BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79647_g1_i1 len=2082 path=[1:0-2081]

Length=2082
                                                                      Score     E

ref|XP_011089492.1|  PREDICTED: laccase-17                              961   0.0     
ref|XP_002284473.1|  PREDICTED: laccase-17                              931   0.0     Vitis vinifera
ref|XP_009796024.1|  PREDICTED: laccase-2-like                          929   0.0     
emb|CBI16199.3|  unnamed protein product                                927   0.0     
ref|XP_006488364.1|  PREDICTED: laccase-17-like                         924   0.0     
ref|XP_002298223.2|  hypothetical protein POPTR_0001s18500g             924   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_002313424.1|  hypothetical protein POPTR_0009s03940g             920   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010275879.1|  PREDICTED: laccase-17-like                         920   0.0     
ref|XP_007140298.1|  hypothetical protein PHAVU_008G100400g             919   0.0     
ref|XP_011043780.1|  PREDICTED: laccase-2-like                          918   0.0     
ref|XP_006379352.1|  hypothetical protein POPTR_0009s15840g             916   0.0     
ref|XP_003632204.1|  PREDICTED: laccase-17                              916   0.0     
ref|XP_011032272.1|  PREDICTED: laccase-2-like                          916   0.0     
ref|XP_010256874.1|  PREDICTED: laccase-17-like                         914   0.0     
ref|XP_006370271.1|  hypothetical protein POPTR_0001s41170g             913   0.0     
ref|XP_006379354.1|  hypothetical protein POPTR_0009s15860g             913   0.0     
ref|XP_008356891.1|  PREDICTED: laccase-2                               912   0.0     
ref|XP_010106521.1|  hypothetical protein L484_025281                   912   0.0     
ref|XP_004241217.1|  PREDICTED: laccase-2-like                          912   0.0     
ref|XP_007016364.1|  Laccase 2                                          912   0.0     
ref|XP_006429125.1|  hypothetical protein CICLE_v10011362mg             911   0.0     
ref|XP_006350913.1|  PREDICTED: laccase-2-like                          910   0.0     
ref|XP_006424872.1|  hypothetical protein CICLE_v10028036mg             910   0.0     
ref|XP_002299296.1|  laccase family protein                             909   0.0     Populus trichocarpa [western balsam poplar]
emb|CBI31651.3|  unnamed protein product                                908   0.0     
emb|CAN60348.1|  hypothetical protein VITISV_005802                     908   0.0     Vitis vinifera
ref|XP_006602579.1|  PREDICTED: laccase-17-like isoform X2              908   0.0     
ref|XP_011077639.1|  PREDICTED: laccase-17-like                         907   0.0     
ref|XP_009774063.1|  PREDICTED: laccase-17-like                         907   0.0     
ref|XP_003552160.2|  PREDICTED: laccase-17-like isoform X1              907   0.0     
ref|XP_002278215.1|  PREDICTED: laccase-17                              907   0.0     Vitis vinifera
ref|XP_011002147.1|  PREDICTED: laccase-17-like                         906   0.0     
emb|CDP09087.1|  unnamed protein product                                906   0.0     
ref|XP_008463808.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-17-like    906   0.0     
ref|XP_010043648.1|  PREDICTED: laccase-17-like                         906   0.0     
ref|XP_008384938.1|  PREDICTED: laccase-2-like                          904   0.0     
ref|XP_004492318.1|  PREDICTED: laccase-17-like                         904   0.0     
ref|XP_004148786.1|  PREDICTED: laccase-17-like                         904   0.0     
ref|XP_009796361.1|  PREDICTED: laccase-17-like                         903   0.0     
ref|XP_009621093.1|  PREDICTED: laccase-17-like                         903   0.0     
ref|XP_010092993.1|  hypothetical protein L484_007174                   903   0.0     
ref|XP_007208016.1|  hypothetical protein PRUPE_ppa003296mg             903   0.0     
gb|KDO52342.1|  hypothetical protein CISIN_1g008085mg                   903   0.0     
ref|XP_002531824.1|  laccase, putative                                  902   0.0     Ricinus communis
ref|XP_009403441.1|  PREDICTED: laccase-4-like                          902   0.0     
ref|XP_002300066.1|  hypothetical protein POPTR_0001s35740g             902   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_006424671.1|  hypothetical protein CICLE_v10030166mg             901   0.0     
ref|XP_009603099.1|  PREDICTED: laccase-2-like                          901   0.0     
ref|XP_009358279.1|  PREDICTED: laccase-17-like                         900   0.0     
ref|XP_003532315.1|  PREDICTED: laccase-17-like                         900   0.0     
ref|XP_009587566.1|  PREDICTED: laccase-17-like                         900   0.0     
ref|XP_007022468.1|  Laccase 17                                         900   0.0     
gb|KDO73109.1|  hypothetical protein CISIN_1g047497mg                   899   0.0     
ref|XP_003623041.1|  Laccase                                            899   0.0     
gb|KHN24986.1|  Laccase-17                                              899   0.0     
ref|XP_006592189.1|  PREDICTED: laccase-2-like isoform X1               899   0.0     
ref|XP_006592190.1|  PREDICTED: laccase-2-like isoform X2               899   0.0     
ref|XP_008358049.1|  PREDICTED: laccase-17-like                         898   0.0     
ref|XP_008223967.1|  PREDICTED: laccase-17                              898   0.0     
ref|XP_011094888.1|  PREDICTED: laccase-17-like                         898   0.0     
gb|KEH22816.1|  laccase/diphenol oxidase family protein                 898   0.0     
gb|KDO73032.1|  hypothetical protein CISIN_1g008109mg                   897   0.0     
ref|XP_002278232.1|  PREDICTED: laccase-17-like                         897   0.0     Vitis vinifera
ref|XP_011042451.1|  PREDICTED: laccase-17-like                         896   0.0     
ref|XP_002271047.2|  PREDICTED: laccase-17                              896   0.0     Vitis vinifera
ref|XP_008385215.1|  PREDICTED: laccase-17-like                         895   0.0     
ref|XP_006424707.1|  hypothetical protein CICLE_v10028090mg             895   0.0     
ref|XP_010920538.1|  PREDICTED: laccase-4-like                          895   0.0     
ref|XP_010690891.1|  PREDICTED: laccase-17-like                         895   0.0     
ref|XP_009354528.1|  PREDICTED: laccase-17-like                         895   0.0     
ref|XP_008222248.1|  PREDICTED: laccase-2                               895   0.0     
gb|KHN16224.1|  Laccase-17                                              894   0.0     
ref|XP_007016584.1|  Laccase 17                                         894   0.0     
emb|CBI30527.3|  unnamed protein product                                894   0.0     
ref|XP_010264408.1|  PREDICTED: laccase-17-like                         893   0.0     
ref|XP_002317505.2|  hypothetical protein POPTR_0011s12100g             893   0.0     Populus trichocarpa [western balsam poplar]
emb|CAN60069.1|  hypothetical protein VITISV_012401                     893   0.0     Vitis vinifera
ref|XP_004492322.1|  PREDICTED: laccase-17-like                         893   0.0     
gb|KHN16229.1|  Laccase-17                                              892   0.0     
ref|XP_006370270.1|  hypothetical protein POPTR_0001s41160g             892   0.0     
ref|XP_010264410.1|  PREDICTED: laccase-17-like                         891   0.0     
ref|XP_007132049.1|  hypothetical protein PHAVU_011G062600g             891   0.0     
ref|XP_010922297.1|  PREDICTED: laccase-17-like                         890   0.0     
emb|CBI31631.3|  unnamed protein product                                889   0.0     
gb|KDP44151.1|  hypothetical protein JCGZ_05618                         889   0.0     
ref|XP_010920540.1|  PREDICTED: laccase-10-like                         888   0.0     
ref|XP_010690924.1|  PREDICTED: laccase-17-like                         888   0.0     
ref|XP_007016607.1|  Laccase 17                                         888   0.0     
ref|XP_011094887.1|  PREDICTED: laccase-17-like                         888   0.0     
ref|XP_002282823.1|  PREDICTED: laccase-17                              888   0.0     Vitis vinifera
ref|XP_008385213.1|  PREDICTED: laccase-17-like                         887   0.0     
ref|XP_011029469.1|  PREDICTED: laccase-17-like                         887   0.0     
ref|XP_009375916.1|  PREDICTED: laccase-2-like                          887   0.0     
ref|XP_002317504.2|  hypothetical protein POPTR_0011s12090g             887   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_006590981.1|  PREDICTED: laccase-2-like isoform X2               886   0.0     
gb|KHN16226.1|  Laccase-17                                              885   0.0     
ref|XP_009354529.1|  PREDICTED: laccase-17-like                         885   0.0     
ref|XP_010037821.1|  PREDICTED: laccase-17-like                         885   0.0     
ref|XP_003539077.1|  PREDICTED: laccase-2-like isoform X1               885   0.0     
ref|XP_003622953.1|  Laccase                                            885   0.0     
ref|XP_009630096.1|  PREDICTED: laccase-17-like                         884   0.0     
ref|XP_006602563.1|  PREDICTED: laccase-17-like                         884   0.0     
ref|XP_010046415.1|  PREDICTED: laccase-17-like                         884   0.0     
ref|XP_008222577.1|  PREDICTED: laccase-17-like                         884   0.0     
ref|XP_010031544.1|  PREDICTED: laccase-17-like                         883   0.0     
ref|XP_009760365.1|  PREDICTED: laccase-17-like                         883   0.0     
ref|XP_002282815.1|  PREDICTED: laccase-17                              883   0.0     Vitis vinifera
gb|AES79165.2|  laccase/diphenol oxidase family protein                 881   0.0     
gb|AAB17194.1|  laccase                                                 881   0.0     Liriodendron tulipifera
ref|XP_010039666.1|  PREDICTED: laccase-17-like                         880   0.0     
ref|XP_008785574.1|  PREDICTED: laccase-17-like                         880   0.0     
ref|XP_010541373.1|  PREDICTED: laccase-17                              879   0.0     
emb|CDP06592.1|  unnamed protein product                                879   0.0     
ref|XP_008358843.1|  PREDICTED: laccase-17-like                         879   0.0     
ref|XP_010535559.1|  PREDICTED: laccase-17                              879   0.0     
gb|AAB17192.1|  laccase                                                 879   0.0     Liriodendron tulipifera
gb|EYU26609.1|  hypothetical protein MIMGU_mgv1a003496mg                879   0.0     
ref|XP_007207546.1|  hypothetical protein PRUPE_ppa017421mg             879   0.0     
ref|XP_010654256.1|  PREDICTED: laccase-17-like isoform X2              878   0.0     
ref|XP_008778964.1|  PREDICTED: laccase-17-like                         878   0.0     
ref|XP_008778578.1|  PREDICTED: laccase-10-like                         878   0.0     
ref|XP_004294637.1|  PREDICTED: laccase-17-like                         878   0.0     
ref|XP_003530894.1|  PREDICTED: laccase-17-like                         878   0.0     
gb|KHN24984.1|  Laccase-17                                              876   0.0     
ref|XP_004246869.2|  PREDICTED: laccase-17-like                         875   0.0     
ref|XP_002520231.1|  laccase, putative                                  875   0.0     Ricinus communis
ref|XP_002268628.2|  PREDICTED: laccase-17-like isoform X1              875   0.0     Vitis vinifera
ref|XP_009364426.1|  PREDICTED: laccase-2-like                          875   0.0     
ref|XP_009354571.1|  PREDICTED: laccase-17-like                         875   0.0     
ref|XP_006429124.1|  hypothetical protein CICLE_v10011358mg             874   0.0     
ref|XP_006341212.1|  PREDICTED: laccase-17-like                         874   0.0     
gb|EYU26602.1|  hypothetical protein MIMGU_mgv1a003840mg                874   0.0     
ref|XP_011019838.1|  PREDICTED: laccase-17-like                         873   0.0     
ref|XP_009597231.1|  PREDICTED: laccase-17-like                         873   0.0     
gb|KDP35659.1|  hypothetical protein JCGZ_09097                         873   0.0     
ref|XP_002309069.1|  hypothetical protein POPTR_0006s08780g             873   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_004246425.1|  PREDICTED: laccase-17-like                         873   0.0     
ref|XP_006480874.1|  PREDICTED: laccase-17-like isoform X1              873   0.0     
ref|XP_002531565.1|  laccase, putative                                  872   0.0     Ricinus communis
ref|XP_006341009.1|  PREDICTED: laccase-17-like                         872   0.0     
ref|XP_011095204.1|  PREDICTED: laccase-17-like                         872   0.0     
ref|XP_010443793.1|  PREDICTED: laccase-17                              872   0.0     
ref|XP_010557244.1|  PREDICTED: laccase-2-like                          871   0.0     
emb|CDP01507.1|  unnamed protein product                                871   0.0     
ref|XP_007208011.1|  hypothetical protein PRUPE_ppa003319mg             870   0.0     
ref|XP_009120521.1|  PREDICTED: laccase-17-like                         870   0.0     
ref|XP_007026983.1|  Laccase 17 isoform 1                               869   0.0     
ref|XP_010455850.1|  PREDICTED: laccase-17-like                         869   0.0     
ref|XP_006429120.1|  hypothetical protein CICLE_v10011363mg             868   0.0     
emb|CDY31581.1|  BnaA10g12900D                                          868   0.0     
gb|KDO51175.1|  hypothetical protein CISIN_1g008090mg                   868   0.0     
gb|KHN16225.1|  Laccase-17                                              868   0.0     
ref|XP_010483648.1|  PREDICTED: laccase-17-like                         868   0.0     
ref|XP_009416147.1|  PREDICTED: laccase-4-like                          868   0.0     
ref|NP_200810.1|  laccase 17                                            868   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_006480879.1|  PREDICTED: laccase-17-like                         868   0.0     
ref|XP_006280235.1|  hypothetical protein CARUB_v10026150mg             868   0.0     
ref|XP_003606701.1|  Laccase                                            867   0.0     
ref|XP_008240736.1|  PREDICTED: laccase-17-like                         867   0.0     
ref|XP_007140515.1|  hypothetical protein PHAVU_008G119200g             867   0.0     
ref|XP_008359106.1|  PREDICTED: laccase-17-like                         866   0.0     
ref|XP_006341211.1|  PREDICTED: laccase-17-like                         866   0.0     
ref|XP_006856866.1|  hypothetical protein AMTR_s00055p00190270          866   0.0     
ref|XP_002269038.2|  PREDICTED: laccase-17 isoform X2                   866   0.0     Vitis vinifera
emb|CDX88735.1|  BnaA03g09140D                                          865   0.0     
ref|XP_008359730.1|  PREDICTED: laccase-17-like                         865   0.0     
gb|AAB17193.1|  laccase                                                 865   0.0     Liriodendron tulipifera
ref|XP_008785569.1|  PREDICTED: laccase-17-like                         864   0.0     
ref|XP_009782930.1|  PREDICTED: laccase-4-like                          864   0.0     
ref|XP_010541371.1|  PREDICTED: laccase-17-like                         863   0.0     
ref|XP_006363101.1|  PREDICTED: laccase-17-like                         863   0.0     
ref|XP_002864664.1|  hypothetical protein ARALYDRAFT_496140             863   0.0     
ref|XP_002308164.1|  hypothetical protein POPTR_0006s08740g             863   0.0     Populus trichocarpa [western balsam poplar]
gb|ABW81073.1|  unknown                                                 863   0.0     Tarenaya spinosa
ref|XP_004246355.1|  PREDICTED: laccase-4-like                          862   0.0     
ref|XP_003622947.1|  Laccase                                            862   0.0     
ref|XP_006400889.1|  hypothetical protein EUTSA_v10013109mg             862   0.0     
ref|XP_010685719.1|  PREDICTED: laccase-17-like                         862   0.0     
ref|XP_010654257.1|  PREDICTED: laccase-17 isoform X1                   861   0.0     
ref|XP_002531562.1|  laccase, putative                                  861   0.0     Ricinus communis
ref|XP_009419259.1|  PREDICTED: laccase-4-like                          861   0.0     
ref|XP_009345405.1|  PREDICTED: laccase-17-like                         861   0.0     
emb|CDY09232.1|  BnaA02g06580D                                          860   0.0     
ref|XP_004507172.1|  PREDICTED: laccase-2-like                          860   0.0     
ref|XP_011019845.1|  PREDICTED: laccase-2-like                          860   0.0     
ref|XP_010039668.1|  PREDICTED: laccase-17-like                         860   0.0     
ref|XP_009131958.1|  PREDICTED: laccase-17                              859   0.0     
ref|XP_006363100.1|  PREDICTED: laccase-4-like                          858   0.0     
ref|XP_008369916.1|  PREDICTED: laccase-17-like                         858   0.0     
ref|XP_002278275.1|  PREDICTED: laccase-17                              858   0.0     Vitis vinifera
ref|XP_007150345.1|  hypothetical protein PHAVU_005G145800g             857   0.0     
ref|XP_007026973.1|  Laccase 17                                         857   0.0     
ref|XP_004514389.1|  PREDICTED: laccase-17-like                         856   0.0     
emb|CAA74105.1|  laccase                                                856   0.0     Populus trichocarpa [western balsam poplar]
emb|CDX71061.1|  BnaC03g11450D                                          855   0.0     
ref|XP_010654259.1|  PREDICTED: laccase-2-like                          855   0.0     
ref|XP_006846061.1|  hypothetical protein AMTR_s00012p00061860          855   0.0     
gb|KFK27539.1|  hypothetical protein AALP_AA8G396300                    855   0.0     
ref|XP_008387791.1|  PREDICTED: laccase-17-like                         855   0.0     
ref|XP_010414434.1|  PREDICTED: laccase-2 isoform X1                    854   0.0     
emb|CAN72263.1|  hypothetical protein VITISV_037366                     854   0.0     Vitis vinifera
ref|XP_010256880.1|  PREDICTED: laccase-4-like                          853   0.0     
ref|XP_008803092.1|  PREDICTED: laccase-17-like                         853   0.0     
emb|CDP06596.1|  unnamed protein product                                853   0.0     
ref|XP_007026975.1|  Laccase 17                                         853   0.0     
ref|XP_010414436.1|  PREDICTED: laccase-2 isoform X3                    853   0.0     
ref|XP_010245131.1|  PREDICTED: laccase-17-like                         852   0.0     
ref|XP_009338594.1|  PREDICTED: laccase-17-like                         852   0.0     
ref|XP_009388612.1|  PREDICTED: laccase-4-like                          852   0.0     
ref|XP_009414328.1|  PREDICTED: laccase-17-like                         852   0.0     
gb|AAB17191.1|  laccase                                                 852   0.0     Liriodendron tulipifera
ref|XP_009338597.1|  PREDICTED: laccase-17-like                         851   0.0     
gb|KEH22909.1|  laccase/diphenol oxidase family protein                 851   0.0     
ref|XP_008442532.1|  PREDICTED: laccase-17-like                         850   0.0     
emb|CBI30529.3|  unnamed protein product                                850   0.0     
ref|XP_004137936.1|  PREDICTED: laccase-17-like                         850   0.0     
gb|KDP42231.1|  hypothetical protein JCGZ_02961                         850   0.0     
ref|XP_004294638.1|  PREDICTED: laccase-17-like                         850   0.0     
gb|KHF97742.1|  Laccase-17 -like protein                                849   0.0     
ref|XP_010043504.1|  PREDICTED: laccase-17                              849   0.0     
ref|XP_010047833.1|  PREDICTED: laccase-17-like                         848   0.0     
emb|CAN80346.1|  hypothetical protein VITISV_003134                     848   0.0     Vitis vinifera
gb|EEC71780.1|  hypothetical protein OsI_04394                          848   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_006846265.1|  hypothetical protein AMTR_s00012p00245710          848   0.0     
ref|XP_004246356.1|  PREDICTED: laccase-17-like                         848   0.0     
ref|XP_009126628.1|  PREDICTED: laccase-17-like                         848   0.0     
ref|XP_002520232.1|  laccase, putative                                  848   0.0     Ricinus communis
ref|XP_002520541.1|  laccase, putative                                  848   0.0     Ricinus communis
ref|XP_004137934.1|  PREDICTED: laccase-17-like                         847   0.0     
ref|XP_010683867.1|  PREDICTED: laccase-17-like                         847   0.0     
ref|XP_008240716.1|  PREDICTED: laccase-17-like                         847   0.0     
ref|XP_006445791.1|  hypothetical protein CICLE_v10018047mg             847   0.0     
ref|XP_006409959.1|  hypothetical protein EUTSA_v10016434mg             846   0.0     
emb|CAN73336.1|  hypothetical protein VITISV_033042                     846   0.0     Vitis vinifera
ref|XP_007026974.1|  Laccase 17                                         845   0.0     
emb|CDY65666.1|  BnaC04g54790D                                          845   0.0     
ref|XP_007208294.1|  hypothetical protein PRUPE_ppa003308mg             845   0.0     
ref|NP_001044773.1|  Os01g0842500                                       844   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_003551482.1|  PREDICTED: laccase-17-like                         844   0.0     
ref|XP_008785568.1|  PREDICTED: laccase-17-like                         843   0.0     
ref|XP_010906603.1|  PREDICTED: laccase-17-like                         844   0.0     
gb|KHN14002.1|  Laccase-17                                              843   0.0     
ref|XP_003552179.1|  PREDICTED: laccase-17-like                         844   0.0     
ref|XP_010683865.1|  PREDICTED: laccase-17-like                         844   0.0     
ref|XP_002458747.1|  hypothetical protein SORBIDRAFT_03g039530          843   0.0     Sorghum bicolor [broomcorn]
ref|XP_003530212.1|  PREDICTED: laccase-17-like                         843   0.0     
ref|XP_006293883.1|  hypothetical protein CARUB_v10022868mg             843   0.0     
ref|XP_004302731.1|  PREDICTED: laccase-17-like                         843   0.0     
ref|XP_004166507.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-17-like    842   0.0     
gb|ABW81166.1|  unknown                                                 842   0.0     Capsella rubella
gb|KDP35658.1|  hypothetical protein JCGZ_09096                         842   0.0     
ref|XP_006644994.1|  PREDICTED: laccase-12/13-like                      842   0.0     
ref|XP_011094885.1|  PREDICTED: laccase-17-like                         842   0.0     
ref|XP_009144396.1|  PREDICTED: laccase-2                               842   0.0     
ref|XP_008442529.1|  PREDICTED: laccase-17-like                         840   0.0     
gb|KHN14004.1|  Laccase-17                                              840   0.0     
ref|XP_010107320.1|  hypothetical protein L484_009454                   841   0.0     
ref|XP_009788568.1|  PREDICTED: laccase-4-like                          840   0.0     
ref|XP_002881031.1|  hypothetical protein ARALYDRAFT_901874             839   0.0     
ref|XP_010107305.1|  hypothetical protein L484_009439                   839   0.0     
ref|XP_004961859.1|  PREDICTED: laccase-12/13-like                      839   0.0     
ref|XP_004514392.1|  PREDICTED: laccase-17-like                         838   0.0     
ref|XP_010922291.1|  PREDICTED: laccase-17-like                         838   0.0     
ref|XP_006583598.1|  PREDICTED: laccase-17-like                         838   0.0     
ref|NP_180477.1|  laccase 2                                             837   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_009416152.1|  PREDICTED: laccase-4-like                          836   0.0     
ref|XP_010521875.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-2-like     837   0.0     
ref|XP_007140513.1|  hypothetical protein PHAVU_008G119000g             836   0.0     
ref|XP_004970542.1|  PREDICTED: laccase-4-like                          835   0.0     
gb|ABW74558.1|  putative laccase                                        833   0.0     Boechera divaricarpa
ref|XP_009602033.1|  PREDICTED: laccase-4-like                          833   0.0     
ref|NP_001147942.1|  L-ascorbate oxidase precursor                      833   0.0     Zea mays [maize]
ref|XP_003532290.1|  PREDICTED: laccase-17-like isoform X1              833   0.0     
gb|ACN34362.1|  unknown                                                 832   0.0     Zea mays [maize]
ref|XP_006856865.1|  hypothetical protein AMTR_s00055p00189700          832   0.0     
ref|XP_003564592.1|  PREDICTED: laccase-4-like                          830   0.0     
ref|XP_002458746.1|  hypothetical protein SORBIDRAFT_03g039520          830   0.0     Sorghum bicolor [broomcorn]
ref|XP_008801588.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-4          828   0.0     
dbj|BAJ99773.1|  predicted protein                                      830   0.0     
gb|AFW84624.1|  putative laccase family protein                         830   0.0     
ref|NP_001044772.1|  Os01g0842400                                       828   0.0     
ref|NP_001105875.1|  putative laccase precursor                         829   0.0     
gb|EAZ14115.1|  hypothetical protein OsJ_04039                          828   0.0     
gb|KHN40291.1|  Laccase-17                                              827   0.0     
ref|NP_001146658.1|  uncharacterized protein LOC100280258 precursor     827   0.0     
ref|XP_010685718.1|  PREDICTED: laccase-17-like                         828   0.0     
emb|CDM84967.1|  unnamed protein product                                826   0.0     
ref|XP_010922290.1|  PREDICTED: laccase-17-like                         825   0.0     
gb|EEC71777.1|  hypothetical protein OsI_04389                          825   0.0     
gb|KDO52343.1|  hypothetical protein CISIN_1g008085mg                   823   0.0     
gb|EMT20803.1|  Laccase-4                                               825   0.0     
ref|NP_001055747.1|  Os05g0458600                                       824   0.0     
gb|EYU41740.1|  hypothetical protein MIMGU_mgv1a026682mg                822   0.0     
ref|XP_008665185.1|  PREDICTED: laccase-4-like                          823   0.0     
ref|XP_006649837.1|  PREDICTED: laccase-10-like                         821   0.0     
ref|XP_007207312.1|  hypothetical protein PRUPE_ppa003714mg             820   0.0     
ref|XP_006644993.1|  PREDICTED: laccase-4-like                          821   0.0     
emb|CDM80721.1|  unnamed protein product                                820   0.0     
ref|XP_006480875.1|  PREDICTED: laccase-17-like isoform X2              818   0.0     
ref|XP_004302730.1|  PREDICTED: laccase-17-like                         819   0.0     
gb|EYU41745.1|  hypothetical protein MIMGU_mgv1a003538mg                818   0.0     
emb|CBI30528.3|  unnamed protein product                                861   0.0     
ref|XP_003564593.1|  PREDICTED: laccase-12/13-like                      817   0.0     
gb|KEH22917.1|  laccase/diphenol oxidase family protein                 817   0.0     
ref|XP_004970543.1|  PREDICTED: laccase-12/13-like                      816   0.0     
ref|XP_008387787.1|  PREDICTED: laccase-17-like                         816   0.0     
ref|XP_002439916.1|  hypothetical protein SORBIDRAFT_09g022510          816   0.0     
ref|XP_006846275.1|  hypothetical protein AMTR_s00012p00248430          815   0.0     
ref|XP_009407501.1|  PREDICTED: laccase-4-like                          815   0.0     
ref|XP_003562893.1|  PREDICTED: laccase-4-like                          815   0.0     
gb|AAC04576.1|  putative high-pI laccase                                813   0.0     
dbj|BAJ84890.1|  predicted protein                                      814   0.0     
ref|XP_003568310.1|  PREDICTED: laccase-12/13-like                      814   0.0     
gb|KCW85519.1|  hypothetical protein EUGRSUZ_B02316                     811   0.0     
dbj|BAJ91763.1|  predicted protein                                      811   0.0     
dbj|BAJ96691.1|  predicted protein                                      811   0.0     
ref|XP_006654510.1|  PREDICTED: laccase-12/13-like                      810   0.0     
gb|KEH30177.1|  laccase/diphenol oxidase family protein                 808   0.0     
gb|AAK37825.1|AF132121_1  laccase                                       807   0.0     
gb|KHN07178.1|  Laccase-17                                              805   0.0     
ref|XP_004984718.1|  PREDICTED: laccase-10-like                         803   0.0     
ref|NP_001049699.1|  Os03g0273200                                       802   0.0     
ref|XP_006603494.1|  PREDICTED: laccase-17-like                         799   0.0     
gb|KHN24985.1|  Laccase-17                                              800   0.0     
ref|XP_002863053.1|  hypothetical protein ARALYDRAFT_497195             801   0.0     
gb|EMS51326.1|  Laccase-4                                               801   0.0     
gb|EMS48628.1|  Laccase-12/13                                           800   0.0     
ref|XP_003564594.1|  PREDICTED: putative laccase-5                      800   0.0     
gb|EMT21652.1|  Laccase-4                                               799   0.0     
ref|XP_009597234.1|  PREDICTED: laccase-4-like                          797   0.0     
gb|AAL73968.1|AF465468_1  laccase LAC5-6                                798   0.0     
emb|CDP06593.1|  unnamed protein product                                796   0.0     
gb|EPS68485.1|  hypothetical protein M569_06281                         792   0.0     
ref|XP_006846062.1|  hypothetical protein AMTR_s00012p00061910          794   0.0     
ref|NP_001131665.1|  uncharacterized protein LOC100193025 precursor     792   0.0     
gb|AAK37827.1|AF132123_1  laccase                                       790   0.0     
ref|XP_002456622.1|  hypothetical protein SORBIDRAFT_03g039570          788   0.0     
ref|XP_004970548.1|  PREDICTED: putative laccase-5-like                 787   0.0     
ref|XP_002531561.1|  laccase, putative                                  786   0.0     
ref|XP_002465485.1|  hypothetical protein SORBIDRAFT_01g039690          786   0.0     
ref|XP_008777229.1|  PREDICTED: laccase-17-like                         783   0.0     
emb|CAN66149.1|  hypothetical protein VITISV_025911                     783   0.0     
emb|CDM84963.1|  unnamed protein product                                782   0.0     
ref|XP_003558240.1|  PREDICTED: laccase-10-like                         780   0.0     
gb|AAK37828.1|AF132124_1  laccase                                       778   0.0     
gb|KCW88963.1|  hypothetical protein EUGRSUZ_A01282                     775   0.0     
ref|XP_007140299.1|  hypothetical protein PHAVU_008G100500g             773   0.0     
gb|ACG47007.1|  L-ascorbate oxidase precursor                           773   0.0     
ref|NP_001055746.1|  Os05g0458500                                       767   0.0     
gb|AAK37823.1|  laccase                                                 768   0.0     
ref|XP_006409960.1|  hypothetical protein EUTSA_v10016434mg             767   0.0     
dbj|BAN10307.1|  laccase                                                763   0.0     
gb|EMS51767.1|  Laccase-4                                               761   0.0     
sp|Q0DHL5.2|LAC11_ORYSJ  RecName: Full=Putative laccase-11; AltNa...    757   0.0     
gb|KDO37152.1|  hypothetical protein CISIN_1g040938mg                   753   0.0     
ref|XP_006586249.1|  PREDICTED: laccase-17-like isoform X2              756   0.0     
ref|XP_004961862.1|  PREDICTED: putative laccase-11-like                753   0.0     
emb|CAN66454.1|  hypothetical protein VITISV_020528                     750   0.0     
gb|AAU44018.1|  putative laccase                                        746   0.0     
ref|XP_007026985.1|  Laccase 17 isoform 3                               743   0.0     
ref|XP_002441216.1|  hypothetical protein SORBIDRAFT_09g022460          743   0.0     
ref|XP_003566184.1|  PREDICTED: putative laccase-11                     743   0.0     
gb|EYU41744.1|  hypothetical protein MIMGU_mgv1a025875mg                740   0.0     
ref|NP_001105921.1|  putative laccase precursor                         739   0.0     
gb|EMT05481.1|  Putative laccase-11                                     739   0.0     
gb|AFW78258.1|  putative laccase family protein                         735   0.0     
ref|NP_001105874.1|  putative laccase precursor                         734   0.0     
gb|KHG14663.1|  Laccase-4                                               726   0.0     
ref|XP_006654509.1|  PREDICTED: LOW QUALITY PROTEIN: putative lac...    727   0.0     
gb|EMT04658.1|  Laccase-12/13                                           728   0.0     
gb|AAK37830.1|AF132126_1  laccase                                       722   0.0     
ref|NP_001172647.1|  Os01g0844050                                       719   0.0     
ref|XP_010099199.1|  hypothetical protein L484_002030                   707   0.0     
gb|ACN39933.1|  unknown                                                 708   0.0     
emb|CDP06511.1|  unnamed protein product                                706   0.0     
gb|KHG18161.1|  Laccase-4 -like protein                                 705   0.0     
ref|XP_009787551.1|  PREDICTED: laccase-4-like                          702   0.0     
ref|XP_007026781.1|  Laccase/Diphenol oxidase family protein isof...    701   0.0     
gb|EMT14964.1|  Putative laccase-5                                      704   0.0     
ref|XP_006663136.1|  PREDICTED: laccase-22-like                         701   0.0     
ref|XP_002322961.2|  hypothetical protein POPTR_0016s11950g             700   0.0     
ref|XP_006429309.1|  hypothetical protein CICLE_v10011400mg             699   0.0     
ref|XP_010262771.1|  PREDICTED: laccase-4-like                          699   0.0     
ref|XP_010092971.1|  hypothetical protein L484_018908                   694   0.0     
ref|XP_006644997.1|  PREDICTED: LOW QUALITY PROTEIN: putative lac...    696   0.0     
gb|AAK37829.1|AF132125_1  laccase                                       697   0.0     
dbj|BAN10308.1|  laccase                                                697   0.0     
ref|XP_011077581.1|  PREDICTED: laccase-4-like                          697   0.0     
gb|AAC49536.1|  diphenol oxidase                                        696   0.0     
ref|XP_004137913.1|  PREDICTED: laccase-4-like                          696   0.0     
ref|XP_009799024.1|  PREDICTED: laccase-4-like                          696   0.0     
ref|XP_011003662.1|  PREDICTED: laccase-4-like                          696   0.0     
sp|Q0IQU1.2|LAC22_ORYSJ  RecName: Full=Laccase-22; AltName: Full=...    696   0.0     
ref|XP_009624727.1|  PREDICTED: laccase-4-like                          695   0.0     
ref|XP_011035278.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-2          694   0.0     
ref|XP_002322962.2|  laccase family protein                             695   0.0     
ref|XP_004163861.1|  PREDICTED: laccase-4-like                          694   0.0     
ref|XP_010685615.1|  PREDICTED: laccase-4                               693   0.0     
ref|XP_010256659.1|  PREDICTED: laccase-4                               692   0.0     
ref|XP_009407561.1|  PREDICTED: laccase-22-like                         692   0.0     
ref|XP_010044087.1|  PREDICTED: laccase-4-like                          691   0.0     
ref|XP_008442464.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-4-like     691   0.0     
ref|XP_002308208.2|  laccase family protein                             691   0.0     
ref|XP_010044089.1|  PREDICTED: laccase-4-like                          689   0.0     
ref|NP_001055744.1|  Os05g0458300                                       686   0.0     
ref|XP_009590412.1|  PREDICTED: laccase-4-like                          687   0.0     
ref|XP_011019151.1|  PREDICTED: laccase-4 isoform X2                    687   0.0     
ref|XP_002308209.2|  laccase family protein                             687   0.0     
ref|XP_006387495.1|  hypothetical protein POPTR_0958s00200g             687   0.0     
ref|XP_010037723.1|  PREDICTED: laccase-4-like                          687   0.0     
ref|XP_009593041.1|  PREDICTED: laccase-4-like                          687   0.0     
ref|XP_004246339.1|  PREDICTED: laccase-4                               687   0.0     
ref|XP_010044090.1|  PREDICTED: laccase-4-like                          686   0.0     
ref|XP_009593274.1|  PREDICTED: laccase-4-like                          686   0.0     
ref|XP_010041000.1|  PREDICTED: laccase-4-like                          686   0.0     
ref|XP_010067496.1|  PREDICTED: laccase-4-like                          686   0.0     
ref|XP_009786393.1|  PREDICTED: laccase-4-like                          685   0.0     
ref|XP_004147923.1|  PREDICTED: laccase-4-like                          685   0.0     
emb|CDP14064.1|  unnamed protein product                                685   0.0     
ref|XP_004249583.1|  PREDICTED: laccase-4-like                          685   0.0     
ref|XP_009384856.1|  PREDICTED: laccase-22-like                         684   0.0     
ref|XP_006338994.1|  PREDICTED: laccase-4-like                          684   0.0     
ref|XP_010676357.1|  PREDICTED: laccase-4-like                          684   0.0     
ref|XP_010044088.1|  PREDICTED: laccase-4-like                          684   0.0     
ref|XP_011019150.1|  PREDICTED: laccase-4 isoform X1                    683   0.0     
ref|XP_004980096.1|  PREDICTED: laccase-22-like                         683   0.0     
ref|XP_008449180.1|  PREDICTED: laccase-4-like                          682   0.0     
ref|XP_003558760.1|  PREDICTED: laccase-22                              682   0.0     
dbj|BAJ98144.1|  predicted protein                                      682   0.0     
ref|XP_010529771.1|  PREDICTED: laccase-4-like                          681   0.0     
ref|XP_010101806.1|  hypothetical protein L484_023595                   680   0.0     
ref|XP_006363052.1|  PREDICTED: laccase-4-like                          680   0.0     
ref|XP_010553253.1|  PREDICTED: laccase-4                               680   0.0     
ref|XP_011032154.1|  PREDICTED: laccase-4-like isoform X2               679   0.0     
gb|EMT26873.1|  Laccase-22                                              679   0.0     
ref|XP_011094977.1|  PREDICTED: laccase-4-like                          679   0.0     
ref|XP_007009094.1|  Laccase/Diphenol oxidase family protein            678   0.0     
ref|XP_002991629.1|  hypothetical protein SELMODRAFT_133734             677   0.0     
ref|XP_002520425.1|  laccase, putative                                  677   0.0     
ref|XP_003544873.2|  PREDICTED: laccase-4-like                          677   0.0     
ref|XP_002278638.1|  PREDICTED: laccase-4                               677   0.0     
ref|XP_011084946.1|  PREDICTED: laccase-4-like                          677   0.0     
ref|XP_002971503.1|  hypothetical protein SELMODRAFT_95740              676   0.0     
ref|XP_007016183.1|  Laccase/Diphenol oxidase family protein            676   0.0     
ref|XP_010024157.1|  PREDICTED: laccase-11                              676   0.0     
ref|XP_011035200.1|  PREDICTED: laccase-4                               676   0.0     
emb|CBI17500.3|  unnamed protein product                                675   0.0     
gb|KHG28836.1|  Laccase-22                                              676   0.0     
emb|CDY18406.1|  BnaA04g21810D                                          675   0.0     
ref|XP_008785423.1|  PREDICTED: laccase-22                              675   0.0     
ref|XP_002266464.1|  PREDICTED: laccase-11                              675   0.0     
ref|XP_006425016.1|  hypothetical protein CICLE_v10028117mg             675   0.0     
emb|CDX93330.1|  BnaC04g45660D                                          674   0.0     
ref|XP_010104682.1|  hypothetical protein L484_022065                   674   0.0     
ref|XP_006293932.1|  hypothetical protein CARUB_v10022927mg             673   0.0     
gb|KDO50695.1|  hypothetical protein CISIN_1g036540mg                   673   0.0     
ref|XP_003518300.1|  PREDICTED: laccase-4-like                          672   0.0     
ref|XP_009141718.1|  PREDICTED: laccase-4-like                          672   0.0     
ref|XP_010924287.1|  PREDICTED: laccase-11-like                         672   0.0     
ref|XP_008220423.1|  PREDICTED: laccase-4                               672   0.0     
gb|AES98533.2|  laccase/diphenol oxidase family protein                 672   0.0     
ref|XP_002533894.1|  laccase, putative                                  672   0.0     
ref|XP_008355354.1|  PREDICTED: laccase-4                               672   0.0     
ref|XP_004302643.1|  PREDICTED: laccase-4-like                          671   0.0     
ref|XP_008239590.1|  PREDICTED: laccase-4-like                          671   0.0     
gb|KHN06247.1|  Laccase-4                                               671   0.0     
ref|XP_010517091.1|  PREDICTED: laccase-4-like                          671   0.0     
ref|XP_002314124.1|  hypothetical protein POPTR_0009s04720g             671   0.0     
emb|CDX74915.1|  BnaA05g06610D                                          671   0.0     
gb|KCW85651.1|  hypothetical protein EUGRSUZ_B02438                     666   0.0     
ref|XP_002299828.2|  hypothetical protein POPTR_0001s25580g             670   0.0     
ref|XP_007146741.1|  hypothetical protein PHAVU_006G065800g             670   0.0     
gb|KEH34185.1|  laccase/diphenol oxidase family protein                 670   0.0     
ref|XP_004249084.1|  PREDICTED: laccase-4-like                          670   0.0     
emb|CDO97037.1|  unnamed protein product                                670   0.0     
ref|XP_010535416.1|  PREDICTED: laccase-16                              670   0.0     
ref|XP_007205010.1|  hypothetical protein PRUPE_ppa003646mg             669   0.0     
ref|XP_003551299.1|  PREDICTED: laccase-4-like                          669   0.0     
ref|XP_008236999.1|  PREDICTED: laccase-11-like                         669   0.0     
ref|XP_007140382.1|  hypothetical protein PHAVU_008G107100g             669   0.0     
ref|XP_004160985.1|  PREDICTED: laccase-11-like                         669   0.0     
ref|XP_004500229.1|  PREDICTED: laccase-4-like                          669   0.0     
ref|XP_006411009.1|  hypothetical protein EUTSA_v10016460mg             669   0.0     
ref|XP_007200216.1|  hypothetical protein PRUPE_ppa015544mg             669   0.0     
ref|XP_002879726.1|  IRX12/LAC4                                         669   0.0     
ref|XP_007198990.1|  hypothetical protein PRUPE_ppa003590mg             669   0.0     
gb|EYU41858.1|  hypothetical protein MIMGU_mgv1a003895mg                668   0.0     
ref|XP_007207096.1|  hypothetical protein PRUPE_ppa022440mg             668   0.0     
emb|CDX91428.1|  BnaC04g07220D                                          668   0.0     
ref|XP_002519529.1|  laccase, putative                                  668   0.0     
ref|XP_003632636.1|  PREDICTED: laccase-11                              668   0.0     
ref|XP_010505418.1|  PREDICTED: laccase-4                               668   0.0     
gb|KHN36103.1|  Laccase-11                                              667   0.0     
ref|XP_004146556.1|  PREDICTED: laccase-11-like                         667   0.0     
ref|XP_008452071.1|  PREDICTED: laccase-11-like                         667   0.0     
gb|KHG01609.1|  Laccase-11 -like protein                                667   0.0     
ref|XP_006349470.1|  PREDICTED: laccase-4-like                          666   0.0     
ref|XP_010104683.1|  hypothetical protein L484_022066                   666   0.0     
ref|NP_565881.1|  laccase-4                                             666   0.0     
gb|KFK36706.1|  hypothetical protein AALP_AA4G158700                    665   0.0     



