
emb|CAN60238.1|  hypothetical protein VITISV_032906                   64.7    8e-10   
emb|CCI55340.1|  PH01B019A14.9                                        65.1    8e-10   
emb|CAN76196.1|  hypothetical protein VITISV_041073                   64.7    8e-10   
ref|XP_008647645.1|  PREDICTED: uncharacterized protein LOC100502...  64.7    8e-10   
emb|CAN67247.1|  hypothetical protein VITISV_008682                   64.7    8e-10   
gb|EMS18077.1|  Gag-Pol polyprotein                                   64.7    8e-10   
gb|KFD67411.1|  LOW QUALITY PROTEIN: hypothetical protein M514_20447  64.7    8e-10   
emb|CAN80919.1|  hypothetical protein VITISV_002640                   64.7    8e-10   
ref|XP_008674202.1|  PREDICTED: retrovirus-related Pol polyprotei...  64.7    8e-10   
emb|CAN75533.1|  hypothetical protein VITISV_024796                   64.7    8e-10   
gb|KFD66862.1|  hypothetical protein M514_21006                       64.7    9e-10   
emb|CAN73002.1|  hypothetical protein VITISV_044056                   64.7    9e-10   
ref|XP_009778353.1|  PREDICTED: uncharacterized protein LOC104227744  64.7    9e-10   
emb|CAN71586.1|  hypothetical protein VITISV_009568                   64.7    9e-10   
emb|CAN82221.1|  hypothetical protein VITISV_015226                   64.7    9e-10   
ref|XP_004499927.1|  PREDICTED: uncharacterized protein LOC101502660  63.2    9e-10   
emb|CAN64225.1|  hypothetical protein VITISV_016222                   64.7    9e-10   
emb|CDP17738.1|  unnamed protein product                              64.3    9e-10   
emb|CAN62755.1|  hypothetical protein VITISV_008109                   64.3    9e-10   
emb|CAN70260.1|  hypothetical protein VITISV_002223                   64.3    9e-10   
emb|CAN73765.1|  hypothetical protein VITISV_035279                   64.7    1e-09   
ref|XP_003626389.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...  63.9    1e-09   
emb|CAN82285.1|  hypothetical protein VITISV_039753                   64.3    1e-09   
emb|CAN82359.1|  hypothetical protein VITISV_027367                   64.3    1e-09   
gb|EEC72005.1|  hypothetical protein OsI_04866                        62.4    1e-09   
emb|CAN65540.1|  hypothetical protein VITISV_029946                   64.3    1e-09   
ref|XP_008369089.1|  PREDICTED: uncharacterized protein LOC103432662  64.3    1e-09   
emb|CAN64452.1|  hypothetical protein VITISV_009528                   64.3    1e-09   
ref|XP_008356535.1|  PREDICTED: uncharacterized protein LOC103420252  64.3    1e-09   
emb|CAN72429.1|  hypothetical protein VITISV_006530                   63.2    1e-09   
ref|NP_001061718.1|  Os08g0389500                                     63.9    1e-09   
emb|CAN76340.1|  hypothetical protein VITISV_026819                   63.5    1e-09   
gb|KFD69490.1|  hypothetical protein M514_18362                       63.5    2e-09   
emb|CDP15021.1|  unnamed protein product                              63.5    2e-09   
gb|AAC35532.1|  contains similarity to proteases                      63.9    2e-09   
ref|XP_008801814.1|  PREDICTED: phosphoglucan phosphatase LSF1, c...  63.2    2e-09   
emb|CAN76078.1|  hypothetical protein VITISV_008973                   63.9    2e-09   
gb|KFD61333.1|  hypothetical protein M514_12060                       63.9    2e-09   
emb|CAB40035.1|  retrotransposon like protein                         63.9    2e-09   
gb|AGJ83729.1|  gag-pol polyprotein                                   63.5    2e-09   
gb|AAM22735.1|AC092388_19  putative gag/pol polyprotein               63.9    2e-09   
gb|KGO39027.1|  Integrase, catalytic core                             63.5    2e-09   
gb|KFD47072.1|  hypothetical protein M513_12060                       63.9    2e-09   
gb|KFD66912.1|  hypothetical protein M514_20778                       62.4    2e-09   
emb|CAN76550.1|  hypothetical protein VITISV_031906                   63.5    2e-09   
emb|CAN63629.1|  hypothetical protein VITISV_018697                   63.5    2e-09   
gb|AGM34082.1|  hypothetical protein                                  63.9    2e-09   
emb|CAN72951.1|  hypothetical protein VITISV_020157                   63.2    2e-09   
emb|CAN71205.1|  hypothetical protein VITISV_025164                   63.5    2e-09   
emb|CAN63276.1|  hypothetical protein VITISV_000400                   63.5    2e-09   
gb|ACI62137.1|  polyprotein                                           63.5    2e-09   
emb|CAD41731.1|  OSJNBb0034I13.10                                     63.5    2e-09   
ref|NP_001064098.1|  Os10g0130700                                     63.5    2e-09   
emb|CAH66624.1|  OSIGBa0115A19.5                                      63.5    2e-09   
emb|CAN77807.1|  hypothetical protein VITISV_036095                   63.5    2e-09   
sp|P10978.1|POLX_TOBAC  RecName: Full=Retrovirus-related Pol poly...  63.5    2e-09   
emb|CAN72676.1|  hypothetical protein VITISV_020406                   63.5    2e-09   
emb|CAN68489.1|  hypothetical protein VITISV_037543                   63.5    2e-09   
ref|XP_010318469.1|  PREDICTED: uncharacterized protein LOC101252...  63.2    2e-09   
emb|CAN71132.1|  hypothetical protein VITISV_007235                   63.5    2e-09   
emb|CAN66898.1|  hypothetical protein VITISV_037436                   63.5    2e-09   
emb|CAN63534.1|  hypothetical protein VITISV_001206                   63.5    2e-09   
emb|CAN65932.1|  hypothetical protein VITISV_016257                   62.8    2e-09   
gb|AAF02855.1|AC009324_4  Similar to retrotransposon proteins         63.5    2e-09   
emb|CAN61548.1|  hypothetical protein VITISV_043524                   63.5    2e-09   
emb|CAN65867.1|  hypothetical protein VITISV_034935                   63.5    2e-09   
gb|ABN06155.1|  Polynucleotidyl transferase, Ribonuclease H fold      60.1    2e-09   



>dbj|BAD99220.1| polypeptide with an integrase domain [Petunia x hybrida]
Length=492

 Score = 94.7 bits (234),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            F  MK ++ L   V   +   CD+C +++Q + PFP S+  S  CFEL+H D WGPY+V 
Sbjct  25   FHAMKTIKTLPVTVDNKQTFPCDICPMARQSKPPFPSSTIKSKQCFELIHIDTWGPYNVP  84

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            T  G +YFLT+VDDFSR TW +L
Sbjct  85   TYKGERYFLTIVDDFSRATWTYL  107



>ref|XP_009595927.1| PREDICTED: uncharacterized protein LOC104092120 [Nicotiana tomentosiformis]
Length=467

 Score = 92.0 bits (227),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 55/81 (68%), Gaps = 2/81 (2%)
 Frame = -3

Query  237  KLLQLLD--SDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTI  64
            K+LQ +D    V +  +  C +C L+K+ RLPFP S++ +   FELVH D+WGPY V T 
Sbjct  243  KILQQMDICKAVNIADDRTCSICPLAKKTRLPFPQSTTRAGKVFELVHGDVWGPYKVSTH  302

Query  63   YGHQYFLTLVDDFSRLTWVFL  1
             GH++FL LVDD SR+ W+FL
Sbjct  303  DGHRFFLILVDDCSRMVWIFL  323



>ref|XP_010324126.1| PREDICTED: uncharacterized protein LOC104648502 [Solanum lycopersicum]
Length=378

 Score = 89.0 bits (219),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            CDVC LS+Q RLPFP SSS++A+ F L+H D+ GPYH+ T  G +YFLTLVDD +R TW+
Sbjct  306  CDVCPLSRQTRLPFPVSSSSTADVFHLIHLDVRGPYHIETHNGMKYFLTLVDDHTRWTWI  365

Query  6    FL  1
            FL
Sbjct  366  FL  367



>gb|AAD25646.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1461

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 63/85 (74%), Gaps = 2/85 (2%)
 Frame = -3

Query  249  FSKM-KLLQLLDSDVKVNKESA-CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYH  76
            FS++  L ++L +    NK+SA C VCHL+KQK+L FP +++   + FEL+H D+WGP+ 
Sbjct  578  FSRLDSLSEVLGTTRHKNKKSAYCHVCHLAKQKKLSFPSANNICNSTFELLHIDVWGPFS  637

Query  75   VHTIYGHQYFLTLVDDFSRLTWVFL  1
            V T+ G++YFLT+VDD SR TW++L
Sbjct  638  VETVEGYKYFLTIVDDHSRATWIYL  662



>ref|XP_010312989.1| PREDICTED: uncharacterized protein LOC104644607 [Solanum lycopersicum]
Length=926

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 5/73 (7%)
 Frame = -3

Query  204  VNKESACD-----VCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLT  40
            VNK+SAC      VC  +KQ R  FP SS  S  CFEL+H D+WGPY+  TI G +YFLT
Sbjct  485  VNKQSACRISKCLVCPYAKQTRNVFPKSSIKSTACFELLHVDLWGPYNTTTIDGKKYFLT  544

Query  39   LVDDFSRLTWVFL  1
            +VDDFSR+TW+FL
Sbjct  545  IVDDFSRVTWLFL  557



>ref|XP_007032202.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
 gb|EOY03128.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
Length=647

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = -3

Query  243  KMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTI  64
            KMK ++ +  D+   + S C VC L+KQK LPF     +S   F+L+H +IWGPY+V++I
Sbjct  332  KMKQIKQVCPDIFFKESSVCYVCPLAKQKHLPFLVHVKSSKAPFDLIHTNIWGPYYVNSI  391

Query  63   YGHQYFLTLVDDFSRLTWVFL  1
            + +QYFLT+VDDF+R TWVFL
Sbjct  392  HRYQYFLTIVDDFTRFTWVFL  412



>ref|XP_009784856.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104233198 
[Nicotiana sylvestris]
Length=1447

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            F KM+ +  L + V   +   C +C +++Q+RLPF DS+  S   F+LVH DIWGPY+  
Sbjct  550  FRKMQSISFLSNKVSAKQPFICSICPMARQQRLPFYDSTIHSTKPFQLVHIDIWGPYNTK  609

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            T  G +YFLTLVDDF+R+TW  L
Sbjct  610  TYNGFRYFLTLVDDFTRVTWTHL  632



>ref|XP_009796454.1| PREDICTED: uncharacterized protein LOC104243030 [Nicotiana sylvestris]
Length=783

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            F KMK +  + ++    +   C +C +++Q+RLPFP  +ST+   FEL+H D+WGPYHV 
Sbjct  483  FVKMKKITSIPANFSAKQPFNCTICPMARQERLPFPQKTSTTNRIFELLHVDMWGPYHVP  542

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
                H+YF+T+VDD+SR TW  L
Sbjct  543  IHDRHKYFITIVDDYSRSTWTHL  565



>ref|XP_009802374.1| PREDICTED: uncharacterized protein LOC104247922, partial [Nicotiana 
sylvestris]
Length=232

 Score = 85.9 bits (211),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            C++C +++Q RLPFPDSS  S+  F+++H D WGPYH +   G +YFLT+VDDF+R TW 
Sbjct  36   CNICPMARQTRLPFPDSSIHSSKPFQIIHVDTWGPYHTYAYSGSKYFLTIVDDFTRSTWT  95

Query  6    FL  1
             L
Sbjct  96   HL  97



>ref|XP_009771994.1| PREDICTED: uncharacterized protein LOC104222458 [Nicotiana sylvestris]
Length=902

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            F KMK +  + ++    +   C +C +++Q+RLPFP  +S S   FEL+H D+WGPYH+ 
Sbjct  653  FVKMKRITSIPANFSPKQPFTCTICPMARQERLPFPQKTSVSNKIFELLHVDLWGPYHIP  712

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            T   H+YF+T+VDD+SR TW  L
Sbjct  713  THDKHKYFVTVVDDYSRSTWTHL  735



>emb|CAN63908.1| hypothetical protein VITISV_044218 [Vitis vinifera]
Length=1236

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -3

Query  195  ESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRL  16
             +ACDVC L+KQ+RLPF  SS +S   FEL+H DIWGPY + ++   +YFLT+VDD+SR 
Sbjct  527  NNACDVCALAKQRRLPFSVSSISSVRPFELIHCDIWGPYKIASLSSAKYFLTIVDDYSRF  586

Query  15   TWVF  4
            TWVF
Sbjct  587  TWVF  590



>ref|XP_009605677.1| PREDICTED: uncharacterized protein LOC104100204 [Nicotiana tomentosiformis]
Length=614

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            F+KMK +  +   +   +   CD+C +++Q R+PFPDSS  +   F+L+H DIWG YH  
Sbjct  506  FAKMKCISEISHVISYVQSFPCDICPMARQTRIPFPDSSIHTFKPFQLIHVDIWGSYHTP  565

Query  69   TIYGHQYFLTLVDDFSRLTW  10
            T  G +YFLT+VDDFSR TW
Sbjct  566  TYSGSRYFLTIVDDFSRSTW  585



>gb|AAF79879.1|AC000348_32 T7N9.5 [Arabidopsis thaliana]
Length=1436

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 58/86 (67%), Gaps = 3/86 (3%)
 Frame = -3

Query  249  FSKMKLLQ--LLDSDVKVNKESA-CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPY  79
            F+K+  L   L+    K+NK+S+ C VCHLSKQK LPF   +      FELVH D WGP+
Sbjct  567  FAKIDTLSDVLMLPKQKINKDSSHCHVCHLSKQKHLPFKSVNHIREKAFELVHIDTWGPF  626

Query  78   HVHTIYGHQYFLTLVDDFSRLTWVFL  1
             V T+  ++YFLT+VDDFSR TW++L
Sbjct  627  SVPTVDSYRYFLTIVDDFSRATWIYL  652



>emb|CAN68148.1| hypothetical protein VITISV_035665 [Vitis vinifera]
Length=1813

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            FS+ KLL  L  D+     + C +C  +KQ RLPFP SS T+   F L+H D+WGP+ + 
Sbjct  779  FSRFKLLSRLLPDIHKEIGNHCPICPQAKQTRLPFPKSSITTKFPFSLLHCDVWGPHKIP  838

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
               G +YFLT+VDDFSR TW+FL
Sbjct  839  AHTGSRYFLTIVDDFSRCTWIFL  861



>ref|XP_004499523.1| PREDICTED: uncharacterized protein LOC101509950 [Cicer arietinum]
Length=370

 Score = 85.5 bits (210),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = -3

Query  210  VKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVD  31
            V  N    CD C+L+KQ RLPF  S++ S N F+L+H DIWGP    +I+GH+YFLT+VD
Sbjct  261  VSFNSYKICDSCYLAKQSRLPFNASNTISDNAFDLIHMDIWGPLSHSSIHGHKYFLTIVD  320

Query  30   DFSRLTWVFL  1
            D +R TW++L
Sbjct  321  DCTRHTWIYL  330



>emb|CAN65820.1| hypothetical protein VITISV_042324 [Vitis vinifera]
Length=1262

 Score = 88.2 bits (217),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = -3

Query  246  SKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHT  67
            +K++L+   DS  K      C +C L+KQK+LPFP S+S S   F+LVH +IWGP+ + +
Sbjct  519  AKIQLINSSDSSXKXIHNKVCXICPLAKQKKLPFPISNSQSNKAFQLVHXBIWGPFSIPS  578

Query  66   IYGHQYFLTLVDDFSRLTWVFL  1
               + +FLT VDDF+R TW+FL
Sbjct  579  YSXYXFFLTXVDDFTRFTWLFL  600



>ref|XP_004235138.1| PREDICTED: uncharacterized protein LOC101243773 [Solanum lycopersicum]
Length=957

 Score = 87.8 bits (216),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            F KM+ +  +  +    +   C++C +++Q R+PFP+S+S +   FEL+H D+WGPYH+ 
Sbjct  610  FVKMRNITSIPVNFSPKQPFTCNICPMARQTRMPFPESTSITTKTFELLHVDLWGPYHIP  669

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            T  G+ YFLT+VDD++R TW  L
Sbjct  670  THDGYHYFLTMVDDYNRSTWTQL  692



>ref|XP_009778056.1| PREDICTED: uncharacterized protein LOC104227505 [Nicotiana sylvestris]
Length=605

 Score = 87.4 bits (215),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            F++MK +  + S +   +   C +C L++Q +L FP+SS+ S   F+L+H D WGPYH  
Sbjct  473  FAQMKNIPSISSSLSAKQSFICPICPLARQPKLSFPNSSTHSTALFQLIHVDTWGPYHTQ  532

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            +  G +YFLT+VDD+SR TW  L
Sbjct  533  SYSGARYFLTIVDDYSRATWTHL  555



>emb|CAN71595.1| hypothetical protein VITISV_010143 [Vitis vinifera]
Length=1523

 Score = 87.8 bits (216),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  SACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLT  13
            S C +C L+K  R PFP S S+S +CF+L+H DIWG YHV ++ G QYFLT+VDD SR T
Sbjct  559  STCSICPLAKHTRTPFPLSVSSSDSCFDLIHVDIWGGYHVPSLSGAQYFLTIVDDHSRST  618

Query  12   WVFL  1
            WV+L
Sbjct  619  WVYL  622



>ref|XP_003599760.1| Peptide transporter PTR2 [Medicago truncatula]
Length=1282

 Score = 87.8 bits (216),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = -3

Query  213  DVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLV  34
             + V+ ++ CDVCH SKQ++LP+  S S + + FE VH DIWGP    +I+GH+YFLT+V
Sbjct  800  SISVDNKATCDVCHFSKQRKLPYNSSHSIAKSKFESVHFDIWGPLAQTSIHGHKYFLTIV  859

Query  33   DDFSRLTWVFL  1
            DDFSR  W+ L
Sbjct  860  DDFSRFLWLIL  870



>ref|XP_003599761.1| Peptide transporter PTR2 [Medicago truncatula]
Length=1194

 Score = 87.8 bits (216),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = -3

Query  213  DVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLV  34
             + V+ ++ CDVCH SKQ++LP+  S S + + FE VH DIWGP    +I+GH+YFLT+V
Sbjct  712  SISVDNKATCDVCHFSKQRKLPYNSSHSIAKSKFESVHFDIWGPLAQTSIHGHKYFLTIV  771

Query  33   DDFSRLTWVFL  1
            DDFSR  W+ L
Sbjct  772  DDFSRFLWLIL  782



>ref|XP_003605102.1| Peptide transporter PTR2 [Medicago truncatula]
Length=1313

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -3

Query  210  VKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVD  31
            + V+ ++ CDVCH SKQ++LP+  S S + + FE VH DIWGP    +I+GH+YFLT+VD
Sbjct  811  ISVDNKATCDVCHFSKQRKLPYNSSHSIAKSKFESVHFDIWGPLAQTSIHGHKYFLTIVD  870