>ref|XP_011089492.1| PREDICTED: laccase-17 [Sesamum indicum]
Length=578

 Score =   961 bits (2484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/573 (80%), Positives = 518/573 (90%), Gaps = 0/573 (0%)
 Frame = +2

Query  116   LLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPR  295
             L +A FL++  ++F F     A+    TRHYKFNI++ NVTRLC TKSI+TVNGKFPGPR
Sbjct  6     LPSAIFLVLFLAVFLFFGTGTAQQSGTTRHYKFNIQLHNVTRLCKTKSIITVNGKFPGPR  65

Query  296   IMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIV  475
             I+AREGDRV++KVVN+V NNVSIHWHGIRQ+++GWADGPAY+TQCPIQ+GQ+YVYNFTI+
Sbjct  66    IVAREGDRVVIKVVNNVSNNVSIHWHGIRQLQSGWADGPAYVTQCPIQSGQSYVYNFTII  125

Query  476   GQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQ  655
             GQRGTLFWHAHISWLRATL+GPI+ILP+KN SYPFPKPHKEVP+IFGEWWN DTEAV+SQ
Sbjct  126   GQRGTLFWHAHISWLRATLYGPIVILPKKNASYPFPKPHKEVPVIFGEWWNADTEAVISQ  185

Query  656   ALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIA  835
             ALQ GGGPN+SDAYTINGLPGPLYNCSANETFK+KVKPGKTYLLR+INAALNDELFF I+
Sbjct  186   ALQTGGGPNVSDAYTINGLPGPLYNCSANETFKLKVKPGKTYLLRLINAALNDELFFSIS  245

Query  836   NHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFD  1015
             NHT+TVVEADA Y+KPFETD+LVIAPGQT NVLL+TK NP  STF MAARPYFTGQGTFD
Sbjct  246   NHTLTVVEADAIYIKPFETDILVIAPGQTTNVLLRTKPNPTNSTFLMAARPYFTGQGTFD  305

Query  1016  NSTVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQ  1195
             N+TVAG+LEY++PS          + +P LPPIN TSFV+NF+ K RSL N++FPANVPQ
Sbjct  306   NTTVAGILEYKLPSQKALDAPINSLQIPTLPPINATSFVANFSSKFRSLANARFPANVPQ  365

Query  1196  TVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVY  1375
             TVDK FFFTVGLG++PCPKNQTCQGPNGTKFAAS+NN+SF  PTTA+LQAY+SR+SNGVY
Sbjct  366   TVDKKFFFTVGLGSSPCPKNQTCQGPNGTKFAASVNNISFTNPTTALLQAYFSRRSNGVY  425

Query  1376  ATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHG  1555
              TDFPS PL PFNYTGTPPNNT V N TK+VVLPFN+TVE+VLQDTSILGAESHPLHLHG
Sbjct  426   NTDFPSFPLMPFNYTGTPPNNTGVANGTKLVVLPFNSTVEVVLQDTSILGAESHPLHLHG  485

Query  1556  YNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFE  1735
             YNF+VVGQGFGNFDP+KDP N+NLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFE
Sbjct  486   YNFFVVGQGFGNFDPQKDPPNFNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFE  545

Query  1736  VHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             VHLSWGL+MAWIV +GKLPNQKL PPPSDLPKC
Sbjct  546   VHLSWGLKMAWIVLDGKLPNQKLPPPPSDLPKC  578



>ref|XP_002284473.1| PREDICTED: laccase-17 [Vitis vinifera]
Length=585

 Score =   931 bits (2407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/586 (75%), Positives = 509/586 (87%), Gaps = 4/586 (1%)
 Frame = +2

Query  86    MGFLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIV  265
             MG  F   PP +   F+    +L   P +A+A+   +TRHYKF+I++QNVTRLCHTKSI+
Sbjct  1     MGVSFLPSPPFVGV-FVFSCMALCLLPELALAQDSGITRHYKFDIKLQNVTRLCHTKSIL  59

Query  266   TVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTG  445
             TVNG+FPGPRI+AREGDR+L+KVVNHV NN+SIHWHGIRQ+R+GWADGPAY+TQCPIQTG
Sbjct  60    TVNGQFPGPRIVAREGDRLLIKVVNHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQTG  119

Query  446   QTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWW  625
             Q+YVYNFT+VGQRGTLFWHAHISWLR+TL+GP+IILP++N  YPF KPHKEVP+IFGEWW
Sbjct  120   QSYVYNFTVVGQRGTLFWHAHISWLRSTLYGPLIILPKRNVPYPFEKPHKEVPIIFGEWW  179

Query  626   NVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAA  805
             N DTEAV+SQALQ GGGPN+SDAYTINGLPGPLYNCSA +TFK++VK  KTYLLR+INAA
Sbjct  180   NADTEAVISQALQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLRVKASKTYLLRLINAA  239

Query  806   LNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAAR  985
             LNDELFF IANHT+TVV+ADA YVKPFETD L+IAPGQT NVLLKTK + P + F + AR
Sbjct  240   LNDELFFSIANHTLTVVDADAIYVKPFETDTLLIAPGQTTNVLLKTKPHFPNAAFLITAR  299

Query  986   PYFTGQGTFDNSTVAGVLEYEIPSLN-ISKNSTK--PIALPPLPPINGTSFVSNFTGKLR  1156
             PY TG GTFDNSTVAG+LEYE+PS +  S  S K  P+  P LPP+N TSF +NFT +LR
Sbjct  300   PYVTGLGTFDNSTVAGILEYELPSASPHSTVSIKKLPLFKPTLPPLNDTSFATNFTNRLR  359

Query  1157  SLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAI  1336
             SL + QFPANVPQ VD++FFFT+GLGT+PC +NQTCQGPNGTKFAAS+NNVSF + TTA+
Sbjct  360   SLASPQFPANVPQKVDRHFFFTIGLGTSPCDQNQTCQGPNGTKFAASVNNVSFASSTTAL  419

Query  1337  LQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTS  1516
             LQA++S +SNGVY  DFP  P+ PFNYTGTPPNNT V N TKVVVLPFN +VELV+QDTS
Sbjct  420   LQAHFSGQSNGVYNPDFPITPIIPFNYTGTPPNNTLVSNGTKVVVLPFNTSVELVMQDTS  479

Query  1517  ILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRA  1696
             ILGAESHPLHLHG+NF+VVGQGFGN+DP KDPAN+NLVDP+ERNT+GVPSGGW AIRF A
Sbjct  480   ILGAESHPLHLHGFNFFVVGQGFGNYDPNKDPANFNLVDPIERNTVGVPSGGWVAIRFLA  539

Query  1697  DNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             DNPGVWFMHCH E+H SWGL+MAW+V +GKLPNQKLLPPP+DLPKC
Sbjct  540   DNPGVWFMHCHLEIHTSWGLKMAWVVLDGKLPNQKLLPPPADLPKC  585



>ref|XP_009796024.1| PREDICTED: laccase-2-like [Nicotiana sylvestris]
Length=583

 Score =   929 bits (2401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/577 (77%), Positives = 503/577 (87%), Gaps = 10/577 (2%)
 Frame = +2

Query  116   LLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPR  295
             L   CF     S+F FP    A    VTRHYKF+IR++NVTRLC TK+IVTVNGKFPGPR
Sbjct  13    LTIFCF---TCSIFLFPEFVTA---GVTRHYKFDIRLKNVTRLCQTKTIVTVNGKFPGPR  66

Query  296   IMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIV  475
             ++AREGDRV+VKV+NHV NNVS HWHGIRQI++GWADGPAYITQCPIQTGQ+YVYNFTI 
Sbjct  67    VVAREGDRVVVKVINHVSNNVSFHWHGIRQIQSGWADGPAYITQCPIQTGQSYVYNFTIT  126

Query  476   GQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQ  655
             GQRGTL+WHAHISW+RATL+GP+II P+ NTSYPF KPHKEVP+IFGEWWN +TEAV++Q
Sbjct  127   GQRGTLWWHAHISWMRATLYGPLIIYPKHNTSYPFAKPHKEVPIIFGEWWNANTEAVINQ  186

Query  656   ALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIA  835
             +L  G GPN+SD+YTINGLPGPLYNCSA +TFK+KVKPGKTY+LR+INAALND+LFF IA
Sbjct  187   SLVTGAGPNVSDSYTINGLPGPLYNCSAKDTFKLKVKPGKTYMLRIINAALNDDLFFSIA  246

Query  836   NHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFD  1015
             NH++TVVEADA YVKPFETD+++IAPGQT NVLLKT  NP  +TF MAARPYFTGQGTFD
Sbjct  247   NHSMTVVEADAVYVKPFETDIILIAPGQTTNVLLKTHPNPQQTTFLMAARPYFTGQGTFD  306

Query  1016  NSTVAGVLEYE---IPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPAN  1186
             NST+AG+L Y+       + S  S K + +P LPPIN TSFV+NF+ K RSL N+QFPAN
Sbjct  307   NSTIAGILMYDNLSASISSSSNTSIKNLPIPTLPPINSTSFVANFSNKFRSLANTQFPAN  366

Query  1187  VPQTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKS  1363
             VPQ VDK FFFTVGLG+NPCPKNQTCQGP N +KF+AS+NNVS + PTTA+LQ+Y+ +KS
Sbjct  367   VPQKVDKQFFFTVGLGSNPCPKNQTCQGPNNSSKFSASVNNVSMILPTTALLQSYFFKKS  426

Query  1364  NGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPL  1543
             NGVY ++FPSVPL PFNYTGTPPNNT V N TKVVVLPFN +VELV+QDTSILGAESHPL
Sbjct  427   NGVYTSNFPSVPLVPFNYTGTPPNNTHVSNGTKVVVLPFNTSVELVMQDTSILGAESHPL  486

Query  1544  HLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMH  1723
             HLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGW AI F ADNPGVWFMH
Sbjct  487   HLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWVAIHFLADNPGVWFMH  546

Query  1724  CHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             CHFEVHLSWGLRMAW+V +G+LPNQKL PPP+DLPKC
Sbjct  547   CHFEVHLSWGLRMAWLVLDGELPNQKLPPPPADLPKC  583



>emb|CBI16199.3| unnamed protein product [Vitis vinifera]
Length=566

 Score =   927 bits (2395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/565 (76%), Positives = 501/565 (89%), Gaps = 3/565 (1%)
 Frame = +2

Query  149   SLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLV  328
             +L   P +A+A+   +TRHYKF+I++QNVTRLCHTKSI+TVNG+FPGPRI+AREGDR+L+
Sbjct  2     ALCLLPELALAQDSGITRHYKFDIKLQNVTRLCHTKSILTVNGQFPGPRIVAREGDRLLI  61

Query  329   KVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAH  508
             KVVNHV NN+SIHWHGIRQ+R+GWADGPAY+TQCPIQTGQ+YVYNFT+VGQRGTLFWHAH
Sbjct  62    KVVNHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNFTVVGQRGTLFWHAH  121

Query  509   ISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNIS  688
             ISWLR+TL+GP+IILP++N  YPF KPHKEVP+IFGEWWN DTEAV+SQALQ GGGPN+S
Sbjct  122   ISWLRSTLYGPLIILPKRNVPYPFEKPHKEVPIIFGEWWNADTEAVISQALQTGGGPNVS  181

Query  689   DAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADA  868
             DAYTINGLPGPLYNCSA +TFK++VK  KTYLLR+INAALNDELFF IANHT+TVV+ADA
Sbjct  182   DAYTINGLPGPLYNCSAKDTFKLRVKASKTYLLRLINAALNDELFFSIANHTLTVVDADA  241

Query  869   GYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYE  1048
              YVKPFETD L+IAPGQT NVLLKTK + P + F + ARPY TG GTFDNSTVAG+LEYE
Sbjct  242   IYVKPFETDTLLIAPGQTTNVLLKTKPHFPNAAFLITARPYVTGLGTFDNSTVAGILEYE  301

Query  1049  IPSLN-ISKNSTK--PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFF  1219
             +PS +  S  S K  P+  P LPP+N TSF +NFT +LRSL + QFPANVPQ VD++FFF
Sbjct  302   LPSASPHSTVSIKKLPLFKPTLPPLNDTSFATNFTNRLRSLASPQFPANVPQKVDRHFFF  361

Query  1220  TVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVP  1399
             T+GLGT+PC +NQTCQGPNGTKFAAS+NNVSF + TTA+LQA++S +SNGVY  DFP  P
Sbjct  362   TIGLGTSPCDQNQTCQGPNGTKFAASVNNVSFASSTTALLQAHFSGQSNGVYNPDFPITP  421

Query  1400  LTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQ  1579
             + PFNYTGTPPNNT V N TKVVVLPFN +VELV+QDTSILGAESHPLHLHG+NF+VVGQ
Sbjct  422   IIPFNYTGTPPNNTLVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQ  481

Query  1580  GFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLR  1759
             GFGN+DP KDPAN+NLVDP+ERNT+GVPSGGW AIRF ADNPGVWFMHCH E+H SWGL+
Sbjct  482   GFGNYDPNKDPANFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEIHTSWGLK  541

Query  1760  MAWIVKEGKLPNQKLLPPPSDLPKC  1834
             MAW+V +GKLPNQKLLPPP+DLPKC
Sbjct  542   MAWVVLDGKLPNQKLLPPPADLPKC  566



>ref|XP_006488364.1| PREDICTED: laccase-17-like [Citrus sinensis]
Length=583

 Score =   924 bits (2387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/575 (75%), Positives = 497/575 (86%), Gaps = 5/575 (1%)
 Frame = +2

Query  119   LAACFLMIMTSLFFFPHMAVA--KHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGP  292
             +   FL++ + ++ FP +AVA  KH  VTRHYKFNIR++NVTRLCHTKS+VTVNGKFPGP
Sbjct  11    ILVAFLIVTSCIWVFPQVAVATSKHTGVTRHYKFNIRLKNVTRLCHTKSMVTVNGKFPGP  70

Query  293   RIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTI  472
             R++AREGDR++VKVVNH PNN+SIHWHGIRQ+++GWADGPAYITQCPIQTGQ+YVYNFT+
Sbjct  71    RVVAREGDRIIVKVVNHAPNNISIHWHGIRQLQSGWADGPAYITQCPIQTGQSYVYNFTV  130

Query  473   VGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVS  652
             VGQRGTL WHAH  WLRAT++GP+IILPR N SYPF KP+KEV ++ GEW+N D EA+++
Sbjct  131   VGQRGTLLWHAHFQWLRATVYGPLIILPRHNASYPFAKPYKEVTIMLGEWFNADPEAIIN  190

Query  653   QALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRI  832
             Q+LQ G GPN+S+AYT NGLPGP YNCSA +T+K+KVKPGK Y+LR+IN ALNDELFF I
Sbjct  191   QSLQTGNGPNVSEAYTFNGLPGPTYNCSAKDTYKLKVKPGKAYMLRLINTALNDELFFSI  250

Query  833   ANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTF  1012
             ANHT+TVVEADA YVKPFET++LVIAPGQT NVLLKT  NPP ++FFM ARPYFTG GTF
Sbjct  251   ANHTLTVVEADATYVKPFETNILVIAPGQTTNVLLKTNPNPPNASFFMLARPYFTGMGTF  310

Query  1013  DNSTVAGVLEYEIPSLNIS-KNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANV  1189
             DNSTVA +LEYE PS + S +N T  +  P LP IN T+FV+NF+ K RSL N+QFPANV
Sbjct  311   DNSTVAAILEYETPSQDNSFRNRT--LFKPSLPAINDTNFVANFSSKFRSLANAQFPANV  368

Query  1190  PQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNG  1369
             PQTVDK FFFTV LG NPCPKNQTCQGPNGTKFAA++NNVSF  P+TA+LQ+Y+  KS G
Sbjct  369   PQTVDKRFFFTVSLGANPCPKNQTCQGPNGTKFAAAVNNVSFALPSTALLQSYFFAKSKG  428

Query  1370  VYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHL  1549
             VY  DFP  PL PFNYTGTPPNNT V N TK +V+PFN +VELVLQDTSILGAESHPLHL
Sbjct  429   VYTADFPQFPLHPFNYTGTPPNNTFVSNGTKALVIPFNTSVELVLQDTSILGAESHPLHL  488

Query  1550  HGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCH  1729
             HGYN YVVGQGFGNFDPK DPA +NL+DPVERNT+GVPSGGW AIRF ADNPGVWFMHCH
Sbjct  489   HGYNVYVVGQGFGNFDPKNDPAKFNLIDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCH  548

Query  1730  FEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             F+VHLSWGLRMAWIV +G+LPNQKL PPPSDLPKC
Sbjct  549   FDVHLSWGLRMAWIVLDGELPNQKLPPPPSDLPKC  583



>ref|XP_002298223.2| hypothetical protein POPTR_0001s18500g [Populus trichocarpa]
 gb|EEE83028.2| hypothetical protein POPTR_0001s18500g [Populus trichocarpa]
Length=576

 Score =   924 bits (2387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/583 (74%), Positives = 498/583 (85%), Gaps = 7/583 (1%)
 Frame = +2

Query  86    MGFLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIV  265
             MG    A P +L    L  M+ L+ FP +A AKH  +TRHYKFNI+++NVTRLCHTKS+V
Sbjct  1     MGASVPASPEILLTILLFAMSCLWAFPEVAGAKHAGITRHYKFNIKLKNVTRLCHTKSMV  60

Query  266   TVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTG  445
             TVNGKFPGPR++AREGDR++VKVVNHVPNN+SIHWHGIRQ+++GWADGPAYITQCPIQT 
Sbjct  61    TVNGKFPGPRVVAREGDRLVVKVVNHVPNNISIHWHGIRQLQSGWADGPAYITQCPIQTN  120

Query  446   QTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWW  625
             QTYVYNFT+ GQRGTLFWHAH+SWLRA+++GP+IILP++N SYPF KPHKEV ++ GEW+
Sbjct  121   QTYVYNFTVTGQRGTLFWHAHLSWLRASVYGPLIILPKRNVSYPFAKPHKEVTIMLGEWF  180

Query  626   NVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAA  805
             N DTEAV+SQALQ GGGPN+S+AYT NGLPGPLYNCS N T+K+KVKPGKTYLLR+INAA
Sbjct  181   NADTEAVISQALQTGGGPNVSEAYTFNGLPGPLYNCSENNTYKLKVKPGKTYLLRLINAA  240

Query  806   LNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAAR  985
             LND+LFF IANHT TVVE DA Y KPFET+LLVI  GQT NVLLKTK   P ++F+M AR
Sbjct  241   LNDDLFFSIANHTFTVVEVDATYAKPFETNLLVITAGQTTNVLLKTKSIAPNASFYMLAR  300

Query  986   PYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLG  1165
             PYFTGQGTFDN+TVAG+LEYE      S NST     P LPPIN T+ V+NFT KLRSL 
Sbjct  301   PYFTGQGTFDNTTVAGILEYE-----TSSNSTA--FKPTLPPINATNVVANFTRKLRSLA  353

Query  1166  NSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQA  1345
             NSQFP NVPQTVDK FFFTVGLG +PCPKNQTCQGPNGTKFAAS+NN+S   P++A+LQ+
Sbjct  354   NSQFPVNVPQTVDKKFFFTVGLGNSPCPKNQTCQGPNGTKFAASVNNISMALPSSALLQS  413

Query  1346  YYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILG  1525
             Y+ +KSNGVY +DFPS PL PFNYTGTPPNNT V N TK+VV+PFN +VE+V+Q T I G
Sbjct  414   YFFKKSNGVYTSDFPSFPLYPFNYTGTPPNNTLVTNGTKLVVVPFNTSVEVVMQGTRIFG  473

Query  1526  AESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNP  1705
             AESHPLHLHG+NFYVVG+GFGNFDP  DP N+NLVDPVERNT+GVP+ GW AIRF ADNP
Sbjct  474   AESHPLHLHGFNFYVVGEGFGNFDPNNDPKNFNLVDPVERNTVGVPTAGWVAIRFYADNP  533

Query  1706  GVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             GVWFMHCHF+VHLSWGLRMAWIV +G LPNQKL PPPSDLPKC
Sbjct  534   GVWFMHCHFDVHLSWGLRMAWIVLDGTLPNQKLPPPPSDLPKC  576



>ref|XP_002313424.1| hypothetical protein POPTR_0009s03940g [Populus trichocarpa]
 gb|EEE87379.1| hypothetical protein POPTR_0009s03940g [Populus trichocarpa]
Length=576

 Score =   920 bits (2379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/583 (75%), Positives = 497/583 (85%), Gaps = 7/583 (1%)
 Frame = +2

Query  86    MGFLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIV  265
             MG    A P +L    L  M+ L+ FP +A AKH  +TRHYKFNI++ NVTRLCHTKS+V
Sbjct  1     MGAPVPASPGILLTILLFAMSCLWAFPEVAGAKHAGITRHYKFNIKLTNVTRLCHTKSMV  60

Query  266   TVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTG  445
             TVNGKFPGPR++AREGDR++VKVVNHVPNN+SIHWHGIRQ+++GWADGPAYITQCPIQT 
Sbjct  61    TVNGKFPGPRVVAREGDRLVVKVVNHVPNNISIHWHGIRQLQSGWADGPAYITQCPIQTN  120

Query  446   QTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWW  625
             QTYVYNFT+ GQRGTLFWHAH+SWLRA+++GP+II P++N SYPF KPHKEV ++ GEW+
Sbjct  121   QTYVYNFTVTGQRGTLFWHAHLSWLRASVYGPLIIFPKRNVSYPFAKPHKEVTIMLGEWF  180

Query  626   NVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAA  805
             N D EAV+ QALQ GGGPN+S+AYT NGL GPLYNCSAN T+K+KVKPGKTYLLR+INAA
Sbjct  181   NADPEAVIRQALQTGGGPNVSEAYTFNGLTGPLYNCSANNTYKLKVKPGKTYLLRLINAA  240

Query  806   LNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAAR  985
             LNDELFF IANHT TVVE DA YVKPFET+LLVI PGQT NVLLKTK   P ++F+M AR
Sbjct  241   LNDELFFSIANHTFTVVEVDATYVKPFETNLLVITPGQTTNVLLKTKPIAPNASFYMLAR  300

Query  986   PYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLG  1165
             PYFTGQGTFDN+TVAG+LEYE      S NST     P LPPIN T+ V+NFT KLRSL 
Sbjct  301   PYFTGQGTFDNTTVAGILEYE-----TSSNSTT--FKPTLPPINATNAVANFTRKLRSLA  353

Query  1166  NSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQA  1345
             N QFP NVPQTVDK FFFTVGLG NPCPKNQTCQGPNGTKF+AS+NN+S   P+TA+LQ+
Sbjct  354   NFQFPVNVPQTVDKKFFFTVGLGNNPCPKNQTCQGPNGTKFSASVNNISMALPSTALLQS  413

Query  1346  YYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILG  1525
             Y+ +KSNGVY +DFPS PL PFNYTGTPPNNT V N TK++VLPFN  VE+V+Q TSILG
Sbjct  414   YFFKKSNGVYTSDFPSSPLHPFNYTGTPPNNTFVTNGTKLIVLPFNTNVEVVMQGTSILG  473

Query  1526  AESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNP  1705
             AESHPLHLHG+NFYVVG+GFGNFDP  DP N+NLVDPVERNT+GVPSGGW AIRF ADNP
Sbjct  474   AESHPLHLHGFNFYVVGEGFGNFDPNNDPKNFNLVDPVERNTVGVPSGGWVAIRFHADNP  533

Query  1706  GVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             GVWFMHCHF+VHLSWGLRMAWIV +G LP+QKL PPPSDLPKC
Sbjct  534   GVWFMHCHFDVHLSWGLRMAWIVLDGTLPSQKLPPPPSDLPKC  576



>ref|XP_010275879.1| PREDICTED: laccase-17-like [Nelumbo nucifera]
Length=584

 Score =   920 bits (2378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/586 (74%), Positives = 505/586 (86%), Gaps = 5/586 (1%)
 Frame = +2

Query  86    MGFLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIV  265
             MGF   + P L A   LM++ +L+  P   VA+H  +TRHYKF+I+++NVTRLCHTKSIV
Sbjct  1     MGFYLLSSPTLRA--ILMVLGTLWLLPEFMVAQHSGITRHYKFDIKLKNVTRLCHTKSIV  58

Query  266   TVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTG  445
             TVNG+FPGPRI+AREGDRVL+KVVN V NN+++HWHGIRQ+R+GWADGPAY+TQCPIQTG
Sbjct  59    TVNGQFPGPRIVAREGDRVLIKVVNQVQNNITLHWHGIRQLRSGWADGPAYVTQCPIQTG  118

Query  446   QTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWW  625
             Q YVYNFTI GQRGTLFWHAHISWLR+TL+GP++ILP++N SYPF KP+KEVP+IFGEWW
Sbjct  119   QAYVYNFTITGQRGTLFWHAHISWLRSTLYGPVVILPKRNASYPFTKPYKEVPIIFGEWW  178

Query  626   NVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAA  805
             N D EAV+SQALQ GGGPN+SDAYTINGLPGPLYNCSA +TFK+KVKPGKTYLLR+INAA
Sbjct  179   NTDPEAVISQALQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRLINAA  238

Query  806   LNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAAR  985
             LNDELFF IANH++TVV+ DA YVKPF+T+ L+I PGQT NVLLKTK + P +TF MAAR
Sbjct  239   LNDELFFSIANHSLTVVDVDAVYVKPFDTETLLITPGQTTNVLLKTKPHYPNATFLMAAR  298

Query  986   PYFTGQGTFDNSTVAGVLEYEIP---SLNISKNSTKPIALPPLPPINGTSFVSNFTGKLR  1156
             PY TG GTFDNST AG+LEY++P   +   S ++ K +  P LPP+N T+  +NF  +LR
Sbjct  299   PYVTGLGTFDNSTTAGILEYQLPSTTTTTRSSSAAKKLLKPTLPPLNDTTLATNFAKRLR  358

Query  1157  SLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAI  1336
             SL  +QFPANVPQTVD+ FFFTVGLG++PCP+NQTCQGPNGTKF+AS+NNVSF  P TA+
Sbjct  359   SLATAQFPANVPQTVDRRFFFTVGLGSSPCPQNQTCQGPNGTKFSASINNVSFALPNTAL  418