Query  30   DFSRLTWVFL  1
            DFSR  W+ L
Sbjct  871  DFSRFLWLIL  880



>ref|XP_004240625.1| PREDICTED: uncharacterized protein LOC101261123 [Solanum lycopersicum]
Length=943

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            CD+C L++Q RLPFP S+S+S   F+L+H D+WGPY V T  G +YF T+VDD+SR TW 
Sbjct  563  CDICPLARQTRLPFPHSTSSSTCVFQLLHMDVWGPYRVETYDGMRYFFTIVDDYSRWTWT  622

Query  6    FL  1
            FL
Sbjct  623  FL  624



>ref|XP_009612658.1| PREDICTED: uncharacterized protein LOC104105930 [Nicotiana tomentosiformis]
Length=911

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            FS+MK +  L       +  +C VC L++Q RLPFPDSS  +   F+L++ D WGPY+  
Sbjct  497  FSRMKHIPALALHFSPKQSFSCPVCPLARQTRLPFPDSSIQTTKPFQLIYIDTWGPYNSP  556

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            T  G +YFLT+VDDFSR TW  L
Sbjct  557  TYNGSKYFLTIVDDFSRATWTHL  579



>gb|ACB45089.1| putative polyprotein [Solanum habrochaites]
Length=849

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -3

Query  201  NKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFS  22
            +K ++C +C L+KQ RLPFP S + + N F+L+HAD+WGPY   T  G++YFLTLVDD S
Sbjct  291  SKLTSCPICPLAKQTRLPFPQSPTRADNVFDLIHADVWGPYKFPTHDGNRYFLTLVDDCS  350

Query  21   RLTWVFL  1
            R+ W+FL
Sbjct  351  RMIWIFL  357



>ref|XP_009774503.1| PREDICTED: uncharacterized protein LOC104224521 [Nicotiana sylvestris]
Length=479

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  SACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLT  13
            + C +C +++Q +LPFP SS ++   FEL+H DIWGPY+  T  G +YFLT+VDDFSR T
Sbjct  374  TPCVICPMARQSKLPFPSSSISTKKVFELIHVDIWGPYNSATYDGFRYFLTIVDDFSRGT  433

Query  12   WVFL  1
            W +L
Sbjct  434  WTYL  437



>emb|CAN59949.1| hypothetical protein VITISV_043423 [Vitis vinifera]
Length=1059

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = -3

Query  195  ESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRL  16
             +ACDVC L+KQ+RLPF  SS +S   FEL+H D WGPY + ++ G + FLT+VDD+SR 
Sbjct  544  NNACDVCXLAKQRRLPFSVSSISSVRPFELIHCDXWGPYKIASLSGAKXFLTIVDDYSRF  603

Query  15   TWVF  4
            TWVF
Sbjct  604  TWVF  607



>ref|XP_009591989.1| PREDICTED: uncharacterized protein LOC104088926 [Nicotiana tomentosiformis]
Length=841

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            FS+MK + +  S +   +  +C +C L++Q RL FPDSS  S   F+L+H D WG YH H
Sbjct  455  FSRMKHISMFGSQLASKQNFSCPICPLARQTRLLFPDSSIQSTKPFQLIHIDTWGLYHSH  514

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            T  G +YF+T+VDD SR TW  L
Sbjct  515  TYTGSKYFITIVDDNSRATWTHL  537



>ref|XP_004231154.1| PREDICTED: uncharacterized protein LOC101251936 [Solanum lycopersicum]
Length=906

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            F KMK +  +       +   C +C +++Q R+PFP+S +T+++ FEL+H D+WGPY+V 
Sbjct  534  FVKMKNISTIPLKFSNKQTFTCIICPMARQTRMPFPESVTTTSSIFELLHVDLWGPYNVP  593

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            T  G+ YFLT+VDD+SR TW  L
Sbjct  594  THDGYHYFLTMVDDYSRATWTQL  616



>emb|CAA19696.1| putative LTR retrotransposon (fragment) [Arabidopsis thaliana]
 emb|CAB78981.1| putative LTR retrotransposon (fragment) [Arabidopsis thaliana]
Length=281

 Score = 83.2 bits (204),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 57/87 (66%), Gaps = 4/87 (5%)
 Frame = -3

Query  249  FSKMKLLQ--LLDSDVKVNKESA--CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGP  82
            +SK+ LL   L   D K+NKE +  C VCHLSKQK L F    +  +  F+LVH D WGP
Sbjct  155  YSKIDLLSDVLNLKDKKINKEHSPVCHVCHLSKQKHLSFQYRQNMCSAAFDLVHIDTWGP  214

Query  81   YHVHTIYGHQYFLTLVDDFSRLTWVFL  1
            + V T  G +YFLT+VDDFSR TW++L
Sbjct  215  FSVPTNDGFKYFLTIVDDFSRATWIYL  241



>ref|XP_009623631.1| PREDICTED: uncharacterized protein LOC104114778 [Nicotiana tomentosiformis]
Length=1272

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            FSKMKL+  LDS +   K   C +C L++Q RL FPDSS  S + F+L+H D WGPY   
Sbjct  743  FSKMKLISGLDSGLSSKKTFTCPICPLARQTRLHFPDSSIQSTHSFQLIHIDTWGPYSTP  802

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
                 +YFL +VDD++R TW  L
Sbjct  803  IHSSSKYFLIIVDDYTRATWTHL  825



>emb|CDP21887.1| unnamed protein product [Coffea canephora]
Length=633

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 53/83 (64%), Gaps = 2/83 (2%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            FS++KL+  +      N    CDVCH +KQ RL F +S+  S   F L+H D+WG Y V 
Sbjct  465  FSRLKLISSIPFPSNFNH--ICDVCHRAKQTRLSFSNSNKKSVKPFALIHVDLWGAYSVS  522

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            ++ G  YFLT+VDDFSR TWVFL
Sbjct  523  SLSGAHYFLTIVDDFSRCTWVFL  545



>ref|XP_010436765.1| PREDICTED: uncharacterized protein LOC104720575 [Camelina sativa]
Length=282

 Score = 82.4 bits (202),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  LQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQ  52
            L +  S  K     +CDVC  +KQ R  FP SS+ S  CF L+H D+WGPY V + YG  
Sbjct  166  LPVFSSSFKNVGSRSCDVCFRAKQTRDVFPLSSNKSTECFSLIHCDVWGPYRVPSSYGAV  225

Query  51   YFLTLVDDFSRLTWVFL  1
            YFLT+VDDF R  W +L
Sbjct  226  YFLTIVDDFLRAVWTYL  242



>gb|AAC67205.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1413

 Score = 85.5 bits (210),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            FS +  L L           +CDVC  +KQ R  FPDSS+ S +CF L+H D+WGPY V 
Sbjct  522  FSVLSSLPLFSGSSCSVSSRSCDVCFRAKQTREVFPDSSNKSTDCFSLIHCDVWGPYRVP  581

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            +  G  YFLT+VDDFSR  W +L
Sbjct  582  SSCGAVYFLTIVDDFSRSVWTYL  604



>emb|CAN82526.1| hypothetical protein VITISV_028058 [Vitis vinifera]
Length=1125

 Score = 85.5 bits (210),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -3

Query  195  ESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRL  16
             +ACDVC L+KQ++LPF  SS +S   FEL+H DIWGPY + ++ G +YFLT+VDD+SR 
Sbjct  280  NNACDVCALAKQRQLPFSVSSISSVRPFELIHCDIWGPYKIASLSGAKYFLTIVDDYSRF  339

Query  15   TWVF  4
            T VF
Sbjct  340  TXVF  343



>dbj|BAA97287.1| retroelement pol polyprotein-like [Arabidopsis thaliana]
Length=1491

 Score = 85.5 bits (210),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            FS +  L L           +CDVC  +KQ R  FPDSS+ S +CF L+H D+WGPY V 
Sbjct  522  FSVLSSLPLFSGSSCSVSSRSCDVCFRAKQTREVFPDSSNKSTDCFSLIHCDVWGPYRVP  581

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            +  G  YFLT+VDDFSR  W +L
Sbjct  582  SSCGAVYFLTIVDDFSRSVWTYL  604



>ref|XP_010692573.1| PREDICTED: uncharacterized protein LOC104905670 [Beta vulgaris 
subsp. vulgaris]
Length=864

 Score = 85.1 bits (209),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -3

Query  195  ESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRL  16
            E  C VC  SK  +LPFP S+S +  CF+L+H D+WGPY VH + G +YFLTLVDD +R+
Sbjct  602  EYNCGVCLHSKHHKLPFPVSNSRAECCFDLIHIDLWGPYRVHALNGARYFLTLVDDHNRV  661

Query  15   TWVFL  1
            TW +L
Sbjct  662  TWTYL  666



>emb|CAN65308.1| hypothetical protein VITISV_002323 [Vitis vinifera]
Length=1114

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -3

Query  195  ESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRL  16
             +ACDVC L+KQ+RLP   SS +S   FEL+H DIWGPY + ++ G +YFLT+VDD+SR 
Sbjct  423  NNACDVCALAKQRRLPISVSSISSVRPFELIHCDIWGPYKIASLSGAKYFLTIVDDYSRF  482

Query  15   TWVF  4
            TWVF
Sbjct  483  TWVF  486



>ref|XP_010323506.1| PREDICTED: uncharacterized protein LOC104648273 [Solanum lycopersicum]
Length=560

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            F KM+ +  +  +    +   C++C +++Q R+PF +S+ST+   FEL+H D+WGPYH+ 
Sbjct  467  FVKMRNISAIPVNFSPKQPFTCNICPMARQTRMPFLESTSTTTTIFELLHVDLWGPYHIP  526

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            T   + YFLT+VDD+SR TW  L
Sbjct  527  THDDYYYFLTMVDDYSRYTWTQL  549



>gb|AAD26943.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1454

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            C VCHL+KQ++L FP S+      F+L+H D+WGP+ V T+ G++YFLT+VDD SR TW+
Sbjct  590  CHVCHLAKQRKLSFPTSNKVCKEIFDLLHIDVWGPFSVETVEGYKYFLTIVDDHSRATWM  649

Query  6    FL  1
            +L
Sbjct  650  YL  651



>gb|AAD41979.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1264

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            C VCHL+K ++L FP  ++     FE++H DIWGP+ V T+ G+QYFLT+VDD SR TW+
Sbjct  449  CHVCHLAKHRKLSFPSQNNVCNEIFEMLHIDIWGPFSVETVDGYQYFLTIVDDHSRATWI  508

Query  6    FL  1
            +L
Sbjct  509  YL  510



>gb|AAB61111.1| Strong similarity to Zea mays retrotransposon Hopscotch polyprotein 
(gb|U12626) [Arabidopsis thaliana]
Length=1315

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -3

Query  207  KVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDD  28
            K N +  C VCH+SKQK LPF   ++ S+  F+L+H D WGP+ V T  G++YFLT+VDD
Sbjct  432  KNNTDFHCRVCHISKQKHLPFVSHNNKSSRPFDLIHIDTWGPFSVQTHDGYRYFLTIVDD  491

Query  27   FSRLTWVFL  1
            +SR TWV+L
Sbjct  492  YSRATWVYL  500



>ref|XP_010424680.1| PREDICTED: uncharacterized protein LOC104709822 [Camelina sativa]
Length=1185

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 61/85 (72%), Gaps = 2/85 (2%)
 Frame = -3

Query  249  FSKMKLL-QLLDSDVKVNKESA-CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYH  76
            +S++ ++ ++L +    NK+ A C VCHL+KQK+L F   ++   + FEL+H D+WGP+ 
Sbjct  515  YSRLDVISEVLGTTGHKNKKPAYCHVCHLAKQKKLSFISENNIFNSTFELLHIDVWGPFS  574

Query  75   VHTIYGHQYFLTLVDDFSRLTWVFL  1
            V T+ G++YFLT+VDD SR TWV+L
Sbjct  575  VETVEGYKYFLTIVDDHSRATWVYL  599



>ref|XP_010542220.1| PREDICTED: uncharacterized protein LOC104815505 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010542221.1| PREDICTED: uncharacterized protein LOC104815505 isoform X2 [Tarenaya 
hassleriana]
Length=751

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -3

Query  189  ACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTW  10
             C++C L+KQ RL FP      +  F+++H D+WGP+HV T  G++YF TLVDDFSRLTW
Sbjct  590  GCNICPLAKQPRLSFPFGGHRCSASFDVIHLDVWGPFHVETYDGYKYFFTLVDDFSRLTW  649

Query  9    VFL  1
            V+L
Sbjct  650  VYL  652



>emb|CAN73696.1| hypothetical protein VITISV_038483 [Vitis vinifera]
Length=1783

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -3

Query  204  VNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDF  25
            V   +AC +C L+KQ RLPF  S+ +S   FE++H DIWG Y   +++G  YFLT+VDD+
Sbjct  915  VQSNNACPICPLAKQSRLPFGTSAISSTKPFEIIHCDIWGRYRHRSLFGAHYFLTIVDDY  974

Query  24   SRLTWVFL  1
            +R TW+FL
Sbjct  975  TRFTWIFL  982



>ref|XP_009631565.1| PREDICTED: uncharacterized protein LOC104121310 [Nicotiana tomentosiformis]
Length=461

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -3

Query  195  ESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRL  16
            E  CD+C  ++Q R+PF  S  TS   FEL+H D WGPY   T  G +YFLT+VDDFSR 
Sbjct  322  ECLCDICPKARQTRIPFALSQITSKRAFELIHVDTWGPYKEPTYNGFKYFLTIVDDFSRD  381

Query  15   TWVFL  1
            TW FL
Sbjct  382  TWTFL  386



>ref|XP_009781844.1| PREDICTED: uncharacterized protein LOC104230679 [Nicotiana sylvestris]
Length=564

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 52/82 (63%), Gaps = 5/82 (6%)
 Frame = -3

Query  243  KMKLLQLLDSDVKVNKESAC-DVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHT  67
            K+K  Q L    K N E+    VC + KQ RLPFP S+S    CF L+HAD+WGPY V T
Sbjct  425  KLKCFQYL----KCNSETKQYTVCPIVKQTRLPFPLSTSVVTACFHLLHADVWGPYRVPT  480

Query  66   IYGHQYFLTLVDDFSRLTWVFL  1
              G +YFLTLVDD S+ TWV L
Sbjct  481  HDGKKYFLTLVDDHSKFTWVLL  502



>ref|XP_010317833.1| PREDICTED: uncharacterized protein LOC104646241 [Solanum lycopersicum]
Length=859

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = -3

Query  213  DVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLV  34
            ++K    S C VC L+K  +LPFP SS  S N FEL+H D+WGPY V T    +YF+T+V
Sbjct  446  NLKSIGHSHCTVCPLAKHTKLPFPVSSHVSKNVFELLHCDVWGPYRVPTHNNKRYFVTIV  505

Query  33   DDFSRLTWVFL  1
            DDFS+ TW++L
Sbjct  506  DDFSQYTWIYL  516



>ref|XP_006359484.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
29-like [Solanum tuberosum]
Length=2159

 Score = 83.2 bits (204),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            C +  L+K  RLPFP S++ +A  F L+H D+WGPYHV T  G++ FLT+VDD SR+TW+
Sbjct  58   CSIFPLAKHTRLPFPKSTTKAATIFYLLHIDVWGPYHVPTFDGNKMFLTVVDDHSRITWL  117

Query  6    FL  1
            FL
Sbjct  118  FL  119



>gb|AAF69161.1|AC007915_13 F27F5.19 [Arabidopsis thaliana]
Length=1309

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 56/87 (64%), Gaps = 4/87 (5%)
 Frame = -3

Query  249  FSKMKLLQ--LLDSDVKVNKESA--CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGP  82
            +SK+ LL   L   D K+NKE +  C VCHLSKQK L F    +     F+LVH D WGP
Sbjct  541  YSKIDLLSDVLNLKDKKINKEHSPVCRVCHLSKQKHLSFQSRQNMCKAAFDLVHIDTWGP  600

Query  81   YHVHTIYGHQYFLTLVDDFSRLTWVFL  1
            ++V T  G +YFLT+VDDFSR TW +L
Sbjct  601  FYVLTKDGFRYFLTIVDDFSRATWNYL  627



>ref|XP_004228785.1| PREDICTED: uncharacterized protein LOC101255821 [Solanum lycopersicum]
Length=1125

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            F KM+ +  +  +V   +   C++C +++Q R+PF +S+S +   FEL+H D+WGPYH+ 
Sbjct  617  FVKMRNITSIPVNVSPKQPFTCNICPMARQTRMPFQESTSITTKIFELLHVDLWGPYHIP  676

Query  69   TIYGHQYFLTLVDDFSRLT  13
            T  G+ YFLT+VDD+SR T
Sbjct  677  THDGYHYFLTMVDDYSRST  695



>ref|XP_010322961.1| PREDICTED: uncharacterized protein LOC104648099 [Solanum lycopersicum]
Length=790

 Score = 82.4 bits (202),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            F KM+ +  + +     +   C +C +++Q+RLPF  S + S + FEL+H DIWGPYH  
Sbjct  327  FVKMRKISTIPASFSNKQPFMCTICPMARQERLPFSQSVTHSNSIFELIHIDIWGPYHTL  386

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            T   ++YF+T+VDDFSR TW  L
Sbjct  387  THDNYRYFITIVDDFSRSTWTHL  409



>ref|XP_010495376.1| PREDICTED: uncharacterized protein LOC104772464 [Camelina sativa]
Length=1032

 Score = 82.4 bits (202),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            C VC L+KQKRL F  +   S   F+LVH DIWGP+ V ++ G++YFLT+VDD+SR+TWV
Sbjct  639  CSVCPLAKQKRLSFESNGHRSTTPFDLVHLDIWGPFAVESVEGYKYFLTIVDDYSRVTWV  698

Query  6    FL  1
            +L
Sbjct  699  YL  700



>gb|ABE88096.1| Integrase, catalytic region [Medicago truncatula]
Length=604

 Score = 81.6 bits (200),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 57/85 (67%), Gaps = 2/85 (2%)
 Frame = -3

Query  249  FSKMKLLQL--LDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYH  76
             S  +L Q+  L  D+ V+ +  CD+CH +KQ++LP+  S+S +++ FEL++ DIWGP  
Sbjct  303  LSNQRLSQMHHLYPDIHVDNKFICDICHFAKQRKLPYNSSTSIASSNFELLYLDIWGPLA  362

Query  75   VHTIYGHQYFLTLVDDFSRLTWVFL  1
              +I+G +YFLT+VDD SR  W  L
Sbjct  363  KVSIHGQRYFLTIVDDHSRFLWTIL  387



>ref|XP_009785772.1| PREDICTED: uncharacterized protein LOC104233988 [Nicotiana sylvestris]
Length=462

 Score = 80.9 bits (198),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 48/72 (67%), Gaps = 2/72 (3%)
 Frame = -3

Query  237  KLLQLLD--SDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTI  64
            ++LQ +D    V  + +  C +C L+KQ RLPFP S+  +   FELVH D+WGPY V T 
Sbjct  134  RVLQQIDICKGVNTSADRTCSICPLAKQARLPFPQSTGRAGKVFELVHGDVWGPYKVSTH  193

Query  63   YGHQYFLTLVDD  28
             GH++FLTLVDD
Sbjct  194  DGHRFFLTLVDD  205



>gb|AEJ72555.1| putative retroelement polyprotein [Malus domestica]
Length=1249

 Score = 82.0 bits (201),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            C+VCH SKQ RLPF  SS+ S   FE+VH+D+WGP  + +  G +YF+T VDDFSR TW+
Sbjct  470  CEVCHFSKQTRLPFDVSSTKSCKPFEIVHSDVWGPAPLVSFDGFRYFVTFVDDFSRCTWL  529

Query  6    FL  1
            +L
Sbjct  530  YL  531



>ref|XP_010412743.1| PREDICTED: uncharacterized protein LOC104699096 [Camelina sativa]
Length=971

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            CD+C L+KQK+LPF   S  SA  F+L+H D WGP+ V +I G++YFLT+VDD +R+TW+
Sbjct  508  CDICPLAKQKKLPFVSHSKLSALPFDLIHIDTWGPFSVESIEGYRYFLTIVDDCTRITWI  567

Query  6    FL  1
            ++
Sbjct  568  YM  569



>ref|XP_010542100.1| PREDICTED: uncharacterized protein LOC104815417 [Tarenaya hassleriana]
 ref|XP_010552828.1| PREDICTED: uncharacterized protein LOC104823102 [Tarenaya hassleriana]
Length=614

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
              K+K L  + +  K+ + + C+ CHL+KQ+ LPF  ++  +++ F+L+H +IWGP+ V 
Sbjct  494  IQKIKNLSSILNLSKITEPTHCNTCHLAKQRHLPFVSNNHVASSIFDLLHINIWGPFSVV  553

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            +I G++YF+T+VDD SR TWV++
Sbjct  554  SIDGYKYFVTIVDDHSRTTWVYM  576



>ref|XP_010414406.1| PREDICTED: uncharacterized protein LOC104700576 isoform X1 [Camelina 
sativa]
Length=473

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 54/81 (67%), Gaps = 4/81 (5%)
 Frame = -3

Query  231  LQLLDSDVKVNKESA----CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTI  64
            LQ L   + + K S     C VCHL+KQKRL F  +++ +   FELVH DIWGP+ V +I
Sbjct  367  LQELSGTLPITKSSLAMSHCSVCHLAKQKRLSFESNNNFTKTPFELVHMDIWGPFSVESI  426

Query  63   YGHQYFLTLVDDFSRLTWVFL  1
             G +YFLT+VDD +R+T ++L
Sbjct  427  EGFKYFLTIVDDCTRVTCIYL  447



>emb|CAN62906.1| hypothetical protein VITISV_043610 [Vitis vinifera]
Length=1498

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -3

Query  195  ESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRL  16
             +AC +C L+KQ RLPF  S+ +S   FE++H DIWG Y   +++G  YFLT+VDD++R 
Sbjct  546  NNACPICPLAKQSRLPFGTSAISSTKPFEIIHCDIWGRYRHPSLFGAHYFLTIVDDYTRF  605

Query  15   TWVFL  1
            TW+FL
Sbjct  606  TWIFL  610



>dbj|BAB10503.1| retroelement pol polyprotein-like [Arabidopsis thaliana]
Length=1475

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = -3

Query  207  KVNKESA--CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLV  34
            K NKE    C +C  +KQK L FP  ++ S N F+L+H D WGP+   T  G++YFLT+V
Sbjct  609  KRNKEDLVHCSICQKAKQKHLSFPSKNNMSENKFDLIHIDTWGPFATPTTEGYKYFLTIV  668

Query  33   DDFSRLTWVFL  1
            DD+SR TWV+L
Sbjct  669  DDYSRATWVYL  679



>ref|XP_010670882.1| PREDICTED: uncharacterized protein LOC104887829 [Beta vulgaris 
subsp. vulgaris]
Length=605

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 53/83 (64%), Gaps = 2/83 (2%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
             SKMK + + +   K  KE  C VC  SKQ +LPF  SSS +  CF+L+H D+WGPY V 
Sbjct  485  LSKMKHIDVCN--CKNLKEYNCGVCFHSKQHKLPFYPSSSRANACFDLIHLDLWGPYKVM  542

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
             + G  YFLT++DD SR+ W +L
Sbjct  543  AMNGAHYFLTILDDHSRVVWTYL  565



>ref|XP_009348351.1| PREDICTED: uncharacterized protein LOC103939989 [Pyrus x bretschneideri]
Length=911

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            C++C +SK  RLPF  S S ++  FE+VH+DIWGP  V +  G++YF+T +DD+SR+TW+
Sbjct  523  CEICQMSKATRLPFVPSKSRTSKLFEVVHSDIWGPSRVESFDGYKYFVTFIDDYSRVTWL  582

Query  6    FL  1
            +L
Sbjct  583  YL  584



>ref|XP_010325686.1| PREDICTED: uncharacterized protein LOC104649000 [Solanum lycopersicum]
Length=1041

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 51/83 (61%), Gaps = 0/83 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            F KMK +  +  +    +   C++C + +Q RL FP  +  ++  FEL+H D+WGPYHV 
Sbjct  555  FIKMKGITSIPVNFSSKQSFTCNICPMVRQTRLSFPPKTHNTSKVFELLHVDLWGPYHVS  614

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            T    +YF+TLVDDFSR TW  L
Sbjct  615  THDNFKYFITLVDDFSRTTWTHL  637



>ref|XP_010436828.1| PREDICTED: uncharacterized protein LOC104720645 [Camelina sativa]
Length=823

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 31/65 (48%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -3

Query  195  ESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRL  16
            + +CD+C  +KQ R PFPDS + +   F+L+H D+WGPY      G +YFLT+VDD SR 
Sbjct  370  QESCDICLRAKQTRQPFPDSFNNAKEIFDLIHCDLWGPYRTPAFCGSRYFLTIVDDCSRA  429

Query  15   TWVFL  1
             W++L
Sbjct  430  VWLYL  434



>emb|CAN83125.1| hypothetical protein VITISV_015109 [Vitis vinifera]
Length=1355

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 48/63 (76%), Gaps = 1/63 (2%)
 Frame = -3

Query  189  ACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTW  10
             CD+CH SK  RLPF  S S S+  FELVH+D+WGP+ + +I G +YF+T +DDFS++TW
Sbjct  525  GCDICHYSKSTRLPFNLSLSKSSEMFELVHSDVWGPFSL-SIDGFKYFVTFIDDFSKVTW  583

Query  9    VFL  1
            V+L
Sbjct  584  VYL  586



>ref|XP_004498431.1| PREDICTED: uncharacterized protein LOC101490285 [Cicer arietinum]
Length=924

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = -3

Query  198  KESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSR  19
            + S CDVC  +K KRLPFP S   +  CF+L+H DIWG + V +I+G +YFLT+VDD SR
Sbjct  528  RHSPCDVCFKAKHKRLPFPHSIIVADFCFDLIHMDIWGAFSVPSIFGFKYFLTVVDDKSR  587

Query  18   LTWVFL  1
              W++L
Sbjct  588  FCWIYL  593



>ref|XP_009801985.1| PREDICTED: uncharacterized protein LOC104247620 [Nicotiana sylvestris]
Length=686

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 50/69 (72%), Gaps = 1/69 (1%)
 Frame = -3

Query  204  VNKES-ACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDD  28
            +NK++  C VC L++Q R PFP S+  S   F+LVH D+WGPY   T   ++YFLT+VDD
Sbjct  576  LNKDNLNCIVCPLARQTRFPFPTSTKKSVCSFDLVHMDVWGPYRQCTYNEYKYFLTIVDD  635

Query  27   FSRLTWVFL  1
            +SR+TW++L
Sbjct  636  YSRMTWIYL  644



>ref|XP_004149403.1| PREDICTED: uncharacterized protein LOC101215551 [Cucumis sativus]
Length=528

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -3

Query  189  ACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTW  10
             C  C L+KQ+RL F  ++  S N F+L+H DIWGP    T  GH YFLT+VDD +R TW
Sbjct  364  TCTTCSLAKQRRLSFSSNNHVSPNSFDLIHVDIWGPLSTATHAGHTYFLTIVDDATRFTW  423

Query  9    VFL  1
            VF+
Sbjct  424  VFM  426



>ref|XP_010025850.1| PREDICTED: uncharacterized protein LOC104416112 [Eucalyptus grandis]
Length=1383

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            C +C L+KQ R  FP S+S + N F L+H DIWGPYH     G +YFLT+VDD+S  TW+
Sbjct  505  CPICPLAKQTRASFPVSTSRTQNHFSLLHMDIWGPYHTSHRDGSRYFLTIVDDYSHATWL  564

Query  6    FL  1
            +L
Sbjct  565  YL  566



>ref|XP_007023091.1| Uncharacterized protein TCM_027093 [Theobroma cacao]
 gb|EOY25713.1| Uncharacterized protein TCM_027093 [Theobroma cacao]
Length=994

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = -3

Query  243  KMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTI  64
            K+ ++    ++VK + +  C++  L+KQ++LPFP     +   FEL+H DIWGPY   TI
Sbjct  332  KLNIIHQQRANVKCSNQLLCEIRPLAKQRKLPFPVHVKNTKIPFELMHVDIWGPYENPTI  391

Query  63   YGHQYFLTLVDDFSRLTWVFL  1
             G +YFL +VDD +R TW+F+
Sbjct  392  SGQRYFLIVVDDHTRFTWIFI  412



>ref|XP_004250863.1| PREDICTED: uncharacterized protein LOC101267084 [Solanum lycopersicum]
Length=747

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            F KMK +  +       +   C +C +++Q R+PFP+S +T+++ FEL+H D+WG Y+V 
Sbjct  619  FVKMKNISTIPLKFSNKQPFTCTICPMARQTRMPFPESVTTTSSIFELLHVDLWGHYNVP  678

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            T  G+ YFLT+VDD SR TW  L
Sbjct  679  THDGYHYFLTMVDDNSRATWTQL  701



>dbj|BAB10837.1| retroelement pol polyprotein-like [Arabidopsis thaliana]
Length=1462

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = -3

Query  240  MKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIY  61
            +KLL   DS         C++C  +KQ R PFP S++ +++ FE+VH D+WGPY   +I 
Sbjct  483  LKLLSFSDSTGHAFDSKTCEICIKAKQTRDPFPLSNNKTSSPFEMVHCDLWGPYRTTSIC  542

Query  60   GHQYFLTLVDDFSRLTWVFL  1
            G  YFLTLVD+++R  W++L
Sbjct  543  GSNYFLTLVDNYTRAVWLYL  562



>ref|XP_010325276.1| PREDICTED: uncharacterized protein LOC101260366 [Solanum lycopersicum]
Length=191

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            F KMK +  +       +   C +C +++Q RLPF  S++ S N F+L+H D+WGPYHV 
Sbjct  113  FVKMKTIPTIPVKFSNRQPFTCTICSMARQTRLPFTHSTTHSKNIFDLLHIDLWGPYHVP  172

Query  69   TIYGHQYFLTLVDDFSRLT  13
            T    +YF+TLVDD+SR T
Sbjct  173  TYDNCRYFITLVDDYSRAT  191



>gb|AAD23883.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1156

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            FS +  L +L S        +CDVC  +KQ R  FP S++ S  CF L+H D+WGPY V 
Sbjct  100  FSVLSSLPVLTSSSLSVGSRSCDVCFRAKQTREVFPVSTNKSIECFSLIHCDVWGPYRVP  159

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            +  G  YFLT+VDDFSR  W +L
Sbjct  160  SSCGAVYFLTIVDDFSRAVWTYL  182



>ref|XP_008778555.1| PREDICTED: uncharacterized protein LOC103698337 [Phoenix dactylifera]
Length=848

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            F  + +L     ++ +   S C +C ++KQ+RL F  S   +++ FEL+H DIWGP+   
Sbjct  420  FPHLSILNKSVPEINICLNSHCSICPIAKQRRLNFSSSDHVTSSIFELIHCDIWGPFSTT  479

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            ++ G +YFLT+VDD+SR TWV+L
Sbjct  480  SLDGSKYFLTIVDDYSRATWVYL  502



>gb|AAG09097.1|AC009323_8 Putative retroelement polyprotein [Arabidopsis thaliana]
Length=1486

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            C++C  +KQ R PFP SS+ ++  FELVH D+WGPY   +I G +YFLTLVDD+SR  W+
Sbjct  537  CEICIQAKQTRDPFPLSSNKTSFAFELVHCDLWGPYRTTSICGSRYFLTLVDDYSRAVWL  596

Query  6    FL  1
            +L
Sbjct  597  YL  598



>ref|XP_010692480.1| PREDICTED: uncharacterized protein LOC104905592 [Beta vulgaris 
subsp. vulgaris]
Length=1085

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 51/81 (63%), Gaps = 1/81 (1%)
 Frame = -3

Query  240  MKLLQLLDSDVKVNK-ESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTI  64
            +KLL  + S     K  + CDVC ++KQ R  FP S   ++  FELVH D+WGPY V + 
Sbjct  537  VKLLPAIKSSSDKKKLNNVCDVCPMAKQTRDSFPTSEHKASRLFELVHCDLWGPYSVPSS  596

Query  63   YGHQYFLTLVDDFSRLTWVFL  1
             G  YFLTLVDD+SR  WV+L
Sbjct  597  CGAVYFLTLVDDYSRAVWVYL  617



>ref|XP_009128559.1| PREDICTED: uncharacterized protein LOC103853393 [Brassica rapa]
Length=964

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = -3

Query  204  VNKES-ACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDD  28
            +NKE   C +C L+KQKRLP+   ++ S N F+L+H DIWGP+ V T  G+++FLT+VDD
Sbjct  589  INKEPFHCAICPLAKQKRLPYNPQNNMSQNVFDLLHIDIWGPFSVSTAEGYKHFLTIVDD  648

Query  27   FSRLTWVFL  1
             +R+ W++L
Sbjct  649  HTRVIWIYL  657



>ref|XP_004229082.1| PREDICTED: uncharacterized protein LOC101247852 [Solanum lycopersicum]
Length=575

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -3

Query  156  RLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWVFL  1
            RLPFP+S+S S + F+LVH D+WGPY V T  G +YFLT+VDD+SR TW+FL
Sbjct  456  RLPFPNSTSRSTSIFQLVHLDVWGPYRVETFDGMRYFLTVVDDYSRCTWIFL  507



>emb|CAN81026.1| hypothetical protein VITISV_023317 [Vitis vinifera]
Length=1158

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = -3

Query  213  DVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLV  34
            +  V   +AC +C L+K  RLPF  S  +S   FEL+H DIWG Y   +++G  YFLT+V
Sbjct  494  NFSVQSNNACPICPLAKXSRLPFGTSXISSTKPFELIHCDIWGHYRHPSLFGAHYFLTIV  553

Query  33   DDFSRLTWVFL  1
            DD++R TW+FL
Sbjct  554  DDYTRFTWIFL  564



>emb|CAN75292.1| hypothetical protein VITISV_014745 [Vitis vinifera]
Length=1472

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = -3

Query  213  DVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLV  34
            +  V   +AC +C L+KQ RLPF  S+ +S   FE++H  IWG Y   +++G  YFLT+V
Sbjct  528  NFSVQSNNACPICPLAKQSRLPFGTSAISSTKPFEIIHCHIWGRYQHPSLFGAHYFLTIV  587

Query  33   DDFSRLTWVFL  1
            DD++R TW+FL
Sbjct  588  DDYTRFTWIFL  598



>ref|XP_009804044.1| PREDICTED: uncharacterized protein LOC104249333 [Nicotiana sylvestris]
Length=621

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = -3

Query  246  SKMKLLQLLDSDVKVNKES-ACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            S + +L  +D+DV  N  S  C +C L++Q RLPF DSS  S + F+L+H D WGPY   
Sbjct  414  SSLPVLSTIDADVNDNSFSFTCLICPLARQTRLPFHDSSIQSTHSFQLIHIDTWGPYSTP  473

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            +  G +YFLT+VDD +R TW  L
Sbjct  474  SHSGAKYFLTIVDDCTRATWTHL  496



>ref|XP_011079197.1| PREDICTED: uncharacterized protein LOC105162774 [Sesamum indicum]
Length=473

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = -3

Query  207  KVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDD  28
            + ++E  CD+C  +KQ R+PF +S S SA  F+LVH D+WGPY   ++ G  Y LT++DD
Sbjct  221  RESQEIKCDICPQAKQSRIPFKNSDSRSAAIFDLVHLDVWGPYKTPSLTGFNYVLTILDD  280

Query  27   FSRLTWVFL  1
            +SR  W +L
Sbjct  281  YSRSLWTYL  289



>ref|XP_004955256.1| PREDICTED: uncharacterized protein LOC101756543 [Setaria italica]
Length=421

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            CD C L+K  R+P+P  S  S+  FE++H DIWGP  V++I GH++F+  +D FSR TW+
Sbjct  253  CDACELAKHTRVPYPSLSRRSSKPFEIIHYDIWGPCEVNSILGHRWFVNFIDGFSRYTWL  312

Query  6    FL  1
            +L
Sbjct  313  YL  314



>emb|CAA72989.1| unnamed protein product [Brassica oleracea var. viridis]
Length=1131

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = -3

Query  237  KLLQLLDSDVKVNKESA-CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIY  61
            K+ + L +    NK  A C VCHL+KQK+L +   +      F+L+H D+WGP+ V T+ 
Sbjct  532  KISEALGTTKHKNKGDAHCHVCHLAKQKKLSYSSQNHICTASFQLLHVDVWGPFSVETLE  591

Query  60   GHQYFLTLVDDFSRLTWVFL  1
            G++YFLT+VDD SR TW++L
Sbjct  592  GYKYFLTIVDDHSRATWIYL  611



>gb|KHN05285.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1346

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = -3

Query  201  NKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFS  22
            +  S CD+CH +K ++LPF  S   +  CF+L+H DIWGP  + +++ H YFLT VDD S
Sbjct  461  DSSSVCDICHFAKHRKLPFVHSYHKAIKCFDLIHFDIWGPISIKSVHNHAYFLTAVDDHS  520

Query  21   RLTWVFL  1
            R TW+ L
Sbjct  521  RYTWITL  527



>ref|XP_004149623.1| PREDICTED: uncharacterized protein LOC101211618 [Cucumis sativus]
Length=2085

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = -3

Query  201   NKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFS  22
             N +  C +C L+KQ+RL FP  ++ + N F+L+H DIWGP+   T  GH YF T+VDD S
Sbjct  1823  NCKEVCHICPLAKQRRLSFPILNNIAENIFDLIHCDIWGPFKTPTHAGHSYFATIVDDKS  1882

Query  21    RLTWVFL  1
             R TWV+L
Sbjct  1883  RYTWVYL  1889


 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -3

Query  180  VCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWVFL  1
            +C L+KQ+RL FP  ++ + N FEL+H DIWGP+   T  GH Y  T+VDD SR TWV+L
Sbjct  405  ICPLAKQRRLSFPILNNIAENVFELIHCDIWGPFKTPTHAGHSYSATIVDDKSRYTWVYL  464



>ref|XP_009614489.1| PREDICTED: uncharacterized protein LOC104107402, partial [Nicotiana 
tomentosiformis]
Length=529