Query  1337  LQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTS  1516
             LQA++  ++ GVY TDFP+ P  PFNYTGTPPNNT V NATKVVVLPFN +VELV+QDTS
Sbjct  419   LQAHFFGQAKGVYTTDFPTNPPFPFNYTGTPPNNTFVNNATKVVVLPFNTSVELVMQDTS  478

Query  1517  ILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRA  1696
             ILGAESHPLHLHG+NF+VVGQGFGNFDP KDPA++NLVDPVERNT+GVPSGGW AIRF A
Sbjct  479   ILGAESHPLHLHGFNFFVVGQGFGNFDPNKDPASFNLVDPVERNTVGVPSGGWVAIRFIA  538

Query  1697  DNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             DNPGVWFMHCH EVH SWGL+MAW V +GKLPNQKL PPPSDLPKC
Sbjct  539   DNPGVWFMHCHLEVHTSWGLKMAWAVMDGKLPNQKLPPPPSDLPKC  584



>ref|XP_007140298.1| hypothetical protein PHAVU_008G100400g [Phaseolus vulgaris]
 gb|ESW12292.1| hypothetical protein PHAVU_008G100400g [Phaseolus vulgaris]
Length=625

 Score =   919 bits (2374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/570 (76%), Positives = 495/570 (87%), Gaps = 7/570 (1%)
 Frame = +2

Query  137   MIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGD  316
             M + SL   P + V   G +TRHY F+I+ QNV+RLCHTKS+VTVNG FPGPRI+AREGD
Sbjct  59    MFLFSLVIIPQLVV---GGITRHYHFDIKYQNVSRLCHTKSMVTVNGLFPGPRIVAREGD  115

Query  317   RVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLF  496
             R+L+KVVNHV NN+SIHWHGIRQ+ +GWADGPAY+TQCPIQTGQ+YVYNFTIVGQRGTLF
Sbjct  116   RLLIKVVNHVQNNISIHWHGIRQLGSGWADGPAYVTQCPIQTGQSYVYNFTIVGQRGTLF  175

Query  497   WHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGG  676
             WHAHISWLR+TL+GPIIILP+    YPF KP+KEVP+IFGEWWN D EAV++QALQ GGG
Sbjct  176   WHAHISWLRSTLYGPIIILPKLGVPYPFTKPYKEVPIIFGEWWNADPEAVITQALQTGGG  235

Query  677   PNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVV  856
             PN+SDAYTINGLPGPLYNCS+ +TFK+KVK GKTYLLR+INAALNDELFF IANHT+TVV
Sbjct  236   PNVSDAYTINGLPGPLYNCSSKDTFKLKVKAGKTYLLRLINAALNDELFFSIANHTLTVV  295

Query  857   EADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGV  1036
             + DA YVKPF+TD ++I PGQT NVLLKTK   P +TFFM+ARPY TGQGTFDNSTVAG+
Sbjct  296   DVDAIYVKPFDTDTILITPGQTTNVLLKTKSKYPNATFFMSARPYATGQGTFDNSTVAGI  355

Query  1037  LEYEIPSLNI-SKNSTKPIAL--PPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDK  1207
             LEYE+P  ++ S NS K ++L  P LP +N TSF +NF  KLRSL +SQFPANVPQ VDK
Sbjct  356   LEYEVPPHSLHSTNSVKKLSLFKPILPALNDTSFATNFASKLRSLASSQFPANVPQKVDK  415

Query  1208  NFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATD  1384
             +FFFTVGLGT PC KNQTCQGP N TKF+AS+NNVS++ PTTA+LQA++  +SNGVY TD
Sbjct  416   HFFFTVGLGTTPCQKNQTCQGPTNTTKFSASVNNVSYIQPTTALLQAHFFGQSNGVYTTD  475

Query  1385  FPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNF  1564
             FP+ PL PFNYTGTPPNNT V N TKVVVLPFN +VELV+QDTSILGAESHPLHLHG+NF
Sbjct  476   FPTKPLVPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNF  535

Query  1565  YVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHL  1744
             +VVGQGFGN+DP KDPA +NLVDPVERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH 
Sbjct  536   FVVGQGFGNYDPNKDPAKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHT  595

Query  1745  SWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             SWGL+MAWIV +GKLPNQKLLPPP DLPKC
Sbjct  596   SWGLKMAWIVLDGKLPNQKLLPPPEDLPKC  625



>ref|XP_011043780.1| PREDICTED: laccase-2-like [Populus euphratica]
Length=576

 Score =   918 bits (2373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/583 (74%), Positives = 499/583 (86%), Gaps = 7/583 (1%)
 Frame = +2

Query  86    MGFLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIV  265
             MG    A P +L    L  M+ L+ FP +A AKH  +TRHYKFNI++ NVTRLCHTKS+V
Sbjct  1     MGASVPASPEILLTILLFAMSCLWAFPEVAGAKHAGITRHYKFNIKLTNVTRLCHTKSMV  60

Query  266   TVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTG  445
             TVNGKFPGPR++AREGDR++VKVVNHVPNN+SIHWHGIRQ+++GWADGP YITQCPIQT 
Sbjct  61    TVNGKFPGPRVVAREGDRLVVKVVNHVPNNISIHWHGIRQLQSGWADGPEYITQCPIQTN  120

Query  446   QTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWW  625
             QTYV+NFT+ GQRGTLFWHAH+SWLRA+++GP+II P++N SYPF KPHKEV ++ GEW+
Sbjct  121   QTYVHNFTVTGQRGTLFWHAHLSWLRASVYGPLIIFPKRNVSYPFAKPHKEVTIMLGEWF  180

Query  626   NVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAA  805
             N DTEAV+SQALQ GGGPN+S+AYT NGLPGPLYNCS N+T+K+KVKPGKTYLLR+INAA
Sbjct  181   NADTEAVISQALQTGGGPNVSEAYTFNGLPGPLYNCSENKTYKLKVKPGKTYLLRLINAA  240

Query  806   LNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAAR  985
             LND+LFF IANHT TVVE DA Y KPFET+LLVI PGQT NVLLKTK   P ++F+M AR
Sbjct  241   LNDDLFFSIANHTFTVVEVDATYAKPFETNLLVITPGQTTNVLLKTKPIAPNASFYMLAR  300

Query  986   PYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLG  1165
             PYFTGQGTFDN+TVAG+LEYE      S NST     P LPPINGT+FV+NFT KLRSL 
Sbjct  301   PYFTGQGTFDNTTVAGILEYE-----TSSNSTA--FKPTLPPINGTNFVANFTRKLRSLA  353

Query  1166  NSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQA  1345
             NS+FP NVPQTVDK FFFTVGLG +PCPKNQTCQGPNGTKFAAS+NN+S   P++A+LQ+
Sbjct  354   NSRFPVNVPQTVDKKFFFTVGLGNSPCPKNQTCQGPNGTKFAASVNNISMALPSSALLQS  413

Query  1346  YYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILG  1525
             Y+ +KSNGV+ +DFPS PL PFNYTGTPPNNT V N TK+VV+PFN +VE+V+Q T I G
Sbjct  414   YFFKKSNGVFTSDFPSSPLHPFNYTGTPPNNTFVANGTKLVVVPFNTSVEVVMQGTRIFG  473

Query  1526  AESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNP  1705
             AESHPLHLHG+NFYVVG+GFGNFDP  DP N+NLVDPVERNT+GVP+ GW AIRF ADNP
Sbjct  474   AESHPLHLHGFNFYVVGEGFGNFDPNNDPKNFNLVDPVERNTVGVPTAGWVAIRFHADNP  533

Query  1706  GVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             GVWFMHCHF+VHLSWGLRMAWIV +G LP+QKL PPPSDLPKC
Sbjct  534   GVWFMHCHFDVHLSWGLRMAWIVLDGTLPSQKLPPPPSDLPKC  576



>ref|XP_006379352.1| hypothetical protein POPTR_0009s15840g [Populus trichocarpa]
 gb|ERP57149.1| hypothetical protein POPTR_0009s15840g [Populus trichocarpa]
Length=576

 Score =   916 bits (2368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/583 (74%), Positives = 496/583 (85%), Gaps = 7/583 (1%)
 Frame = +2

Query  86    MGFLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIV  265
             MG    A P +L    L  M+ L+ FP +A AKH  +TRHYKFNI + NVTRLCHTKS+V
Sbjct  1     MGASVPASPEILLTILLFAMSCLWAFPEVAGAKHAGITRHYKFNIELTNVTRLCHTKSMV  60

Query  266   TVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTG  445
             TVNGKFPGPR++AREGDR++VKVVNHVPNN+SIHWHGIRQ+++GWADGPAYITQCPIQT 
Sbjct  61    TVNGKFPGPRVVAREGDRLVVKVVNHVPNNISIHWHGIRQLQSGWADGPAYITQCPIQTN  120

Query  446   QTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWW  625
             QTYVYNFTI GQRGTLFWHAH+SWLRA+++GP+IILP++N SYPF KPHKEV ++ GEW+
Sbjct  121   QTYVYNFTITGQRGTLFWHAHLSWLRASVYGPLIILPKRNVSYPFAKPHKEVTIMLGEWF  180

Query  626   NVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAA  805
             N DTEAV+SQALQ GGGPN+S+AYT NGLPGPLYNCS N T+K+KVKPGKTYLLR+INAA
Sbjct  181   NADTEAVISQALQTGGGPNVSEAYTFNGLPGPLYNCSENNTYKLKVKPGKTYLLRLINAA  240

Query  806   LNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAAR  985
             LND+LFF IANHT TVVE DA Y KPFET+LLVI  GQT NVLLKTK   P ++F+M AR
Sbjct  241   LNDDLFFSIANHTFTVVEVDATYAKPFETNLLVITAGQTTNVLLKTKPIAPNASFYMLAR  300

Query  986   PYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLG  1165
             PYFTGQGTFDN+TVAG+LEYE      S NST P   P LPPIN T+ V+NFT +LRSL 
Sbjct  301   PYFTGQGTFDNTTVAGILEYE-----TSSNST-PFK-PTLPPINATNVVANFTRRLRSLA  353

Query  1166  NSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQA  1345
             NS+FP NVPQT DK FFFTVGLG NPCPKNQTCQGPNGTKF+AS+NN+S   P++A+LQ+
Sbjct  354   NSRFPVNVPQTADKKFFFTVGLGNNPCPKNQTCQGPNGTKFSASVNNISMALPSSALLQS  413

Query  1346  YYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILG  1525
             Y+ +KSNGVY +DFPS PL PFNYTGTPPNNT V N TK+VV+PFN +VE+V+Q T I G
Sbjct  414   YFFKKSNGVYTSDFPSFPLHPFNYTGTPPNNTLVANGTKLVVVPFNTSVEVVMQGTRIFG  473

Query  1526  AESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNP  1705
             AESHPLHLHG+NFYVVG+GFGNFDP  DP N+NLVDPVERNT+GVP+ GW AIRF ADNP
Sbjct  474   AESHPLHLHGFNFYVVGEGFGNFDPNNDPKNFNLVDPVERNTVGVPTAGWVAIRFHADNP  533

Query  1706  GVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             GVWFMHCHF+VHLSWGLRMAWIV +G LP+QKL PPPSDLPKC
Sbjct  534   GVWFMHCHFDVHLSWGLRMAWIVLDGTLPSQKLPPPPSDLPKC  576



>ref|XP_003632204.1| PREDICTED: laccase-17 [Vitis vinifera]
 emb|CBI16224.3| unnamed protein product [Vitis vinifera]
Length=585

 Score =   916 bits (2368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/589 (74%), Positives = 497/589 (84%), Gaps = 10/589 (2%)
 Frame = +2

Query  86    MGFLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIV  265
             MG  F   P  L    L  +T     P +A+AK   +TRHYKF I++QNVTRLCHTKSIV
Sbjct  1     MGASFLPLPAFLGVLLLSCVT-FCLLPEIALAKDTGLTRHYKFEIKLQNVTRLCHTKSIV  59

Query  266   TVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTG  445
             TVNG FPGPRI+AREGDR+L+KVVNHV +N+SIHWHGI+Q+++GWADGPAY+TQCPIQTG
Sbjct  60    TVNGLFPGPRIVAREGDRLLIKVVNHVQDNISIHWHGIKQLQSGWADGPAYVTQCPIQTG  119

Query  446   QTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWW  625
             Q+YVYNFTIVGQRGTLFWHAHISWLR+TL+GPIIILPR+N SYPF KPHK VP+IFGEWW
Sbjct  120   QSYVYNFTIVGQRGTLFWHAHISWLRSTLYGPIIILPRRNASYPFEKPHKGVPIIFGEWW  179

Query  626   NVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAA  805
             N D EAV+SQALQ GGGPN+SDAYTINGLPGPLYNCSA +TFK+KVKP KTYLLR INAA
Sbjct  180   NADPEAVISQALQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVKPNKTYLLRFINAA  239

Query  806   LNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAAR  985
             LNDELFF IANHT+TVV+ DA YVKPFET  L+I PGQT NVLLKTK N P +TF M AR
Sbjct  240   LNDELFFSIANHTLTVVDVDAIYVKPFETKTLLITPGQTTNVLLKTKPNFPNATFLMTAR  299

Query  986   PYFTGQGTFDNSTVAGVLEYEIPS------LNISKNSTKPIALPPLPPINGTSFVSNFTG  1147
             PY TG GTFDNSTVAG+LEYE+PS      L I K    P+  P LPP+N TSF +NFT 
Sbjct  300   PYVTGLGTFDNSTVAGILEYELPSGSPHSTLFIKK---LPLFKPTLPPLNDTSFAANFTS  356

Query  1148  KLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPT  1327
             KLRSL + QFPANVPQ VD++FFFTVGLG++PC +NQTCQGPNGTKF+AS NN+SF  PT
Sbjct  357   KLRSLASPQFPANVPQKVDRHFFFTVGLGSSPCDQNQTCQGPNGTKFSASFNNISFALPT  416

Query  1328  TAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQ  1507
             TA+LQA++  +SNGVY  DFP  P+ PFNYTGTPPNNT V N TKVVVLPFN +VELV+Q
Sbjct  417   TALLQAHFFGQSNGVYKPDFPITPIIPFNYTGTPPNNTLVSNGTKVVVLPFNTSVELVVQ  476

Query  1508  DTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIR  1687
             DTSILGAESHPLHLHG+NF+VVGQGFGN+DP KDPA +NLVDP+ERNT+GVPSGGW AIR
Sbjct  477   DTSILGAESHPLHLHGFNFFVVGQGFGNYDPNKDPAKFNLVDPIERNTVGVPSGGWVAIR  536

Query  1688  FRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             F ADNPGVWFMHCH E+H SWGL+MAW+V +GKLPNQKL PPP+DLPKC
Sbjct  537   FLADNPGVWFMHCHLEIHTSWGLKMAWVVLDGKLPNQKLPPPPADLPKC  585



>ref|XP_011032272.1| PREDICTED: laccase-2-like [Populus euphratica]
Length=576

 Score =   916 bits (2367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/583 (74%), Positives = 497/583 (85%), Gaps = 7/583 (1%)
 Frame = +2

Query  86    MGFLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIV  265
             MG    A P +L    L  M+ L+ FP +A AKH  +TRHYKFNI + NVTRLCHTKS+V
Sbjct  1     MGAPVPASPEILLTILLFAMSCLWAFPDVAGAKHAGITRHYKFNIELTNVTRLCHTKSMV  60

Query  266   TVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTG  445
             TVNGKFPGPR++AREGDR++VKVVNHVPNN++IHWHGIRQ+++GWADGP YITQCPIQT 
Sbjct  61    TVNGKFPGPRVVAREGDRLVVKVVNHVPNNITIHWHGIRQLQSGWADGPEYITQCPIQTN  120

Query  446   QTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWW  625
             QTYV+NFT+ GQRGTLFWHAH+SWLRA+++GP+II P++N  YPF KPHKEV ++ GEW+
Sbjct  121   QTYVHNFTVTGQRGTLFWHAHLSWLRASVYGPLIIFPKRNVPYPFAKPHKEVTIMLGEWF  180

Query  626   NVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAA  805
             N D EAV+ QALQ GGGPN+S+AYT NGLPGPLYNCSAN T+K+KVKPGKTYLLR+INAA
Sbjct  181   NADPEAVIRQALQTGGGPNVSEAYTFNGLPGPLYNCSANHTYKLKVKPGKTYLLRLINAA  240

Query  806   LNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAAR  985
             LNDELFF IANHT TVVE DA YVKPFET+LLVI PGQT NVLLKTK   P ++F+M AR
Sbjct  241   LNDELFFSIANHTFTVVEVDATYVKPFETNLLVITPGQTTNVLLKTKPIAPNASFYMLAR  300

Query  986   PYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLG  1165
             PYFTGQGTFDN+TVAG+LEYE      S NST     P LPPIN T+ V+NFT KLRSL 
Sbjct  301   PYFTGQGTFDNTTVAGILEYE-----TSSNSTA--FKPTLPPINATNAVANFTRKLRSLA  353

Query  1166  NSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQA  1345
             NSQFP NVPQTVDK FFFTVGLG +PCPKNQTCQGPNGTKFAAS+NN+S   P+TA+LQ+
Sbjct  354   NSQFPVNVPQTVDKTFFFTVGLGNSPCPKNQTCQGPNGTKFAASVNNISMALPSTALLQS  413

Query  1346  YYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILG  1525
             Y+ +KSNGV+ +DFPS PL PFNYTGTPPNNT V N TK+VVLPFN +VE+V+Q TSILG
Sbjct  414   YFFKKSNGVFTSDFPSSPLHPFNYTGTPPNNTFVANGTKLVVLPFNTSVEVVMQGTSILG  473

Query  1526  AESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNP  1705
             AESHPLH+HG+NFYVVG+GFGNFDP  DP N+NLVDPVERNT+GVPSGGW AIRF ADNP
Sbjct  474   AESHPLHIHGFNFYVVGEGFGNFDPNNDPKNFNLVDPVERNTVGVPSGGWVAIRFHADNP  533

Query  1706  GVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             GVWFMHCHF+VHLSWGLRMAWIV +G LP+QKL PPPSDLPKC
Sbjct  534   GVWFMHCHFDVHLSWGLRMAWIVLDGTLPSQKLPPPPSDLPKC  576



>ref|XP_010256874.1| PREDICTED: laccase-17-like [Nelumbo nucifera]
Length=583

 Score =   914 bits (2363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/575 (76%), Positives = 500/575 (87%), Gaps = 5/575 (1%)
 Frame = +2

Query  119   LAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRI  298
             L    ++++++L+  P    A+H  +TRHYKF I++QNVTRLCHTKSIVTVNGKFPGPRI
Sbjct  11    LVGALVVLLSNLWLLP--IAAQHSGITRHYKFEIKLQNVTRLCHTKSIVTVNGKFPGPRI  68

Query  299   MAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVG  478
             +AREGDRVLVKVVNHV NN+++HWHGIRQ+++GWADGPAYITQCP+QTGQ+YVYNFTI G
Sbjct  69    VAREGDRVLVKVVNHVQNNITLHWHGIRQLQSGWADGPAYITQCPMQTGQSYVYNFTITG  128

Query  479   QRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQA  658
             QRGTLFWHAHISWLR+TL+GPI+ILP++N+SYPF KP+KEVP+IFGEWWN D EAV++QA
Sbjct  129   QRGTLFWHAHISWLRSTLYGPIVILPKRNSSYPFAKPYKEVPIIFGEWWNADPEAVINQA  188

Query  659   LQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIAN  838
             LQ GGGPN+SDAYTINGLPGPLYNCSA +TFK+KVKPGKTYLLR+INAALNDELFF IAN
Sbjct  189   LQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRLINAALNDELFFNIAN  248

Query  839   HTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDN  1018
             HT TVV+ DA YVKP +TD LVIAPGQT NVLLKTK + P +TF MAARPY TG GTFDN
Sbjct  249   HTFTVVDVDAVYVKPLDTDTLVIAPGQTTNVLLKTKPHFPNATFLMAARPYLTGLGTFDN  308

Query  1019  STVAGVLEYE-IPSLNISKNSTKPIAL--PPLPPINGTSFVSNFTGKLRSLGNSQFPANV  1189
             ST AG+LEYE   S     +S K + L  P LP +N TSFV+NFT +LRSL  ++FPANV
Sbjct  309   STTAGILEYEPSDSSLSINSSIKKLQLFKPVLPVLNDTSFVANFTNRLRSLATAEFPANV  368

Query  1190  PQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNG  1369
             PQTVDK FFFTVGLGT+PCP+NQTCQGPNGTKF+AS+NNVSF  PTTA+LQA++  ++NG
Sbjct  369   PQTVDKQFFFTVGLGTSPCPQNQTCQGPNGTKFSASVNNVSFAMPTTALLQAHFLGQANG  428

Query  1370  VYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHL  1549
             VY TDFP+ P   FNYTGTPPNNT V N TKVVVLPFN +VELV+QDTSILGAESHPLHL
Sbjct  429   VYTTDFPTNPPLHFNYTGTPPNNTLVTNGTKVVVLPFNTSVELVMQDTSILGAESHPLHL  488

Query  1550  HGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCH  1729
             HG+NF+VVGQGFGNFDP KDPAN+NLVDPVERNT+GVPSGGW AIRF ADNPGVWFMHCH
Sbjct  489   HGFNFFVVGQGFGNFDPNKDPANFNLVDPVERNTVGVPSGGWVAIRFFADNPGVWFMHCH  548

Query  1730  FEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
              EVH SWGL+MAW+V +GKLPNQKL PPP DLPKC
Sbjct  549   LEVHTSWGLKMAWVVMDGKLPNQKLPPPPFDLPKC  583



>ref|XP_006370271.1| hypothetical protein POPTR_0001s41170g [Populus trichocarpa]
 gb|ERP66840.1| hypothetical protein POPTR_0001s41170g [Populus trichocarpa]
Length=581

 Score =   913 bits (2360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/577 (75%), Positives = 502/577 (87%), Gaps = 7/577 (1%)
 Frame = +2

Query  113   PLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGP  292
             P   A FL+   +L   P  A+A    +TRHYKF++ +QNVTRLCHTKSIVTVNGKFPGP
Sbjct  9     PAFLAVFLISFVTLSIHPEPALA----ITRHYKFDVMLQNVTRLCHTKSIVTVNGKFPGP  64

Query  293   RIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTI  472
             RI+AREGDR+L+KVVNHV NN+SIHWHGIRQ+R+GWADGPAYITQCPIQTGQ+YVYN+TI
Sbjct  65    RIVAREGDRLLIKVVNHVQNNISIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTI  124

Query  473   VGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVS  652
             VGQRGTL+WHAHISWLR+TL+GP+IILP+  T+YPF KPHKEVP+IFGEW+N D EA+++
Sbjct  125   VGQRGTLWWHAHISWLRSTLYGPLIILPKLGTTYPFAKPHKEVPIIFGEWFNADPEAIIN  184

Query  653   QALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRI  832
             QA+Q GGGPN+SDAYTING PGPLYNCSA +TFK+KVKPGKTYLLRMINAALNDELFF I
Sbjct  185   QAMQTGGGPNVSDAYTINGFPGPLYNCSAKDTFKLKVKPGKTYLLRMINAALNDELFFSI  244

Query  833   ANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTF  1012
             ANHT+TVV+ DA YVKPF+T+ L+IAPGQT NVLLKTK + P ++FFM+ARPY TGQGTF
Sbjct  245   ANHTLTVVDVDAIYVKPFDTETLLIAPGQTTNVLLKTKPHHPNASFFMSARPYVTGQGTF  304

Query  1013  DNSTVAGVLEYEIPSLNI-SKNSTK--PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPA  1183
             DNSTVAG+LEYE  +  I S +S K  P   P LPP+N TSF +NFT KLRSL +++FPA
Sbjct  305   DNSTVAGILEYEESNKTIKSSHSPKKLPFYKPNLPPLNDTSFATNFTSKLRSLASAEFPA  364

Query  1184  NVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKS  1363
             NVPQ VD+ FFF+V LGTNPC KN+TCQGPNGT FAAS+NNVSFV PT A+LQA++  +S
Sbjct  365   NVPQKVDRQFFFSVSLGTNPCSKNKTCQGPNGTMFAASVNNVSFVMPTKALLQAHHFGQS  424

Query  1364  NGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPL  1543
              GVY+ +FP  PL PFNYTGTPPNNT V N TK+VVLPFN +VEL++QDTSILGAESHPL
Sbjct  425   KGVYSPNFPINPLIPFNYTGTPPNNTMVSNGTKLVVLPFNTSVELIMQDTSILGAESHPL  484

Query  1544  HLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMH  1723
             HLHG+NF+VVG+GFGNFDPKKDPAN+NLVDPVERNT+GVPSGGW AIRF ADNPGVWFMH
Sbjct  485   HLHGFNFFVVGEGFGNFDPKKDPANFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMH  544

Query  1724  CHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             CH EVH SWGL+MAW+V +GKLPNQKLLPPP+DLPKC
Sbjct  545   CHLEVHTSWGLKMAWVVLDGKLPNQKLLPPPADLPKC  581



>ref|XP_006379354.1| hypothetical protein POPTR_0009s15860g [Populus trichocarpa]
 gb|ERP57151.1| hypothetical protein POPTR_0009s15860g [Populus trichocarpa]
Length=576

 Score =   913 bits (2360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/583 (73%), Positives = 494/583 (85%), Gaps = 7/583 (1%)
 Frame = +2

Query  86    MGFLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIV  265
             MG    A P +L    L  M+ L+ FP +A AKH  +TRHYKFNI + NVTRLCHTKS+V
Sbjct  1     MGASVPASPEILLTILLFAMSCLWAFPEVAGAKHAGITRHYKFNIELTNVTRLCHTKSMV  60

Query  266   TVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTG  445
             TVNGKFPGPR++AREGDR++VKVVNHVPNN+SIHWHGIRQ+++GWADGPAYITQCPIQT 
Sbjct  61    TVNGKFPGPRVVAREGDRLVVKVVNHVPNNISIHWHGIRQLQSGWADGPAYITQCPIQTN  120

Query  446   QTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWW  625
             QTYVYNFTI GQRGTLFWHAH+SWLRA+++GP+IILP++N SYPF KPHKEV ++ GEW+
Sbjct  121   QTYVYNFTITGQRGTLFWHAHLSWLRASVYGPLIILPKRNVSYPFAKPHKEVTIMLGEWF  180

Query  626   NVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAA  805
             N DTEAV+SQALQ GGGPN+S+AYT NGLPGPLYNCS N T+K+KVKPGKTYLLR+INAA
Sbjct  181   NADTEAVISQALQTGGGPNVSEAYTFNGLPGPLYNCSENNTYKLKVKPGKTYLLRLINAA  240

Query  806   LNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAAR  985
             LND+LFF IANHT TVVE DA Y KPFET+LLVI  GQT NVLLK K   P ++F+M AR
Sbjct  241   LNDDLFFSIANHTFTVVEVDATYAKPFETNLLVITAGQTTNVLLKAKPIAPNASFYMLAR  300

Query  986   PYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLG  1165
             PYFTGQGTFDN+TVAG+LEYE      S NST     P LPPIN T+ V+NFT +LRSL 
Sbjct  301   PYFTGQGTFDNTTVAGILEYE-----TSSNSTA--FKPTLPPINATNVVANFTRRLRSLA  353

Query  1166  NSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQA  1345
             NS+FP NVPQT DK FFFTVGLG +PCPKNQTCQGPNGTKF+AS+NN+S   P++A+LQ+
Sbjct  354   NSRFPVNVPQTADKKFFFTVGLGNSPCPKNQTCQGPNGTKFSASVNNISMALPSSALLQS  413

Query  1346  YYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILG  1525
             Y+ +KSNGVY +DFPS PL PFNYTGTPPNNT V N TK+VV+PFN +VE+V+Q T I G
Sbjct  414   YFFKKSNGVYTSDFPSFPLHPFNYTGTPPNNTLVANGTKLVVVPFNTSVEVVMQGTRIFG  473

Query  1526  AESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNP  1705
             AESHPLHLHG+NFYVVG+GFGNFDP  DP N+NLVDPVERNT+GVP+ GW AIRF ADNP
Sbjct  474   AESHPLHLHGFNFYVVGEGFGNFDPNNDPKNFNLVDPVERNTVGVPTAGWVAIRFHADNP  533

Query  1706  GVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             GVWFMHCHF+VHLSWGLRMAWIV +G LP+QKL PPPSDLPKC
Sbjct  534   GVWFMHCHFDVHLSWGLRMAWIVLDGTLPSQKLPPPPSDLPKC  576



>ref|XP_008356891.1| PREDICTED: laccase-2 [Malus domestica]
Length=584

 Score =   912 bits (2358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/578 (75%), Positives = 500/578 (87%), Gaps = 2/578 (0%)
 Frame = +2

Query  107   FPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFP  286
             F P     FL+ + SL  FP  A+A  GSVTR YKF+I+++NVTRLC TKSIVTVNGKFP
Sbjct  7     FSPTFLVAFLLALISLLAFPEFAIAAAGSVTRLYKFDIKLKNVTRLCTTKSIVTVNGKFP  66

Query  287   GPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNF  466
             GPRI+AREGDRVLVKVVNHVPNN++IHWHGIRQ+++GWADGP+Y+TQCPIQT Q+YVYNF
Sbjct  67    GPRIIAREGDRVLVKVVNHVPNNMTIHWHGIRQLQSGWADGPSYVTQCPIQTNQSYVYNF  126

Query  467   TIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAV  646
             TI+GQRGTLFWHAHISWLRAT++GP+IILP+++  YPFPKPHKEVP+IFGEWWNVDTEAV
Sbjct  127   TIIGQRGTLFWHAHISWLRATVYGPLIILPKRHAPYPFPKPHKEVPIIFGEWWNVDTEAV  186

Query  647   VSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFF  826
             +SQALQ GGGPN+S+AYTINGLPGPLYNCS  +TF +KVKPGKTYLLR+INAA+NDELFF
Sbjct  187   ISQALQTGGGPNVSNAYTINGLPGPLYNCSKKDTFSLKVKPGKTYLLRLINAAVNDELFF  246

Query  827   RIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQG  1006
              IANH++TVVEADA YVKPF+T++L+I PGQT NVLLK K + P +TF M ARPYFTG G
Sbjct  247   SIANHSLTVVEADAVYVKPFKTNILLITPGQTTNVLLKAKPHYPNATFLMLARPYFTGMG  306

Query  1007  TFDNSTVAGVLEY-EIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPA  1183
             TFDNSTVAG+LEY E  + + S +   P+  P LP IN TSFV+NFT K RSL NS+FPA
Sbjct  307   TFDNSTVAGILEYKEHSNSSSSTSLKSPLFRPILPQINATSFVANFTSKFRSLANSKFPA  366

Query  1184  NVPQTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRK  1360
             NVP+TV+K FFFTVGLGTNPCPKNQTCQGP N TKFAAS+NN SFV P+ A+LQ+++  +
Sbjct  367   NVPRTVEKRFFFTVGLGTNPCPKNQTCQGPTNTTKFAASINNNSFVLPSVALLQSHFFAQ  426

Query  1361  SNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHP  1540
             SN +Y TDFP++P   FNYTGTPPNNT V N TKVVVL FN +VELVLQ TSILGAESHP
Sbjct  427   SNSIYTTDFPTIPPKLFNYTGTPPNNTNVSNGTKVVVLKFNTSVELVLQGTSILGAESHP  486

Query  1541  LHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFM  1720
             LHLHG+NF+VVGQGFGNFDP KDP N+NLVDPVERNT GVPS GW AIRF ADNPGVW M
Sbjct  487   LHLHGFNFFVVGQGFGNFDPNKDPPNFNLVDPVERNTFGVPSRGWVAIRFLADNPGVWLM  546

Query  1721  HCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             HCHF++HLSWGLRMAW+V++GKLPNQKL PPPSDLPKC
Sbjct  547   HCHFDIHLSWGLRMAWVVQDGKLPNQKLPPPPSDLPKC  584



>ref|XP_010106521.1| hypothetical protein L484_025281 [Morus notabilis]
 gb|EXC10697.1| hypothetical protein L484_025281 [Morus notabilis]
Length=577

 Score =   912 bits (2358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/579 (75%), Positives = 500/579 (86%), Gaps = 11/579 (2%)
 Frame = +2

Query  104   AFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKF  283
             + P ++A  F +I++ L F        H  VTRHYKF+I ++NVTRLCH+KSIVTVNG+F
Sbjct  8     SMPHIVAFLFALIISFLAF-------SHAGVTRHYKFDITLKNVTRLCHSKSIVTVNGRF  60

Query  284   PGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYN  463
             PGPRI+AREGDRVL+KVVNHVPNN++IHWHGIRQ+++GWADGP+YITQCPIQTGQ+YVYN
Sbjct  61    PGPRIVAREGDRVLIKVVNHVPNNITIHWHGIRQLQSGWADGPSYITQCPIQTGQSYVYN  120

Query  464   FTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEA  643
             FTI+GQRGTL+WHAHISWLRAT++GP +ILPR+N SYPF KPHKEVP+IFGEWWN DTEA
Sbjct  121   FTIIGQRGTLWWHAHISWLRATVYGPFVILPRRNESYPFLKPHKEVPIIFGEWWNADTEA  180

Query  644   VVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELF  823
             V+ QALQ G GPN+SDAYTINGLPGPLYNCS  ETFK+KVKPGKTYLLR+INAALND+LF
Sbjct  181   VIKQALQTGAGPNVSDAYTINGLPGPLYNCSQKETFKLKVKPGKTYLLRLINAALNDDLF  240

Query  824   FRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFT-G  1000
             F IANHT+TVVEADA YVKPF++++++I PGQT NV+LKTK + P ++FFM ARPY T  
Sbjct  241   FSIANHTLTVVEADAVYVKPFQSNIVLINPGQTTNVVLKTKKHSPNASFFMLARPYSTAA  300

Query  1001  QGTFDNSTVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFP  1180
              GTF N+TVAGVLEYE P++  SKN   PI    LP IN TSF SNF+ K RSL  ++FP
Sbjct  301   SGTFANTTVAGVLEYENPAIKSSKN--LPILRLSLPQINDTSFASNFSNKFRSLATAKFP  358

Query  1181  ANVPQTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSR  1357
             ANVPQTV K+FFFTVGLGTNPCPKNQTCQGP N +KFAAS+NNVSF+ P+ A+LQ ++ +
Sbjct  359   ANVPQTVQKHFFFTVGLGTNPCPKNQTCQGPTNSSKFAASVNNVSFIMPSVALLQTHFFK  418