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -3

Query  201  NKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFS  22
            N   +C VC L+KQ R  FP S++ +  CF  +H DIW PY V T  G +YFLTLVDD+S
Sbjct  380  NTTKSCTVCPLAKQTRFHFPLSTTNTNVCFHTLHGDIWRPYRVPTYDGKKYFLTLVDDYS  439

Query  21   RLTWVFL  1
            R  W+FL
Sbjct  440  RYCWIFL  446



>emb|CAN76546.1| hypothetical protein VITISV_010420 [Vitis vinifera]
Length=1288

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 62/84 (74%), Gaps = 2/84 (2%)
 Frame = -3

Query  249  FSKMKLLQ-LLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHV  73
            FS++K LQ +LD D   +  + C+VC L+KQ+ LP+   +   ++ F+L+H DIWGP+ V
Sbjct  425  FSRLKGLQSVLDFDSSFDL-TPCNVCPLAKQRCLPYISLNKRCSSTFDLLHLDIWGPFSV  483

Query  72   HTIYGHQYFLTLVDDFSRLTWVFL  1
             ++ G+++FLT+VDD+SR+TWV++
Sbjct  484  GSVEGYKFFLTIVDDYSRVTWVYM  507



>ref|XP_010463099.1| PREDICTED: uncharacterized protein LOC104743749 [Camelina sativa]
Length=1164

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            FS +  L L          ++ DVC  +KQ R  FPDS + + +CF ++H D+WGPY V 
Sbjct  436  FSVLSALPLFSRSSSSVDSTSYDVCFRAKQTRAVFPDSLNKTTDCFSMIHCDVWGPYRVS  495

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            +  G  YFLT+VDDFSR  W FL
Sbjct  496  SSCGAIYFLTVVDDFSRAVWTFL  518



>gb|AAD19784.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1501

 Score = 79.3 bits (194),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 47/83 (57%), Gaps = 0/83 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            FS +  L L           +CDVC  +KQ R  FP+S + +  CF L+H D+WGPY V 
Sbjct  539  FSVLSSLPLFSKTSSTVTSHSCDVCFRAKQTREVFPESINKTEECFSLIHCDVWGPYRVP  598

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
               G  YFLT+VDD+SR  W +L
Sbjct  599  ASCGAVYFLTIVDDYSRAVWTYL  621



>ref|XP_004498023.1| PREDICTED: uncharacterized protein LOC101511025 [Cicer arietinum]
Length=852

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 50/68 (74%), Gaps = 1/68 (1%)
 Frame = -3

Query  210  VKVNKE-SACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLV  34
            V+++K  S CDVC  +K KRLPFP+S+  +  CF+L+H DIWGP+ + +I G++YFLT+V
Sbjct  558  VRISKSISPCDVCFHAKHKRLPFPNSTIIADCCFDLIHMDIWGPFSMPSILGYKYFLTVV  617

Query  33   DDFSRLTW  10
            DD S   W
Sbjct  618  DDKSHFCW  625



>ref|XP_009109940.1| PREDICTED: uncharacterized protein LOC103835509 [Brassica rapa]
Length=944

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 56/82 (68%), Gaps = 5/82 (6%)
 Frame = -3

Query  231  LQLLDSDVKVNK-----ESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHT  67
            LQ+L +++ + +      S C VC L+KQKRL FP +++ S   F+L H DIWGP+   +
Sbjct  600  LQVLSTELSIPRCIIPSHSTCTVCPLAKQKRLSFPFNNNLSLKPFDLHHLDIWGPFAQES  659

Query  66   IYGHQYFLTLVDDFSRLTWVFL  1
            I G++YFLT+VDD SR+TW+ L
Sbjct  660  IEGYKYFLTIVDDCSRVTWIHL  681



>gb|KHN01991.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1311

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = -3

Query  210  VKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVD  31
            ++ +K   C+ CH +K K+LPF  S+S +++ F L+H DIWGP    +++GH+YFLT+VD
Sbjct  425  LRNDKTFVCNTCHYAKHKKLPFSSSTSHASHIFYLLHVDIWGPCSKPSMHGHKYFLTIVD  484

Query  30   DFSRLTWVFL  1
            D SR TWV L
Sbjct  485  DHSRFTWVHL  494



>ref|XP_010424200.1| PREDICTED: uncharacterized protein LOC104709252 [Camelina sativa]
Length=492

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 51/83 (61%), Gaps = 0/83 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            +S + +L ++      N   +CDVC  +KQ R  FPDS +  ++CF L+H D+ GPY V 
Sbjct  375  YSVLSVLPMVSVSGSSNSYLSCDVCFRAKQTREVFPDSINKVSDCFSLIHCDVCGPYRVP  434

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            +  G  YFLT+VDDFSR  W +L
Sbjct  435  SSCGAVYFLTIVDDFSRSVWTYL  457



>ref|XP_004246827.1| PREDICTED: uncharacterized protein LOC101260567 [Solanum lycopersicum]
Length=923

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            F KMK +  +       +   C +C +++Q RLPF  S++ S + F+L+H D+WGPYHV 
Sbjct  607  FVKMKTIPTIPVKFSNRQPFTCTICPMARQTRLPFTHSTTHSKSIFDLLHIDLWGPYHVP  666

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            T    +Y +TLVDD+SR TW +L
Sbjct  667  TYDNCRYCITLVDDYSRATWTYL  689



>ref|XP_009612717.1| PREDICTED: uncharacterized protein LOC104105976 [Nicotiana tomentosiformis]
Length=706

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = -3

Query  183  DVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWVF  4
            D  + +KQ  LPFP SSS S + F+LVH D+WGPY V T  G +YFLTLVDD+S+ TW+F
Sbjct  436  DDINKAKQSSLPFPISSSYSKSAFDLVHGDVWGPYRVPTHDGKRYFLTLVDDYSKYTWLF  495

Query  3    L  1
            L
Sbjct  496  L  496



>ref|XP_010030630.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104420491 
[Eucalyptus grandis]
Length=1191

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            C +C ++KQ R  F +S+S + + F L+HAD+WGPYH     G ++FL +VDD+SR TW+
Sbjct  675  CPICPMAKQTRATFQNSTSRADDIFSLIHADVWGPYHTLNHDGSRFFLIIVDDYSRATWI  734

Query  6    FL  1
            FL
Sbjct  735  FL  736



>ref|XP_010513552.1| PREDICTED: uncharacterized protein LOC104789576 [Camelina sativa]
Length=824

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = -3

Query  237  KLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYG  58
            KL+ L+ S    +  S C +C L+KQKRL +    + +   F+LVH DIWGP+ + ++ G
Sbjct  526  KLVSLIPSLKNSSLSSHCSICPLAKQKRLAYVSHGNIADKPFDLVHLDIWGPFSIESVEG  585

Query  57   HQYFLTLVDDFSRLTWVFL  1
             +YFLTLVDD +R TWV+L
Sbjct  586  FRYFLTLVDDCTRTTWVYL  604



>emb|CAN83990.1| hypothetical protein VITISV_018454 [Vitis vinifera]
Length=1243

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 61/84 (73%), Gaps = 2/84 (2%)
 Frame = -3

Query  249  FSKMKLLQ-LLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHV  73
            FS++K LQ +LD D   +  + C VC L+KQ+ LP+   +   ++ F+L+H DIWGP+ V
Sbjct  424  FSRLKGLQSVLDFDSSFDL-TPCXVCPLAKQRCLPYISLNKRCSSTFDLLHLDIWGPFSV  482

Query  72   HTIYGHQYFLTLVDDFSRLTWVFL  1
             ++ G+++FLT+VDD+SR+TWV++
Sbjct  483  GSVEGYKFFLTIVDDYSRVTWVYM  506



>ref|XP_010682952.1| PREDICTED: uncharacterized protein LOC104897713 [Beta vulgaris 
subsp. vulgaris]
Length=736

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = -3

Query  198  KESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSR  19
            K+  CD C ++K  +LPF  S S +++ F+L+H D+WGPY    I G  YFLT+VDD+SR
Sbjct  13   KDYFCDTCSIAKHHKLPFSPSKSIASHIFDLIHVDLWGPYRTKAITGASYFLTIVDDYSR  72

Query  18   LTWVFL  1
            +TW  L
Sbjct  73   VTWTQL  78



>gb|AAB87099.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1496

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = -3

Query  201  NKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFS  22
            +K  +CD C  SKQ R  FP S++ +  CF L+H D+WGPY   +  G  YFLTLVDD+S
Sbjct  528  DKIDSCDTCFRSKQTREVFPISNNKTMECFSLIHGDVWGPYRTPSTTGAVYFLTLVDDYS  587

Query  21   RLTWVFL  1
            R  W +L
Sbjct  588  RSVWTYL  594



>ref|XP_010677195.1| PREDICTED: uncharacterized protein LOC104892872 [Beta vulgaris 
subsp. vulgaris]
Length=897

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 47/69 (68%), Gaps = 2/69 (3%)
 Frame = -3

Query  207  KVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDD  28
            K+NK   CDVC ++KQ R  FP S+  +   FEL+H D+WGPY V +  G  YFLTLVDD
Sbjct  495  KLNK--ICDVCPMAKQTRDSFPLSTHKATRLFELIHCDLWGPYSVPSSCGAIYFLTLVDD  552

Query  27   FSRLTWVFL  1
            +SR  WV+L
Sbjct  553  YSRAVWVYL  561



>ref|XP_010474506.1| PREDICTED: uncharacterized protein LOC104754043 [Camelina sativa]
Length=823

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -3

Query  195  ESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRL  16
            + +CD+C  +KQ    FPDS + +   F+L+H D+WGPYH H   G +YFLT+VDD SR 
Sbjct  403  QESCDICLGAKQTHQSFPDSFNNAKEIFDLIHCDLWGPYHTHAFCGSRYFLTIVDDCSRA  462

Query  15   TWVFL  1
             W++L
Sbjct  463  VWLYL  467



>ref|XP_010325229.1| PREDICTED: uncharacterized protein LOC104648889 [Solanum lycopersicum]
Length=749

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 51/83 (61%), Gaps = 1/83 (1%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            FS MK +  + S +  +    CD+C  S+Q R  FP SS +S   F+L+H D WGPY   
Sbjct  503  FSNMKFIPNIAS-IFPDSSRICDICAKSRQTRTTFPSSSISSKKIFDLIHVDTWGPYKTP  561

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            T  G +YFLT+VDDFSR TW FL
Sbjct  562  THNGFKYFLTIVDDFSRGTWTFL  584



>ref|XP_009123624.1| PREDICTED: uncharacterized protein LOC103848474 [Brassica rapa]
Length=583

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            CD+C  +KQ R  FPDS   +   F+L+H D+WGP+   TI G +YFLT+VDD S+  W+
Sbjct  493  CDICFRAKQTRESFPDSLHNAKEIFDLIHCDLWGPFKTTTICGSRYFLTIVDDHSQAVWL  552

Query  6    FL  1
            +L
Sbjct  553  YL  554



>gb|AAG50751.1|AC079733_19 polyprotein, putative [Arabidopsis thaliana]
Length=1468

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -3

Query  195  ESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRL  16
            E+ CD C  +KQ R  FP S + S + F+L+H D+WGPY   +  G +YFLT+VDD+SR 
Sbjct  544  ENVCDTCMRAKQTRDTFPLSDNRSMDSFQLIHCDVWGPYRAPSYSGARYFLTIVDDYSRG  603

Query  15   TWVFL  1
             WV+L
Sbjct  604  VWVYL  608



>dbj|BAB10743.1| retroelement pol polyprotein-like [Arabidopsis thaliana]
Length=1109

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -3

Query  195  ESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRL  16
            E+ CD C  +KQ R  FP S + S + F+L+H D+WGPY   +  G +YFLT+VDD+SR 
Sbjct  320  ENVCDTCMRAKQTRDTFPLSDNRSMDSFQLIHCDVWGPYRTPSYSGARYFLTIVDDYSRG  379

Query  15   TWVFL  1
             WV+L
Sbjct  380  VWVYL  384



>ref|XP_009123006.1| PREDICTED: uncharacterized protein LOC103847675 [Brassica rapa]
Length=1066

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            C V  L+KQKRL F  +++ S N F+LVH DIWGP+ + ++ G++YFLTLVDD +R+TW+
Sbjct  424  CHVWPLAKQKRLAFISNNTLSKNPFDLVHLDIWGPFKIESVEGYKYFLTLVDDCTRVTWI  483

Query  6    FL  1
            ++
Sbjct  484  YM  485



>ref|XP_010473846.1| PREDICTED: uncharacterized protein LOC104753269 [Camelina sativa]
Length=907

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 49/77 (64%), Gaps = 2/77 (3%)
 Frame = -3

Query  231  LQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQ  52
            + L +S   +NK  ACD C  +KQ RL FP S + +   FEL+H D+WGPY   T  G +
Sbjct  500  VSLNNSSTFLNK--ACDTCLRAKQTRLSFPISENKTTKIFELIHCDLWGPYRTPTYSGAR  557

Query  51   YFLTLVDDFSRLTWVFL  1
            +FLT+VDD+SR  W+ L
Sbjct  558  FFLTIVDDYSRGVWIHL  574



>ref|XP_009597751.1| PREDICTED: uncharacterized protein LOC104093673 [Nicotiana tomentosiformis]
Length=513

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 3/65 (5%)
 Frame = -3

Query  207  KVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDD  28
            K+NK   CDVC  +KQ R PFP+S   S   F+LVH D+W PY      G++YFLT+VDD
Sbjct  452  KINK---CDVCPCAKQTRQPFPNSCIKSTVSFDLVHIDLWSPYKAAIFDGNKYFLTVVDD  508

Query  27   FSRLT  13
            FSR T
Sbjct  509  FSRTT  513



>ref|XP_010526682.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X4 [Tarenaya hassleriana]
Length=940

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -3

Query  189  ACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTW  10
            +C VC L+KQ+RL FP SS  S   FEL+H D+WGP    +  GH++FL++VDD+SR TW
Sbjct  274  SCPVCPLAKQRRLSFPVSSHVSKFPFELLHVDVWGPCSEISTDGHRFFLSIVDDYSRCTW  333

Query  9    VFL  1
            V+L
Sbjct  334  VYL  336



>ref|XP_010526684.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X6 [Tarenaya hassleriana]
Length=789

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -3

Query  189  ACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTW  10
            +C VC L+KQ+RL FP SS  S   FEL+H D+WGP    +  GH++FL++VDD+SR TW
Sbjct  123  SCPVCPLAKQRRLSFPVSSHVSKFPFELLHVDVWGPCSEISTDGHRFFLSIVDDYSRCTW  182

Query  9    VFL  1
            V+L
Sbjct  183  VYL  185



>emb|CAN82960.1| hypothetical protein VITISV_004472 [Vitis vinifera]
Length=437

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 53/83 (64%), Gaps = 5/83 (6%)
 Frame = -3

Query  234  LLQLLDSDVKVNKES-----ACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            L  +L+SD+  NK+       CD C L K K LPFP  +S +++CF+L+H+D+WGP  V 
Sbjct  341  LSHVLNSDLPGNKDRYSLSLECDSCKLGKSKTLPFPLHASRASHCFDLIHSDVWGPSLVS  400

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            +    +Y++T +DD SR TWV+ 
Sbjct  401  SHEKFKYYVTFIDDHSRFTWVYF  423



>ref|XP_010259176.1| PREDICTED: uncharacterized protein LOC104598693 [Nelumbo nucifera]
Length=550

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -3

Query  189  ACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTW  10
            ACD C   K  R PFP SS  +   F L+H DIWG YHV ++ G +YFLT+VDDFS  TW
Sbjct  303  ACDACERDKHCRNPFPLSSFRATTPFALIHCDIWGAYHVLSLSGARYFLTIVDDFSHYTW  362

Query  9    VFL  1
            ++L
Sbjct  363  IYL  365



>ref|XP_010526683.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X5 [Tarenaya hassleriana]
Length=886

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -3

Query  189  ACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTW  10
            +C VC L+KQ+RL FP SS  S   FEL+H D+WGP    +  GH++FL++VDD+SR TW
Sbjct  220  SCPVCPLAKQRRLSFPVSSHVSKFPFELLHVDVWGPCSEISTDGHRFFLSIVDDYSRCTW  279

Query  9    VFL  1
            V+L
Sbjct  280  VYL  282



>emb|CAN80320.1| hypothetical protein VITISV_034560 [Vitis vinifera]
Length=1261

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            C  C L KQ  LPF +S S S + FEL+H+D+WGP+ V +I G +YF+  +DD+SR +W+
Sbjct  424  CTSCQLGKQPALPFNNSESISKSIFELIHSDVWGPFPVASIGGSRYFVVFIDDYSRYSWI  483

Query  6    F  4
            F
Sbjct  484  F  484



>gb|EPS62921.1| hypothetical protein M569_11867 [Genlisea aurea]
Length=1264

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            C  C LSK  RLPFP +   +   FE +H D+WGPYH  +  G++YFLT+VDD+SR  W+
Sbjct  530  CHTCRLSKPTRLPFPINFKRAEKSFEALHIDLWGPYHTPSRSGNRYFLTIVDDYSRAVWL  589

Query  6    FL  1
            +L
Sbjct  590  YL  591



>ref|XP_010526681.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X3 [Tarenaya hassleriana]
Length=1238

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -3

Query  189  ACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTW  10
            +C VC L+KQ+RL FP SS  S   FEL+H D+WGP    +  GH++FL++VDD+SR TW
Sbjct  609  SCPVCPLAKQRRLSFPVSSHVSKFPFELLHVDVWGPCSEISTDGHRFFLSIVDDYSRCTW  668

Query  9    VFL  1
            V+L
Sbjct  669  VYL  671



>ref|XP_010526678.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X1 [Tarenaya hassleriana]
Length=1275

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -3

Query  189  ACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTW  10
            +C VC L+KQ+RL FP SS  S   FEL+H D+WGP    +  GH++FL++VDD+SR TW
Sbjct  609  SCPVCPLAKQRRLSFPVSSHVSKFPFELLHVDVWGPCSEISTDGHRFFLSIVDDYSRCTW  668

Query  9    VFL  1
            V+L
Sbjct  669  VYL  671



>gb|ABH07899.1| putative polyprotein [Solanum lycopersicum]
Length=1428

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = -3

Query  240  MKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIY  61
            +KLL++  S       + C VC L+KQ RL FP S++ ++  F++VH D+WGPY   T+ 
Sbjct  516  LKLLKIDSSSKGDGIPAHCPVCPLAKQTRLTFPVSTTRTSMMFDVVHMDLWGPYKTPTLN  575

Query  60   GHQYFLTLVDDFSRLTWVFL  1
               YFLT+VDD+SR  WV L
Sbjct  576  RKHYFLTIVDDYSRFVWVHL  595



>emb|CAN81016.1| hypothetical protein VITISV_025518 [Vitis vinifera]
Length=1461

 Score = 77.0 bits (188),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = -3

Query  240  MKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIY  61
            +++L  ++  +  + +  CD+C L+KQ RL FP S  +S   F+L+H DIWGP+ +++  
Sbjct  551  LQVLAKVNPKIYFDSKHVCDICPLAKQTRLSFPSSFISSHAPFDLIHCDIWGPHRINSHS  610

Query  60   GHQYFLTLVDDFSRLTWVFL  1
            G  YFLT+VDD +R TW+ L
Sbjct  611  GAXYFLTIVDDHTRYTWIHL  630



>ref|XP_010526680.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X2 [Tarenaya hassleriana]
Length=1244

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -3

Query  189  ACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTW  10
            +C VC L+KQ+RL FP SS  S   FEL+H D+WGP    +  GH++FL++VDD+SR TW
Sbjct  578  SCPVCPLAKQRRLSFPVSSHVSKFPFELLHVDVWGPCSEISTDGHRFFLSIVDDYSRCTW  637

Query  9    VFL  1
            V+L
Sbjct  638  VYL  640



>dbj|BAA97099.1| retroelement pol polyprotein-like [Arabidopsis thaliana]
Length=1098

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 47/72 (65%), Gaps = 2/72 (3%)
 Frame = -3

Query  216  SDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTL  37
            SD+++ K  +CD+C+ +KQ R  F  S + +  CFEL+H D+WGPY      G  YFLT+
Sbjct  528  SDLEIIK--SCDICYRAKQAREVFSPSLNKTTVCFELIHCDVWGPYRTPASCGSVYFLTI  585

Query  36   VDDFSRLTWVFL  1
            VDDFSR  W FL
Sbjct  586  VDDFSRSVWTFL  597



>emb|CAN74794.1| hypothetical protein VITISV_041689 [Vitis vinifera]
Length=845

 Score = 76.3 bits (186),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 53/83 (64%), Gaps = 5/83 (6%)
 Frame = -3

Query  234  LLQLLDSDVKVNKES-----ACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            L  +L+SD+  NK+       CD C L K K LPFP  +S +++CF+L+H+D+WGP  V 
Sbjct  484  LSHVLNSDLPGNKDRYSLSLECDSCKLGKSKTLPFPLHASRASHCFDLIHSDVWGPSPVS  543

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            +    +Y++T +DD SR TWV+ 
Sbjct  544  SHEKFKYYVTFIDDHSRFTWVYF  566



>emb|CAN71267.1| hypothetical protein VITISV_017889 [Vitis vinifera]
Length=1576

 Score = 76.6 bits (187),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 5/82 (6%)
 Frame = -3

Query  234  LLQLLDSDVKVNKES-----ACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            L  +L+SD+  NK+       CD C L K K LPFP  +S +++CF+L+H+D+WGP  V 
Sbjct  649  LSHVLNSDLPGNKDRYSLSLECDSCKLGKSKTLPFPLHASRASHCFDLIHSDVWGPSPVS  708

Query  69   TIYGHQYFLTLVDDFSRLTWVF  4
            +    +Y++T +DD SR TWV+
Sbjct  709  SHEKFKYYVTFIDDHSRFTWVY  730



>emb|CAN79936.1| hypothetical protein VITISV_033548 [Vitis vinifera]
Length=981

 Score = 76.3 bits (186),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 55/83 (66%), Gaps = 5/83 (6%)
 Frame = -3

Query  234  LLQLLDSDVKVNKESA-----CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            L  +L+SD+  NK+ +     CD C L K K LPFP  +ST+++CF+L+H+++WGP  V 
Sbjct  208  LSHVLNSDLPGNKDRSSLSLECDSCKLGKSKTLPFPLHASTASHCFDLIHSNVWGPSPVS  267

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            +    +Y++T +DD S+ TWV+ 
Sbjct  268  SHEKFKYYVTFIDDHSKFTWVYF  290



>ref|XP_004233950.1| PREDICTED: uncharacterized protein LOC101265997 [Solanum lycopersicum]
Length=953

 Score = 76.3 bits (186),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -3

Query  189  ACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTW  10
             C +C L+KQ RLPF  S+S S   F+L+H D+WGP++  T  G+++F+T+VDD++R+ W
Sbjct  545  TCTICPLAKQHRLPFFHSTSMSTKAFQLLHIDVWGPFNTTTHDGNRFFVTIVDDYTRMLW  604

Query  9    VFL  1
            +FL
Sbjct  605  LFL  607



>emb|CAN71164.1| hypothetical protein VITISV_031057 [Vitis vinifera]
Length=1303

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 5/82 (6%)
 Frame = -3

Query  234  LLQLLDSDVKVNKES-----ACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            L  +L+SD+  NK+       CD C L K K LPFP  +S +++CF+L+H+D+WGP  V 
Sbjct  627  LSHVLNSDLPGNKDRYSLSLECDSCKLGKSKTLPFPLHASRASHCFDLIHSDVWGPSPVS  686

Query  69   TIYGHQYFLTLVDDFSRLTWVF  4
            +    +Y++T +DD SR TWV+
Sbjct  687  SHEKFKYYVTFIDDHSRFTWVY  708



>ref|XP_004231364.1| PREDICTED: uncharacterized protein LOC101245809 [Solanum lycopersicum]
Length=1094

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 51/83 (61%), Gaps = 0/83 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            F KM+ +  +       +   C +C +++Q+RLPF   ++ +++ FEL+H D+WGPY   
Sbjct  541  FVKMRNISSIPVKFSAKQPFMCSICPMARQERLPFKPRTTLTSHIFELLHVDLWGPYSTP  600

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            T    +YF+T+VDDFSR TW  L
Sbjct  601  TYNHFKYFMTIVDDFSRATWTQL  623



>ref|XP_009775421.1| PREDICTED: uncharacterized protein LOC104225345 [Nicotiana sylvestris]
Length=434

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 51/83 (61%), Gaps = 0/83 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            F KMK +  +       +   C +C +++Q RL FP+ ++ +   FEL+H D+WGPYHV 
Sbjct  291  FVKMKGISSILVAFAPKQPFLCPICPMARQTRLSFPERTTLTTKPFELLHIDLWGPYHVT  350

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            T   ++YF+TLV D+SR TW  L
Sbjct  351  THNKYKYFITLVYDYSRSTWTHL  373



>emb|CAA18107.1| LTR retrotransposon like protein [Arabidopsis thaliana]
 emb|CAB79159.1| LTR retrotransposon like protein [Arabidopsis thaliana]
Length=1109

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -3

Query  195  ESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRL  16
            E+ CD C  +KQ R  FP   + S + F+L+H D+WGPY   +  G +YFLT+VDD+SR 
Sbjct  320  ENVCDTCMRAKQTRDTFPLRDNRSMDSFQLIHCDVWGPYRTPSYSGARYFLTIVDDYSRG  379

Query  15   TWVFL  1
             WV+L
Sbjct  380  VWVYL  384



>gb|AAD24600.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1333

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 48/72 (67%), Gaps = 2/72 (3%)
 Frame = -3

Query  216  SDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTL  37
            S   +NK  ACDVCH +KQ R  FP S + +   FEL++ D+WGPY   +  G +YFLT+
Sbjct  415  SSTHLNK--ACDVCHRAKQTRNSFPLSINKTLRIFELIYCDLWGPYRTPSHTGARYFLTI  472

Query  36   VDDFSRLTWVFL  1
            +DD+SR  W++L
Sbjct  473  IDDYSRGVWLYL  484



>emb|CAN79492.1| hypothetical protein VITISV_033373 [Vitis vinifera]
Length=2116

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 52/82 (63%), Gaps = 5/82 (6%)
 Frame = -3

Query  234   LLQLLDSDVKVNKES-----ACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
             L  +L+SD+  NK+       CD C L K K LPFP  +S +++CF+L+H+D WGP  + 
Sbjct  1269  LSHVLNSDLPGNKDRYSLSLECDSCKLGKSKTLPFPLHASRASHCFDLIHSDFWGPSPIS  1328

Query  69    TIYGHQYFLTLVDDFSRLTWVF  4
             +    +Y++T +DD SR TWV+
Sbjct  1329  SYEKFKYYVTFIDDHSRFTWVY  1350



>ref|XP_010274487.1| PREDICTED: uncharacterized protein LOC104609798 [Nelumbo nucifera]
Length=569

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/62 (50%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            C VC  +KQ R  F  S + +   F+L+H D+WGPY V    G  YFLT+VDDFSR  W+
Sbjct  464  CGVCLKAKQTRGTFDSSENNAKKIFDLIHCDLWGPYSVRASCGATYFLTIVDDFSRAVWI  523

Query  6    FL  1
            FL
Sbjct  524  FL  525



>emb|CAN60374.1| hypothetical protein VITISV_001215 [Vitis vinifera]
Length=1535

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            C +C L+KQ RLPF  S  +S   F+L+H DIWG Y   ++ G  YFLT+VDD++R TW+
Sbjct  578  CPICLLAKQHRLPFGTSEISSEKPFDLIHCDIWGRYKHSSLSGAHYFLTIVDDYTRFTWI  637

Query  6    FL  1
            FL
Sbjct  638  FL  639



>ref|XP_009596841.1| PREDICTED: uncharacterized protein LOC104092864 [Nicotiana tomentosiformis]
Length=653

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 51/74 (69%), Gaps = 1/74 (1%)
 Frame = -3

Query  240  MKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIY  61
            +K +  L++D ++ KE  C VCH++KQ R  F  +++   N F+L+HADIWGPY V T  
Sbjct  204  LKKIGSLNND-QMKKEQFCTVCHVAKQIRTHFSLTNAYFINSFDLIHADIWGPYRVPTHN  262

Query  60   GHQYFLTLVDDFSR  19
            G  YF+TLVDD+SR
Sbjct  263  GRNYFMTLVDDYSR  276



>ref|XP_010667912.1| PREDICTED: uncharacterized protein LOC104884908 [Beta vulgaris 
subsp. vulgaris]
Length=1117

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -3

Query  189  ACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTW  10
            AC VC  +KQ R  FP S + ++  FEL+H D+WG Y   +  G  YFLTLVDDFSR TW
Sbjct  454  ACTVCPQAKQSRPSFPTSYNKASRIFELIHCDLWGSYKTPSSCGAHYFLTLVDDFSRATW  513

Query  9    VFL  1
            V+L
Sbjct  514  VYL  516



>ref|XP_010665586.1| PREDICTED: uncharacterized protein LOC104882867 [Beta vulgaris 
subsp. vulgaris]
Length=872

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/83 (43%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
             SKM+ ++    + K  K   CD+C L+K  R PF  S S + + F+L+H D+WG Y   
Sbjct  570  LSKMQHIEF--CNCKHLKHYFCDICSLAKHHRQPFMPSKSIADSIFDLIHIDLWGAYKSK  627

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
             I G  YFLT+VDD SR+TW  L
Sbjct  628  AITGGNYFLTIVDDNSRVTWTHL  650



>emb|CAN61929.1| hypothetical protein VITISV_014855 [Vitis vinifera]
Length=1271

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            C  C L KQ  LPF +S S S + FEL+H+D+WGP  V +I G +YF+  +DD+SR +W+
Sbjct  506  CTSCQLGKQPALPFNNSDSISKSIFELIHSDVWGPSPVASIGGSRYFVVFIDDYSRYSWI  565

Query  6    F  4
            F
Sbjct  566  F  566



>emb|CAN63642.1| hypothetical protein VITISV_038695 [Vitis vinifera]
Length=1069

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 5/82 (6%)
 Frame = -3

Query  234  LLQLLDSDVKVNKES-----ACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            L  +L+SD+  NK+       CD C L K K LPFP  +S +++CF+L+H+D WGP  V 
Sbjct  427  LSHVLNSDLPSNKDRYSSSLECDSCKLGKSKTLPFPLHASRASHCFDLIHSDAWGPSPVS  486

Query  69   TIYGHQYFLTLVDDFSRLTWVF  4
            +    +Y++T +DD SR TWV+
Sbjct  487  SHEKFKYYVTFIDDHSRFTWVY  508



>ref|XP_009602905.1| PREDICTED: uncharacterized protein LOC104097976 [Nicotiana tomentosiformis]
Length=870

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 6/79 (8%)
 Frame = -3

Query  237  KLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYG  58
            KL  + D+   +NK   C V   ++Q RL FP S   +   F+L+H D+WGPY+  T  G
Sbjct  565  KLASINDT---INK---CSVYPCARQTRLAFPSSCIKTVVAFDLIHLDVWGPYNCATFDG  618

Query  57   HQYFLTLVDDFSRLTWVFL  1
            ++YFLT+VDDF+R+TWVF 
Sbjct  619  NRYFLTVVDDFTRMTWVFF  637



>emb|CAN75041.1| hypothetical protein VITISV_027174 [Vitis vinifera]
Length=1381

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            C  C L KQ  LPF +S S S + FEL+H+D+WGP  V +I G +YF+  +DD+SR +W+
Sbjct  514  CTSCQLGKQPALPFNNSDSISKSIFELIHSDVWGPSPVASIGGSRYFVVFIDDYSRYSWI  573

Query  6    F  4
            F
Sbjct  574  F  574



>ref|XP_010675539.1| PREDICTED: uncharacterized protein LOC104891530 [Beta vulgaris 
subsp. vulgaris]
Length=1011

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 48/80 (60%), Gaps = 0/80 (0%)
 Frame = -3

Query  240  MKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIY  61
            +KLL  L   V      AC++C  +K  R  FP S S ++  FE +H D+WGPY   +  
Sbjct  426  VKLLPPLCGHVGSLSNKACEICFRAKHTREKFPLSDSKASRIFEKIHCDLWGPYRQVSSC  485

Query  60   GHQYFLTLVDDFSRLTWVFL  1
            G +YFLT+VDDFSR  WV+L
Sbjct  486  GARYFLTIVDDFSRAVWVYL  505



>ref|XP_010412617.1| PREDICTED: uncharacterized protein LOC104698945 [Camelina sativa]
Length=1386

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 2/72 (3%)
 Frame = -3

Query  216  SDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTL  37
            S + +NK  ACDVC  +KQ R  FP S + +   FEL+H D+WGPY   +  G +YFLT+
Sbjct  503  SSMHLNK--ACDVCLRAKQTRQSFPLSLNKTERIFELIHCDLWGPYRTTSHSGAKYFLTI  560

Query  36   VDDFSRLTWVFL  1
            VDD+SR  W++L
Sbjct  561  VDDYSRGVWLYL  572



>ref|XP_010675125.1| PREDICTED: uncharacterized protein LOC104891164 [Beta vulgaris 
subsp. vulgaris]
Length=916

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 52/84 (62%), Gaps = 2/84 (2%)
 Frame = -3

Query  249  FSKMK-LLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHV  73
            FS+ K LL  LD    V K   C VC L+KQ RL F  S   S   F+L+H D+WGPYH 
Sbjct  475  FSQFKHLLPHLDVSSCV-KSCICQVCPLAKQPRLSFHHSEIKSVKPFQLLHLDVWGPYHT  533

Query  72   HTIYGHQYFLTLVDDFSRLTWVFL  1
             T  G Q+FLT+VDDF+R TW+ L
Sbjct  534  VTHDGCQFFLTIVDDFTRCTWIHL  557



>ref|XP_010412990.1| PREDICTED: uncharacterized protein LOC104699374 [Camelina sativa]
Length=1511

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 2/72 (3%)
 Frame = -3

Query  216  SDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTL  37
            S + +NK  ACDVC  +KQ R  FP S + +   FEL+H D+WGPY   +  G +YFLT+
Sbjct  557  SSMHLNK--ACDVCLRAKQTRQSFPLSLNKTVRIFELIHCDLWGPYRTTSHSGAKYFLTI  614

Query  36   VDDFSRLTWVFL  1
            VDD+SR  W++L
Sbjct  615  VDDYSRGVWLYL  626



>emb|CAN70907.1| hypothetical protein VITISV_015933 [Vitis vinifera]
Length=354

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = -3

Query  213  DVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLV  34
            +  V   +AC +C L+KQ RLPF  S+ +S   FE++H DIWG Y   ++ G  YFLT+V
Sbjct  284  NFSVQSNNACPICSLTKQSRLPFGTSAISSTKPFEIIHCDIWGCYQHLSLSGAHYFLTIV  343

Query  33   DDFSRLTW  10
            DD++  TW
Sbjct  344  DDYTHFTW  351



>emb|CAN70361.1| hypothetical protein VITISV_033646 [Vitis vinifera]
Length=1013

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            C  C L KQ  LPF +S S S + FEL+H+D+WGP  V +I G +YF+  +DD+SR  W+
Sbjct  205  CTSCQLGKQPTLPFNNSESISNSIFELIHSDVWGPSPVASIGGSRYFVVFIDDYSRYIWI  264

Query  6    F  4
            F
Sbjct  265  F  265



>emb|CAN74229.1| hypothetical protein VITISV_000584 [Vitis vinifera]
Length=1039

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -3

Query  240  MKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIY  61
            +++L  ++ ++  + +  CD+  L+KQ RL FP S  +S   F+L+H DIWGP+ +++  
Sbjct  143  LQVLAKVNXEIYFDSKHVCDIXPLAKQTRLSFPSSFISSHAPFDLIHCDIWGPHRINSHS  202

Query  60   GHQYFLTLVDDFSRLTWVFL  1
            G +YFLT+VDD +R TW+ L
Sbjct  203  GARYFLTIVDDHTRYTWIHL  222



>emb|CAN79142.1| hypothetical protein VITISV_040460 [Vitis vinifera]
Length=1293

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            C  C L KQ  LPF +S S S + FEL+H+D+WGP  + +I G +YF+  +DD+SR +W+
Sbjct  316  CTSCQLGKQPALPFNNSESISNSIFELIHSDVWGPSPIASIGGSRYFVVFIDDYSRYSWI  375

Query  6    F  4
            F
Sbjct  376  F  376



>emb|CAN83290.1| hypothetical protein VITISV_018945 [Vitis vinifera]
Length=723

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 53/83 (64%), Gaps = 5/83 (6%)
 Frame = -3

Query  234  LLQLLDSDVKVNKESA-----CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            L  +L+S +  NK+ +     CD C L K K LPFP  +S +++CF+L+H+D+WGP  V 
Sbjct  387  LSHVLNSXLPGNKDCSSLSLECDSCKLGKSKTLPFPLHASRASHCFDLIHSDVWGPSPVS  446

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            +    +Y++T +DD SR TWV+ 
Sbjct  447  SHEKFKYYMTFIDDXSRFTWVYF  469



>gb|AAT58770.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1419

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = -3

Query  216  SDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTL  37
             +V +  +  C  C L KQ +LP+  S S S + F LVH+D+WGP   H+  GH+Y++  
Sbjct  660  GNVSIETDFVCKGCKLGKQVQLPYRSSMSRSTSPFALVHSDVWGPAPFHSKGGHRYYVIF  719

Query  36   VDDFSRLTWVF  4
            VDDFSR TW++
Sbjct  720  VDDFSRYTWIY  730



>ref|XP_009613779.1| PREDICTED: uncharacterized protein LOC104106841 [Nicotiana tomentosiformis]
Length=792

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            C +C ++ Q +LPF  S + +   FELVH DIWGPY V T  G +YF+T+VDD++R TW 
Sbjct  407  CTLCPVAMQSKLPFQLSIAATKAIFELVHCDIWGPYRVPTYDGKRYFVTIVDDYARYTWK  466

Query  6    FL  1
            FL
Sbjct  467  FL  468



>ref|XP_007034104.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
 gb|EOY05030.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
Length=1141