Query  1358  KSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESH  1537
             KSNGV+ TDFPS PL  FNYTGTPPNNT V N TKVVVL +N +VELV QDT ILGAESH
Sbjct  419   KSNGVFTTDFPSFPLVQFNYTGTPPNNTNVSNGTKVVVLKYNTSVELVFQDTGILGAESH  478

Query  1538  PLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWF  1717
             PLHLHG+NF+VVGQGFGNFDP KDPA +NLVDPVERNTIGVPSGGWAAIRF ADNPGVWF
Sbjct  479   PLHLHGFNFFVVGQGFGNFDPNKDPAKFNLVDPVERNTIGVPSGGWAAIRFLADNPGVWF  538

Query  1718  MHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             MHCHF+VHLSWGLRMAWIV++GKLPNQKL PPPSDLPKC
Sbjct  539   MHCHFDVHLSWGLRMAWIVQDGKLPNQKLPPPPSDLPKC  577



>ref|XP_004241217.1| PREDICTED: laccase-2-like [Solanum lycopersicum]
Length=576

 Score =   912 bits (2357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/584 (73%), Positives = 499/584 (85%), Gaps = 9/584 (2%)
 Frame = +2

Query  86    MGFLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIV  265
             M   + + P L   C +  + S+  FP   +A    VTRHYKF+IR++NVTRLC TK+IV
Sbjct  1     MSLFYFSRPTLF--CVIFCICSILLFPEFVIA---GVTRHYKFDIRLKNVTRLCKTKTIV  55

Query  266   TVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTG  445
             TVNGKFPGPR++AREGDR+++KVVNHV NNVSIHWHGIRQ+++GWADGPAY+TQCPIQ G
Sbjct  56    TVNGKFPGPRVVAREGDRLVIKVVNHVSNNVSIHWHGIRQLQSGWADGPAYVTQCPIQKG  115

Query  446   QTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWW  625
             Q+YVYNFTI GQRGTL+WHAHISW+RATL+GP+II P+ N SYPF KPHKE+P++FGEWW
Sbjct  116   QSYVYNFTITGQRGTLWWHAHISWMRATLYGPLIIYPKHNVSYPFAKPHKEIPIMFGEWW  175

Query  626   NVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAA  805
             N +TEAV++Q+L  G GPN+SD+YTINGLPGPLYNCSA +TFK+KVK GKTY+LR+INAA
Sbjct  176   NANTEAVINQSLVTGAGPNVSDSYTINGLPGPLYNCSAKDTFKLKVKSGKTYMLRIINAA  235

Query  806   LNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAAR  985
             LND+LFFRIANHT+TVVEADA YVKPFETD++VI PGQT NVLLKT  NP  +TF MAAR
Sbjct  236   LNDDLFFRIANHTMTVVEADAFYVKPFETDIIVITPGQTTNVLLKTHHNPQQTTFVMAAR  295

Query  986   PYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLG  1165
             PYFTG GTFDNST+AG+L YE    + +  S   + +P LPPIN TSFVSNFT K R+L 
Sbjct  296   PYFTGLGTFDNSTIAGILMYE---SSSNNISINNLPIPTLPPINSTSFVSNFTNKFRALA  352

Query  1166  NSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQ  1342
             + +FP NVP+ VDK+FFFTVGLG+NPCPKNQTCQGP N +KFAAS+NN+S + P TA+LQ
Sbjct  353   SVKFPVNVPRNVDKHFFFTVGLGSNPCPKNQTCQGPNNSSKFAASVNNISMILPNTALLQ  412

Query  1343  AYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSIL  1522
             +Y+ +KSNGVY +DFPSVPL  FNY+GTPPNNT V N TKVVVLPFN +VE+V+QDTSIL
Sbjct  413   SYFFKKSNGVYTSDFPSVPLVSFNYSGTPPNNTNVSNGTKVVVLPFNTSVEVVMQDTSIL  472

Query  1523  GAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADN  1702
             GAESHPLHLHGYNFYVVGQGFGNFDPK DPA YNLVDPVERNT+GVPSGGW AIRF ADN
Sbjct  473   GAESHPLHLHGYNFYVVGQGFGNFDPKNDPAKYNLVDPVERNTVGVPSGGWVAIRFLADN  532

Query  1703  PGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             PGVW MHCHF+VHLSWGLRMAWIV +GKLPNQKLLPPP+DLP C
Sbjct  533   PGVWLMHCHFDVHLSWGLRMAWIVLDGKLPNQKLLPPPADLPMC  576



>ref|XP_007016364.1| Laccase 2 [Theobroma cacao]
 gb|EOY33983.1| Laccase 2 [Theobroma cacao]
Length=585

 Score =   912 bits (2356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/585 (73%), Positives = 500/585 (85%), Gaps = 2/585 (0%)
 Frame = +2

Query  86    MGFLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIV  265
             MG       P +   FL+ + SL  +P +  AKH  +TRHY F+I+++++TRLC TKSIV
Sbjct  1     MGASSALLSPAVLMTFLVAVGSLMAYPEVVTAKHAGITRHYHFDIKLKSITRLCRTKSIV  60

Query  266   TVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTG  445
              VNGKFPGPR++AREGDR++V+VVNHVPNN+SIHWHG+RQ+R+GWADGP+YITQCPIQTG
Sbjct  61    AVNGKFPGPRLIAREGDRLVVEVVNHVPNNISIHWHGVRQLRSGWADGPSYITQCPIQTG  120

Query  446   QTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWW  625
             Q+YVYNFTI GQRGTLFWHAHISWLRAT++GP+IILP++N SYPF KP+KEVP++FGEW+
Sbjct  121   QSYVYNFTISGQRGTLFWHAHISWLRATVYGPLIILPKRNESYPFVKPYKEVPILFGEWF  180

Query  626   NVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAA  805
             N D EAV++Q+LQ G GPN+SDAYT+NGLPGPLYNCS+ +T+K+KVKPGKTYLLR+INAA
Sbjct  181   NADPEAVINQSLQTGAGPNVSDAYTLNGLPGPLYNCSSKDTYKLKVKPGKTYLLRLINAA  240

Query  806   LNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAAR  985
             LNDELFF IANH+ TVVEADA YVKPF T+ LVIAPGQT NVLLKTK   P +TFFM AR
Sbjct  241   LNDELFFSIANHSFTVVEADAVYVKPFVTNTLVIAPGQTTNVLLKTKPQAPNATFFMLAR  300

Query  986   PYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTK--PIALPPLPPINGTSFVSNFTGKLRS  1159
             PYFTG G FDN+TVAG+LEYE PS + S  S+K  P+  P LP IN T+FV+ F+ K RS
Sbjct  301   PYFTGMGAFDNTTVAGILEYETPSSSSSSISSKNHPLLKPGLPAINATNFVAKFSSKFRS  360

Query  1160  LGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAIL  1339
             L  ++FPANVPQ VDK FFFTVGLG++PCPKNQTCQGPNGTKFAAS+NN+SF  P TA+L
Sbjct  361   LATTKFPANVPQKVDKKFFFTVGLGSSPCPKNQTCQGPNGTKFAASMNNISFALPRTALL  420

Query  1340  QAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSI  1519
             Q+Y+  +SN  Y TDFP+ PL PFNYTGTPPNNT V N TKVVV+PFN +VE+VLQDTSI
Sbjct  421   QSYFFAQSNRGYTTDFPAFPLHPFNYTGTPPNNTLVTNGTKVVVIPFNTSVEVVLQDTSI  480

Query  1520  LGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRAD  1699
             LGAESHPLHLHGYNFYVVGQGFGNFDP KDPA +N+VDP ERNT+GVPSGGW AIRF+AD
Sbjct  481   LGAESHPLHLHGYNFYVVGQGFGNFDPNKDPAKFNVVDPAERNTVGVPSGGWVAIRFQAD  540

Query  1700  NPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             NPGVW MHCH +VHLSWGLRMAWIV +G+LPNQKL PPPSDLPKC
Sbjct  541   NPGVWLMHCHLDVHLSWGLRMAWIVLDGELPNQKLPPPPSDLPKC  585



>ref|XP_006429125.1| hypothetical protein CICLE_v10011362mg [Citrus clementina]
 ref|XP_006480873.1| PREDICTED: laccase-17-like [Citrus sinensis]
 gb|ESR42365.1| hypothetical protein CICLE_v10011362mg [Citrus clementina]
Length=578

 Score =   911 bits (2355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/573 (75%), Positives = 501/573 (87%), Gaps = 10/573 (2%)
 Frame = +2

Query  134   LMIMTSLFFFPH-MAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
             L I+   F FP  +AVA   S+TRHYKF+I+MQNVTRLCHTKSI+TVNG+FPGPRI+ARE
Sbjct  10    LAILCVWFLFPAGLAVA---SITRHYKFDIKMQNVTRLCHTKSIITVNGQFPGPRIVARE  66

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GDR+++KVVNHVPNN+SIHWHGIRQ+ +GWADGPAYITQCPIQTGQ+YVYNFTI GQRGT
Sbjct  67    GDRLIIKVVNHVPNNISIHWHGIRQLLSGWADGPAYITQCPIQTGQSYVYNFTISGQRGT  126

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             LFWHAHISWLRAT++GP++I P++   YPFPKP+KEVP+IFGEW+N DTEA+++Q+LQ G
Sbjct  127   LFWHAHISWLRATVYGPLVIFPKRGVPYPFPKPYKEVPIIFGEWFNADTEAIINQSLQTG  186

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
              GPN+SDAYTINGLPGPLYNCSA +TFK+KVKPGKTYLLR+INAALNDELFF IANHTVT
Sbjct  187   AGPNVSDAYTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTVT  246

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VV+ DA Y+KPF+TD+L+I PGQT N+LLKTK + P +TF M+ARPY TGQGTFDNSTVA
Sbjct  247   VVDVDAIYMKPFQTDILLITPGQTTNILLKTKPSYPNATFLMSARPYATGQGTFDNSTVA  306

Query  1031  GVLEYEIPSLNISKNSTK----PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQT  1198
             G+LEYE P+ +   ++      P+  P LP +N T+F  N+T +LRSL N+QFPANVPQT
Sbjct  307   GILEYEAPTKHPRSSTVSIKKLPLMKPTLPALNDTAFAFNYTTRLRSLANAQFPANVPQT  366

Query  1199  VDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVY  1375
             VDK FFFTVGLGTNPCPKNQTCQGP N TKFAAS+NN SF+ P+TA+LQA++  + NGVY
Sbjct  367   VDKRFFFTVGLGTNPCPKNQTCQGPNNSTKFAASVNNFSFILPSTALLQAHFFGQ-NGVY  425

Query  1376  ATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHG  1555
              TDFPS PL  FNYTGTPPNNT V+N TK VVLPFN TVELV+QDTSILGAESHPLHLHG
Sbjct  426   TTDFPSTPLIKFNYTGTPPNNTSVMNGTKAVVLPFNTTVELVMQDTSILGAESHPLHLHG  485

Query  1556  YNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFE  1735
             +NF+VVGQGFGN+DP+KD  N+NL+DPVERNT+GVPSGGW AIRFRADNPGVWFMHCHFE
Sbjct  486   FNFFVVGQGFGNYDPRKDRKNFNLIDPVERNTVGVPSGGWVAIRFRADNPGVWFMHCHFE  545

Query  1736  VHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             VH+SWGL+MAWIV +G LPNQKL PPP+DLPKC
Sbjct  546   VHISWGLKMAWIVLDGNLPNQKLPPPPADLPKC  578



>ref|XP_006350913.1| PREDICTED: laccase-2-like [Solanum tuberosum]
Length=584

 Score =   910 bits (2353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/589 (74%), Positives = 500/589 (85%), Gaps = 11/589 (2%)
 Frame = +2

Query  86    MGFLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIV  265
             M     + P LL  C +  + S+  FP    A    VTRHYKF+IR++NVTRLC TKSIV
Sbjct  1     MSVFVFSKPTLL--CVIFCICSILLFPEFVTA---GVTRHYKFDIRLKNVTRLCKTKSIV  55

Query  266   TVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTG  445
             TVNGKFPGPR++AREGDR+++KVVNHV NNVSIHWHGIRQ+++GWADGPAY+TQCPIQ G
Sbjct  56    TVNGKFPGPRVVAREGDRLVIKVVNHVSNNVSIHWHGIRQLQSGWADGPAYVTQCPIQKG  115

Query  446   QTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWW  625
             Q+YVYNFTI GQRGTL+WHAHISW+RATL+GP+II P+ N SYPF KPHKEVP++FGEWW
Sbjct  116   QSYVYNFTITGQRGTLWWHAHISWMRATLYGPLIIYPQHNASYPFAKPHKEVPIVFGEWW  175

Query  626   NVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAA  805
             N +TEAV++Q+L  G GPN+SD+YTINGLPGPLYNCSA +TFK+KVKPGKTY+LR+INAA
Sbjct  176   NANTEAVINQSLVTGAGPNVSDSYTINGLPGPLYNCSAKDTFKLKVKPGKTYMLRIINAA  235

Query  806   LNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAAR  985
             LND+LFFRIANHT+ VVEADA YVKPFETD++VI PGQT NVLLKT  NP  +TF M AR
Sbjct  236   LNDDLFFRIANHTMAVVEADALYVKPFETDIIVITPGQTTNVLLKTHHNPQQTTFVMVAR  295

Query  986   PYFTGQGTFDNSTVAGVLEY-----EIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGK  1150
             PYFTGQGTFDNST+AG+L Y       P  + +  S K + +P LPPIN TSFV NFT K
Sbjct  296   PYFTGQGTFDNSTIAGILMYGDDHHNSPPSSSNNISIKNLPIPTLPPINSTSFVFNFTNK  355

Query  1151  LRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPT  1327
              R+L + +FPANVP+ VDK+FFFTVGLG+NPCPKNQTCQGP N +KFAAS+NNVS + P 
Sbjct  356   FRALASVKFPANVPRNVDKHFFFTVGLGSNPCPKNQTCQGPNNSSKFAASVNNVSMILPN  415

Query  1328  TAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQ  1507
             +A+LQ+Y+ +KSNGVY +DFPSVPL PFNYTGTPPNNT V N TKVVVL FN +VE+V+Q
Sbjct  416   SALLQSYFFKKSNGVYTSDFPSVPLIPFNYTGTPPNNTNVSNGTKVVVLLFNTSVEVVMQ  475

Query  1508  DTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIR  1687
             DTSILGAESHPLHLHGYNFYVVGQGFGNFDPK DPANYNLVDPVERNT+GVPSGGW AIR
Sbjct  476   DTSILGAESHPLHLHGYNFYVVGQGFGNFDPKNDPANYNLVDPVERNTVGVPSGGWVAIR  535

Query  1688  FRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             F ADNPGVW MHCHF+VHLSWGLRMAWIV +GKLPNQKLLPPP+DLP C
Sbjct  536   FLADNPGVWLMHCHFDVHLSWGLRMAWIVLDGKLPNQKLLPPPADLPMC  584



>ref|XP_006424872.1| hypothetical protein CICLE_v10028036mg [Citrus clementina]
 gb|ESR38112.1| hypothetical protein CICLE_v10028036mg [Citrus clementina]
Length=617

 Score =   910 bits (2351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/609 (71%), Positives = 498/609 (82%), Gaps = 39/609 (6%)
 Frame = +2

Query  119   LAACFLMIMTSLFFFPHMAVA--KHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGP  292
             +   FL++ + ++ FP +AVA  KH SVTRHYKFNIR++NVTRLCHTKS+VTVNGKFPGP
Sbjct  11    ILVAFLIVTSCIWMFPQVAVATSKHTSVTRHYKFNIRLKNVTRLCHTKSMVTVNGKFPGP  70

Query  293   RIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTI  472
             R++AREGDR++VKVVNH PNN+SIHWHGIRQ+++GWADGPAYITQCPIQTGQ+YVYNFT+
Sbjct  71    RVVAREGDRIIVKVVNHAPNNISIHWHGIRQLQSGWADGPAYITQCPIQTGQSYVYNFTV  130

Query  473   VGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFG------------  616
             VGQRGTL WHAH  WLRAT++GP+IILPR N SYPF KP+KEV ++ G            
Sbjct  131   VGQRGTLLWHAHFQWLRATVYGPLIILPRHNASYPFAKPYKEVTIMLGNLSFISSNLIES  190

Query  617   ----------------------EWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYN  730
                                   EW+N D EA+++Q+LQ G GPN+S+AYT NGLPGP YN
Sbjct  191   FCHAILLINMIKKIWQIIITTGEWFNADPEAIINQSLQTGNGPNVSEAYTFNGLPGPTYN  250

Query  731   CSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIA  910
             CSA +T+K+KVKPGK Y+LR+IN ALNDELFF IANHT+TVVEADA YVKPFET++LVIA
Sbjct  251   CSAKDTYKLKVKPGKAYMLRLINTALNDELFFSIANHTLTVVEADATYVKPFETNILVIA  310

Query  911   PGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNIS-KNSTKP  1087
             PGQT NVLLKT  NPP ++FFM ARPYFTG GTFDNSTVA +LEYE PS + S +N T  
Sbjct  311   PGQTTNVLLKTNPNPPNASFFMLARPYFTGMGTFDNSTVAAILEYETPSQDNSFRNRT--  368

Query  1088  IALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQ  1267
             +  P LP IN T+FV+NF+ K RSL N+QFPANVPQTVDK FFFTV LG NPCPKNQTCQ
Sbjct  369   LFKPSLPAINATNFVANFSSKFRSLANAQFPANVPQTVDKRFFFTVSLGANPCPKNQTCQ  428

Query  1268  GPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQV  1447
             GPNGTKFAA++NNVSF  P+TA+LQ+Y+  KS GVY  DFP  PL PFNYTGTPPNNT V
Sbjct  429   GPNGTKFAAAVNNVSFALPSTALLQSYFFAKSKGVYTADFPQFPLHPFNYTGTPPNNTFV  488

Query  1448  VNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNL  1627
              N TK +V+PFN +VELVLQDTSILGAESHPLHLHGYN YVVGQGFGNFDPK DPA +NL
Sbjct  489   SNGTKALVIPFNTSVELVLQDTSILGAESHPLHLHGYNVYVVGQGFGNFDPKNDPAKFNL  548

Query  1628  VDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLL  1807
             +DPVERNT+GVPSGGW AIRF ADNPGVWFMHCHF+VHLSWGLRMAWIV +G+LPNQKL 
Sbjct  549   IDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHFDVHLSWGLRMAWIVLDGELPNQKLP  608

Query  1808  PPPSDLPKC  1834
             PPPSDLPKC
Sbjct  609   PPPSDLPKC  617



>ref|XP_002299296.1| laccase family protein [Populus trichocarpa]
 gb|EEE84101.1| laccase family protein [Populus trichocarpa]
Length=581

 Score =   909 bits (2348),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/586 (75%), Positives = 498/586 (85%), Gaps = 8/586 (1%)
 Frame = +2

Query  86    MGFLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIV  265
             MG  F   P  L    L    +L   P  AVA     TRHYK ++ +QNVTRLCHTKS+V
Sbjct  1     MGVSFLPSPAFLG-LLLFSFVTLSLHPKPAVA----TTRHYKLDVMLQNVTRLCHTKSMV  55

Query  266   TVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTG  445
             TVNGKFPGPRI+AREGDR+L+KVVNHV NN+SIHWHGIRQ+R+GWADGPAY+TQCPIQTG
Sbjct  56    TVNGKFPGPRIVAREGDRLLIKVVNHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQTG  115

Query  446   QTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWW  625
             Q+YVYN+TIVGQRGTL+WHAHISWLR+TL+GP+IILP+  T YPF KP+KEVP+IFGEW+
Sbjct  116   QSYVYNYTIVGQRGTLWWHAHISWLRSTLYGPLIILPKLGTPYPFVKPYKEVPIIFGEWF  175

Query  626   NVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAA  805
             N D EA+++QALQ GGGPN+SDAYTINGLPGPLYNCSA +TFK+KVKPGKTYLLR+INAA
Sbjct  176   NADPEAIINQALQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRLINAA  235

Query  806   LNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAAR  985
             LNDELFF IANHT TVVEADA YVKPF+T  L+IAPGQT NVLLKTK + P + FFM AR
Sbjct  236   LNDELFFSIANHTFTVVEADAVYVKPFDTKTLLIAPGQTTNVLLKTKPHHPNAKFFMTAR  295

Query  986   PYFTGQGTFDNSTVAGVLEYEIPSLNI-SKNSTK--PIALPPLPPINGTSFVSNFTGKLR  1156
             PY TGQGTFDNSTVAG+LEYE     I S +STK  P+  P LPP+N TSF + FT KLR
Sbjct  296   PYVTGQGTFDNSTVAGILEYEESHKTIQSSHSTKRLPLFKPNLPPLNDTSFATKFTSKLR  355

Query  1157  SLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAI  1336
             SL N+QFPANVPQ VD+ FFFTVGLGT+ CP+NQTCQGPNGT FAAS+NNVSF  PTTA+
Sbjct  356   SLANAQFPANVPQKVDRQFFFTVGLGTHSCPQNQTCQGPNGTMFAASVNNVSFAMPTTAL  415

Query  1337  LQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTS  1516
             LQA++  +SNGVY  DFP  PLTPFNYTG PPNNT V N TK+VVLPFN TVEL++QDTS
Sbjct  416   LQAHHFGQSNGVYTPDFPINPLTPFNYTGNPPNNTMVSNGTKLVVLPFNTTVELIMQDTS  475

Query  1517  ILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRA  1696
             ILGAESHPLHLHG+NF+VVGQGFGNFDP KDPAN+NL+DP+ERNT+GVPSGGW AIRF A
Sbjct  476   ILGAESHPLHLHGFNFFVVGQGFGNFDPNKDPANFNLIDPIERNTVGVPSGGWVAIRFLA  535

Query  1697  DNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             DNPGVWFMHCH EVH SWGL+MAW+V +GKLPNQKLLPPP+DLP+C
Sbjct  536   DNPGVWFMHCHLEVHTSWGLKMAWVVLDGKLPNQKLLPPPADLPRC  581



>emb|CBI31651.3| unnamed protein product [Vitis vinifera]
Length=1094

 Score =   908 bits (2347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/571 (75%), Positives = 496/571 (87%), Gaps = 6/571 (1%)
 Frame = +2

Query  134   LMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREG  313
              +++ +L+  P +A +    VTRHYKF+I++QNVTRLCHTKSIV+VNG+FPGP I+AREG
Sbjct  526   FIVLNTLWLSPELASS--AGVTRHYKFHIKLQNVTRLCHTKSIVSVNGQFPGPPIIAREG  583

Query  314   DRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTL  493
             D+V+VKV+NHV NNV+IHWHG+RQ+R+GWADGPAY+TQCPIQTGQTYVYNFTI GQRGTL
Sbjct  584   DQVVVKVINHVQNNVTIHWHGVRQLRSGWADGPAYVTQCPIQTGQTYVYNFTITGQRGTL  643

Query  494   FWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGG  673
             FWHAHISWLRATL+GPIIILP+KN  YPF KP+KEVP+IFGEWWN D EAV++QALQNGG
Sbjct  644   FWHAHISWLRATLYGPIIILPKKNVPYPFVKPYKEVPIIFGEWWNADPEAVITQALQNGG  703

Query  674   GPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTV  853
             GPN+SDAYTINGLPGPLYNCSA +TFK+KVKPG+TYLLR+INAALNDELFF IANHT+TV
Sbjct  704   GPNVSDAYTINGLPGPLYNCSAQDTFKLKVKPGRTYLLRLINAALNDELFFSIANHTLTV  763

Query  854   VEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAG  1033
             V+ DA YVKPF+TD ++I PGQT N+LLK K + P +TF MAARPY TG+GTFDNSTV G
Sbjct  764   VDVDAIYVKPFKTDTILITPGQTTNLLLKAKPHFPNATFLMAARPYATGRGTFDNSTVTG  823

Query  1034  VLEYEIPSLNISKN---STKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVD  1204
             +L YE P  +          P+  P LPP+N TSF +NFT KLRSL NSQFPANVPQ VD
Sbjct  824   LLHYETPPKSSPSASSFKNLPLFKPTLPPLNDTSFAANFTHKLRSLANSQFPANVPQKVD  883

Query  1205  KNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYAT  1381
             K FFFTVGLGTNPCP+NQTCQGP N TKF+AS+NNVSFV PTTAILQA++ ++SNGVY T
Sbjct  884   KRFFFTVGLGTNPCPQNQTCQGPNNSTKFSASVNNVSFVLPTTAILQAHFFQQSNGVYTT  943

Query  1382  DFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYN  1561
             DFP+ P+ PFNYTGTPPNNT V N TKVVVLPFN +VELVLQDTSILG ESHPLHLHG+N
Sbjct  944   DFPATPIFPFNYTGTPPNNTMVNNGTKVVVLPFNTSVELVLQDTSILGIESHPLHLHGFN  1003

Query  1562  FYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVH  1741
             F+VVGQGFGNFD KKDP  +NLVDPVERNT+GVPSGGW AIRF ADNPGVWFMHCHFEVH
Sbjct  1004  FFVVGQGFGNFDSKKDPPKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHFEVH  1063

Query  1742  LSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             +SWGL+M W+V +GKLPNQKL PPPSDLP+C
Sbjct  1064  MSWGLKMVWMVMDGKLPNQKLPPPPSDLPQC  1094


 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/504 (75%), Positives = 436/504 (87%), Gaps = 7/504 (1%)
 Frame = +2

Query  128   CFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAR  307
                +++ SL+ FP +A A    +TRHYKFNI++QNVTRLCHTK+IV+VNG+FPGPRI+AR
Sbjct  4     VLFLVLNSLWLFPELASA---GITRHYKFNIKLQNVTRLCHTKNIVSVNGQFPGPRIIAR  60

Query  308   EGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRG  487
             EGDRV+V VVNHVPNNV+IHWHG+RQ+R+GWADGPAY+TQCPIQTGQTYVYNFTI GQRG
Sbjct  61    EGDRVVVNVVNHVPNNVTIHWHGVRQLRSGWADGPAYVTQCPIQTGQTYVYNFTITGQRG  120

Query  488   TLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQN  667
             TLFWHAHISWLR+T++GPIIILP+KN  YPF KP+KEVP+IFGEWWN D EAV++QALQN
Sbjct  121   TLFWHAHISWLRSTVYGPIIILPKKNVPYPFVKPYKEVPIIFGEWWNADPEAVITQALQN  180

Query  668   GGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTV  847
             GGGPN+SDAYTINGLPGPLYNCSA +TFK+KVKPGKTYLLR+INAALNDELFF IANHT+
Sbjct  181   GGGPNVSDAYTINGLPGPLYNCSAQDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTL  240

Query  848   TVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTV  1027
             TVV+ DA YVKPF+TD ++I PGQT N+LLK K + P +TF MAARPY TG+GTFDNSTV
Sbjct  241   TVVDVDAIYVKPFKTDTILITPGQTTNLLLKAKPHFPNATFLMAARPYATGRGTFDNSTV  300

Query  1028  AGVLEYEIP---SLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQT  1198
             AG+L YE P   S + S     P+  P LPP+N TSF +NFT KLRSL NSQFPANVP+ 
Sbjct  301   AGLLHYEPPQKSSPSASSFKNLPVFKPTLPPLNDTSFAANFTRKLRSLANSQFPANVPKK  360

Query  1199  VDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVY  1375
             VDK FFFTVGLGT+PCP+NQTCQGP N TKF+AS+NNVSFV PTTAILQA++ ++SNGVY
Sbjct  361   VDKRFFFTVGLGTSPCPQNQTCQGPNNSTKFSASVNNVSFVLPTTAILQAHFFQQSNGVY  420

Query  1376  ATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHG  1555
              TDFP+ P+ PFNYTGTPPNNT   N TKVVVLPFN TVELVLQDTSILG ESHPLHLHG
Sbjct  421   TTDFPATPIFPFNYTGTPPNNTMASNGTKVVVLPFNTTVELVLQDTSILGIESHPLHLHG  480

Query  1556  YNFYVVGQGFGNFDPKKDPANYNL  1627
             +NF+VVGQGFGNFD KKDP  +NL
Sbjct  481   FNFFVVGQGFGNFDSKKDPPKFNL  504



>emb|CAN60348.1| hypothetical protein VITISV_005802 [Vitis vinifera]
Length=559

 Score =   908 bits (2347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/561 (76%), Positives = 488/561 (87%), Gaps = 9/561 (2%)
 Frame = +2

Query  170   MAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVP  349
             +A+AK   +TRHYKF I++QNVTRLCHTKSIVTVNG FPGPRI+AREGDR+L+KVVNHV 
Sbjct  2     IALAKDTGLTRHYKFEIKLQNVTRLCHTKSIVTVNGXFPGPRIVAREGDRLLIKVVNHVQ  61

Query  350   NNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRAT  529
             +N+SIHWHGI+Q+++GWADGPAY+TQCPIQTGQ+YVYNFTIVGQRGTLFWHAHISWLR+T
Sbjct  62    DNISIHWHGIKQLQSGWADGPAYVTQCPIQTGQSYVYNFTIVGQRGTLFWHAHISWLRST  121

Query  530   LHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTING  709
             L+GPIIILPR+N SYPF KPHK VP+IFGEWWN D EAV+SQALQ GGGPN+SDAYTING
Sbjct  122   LYGPIIILPRRNASYPFEKPHKGVPIIFGEWWNADPEAVISQALQTGGGPNVSDAYTING  181

Query  710   LPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFE  889
             LPGPLYNCSA +TFK+KVKP KTYLLR INAALNDELFF IANHT+TVV+ DA YVKPFE
Sbjct  182   LPGPLYNCSAKDTFKLKVKPNKTYLLRFINAALNDELFFSIANHTLTVVDVDAIYVKPFE  241

Query  890   TDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPS----  1057
             T  L+I PGQT NVLLKTK N P +TF M ARPY TG GTFDNSTVAG+LEYE+PS    
Sbjct  242   TKTLLITPGQTTNVLLKTKPNFPNATFLMTARPYVTGLGTFDNSTVAGILEYELPSGSPH  301

Query  1058  --LNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGL  1231
               L I K    P+  P LPP+N TSF +NFT KLRSL + QFPANVPQ VD++FFFTVGL
Sbjct  302   STLFIKK---LPLFKPTLPPLNDTSFAANFTSKLRSLASPQFPANVPQKVDRHFFFTVGL  358

Query  1232  GTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPF  1411
             G++PC +NQTCQGPNGTKF+AS NN+SF  PTTA+LQA++  +SNGVY  DFP  P+ PF
Sbjct  359   GSSPCDQNQTCQGPNGTKFSASFNNISFALPTTALLQAHFFGQSNGVYKPDFPITPIIPF  418

Query  1412  NYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGN  1591
             NYTGTPPNNT V N TKVVVLPFN +VELV+QDTSILGAESHPLHLHG+NF+VVGQGFGN
Sbjct  419   NYTGTPPNNTLVSNGTKVVVLPFNTSVELVVQDTSILGAESHPLHLHGFNFFVVGQGFGN  478

Query  1592  FDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWI  1771
             +DP KDPA +NLVDP+ERNT+GVPSGGW AIRF ADNPGVWFMHCH E+H SWGL+MAW+
Sbjct  479   YDPNKDPAKFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEIHTSWGLKMAWV  538

Query  1772  VKEGKLPNQKLLPPPSDLPKC  1834
             V +GKLPNQKL PPP+DLPKC
Sbjct  539   VLDGKLPNQKLPPPPADLPKC  559



>ref|XP_006602579.1| PREDICTED: laccase-17-like isoform X2 [Glycine max]
Length=580

 Score =   908 bits (2346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/570 (75%), Positives = 496/570 (87%), Gaps = 7/570 (1%)
 Frame = +2

Query  137   MIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGD  316
             M + SL   P +A+   G +TRHY F+I+ QNV+RLCHTKS+VTVNG+FPGPRI+AREGD
Sbjct  14    MFLFSLIIIPQLAL---GGITRHYHFDIKYQNVSRLCHTKSVVTVNGQFPGPRIVAREGD  70

Query  317   RVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLF  496
             R+L+KV +HV NN+SIHWHGIRQ+R+GWADGPAY+TQCPIQTGQ+YVYN+TI GQRGTLF
Sbjct  71    RLLIKVTSHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNYTIFGQRGTLF  130

Query  497   WHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGG  676
             WHAHISWLR+TL+GPIIILP++   YPF KP+KEVP+IFGEWWN D EAV++QALQ GGG
Sbjct  131   WHAHISWLRSTLYGPIIILPKQGAPYPFTKPYKEVPIIFGEWWNTDPEAVITQALQTGGG  190

Query  677   PNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVV  856
             PN+SDAYTINGLPGPLYNCSA +TFK+KVKPGKTYLLR+INAALNDELFF IANHT+TVV
Sbjct  191   PNVSDAYTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTLTVV  250

Query  857   EADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGV  1036
             + DA YVKPF+TD ++IAPGQT NVLLKTK + P +TFFM+ARPY TGQGTFDNSTVA +
Sbjct  251   DVDAIYVKPFDTDTILIAPGQTSNVLLKTKSHYPNATFFMSARPYATGQGTFDNSTVAAI  310

Query  1037  LEYEIPSLNI-SKNSTKPIAL--PPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDK  1207
             LEYE+P   + S  S K ++L  P LP +N TSF +NF  KL SL ++QFPANVPQ VDK
Sbjct  311   LEYEVPPHFVHSTTSVKKLSLFKPILPALNDTSFATNFANKLHSLASAQFPANVPQKVDK  370

Query  1208  NFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATD  1384
             +FFFTVGLGT PCP+NQTCQGP N TKFAAS+NNVSF+ PTTA+LQA++  +SNGVY+  
Sbjct  371   HFFFTVGLGTTPCPQNQTCQGPTNATKFAASVNNVSFIQPTTALLQAHFFGQSNGVYSPY  430

Query  1385  FPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNF  1564
             FP  PL PFNYTGTPPNNT V N TKVVVLPFN +VELV+QDTSILGAESHPLHLHG+NF
Sbjct  431   FPISPLVPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNF  490

Query  1565  YVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHL  1744
             +VVGQGFGNFDPKKDPAN N VDPVERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH 
Sbjct  491   FVVGQGFGNFDPKKDPANLNPVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHT  550

Query  1745  SWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             SWGL+MAWIV +G+LPNQKLLPPP+DLPKC
Sbjct  551   SWGLKMAWIVLDGELPNQKLLPPPADLPKC  580



>ref|XP_011077639.1| PREDICTED: laccase-17-like [Sesamum indicum]
Length=578

 Score =   907 bits (2345),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/574 (74%), Positives = 501/574 (87%), Gaps = 5/574 (1%)
 Frame = +2