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -3

Query  219  DSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLT  40
            D  + V +   CD C  ++Q RLPF  S+  S+  FEL+H DIWG Y   ++ G  YFLT
Sbjct  318  DLSINVKENKFCDACCRARQHRLPFFASTYESSRIFELIHCDIWGDYKTPSLSGAVYFLT  377

Query  39   LVDDFSRLTWVFL  1
            +V+D+SR  WV+L
Sbjct  378  IVNDYSRAIWVYL  390



>ref|XP_010317367.1| PREDICTED: uncharacterized protein LOC101266092 [Solanum lycopersicum]
Length=287

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = -3

Query  240  MKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIY  61
            +K +  L S  +     +C VC L++  R  FP S   +   FEL+H D+WGPY+  T  
Sbjct  91   LKKIDSLKSAFQHQDFESCLVCPLARHTRFSFPSSIKKTVFPFELLHMDVWGPYNKCTYN  150

Query  60   GHQYFLTLVDDFSRLTWVFL  1
             H++FLT+V+D+SR+TW+FL
Sbjct  151  CHRFFLTIVNDYSRMTWIFL  170



>ref|XP_009760003.1| PREDICTED: uncharacterized protein LOC104212438 [Nicotiana sylvestris]
Length=321

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            FS+MK + +L   +   +   C VC L+++ RL FPD++  S   F+L+H D W  YH  
Sbjct  194  FSRMKGIPILSPCLSSKQSFPCPVCPLARKTRLSFPDNTIHSTAPFQLIHIDTWSLYHSS  253

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            T +  +YFLT+VDD+ R TW  L
Sbjct  254  TSHLAKYFLTIVDDYPRATWTHL  276



>emb|CAN75186.1| hypothetical protein VITISV_001913 [Vitis vinifera]
Length=746

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = -3

Query  207  KVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDD  28
            ++NK   C +C L+KQ+R  F   +  S   F+LVH DIWGPY V +   H+YFLTL DD
Sbjct  97   QLNKALPCYICPLAKQRRFSFDSHNHMSQFPFDLVHCDIWGPYSVSSHARHRYFLTLGDD  156

Query  27   FSRLTWVFL  1
             SR TW+FL
Sbjct  157  CSRFTWIFL  165



>ref|XP_009602511.1| PREDICTED: uncharacterized protein LOC104097618 [Nicotiana tomentosiformis]
Length=568

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            F+K+K +  + +     +   C +C +++  RLPFP+ ++ +   FE++HAD+WGPYH+ 
Sbjct  490  FAKIKGINEMPAKFTPTQPFLCPICPMARHSRLPFPERTTLATEVFEILHADLWGPYHIA  549

Query  69   TIYGHQYFLTLVDDFSRLT  13
            T   H+YF+  V D+SR T
Sbjct  550  THGRHKYFIAFVVDYSRCT  568



>emb|CAN77868.1| hypothetical protein VITISV_001383 [Vitis vinifera]
Length=662

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 54/83 (65%), Gaps = 5/83 (6%)
 Frame = -3

Query  234  LLQLLDSDVKVNKESA-----CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            L  +L+SD+  NK+ +     CD C L K K LPFP  +S +++CF+L+H+D+WGP  V 
Sbjct  87   LSHVLNSDLPGNKDRSSISLECDSCKLGKSKTLPFPLHASRASHCFDLIHSDVWGPSPVS  146

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            +    +Y++T +DD ++ TWV+ 
Sbjct  147  SHEKFKYYVTFIDDHNKFTWVYF  169



>dbj|BAB01972.1| copia-like retrotransposable element [Arabidopsis thaliana]
Length=1499

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 34/88 (39%), Positives = 51/88 (58%), Gaps = 5/88 (6%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNK----ESACDVCHLSKQKRLPFPDSSSTSAN-CFELVHADIWG  85
            + K++ +Q L    K+ K    +  C  C + KQ R  FP  S ++ N   EL+H+D+ G
Sbjct  466  YDKIETMQTLKIVEKLPKFEVIKGICAACEMGKQSRRSFPKKSQSNTNKTLELIHSDVCG  525

Query  84   PYHVHTIYGHQYFLTLVDDFSRLTWVFL  1
            P    +I G +YFLT +DDFSR+TWV+ 
Sbjct  526  PMQTESINGSRYFLTFIDDFSRMTWVYF  553



>ref|XP_010260173.1| PREDICTED: uncharacterized protein LOC104599359 [Nelumbo nucifera]
Length=783

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            C++ HL+KQ+RLPFP S   S +  +L+H D+WGPY   +I    Y  TLVDDF+R TW+
Sbjct  563  CEIYHLAKQQRLPFPVSKIRSKSIIDLMHLDLWGPYKHPSITSAHYVFTLVDDFNRSTWI  622

Query  6    FL  1
            FL
Sbjct  623  FL  624



>emb|CAN72268.1| hypothetical protein VITISV_017854 [Vitis vinifera]
Length=972

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 54/83 (65%), Gaps = 5/83 (6%)
 Frame = -3

Query  234  LLQLLDSDVKVNKESA-----CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            L  +L+SD+  NK+ +     CD C L K K LPFP  +S +++CF+L+H+++WGP  V 
Sbjct  358  LSHVLNSDLPSNKDRSSLSLECDSCKLGKSKTLPFPLHASRASHCFDLIHSNVWGPSSVS  417

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            ++   +Y++T ++D S  TWV+ 
Sbjct  418  SLEKFKYYVTFIBDHSIFTWVYF  440



>ref|XP_007029159.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
 gb|EOY09661.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
Length=492

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  LSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWVFL  1
            ++KQK+LPF     ++   F+LVH DIWGPY   T+ G +YFL +VDDF+R TWVFL
Sbjct  1    MAKQKKLPFLVHVQSTTCAFQLVHVDIWGPYETPTLSGQRYFLIVVDDFTRFTWVFL  57



>ref|XP_008338000.1| PREDICTED: uncharacterized protein LOC103401070 [Malus domestica]
Length=952

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 44/63 (70%), Gaps = 1/63 (2%)
 Frame = -3

Query  189  ACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTW  10
            +C+  HLSK  RLPF  S S ++ CFELVH D+WGP    +  G++YF+  V DFSR+TW
Sbjct  547  SCETXHLSKSTRLPFNSSLSRTSKCFELVHXDVWGPTS-ESFDGYKYFVIFVXDFSRVTW  605

Query  9    VFL  1
            ++L
Sbjct  606  LYL  608



>ref|XP_010690733.1| PREDICTED: uncharacterized protein LOC104904233 [Beta vulgaris 
subsp. vulgaris]
Length=643

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  SDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTL  37
            SDV    +  CDVC  + Q R  F  S+S ++  FELVH D+WGPY  ++  G  YF TL
Sbjct  524  SDVSSCNKDWCDVCFRAHQPRTSFSRSNSRASRMFELVHCDLWGPYRTNSSCGASYFFTL  583

Query  36   VDDFSRLTWVFL  1
            VDD+SR  W +L
Sbjct  584  VDDYSRSVWTYL  595



>emb|CAN67970.1| hypothetical protein VITISV_025093 [Vitis vinifera]
Length=1023

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 53/82 (65%), Gaps = 5/82 (6%)
 Frame = -3

Query  234  LLQLLDSDVKVNKESA-----CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            L  +L+ D+  NK+ +     CD C L K K LPFP  +S +++CF+L+H+D+WGP  + 
Sbjct  403  LSHVLNFDLPGNKDRSSLSLECDSCKLGKSKTLPFPLHASRASHCFDLIHSDVWGPSPIS  462

Query  69   TIYGHQYFLTLVDDFSRLTWVF  4
            +    +Y++T +DD SR TWV+
Sbjct  463  SHEKFKYYVTFIDDHSRFTWVY  484



>emb|CAN62394.1| hypothetical protein VITISV_021305 [Vitis vinifera]
Length=1287

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            C  C + KQ  LPF +S S S + FEL+H+D+WGP  V +I G +YF+  +DD+SR +W+
Sbjct  481  CTSCQIGKQPALPFNNSESISHSIFELIHSDVWGPSPVASIGGSRYFVVFIDDYSRYSWI  540

Query  6    F  4
            F
Sbjct  541  F  541



>ref|XP_010420948.1| PREDICTED: uncharacterized protein LOC104706448 [Camelina sativa]
Length=770

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 49/72 (68%), Gaps = 2/72 (3%)
 Frame = -3

Query  216  SDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTL  37
            S + +NK+  CDVC  +K+ R  FP S + ++  FEL+H  +WGPY V +  G +YFLT+
Sbjct  378  SVINLNKD--CDVCFCAKKTRESFPLSMNKTSTIFELIHIVLWGPYRVPSHSGARYFLTI  435

Query  36   VDDFSRLTWVFL  1
            VDD+S+  W++L
Sbjct  436  VDDYSKGVWLYL  447



>ref|XP_008372204.1| PREDICTED: uncharacterized protein LOC103435597 [Malus domestica]
Length=1159

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            C+ CHLSK  RLPF  SSS ++  FELVH+D+WGP    +   ++Y++  VDDFSR TW+
Sbjct  548  CETCHLSKXTRLPFHSSSSXTSKVFELVHSDVWGPT-FESFDXYKYYVIFVDDFSRATWL  606

Query  6    FL  1
            +L
Sbjct  607  YL  608



>emb|CAN67587.1| hypothetical protein VITISV_036279 [Vitis vinifera]
Length=1034

 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 54/83 (65%), Gaps = 5/83 (6%)
 Frame = -3

Query  234  LLQLLDSDVKVNKESA-----CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            L  +L+SD+  NK+ +     CD C LSK K L FP  +S +++CF+L+H+D+WGP  V 
Sbjct  466  LSHVLNSDLLGNKDRSSLSLKCDSCKLSKSKTLHFPLHTSRASHCFDLIHSDVWGPSSVS  525

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            +    +Y++T +DD SR TWV+ 
Sbjct  526  SHEKFKYYVTFIDDHSRFTWVYF  548



>ref|XP_010677705.1| PREDICTED: uncharacterized protein LOC104893304 [Beta vulgaris 
subsp. vulgaris]
Length=1239

 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = -3

Query  240  MKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIY  61
            +KLL  L   V      AC+VC  +K  R  FP S S ++  FE +H D+WGPY   +  
Sbjct  410  VKLLPPLCGHVGSLSNKACEVCFRAKHTRDKFPLSDSKASRIFEKIHCDLWGPYRHVSSC  469

Query  60   GHQYFLTLVDDFSRLTWVFL  1
            G +YF TLVDDFSR  WV+L
Sbjct  470  GARYFFTLVDDFSRAVWVYL  489



>ref|NP_001174869.1| Os06g0583500 [Oryza sativa Japonica Group]
 dbj|BAH93597.1| Os06g0583500, partial [Oryza sativa Japonica Group]
Length=174

 Score = 69.3 bits (168),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = -3

Query  210  VKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVD  31
            V ++    C  C L KQ +LP+P S+S ++  F+LVH+D+WGP    +  GH+Y++  +D
Sbjct  94   VSIDTTFDCTGCKLGKQIQLPYPISNSRTSCPFDLVHSDVWGPAPFASKGGHKYYVIFID  153

Query  30   DFSRLTWVF  4
            D+SR TW++
Sbjct  154  DYSRYTWIY  162



>ref|XP_004243080.1| PREDICTED: uncharacterized protein LOC101259058 [Solanum lycopersicum]
Length=1041

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/77 (43%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = -3

Query  240  MKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIY  61
            M+ ++ L   +       CD+C LSK  RL FP+ S+     F+LVH D+WGPY   T  
Sbjct  473  MQHIKALPHKIHPQVHDQCDICPLSKYHRLKFPEHSTKVTASFDLVHLDVWGPYKKPTYD  532

Query  60   GHQYFLTLVDDFSRLTW  10
                F+TLVDD+SR TW
Sbjct  533  MKHSFVTLVDDYSRYTW  549



>ref|XP_010695294.1| PREDICTED: uncharacterized protein LOC104907962 [Beta vulgaris 
subsp. vulgaris]
Length=797

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 52/84 (62%), Gaps = 2/84 (2%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVK-VNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHV  73
            FS++K + L + DVK    +  C VC  +KQ R  FP S+S S   FEL+H D+WGPY  
Sbjct  422  FSQIKHV-LPECDVKSCIHDIVCHVCPAAKQTRKSFPISTSHSVKPFELLHIDVWGPYRS  480

Query  72   HTIYGHQYFLTLVDDFSRLTWVFL  1
             T  G   FLT+VDDF+R TWV L
Sbjct  481  KTHTGCNQFLTIVDDFTRFTWVHL  504



>ref|XP_009144811.1| PREDICTED: uncharacterized protein LOC103868473 [Brassica rapa]
Length=860

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -3

Query  201  NKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFS  22
            +K   C++C  +KQ R  FP+SS+ ++  F+L+H D+WGPY      G  YFLT+VDDFS
Sbjct  410  DKFGGCNICFKAKQTRGVFPESSNKASVPFKLIHVDLWGPYREPASCGAVYFLTIVDDFS  469

Query  21   RLTWVFL  1
            R  W+ L
Sbjct  470  RAVWIHL  476



>gb|AAG10817.1|AC011808_5 Putative retroelement polyprotein [Arabidopsis thaliana]
Length=1413

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            CD+C  +KQK+L +P   +     F+L+H D+WGP+   T  G+ YFLT+VDD +R+TWV
Sbjct  566  CDICQRAKQKKLTYPSRHNICLAPFDLLHIDVWGPFSEPTQEGYHYFLTIVDDHTRVTWV  625

Query  6    FL  1
            +L
Sbjct  626  YL  627



>emb|CAN62271.1| hypothetical protein VITISV_010713 [Vitis vinifera]
Length=711

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 52/83 (63%), Gaps = 5/83 (6%)
 Frame = -3

Query  234  LLQLLDSDVKVNKESA-----CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            L  +L+SD+  NK+ +     CD C   K K LPFP  +S +++CF+L+H+D+W P  V 
Sbjct  358  LSHVLNSDLPGNKDRSSLSLECDSCKFGKSKTLPFPLHASRASHCFDLIHSDVWEPSPVS  417

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            +    +Y++T +DD SR TWV+ 
Sbjct  418  SHEKFKYYVTFIDDHSRFTWVYF  440



>ref|XP_010696216.1| PREDICTED: uncharacterized protein LOC104908765 [Beta vulgaris 
subsp. vulgaris]
Length=445

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = -3

Query  246  SKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHT  67
            SK+K +  L   ++ N+   C  C ++K  + PFP S++  A  F+L+H DIWGPY V  
Sbjct  274  SKLKYISCLKKHLETNQNEICLSCTMAKLTKSPFPLSNTLVAGPFDLIHIDIWGPYRVPY  333

Query  66   IYGHQYFLTLVDDFSRLTWVFL  1
                ++FL +VDD++R TWV L
Sbjct  334  KGKFRFFLIIVDDYTRATWVHL  355



>emb|CAN67539.1| hypothetical protein VITISV_021584 [Vitis vinifera]
Length=1652

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 53/83 (64%), Gaps = 5/83 (6%)
 Frame = -3

Query  234  LLQLLDSDVKVNKESA-----CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            L  +L+SD+  NK+ +     CD C L K K L FP  +S +++CF+L+H+D+WGP  V 
Sbjct  568  LSHVLNSDLPDNKDRSSLSLECDSCKLGKSKTLLFPLHASRASHCFDLIHSDVWGPSPVS  627

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            +    +Y++T +DD SR TWV+ 
Sbjct  628  SHEKFKYYVTFIDDHSRFTWVYF  650



>ref|XP_008387850.1| PREDICTED: uncharacterized protein LOC103450292 [Malus domestica]
Length=778

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = -3

Query  204  VNKESA-CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDD  28
            + KES  C+ CHLSK  RLP   S S     FELVH+DIWGP    +  G++YF+  VDD
Sbjct  407  LGKESTHCETCHLSKATRLPLGSSMSRVFQPFELVHSDIWGP-SSESFDGYKYFIIFVDD  465

Query  27   FSRLTWVFL  1
            +SR TW++L
Sbjct  466  YSRTTWLYL  474



>gb|AFN88207.1| integrase core domain containing protein [Phaseolus vulgaris]
Length=1387

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 50/83 (60%), Gaps = 2/83 (2%)
 Frame = -3

Query  246  SKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANC-FELVHADIWGPYHVH  70
            S  K+ QL+ S   V+  S C+ C   K  R  FP S S  A+  F LVH+DIWGP  + 
Sbjct  491  SLAKMQQLVPSLSNVSSLS-CESCQFGKHIRSSFPSSVSQRASSPFALVHSDIWGPSRIK  549

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
            +  G QYF+T +DD+SR TWVFL
Sbjct  550  SNLGFQYFVTFIDDYSRCTWVFL  572



>emb|CAN64955.1| hypothetical protein VITISV_029829 [Vitis vinifera]
Length=1368

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            C+ C L+K  R+ FP S+  S++ F L+H+DIWGP  +  + G ++F++L+DD +R+TW+
Sbjct  460  CETCELAKHTRVSFPISNKRSSHXFHLIHSDIWGPSTIPNVSGARWFVSLIDDCTRVTWI  519

Query  6    FL  1
            FL
Sbjct  520  FL  521



>ref|XP_010671949.1| PREDICTED: uncharacterized protein LOC104888623 [Beta vulgaris 
subsp. vulgaris]
Length=840

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 50/84 (60%), Gaps = 2/84 (2%)
 Frame = -3

Query  249  FSKMK-LLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHV  73
            FSK K LL  +D    V +   C VC L+KQ RL F  S   S   F+L+H D+WGPY  
Sbjct  433  FSKFKHLLPTIDVSSCV-QNCICQVCPLAKQPRLTFHSSQIKSVRSFQLLHLDVWGPYQT  491

Query  72   HTIYGHQYFLTLVDDFSRLTWVFL  1
             T  G  +FLT+VDDF+R TW+ L
Sbjct  492  VTHNGCTFFLTIVDDFTRCTWIHL  515



>emb|CAN69870.1| hypothetical protein VITISV_032283 [Vitis vinifera]
Length=959

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 29/71 (41%), Positives = 43/71 (61%), Gaps = 3/71 (4%)
 Frame = -3

Query  204  VNKESA---CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLV  34
            +NK  A   C++C  +K  R  +P      +  F LVH+D+WGP  +  I G ++F+T V
Sbjct  155  INKNPASYXCEICQFAKHTRTVYPQIXYKPSTVFSLVHSDVWGPSRIKNISGTRWFVTFV  214

Query  33   DDFSRLTWVFL  1
            DD +R+TWVFL
Sbjct  215  DDHTRVTWVFL  225



>emb|CAD39831.3| OSJNBa0079F16.4 [Oryza sativa Japonica Group]
Length=1708

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 35/66 (53%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = -3

Query  195  ESACDVCHLSKQKRLPFPDSSSTSAN-CFELVHADIWGPYHVHTIYGHQYFLTLVDDFSR  19
            E  CDVC L+KQ+RLPFP  +S  A    ELVH D+ GP    T  G +YFL LVDD SR
Sbjct  826  EQLCDVCVLTKQRRLPFPQQTSFRAKEQLELVHGDLCGPVTPATPGGRRYFLLLVDDLSR  885