Query  116   LLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPR  295
             LL +  +++  +L   PH A A     TRHY+FNI+MQNVTRLCHTKSIVTVNGKFPGPR
Sbjct  9     LLFSVGILMCVALCLLPHHAEA----ATRHYEFNIKMQNVTRLCHTKSIVTVNGKFPGPR  64

Query  296   IMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIV  475
             ++AREGDR+LV+V NHVPNN++IHWHGIRQ+R+GWADGPAYITQCPIQTGQ+YVYNFT+V
Sbjct  65    VIAREGDRLLVRVTNHVPNNITIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNFTVV  124

Query  476   GQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQ  655
             GQRGT FWHAHISWLR+TL+GP+IILP+KN  YPF KP++E+P++FGEW+N DTEA++SQ
Sbjct  125   GQRGTFFWHAHISWLRSTLYGPLIILPKKNVPYPFQKPYEEIPIVFGEWFNADTEAIISQ  184

Query  656   ALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIA  835
             ALQ GGGPN+SDAYTINGLPGPLYNCSA +TFK++VKPGKTYLLRM+NAALNDELFF IA
Sbjct  185   ALQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLRVKPGKTYLLRMVNAALNDELFFSIA  244

Query  836   NHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFD  1015
             NH++T+V+ADA YVKPFET+ ++I PGQT NVLLKTK N P +TF M ARPY TGQGTFD
Sbjct  245   NHSLTIVDADAIYVKPFETNTILITPGQTTNVLLKTKPNFPGATFLMTARPYVTGQGTFD  304

Query  1016  NSTVAGVLEYEIPSL-NISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVP  1192
             NSTVAG+LEYE P L +++     P+  P LPP+N TSF +NF  KLRSL   QFPANVP
Sbjct  305   NSTVAGILEYESPFLHSVTPLKKLPLYKPILPPLNDTSFATNFAKKLRSLATPQFPANVP  364

Query  1193  QTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGV  1372
             Q VDK+FFFTVGLGT+PC +N+TCQGPNGTKFAAS++N+SFV PTTA+LQA+++ +S+GV
Sbjct  365   QEVDKHFFFTVGLGTSPCDQNKTCQGPNGTKFAASVSNISFVQPTTALLQAHFTGQSSGV  424

Query  1373  YATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLH  1552
             Y+ DFP  PL  FNYTG PPNNT V N TK++VLPFN +VELV+QDTSILGAESHPLHLH
Sbjct  425   YSPDFPINPLHWFNYTGNPPNNTMVGNGTKLMVLPFNTSVELVMQDTSILGAESHPLHLH  484

Query  1553  GYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHF  1732
             G+NF+VVGQGFGN+DP +DP N+NLVDP+ERNT+GVP+GGW AIRF ADNPGVWFMHCH 
Sbjct  485   GFNFFVVGQGFGNYDPNEDPKNFNLVDPIERNTVGVPAGGWVAIRFLADNPGVWFMHCHL  544

Query  1733  EVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             EVH SWGL+MAW+V +GKLPNQKLLPPP+DLPKC
Sbjct  545   EVHTSWGLKMAWLVLDGKLPNQKLLPPPADLPKC  578



>ref|XP_009774063.1| PREDICTED: laccase-17-like [Nicotiana sylvestris]
Length=581

 Score =   907 bits (2345),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/586 (75%), Positives = 499/586 (85%), Gaps = 8/586 (1%)
 Frame = +2

Query  86    MGFLFHAFPPLL-AACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSI  262
             MGF    FP L+  A F++   +L   P  A A    +TRHY+FNI M NVTRLCHTKSI
Sbjct  1     MGFS-STFPSLVPMAMFIIAFLALCLMPQPAQA----ITRHYEFNITMANVTRLCHTKSI  55

Query  263   VTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQT  442
             VTVNGKFPGPRI+ REGDR+L+KV NHVPNN+SIHWHG+RQ+R+GWADGPAYITQCPIQT
Sbjct  56    VTVNGKFPGPRIVTREGDRLLIKVNNHVPNNISIHWHGVRQLRSGWADGPAYITQCPIQT  115

Query  443   GQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEW  622
             GQ+YVYN+TIVGQRGTL+WHAHISWLR+TL+GPIIILP+KN SYPF KP KE+P+I GEW
Sbjct  116   GQSYVYNYTIVGQRGTLWWHAHISWLRSTLYGPIIILPKKNESYPFVKPFKEIPIILGEW  175

Query  623   WNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINA  802
             +N D EA++SQALQ GGGPN+SDAYTINGLPG LYNCSA +TFK+KVKPGKTYLLRMINA
Sbjct  176   FNTDPEAIISQALQTGGGPNVSDAYTINGLPGLLYNCSAKDTFKLKVKPGKTYLLRMINA  235

Query  803   ALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAA  982
             ALNDELFF IANHT+TVV+ADA YVKPFETD ++I PGQT NVLLKTK   P +TF MAA
Sbjct  236   ALNDELFFSIANHTLTVVDADAVYVKPFETDTILITPGQTTNVLLKTKSEYPSATFLMAA  295

Query  983   RPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTK-PIALPPLPPINGTSFVSNFTGKLRS  1159
             RPY TGQGTFDNSTVAG+LEYE P L+ +K+  K P+  P LPP+N TSF +NF+ KLRS
Sbjct  296   RPYVTGQGTFDNSTVAGILEYESPLLHSTKSMKKLPMFKPALPPLNDTSFATNFSKKLRS  355

Query  1160  LGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAI  1336
             L NSQFPA VPQ VDK+FFFTVGLGT PC KNQTCQGP N TKFAAS+NN+SFV PTTA+
Sbjct  356   LANSQFPAKVPQNVDKHFFFTVGLGTTPCDKNQTCQGPTNTTKFAASINNISFVQPTTAL  415

Query  1337  LQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTS  1516
             LQ+++  +SNGVY   FP  PL  FNYTG PPNNT V N TKV+VLPFN  VEL++QDTS
Sbjct  416   LQSHFIGQSNGVYNPYFPINPLHWFNYTGNPPNNTMVNNGTKVLVLPFNTNVELIMQDTS  475

Query  1517  ILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRA  1696
             ILGAESHPLHLHG+NF+VVGQGFGNFDP KDP N+NL+DPVERNT+GVP+GGW AIRF A
Sbjct  476   ILGAESHPLHLHGFNFFVVGQGFGNFDPNKDPTNFNLIDPVERNTVGVPAGGWVAIRFLA  535

Query  1697  DNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             DNPG+WFMHCH EVH SWGL+MAW+V +GKLPNQKLLPPPSDLPKC
Sbjct  536   DNPGIWFMHCHLEVHTSWGLKMAWLVLDGKLPNQKLLPPPSDLPKC  581



>ref|XP_003552160.2| PREDICTED: laccase-17-like isoform X1 [Glycine max]
Length=580

 Score =   907 bits (2344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/570 (75%), Positives = 496/570 (87%), Gaps = 7/570 (1%)
 Frame = +2

Query  137   MIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGD  316
             M++ S+   P +A+   G +TRHY F+I+ QNV+RLCHTKS+VTVNG+FPGP I+AREGD
Sbjct  14    MLLFSMIIIPQLAL---GGITRHYHFDIKYQNVSRLCHTKSVVTVNGQFPGPHIVAREGD  70

Query  317   RVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLF  496
             R+L+KV NHV NN+SIHWHGIRQ+R+GWADGPAY+TQCPIQTGQ+YVYN+TI GQRGTLF
Sbjct  71    RLLIKVTNHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNYTIFGQRGTLF  130

Query  497   WHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGG  676
             WHAHISWLR+TL+GPIIILP++   YPF KP+KEVP+IFGEWWN D EAV++QALQ GGG
Sbjct  131   WHAHISWLRSTLYGPIIILPKQGAPYPFTKPYKEVPIIFGEWWNTDPEAVITQALQTGGG  190

Query  677   PNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVV  856
             PN+SDAYTINGLPGPLYNCSA +TFK+KVKPGKTYLLR+INAALNDELFF IANHT+TVV
Sbjct  191   PNVSDAYTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTLTVV  250

Query  857   EADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGV  1036
             + DA YVKPF+TD ++IAPGQT NVLLKTK + P +TFFM+ARPY TGQGTFDNSTVA +
Sbjct  251   DVDAIYVKPFDTDTILIAPGQTSNVLLKTKSHYPNATFFMSARPYATGQGTFDNSTVAAI  310

Query  1037  LEYEIPSLNI-SKNSTKPIAL--PPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDK  1207
             LEYE+P   + S  S K ++L  P LP +N TSF +NF  KL SL ++QFPANVPQ VDK
Sbjct  311   LEYEVPPHFVHSTTSVKKLSLFKPILPALNDTSFATNFANKLHSLASAQFPANVPQKVDK  370

Query  1208  NFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATD  1384
             +FFFTVGLGT PCP+NQTCQGP N TKFAAS+NNVSF+ PTTA+LQA++  +SNGVY+  
Sbjct  371   HFFFTVGLGTTPCPQNQTCQGPTNATKFAASVNNVSFIQPTTALLQAHFFGQSNGVYSPY  430

Query  1385  FPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNF  1564
             FP  PL PFNYTGTPPNNT V N TKVVVLPFN +VELV+QDTSILGAESHPLHLHG+NF
Sbjct  431   FPISPLVPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNF  490

Query  1565  YVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHL  1744
             +VVGQGFGNFDPKKDPAN N VDPVERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH 
Sbjct  491   FVVGQGFGNFDPKKDPANLNPVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHT  550

Query  1745  SWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             SWGL+MAWIV +G+LPNQKLLPPP+DLPKC
Sbjct  551   SWGLKMAWIVLDGELPNQKLLPPPADLPKC  580



>ref|XP_002278215.1| PREDICTED: laccase-17 [Vitis vinifera]
Length=584

 Score =   907 bits (2343),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/571 (75%), Positives = 496/571 (87%), Gaps = 6/571 (1%)
 Frame = +2

Query  134   LMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREG  313
              +++ +L+  P +A +    VTRHYKF+I++QNVTRLCHTKSIV+VNG+FPGP I+AREG
Sbjct  16    FIVLNTLWLSPELASS--AGVTRHYKFHIKLQNVTRLCHTKSIVSVNGQFPGPPIIAREG  73

Query  314   DRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTL  493
             D+V+VKV+NHV NNV+IHWHG+RQ+R+GWADGPAY+TQCPIQTGQTYVYNFTI GQRGTL
Sbjct  74    DQVVVKVINHVQNNVTIHWHGVRQLRSGWADGPAYVTQCPIQTGQTYVYNFTITGQRGTL  133

Query  494   FWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGG  673
             FWHAHISWLRATL+GPIIILP+KN  YPF KP+KEVP+IFGEWWN D EAV++QALQNGG
Sbjct  134   FWHAHISWLRATLYGPIIILPKKNVPYPFVKPYKEVPIIFGEWWNADPEAVITQALQNGG  193

Query  674   GPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTV  853
             GPN+SDAYTINGLPGPLYNCSA +TFK+KVKPG+TYLLR+INAALNDELFF IANHT+TV
Sbjct  194   GPNVSDAYTINGLPGPLYNCSAQDTFKLKVKPGRTYLLRLINAALNDELFFSIANHTLTV  253

Query  854   VEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAG  1033
             V+ DA YVKPF+TD ++I PGQT N+LLK K + P +TF MAARPY TG+GTFDNSTV G
Sbjct  254   VDVDAIYVKPFKTDTILITPGQTTNLLLKAKPHFPNATFLMAARPYATGRGTFDNSTVTG  313

Query  1034  VLEYEIPSLNISKN---STKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVD  1204
             +L YE P  +          P+  P LPP+N TSF +NFT KLRSL NSQFPANVPQ VD
Sbjct  314   LLHYETPPKSSPSASSFKNLPLFKPTLPPLNDTSFAANFTHKLRSLANSQFPANVPQKVD  373

Query  1205  KNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYAT  1381
             K FFFTVGLGTNPCP+NQTCQGP N TKF+AS+NNVSFV PTTAILQA++ ++SNGVY T
Sbjct  374   KRFFFTVGLGTNPCPQNQTCQGPNNSTKFSASVNNVSFVLPTTAILQAHFFQQSNGVYTT  433

Query  1382  DFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYN  1561
             DFP+ P+ PFNYTGTPPNNT V N TKVVVLPFN +VELVLQDTSILG ESHPLHLHG+N
Sbjct  434   DFPATPIFPFNYTGTPPNNTMVNNGTKVVVLPFNTSVELVLQDTSILGIESHPLHLHGFN  493

Query  1562  FYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVH  1741
             F+VVGQGFGNFD KKDP  +NLVDPVERNT+GVPSGGW AIRF ADNPGVWFMHCHFEVH
Sbjct  494   FFVVGQGFGNFDSKKDPPKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHFEVH  553

Query  1742  LSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             +SWGL+M W+V +GKLPNQKL PPPSDLP+C
Sbjct  554   MSWGLKMVWMVMDGKLPNQKLPPPPSDLPQC  584



>ref|XP_011002147.1| PREDICTED: laccase-17-like [Populus euphratica]
Length=581

 Score =   906 bits (2342),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/586 (74%), Positives = 497/586 (85%), Gaps = 8/586 (1%)
 Frame = +2

Query  86    MGFLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIV  265
             MG  F   P  L    L    +    P  AVA    +TRHYK ++ +QNVTRLCHTKS+V
Sbjct  1     MGISFLPSPAFLG-LLLFSFVTFSLHPKSAVA----ITRHYKLDVMLQNVTRLCHTKSMV  55

Query  266   TVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTG  445
             TVNGKFPGPRI+AREGDR+L+KVVNHV NN+SIHWHGIRQ+R+GWADGPAYITQCPIQTG
Sbjct  56    TVNGKFPGPRIVAREGDRLLIKVVNHVQNNISIHWHGIRQLRSGWADGPAYITQCPIQTG  115

Query  446   QTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWW  625
             Q+YVYN+TIVGQRGTL+WHAHISWLR+TLHGP+IILP+  T YPF KP+KEVP+IFGEW+
Sbjct  116   QSYVYNYTIVGQRGTLWWHAHISWLRSTLHGPLIILPKLGTPYPFVKPYKEVPVIFGEWF  175

Query  626   NVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAA  805
             N D EA++SQALQ GGGPN+SDAYTINGLPGPLYNCS  +TFK++VKPGKTYLLR+INAA
Sbjct  176   NADPEAIISQALQTGGGPNVSDAYTINGLPGPLYNCSDKDTFKLRVKPGKTYLLRLINAA  235

Query  806   LNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAAR  985
             LNDELFF IANHT TVVEADA YVKPF+T  L+IAPGQT NVLLKTK + P + FFM AR
Sbjct  236   LNDELFFSIANHTFTVVEADAVYVKPFDTKTLLIAPGQTTNVLLKTKPHRPNAKFFMTAR  295

Query  986   PYFTGQGTFDNSTVAGVLEYEIPSLNI-SKNSTK--PIALPPLPPINGTSFVSNFTGKLR  1156
             PY TGQGTFDN+T+AG+LEY+     I S +STK  P+  P LPP+N TSF +NFT KLR
Sbjct  296   PYVTGQGTFDNTTIAGILEYKESHKTIQSSHSTKKLPLFKPNLPPLNDTSFATNFTRKLR  355

Query  1157  SLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAI  1336
             SL N+QFPANVPQ +D+ FFFTVGLGT+ CP+NQTCQGPNGT FAAS+NNVSF  PTTA+
Sbjct  356   SLANAQFPANVPQKIDRQFFFTVGLGTHSCPQNQTCQGPNGTMFAASVNNVSFAMPTTAL  415

Query  1337  LQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTS  1516
             LQA++  +S GVY  DFP  PLTPFNYTG PPNNT V N TK+VVLPFN TVEL++QDTS
Sbjct  416   LQAHHFGQSKGVYTPDFPINPLTPFNYTGNPPNNTIVSNGTKLVVLPFNTTVELIMQDTS  475

Query  1517  ILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRA  1696
             ILGAESHPLHLHG+NF+VVGQGFGNFDP KDPAN+NLVDP+ERNT+GVPSGGW AIRF A
Sbjct  476   ILGAESHPLHLHGFNFFVVGQGFGNFDPNKDPANFNLVDPIERNTVGVPSGGWVAIRFLA  535

Query  1697  DNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             DNPGVWFMHCH EVH SWGL+MAWIV +GKLPNQKLLPPP+DLP+C
Sbjct  536   DNPGVWFMHCHLEVHTSWGLKMAWIVLDGKLPNQKLLPPPADLPRC  581



>emb|CDP09087.1| unnamed protein product [Coffea canephora]
Length=587

 Score =   906 bits (2342),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/581 (74%), Positives = 497/581 (86%), Gaps = 10/581 (2%)
 Frame = +2

Query  116   LLAACFL----MIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKF  283
             L   CFL     +M+ L      A A    +T+HY F IR+QNVTRLCHTKS+VTVNG+F
Sbjct  9     LSPTCFLAGVSFVMSCLVVLAIPASA--AGITKHYTFEIRLQNVTRLCHTKSVVTVNGEF  66

Query  284   PGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYN  463
             PGPRI+AREGD V VKVVNHV NN+SIHWHG+RQ+++GWADGP+YITQCPIQTGQ+Y+YN
Sbjct  67    PGPRIVAREGDNVQVKVVNHVSNNISIHWHGVRQLQSGWADGPSYITQCPIQTGQSYLYN  126

Query  464   FTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEA  643
             FTI GQRGTL+WHAHI+WLRA+++GP IILP+KN  YPFPKPHKEVP++FGEWWN D  A
Sbjct  127   FTITGQRGTLWWHAHITWLRASVYGPFIILPKKNVPYPFPKPHKEVPILFGEWWNADPVA  186

Query  644   VVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELF  823
             VV+QALQ G GPN+SD+YTINGLPGPLYNCSANETFK+KVKPGKTYLLR+INAALND+LF
Sbjct  187   VVNQALQTGAGPNVSDSYTINGLPGPLYNCSANETFKLKVKPGKTYLLRLINAALNDDLF  246

Query  824   FRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQ  1003
             F IANHT+TVVEADA YVKPF TD+L+IAPGQT+NVLL+ K +   ST+FMAARPYFTGQ
Sbjct  247   FSIANHTLTVVEADATYVKPFRTDILLIAPGQTINVLLEAKHHLANSTYFMAARPYFTGQ  306

Query  1004  GTFDNSTVAGVLEYEIPSLNIS----KNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNS  1171
             GT DNST+AG+LEY  P+ ++S     N++    LP LPPINGTSF +NFT K RSL N+
Sbjct  307   GTIDNSTIAGILEYGNPTGSVSGSSFTNTSITSLLPALPPINGTSFFANFTRKFRSLANA  366

Query  1172  QFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYY  1351
             QFPANVP+TVDK+FFFTVGLG+ PCPKNQTCQGPNG+KFAAS+NN+SF  PTTA+LQ+Y+
Sbjct  367   QFPANVPKTVDKHFFFTVGLGSKPCPKNQTCQGPNGSKFAASMNNISFNLPTTALLQSYF  426

Query  1352  SRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAE  1531
               KSNGVY TDFPSVPL PFNYTGTPPN+T VVN TK VV+ FN+++E+VLQ TSILGAE
Sbjct  427   FGKSNGVYTTDFPSVPLKPFNYTGTPPNSTFVVNGTKAVVVKFNSSIEVVLQGTSILGAE  486

Query  1532  SHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGV  1711
             SHPLH+HGYNFYVVGQGFGNFDP+ DPA YNLVDPVERNT+ VP  GW A+RF ADNPGV
Sbjct  487   SHPLHIHGYNFYVVGQGFGNFDPENDPAKYNLVDPVERNTVAVPPNGWVAVRFLADNPGV  546

Query  1712  WFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             WF HCHF+VHLSWGL MA IV +GKLPNQKL PPPSDLPKC
Sbjct  547   WFFHCHFDVHLSWGLEMALIVLDGKLPNQKLPPPPSDLPKC  587



>ref|XP_008463808.1| PREDICTED: LOW QUALITY PROTEIN: laccase-17-like [Cucumis melo]
Length=578

 Score =   906 bits (2342),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/552 (77%), Positives = 483/552 (88%), Gaps = 4/552 (1%)
 Frame = +2

Query  188   GSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIH  367
             G  TRHY F I+MQNVTRLCHTKSIVTVNGKFPGPRI+AREGDR+L+KVVNHVPNN+SIH
Sbjct  28    GGTTRHYNFEIKMQNVTRLCHTKSIVTVNGKFPGPRIVAREGDRLLIKVVNHVPNNISIH  87

Query  368   WHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPII  547
             WHGIRQ+R+GWADGPAYITQCPIQ+GQ+YVYN+TI+GQRGTLFWHAHISWLR+TL+GPII
Sbjct  88    WHGIRQLRSGWADGPAYITQCPIQSGQSYVYNYTIIGQRGTLFWHAHISWLRSTLYGPII  147

Query  548   ILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLY  727
             ILP+    YPFPKPHKE+P+IFGEWWNVDTEAV+SQALQ GGGPN+SDAYT+NGLPGP Y
Sbjct  148   ILPKLGVPYPFPKPHKEMPIIFGEWWNVDTEAVISQALQTGGGPNVSDAYTMNGLPGPFY  207

Query  728   NCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVI  907
             NCSA +T K+KVKPGKTYLLR+INAALNDELFF IANH++T+V+ DA Y+KP +T+ L+I
Sbjct  208   NCSAKDTLKLKVKPGKTYLLRLINAALNDELFFSIANHSLTIVDVDAVYIKPLKTNTLII  267

Query  908   APGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKP  1087
             APGQT NVLL+TK N P + F+M ARPY TGQGTFDNSTVAG+LEY+       K  T P
Sbjct  268   APGQTSNVLLQTKSNFPNAKFYMLARPYVTGQGTFDNSTVAGILEYDGHQQKNPK-KTLP  326

Query  1088  IALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPC---PKNQ  1258
             I  P LP +N TSFV+NFT KLRSL NSQFPANVPQ +DK FFFTVGLGTNPC    KNQ
Sbjct  327   IYKPNLPSLNDTSFVTNFTKKLRSLANSQFPANVPQKIDKKFFFTVGLGTNPCNNNKKNQ  386

Query  1259  TCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNN  1438
             TCQGPNGT FAAS+NNVSFV P  A+LQ++Y  +SNGVY+  FP+ PL PFNYTG PPNN
Sbjct  387   TCQGPNGTMFAASINNVSFVMPNVALLQSHYKGQSNGVYSPFFPNSPLIPFNYTGNPPNN  446

Query  1439  TQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPAN  1618
             T V N TKVVVLPFN +VEL++QDTSILGAESHPLHLHG+NF+VVGQGFGNFDP KDP N
Sbjct  447   TMVGNGTKVVVLPFNTSVELIMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDPQN  506

Query  1619  YNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQ  1798
             +NLVDPVERNT+GVP+GGW AIRF ADNPGVWFMHCH EVH SWGL+MAW+V +GKLPNQ
Sbjct  507   FNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQ  566

Query  1799  KLLPPPSDLPKC  1834
             KLLPPP+DLPKC
Sbjct  567   KLLPPPADLPKC  578



>ref|XP_010043648.1| PREDICTED: laccase-17-like [Eucalyptus grandis]
Length=585

 Score =   906 bits (2341),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/578 (74%), Positives = 500/578 (87%), Gaps = 9/578 (2%)
 Frame = +2

Query  119   LAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRI  298
             LA  FL+ + +  FFP  A+     +TRHYKFN+ + NVTRLCHTKS+VTVNGK+PGPR+
Sbjct  11    LAGFFLVALFASCFFPDPALVAGEGMTRHYKFNVVLHNVTRLCHTKSMVTVNGKWPGPRV  70

Query  299   MAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVG  478
             +AREGDR+L++VVNHVPNN+SIHWHGIRQ+R+GWADGPAY+TQCPIQTGQ+YVYN+TIVG
Sbjct  71    VAREGDRLLIEVVNHVPNNISIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNYTIVG  130

Query  479   QRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQA  658
             QRGTL+WHAHISWLR+TL+GP+IILP+ N SYPF KPHKE+P+IFGEW+N DTEA+++QA
Sbjct  131   QRGTLWWHAHISWLRSTLYGPLIILPKHNGSYPFIKPHKEIPIIFGEWFNSDTEAIINQA  190

Query  659   LQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIAN  838
             L+ GGGPN+SDAYTING PGPLYNCSA +T+++KVKPGKTYLLR+INAALNDELFF IAN
Sbjct  191   LKTGGGPNVSDAYTINGFPGPLYNCSAKDTYRLKVKPGKTYLLRLINAALNDELFFSIAN  250

Query  839   HTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDN  1018
             HT+TVVEADA Y+KPFET+ L+I PGQT NVLLKTK + P +TF M ARPY TG GTFDN
Sbjct  251   HTLTVVEADAIYLKPFETETLLITPGQTTNVLLKTKPHYPKATFLMTARPYVTGLGTFDN  310

Query  1019  STVAGVLEYEIP------SLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFP  1180
             STVAG+LEYE P      S +I +    P+  P LPP+N T+F +NFT KLRSL  +QFP
Sbjct  311   STVAGILEYEPPLKEPHQSFSIKQ---LPLFKPTLPPLNDTAFATNFTNKLRSLATAQFP  367

Query  1181  ANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRK  1360
             ANVPQ VD+ FFFTVGLGTNPC  NQTCQGPNGT F A++NNVSF  PTTA+LQA+Y+ +
Sbjct  368   ANVPQKVDQRFFFTVGLGTNPCQGNQTCQGPNGTMFTAAVNNVSFTLPTTALLQAHYTGQ  427

Query  1361  SNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHP  1540
             SNGVY+ DFP+ P T FN+TGTPPNNT V N TK+VVLPFNA+VEL++QDTSILGAESHP
Sbjct  428   SNGVYSPDFPNYPKTIFNFTGTPPNNTNVGNGTKLVVLPFNASVELIMQDTSILGAESHP  487

Query  1541  LHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFM  1720
             LHLHG+NF+VVGQGFGNFDP KDPA +NLVDPVERNT+GVPSGGW AIRF ADNPGVWFM
Sbjct  488   LHLHGFNFFVVGQGFGNFDPNKDPAKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFM  547

Query  1721  HCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             HCH EVH SWGL+MAW+V +GKLPNQKLLPPP+DLPKC
Sbjct  548   HCHLEVHTSWGLKMAWLVLDGKLPNQKLLPPPADLPKC  585



>ref|XP_008384938.1| PREDICTED: laccase-2-like [Malus domestica]
Length=585

 Score =   904 bits (2337),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/572 (74%), Positives = 496/572 (87%), Gaps = 3/572 (1%)
 Frame = +2

Query  128   CFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAR  307
              FL+ + SL   P  A+A  G VTR YKF+I ++NVTRLC TKSIVTVNGKFPGPRI+AR
Sbjct  14    AFLLALISLCASPEFAIAAAGGVTRQYKFDIELKNVTRLCTTKSIVTVNGKFPGPRIIAR  73

Query  308   EGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRG  487
             EGDRVLVKVVNHVPNN+++HWHGIRQ+++GWADGP+Y+TQCPIQT Q YVYNFTI+GQRG
Sbjct  74    EGDRVLVKVVNHVPNNITLHWHGIRQLQSGWADGPSYVTQCPIQTNQNYVYNFTIIGQRG  133

Query  488   TLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQN  667
             TLFWHAHISWLRAT++GP+IILP+++  YPFPKPHKEVP+IFGEWWNVD E V+SQALQ 
Sbjct  134   TLFWHAHISWLRATVYGPLIILPKRHAPYPFPKPHKEVPIIFGEWWNVDXEXVISQALQT  193

Query  668   GGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTV  847
             G GPN+SDAYTINGLPGPLYNCS  +TF++KVKPGKTYLLR+I+AALNDELFF IANH++
Sbjct  194   GNGPNVSDAYTINGLPGPLYNCSKKDTFRLKVKPGKTYLLRLISAALNDELFFSIANHSI  253

Query  848   TVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTV  1027
             TVVEADA YVKPF+T++L+I PGQT NVLLK K + P +TF M ARPYFTG+GTFDNSTV
Sbjct  254   TVVEADAVYVKPFKTNILLITPGQTTNVLLKAKPHYPNATFLMLARPYFTGRGTFDNSTV  313

Query  1028  AGVLEY--EIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTV  1201
             AG+LEY     S + +   + P+  P LP IN TSFV+NFT KLRSL NS+FPANVP+TV
Sbjct  314   AGILEYKKPSNSSSSTSLKSHPLFRPILPQINATSFVANFTSKLRSLANSRFPANVPKTV  373

Query  1202  DKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYA  1378
             ++ FFFTVGLGTNPCPKNQTCQGP N TKFAAS+NN+SF  P+ A+LQ+++  +SN VY+
Sbjct  374   ERRFFFTVGLGTNPCPKNQTCQGPTNTTKFAASMNNISFALPSXAMLQSHFFAQSNSVYS  433

Query  1379  TDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGY  1558
             TDFP +P  PFNYTGTPPNNT V N TKVVVL FN +VELV+Q TSILGAESHPLHLHG+
Sbjct  434   TDFPIIPPKPFNYTGTPPNNTNVSNGTKVVVLKFNTSVELVMQGTSILGAESHPLHLHGF  493

Query  1559  NFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEV  1738
             NF+VVGQGFGNFDP  DP+N+NLVDPVERNT+GVPSGGW AIRF ADNPGVW MHCHF+V
Sbjct  494   NFFVVGQGFGNFDPNNDPSNFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWLMHCHFDV  553

Query  1739  HLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             HLSWGLRMAW+V++GKLPNQKL PPPSDLPKC
Sbjct  554   HLSWGLRMAWVVQDGKLPNQKLPPPPSDLPKC  585



>ref|XP_004492318.1| PREDICTED: laccase-17-like [Cicer arietinum]
Length=580

 Score =   904 bits (2337),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/569 (75%), Positives = 493/569 (87%), Gaps = 4/569 (1%)
 Frame = +2

Query  137   MIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGD  316
             M + SL  F    +A  G+ T+HY F+IR QNVTRLCHTKS+VTVNG+FPGPRI+AREGD
Sbjct  13    MFLLSLINFGIFELALAGT-TKHYHFDIRYQNVTRLCHTKSMVTVNGQFPGPRIVAREGD  71

Query  317   RVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLF  496
             R+L+KVVN+V NN+SIHWHGIRQ+R+GWADGPAY+TQCPIQTGQ+YVYN+TI GQRGTLF
Sbjct  72    RLLIKVVNNVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNYTIKGQRGTLF  131

Query  497   WHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGG  676
             WHAHISWLR+T++GP+IILP+KN  YPF KPHKEVP+IFGEW+N DTEAV++QALQ GGG
Sbjct  132   WHAHISWLRSTVYGPLIILPKKNVQYPFAKPHKEVPIIFGEWFNADTEAVIAQALQTGGG  191

Query  677   PNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVV  856
             PN+SDAYTINGLPGPLYNCS  +TFK+KVKPGKTYLLR+INAALNDELFF IANHT+TVV
Sbjct  192   PNVSDAYTINGLPGPLYNCSKKDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTLTVV  251

Query  857   EADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGV  1036
             EADA YVKPF T+ ++IAPGQT NVLLKTK + P +TF M ARPY TG GTFDN+TVAG+
Sbjct  252   EADAIYVKPFVTNTILIAPGQTTNVLLKTKPHYPNATFLMTARPYATGLGTFDNTTVAGI  311

Query  1037  LEYEIPS---LNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDK  1207
             LEYEIPS    + +   T P+  P LP +N TSF + FT KLRSL ++QFPANVPQ +D+
Sbjct  312   LEYEIPSNTHHSAASLETLPLFKPVLPALNDTSFATKFTNKLRSLASAQFPANVPQKIDR  371

Query  1208  NFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDF  1387
             +FFFTVGLGTNPC  NQTCQGPNGT FAAS+NNVSF TPTTA+LQ+++  +SNGVYA  F
Sbjct  372   HFFFTVGLGTNPCKSNQTCQGPNGTMFAASINNVSFTTPTTALLQSHFFGQSNGVYAPYF  431

Query  1388  PSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFY  1567
             P+ PL PFNYTGTPPNNT V N TKVVVLPFN +VELV+QDTSILGAESHPLHLHG+NF+
Sbjct  432   PTSPLHPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFF  491

Query  1568  VVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLS  1747
             VVGQGFGNFD  KDP  +NLVDPVERNT+GVPSGGW AIRF+ADNPG WFMHCH EVH S
Sbjct  492   VVGQGFGNFDKNKDPKKFNLVDPVERNTVGVPSGGWVAIRFQADNPGAWFMHCHLEVHTS  551

Query  1748  WGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             WGL+MAWIV +GKLPNQKLLPPP+DLPKC
Sbjct  552   WGLKMAWIVLDGKLPNQKLLPPPADLPKC  580



>ref|XP_004148786.1| PREDICTED: laccase-17-like [Cucumis sativus]
 ref|XP_004165834.1| PREDICTED: laccase-17-like [Cucumis sativus]
 gb|KGN64741.1| hypothetical protein Csa_1G085370 [Cucumis sativus]
Length=579

 Score =   904 bits (2337),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/552 (77%), Positives = 484/552 (88%), Gaps = 4/552 (1%)
 Frame = +2

Query  188   GSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIH  367
             G+ TRHY F I+MQNVTRLCHTKSIVTVNGKFPGPRI+AREGDR+L+KVVN+VPNN+SIH
Sbjct  29    GTTTRHYNFEIKMQNVTRLCHTKSIVTVNGKFPGPRIVAREGDRLLIKVVNNVPNNISIH  88

Query  368   WHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPII  547
             WHGIRQ+R+GWADGPAYITQCPIQ+GQ+YVYN+TI+GQRGTLFWHAHISWLR+TL+GPII
Sbjct  89    WHGIRQLRSGWADGPAYITQCPIQSGQSYVYNYTIIGQRGTLFWHAHISWLRSTLYGPII  148

Query  548   ILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLY  727
             ILP+    YPFPKPHKE+P+IFGEWWNVDTEAV+SQALQ GGGPN+SDAYT+NGLPGP Y
Sbjct  149   ILPKLGVPYPFPKPHKEMPIIFGEWWNVDTEAVISQALQTGGGPNVSDAYTMNGLPGPFY  208

Query  728   NCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVI  907
             NCS  +T K+KVKPGKTYLLR+INAALNDELFF IANH++T+V+ DA Y+KPF+T+ L+I
Sbjct  209   NCSTKDTLKLKVKPGKTYLLRLINAALNDELFFSIANHSLTIVDVDAVYIKPFKTNTLII  268

Query  908   APGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKP  1087
             APGQT NVLL+TK N P + F+M ARPY TGQGTFDNSTVAG+LEY+       K  T P
Sbjct  269   APGQTSNVLLQTKSNFPNAKFYMLARPYVTGQGTFDNSTVAGILEYDDHQQKNPK-KTLP  327

Query  1088  IALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCP---KNQ  1258
             I  P LP +N TSFV+NFT KLRSL NSQFPANVPQ +DK FFFTVGLGTNPC    KNQ
Sbjct  328   IYKPNLPSLNDTSFVTNFTKKLRSLANSQFPANVPQKIDKKFFFTVGLGTNPCSNNKKNQ  387

Query  1259  TCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNN  1438
             TCQGPNGT FAAS+NNVSF+ P  A+LQ++Y  +SNGVY+  FP+ PL PFNYTG PPNN
Sbjct  388   TCQGPNGTMFAASINNVSFIMPNVALLQSHYKGQSNGVYSPFFPNSPLIPFNYTGNPPNN  447

Query  1439  TQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPAN  1618
             T V N TKVVVLPFN +VEL++QDTSILGAESHPLHLHG+NF+VVGQGFGNFDP KDP N
Sbjct  448   TMVGNGTKVVVLPFNTSVELIMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDPQN  507

Query  1619  YNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQ  1798
             +NLVDPVERNT+GVP+GGW AIRF ADNPGVWFMHCH EVH SWGL+MAW+V +GKLPNQ
Sbjct  508   FNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQ  567

Query  1799  KLLPPPSDLPKC  1834
             KLLPPP+DLPKC
Sbjct  568   KLLPPPADLPKC  579



>ref|XP_009796361.1| PREDICTED: laccase-17-like [Nicotiana sylvestris]
Length=581

 Score =   903 bits (2334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/586 (74%), Positives = 500/586 (85%), Gaps = 8/586 (1%)
 Frame = +2

Query  86    MGFLFHAFPPLL-AACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSI  262
             MGF    FP L+  A F++   +L   P  A A    +TRHY+FNI MQNVTRLCHTKSI
Sbjct  1     MGFS-STFPSLVPMAIFIIAFLALCLMPQPAQA----ITRHYEFNITMQNVTRLCHTKSI  55

Query  263   VTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQT  442
             VTVNGKFPGPRI+ REGDR+L+KV NHVPNN+SIHWHG+RQ+R+GWADGPAYITQCPIQT
Sbjct  56    VTVNGKFPGPRIVTREGDRLLIKVNNHVPNNISIHWHGVRQLRSGWADGPAYITQCPIQT  115

Query  443   GQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEW  622
             GQ+YVYN+TI+GQRGTL+WHAHISWLR+TL+GP+IILP+KN SYPF KP KEVP+I GEW
Sbjct  116   GQSYVYNYTIIGQRGTLWWHAHISWLRSTLYGPLIILPKKNESYPFLKPFKEVPIILGEW  175

Query  623   WNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINA  802
             +N D EA++SQALQ GGGPN+SDAYTINGLPG LYNCS  +TFK+KVKPGKTYLLRMINA
Sbjct  176   FNADPEAIISQALQTGGGPNVSDAYTINGLPGLLYNCSTKDTFKLKVKPGKTYLLRMINA  235

Query  803   ALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAA  982
             ALNDELFF IANHT+TVV+ADA YVKPF+T+ ++I PGQT NVLLKTK   P +TF M A
Sbjct  236   ALNDELFFSIANHTLTVVDADAVYVKPFDTNTILITPGQTTNVLLKTKSEYPSATFLMTA  295

Query  983   RPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTK-PIALPPLPPINGTSFVSNFTGKLRS  1159
             RPY TGQGTFDNSTVAG+LEYE P  + +K+  K P+  P LPP+N TSF +NF+ KL S
Sbjct  296   RPYVTGQGTFDNSTVAGILEYETPISHSTKSIKKLPLFKPTLPPLNDTSFATNFSKKLHS  355

Query  1160  LGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAI  1336
             L NSQFPA VPQ VDK+FFFTVGLGT PC KNQ CQGP N TKFAAS+NNVSF+ PTTA+
Sbjct  356   LANSQFPAKVPQNVDKHFFFTVGLGTTPCDKNQICQGPTNTTKFAASINNVSFIQPTTAL  415

Query  1337  LQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTS  1516
             LQ+++  +SNGVY+  FP  PL  FNYTGTPPNNT+V N TKV+VLPFN +VEL++QDTS
Sbjct  416   LQSHFIGQSNGVYSPYFPINPLHWFNYTGTPPNNTRVNNGTKVLVLPFNTSVELIMQDTS  475

Query  1517  ILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRA  1696
             ILGAESHPLHLHG+NFYVVGQGFGNFDP KDPAN+NL+DPVERNT+GVPSGGW AIRF A
Sbjct  476   ILGAESHPLHLHGFNFYVVGQGFGNFDPNKDPANFNLIDPVERNTVGVPSGGWVAIRFLA  535

Query  1697  DNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             DNPGVWFMHCH EVH SWGL+MAW+V +GKLPNQKLLPPPSDLP+C
Sbjct  536   DNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQKLLPPPSDLPQC  581



>ref|XP_009621093.1| PREDICTED: laccase-17-like [Nicotiana tomentosiformis]
Length=581

 Score =   903 bits (2334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/586 (74%), Positives = 499/586 (85%), Gaps = 8/586 (1%)
 Frame = +2

Query  86    MGFLFHAFPPLL-AACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSI  262
             MGF    FP L+  A F++   +L   P  A+A    +TRHY+FNI M NVTRLCHTKSI
Sbjct  1     MGFS-STFPSLVPMAMFIIAFLALCLMPQPALA----ITRHYEFNITMANVTRLCHTKSI  55

Query  263   VTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQT  442
             VTVNGKFPGPRI+ REGDR+L+KV NHVPNN+SIHWHG+RQ+R+GWADGPAYITQCPIQT
Sbjct  56    VTVNGKFPGPRIVTREGDRLLIKVNNHVPNNISIHWHGVRQLRSGWADGPAYITQCPIQT  115

Query  443   GQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEW  622
             GQ+YVYN+TIVGQRGTL+WHAHISWLR+TL+GP+IILP+KN SYPF KP KEVP+I GEW
Sbjct  116   GQSYVYNYTIVGQRGTLWWHAHISWLRSTLYGPLIILPKKNESYPFLKPFKEVPIILGEW  175

Query  623   WNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINA  802
             +N D EA++SQALQ GGGPN+SDAYTINGLPG LYNCSA +TFK+KVK GKTYL RMINA
Sbjct  176   FNADPEAIISQALQTGGGPNVSDAYTINGLPGLLYNCSAKDTFKLKVKLGKTYLFRMINA  235

Query  803   ALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAA  982
             ALNDELFF IANHT+TVV+ADA YVKPFET+ ++I PGQT NVLLKTK   P +TF M A
Sbjct  236   ALNDELFFSIANHTLTVVDADAVYVKPFETNTILITPGQTTNVLLKTKSEYPSATFLMTA  295

Query  983   RPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTK-PIALPPLPPINGTSFVSNFTGKLRS  1159
             RPY TGQGTFDNSTVAG+LEYE P  + +K+  K P+ +P LPP+N TSF +NF+ KLRS
Sbjct  296   RPYVTGQGTFDNSTVAGILEYESPISHSTKSMKKLPMFMPTLPPLNDTSFATNFSKKLRS  355

Query  1160  LGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAI  1336
             L  SQFP  VPQ VDK+FFFTVGLGT PC KNQTCQGP N TKFAAS+NN+SFV PTTA+
Sbjct  356   LATSQFPTKVPQNVDKHFFFTVGLGTTPCDKNQTCQGPTNTTKFAASINNISFVQPTTAL  415

Query  1337  LQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTS  1516
             LQ+++  +SNGVY+  FP+ PL  FNYTG PPNNT V N TKV+VLPFN +VEL++QDTS
Sbjct  416   LQSHFIGQSNGVYSPYFPNNPLNWFNYTGNPPNNTMVSNGTKVLVLPFNTSVELIMQDTS  475

Query  1517  ILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRA  1696
             ILGAESHPLHLHG+NF+VVGQGFGNFDP KDPAN+NL+DPVERNT+GVPSGGW AIRF A
Sbjct  476   ILGAESHPLHLHGFNFFVVGQGFGNFDPNKDPANFNLIDPVERNTVGVPSGGWVAIRFLA  535

Query  1697  DNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             DNPGVWFMHCH EVH SWGL+MAW+V +GKLPNQKLLPPPSDLPKC
Sbjct  536   DNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQKLLPPPSDLPKC  581



>ref|XP_010092993.1| hypothetical protein L484_007174 [Morus notabilis]
 gb|EXB53231.1| hypothetical protein L484_007174 [Morus notabilis]
Length=586

 Score =   903 bits (2334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/589 (73%), Positives = 496/589 (84%), Gaps = 9/589 (2%)
 Frame = +2

Query  86    MGFLFHAFPP-LLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSI  262
             MG   H F P      FL    ++   P  A A    +TRHYKFNI ++NVTRLCHTKSI
Sbjct  1     MGAPDHQFSPRAFLGVFLFGFVTMAAIPEHAFA--AGITRHYKFNIELKNVTRLCHTKSI  58

Query  263   VTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQT  442
             V+VNG+FPGPRI+AREGDR+L+KVVNHV NN+SIHWHGIRQ++ GWADGPAY+TQCPIQT
Sbjct  59    VSVNGQFPGPRIVAREGDRLLIKVVNHVKNNISIHWHGIRQLQTGWADGPAYVTQCPIQT  118

Query  443   GQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEW  622
             GQ+YVYN++I GQRGTLFWHAHISW+RAT++GPI+ILP++   YPF KP+KEVP+IFGEW
Sbjct  119   GQSYVYNYSITGQRGTLFWHAHISWIRATIYGPIVILPKRGVPYPFTKPYKEVPIIFGEW  178

Query  623   WNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINA  802
             +N D EAV+SQALQ GGGPN+SDAYTINGLPGPLYNCSA +TFK+KV+PGKTYLLR+INA
Sbjct  179   FNADPEAVISQALQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVEPGKTYLLRLINA  238

Query  803   ALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAA  982
             A+NDELFF IANHT+ VVEADA YVKPF+TD ++IAPGQT NVLLKTK + P +TFFM A
Sbjct  239   AMNDELFFSIANHTLKVVEADAIYVKPFDTDTILIAPGQTTNVLLKTKPHFPNATFFMTA  298

Query  983   RPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKPIA-----LPPLPPINGTSFVSNFTG  1147
             RPY TG GTFDNSTVA +LEYE PS  +S +ST P+       P LP +N TSF + F+ 
Sbjct  299   RPYATGLGTFDNSTVAAILEYEFPS-KLSPHSTLPMKKLQLFKPILPALNDTSFATKFSN  357

Query  1148  KLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPT  1327
             KLRSL ++QFPANVPQ VDK FFFT+GLGT+PC  NQTCQGPNGT FAAS+NN+SF  P 
Sbjct  358   KLRSLASTQFPANVPQKVDKRFFFTIGLGTSPCTHNQTCQGPNGTMFAASVNNISFALPR  417

Query  1328  TAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQ  1507
             TA+LQA++S +SNGVY+  FP+ PL PFNYTG PPNNT V N TKV VLPFN +VELVLQ
Sbjct  418   TALLQAHFSGQSNGVYSPKFPTSPLIPFNYTGAPPNNTMVTNGTKVAVLPFNTSVELVLQ  477

Query  1508  DTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIR  1687
             DTSILGAESHPLHLHG+NF+VVGQGFGNFDP KDPAN+NLVDPVERNT+GVPSGGW AIR
Sbjct  478   DTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDPANFNLVDPVERNTVGVPSGGWVAIR  537

Query  1688  FRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             F ADNPGVWFMHCH EVH SWGLRMAW+V +GKLPNQKLLPPP+DLPKC
Sbjct  538   FLADNPGVWFMHCHLEVHTSWGLRMAWVVLDGKLPNQKLLPPPADLPKC  586



>ref|XP_007208016.1| hypothetical protein PRUPE_ppa003296mg [Prunus persica]
 gb|EMJ09215.1| hypothetical protein PRUPE_ppa003296mg [Prunus persica]
Length=587

 Score =   903 bits (2334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/584 (73%), Positives = 498/584 (85%), Gaps = 7/584 (1%)
 Frame = +2

Query  104   AFP--PLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNG  277
             AFP  P   A FL+ ++  +  P  + A    VTRHYKF+I+++NVTRLC TKSIV VNG
Sbjct  4     AFPLSPAFVAAFLLALSCFWSLPEFSAAAASGVTRHYKFDIKLKNVTRLCQTKSIVAVNG  63

Query  278   KFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYV  457
             KFPGPRI+AREGDR++VKVVNHV NN+S+HWHGIRQ+++GWADGP+YITQCPIQT Q+YV
Sbjct  64    KFPGPRIIAREGDRIVVKVVNHVQNNISLHWHGIRQLQSGWADGPSYITQCPIQTNQSYV  123

Query  458   YNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDT  637
             YNFTI GQRGTLFWHAHISWLRAT++GP+IILP+ N SYPFPKPHKEVP+IFGEWW  D 
Sbjct  124   YNFTITGQRGTLFWHAHISWLRATVYGPLIILPKHNASYPFPKPHKEVPIIFGEWWKADP  183

Query  638   EAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDE  817
             EAV+ QALQ G GPN+S+AYTINGLPGPLYNCS  +TF++KVKPGKTYLLR+INAA+NDE
Sbjct  184   EAVIRQALQTGAGPNVSEAYTINGLPGPLYNCSKKDTFRLKVKPGKTYLLRLINAAVNDE  243

Query  818   LFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFT  997
             LFF IANH++TVVEADA YVKPF+TD+L+I PGQT NVLL+TK + P +TF M ARPYFT
Sbjct  244   LFFSIANHSLTVVEADALYVKPFKTDILLITPGQTTNVLLRTKPSYPNATFLMLARPYFT  303

Query  998   GQGTFDNSTVAGVLEYEIPSLNISKNSTK--PIALPPLPPINGTSFVSNFTGKLRSLGNS  1171
             G GTFDNSTVAG+LEY+ PS   +  S +  P+  P LP IN TSFV+NF+ K RSL NS
Sbjct  304   GMGTFDNSTVAGILEYKNPSNPSASTSPRNPPLLRPTLPQINATSFVANFSAKFRSLANS  363

Query  1172  QFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAY  1348
             +FPANVP+TV K FFFTVGLGTNPCPKNQTCQGP N +KFAAS+NN+SF+ PTTA+LQ++
Sbjct  364   KFPANVPKTVRKRFFFTVGLGTNPCPKNQTCQGPNNSSKFAASINNISFILPTTALLQSH  423

Query  1349  YSRKSNGVYATDFPSVPLTPFNYTGTPPNNT--QVVNATKVVVLPFNATVELVLQDTSIL  1522
             +  KSNGV+ TDFP+ PL PFNYTGTP NNT   V N TK VVL FN +VE+VLQ T IL
Sbjct  424   FFGKSNGVFTTDFPTNPLQPFNYTGTPSNNTNINVSNGTKAVVLKFNTSVEVVLQGTGIL  483

Query  1523  GAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADN  1702
             GAESHPLHLHG+NF+VVGQGFGNF+P KDPA++NLVDPVERNTIGVPSGGW AIRF ADN
Sbjct  484   GAESHPLHLHGFNFFVVGQGFGNFNPNKDPASFNLVDPVERNTIGVPSGGWVAIRFLADN  543

Query  1703  PGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             PGVW +HCHF+VHLSWGLRMAW+V++GKLPNQKL PPPSDLPKC
Sbjct  544   PGVWLLHCHFDVHLSWGLRMAWVVQDGKLPNQKLPPPPSDLPKC  587



>gb|KDO52342.1| hypothetical protein CISIN_1g008085mg [Citrus sinensis]
Length=578

 Score =   903 bits (2333),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/574 (74%), Positives = 499/574 (87%), Gaps = 12/574 (2%)
 Frame = +2

Query  134   LMIMTSLFFFPH-MAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
             L I+   F FP  +AVA   S+TRHYKF+I+MQNVTRLCHTKSI+TVNG+FPGPRI+ARE
Sbjct  10    LAILCVWFLFPAGLAVA---SITRHYKFDIKMQNVTRLCHTKSIITVNGQFPGPRIVARE  66

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GDR+++KVVNHVPNN+SIHWHGIRQ+ +GWADGPAYITQCPIQTGQ+YVYNFTI GQRGT
Sbjct  67    GDRLIIKVVNHVPNNISIHWHGIRQLLSGWADGPAYITQCPIQTGQSYVYNFTISGQRGT  126

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             LFWHAHISWLRAT++GP++I P++   YPFPKP+KEVP+IFGEW+N DTEA+++Q+LQ G
Sbjct  127   LFWHAHISWLRATVYGPLVIFPKRGVPYPFPKPYKEVPIIFGEWFNADTEAIINQSLQTG  186

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
              GPN+SDAYTINGLPGPLYNCSA +TFK+KVKPGKTYLLR+INAALNDELFF IANH+VT
Sbjct  187   AGPNVSDAYTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRLINAALNDELFFSIANHSVT  246

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VV+ DA Y+K F+TD+L+I PGQT N+LLK K + P +TF M+ARPY TGQGTFDNSTVA
Sbjct  247   VVDVDAIYIKSFQTDILLITPGQTTNILLKAKPSYPNATFLMSARPYATGQGTFDNSTVA  306

Query  1031  GVLEYEIPSLNISKNST-----KPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQ  1195
             G+LEYE P+    ++ST      P+  P LP +N T+F  N+T +LRSL N+QFPANVPQ
Sbjct  307   GILEYEAPA-KFPRSSTVSIKKLPLMKPTLPALNDTAFAFNYTTRLRSLANAQFPANVPQ  365

Query  1196  TVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGV  1372
             TV+K FFFTVGLGTNPCPKNQTCQGP N TKFAAS+NN SF+ P+TA+LQA++  + NGV
Sbjct  366   TVNKRFFFTVGLGTNPCPKNQTCQGPNNSTKFAASVNNFSFILPSTALLQAHFFGQ-NGV  424

Query  1373  YATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLH  1552
             Y TDFPS PL  FNYTGTPPNNT V+N TKVVVLPFNA+VELV+QDTS LGAESHPLHLH
Sbjct  425   YTTDFPSTPLIKFNYTGTPPNNTSVMNGTKVVVLPFNASVELVMQDTSTLGAESHPLHLH  484

Query  1553  GYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHF  1732
             G+NF+V+GQGFGN+DP KD  N+NL+DPVERNT+GVPSGGW AIRFRADNPGVWFMHCHF
Sbjct  485   GFNFFVIGQGFGNYDPSKDRKNFNLIDPVERNTVGVPSGGWVAIRFRADNPGVWFMHCHF  544

Query  1733  EVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             EVH+SWGL+MAWIV  G LPNQKL PPP+DLPKC
Sbjct  545   EVHISWGLKMAWIVLNGNLPNQKLPPPPADLPKC  578



>ref|XP_002531824.1| laccase, putative [Ricinus communis]
 gb|EEF30544.1| laccase, putative [Ricinus communis]
Length=576

 Score =   902 bits (2332),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/583 (73%), Positives = 491/583 (84%), Gaps = 7/583 (1%)
 Frame = +2

Query  86    MGFLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIV  265
             MG  F    P      L I+ +    P  A  +    TRHYKF+I++QNVTRLCHTKSIV
Sbjct  1     MGSPFLLPKPSFLGVSLFILVTFCLLPEPAFGR----TRHYKFDIKLQNVTRLCHTKSIV  56

Query  266   TVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTG  445
             TVNG FPGPRI+AREGD +L+KVVNHV NN+S+HWHGIRQ+R+GWADGPAYITQCPIQTG
Sbjct  57    TVNGMFPGPRIVAREGDNLLIKVVNHVQNNISLHWHGIRQLRSGWADGPAYITQCPIQTG  116

Query  446   QTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWW  625
             Q Y+YN+T+VGQRGTL+WHAHISWLR+TL+GPIII P++   YPF KP+KEVP+ FGEW+
Sbjct  117   QHYLYNYTVVGQRGTLWWHAHISWLRSTLYGPIIIFPKRGVPYPFAKPYKEVPITFGEWF  176

Query  626   NVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAA  805
             N DTE ++ QALQ GGGPN+SDAYTINGLPGPLYNCSA +TFK+KVK GKTY+LR+INAA
Sbjct  177   NADTETIIKQALQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVKTGKTYMLRLINAA  236

Query  806   LNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAAR  985
             LNDELFF IANHT+TVV+ DA YVKPFET +L+IAPGQT NVLLKTK + P + FFM AR
Sbjct  237   LNDELFFSIANHTLTVVDVDAVYVKPFETKILLIAPGQTTNVLLKTKPSFPNAAFFMTAR  296

Query  986   PYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLG  1165
             PY TGQGTFDNSTVAG+LEYE  +L+   N   P+  P LP +N T+F +NFT +LRSL 
Sbjct  297   PYVTGQGTFDNSTVAGILEYEPSTLS---NKKLPLFKPSLPALNDTAFATNFTNRLRSLA  353

Query  1166  NSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQA  1345
             ++QFPANVPQ VDK FFFTVGLGTNPCPKNQTCQGPNGTKFAAS+NN+SF  PTTA+LQA
Sbjct  354   SAQFPANVPQVVDKQFFFTVGLGTNPCPKNQTCQGPNGTKFAASINNISFAMPTTALLQA  413

Query  1346  YYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILG  1525
             +YS +S GVY+  FP  P+ PFNYTG PPNNT V N TK+VVL +N +VEL+LQDTSILG
Sbjct  414   HYSGQSKGVYSPYFPISPIIPFNYTGNPPNNTMVSNGTKLVVLSYNTSVELILQDTSILG  473

Query  1526  AESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNP  1705
             AESHPLHLHG+NF+VVGQGFGNFDPKKDPA YNL+DPVERNT+GVPSGGW AIRFRADNP
Sbjct  474   AESHPLHLHGFNFFVVGQGFGNFDPKKDPAKYNLIDPVERNTVGVPSGGWVAIRFRADNP  533

Query  1706  GVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             GVWFMHCH EVH SWGL+MAW+V +GKLPNQKL PPP+DLPKC
Sbjct  534   GVWFMHCHLEVHTSWGLKMAWVVLDGKLPNQKLRPPPADLPKC  576



>ref|XP_009403441.1| PREDICTED: laccase-4-like [Musa acuminata subsp. malaccensis]
Length=579

 Score =   902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/575 (74%), Positives = 484/575 (84%), Gaps = 3/575 (1%)
 Frame = +2

Query  116   LLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPR  295
             L+ A FL  M  +F FP  A A+H   TRHY F+IRM NV+RLC TKSI+TVNG+FPGPR
Sbjct  6     LMGALFLSSMV-VFAFPDDARAEHAGTTRHYSFDIRMANVSRLCATKSILTVNGEFPGPR  64

Query  296   IMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIV  475
             I+AREGDRV+VKV NHVP+NV+IHWHG+RQ+R+GWADGPAY+TQCPIQTG  YVYNFT+V
Sbjct  65    IVAREGDRVVVKVSNHVPHNVTIHWHGVRQLRSGWADGPAYVTQCPIQTGHNYVYNFTVV  124

Query  476   GQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQ  655
             GQRGTLFWHAH+SWLRATL+GPIIILP+    YPF KP+KEVP+IFGEWW  DTEA++SQ
Sbjct  125   GQRGTLFWHAHVSWLRATLYGPIIILPKHGVPYPFAKPYKEVPIIFGEWWKADTEAIISQ  184

Query  656   ALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIA  835
             ALQ GGGPN+SDAYTINGLPGPLYNCSA +TFK+KVKPGKTYLLR+INAA+NDELFF IA
Sbjct  185   ALQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRLINAAVNDELFFSIA  244

Query  836   NHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFD  1015
             NH+VTV+E DA YVKPF+ + +VI+PGQT NVLL  K   P +TFFM ARPY TG GTFD
Sbjct  245   NHSVTVIEVDAVYVKPFDAETIVISPGQTTNVLLHAKPTYPSATFFMMARPYATGSGTFD  304

Query  1016  NSTVAGVLEYEIPSLNISKNSTK--PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANV  1189
             NSTVA VLEY  P  + +    K  P+  P LP  N TS  +NFTGKLRSL  + FPANV
Sbjct  305   NSTVAAVLEYRKPYSSSAAGFDKNLPLYKPTLPAFNDTSSAANFTGKLRSLATALFPANV  364

Query  1190  PQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNG  1369
             PQTVD+ FFFTVGLGT PCPKNQTCQGPNGT FAA++NN+SFV+PTTA+LQA+++ KS+G
Sbjct  365   PQTVDRRFFFTVGLGTRPCPKNQTCQGPNGTMFAAAVNNISFVSPTTALLQAHFTGKSSG  424

Query  1370  VYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHL  1549
             VY  DFP VPL PFNYTG PPNNT V N TK+VVLPFN +VELV+QDTSILGAESHPLHL
Sbjct  425   VYTPDFPVVPLMPFNYTGAPPNNTMVSNGTKLVVLPFNTSVELVMQDTSILGAESHPLHL  484

Query  1550  HGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCH  1729
             HGYNF+VVGQGFGN+DP  DPA +NLVDPVERNTIGV +GGW AIRF ADNPGVWFMHCH
Sbjct  485   HGYNFFVVGQGFGNYDPVNDPAKFNLVDPVERNTIGVTAGGWVAIRFLADNPGVWFMHCH  544

Query  1730  FEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
              E H+SWGLRMAW+V  G+LPNQ L PPPSDLPKC
Sbjct  545   IEAHMSWGLRMAWLVLNGRLPNQTLPPPPSDLPKC  579



>ref|XP_002300066.1| hypothetical protein POPTR_0001s35740g [Populus trichocarpa]
 gb|EEE84871.1| hypothetical protein POPTR_0001s35740g [Populus trichocarpa]
Length=580

 Score =   902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/579 (74%), Positives = 494/579 (85%), Gaps = 7/579 (1%)
 Frame = +2

Query  107   FPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFP  286
              PP      L   +     P  A A    VTRHYKF+I++QNVTRLCH+KS+VTVNG+FP
Sbjct  6     LPPPAFRALLFSFSIFCLLPEHAFA----VTRHYKFDIKLQNVTRLCHSKSMVTVNGQFP  61

Query  287   GPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNF  466
             GPRI+AREGD + +KVVNHV NN+SIHWHGIRQ+++GWADGPAYITQCPIQTGQ+YVYN+
Sbjct  62    GPRIVAREGDNLFIKVVNHVQNNISIHWHGIRQLQSGWADGPAYITQCPIQTGQSYVYNY  121

Query  467   TIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAV  646
             TIVGQRGTL+WHAHISWLR+T++GP+IILP++   YPF KP+KEVP+IFGEW+NVD EAV
Sbjct  122   TIVGQRGTLWWHAHISWLRSTVYGPLIILPKRGVQYPFAKPYKEVPIIFGEWFNVDPEAV  181

Query  647   VSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFF  826
             +SQALQ GGGPN+SDAYTINGLPGPLYNCSA +TFK+KVKPGKTY+LR+INAALNDELFF
Sbjct  182   ISQALQTGGGPNVSDAYTINGLPGPLYNCSAEDTFKLKVKPGKTYMLRLINAALNDELFF  241

Query  827   RIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQG  1006
              IANH+VT+V+ DA YVKPF+T+ L+I PGQT NVLLKTK   P +TFFM ARPY TGQG
Sbjct  242   SIANHSVTIVDVDAVYVKPFDTETLLITPGQTTNVLLKTKPYFPNATFFMTARPYATGQG  301

Query  1007  TFDNSTVAGVLEYEIP-SLNISKNSTK--PIALPPLPPINGTSFVSNFTGKLRSLGNSQF  1177
             TFDNSTVA +LEYE P +++ S+ S K  P+  P LPP+N T+F +NFT KLRSL ++QF
Sbjct  302   TFDNSTVAAILEYESPKTIHSSQLSLKNLPLFKPTLPPLNDTAFAANFTSKLRSLASAQF  361

Query  1178  PANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSR  1357
             PA VPQ VD  FFFTVGLGTNPCPKNQTCQGPNGTKFAAS+NNVSF  PTTA+LQA++  
Sbjct  362   PAKVPQKVDMRFFFTVGLGTNPCPKNQTCQGPNGTKFAASVNNVSFSLPTTALLQAHFFG  421

Query  1358  KSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESH  1537
             KSNGVY  DFP  P+ PFNYTG PPNNT V   T++VVLPFN +VEL++QDTSILG ESH
Sbjct  422   KSNGVYIPDFPITPIFPFNYTGNPPNNTMVSTGTRLVVLPFNTSVELIMQDTSILGVESH  481

Query  1538  PLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWF  1717
             PLHLHGYNF+VVGQGFGNFDP KDPA +NLVDPVERNT+GVPSGGWAAIRF+ADNPGVWF
Sbjct  482   PLHLHGYNFFVVGQGFGNFDPNKDPAKFNLVDPVERNTVGVPSGGWAAIRFQADNPGVWF  541

Query  1718  MHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             MHCH EVH SWGL MAW+V +GKLPNQKL+PPP+DLPKC
Sbjct  542   MHCHLEVHTSWGLEMAWVVLDGKLPNQKLIPPPADLPKC  580



>ref|XP_006424671.1| hypothetical protein CICLE_v10030166mg [Citrus clementina]
 ref|XP_006488193.1| PREDICTED: laccase-17-like [Citrus sinensis]
 gb|ESR37911.1| hypothetical protein CICLE_v10030166mg [Citrus clementina]
Length=580

 Score =   901 bits (2329),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/576 (74%), Positives = 499/576 (87%), Gaps = 4/576 (1%)
 Frame = +2

Query  116   LLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPR  295
             L +  FL ++ S      +A    G VTRHYKF+I++QNVTRLC+TKSI++VNGKFPGPR
Sbjct  6     LRSPAFLGVICSFINLCLLAEPALG-VTRHYKFDIKLQNVTRLCNTKSIISVNGKFPGPR  64

Query  296   IMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIV  475
             I+AREGD++L+KV+NHV NN+SIHWHGIRQ+R+GWADGPAYITQCPIQTGQ+YVYNFTIV
Sbjct  65    IVAREGDQLLIKVMNHVQNNISIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNFTIV  124

Query  476   GQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQ  655
             GQRGTL+WHAH+SWLR+TL+GPIIILP++   YPF KP+KEVP+IFGEW+  D E ++SQ
Sbjct  125   GQRGTLWWHAHLSWLRSTLYGPIIILPKRGIPYPFTKPYKEVPIIFGEWFKADPETIISQ  184

Query  656   ALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIA  835
             ALQ GGGPN+SDAYTINGLPGPLYNCSA +TFK+KVKPGKTYLLR+INAALNDELFF IA
Sbjct  185   ALQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRLINAALNDELFFSIA  244

Query  836   NHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFD  1015
             NHT+TVVEADA YVKPFET+ L+IAPGQT NVLLKTK + P +TFFM ARPY TGQGTFD
Sbjct  245   NHTLTVVEADAIYVKPFETETLLIAPGQTTNVLLKTKPHYPSATFFMKARPYVTGQGTFD  304

Query  1016  NSTVAGVLEYEIP-SLNISKNSTK--PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPAN  1186
             NSTVAG+LEYE P + ++S NS K  P+  P LP +N TSF ++FT KLRSL ++QFPAN
Sbjct  305   NSTVAGILEYEKPLNFHLSSNSIKNLPLFKPVLPALNDTSFATSFTNKLRSLASTQFPAN  364

Query  1187  VPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSN  1366
             VPQ VD+ FFFTVGLGT+PC  NQTCQGPNGT F AS+NN+SFV PTTA+LQA+++ KS+
Sbjct  365   VPQNVDRRFFFTVGLGTSPCQSNQTCQGPNGTMFQASVNNISFVMPTTALLQAHFTGKSD  424

Query  1367  GVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLH  1546
             GVY  DFP+ PL  FNYTGTPPNNT V N TK+VVLPFN++VEL++QDTSILGAESHPLH
Sbjct  425   GVYTPDFPTSPLIAFNYTGTPPNNTMVSNGTKLVVLPFNSSVELIMQDTSILGAESHPLH  484

Query  1547  LHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHC  1726
             LHG+NF+VVGQGFGNFDP KDP  +NLVDPVERNT+GVPSGGW AIRF ADNPGVWFMHC
Sbjct  485   LHGFNFFVVGQGFGNFDPNKDPTKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHC  544

Query  1727  HFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             H EVH SWGL+MAWIV +GK PNQKL PPP+DLP+C
Sbjct  545   HLEVHTSWGLKMAWIVLDGKHPNQKLPPPPADLPQC  580



>ref|XP_009603099.1| PREDICTED: laccase-2-like [Nicotiana tomentosiformis]
Length=583

 Score =   901 bits (2328),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/578 (77%), Positives = 504/578 (87%), Gaps = 10/578 (2%)
 Frame = +2

Query  116   LLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPR  295
             +L A F  I  S+F FP    A    VTRHYKF+IR++NVTRLC TK+IVTVNGKFPGPR
Sbjct  11    ILLAIFC-ITCSIFLFPEFVTA---GVTRHYKFDIRLKNVTRLCQTKTIVTVNGKFPGPR  66

Query  296   IMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIV  475
             ++AREGDRV+VKVVNHV NNVS HWHGIRQI++GWADGPAYITQCPIQT Q+YVYNFTI 
Sbjct  67    VVAREGDRVVVKVVNHVSNNVSFHWHGIRQIQSGWADGPAYITQCPIQTSQSYVYNFTIT  126

Query  476   GQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQ  655
             GQRGTL+WHAHISW+RATL+GP+II P+ NTSYPF KPHKEVP+IFGEWWN +TEAV++Q
Sbjct  127   GQRGTLWWHAHISWMRATLYGPLIIYPQHNTSYPFAKPHKEVPIIFGEWWNANTEAVINQ  186

Query  656   ALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIA  835
             +L  G GPN+SD+YTINGLPGPLYNCSA +TFK+KVKPGKTY+LRMINAALND+LFFRIA
Sbjct  187   SLVTGAGPNVSDSYTINGLPGPLYNCSAKDTFKLKVKPGKTYMLRMINAALNDDLFFRIA  246