Query  18   LTWVFL  1
              WV +
Sbjct  886  YMWVMV  891



>ref|XP_009144144.1| PREDICTED: uncharacterized protein LOC103867808 [Brassica rapa]
Length=534

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = -3

Query  195  ESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRL  16
             + C +C LSKQ+RL +   ++ S + F+LVH DIWGP+ V ++ G++YFLTLVDD +R+
Sbjct  474  NTPCTICPLSKQRRLAYVSHNTLSQSPFDLVHLDIWGPFSVQSVEGYRYFLTLVDDCTRV  533

Query  15   T  13
            T
Sbjct  534  T  534



>ref|XP_010412622.1| PREDICTED: uncharacterized protein LOC104698950 [Camelina sativa]
Length=567

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = -3

Query  201  NKE-SACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDF  25
            NK+ S CD+C  +K  R  F  S + S   F+++H D+WGPY   T+    YFLT+VDDF
Sbjct  499  NKDFSVCDICLKAKHCREVFHTSDNKSDGVFDMIHVDLWGPYRRPTLCNSYYFLTIVDDF  558

Query  24   SRLTWVFL  1
            SR  WV+L
Sbjct  559  SRGVWVYL  566



>gb|AAR88589.1| putative copia-like retrotransposon protein [Oryza sativa Japonica 
Group]
Length=1399

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = -3

Query  204  VNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDF  25
             NK+S CD C   K  +LP+P SSS S+   EL+ +++WGP  + ++ G +++++ +DD+
Sbjct  447  ANKDSICDACQKGKSHQLPYPKSSSVSSQPLELIFSNVWGPAPI-SVGGKKFYVSFIDDY  505

Query  24   SRLTWVFL  1
            S+ TWV+L
Sbjct  506  SKFTWVYL  513



>ref|XP_010683416.1| PREDICTED: uncharacterized protein LOC104898103 [Beta vulgaris 
subsp. vulgaris]
Length=654

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = -3

Query  237  KLLQLLD--SDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTI  64
            K+++LL   S +K +   ACD+C  ++  R  FP S + +   FE +H D+WGPY   + 
Sbjct  523  KVVKLLSPVSHLKGSLPKACDICFYAQHPRDQFPISDTKTTRIFEKIHCDLWGPYRHASS  582

Query  63   YGHQYFLTLVDDFSRLTWVFL  1
             G +YFLT+VDDFSR  W +L
Sbjct  583  CGARYFLTIVDDFSRAVWTYL  603



>gb|EEE55237.1| hypothetical protein OsJ_03115 [Oryza sativa Japonica Group]
Length=276

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 39/64 (61%), Gaps = 1/64 (2%)
 Frame = -3

Query  195  ESACDVCHLSKQKRLPFPDSSSTSAN-CFELVHADIWGPYHVHTIYGHQYFLTLVDDFSR  19
            E  CDVC ++KQ+RLPFP   S  A    ELVH D+ GP    T  G +YFL LVDD SR
Sbjct  12   EQLCDVCVVTKQRRLPFPQQMSFRAKERLELVHGDLCGPVTPATPGGRRYFLLLVDDLSR  71

Query  18   LTWV  7
              WV
Sbjct  72   YMWV  75



>ref|XP_010484894.1| PREDICTED: uncharacterized protein LOC104763183 [Camelina sativa]
Length=1077

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = -3

Query  246  SKMKLLQLLD-SDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
            + M++LQ  D S        +CDVC  ++Q    FP S++ ++  FEL+H D+WGPY   
Sbjct  524  TSMEMLQFSDLSSSSGFDSQSCDVCIRARQTHDSFPLSNNKTSFPFELIHCDLWGPYRTT  583

Query  69   TIYGHQYFLTLVDDFSRLTWVFL  1
             + G +YFLT++DD+SR+ W++L
Sbjct  584  ALCGSRYFLTILDDYSRVVWIYL  606



>ref|XP_010669433.1| PREDICTED: uncharacterized protein LOC104886664 [Beta vulgaris 
subsp. vulgaris]
Length=555

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLT  13
            C++C  +K  + PFP S +  A CF+LVH D+WGPY   TI G  YFLT++DD SR T
Sbjct  498  CEICIFAKHHKSPFPRSLNRVAACFDLVHMDLWGPYKTKTILGASYFLTILDDHSRCT  555



>emb|CAN75466.1| hypothetical protein VITISV_025054 [Vitis vinifera]
Length=1576

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = -3

Query  240  MKLLQLLDSDVKVNKES-ACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTI  64
            M L  L  S    N +S  C++C LSKQ R  FP      ++ F ++H+DIWGP  +  +
Sbjct  646  MYLKHLFPSLFNKNPQSFECEICQLSKQVRSHFPIQPYKESSPFSMIHSDIWGPSRIKNV  705

Query  63   YGHQYFLTLVDDFSRLTWVFL  1
             G ++F++ +DD +RLTWVFL
Sbjct  706  TGTRWFVSFIDDHTRLTWVFL  726



>ref|XP_008465178.1| PREDICTED: uncharacterized protein LOC103502842 [Cucumis melo]
Length=385

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            C  C L+KQ  L F  S+S S   F+L+H+DIWGP    T++G++Y++  +DDFSR TW+
Sbjct  276  CLNCKLTKQSALSFSTSTSISDKSFDLIHSDIWGPAPSSTVHGYRYYVLFIDDFSRFTWI  335

Query  6    F  4
            +
Sbjct  336  Y  336



>emb|CAN67362.1| hypothetical protein VITISV_001157 [Vitis vinifera]
Length=1259

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/71 (41%), Positives = 43/71 (61%), Gaps = 3/71 (4%)
 Frame = -3

Query  204  VNKESA---CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLV  34
            +NK  A   C++C  +K  R  +P      +  F LVH+D+WGP  +  I G ++F+T V
Sbjct  502  INKNPASYHCEICQFAKHTRTVYPQIPYKPSTVFSLVHSDVWGPSRIKNISGTRWFVTFV  561

Query  33   DDFSRLTWVFL  1
            DD +R+TWVFL
Sbjct  562  DDHTRVTWVFL  572



>emb|CAN79175.1| hypothetical protein VITISV_001884 [Vitis vinifera]
Length=1487

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/71 (41%), Positives = 43/71 (61%), Gaps = 3/71 (4%)
 Frame = -3

Query  204  VNKESA---CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLV  34
            +NK  A   C++C  +K  R  +P      +  F LVH+D+WGP  +  I G ++F+T V
Sbjct  455  INKNPASYHCEICQFAKHTRTVYPQIPYKPSTVFSLVHSDVWGPSRIKNISGTRWFVTFV  514

Query  33   DDFSRLTWVFL  1
            DD +R+TWVFL
Sbjct  515  DDHTRVTWVFL  525



>emb|CAN82483.1| hypothetical protein VITISV_006799 [Vitis vinifera]
Length=1180

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = -3

Query  240  MKLLQLLDSDVKVNKES-ACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTI  64
            M L  L  S    N +S  C++C LSKQ R  FP      ++ F ++H+DIWGP  +  +
Sbjct  250  MYLKHLFPSLFNKNPQSFECEICQLSKQVRSHFPIQPYKESSPFSMIHSDIWGPSRIKNV  309

Query  63   YGHQYFLTLVDDFSRLTWVFL  1
             G ++F++ +DD +RLTWVFL
Sbjct  310  TGTRWFVSFIDDHTRLTWVFL  330



>gb|EMT17614.1| DNA-directed RNA polymerase I subunit RPA2 [Aegilops tauschii]
Length=1856

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 50/81 (62%), Gaps = 4/81 (5%)
 Frame = -3

Query  243   KMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTI  64
             +  +L  +  DV ++    C+ C L KQ +LP+P S S S   F+LVH+D+WGP    + 
Sbjct  1300  RQGILGSVSGDVSLH----CNGCRLGKQTQLPYPTSESVSQRPFDLVHSDVWGPAPFDSK  1355

Query  63    YGHQYFLTLVDDFSRLTWVFL  1
              GH+Y++  +DDFSR T +++
Sbjct  1356  GGHRYYILFIDDFSRYTLLYI  1376



>ref|XP_010688568.1| PREDICTED: uncharacterized protein LOC104902479 [Beta vulgaris 
subsp. vulgaris]
Length=1111

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = -3

Query  237  KLLQLLDS--DVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTI  64
            K+++LL    + K + +  C++C  SK  R  FP S S ++  FE +H D+WGPY   + 
Sbjct  512  KIVKLLPPLCNHKGSLDPNCEICFRSKHSRTKFPTSDSKASRIFEKIHCDLWGPYRHMSS  571

Query  63   YGHQYFLTLVDDFSRLTWVFL  1
             G +YFLT+VDD+SR  W +L
Sbjct  572  SGARYFLTIVDDYSRAVWTYL  592



>gb|ABG00000.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=2074

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = -3

Query  204   VNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDF  25
             VN+   C+ C  +K  +LP+P S S S N  ELV +D+WGP    ++ G +Y+++ +DDF
Sbjct  1443  VNESGVCNACQQAKSHQLPYPKSFSVSNNPLELVFSDVWGPAPT-SVGGRKYYVSFIDDF  1501

Query  24    SRLTWVFL  1
             S+ TW++L
Sbjct  1502  SKFTWIYL  1509



>emb|CAN68682.1| hypothetical protein VITISV_024814 [Vitis vinifera]
Length=1248

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            C+VC L+K KR+ FP S+  S   F L+H+DIWGP  +  I G ++F++ +DD +R+TW+
Sbjct  450  CEVCELAKHKRVSFPISNKRSFIPFYLIHSDIWGPSPIPNITGAKWFVSFIDDCTRVTWI  509

Query  6    FL  1
            FL
Sbjct  510  FL  511



>ref|XP_009761987.1| PREDICTED: uncharacterized protein LOC104214079 [Nicotiana sylvestris]
Length=408

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = -3

Query  249  FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
             S MK ++ L S V +  E+ C VC L+KQ RL F  + S +   F  VH D+WGPY V 
Sbjct  76   LSTMKNIKELHSYVSIIAENNCFVCPLAKQTRLKFSLNDSRADGLFHRVHMDLWGPYKVP  135

Query  69   TIYGHQYFLTLVDDFSRLTW  10
            T     Y LT+VDD SR TW
Sbjct  136  TFNNMYYLLTIVDDHSRYTW  155



>emb|CAN67245.1| hypothetical protein VITISV_008680 [Vitis vinifera]
Length=1333

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = -3

Query  240  MKLLQLLDSDVKVNKES-ACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTI  64
            M L  L  S    N +S  C++C LSKQ R  FP      ++ F ++H+DIWGP  +  +
Sbjct  822  MYLKHLFPSLFNKNPKSFECEICQLSKQVRSHFPIQPYKESSPFSMIHSDIWGPSRIKNV  881

Query  63   YGHQYFLTLVDDFSRLTWVFL  1
             G ++F++ +DD +RLTWVFL
Sbjct  882  TGTRWFVSFIDDHTRLTWVFL  902



>emb|CAN63081.1| hypothetical protein VITISV_016842 [Vitis vinifera]
Length=1179

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (63%), Gaps = 1/64 (2%)
 Frame = -3

Query  189  ACDVCHLSKQKRLPFPDSSSTSANC-FELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLT  13
            AC+ C L K  R+ FP   +  A   FELVH D+WGP    +  G QYF+T +DD+SR T
Sbjct  398  ACESCQLGKHTRVSFPKRLNNRAKSPFELVHTDVWGPCRTASTLGFQYFVTFIDDYSRCT  457

Query  12   WVFL  1
            W+FL
Sbjct  458  WLFL  461



>emb|CAN80566.1| hypothetical protein VITISV_029672 [Vitis vinifera]
Length=1636

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            C++C LSKQ R  FP      ++ F ++H+DIWGP  +  + G ++F++ +DD +RLTWV
Sbjct  550  CEICQLSKQVRSHFPIQPYKESSPFSMIHSDIWGPSRIKNVTGTRWFVSFIDDHTRLTWV  609

Query  6    FL  1
            FL
Sbjct  610  FL  611



>gb|AAC33963.1| contains similarity to reverse transcriptases (Pfam; rvt.hmm, 
score: 11.19) [Arabidopsis thaliana]
Length=1633

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  SACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLT  13
            S C +  L+KQKRL +   ++ +++ F+L+H DIWGP+ + ++ G +YFLTLVDD +R T
Sbjct  530  SHCRISPLAKQKRLAYVSHNNLASSPFDLIHLDIWGPFSIESVDGFRYFLTLVDDCTRTT  589

Query  12   WVFL  1
            WV++
Sbjct  590  WVYM  593



>gb|EEC72737.1| hypothetical protein OsI_06355 [Oryza sativa Indica Group]
Length=468

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = -3

Query  195  ESACDVCHLSKQKRLPFPDSSSTSAN-CFELVHADIWGPYHVHTIYGHQYFLTLVDDFSR  19
            E  CDVC ++KQ+RLPFP  +S  A    ELVH D+ GP    T  G +YFL LVDD SR
Sbjct  12   EQLCDVCVVTKQRRLPFPQQTSFRAKERLELVHEDLCGPVTPATPGGRRYFLLLVDDLSR  71

Query  18   LTWVFL  1
              WV +
Sbjct  72   YMWVMV  77



>emb|CAN75564.1| hypothetical protein VITISV_032580 [Vitis vinifera]
Length=1191

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (63%), Gaps = 1/64 (2%)
 Frame = -3

Query  189   ACDVCHLSKQKRLPFPDSSSTSANC-FELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLT  13
             AC+ C L K  R+ FP   +  A   FELVH D+WGP    +  G QYF+T +DD+SR T
Sbjct  1108  ACESCRLGKHTRVSFPKRLNNRAKSHFELVHTDVWGPCRTASXLGFQYFVTFIDDYSRCT  1167

Query  12    WVFL  1
             W+FL
Sbjct  1168  WLFL  1171



>ref|XP_010674610.1| PREDICTED: uncharacterized protein LOC104890733 [Beta vulgaris 
subsp. vulgaris]
Length=585

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -3

Query  189  ACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTW  10
            AC++C  +K  R  FP S + ++  FE +H D+WGPY   +  G +YFLT+VDDFSR  W
Sbjct  463  ACEICFRAKHSRDKFPLSDNKASRIFEKIHCDLWGPYRHVSSCGARYFLTIVDDFSRAVW  522

Query  9    VFL  1
            V+L
Sbjct  523  VYL  525



>gb|ABA92122.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=685

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 36/77 (47%), Positives = 43/77 (56%), Gaps = 11/77 (14%)
 Frame = -3

Query  198  KESACDVCHLSKQKRLPFPDSSSTSAN-----------CFELVHADIWGPYHVHTIYGHQ  52
            KE  CDVC ++KQ+RLPFP  +S  AN             ELVH D+ GP    T  G +
Sbjct  547  KEMLCDVCVVTKQRRLPFPQQTSFRANERLELVHGDNERLELVHGDLCGPVTPATPGGRR  606

Query  51   YFLTLVDDFSRLTWVFL  1
            YFL LVDD SR  WV +
Sbjct  607  YFLLLVDDLSRYMWVMV  623



>gb|EEE52905.1| hypothetical protein OsJ_35506 [Oryza sativa Japonica Group]
Length=832

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = -3

Query  195  ESACDVCHLSKQKRLPFPDSSSTSAN-CFELVHADIWGPYHVHTIYGHQYFLTLVDDFSR  19
            E  CDVC ++KQ+RLPFP  +S  A    ELVH D+ GP    T  G +YFL LVDD SR
Sbjct  12   EQLCDVCVVTKQRRLPFPQQTSFRAKERLELVHGDLCGPVTPATPGGRRYFLLLVDDLSR  71

Query  18   LTWVFL  1
              WV +
Sbjct  72   YMWVMV  77



>emb|CAN83378.1| hypothetical protein VITISV_011333 [Vitis vinifera]
Length=758

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = -3

Query  198  KESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSR  19
            K   CD+C  ++Q R  F  S +    CF+L+H D+WG Y V T  G  YFLT+VDD SR
Sbjct  281  KNKFCDICFRAQQTREVFFSSDNKVKECFDLIHCDLWGAYRVPTSCGGIYFLTIVDDCSR  340

Query  18   LTWVFL  1
            + W++L
Sbjct  341  VVWIYL  346



>ref|NP_001067439.2| Os11g0199800 [Oryza sativa Japonica Group]
 dbj|BAF27802.2| Os11g0199800 [Oryza sativa Japonica Group]
Length=872

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = -3

Query  195  ESACDVCHLSKQKRLPFPDSSSTSAN-CFELVHADIWGPYHVHTIYGHQYFLTLVDDFSR  19
            E  CDVC L+KQ+RLPFP  +S  A    EL+H D+ GP    T  G +YFL LVDD SR
Sbjct  621  EQLCDVCVLTKQRRLPFPQQTSFRAKERLELMHGDLCGPVTPATPGGRRYFLLLVDDLSR  680

Query  18   LTWVFL  1
              WV +
Sbjct  681  YMWVMV  686



>gb|AAK92587.1|AC074354_21 Putative retroelement [Oryza sativa Japonica Group]
 gb|AAM01102.1|AC098682_6 Putative retroelement [Oryza sativa Japonica Group]
 gb|AAP52946.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=934

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = -3

Query  195  ESACDVCHLSKQKRLPFPDSSSTSAN-CFELVHADIWGPYHVHTIYGHQYFLTLVDDFSR  19
            E  CDVC ++KQ+RLPFP  +S  A    ELVH D+ GP    T  G +YFL LVDD SR
Sbjct  47   EQLCDVCVVTKQRRLPFPQQTSFRAKERLELVHGDLCGPVTPATPGGRRYFLLLVDDLSR  106

Query  18   LTWVFL  1
              WV +
Sbjct  107  YMWVMV  112



>gb|ABW74573.1| putative pol polyprotein [Boechera divaricarpa]
Length=937

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = -3

Query  201  NKESA-CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDF  25
            NK+SA C + HL+KQ +L +   ++     FEL+H D+WGP+ V TI G +YFL +VDD 
Sbjct  504  NKKSAYCHIYHLAKQIKLFYVSPNNMCKIIFELLHIDVWGPFSVDTIEGFKYFLIIVDDC  563

Query  24   SRLTWVFL  1
            SR TWV+L
Sbjct  564  SRATWVYL  571



>ref|XP_007030765.1| Uncharacterized protein TCM_026511 [Theobroma cacao]
 gb|EOY11267.1| Uncharacterized protein TCM_026511 [Theobroma cacao]
Length=1318

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = -3

Query  219  DSDVKVNKESACDVCHLSKQKRLPFPDSSST-SANCFELVHADIWGPYHVHTIYGHQYFL  43
            D  +    E  C+VC   KQ R PFP  S T +AN  +L+H DI GP    ++ G++YF+
Sbjct  482  DMPIITEVEKTCEVCLQGKQSRHPFPKQSQTRTANRLQLIHTDICGPIGTLSLNGNKYFI  541