Query  836   NHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFD  1015
             NHT+TVVEADA YVKPFETD ++I PGQT NVLLKT  NP  +TFFMAARPYFTGQGTFD
Sbjct  247   NHTMTVVEADAVYVKPFETDTILITPGQTTNVLLKTHPNPQQTTFFMAARPYFTGQGTFD  306

Query  1016  NSTVAGVLEYE---IPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPAN  1186
             NST+AG+L Y+       + S    K + +P LPPIN TSFV+NFT K RSL N++FPAN
Sbjct  307   NSTIAGILMYDNVSASISSSSNTLIKNLPIPTLPPINSTSFVANFTNKFRSLANARFPAN  366

Query  1187  VPQTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKS  1363
             VPQ VDK+FFFTVGLG+NPCPKNQTCQGP N +KF+AS+NNVS + PTTA+LQ+Y+ +KS
Sbjct  367   VPQKVDKHFFFTVGLGSNPCPKNQTCQGPNNSSKFSASVNNVSMILPTTALLQSYF-KKS  425

Query  1364  NGVYAT-DFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHP  1540
             NGVY T DFPSVPL PFNYTGTPPNNT V N TKVVVLPFN +VELV+Q TSILGAESHP
Sbjct  426   NGVYTTDDFPSVPLVPFNYTGTPPNNTHVSNGTKVVVLPFNTSVELVMQGTSILGAESHP  485

Query  1541  LHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFM  1720
             LHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGW AIRF ADNPGVWFM
Sbjct  486   LHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWVAIRFLADNPGVWFM  545

Query  1721  HCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             HCHFEVHLSWGLRMAW+V +G+LPNQKL PPP+DLPKC
Sbjct  546   HCHFEVHLSWGLRMAWLVLDGELPNQKLPPPPADLPKC  583



>ref|XP_009358279.1| PREDICTED: laccase-17-like [Pyrus x bretschneideri]
Length=583

 Score =   900 bits (2326),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/578 (74%), Positives = 489/578 (85%), Gaps = 7/578 (1%)
 Frame = +2

Query  113   PLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGP  292
             P L   FL  + +L   P  A+A   S+TRHYKF+I+ QNVTRLCHTKSIVTVNG+FPGP
Sbjct  9     PTLLRLFLFSLITLCLIPQHALA---SITRHYKFDIKHQNVTRLCHTKSIVTVNGQFPGP  65

Query  293   RIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTI  472
             RI+AREGD VL+KVVNHV NN+SIHWHGIRQ+++GWADGPAY+TQCPIQTG  YVYNFTI
Sbjct  66    RIVAREGDHVLIKVVNHVQNNISIHWHGIRQLQSGWADGPAYVTQCPIQTGNNYVYNFTI  125

Query  473   VGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVS  652
              GQRGTLFWHAHISWLR+T++GP+IILP++   YPF KP+KE+P+IFGEWWNVD EAV+S
Sbjct  126   TGQRGTLFWHAHISWLRSTVYGPLIILPKRGVPYPFAKPYKEIPIIFGEWWNVDPEAVIS  185

Query  653   QALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRI  832
             QALQ GGGPN+SDAYTINGLPGPLYNCSA +TFK+KV+ GKTYLLR+INAALNDELFF I
Sbjct  186   QALQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVQSGKTYLLRLINAALNDELFFSI  245

Query  833   ANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTF  1012
             ANHT+ VVEADA YVKPFETD ++IAPGQT NVLLKTK N P +TFFM ARPY TG GTF
Sbjct  246   ANHTLKVVEADAIYVKPFETDTILIAPGQTTNVLLKTKANFPSATFFMTARPYATGLGTF  305

Query  1013  DNSTVAGVLEYEIPSLNISKN---STKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPA  1183
             DN+TVA +LEYE PS  +         P+  P LP +N TSF + F  KLRSL N+QFPA
Sbjct  306   DNTTVAAILEYESPSKTLHSTLPVKKLPLFKPVLPALNDTSFATKFGNKLRSLANAQFPA  365

Query  1184  NVPQTVDKNFFFTVGLGTNPCP-KNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRK  1360
             NVPQ VDK+FFFT+GLGTNPC   NQTCQGPNGT FAAS+NNVSF  PTTA+LQA+++ +
Sbjct  366   NVPQKVDKHFFFTIGLGTNPCSNSNQTCQGPNGTMFAASVNNVSFAMPTTALLQAHFTGQ  425

Query  1361  SNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHP  1540
             SN VY+  FPS PL PFNYTGTPPNNT V N TK++VLPFN +VELV+QDTSILG ESHP
Sbjct  426   SNAVYSPYFPSSPLIPFNYTGTPPNNTMVGNGTKLMVLPFNTSVELVMQDTSILGVESHP  485

Query  1541  LHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFM  1720
             LHLHG+NF+VVGQGFGNFD  KDPAN+NLVDPVERNT+GVPSGGW AIRF ADNPGVWFM
Sbjct  486   LHLHGFNFFVVGQGFGNFDRNKDPANFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFM  545

Query  1721  HCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             HCH E+H SWGL+MAW+V +GKLPNQKLLPPP+DLP C
Sbjct  546   HCHLEIHTSWGLKMAWLVLDGKLPNQKLLPPPADLPTC  583



>ref|XP_003532315.1| PREDICTED: laccase-17-like [Glycine max]
Length=579

 Score =   900 bits (2326),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/570 (74%), Positives = 496/570 (87%), Gaps = 7/570 (1%)
 Frame = +2

Query  137   MIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGD  316
             M++ S+   P +A+   G +TRHY F+I+ QNV+RLCHTKS+VTVNG+FPGPRI+AREGD
Sbjct  13    MLLFSMIIIPQLAL---GGITRHYHFDIKYQNVSRLCHTKSVVTVNGQFPGPRIVAREGD  69

Query  317   RVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLF  496
              +L+KV NHV NN+SIHWHGIRQ+R+GWADGPAY+TQCPIQTGQ+YVYN+T+VGQRGTL+
Sbjct  70    NLLIKVTNHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNYTVVGQRGTLW  129

Query  497   WHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGG  676
             WHAHISWLR+TL+GP+IILP+    YPF KP+KEVP+IFGEWWN D EAV++QALQ GGG
Sbjct  130   WHAHISWLRSTLYGPLIILPQYGVPYPFTKPYKEVPIIFGEWWNADPEAVITQALQTGGG  189

Query  677   PNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVV  856
             PN+SDAYTINGLPGPLYNCSA +TFK+KVKPGKTYLLR+INAALNDELFF IANHT+TVV
Sbjct  190   PNVSDAYTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTLTVV  249

Query  857   EADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGV  1036
             + DA YVKPF+TD ++I+PGQT NVLLKTK + P +TF M+ARPY TGQGTFDNSTVA +
Sbjct  250   DVDAIYVKPFDTDTILISPGQTSNVLLKTKSHYPNATFLMSARPYATGQGTFDNSTVAAI  309

Query  1037  LEYEI-PSLNISKNSTKPIAL--PPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDK  1207
             LEYE+ P    S  S K ++L  P LP +N TSF +NF+ KLRSL ++QFPANVPQ +DK
Sbjct  310   LEYEVSPHALHSTTSIKKLSLFKPILPALNDTSFATNFSNKLRSLASAQFPANVPQKIDK  369

Query  1208  NFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATD  1384
             +FFFTVGLGT PC +NQTCQGP N TKFAAS+NNVSF+ PTTA+LQ+++  +SNGVY+  
Sbjct  370   HFFFTVGLGTTPCSQNQTCQGPTNSTKFAASVNNVSFIQPTTALLQSHFFGQSNGVYSPY  429

Query  1385  FPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNF  1564
             FP  PL PFNYTGTPPNNT V N TKVVVLPFN +VELV+QDTSILGAESHPLHLHG+NF
Sbjct  430   FPISPLIPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNF  489

Query  1565  YVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHL  1744
             +VVGQGFGNFDP KDPAN+NLVDPVERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH 
Sbjct  490   FVVGQGFGNFDPNKDPANFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHT  549

Query  1745  SWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             SWGL+MAWIV +G+LPNQKLLPPP+DLPKC
Sbjct  550   SWGLKMAWIVLDGELPNQKLLPPPADLPKC  579



>ref|XP_009587566.1| PREDICTED: laccase-17-like [Nicotiana tomentosiformis]
Length=581

 Score =   900 bits (2325),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/586 (74%), Positives = 497/586 (85%), Gaps = 8/586 (1%)
 Frame = +2

Query  86    MGFLFHAFPPLL-AACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSI  262
             MGF    FP L+  A F +   +L   P  + A    +TRHY+FNI MQNVTRLCHTKSI
Sbjct  1     MGFS-STFPSLVPMAMFFIAFLALCLMPQPSQA----ITRHYEFNITMQNVTRLCHTKSI  55

Query  263   VTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQT  442
             VTVNGKFPGPRI+ REGDR+L+KV NHVPNN+SIHWHG+RQ+R+GWADGPAYITQCPIQT
Sbjct  56    VTVNGKFPGPRIITREGDRLLIKVNNHVPNNISIHWHGVRQLRSGWADGPAYITQCPIQT  115

Query  443   GQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEW  622
             GQ+YVYN+TIVGQRGTL+WHAHISWLR+TL+GP+IILP+KN SYPF KP KE+P+I GEW
Sbjct  116   GQSYVYNYTIVGQRGTLWWHAHISWLRSTLYGPLIILPKKNESYPFVKPFKEIPIILGEW  175

Query  623   WNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINA  802
             +N D E ++SQALQ GGGPN+SDAYTINGLPG LYNCSA +TFK+KVKPGKTYLLRMINA
Sbjct  176   FNADPETIISQALQTGGGPNVSDAYTINGLPGLLYNCSAKDTFKLKVKPGKTYLLRMINA  235

Query  803   ALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAA  982
             ALNDELFF IANHT+TVV+ADA YVKPFET+ +++ PGQT NVLLKTK   P +TF M A
Sbjct  236   ALNDELFFSIANHTLTVVDADAVYVKPFETETILVTPGQTTNVLLKTKPEYPSATFLMTA  295

Query  983   RPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTK-PIALPPLPPINGTSFVSNFTGKLRS  1159
             RPY TGQGTFDNSTVAG+LEYE P  + +K+  K P+  P LPP+N TSF +NF+ KLRS
Sbjct  296   RPYVTGQGTFDNSTVAGILEYESPIPHSTKSIKKLPLFKPTLPPLNDTSFATNFSKKLRS  355

Query  1160  LGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAI  1336
             L NSQFPA VPQ VDK+FFFTVGLGT PC KNQTCQGP N TKFAAS+NN+SFV PTTA+
Sbjct  356   LANSQFPAKVPQNVDKHFFFTVGLGTTPCDKNQTCQGPTNTTKFAASINNISFVQPTTAL  415

Query  1337  LQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTS  1516
             LQ+++  +SN VY+  FP  PL  FNYTG PPNNT V N TKV+VLPFN +VEL++QDTS
Sbjct  416   LQSHFMGQSNSVYSPYFPINPLNWFNYTGNPPNNTMVYNGTKVLVLPFNTSVELIMQDTS  475

Query  1517  ILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRA  1696
             ILGAESHPLHLHG+NF+V GQGFGNFDP KDPAN+NL+DPVERNT+GVPSGGW AIRF A
Sbjct  476   ILGAESHPLHLHGFNFFVAGQGFGNFDPNKDPANFNLIDPVERNTVGVPSGGWVAIRFLA  535

Query  1697  DNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             DNPGVWFMHCH EVH SWGL+MAW+V +GKLPNQKLLPPPSDLP+C
Sbjct  536   DNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQKLLPPPSDLPQC  581



>ref|XP_007022468.1| Laccase 17 [Theobroma cacao]
 gb|EOY13993.1| Laccase 17 [Theobroma cacao]
Length=577

 Score =   900 bits (2325),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/549 (77%), Positives = 489/549 (89%), Gaps = 3/549 (1%)
 Frame = +2

Query  194   VTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWH  373
             +TRHYKF+I++ NVTRL +TKSIV+VNG+FPGPRI+AREGD++L+KVVNHV NN+SIHWH
Sbjct  30    ITRHYKFDIKLHNVTRLRNTKSIVSVNGQFPGPRIVAREGDQLLIKVVNHVSNNISIHWH  89

Query  374   GIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIIL  553
             GIRQ+R+GWADGPAY+TQCP+QTGQ+YVYNFTIVGQRGTLFWHAHISWLRAT++GP++IL
Sbjct  90    GIRQLRSGWADGPAYVTQCPVQTGQSYVYNFTIVGQRGTLFWHAHISWLRATVYGPLVIL  149

Query  554   PRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNC  733
             P++   YPFPKP+KEVP+IFGEW+N D EAV+SQALQ GGGPN+SDAYTINGLPGPLYNC
Sbjct  150   PKRGVPYPFPKPYKEVPIIFGEWFNADPEAVISQALQTGGGPNVSDAYTINGLPGPLYNC  209

Query  734   SANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAP  913
             SA +TFK+KVKPG+TYLLR+INAALNDELFF IANHT+TVV+ DA YVKPFET+ L+I P
Sbjct  210   SAKDTFKLKVKPGRTYLLRLINAALNDELFFSIANHTLTVVDVDAIYVKPFETETLLITP  269

Query  914   GQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTK--P  1087
             GQT NVLLKTK + P +TFFM ARPY TGQGTFDNSTVAG+LEYE PS N   +S K  P
Sbjct  270   GQTTNVLLKTKPSYPSATFFMTARPYVTGQGTFDNSTVAGILEYESPS-NSFHSSIKMLP  328

Query  1088  IALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQ  1267
             +  P LP +N TSF +NF  KLRSL ++Q+PANVP+ VDK+FFFTVGLGT+ C +NQTCQ
Sbjct  329   LFKPILPALNDTSFATNFASKLRSLASAQYPANVPRKVDKHFFFTVGLGTSACQQNQTCQ  388

Query  1268  GPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQV  1447
             GPNGTKFAAS+NNVSF  PTTA+LQ+++  +SNGVY  DFP  P+ PFNYTGTPPNNT V
Sbjct  389   GPNGTKFAASVNNVSFTMPTTALLQSHFFGQSNGVYTPDFPINPIIPFNYTGTPPNNTMV  448

Query  1448  VNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNL  1627
              N TKVVVLPFN +VEL++QDTSILGAESHPLHLHG+NF+VVGQGFGNFDP KDPAN+NL
Sbjct  449   SNGTKVVVLPFNTSVELIMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDPANFNL  508

Query  1628  VDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLL  1807
             VDP+ERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH SWGL+MAWIV +GKLPNQKLL
Sbjct  509   VDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWIVLDGKLPNQKLL  568

Query  1808  PPPSDLPKC  1834
             PPP+DLPKC
Sbjct  569   PPPADLPKC  577



>gb|KDO73109.1| hypothetical protein CISIN_1g047497mg [Citrus sinensis]
Length=580

 Score =   899 bits (2324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/576 (74%), Positives = 498/576 (86%), Gaps = 4/576 (1%)
 Frame = +2

Query  116   LLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPR  295
             L +  FL ++ S      +A    G VTRHYKF+I++QNVTRLC+TKSI++VNGKFPGPR
Sbjct  6     LRSPAFLGVICSFVTLCLLAEPALG-VTRHYKFDIKLQNVTRLCNTKSIISVNGKFPGPR  64

Query  296   IMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIV  475
             I+AREGD++L+KV+NHV NN+SIHWHGIRQ+R+GWADGPAYITQCPIQTGQ+YVYNFTIV
Sbjct  65    IVAREGDQLLIKVMNHVQNNISIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNFTIV  124

Query  476   GQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQ  655
             GQRGTL+WHAH+SWLR+TL+GPIIILP++   YPF KP+KEVP+IFGEW+  D E ++SQ
Sbjct  125   GQRGTLWWHAHLSWLRSTLYGPIIILPKRGIPYPFTKPYKEVPIIFGEWFKADPETIISQ  184

Query  656   ALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIA  835
             ALQ GGGPN+SDAYTINGLPGPLYNCSA +TFK+KVKPGKTYLLR+INAALNDELFF IA
Sbjct  185   ALQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRLINAALNDELFFSIA  244

Query  836   NHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFD  1015
             NHT+TVVEADA YVKPFET+ L+IAPGQT NVLLKTK + P +TFFM ARPY TGQGTFD
Sbjct  245   NHTLTVVEADAIYVKPFETETLLIAPGQTTNVLLKTKPHYPSATFFMKARPYVTGQGTFD  304

Query  1016  NSTVAGVLEYEIP-SLNISKNSTK--PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPAN  1186
             NSTVAG+LEYE P + ++S NS K  P+  P LP +N TSF ++FT KLRSL ++QFPAN
Sbjct  305   NSTVAGILEYEKPLNFHLSSNSIKNLPLFKPVLPALNDTSFATSFTNKLRSLASTQFPAN  364

Query  1187  VPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSN  1366
             VPQ VD+ FFFTVGLGT+PC  NQTCQGPNGT F AS+NN+SFV PTTA+LQA+++ KS 
Sbjct  365   VPQNVDRRFFFTVGLGTSPCQSNQTCQGPNGTMFQASVNNISFVMPTTALLQAHFTGKSY  424

Query  1367  GVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLH  1546
             GVY  DFP+ PL  FNYTGTPPNNT V N TK+VVLPFN++VEL++QDTSILGAESHPLH
Sbjct  425   GVYNPDFPTSPLIAFNYTGTPPNNTMVSNGTKLVVLPFNSSVELIMQDTSILGAESHPLH  484

Query  1547  LHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHC  1726
             LHG+NF+VVGQGFGNFDP KDP  +NLVDPVERNT+GVPSGGW AIRF ADNPGVWFMHC
Sbjct  485   LHGFNFFVVGQGFGNFDPNKDPTKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHC  544

Query  1727  HFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             H EVH SWGL+MAWIV +GK PNQKL PPP+DLP+C
Sbjct  545   HLEVHTSWGLKMAWIVLDGKHPNQKLPPPPADLPQC  580



>ref|XP_003623041.1| Laccase [Medicago truncatula]
 ref|XP_003636576.1| Laccase [Medicago truncatula]
 gb|AES79259.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=581

 Score =   899 bits (2324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/583 (74%), Positives = 494/583 (85%), Gaps = 8/583 (1%)
 Frame = +2

Query  98    FHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNG  277
             F  F  L    F+  + +  FF  +A+A   S TRHY F+IR +NVTRLCH KS+VTVNG
Sbjct  3     FSLFSSLKIQVFIFSLINFGFF-EVALA---STTRHYHFDIRYENVTRLCHKKSMVTVNG  58

Query  278   KFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYV  457
             +FPGPRI+AREGDR+++KVVNHV NN+SIHWHGIRQ+++GWADGPAY+TQCPIQTGQ+YV
Sbjct  59    QFPGPRIVAREGDRLIIKVVNHVQNNISIHWHGIRQLQSGWADGPAYVTQCPIQTGQSYV  118

Query  458   YNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDT  637
             YN+TI GQRGTLFWHAHISWLR+TL+GP+IILP+KN  YPF KPHKEVP+IFGEW+N D 
Sbjct  119   YNYTIKGQRGTLFWHAHISWLRSTLYGPLIILPKKNVQYPFAKPHKEVPIIFGEWFNTDP  178

Query  638   EAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDE  817
             EA+++QALQ GGGPN+SDAYTINGLPGPLYNCSA +TFK+KVKP KTYLLR+INAALNDE
Sbjct  179   EAIIAQALQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVKPRKTYLLRLINAALNDE  238

Query  818   LFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFT  997
             LFF IANHT+TVVEADA Y KPF T+ ++IAPGQT NVLLKTK + P +TF M ARPY T
Sbjct  239   LFFSIANHTLTVVEADAVYAKPFVTNTILIAPGQTTNVLLKTKPHYPNATFLMLARPYAT  298

Query  998   GQGTFDNSTVAGVLEYEIPSLNISKNST---KPIALPPLPPINGTSFVSNFTGKLRSLGN  1168
             GQGTFDNSTVAG++EYEIP      NS+    P+  P LP +N TSF +NFT KL SL N
Sbjct  299   GQGTFDNSTVAGIIEYEIPFNTHHSNSSLKKLPLLKPILPQLNDTSFATNFTNKLHSLAN  358

Query  1169  SQFPANVPQTVDKNFFFTVGLGTNPCP-KNQTCQGPNGTKFAASLNNVSFVTPTTAILQA  1345
             +QFPANVPQ VDK+FFFTVGLGTNPC  KNQTCQGPNGT FAAS+NNVSF+ PTTA+LQ 
Sbjct  359   AQFPANVPQKVDKHFFFTVGLGTNPCQNKNQTCQGPNGTMFAASVNNVSFIMPTTALLQT  418

Query  1346  YYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILG  1525
             ++  ++NG+Y TDFPS P+ PFNYTGTPPNNT V N TKVVVLPFN +VELVLQDTSILG
Sbjct  419   HFFGQNNGIYTTDFPSKPMNPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVLQDTSILG  478

Query  1526  AESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNP  1705
              ESHPLHLHG+NF+VVGQGFGNFD   DP N+NLVDPVERNT+GVPSGGW AIRF ADNP
Sbjct  479   VESHPLHLHGFNFFVVGQGFGNFDSNSDPQNFNLVDPVERNTVGVPSGGWVAIRFLADNP  538

Query  1706  GVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             GVWFMHCH E+H SWGL+MAWIV +GKLPNQK+LPPP DLPKC
Sbjct  539   GVWFMHCHLEIHTSWGLKMAWIVLDGKLPNQKVLPPPVDLPKC  581



>gb|KHN24986.1| Laccase-17 [Glycine soja]
Length=579

 Score =   899 bits (2323),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/570 (74%), Positives = 495/570 (87%), Gaps = 7/570 (1%)
 Frame = +2

Query  137   MIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGD  316
             M++ S+   P +A+   G +TRHY F+I+ QNV+RLCHTKS+VTVNG+FPGPRI+AREGD
Sbjct  13    MLLFSMIIIPQLAL---GGITRHYHFDIKYQNVSRLCHTKSVVTVNGQFPGPRIVAREGD  69

Query  317   RVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLF  496
              +L+KV NHV NN+SIHWHGIRQ+R+GWADGPAY+TQCPIQTGQ+YVYN+T+VGQRGTL+
Sbjct  70    NLLIKVTNHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNYTVVGQRGTLW  129

Query  497   WHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGG  676
             WHAHISWLR+TL+GP+IILP+    YPF KP+KEVP+IFGEWWN D EAV++QALQ GGG
Sbjct  130   WHAHISWLRSTLYGPLIILPQYGVPYPFTKPYKEVPIIFGEWWNADPEAVITQALQTGGG  189

Query  677   PNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVV  856
             PN+SDAYTINGLPGPLYNCSA +TFK+KVKPGKTYLLR+INAALNDELFF IANHT+TVV
Sbjct  190   PNVSDAYTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTLTVV  249

Query  857   EADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGV  1036
             + DA YVKPF+TD ++IAPGQT N LLKTK + P +TF M+ARPY TGQGTFDNSTVA +
Sbjct  250   DVDAIYVKPFDTDTILIAPGQTSNGLLKTKSHYPNATFLMSARPYATGQGTFDNSTVAAI  309

Query  1037  LEYEI-PSLNISKNSTKPIAL--PPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDK  1207
             LEYE+ P    S  S K ++L  P LP +N TSF +NF+ KLRSL ++QFPANVPQ +DK
Sbjct  310   LEYEVSPHALHSTTSIKKLSLFKPILPALNDTSFATNFSNKLRSLASAQFPANVPQKIDK  369

Query  1208  NFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATD  1384
             +FFFTVGLGT PC +NQTCQGP N TKFAAS+NNVSF+ PTTA+LQ+++  +SNGVY+  
Sbjct  370   HFFFTVGLGTTPCSQNQTCQGPTNSTKFAASVNNVSFIQPTTALLQSHFFGQSNGVYSPY  429

Query  1385  FPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNF  1564
             FP  PL PFNYTGTPPNNT V N TKVVVLPFN +VELV+QDTSILGAESHPLHLHG+NF
Sbjct  430   FPISPLIPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNF  489

Query  1565  YVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHL  1744
             +VVGQGFGNFDP KDPAN+NLVDPVERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH 
Sbjct  490   FVVGQGFGNFDPNKDPANFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHT  549

Query  1745  SWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             SWGL+MAWIV +G+LPNQKLLPPP+DLPKC
Sbjct  550   SWGLKMAWIVLDGELPNQKLLPPPADLPKC  579



>ref|XP_006592189.1| PREDICTED: laccase-2-like isoform X1 [Glycine max]
 gb|KHN32142.1| Laccase-2 [Glycine soja]
Length=590

 Score =   899 bits (2323),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/579 (73%), Positives = 495/579 (85%), Gaps = 12/579 (2%)
 Frame = +2

Query  128   CFLMIMTSLFFFPHMAVA--KHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIM  301
              FL   + L+ FP  A+A  KHGSVTRHYKF+IR++N+TRLCHTKS+VTVNGKFPGPR++
Sbjct  14    AFLFATSFLWSFPEFALATSKHGSVTRHYKFDIRLRNITRLCHTKSMVTVNGKFPGPRVV  73

Query  302   AREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQ  481
             AREGDR++VKVVNHVPNNVSIHWHG+RQ+++GWADGP+YITQCPIQTGQ+YVYNFTIVGQ
Sbjct  74    AREGDRIVVKVVNHVPNNVSIHWHGVRQLQSGWADGPSYITQCPIQTGQSYVYNFTIVGQ  133

Query  482   RGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQAL  661
             RGTLFWHAHISWLRATL+GP+I+LPR+N SYPF KP+KEVP++FGEWWN D EAV++QAL
Sbjct  134   RGTLFWHAHISWLRATLYGPLILLPRRNESYPFEKPYKEVPILFGEWWNADPEAVIAQAL  193

Query  662   QNGGGPNISDAYTINGLPGPLYNCSANE------TFKVKVKPGKTYLLRMINAALNDELF  823
             Q G GPN+SDAYT NGLPGPLYNCS NE      TF++KVKPGKTYLLR+INAALNDELF
Sbjct  194   QTGAGPNVSDAYTFNGLPGPLYNCSNNETDTETDTFRLKVKPGKTYLLRLINAALNDELF  253

Query  824   FRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQ  1003
             F IANHT+  VEADA YVKPFE++++VI PGQT N LLKTK   P   F M ARPYFTG 
Sbjct  254   FSIANHTLVTVEADATYVKPFESEIIVIGPGQTSNFLLKTKPEYPNVNFLMLARPYFTGM  313

Query  1004  GTFDNSTVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPA  1183
             GTFDNSTVAG+LEY+ P   ++  +T P   P LP IN TSFV+NF+ K  SL   ++PA
Sbjct  314   GTFDNSTVAGILEYKKPL--VAPKNTIPTLKPSLPAINDTSFVANFSSKFLSLNTDKYPA  371

Query  1184  NVPQTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQA-YYSR  1357
              VPQTVDK+FFFT+GLGT+PCPKNQTCQGP N +KFAAS+NN+SF  P+ A+LQ  ++ +
Sbjct  372   KVPQTVDKSFFFTIGLGTSPCPKNQTCQGPNNSSKFAASMNNISFTLPSIALLQQHFFGQ  431

Query  1358  KSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESH  1537
              +NG+Y TDFP++PL PFNYTGTPPNNT+V N TK VV+PFN  V++VLQDTSILGAESH
Sbjct  432   ANNGIYTTDFPAMPLMPFNYTGTPPNNTRVSNGTKTVVIPFNTRVQVVLQDTSILGAESH  491

Query  1538  PLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWF  1717
             PLHLHG+NFYVVGQGFGNF+P  DP  +NLVDPVERNT+GVPSGGW AIRF ADNPGVW 
Sbjct  492   PLHLHGFNFYVVGQGFGNFNPNTDPPKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWL  551

Query  1718  MHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             MHCHF+VHLSWGLRMAWIV++GKLPNQKL PPP+DLPKC
Sbjct  552   MHCHFDVHLSWGLRMAWIVEDGKLPNQKLPPPPADLPKC  590



>ref|XP_006592190.1| PREDICTED: laccase-2-like isoform X2 [Glycine max]
Length=588

 Score =   899 bits (2322),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/577 (73%), Positives = 495/577 (86%), Gaps = 10/577 (2%)
 Frame = +2

Query  128   CFLMIMTSLFFFPHMAVA--KHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIM  301
              FL   + L+ FP  A+A  KHGSVTRHYKF+IR++N+TRLCHTKS+VTVNGKFPGPR++
Sbjct  14    AFLFATSFLWSFPEFALATSKHGSVTRHYKFDIRLRNITRLCHTKSMVTVNGKFPGPRVV  73

Query  302   AREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQ  481
             AREGDR++VKVVNHVPNNVSIHWHG+RQ+++GWADGP+YITQCPIQTGQ+YVYNFTIVGQ
Sbjct  74    AREGDRIVVKVVNHVPNNVSIHWHGVRQLQSGWADGPSYITQCPIQTGQSYVYNFTIVGQ  133

Query  482   RGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQAL  661
             RGTLFWHAHISWLRATL+GP+I+LPR+N SYPF KP+KEVP++FGEWWN D EAV++QAL
Sbjct  134   RGTLFWHAHISWLRATLYGPLILLPRRNESYPFEKPYKEVPILFGEWWNADPEAVIAQAL  193

Query  662   QNGGGPNISDAYTINGLPGPLYNCSAN----ETFKVKVKPGKTYLLRMINAALNDELFFR  829
             Q G GPN+SDAYT NGLPGPLYNCS N    +TF++KVKPGKTYLLR+INAALNDELFF 
Sbjct  194   QTGAGPNVSDAYTFNGLPGPLYNCSNNDTETDTFRLKVKPGKTYLLRLINAALNDELFFS  253

Query  830   IANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGT  1009
             IANHT+  VEADA YVKPFE++++VI PGQT N LLKTK   P   F M ARPYFTG GT
Sbjct  254   IANHTLVTVEADATYVKPFESEIIVIGPGQTSNFLLKTKPEYPNVNFLMLARPYFTGMGT  313

Query  1010  FDNSTVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANV  1189
             FDNSTVAG+LEY+ P   ++  +T P   P LP IN TSFV+NF+ K  SL   ++PA V
Sbjct  314   FDNSTVAGILEYKKPL--VAPKNTIPTLKPSLPAINDTSFVANFSSKFLSLNTDKYPAKV  371

Query  1190  PQTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQA-YYSRKS  1363
             PQTVDK+FFFT+GLGT+PCPKNQTCQGP N +KFAAS+NN+SF  P+ A+LQ  ++ + +
Sbjct  372   PQTVDKSFFFTIGLGTSPCPKNQTCQGPNNSSKFAASMNNISFTLPSIALLQQHFFGQAN  431

Query  1364  NGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPL  1543
             NG+Y TDFP++PL PFNYTGTPPNNT+V N TK VV+PFN  V++VLQDTSILGAESHPL
Sbjct  432   NGIYTTDFPAMPLMPFNYTGTPPNNTRVSNGTKTVVIPFNTRVQVVLQDTSILGAESHPL  491

Query  1544  HLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMH  1723
             HLHG+NFYVVGQGFGNF+P  DP  +NLVDPVERNT+GVPSGGW AIRF ADNPGVW MH
Sbjct  492   HLHGFNFYVVGQGFGNFNPNTDPPKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWLMH  551

Query  1724  CHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             CHF+VHLSWGLRMAWIV++GKLPNQKL PPP+DLPKC
Sbjct  552   CHFDVHLSWGLRMAWIVEDGKLPNQKLPPPPADLPKC  588



>ref|XP_008358049.1| PREDICTED: laccase-17-like [Malus domestica]
Length=583

 Score =   898 bits (2321),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/578 (74%), Positives = 489/578 (85%), Gaps = 7/578 (1%)
 Frame = +2

Query  113   PLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGP  292
             P L   FL  + +L   P  A+A   S+TRHYKF+I+ QNVTRLCHTKSIVTVNG+FPGP
Sbjct  9     PTLLRLFLFSLITLCLIPQHALA---SITRHYKFDIKHQNVTRLCHTKSIVTVNGQFPGP  65

Query  293   RIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTI  472
             RI+AREGD VL+KVVNHV NN+SIHWHGIRQ+R+GWADGPAY+TQCPIQ G  YVYNFTI
Sbjct  66    RIVAREGDHVLIKVVNHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQKGNNYVYNFTI  125

Query  473   VGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVS  652
              GQRGTLFWHAHISWLR+T++GP+IILP++   YPF KP+KEVP+IFGEWWNVDTEA++S
Sbjct  126   TGQRGTLFWHAHISWLRSTVYGPLIILPKRGVPYPFAKPYKEVPIIFGEWWNVDTEAIIS  185

Query  653   QALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRI  832
             QALQ GGGPN+S+AYTINGLPGPLYNCS  +TFK+KV+ GKTYLLR+INAALNDELFF I
Sbjct  186   QALQTGGGPNVSNAYTINGLPGPLYNCSVKDTFKLKVQSGKTYLLRLINAALNDELFFSI  245

Query  833   ANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTF  1012
             ANHT+ VVEADA YVKPFET+ ++IAPGQT NVLLKTK N P +TFFM ARPY TG GTF
Sbjct  246   ANHTLKVVEADAIYVKPFETNTILIAPGQTTNVLLKTKANFPNATFFMTARPYATGLGTF  305

Query  1013  DNSTVAGVLEYEIPSLNISKN---STKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPA  1183
             DNSTVA +LEYE PS  +         P+  P +P +N TSF + F+ KLRSL N+QFPA
Sbjct  306   DNSTVAAILEYESPSKTLHSTLPMKKLPLFKPFMPALNDTSFATKFSNKLRSLANAQFPA  365

Query  1184  NVPQTVDKNFFFTVGLGTNPCP-KNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRK  1360
             NVPQ VDK+FFFT+GLGTNPC   NQTCQGPNGT FAAS+NNVSF  PTTA+LQA+++ +
Sbjct  366   NVPQKVDKHFFFTIGLGTNPCSNSNQTCQGPNGTMFAASVNNVSFAMPTTALLQAHFTGQ  425

Query  1361  SNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHP  1540
             SNGVY+  FPS PL PFNYTGTPPNNT V N TK++VLPFN +VELV QDTSILG ESHP
Sbjct  426   SNGVYSPYFPSSPLIPFNYTGTPPNNTMVGNGTKLMVLPFNTSVELVXQDTSILGVESHP  485

Query  1541  LHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFM  1720
             LHLHG+NF+VVGQGFGNFD  KDPAN+NLVDP+ERNT+GVPSGGW AIRF ADNPGVWFM
Sbjct  486   LHLHGFNFFVVGQGFGNFDRNKDPANFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFM  545