Query  42   TLVDDFSRLTWVFL  1
              +DDFSR  W+F 
Sbjct  542  LFIDDFSRFCWIFF  555



>emb|CAD39834.1| OSJNBa0079F16.1 [Oryza sativa Japonica Group]
 emb|CAE05105.1| OSJNBa0009K15.25 [Oryza sativa Japonica Group]
Length=1592

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = -3

Query  195  ESACDVCHLSKQKRLPFPDSSSTSAN-CFELVHADIWGPYHVHTIYGHQYFLTLVDDFSR  19
            E  CDVC ++KQ+RLPFP  +S  A    ELVH D+ GP    T  G +YFL LVDD SR
Sbjct  752  EQLCDVCVVTKQRRLPFPQQTSFRAKEQLELVHGDLCGPVTPATPGGRRYFLLLVDDLSR  811

Query  18   LTWVFL  1
              WV +
Sbjct  812  YMWVMV  817



>gb|AAL79695.1|AC087599_14 putative gag-pol polyprotein [Oryza sativa Japonica Group]
 gb|AAP55058.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1168

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = -3

Query  195  ESACDVCHLSKQKRLPFPDSSSTSAN-CFELVHADIWGPYHVHTIYGHQYFLTLVDDFSR  19
            E  CDVC ++KQ+RLPFP  +S  A    ELVH D+ GP    T  G +YFL LVDD SR
Sbjct  338  EQLCDVCVVTKQRRLPFPQQTSFRAKERLELVHGDLCGPVTPATPGGRRYFLLLVDDLSR  397

Query  18   LTWVFL  1
              WV +
Sbjct  398  YMWVMV  403



>emb|CAN62623.1| hypothetical protein VITISV_001656 [Vitis vinifera]
Length=1394

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -3

Query  198  KESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSR  19
            K   C++C LSKQ R  FP      ++ F ++H+DIWGP  +  + G ++F++ +DD  R
Sbjct  537  KSFECEICQLSKQVRSHFPIQPYKESSPFSMIHSDIWGPSRIKNVTGTRWFVSFIDDHXR  596

Query  18   LTWVFL  1
            LTWVFL
Sbjct  597  LTWVFL  602



>gb|ABA99153.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1515

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = -3

Query  195  ESACDVCHLSKQKRLPFPDSSSTSAN-CFELVHADIWGPYHVHTIYGHQYFLTLVDDFSR  19
            E  CDVC ++KQ+RLPFP  +S  A    ELVH D+ GP    T  G +YFL LVDD SR
Sbjct  635  EQLCDVCVVTKQRRLPFPQQTSFRAKERLELVHGDLCGPVTPATPGGRRYFLLLVDDLSR  694

Query  18   LTWVFL  1
              WV +
Sbjct  695  YMWVMV  700



>gb|AAX96737.1| retrotransposon protein, putative, Ty1-copia sub-class [Oryza 
sativa Japonica Group]
Length=1523

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = -3

Query  195  ESACDVCHLSKQKRLPFPDSSSTSAN-CFELVHADIWGPYHVHTIYGHQYFLTLVDDFSR  19
            E  CDVC L+KQ+RLPFP  +S  A    EL+H D+ GP    T  G +YFL LVDD SR
Sbjct  673  EQLCDVCVLTKQRRLPFPQQTSFRAKERLELMHGDLCGPVTPATPGGRRYFLLLVDDLSR  732

Query  18   LTWVFL  1
              WV +
Sbjct  733  YMWVMV  738



>ref|XP_008672007.1| PREDICTED: uncharacterized protein LOC100191195 isoform X3 [Zea 
mays]
Length=257

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            C  CHL KQ +LP+  S+S S   F+LVH+DIWGP    +  G++Y++  +DD SR TW+
Sbjct  153  CKGCHLGKQIQLPYFTSNSHSVEPFDLVHSDIWGPAPFVSKGGYKYYVIFIDDHSRYTWI  212

Query  6    FL  1
            + 
Sbjct  213  YF  214



>emb|CAN60593.1| hypothetical protein VITISV_023128 [Vitis vinifera]
Length=1285

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (63%), Gaps = 1/64 (2%)
 Frame = -3

Query  189  ACDVCHLSKQKRLPFPDSSSTSANC-FELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLT  13
            AC+ C L K  R+ FP   +  A   FELVH D+WGP    +  G QYF+T +DD+SR T
Sbjct  330  ACESCQLGKHTRVSFPKCLNNRAKSPFELVHIDVWGPCRTASTLGFQYFVTFIDDYSRCT  389

Query  12   WVFL  1
            W+FL
Sbjct  390  WLFL  393



>emb|CAN71773.1| hypothetical protein VITISV_002508 [Vitis vinifera]
Length=680

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 40/64 (63%), Gaps = 1/64 (2%)
 Frame = -3

Query  189  ACDVCHLSKQKRLPFPDSSSTSANC-FELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLT  13
            +C+ C L K  R+ FP   +  A   FELVH D+WGP    +  G QYF+T +DD+SR T
Sbjct  493  SCESCQLGKHTRVSFPKRLNNRAKSPFELVHTDVWGPCRTASTLGFQYFVTFIDDYSRCT  552

Query  12   WVFL  1
            W+FL
Sbjct  553  WLFL  556



>emb|CAN69647.1| hypothetical protein VITISV_022133 [Vitis vinifera]
Length=2655

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 49/82 (60%), Gaps = 5/82 (6%)
 Frame = -3

Query  249   FSKMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVH  70
             FS +  L L DS +     S      L KQ  LPF +S S S + FEL+H+D+WGP  V 
Sbjct  1789  FSSLPSLALWDSRLGHAPSS-----RLGKQPALPFNNSESISNSIFELIHSDVWGPSPVA  1843

Query  69    TIYGHQYFLTLVDDFSRLTWVF  4
             +I G +YF+  +DD+SR +W+F
Sbjct  1844  SIGGSRYFVVFIDDYSRYSWIF  1865



>ref|XP_007014929.1| Uncharacterized protein TCM_040529 [Theobroma cacao]
 gb|EOY32548.1| Uncharacterized protein TCM_040529 [Theobroma cacao]
Length=1266

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 1/74 (1%)
 Frame = -3

Query  219  DSDVKVNKESACDVCHLSKQKRLPFPDSSSTSA-NCFELVHADIWGPYHVHTIYGHQYFL  43
            D  V    E  C+VC   KQ R PFP  S T A N  +L+H DI GP    ++ G++YF+
Sbjct  482  DMPVITEVEKTCEVCLQGKQSRHPFPKQSQTRATNRLQLIHTDICGPIGTLSLNGNKYFI  541

Query  42   TLVDDFSRLTWVFL  1
              +DDFSR  W+F 
Sbjct  542  LFIDDFSRFCWIFF  555



>emb|CAN68902.1| hypothetical protein VITISV_031323 [Vitis vinifera]
Length=1206

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = -3

Query  186   CDVCHLSKQKRLPFPDSSSTSANC-FELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTW  10
             C+ C L K  R+ FP   +  A   FELVH D+WGP    +  G QYF+T +DD+SR TW
Sbjct  1079  CESCQLGKHTRVSFPKRLNNRAKSPFELVHTDVWGPCRTASTLGFQYFVTFIDDYSRCTW  1138

Query  9     VFL  1
             +FL
Sbjct  1139  LFL  1141



>ref|XP_010242510.1| PREDICTED: uncharacterized protein LOC104586844 [Nelumbo nucifera]
Length=900

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = -3

Query  213  DVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLV  34
            ++  +K   CDVC  +KQ R  F  SS+   +CF L+H D+WG Y V    G  YF T+V
Sbjct  256  NISNSKNKMCDVCLKAKQTRDVFIQSSNKVTDCFALIHCDLWGAYRVPASCGAAYFFTIV  315

Query  33   DDFSRLTWVFL  1
            +D+SR+ W++L
Sbjct  316  EDYSRVVWIYL  326



>ref|XP_007027939.1| Uncharacterized protein TCM_022873 [Theobroma cacao]
 gb|EOY08441.1| Uncharacterized protein TCM_022873 [Theobroma cacao]
Length=615

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 3/50 (6%)
 Frame = -3

Query  150  PFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWVFL  1
            PFP +++ S   FELVH D+WGPY V TI G +YFLTLVDD SR TW+FL
Sbjct  97   PFPKNTTFS---FELVHVDLWGPYIVPTIKGQRYFLTLVDDCSRFTWIFL  143



>emb|CAN67447.1| hypothetical protein VITISV_031398 [Vitis vinifera]
Length=795

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 39/64 (61%), Gaps = 1/64 (2%)
 Frame = -3

Query  189  ACDVCHLSKQKRLPFPDSSSTSANC-FELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLT  13
            AC+ C L K  R+ FP   +  A   FELVH D+WGP    +  G QYF+T +DD+SR T
Sbjct  438  ACESCQLGKHTRVSFPKRLNNRAKSPFELVHTDVWGPCRTASTLGFQYFVTFIDDYSRCT  497

Query  12   WVFL  1
            W FL
Sbjct  498  WFFL  501



>emb|CAN63530.1| hypothetical protein VITISV_038849 [Vitis vinifera]
Length=938

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (63%), Gaps = 1/64 (2%)
 Frame = -3

Query  189  ACDVCHLSKQKRLPFPDSSSTSANC-FELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLT  13
            AC+ C L K  R+ FP   +  A   FEL+H ++WGP    +  G QYF+T +DD+SR T
Sbjct  355  ACESCQLGKHTRVSFPKRLNNRAKSHFELIHTNVWGPSRTASTLGFQYFVTFIDDYSRCT  414

Query  12   WVFL  1
            W+FL
Sbjct  415  WLFL  418



>gb|AAT47108.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1204

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 3/80 (4%)
 Frame = -3

Query  243  KMKLLQLLDSDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTI  64
            +  LL  +   V +N+   C  C L KQ +LP+  S S S   F+LVH+D+WGP    + 
Sbjct  514  RRGLLGSVSGAVSLNQ---CQGCKLGKQIQLPYHSSESVSKRPFDLVHSDVWGPAPFVSK  570

Query  63   YGHQYFLTLVDDFSRLTWVF  4
             GH+Y++  +DDFSR TW++
Sbjct  571  GGHRYYIIFIDDFSRHTWIY  590



>emb|CAN72168.1| hypothetical protein VITISV_004170 [Vitis vinifera]
Length=1415

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 43/71 (61%), Gaps = 3/71 (4%)
 Frame = -3

Query  204  VNKESA---CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLV  34
            +NK  A   C++C  +K  R  +P         F LVH+D+WGP  +  I+G ++F+T V
Sbjct  491  INKNPASYHCEICQFAKHTRTVYPQIPYKPLTVFSLVHSDVWGPSRIKNIFGTRWFVTFV  550

Query  33   DDFSRLTWVFL  1
            DD +R+TWVFL
Sbjct  551  DDHTRVTWVFL  561



>emb|CAN68461.1| hypothetical protein VITISV_037728 [Vitis vinifera]
Length=472

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (61%), Gaps = 1/64 (2%)
 Frame = -3

Query  189  ACDVCHLSKQKRLPFPDSSSTSANC-FELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLT  13
            AC+ C   K  R+ FP   +  A   FEL+H D+WGP    +  G QYF+T +DD+SR T
Sbjct  398  ACESCQFGKHTRVSFPKYLNNRAKSPFELIHTDVWGPCQTASTLGFQYFVTFIDDYSRYT  457

Query  12   WVFL  1
            W+FL
Sbjct  458  WLFL  461



>gb|ABA96719.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1795

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 34/66 (52%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = -3

Query  195  ESACDVCHLSKQKRLPFPDSSSTSANC-FELVHADIWGPYHVHTIYGHQYFLTLVDDFSR  19
            E  CDVC ++KQ+RLPFP  +S  A    ELVH D+ GP    T  G +YFL LVDD SR
Sbjct  868  EQLCDVCVVTKQRRLPFPQQTSFRAKKRLELVHEDLCGPVTPATPGGRRYFLLLVDDLSR  927

Query  18   LTWVFL  1
              WV +
Sbjct  928  YMWVMV  933



>ref|XP_009610755.1| PREDICTED: uncharacterized protein LOC104104389 [Nicotiana tomentosiformis]
Length=552

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            C VC ++KQ RL F  S++ S    + VH D+WGP  + T  G ++FLTLVDDFSR TW+
Sbjct  184  CSVCPVAKQTRLSFSTSTNRSEAFGDFVHTDVWGPLKIPTFDGKRHFLTLVDDFSRYTWI  243

Query  6    FL  1
             L
Sbjct  244  CL  245



>emb|CAN80469.1| hypothetical protein VITISV_008623 [Vitis vinifera]
Length=1041

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANC-FELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTW  10
            C+ C L K  R+ FP   +  A   FELVH D+WGP    +  G QYF+T +DD+SR TW
Sbjct  340  CESCQLGKHTRVSFPKRLNNRAKSPFELVHTDVWGPCRTASTLGFQYFVTFIDDYSRCTW  399

Query  9    VFL  1
            +FL
Sbjct  400  LFL  402



>ref|XP_010684008.1| PREDICTED: uncharacterized protein LOC104898610 [Beta vulgaris 
subsp. vulgaris]
Length=983

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = -3

Query  237  KLLQLLDSDVKVNK--ESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTI  64
            K+++LL   + +       C+VC  +K  R  FP S+  ++  FE VH D+WGPY   + 
Sbjct  470  KIVKLLPPALHLQGSLNKGCEVCFRAKHPRTKFPLSAHKASRIFEKVHCDLWGPYKHVSS  529

Query  63   YGHQYFLTLVDDFSRLTWVFL  1
             G +YFLTLVDD+SR  WV+L
Sbjct  530  CGARYFLTLVDDYSRAVWVYL  550



>ref|XP_009781907.1| PREDICTED: uncharacterized protein LOC104230728 [Nicotiana sylvestris]
Length=765

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -3

Query  210  VKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVD  31
            V   ++  C +C L++Q R  FP SS+T+   F L+H D+WGPY+  T  G++YFLTLVD
Sbjct  427  VPSTQQFPCHICPLARQTRNSFPSSSTTTTCLFALIHVDVWGPYNTVTHSGNRYFLTLVD  486

Query  30   DFSRLTWVFL  1
            D+S  TW +L
Sbjct  487  DYSGSTWTYL  496



>emb|CAN64580.1| hypothetical protein VITISV_002159 [Vitis vinifera]
Length=1453

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            C+VC L+K K + FP S+  S+  F L+H+DIWGP  +  I G ++F++ +DD +R+TW+
Sbjct  616  CEVCELAKHKXVSFPVSNKRSSIPFYLIHSDIWGPSPIPNITGAKWFVSFIDDCTRVTWI  675

Query  6    FL  1
            FL
Sbjct  676  FL  677



>emb|CAN83937.1| hypothetical protein VITISV_042335 [Vitis vinifera]
Length=641

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 43/71 (61%), Gaps = 3/71 (4%)
 Frame = -3

Query  204  VNKESA---CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLV  34
            +NK  A   C++C  +K  R  +P      +  F LVH+D+WGP  +  I G ++F+T V
Sbjct  487  INKNPASYHCEICQFAKHTRTVYPQIPYKPSTVFSLVHSDVWGPSRIKNISGTRWFVTFV  546

Query  33   DDFSRLTWVFL  1
            DD +R+TWVFL
Sbjct  547  DDHTRVTWVFL  557



>ref|XP_011085911.1| PREDICTED: uncharacterized protein LOC105167794 [Sesamum indicum]
Length=378

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
            CD+C  +KQ R+ F  S S S   FELV  D+WGPY   +I G+ Y LT++DDFS+  W 
Sbjct  300  CDICPKAKQSRISFKPSLSQSLVPFELVQLDLWGPYRTPSISGYSYVLTILDDFSKSLWE  359

Query  6    FL  1
            FL
Sbjct  360  FL  361



>emb|CAN70029.1| hypothetical protein VITISV_010388 [Vitis vinifera]
Length=1222

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 40/64 (63%), Gaps = 1/64 (2%)
 Frame = -3

Query  189  ACDVCHLSKQKRLPFPDSSSTSANC-FELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLT  13
            +C+ C L K  R+ FP   +  A   FELVH D+WGP    +  G QYF+T +DD+SR T
Sbjct  410  SCESCQLGKHTRVSFPKRLNNRAKSPFELVHTDVWGPCRTASTLGFQYFVTFIDDYSRCT  469

Query  12   WVFL  1
            W+FL
Sbjct  470  WLFL  473



>ref|XP_009590306.1| PREDICTED: uncharacterized protein LOC104087513 [Nicotiana tomentosiformis]
Length=198

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = -3

Query  237  KLLQLLD--SDVKVNKESACDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTI  64
            ++LQ ++   D+K +    C +C L+KQ RL FP S+S +   FELVH D+WGPY+VH +
Sbjct  131  RILQQMNFFKDIKTDTGRTCSICPLAKQTRLSFPQSTSGTTTLFELVHGDVWGPYNVHMV  190



>emb|CAN74984.1| hypothetical protein VITISV_035210 [Vitis vinifera]
Length=2408

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = -3

Query  186   CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTWV  7
             C  C L KQ  LPF +  S S + FEL+H+D+WGP  V +I   +YF+  +DD+SR +W+
Sbjct  1632  CTSCXLXKQPALPFNNXESISNSIFELIHSDVWGPSPVASIGXSRYFVVFIDDYSRYSWI  1691

Query  6     F  4
             F
Sbjct  1692  F  1692



>emb|CAN72886.1| hypothetical protein VITISV_019713 [Vitis vinifera]
Length=1504

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 43/71 (61%), Gaps = 3/71 (4%)
 Frame = -3

Query  204  VNKESA---CDVCHLSKQKRLPFPDSSSTSANCFELVHADIWGPYHVHTIYGHQYFLTLV  34
            +NK  A   C++C  +K  R  +P      +  F LVH+D+WGP  +  I G ++F+T V
Sbjct  716  INKNPASYHCEICQFAKHTRTVYPQIPYKPSTVFSLVHSDVWGPSRIKNISGTRWFVTFV  775

Query  33   DDFSRLTWVFL  1
            DD +R+TWVFL
Sbjct  776  DDHTRVTWVFL  786



>emb|CAN67119.1| hypothetical protein VITISV_017483 [Vitis vinifera]
Length=1970

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANC-FELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTW  10
            C+ C L K  R+ FP   +  A   FELVH D+WGP    +  G QYF+T +DD+SR TW
Sbjct  449  CESCQLGKHTRVSFPKRLNNRAKSPFELVHTDVWGPCRTASTLGFQYFVTFIDDYSRCTW  508

Query  9    VFL  1
            +FL
Sbjct  509  LFL  511



>emb|CAN60609.1| hypothetical protein VITISV_036599 [Vitis vinifera]
Length=1455

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = -3

Query  186  CDVCHLSKQKRLPFPDSSSTSANC-FELVHADIWGPYHVHTIYGHQYFLTLVDDFSRLTW  10
            C+ C L K  R+ FP   +  A   FELVH D+WGP    +  G QYF+T +DD+SR TW
Sbjct  612  CESCQLGKHTRVSFPKRLNNRAKSPFELVHTDVWGPCRTASTLGFQYFVTFIDDYSRCTW  671

Query  9    VFL  1
            +FL
Sbjct  672  LFL  674



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 510865472736