Query  1721  HCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             HCH E+H SWGL+MAW+V +GKLPNQKLLPPP+DLP C
Sbjct  546   HCHLEIHTSWGLKMAWLVLDGKLPNQKLLPPPADLPTC  583



>ref|XP_008223967.1| PREDICTED: laccase-17, partial [Prunus mume]
Length=556

 Score =   898 bits (2321),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/553 (76%), Positives = 480/553 (87%), Gaps = 4/553 (1%)
 Frame = +2

Query  188   GSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIH  367
              S+TRHYKF I+ QNVTRLCHTKSIVTVNG+FPGPRI+AREGDR+L+KVVNHV +N+SIH
Sbjct  4     ASITRHYKFEIKQQNVTRLCHTKSIVTVNGQFPGPRIVAREGDRLLIKVVNHVQHNISIH  63

Query  368   WHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPII  547
             WHGIRQ+R GWADGPAY+TQCPIQTG +YVYNFTIVGQRGTL+WHAHISWLR+TLHGPI+
Sbjct  64    WHGIRQLRTGWADGPAYVTQCPIQTGNSYVYNFTIVGQRGTLWWHAHISWLRSTLHGPIV  123

Query  548   ILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLY  727
             ILP+    YPF KP+KEVP+IFGEWWN D EAV+ QALQ GGGPN+SDAYT NGLPGPLY
Sbjct  124   ILPKLGVPYPFTKPYKEVPIIFGEWWNADPEAVIKQALQTGGGPNVSDAYTFNGLPGPLY  183

Query  728   NCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVI  907
             NCSA + FK+KVK GKTYLLR+INAALNDELFF IANHT+ VV+ADA YVKPFETD ++I
Sbjct  184   NCSAKDAFKLKVKSGKTYLLRLINAALNDELFFSIANHTLKVVDADAVYVKPFETDTILI  243

Query  908   APGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISKN---S  1078
              PGQT NVLLKTK + P +TFFM ARPY TG GTFDNSTVAG+LEYE PS  +       
Sbjct  244   TPGQTTNVLLKTKPHFPNATFFMTARPYVTGLGTFDNSTVAGILEYESPSKTLHSTLPMK  303

Query  1079  TKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPK-N  1255
               P+  P LP +N TSF + F+ KLRSL N+QFPANVPQ VDK+FFFTVGLGTNPC K N
Sbjct  304   KLPLFKPILPALNDTSFATKFSKKLRSLANAQFPANVPQKVDKHFFFTVGLGTNPCNKHN  363

Query  1256  QTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPN  1435
             QTCQGPNGT FAAS+NNVSFV PTTA+LQA++S +SN VY+++FPS P+ PFNYTGTPPN
Sbjct  364   QTCQGPNGTMFAASVNNVSFVMPTTALLQAHFSGQSNRVYSSNFPSSPVIPFNYTGTPPN  423

Query  1436  NTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPA  1615
             NT V N TK+VVLPFN +VEL++QDTSILGAESHPLHLHGYNF+VVGQGFGNFD  KDPA
Sbjct  424   NTMVSNGTKLVVLPFNTSVELIMQDTSILGAESHPLHLHGYNFFVVGQGFGNFDQNKDPA  483

Query  1616  NYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPN  1795
             N+NLVDPVERNT+GVPSGGW AIRF ADNPGVWFMHCH E+H SWGL+MAW+V +GKLPN
Sbjct  484   NFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEIHTSWGLKMAWVVLDGKLPN  543

Query  1796  QKLLPPPSDLPKC  1834
             QKLLPPP+DLP C
Sbjct  544   QKLLPPPADLPTC  556



>ref|XP_011094888.1| PREDICTED: laccase-17-like [Sesamum indicum]
Length=578

 Score =   898 bits (2320),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/574 (73%), Positives = 491/574 (86%), Gaps = 5/574 (1%)
 Frame = +2

Query  116   LLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPR  295
             L++  F +   +L   P    A     TRHY FNI+MQNVTRLCHTKSIVTVNG+FPGPR
Sbjct  9     LVSMGFFVAFMALCLLPQPVQA----ATRHYHFNIKMQNVTRLCHTKSIVTVNGQFPGPR  64

Query  296   IMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIV  475
             ++AREGDR+L+KV NHV NN++IHWHGIRQ+R+GWADGPAYITQCPIQTGQ+YVYNFT+V
Sbjct  65    VVAREGDRLLIKVTNHVSNNITIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNFTVV  124

Query  476   GQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQ  655
             GQRGTLFWHAHISWLR+T++GP+IILP+KN  YPF KP+KEVP+IFGEW+N DTEA++SQ
Sbjct  125   GQRGTLFWHAHISWLRSTVYGPLIILPKKNVPYPFEKPYKEVPIIFGEWFNADTEAIISQ  184

Query  656   ALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIA  835
             ALQ GGGPN+SDAYTINGLPGPLYNCSA +TFK+KVKPGKTYLLRMINAALNDELFF IA
Sbjct  185   ALQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRMINAALNDELFFSIA  244

Query  836   NHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFD  1015
             NH++TVV+ADA YVKPFETD ++I PGQT NVLLKTK   P +TF M ARPY TGQGTFD
Sbjct  245   NHSLTVVDADAIYVKPFETDTILITPGQTTNVLLKTKPKFPGATFLMTARPYVTGQGTFD  304

Query  1016  NSTVAGVLEYEIPSLNISKNSTK-PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVP  1192
             NSTVAG+LEY+ P  + + +  K P+  P LP +N T F +NF+ KLRSL   QFPANVP
Sbjct  305   NSTVAGILEYQAPLRHSALSMKKLPLYKPILPALNDTMFATNFSKKLRSLATPQFPANVP  364

Query  1193  QTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGV  1372
             Q VDK FFFTVGLGT+PC KN+TCQGPNGTKFAA+++N+SFV PTTA+LQA+Y+ +S+GV
Sbjct  365   QKVDKQFFFTVGLGTHPCDKNRTCQGPNGTKFAAAVSNISFVQPTTALLQAHYTGQSSGV  424

Query  1373  YATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLH  1552
             Y+ DFP  P   FNYTG PPNNT V N TK++VLPFN +VELVLQDTSILGAESHPLHLH
Sbjct  425   YSPDFPISPFHWFNYTGNPPNNTMVANGTKLMVLPFNTSVELVLQDTSILGAESHPLHLH  484

Query  1553  GYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHF  1732
             G+NF++VGQGFGN+DP  D  N+NLVDP+ERNT+GVP+GGW AIRF ADNPGVWFMHCH 
Sbjct  485   GFNFFIVGQGFGNYDPNTDLKNFNLVDPIERNTVGVPAGGWVAIRFLADNPGVWFMHCHL  544

Query  1733  EVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             EVH SWGL+MAW+V +GKLPNQKLLPPP+DLPKC
Sbjct  545   EVHTSWGLKMAWLVLDGKLPNQKLLPPPADLPKC  578



>gb|KEH22816.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=580

 Score =   898 bits (2320),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/568 (75%), Positives = 490/568 (86%), Gaps = 4/568 (1%)
 Frame = +2

Query  140   IMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDR  319
             +  SL  F     A  G+ TRHY+F+I  QNVTRLCH K +VTVNG+FPGPRIMAREGDR
Sbjct  14    LFLSLINFCAFEFALAGT-TRHYQFDIGYQNVTRLCHNKRMVTVNGQFPGPRIMAREGDR  72

Query  320   VLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFW  499
             +++KVVN+V NN+SIHWHGIRQ+++GWADGPAY+TQCPIQTGQ+YVYN+TI GQRGTLFW
Sbjct  73    LVIKVVNNVQNNISIHWHGIRQLQSGWADGPAYVTQCPIQTGQSYVYNYTIKGQRGTLFW  132

Query  500   HAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGP  679
             HAHISWLR+TL+GP+IILP+KN  YPF KPHKEVPMIFGEW+N DTEA+++QALQ GGGP
Sbjct  133   HAHISWLRSTLYGPLIILPKKNVPYPFAKPHKEVPMIFGEWFNADTEAIIAQALQTGGGP  192

Query  680   NISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVE  859
             N+S+AYTINGLPGPLYNCS  +TFK+KVKPGKTYLLR+INAALNDELFF +ANHT+ VVE
Sbjct  193   NVSEAYTINGLPGPLYNCSKKDTFKLKVKPGKTYLLRLINAALNDELFFSVANHTLKVVE  252

Query  860   ADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVL  1039
             ADA YVKPFET+ ++IAPGQT NVLLKTK + P + F M+ARPY TGQGTFDN+TVAG+L
Sbjct  253   ADAIYVKPFETNTILIAPGQTTNVLLKTKSHYPNAAFLMSARPYATGQGTFDNTTVAGIL  312

Query  1040  EYEIPS-LNISKNSTKPIAL--PPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKN  1210
             EYEIPS  + S +S K I L  P LP +N TSF + F+ KLRSL + QFPANVPQ VDK+
Sbjct  313   EYEIPSNTHHSASSLKKIPLFKPTLPALNDTSFATKFSKKLRSLASPQFPANVPQKVDKH  372

Query  1211  FFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFP  1390
             FFFTVGLGTNPC  NQTCQGPNGT FAAS+NNVSF  PTTA+LQ++++ +S GVYA  FP
Sbjct  373   FFFTVGLGTNPCQSNQTCQGPNGTMFAASVNNVSFTMPTTALLQSHFTGQSRGVYAPYFP  432

Query  1391  SVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYV  1570
             S PL PFNYTGTPPNNT V N TKV VLPFN +VELV+QDTSILGAESHPLHLHG+NF+V
Sbjct  433   SSPLHPFNYTGTPPNNTMVSNGTKVTVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFV  492

Query  1571  VGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSW  1750
             VGQGFGN+D  KDP N+NLVDPVERNTIGVPSGGW AIRF ADNPGVWFMHCH EVH SW
Sbjct  493   VGQGFGNYDSNKDPKNFNLVDPVERNTIGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSW  552

Query  1751  GLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             GL+MAWIV +GKLPNQKLLPPP+DLPKC
Sbjct  553   GLKMAWIVLDGKLPNQKLLPPPADLPKC  580



>gb|KDO73032.1| hypothetical protein CISIN_1g008109mg [Citrus sinensis]
Length=577

 Score =   897 bits (2317),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/552 (76%), Positives = 490/552 (89%), Gaps = 5/552 (1%)
 Frame = +2

Query  191   SVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHW  370
             ++TRHYKFN+ ++NVTRLCHTK++V+VNG+FPGPRI+AREGDR+L+KVVNHV +N+SIHW
Sbjct  27    AITRHYKFNVELKNVTRLCHTKTLVSVNGQFPGPRIVAREGDRLLIKVVNHVQHNISIHW  86

Query  371   HGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIII  550
             HGIRQ+R+GWADGPAYITQCPIQTGQ+Y+YNFTIVGQRGTL+WHAHISWLR+TL+GPIII
Sbjct  87    HGIRQLRSGWADGPAYITQCPIQTGQSYIYNFTIVGQRGTLWWHAHISWLRSTLYGPIII  146

Query  551   LPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYN  730
             LP++   YPF KP+KEVP++FGEW+  DTEA+++QALQ GGGPN+SDAYT NGLPGPLYN
Sbjct  147   LPKRGIPYPFAKPYKEVPIVFGEWFKSDTEAIINQALQTGGGPNVSDAYTFNGLPGPLYN  206

Query  731   CSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIA  910
             CSA +TFK+KVK GKTYLLR++N+ALND+LFF IANHT+TVVE DA YVKPFET+ LVI 
Sbjct  207   CSAKDTFKLKVKSGKTYLLRLVNSALNDDLFFSIANHTLTVVEVDAVYVKPFETETLVIT  266

Query  911   PGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNI--SKNSTK  1084
             PGQT NVLL+TK + P +TFFM ARPY TG GTFDNSTVAG+LEYE P LN   S NS K
Sbjct  267   PGQTTNVLLETKPHYPSATFFMTARPYVTGLGTFDNSTVAGILEYEKP-LNFIHSGNSIK  325

Query  1085  --PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQ  1258
               P+  P LPP+N T+FV+NF  KLRSLG++QFPANVPQ VDK FFFTVGLGT+PCP+NQ
Sbjct  326   KLPLFKPILPPLNDTNFVTNFVNKLRSLGSAQFPANVPQNVDKRFFFTVGLGTSPCPRNQ  385

Query  1259  TCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNN  1438
             TCQGPNGT F AS+NN+SFV PTTA+LQA+++ +SNGVY  DFP+ PL PFNYTG PPNN
Sbjct  386   TCQGPNGTMFEASINNISFVMPTTALLQAHFTGQSNGVYVPDFPTSPLIPFNYTGNPPNN  445

Query  1439  TQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPAN  1618
             T V + TK+VVLPFN +VEL++QDTSILGAE+HPLHLHGYNF+VVGQGFGNFDP KDPA 
Sbjct  446   TMVSSGTKLVVLPFNTSVELIMQDTSILGAENHPLHLHGYNFFVVGQGFGNFDPNKDPAK  505

Query  1619  YNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQ  1798
             +NLVDP+ERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH SWGL+ AW+V +GKLPNQ
Sbjct  506   FNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKTAWLVLDGKLPNQ  565

Query  1799  KLLPPPSDLPKC  1834
             KLLPPP+DLPKC
Sbjct  566   KLLPPPADLPKC  577



>ref|XP_002278232.1| PREDICTED: laccase-17-like [Vitis vinifera]
Length=583

 Score =   897 bits (2317),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/572 (77%), Positives = 500/572 (87%), Gaps = 7/572 (1%)
 Frame = +2

Query  131   FLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
               +++ SL+ FP +A A    +TRHYKFNI++QNVTRLCHTK+IV+VNG+FPGPRI+ARE
Sbjct  15    LFLVLNSLWLFPELASA---GITRHYKFNIKLQNVTRLCHTKNIVSVNGQFPGPRIIARE  71

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GDRV+V VVNHVPNNV+IHWHG+RQ+R+GWADGPAY+TQCPIQTGQTYVYNFTI GQRGT
Sbjct  72    GDRVVVNVVNHVPNNVTIHWHGVRQLRSGWADGPAYVTQCPIQTGQTYVYNFTITGQRGT  131

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             LFWHAHISWLR+T++GPIIILP+KN  YPF KP+KEVP+IFGEWWN D EAV++QALQNG
Sbjct  132   LFWHAHISWLRSTVYGPIIILPKKNVPYPFVKPYKEVPIIFGEWWNADPEAVITQALQNG  191

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
             GGPN+SDAYTINGLPGPLYNCSA +TFK+KVKPGKTYLLR+INAALNDELFF IANHT+T
Sbjct  192   GGPNVSDAYTINGLPGPLYNCSAQDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTLT  251

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VV+ DA YVKPF+TD ++I PGQT N+LLK K + P +TF MAARPY TG+GTFDNSTVA
Sbjct  252   VVDVDAIYVKPFKTDTILITPGQTTNLLLKAKPHFPNATFLMAARPYATGRGTFDNSTVA  311

Query  1031  GVLEYEIP---SLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTV  1201
             G+L YE P   S + S     P+  P LPP+N TSF +NFT KLRSL NSQFPANVP+ V
Sbjct  312   GLLHYEPPQKSSPSASSFKNLPVFKPTLPPLNDTSFAANFTRKLRSLANSQFPANVPKKV  371

Query  1202  DKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYA  1378
             DK FFFTVGLGT+PCP+NQTCQGP N TKF+AS+NNVSFV PTTAILQA++ ++SNGVY 
Sbjct  372   DKRFFFTVGLGTSPCPQNQTCQGPNNSTKFSASVNNVSFVLPTTAILQAHFFQQSNGVYT  431

Query  1379  TDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGY  1558
             TDFP+ P+ PFNYTGTPPNNT   N TKVVVLPFN TVELVLQDTSILG ESHPLHLHG+
Sbjct  432   TDFPATPIFPFNYTGTPPNNTMASNGTKVVVLPFNTTVELVLQDTSILGIESHPLHLHGF  491

Query  1559  NFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEV  1738
             NF+VVGQGFGNFD KKDP  +NLVDPVERNT+GVPSGGW AIRF ADNPGVWFMHCH EV
Sbjct  492   NFFVVGQGFGNFDSKKDPPKFNLVDPVERNTVGVPSGGWVAIRFVADNPGVWFMHCHLEV  551

Query  1739  HLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             H SWGL+MAWIVK+GKLPNQKL PPPSDLP+C
Sbjct  552   HTSWGLKMAWIVKDGKLPNQKLPPPPSDLPQC  583



>ref|XP_011042451.1| PREDICTED: laccase-17-like [Populus euphratica]
Length=581

 Score =   896 bits (2315),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/577 (75%), Positives = 501/577 (87%), Gaps = 7/577 (1%)
 Frame = +2

Query  113   PLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGP  292
             P   A FL+   +L   P  A+A    +TRHYKF++ +QNVTRLCHTKSIVTVNGKFPGP
Sbjct  9     PAFLAVFLISFVTLSIHPEPALA----ITRHYKFDVMLQNVTRLCHTKSIVTVNGKFPGP  64

Query  293   RIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTI  472
             RI+AREGDR+++KVVNHV NN+SIHWHGIRQ+R+GWADGPAYITQCPIQTGQ+YVYN+T 
Sbjct  65    RIVAREGDRLIIKVVNHVQNNISIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTT  124

Query  473   VGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVS  652
             VGQRGTL+WHAHISWLR+TLHGP+IILP+  T+YPF KPHKEVP+IFGEW+N D EA+++
Sbjct  125   VGQRGTLWWHAHISWLRSTLHGPLIILPKLGTTYPFAKPHKEVPIIFGEWFNADPEAIIT  184

Query  653   QALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRI  832
             QA+Q GGGPN+SDAYTING PGPLYNCSA +TFK+KVKPGKTYLLRMINAALNDELFF I
Sbjct  185   QAMQTGGGPNVSDAYTINGFPGPLYNCSAKDTFKLKVKPGKTYLLRMINAALNDELFFSI  244

Query  833   ANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTF  1012
             ANHT+TVV+ DA YVKPF+T+ L+IAPGQT NVLLKTK + P ++FFM+ARPY TGQGTF
Sbjct  245   ANHTLTVVDVDAIYVKPFDTETLLIAPGQTTNVLLKTKPHHPNASFFMSARPYVTGQGTF  304

Query  1013  DNSTVAGVLEYEIPSLNI-SKNSTK--PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPA  1183
             DNSTVAG+LEYE  +  I S +S K  P+  P LPP+  TSF +NFT KLRSL +++FPA
Sbjct  305   DNSTVAGILEYEESNKTIKSSHSPKKLPLYKPNLPPLTDTSFATNFTSKLRSLASAEFPA  364

Query  1184  NVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKS  1363
             NVP+ VD+ FFF+VGLGTNPC KNQTCQGPNGT FAAS+NNVSFV PT A+LQA++  +S
Sbjct  365   NVPRKVDRQFFFSVGLGTNPCSKNQTCQGPNGTMFAASVNNVSFVMPTKALLQAHHFGQS  424

Query  1364  NGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPL  1543
              GVY+ +FP  P  PFNYTGTPPNNT V N TK+VVLPFNA+VEL++QDTSILGAESHPL
Sbjct  425   KGVYSPNFPINPPIPFNYTGTPPNNTMVNNGTKLVVLPFNASVELIMQDTSILGAESHPL  484

Query  1544  HLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMH  1723
             HLHG+NF+VVGQGFGNFD KKDPAN+NLVDPVERNT+GVPSGGW AIRF ADNPGVWFMH
Sbjct  485   HLHGFNFFVVGQGFGNFDAKKDPANFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMH  544

Query  1724  CHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             CH EVH SWGL+MAW+V +GKLPNQKLLPPP+DLPKC
Sbjct  545   CHLEVHTSWGLKMAWVVLDGKLPNQKLLPPPADLPKC  581



>ref|XP_002271047.2| PREDICTED: laccase-17 [Vitis vinifera]
Length=611

 Score =   896 bits (2315),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/588 (72%), Positives = 491/588 (84%), Gaps = 5/588 (1%)
 Frame = +2

Query  83    IMGFLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSI  262
             IMG +F    P +   FL  + +    P +A+AK   +TR YKF+I++  +TRLCHTK +
Sbjct  25    IMG-VFPFSSPAIVGVFLFALITSSLLPELALAKDAGITRRYKFDIKLVRMTRLCHTKGV  83

Query  263   VTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQT  442
             +TVNGKFPGP +  REGD +LV+VVNHV NN+SIHWHGIRQ+R+GWADGPAYITQCPI+T
Sbjct  84    ITVNGKFPGPLVTVREGDNLLVEVVNHVQNNISIHWHGIRQLRSGWADGPAYITQCPIRT  143

Query  443   GQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEW  622
             GQ Y+YNFT+ GQRGTLFWHAHISW+RAT+HGP+IILP+ N  YPF  P+KEVP+IFGEW
Sbjct  144   GQRYMYNFTVSGQRGTLFWHAHISWIRATVHGPLIILPKPNVPYPFGNPYKEVPIIFGEW  203

Query  623   WNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINA  802
             WNVD EAV+SQALQ G GPN+SDAYTINGLPGPLYNCSA +TFK+KVKP KTYLLR+INA
Sbjct  204   WNVDPEAVISQALQTGAGPNVSDAYTINGLPGPLYNCSAKDTFKLKVKPAKTYLLRLINA  263

Query  803   ALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAA  982
             A++DELFF IANHT+TVVE DA YVKPF+TD L+I PGQT NVLLKTK   P + FFM A
Sbjct  264   AVDDELFFSIANHTITVVEVDAVYVKPFDTDTLLITPGQTTNVLLKTKPYFPKANFFMYA  323

Query  983   RPYFTGQGTFDNSTVAGVLEYEIPSLN-ISKNSTK--PIALPPLPPINGTSFVSNFTGKL  1153
             RPY TGQGTFDNSTVAG+LEYE+ + +  +  STK  P   P LPP N TSF SNF+ K+
Sbjct  324   RPYATGQGTFDNSTVAGILEYELSNFSPFNSTSTKNLPFFKPALPPFNDTSFASNFSRKI  383

Query  1154  RSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNG-TKFAASLNNVSFVTPTT  1330
             RSL ++QFPA VPQ V++ FFFTVGLGTNPCP+NQTCQGPN  TKF+AS+NNVSFV PTT
Sbjct  384   RSLASAQFPAKVPQKVERRFFFTVGLGTNPCPRNQTCQGPNNRTKFSASINNVSFVLPTT  443

Query  1331  AILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQD  1510
             AILQAY+  +SNGVY TDFP+ P+TPFNYTG PPNNT V N TK VVLP+N +VELV+QD
Sbjct  444   AILQAYFFGQSNGVYTTDFPNNPITPFNYTGNPPNNTMVSNGTKAVVLPYNTSVELVMQD  503

Query  1511  TSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRF  1690
             TSILGAESHPLHLHG+NF+VVGQGFGN+DP KDPA +NLVDP+ERNT+GVPSGGW AIRF
Sbjct  504   TSILGAESHPLHLHGFNFFVVGQGFGNYDPNKDPAKFNLVDPIERNTVGVPSGGWVAIRF  563

Query  1691  RADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
              ADNPGVWFMHCH EVH SWGL+M WIV EGKLPNQKL PPPSDLP C
Sbjct  564   LADNPGVWFMHCHLEVHTSWGLKMVWIVLEGKLPNQKLPPPPSDLPTC  611



>ref|XP_008385215.1| PREDICTED: laccase-17-like [Malus domestica]
Length=583

 Score =   895 bits (2314),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/578 (73%), Positives = 490/578 (85%), Gaps = 7/578 (1%)
 Frame = +2

Query  113   PLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGP  292
             P     FL+ + +L   P    A   S+TRHYKF+I+ QNVTRLCHTKSIVTVNG+FPGP
Sbjct  9     PEFLRLFLLSLITLCLIPQHVFA---SITRHYKFDIKQQNVTRLCHTKSIVTVNGQFPGP  65

Query  293   RIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTI  472
             +I+AREGDRVL+KVVNHV NN+SIHWHGIRQ+R+GWADGPAY+TQCPIQ+G +YVYNFTI
Sbjct  66    QIVAREGDRVLIKVVNHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQSGNSYVYNFTI  125

Query  473   VGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVS  652
              GQRGTLFWHAHISWLR+T++GP+IILP++   YPF KP+KEVP+IFGEWWN D EAV+S
Sbjct  126   TGQRGTLFWHAHISWLRSTVYGPLIILPKRGVPYPFAKPYKEVPIIFGEWWNADPEAVIS  185

Query  653   QALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRI  832
             QALQ GGGPN+SDAYT NGLPGPLYNCSA + FK+KV+ GKTYLLR+INAALNDELFF I
Sbjct  186   QALQTGGGPNVSDAYTFNGLPGPLYNCSAKDAFKLKVRSGKTYLLRLINAALNDELFFSI  245

Query  833   ANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTF  1012
             ANHT+ VVEADA YVKPF+TD ++IAPGQT NVLLKTK + P +TFFM ARPY TG GTF
Sbjct  246   ANHTLKVVEADAIYVKPFDTDTVLIAPGQTTNVLLKTKPHFPSATFFMTARPYVTGLGTF  305

Query  1013  DNSTVAGVLEYEIPSLNISKN---STKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPA  1183
             DNSTVAG+LEYE  S  +         P+  P LP +N TSF + F+ KLRSL N+QFPA
Sbjct  306   DNSTVAGILEYESTSKALHTTLPMKKLPLFKPILPALNDTSFATKFSNKLRSLANAQFPA  365

Query  1184  NVPQTVDKNFFFTVGLGTNPCPK-NQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRK  1360
             NVPQ VD++FFFT+GLGTNPC   NQTCQGPNGT FAAS+NNVSF  PTTA+LQA++S +
Sbjct  366   NVPQKVDRHFFFTIGLGTNPCSSNNQTCQGPNGTMFAASVNNVSFAMPTTALLQAHFSGQ  425

Query  1361  SNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHP  1540
             SNGVY+ DFPS P+ PFNYTGTPPN+T V N TK++VLP+N +VELV+QDTSILGAESHP
Sbjct  426   SNGVYSPDFPSSPIIPFNYTGTPPNDTMVGNGTKLMVLPYNTSVELVMQDTSILGAESHP  485

Query  1541  LHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFM  1720
             LHLHG+NF+VVGQGFGNFD  KDPAN+NLVDPVERNT+GVPSGGW AIRF ADNPGVWFM
Sbjct  486   LHLHGFNFFVVGQGFGNFDRNKDPANFNLVDPVERNTVGVPSGGWVAIRFVADNPGVWFM  545

Query  1721  HCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             HCH E+H SWGL+MAW+V +GKLPNQ+LLPPP+DLP C
Sbjct  546   HCHLEIHTSWGLKMAWLVLDGKLPNQRLLPPPADLPTC  583



>ref|XP_006424707.1| hypothetical protein CICLE_v10028090mg [Citrus clementina]
 ref|XP_006488221.1| PREDICTED: laccase-17-like [Citrus sinensis]
 gb|ESR37947.1| hypothetical protein CICLE_v10028090mg [Citrus clementina]
Length=577

 Score =   895 bits (2314),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/552 (75%), Positives = 489/552 (89%), Gaps = 5/552 (1%)
 Frame = +2

Query  191   SVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHW  370
             ++TRHYKFN+ ++NVTRLCHTK++V+VNG+FPGPRI+AREGDR+L+KVVNHV +N+SIHW
Sbjct  27    AITRHYKFNVELKNVTRLCHTKTLVSVNGQFPGPRIVAREGDRLLIKVVNHVQHNISIHW  86

Query  371   HGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIII  550
             HGIRQ+R+GWADGPAYITQCPIQTGQ+Y+YNFTIVGQRGTL+WHAHISWLR+TL+GPIII
Sbjct  87    HGIRQLRSGWADGPAYITQCPIQTGQSYIYNFTIVGQRGTLWWHAHISWLRSTLYGPIII  146

Query  551   LPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYN  730
             LP++   YPF KP+KEVP++FGEW+  DTEA+++QALQ GGGPN+SDAYT NGLPGPLYN
Sbjct  147   LPKRGIPYPFAKPYKEVPIVFGEWFKSDTEAIINQALQTGGGPNVSDAYTFNGLPGPLYN  206

Query  731   CSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIA  910
             CSA + FK+KVK GKTYLLR++N+ALND+LFF IANHT+TVVE DA YVKPFET+ LVI 
Sbjct  207   CSAKDAFKLKVKSGKTYLLRLVNSALNDDLFFSIANHTLTVVEVDAVYVKPFETETLVIT  266

Query  911   PGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNI--SKNSTK  1084
             PGQT NVLL+TK + P +TFFM ARPY TG GTFDNSTVAG+LEYE P LN   S NS K
Sbjct  267   PGQTTNVLLETKPHYPSATFFMTARPYVTGLGTFDNSTVAGILEYEKP-LNFIHSGNSIK  325

Query  1085  --PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQ  1258
               P+  P LPP+N T+FV+NF  KLRSLG++QFPANVPQ VDK FFFTVGLGT+PCP+NQ
Sbjct  326   KLPLFKPILPPLNDTNFVTNFVNKLRSLGSAQFPANVPQNVDKRFFFTVGLGTSPCPRNQ  385

Query  1259  TCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNN  1438
             TCQGPNGT F AS+NN+SFV PTTA+LQA+++ +SNGVY  DFP+ PL PFNYTG PPNN
Sbjct  386   TCQGPNGTMFEASINNISFVMPTTALLQAHFTGQSNGVYVPDFPTSPLIPFNYTGNPPNN  445

Query  1439  TQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPAN  1618
             T V + TK+VVLPFN +VEL++QDTSILGAE+HPLHLHGYNF+VVGQGFGNFDP KDPA 
Sbjct  446   TMVSSGTKLVVLPFNTSVELIMQDTSILGAENHPLHLHGYNFFVVGQGFGNFDPNKDPAK  505

Query  1619  YNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQ  1798
             +NLVDP+ERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH SWGL+ AW+V +GKLPNQ
Sbjct  506   FNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKTAWLVLDGKLPNQ  565

Query  1799  KLLPPPSDLPKC  1834
             KLLPPP+DLPKC
Sbjct  566   KLLPPPADLPKC  577



>ref|XP_010920538.1| PREDICTED: laccase-4-like [Elaeis guineensis]
Length=584

 Score =   895 bits (2313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/584 (72%), Positives = 491/584 (84%), Gaps = 4/584 (1%)
 Frame = +2

Query  89    GFLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVT  268
              FL H+    LA   L   ++L  FP +  A+   +TRHYKF+I+M NVTRLCHTKS+VT
Sbjct  3     AFLLHS--RALAGALLFAFSTLLLFPELPCAQQNGITRHYKFDIQMTNVTRLCHTKSMVT  60

Query  269   VNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQ  448
             VNG++PGPRI+AREGDRV+VKVVNHV +NVSIHWHG+RQ+R+GWADGPAY+ QCPIQTG 
Sbjct  61    VNGQYPGPRIVAREGDRVIVKVVNHVQSNVSIHWHGVRQLRSGWADGPAYVAQCPIQTGH  120

Query  449   TYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWN  628
             +YVYNFTIV QRGTLFWHAHISWLRATL+GPIIILP++   YPF KP+KEVPMIFGEWWN
Sbjct  121   SYVYNFTIVAQRGTLFWHAHISWLRATLYGPIIILPKRGVPYPFAKPYKEVPMIFGEWWN  180

Query  629   VDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAAL  808
              DTEAV++QALQ GGGPN+SDAYTINGLPGPLYNCSA +TFK++VKPG+TYLLR+INAAL
Sbjct  181   ADTEAVINQALQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLRVKPGRTYLLRIINAAL  240

Query  809   NDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARP  988
             NDELFF IANHT+T+VE DA YVKPF+T+ L+I PGQT NVLL TK   P +TF M ARP
Sbjct  241   NDELFFSIANHTLTIVEVDAVYVKPFDTNTLIITPGQTTNVLLHTKPTFPGATFLMLARP  300

Query  989   YFTGQGTFDNSTVAGVLEYEIPSLNISKNSTK--PIALPPLPPINGTSFVSNFTGKLRSL  1162
             Y TGQGTFDNST AG+LEY+  + + S + +K  P+  P LP +N T FV++FT KLRSL
Sbjct  301   YATGQGTFDNSTTAGILEYQHSNASSSPSFSKKLPLFKPSLPSLNDTKFVADFTRKLRSL  360

Query  1163  GNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQ  1342
               +Q+PA VPQT+D+ FFFTVGLGT+PCPKNQTCQGPNGTKFAA++NNVSF  PTTA+LQ
Sbjct  361   ATTQYPAKVPQTIDRRFFFTVGLGTSPCPKNQTCQGPNGTKFAATVNNVSFSMPTTALLQ  420

Query  1343  AYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSIL  1522
             A++  +S GVY  DFP +PL P NYTG PPNNT V N T++VVLPFN +VELV+QDTSIL
Sbjct  421   AHFFGQSKGVYTPDFPIIPLMPLNYTGAPPNNTLVSNGTRLVVLPFNTSVELVMQDTSIL  480

Query  1523  GAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADN  1702
             G ESHPLHLHG+NF+VVGQGFGN DP+KDPA +NLVDPVERNT+ VP GGW AIRF ADN
Sbjct  481   GNESHPLHLHGFNFFVVGQGFGNHDPEKDPAKFNLVDPVERNTVSVPPGGWVAIRFLADN  540

Query  1703  PGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             PGVWFMHCH EVH SWGL+MAW+V +G LPNQKL PPPSDLPKC
Sbjct  541   PGVWFMHCHLEVHTSWGLKMAWLVLDGNLPNQKLPPPPSDLPKC  584



>ref|XP_010690891.1| PREDICTED: laccase-17-like [Beta vulgaris subsp. vulgaris]
Length=582

 Score =   895 bits (2313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/577 (74%), Positives = 492/577 (85%), Gaps = 10/577 (2%)
 Frame = +2

Query  131   FLMIMTSLFFF---PHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIM  301
             FL+ + S+  F    ++A A +  +TRHYKFN+++QNVTRLCHTKSIVTVNG+FPGPRI+
Sbjct  7     FLIAIFSISCFIVSNNIADATYTGITRHYKFNVKLQNVTRLCHTKSIVTVNGQFPGPRIV  66

Query  302   AREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQ  481
             AREGDR+++KVVNHV NN++IHWHGIRQ+R+GWADGPAYI QCPIQTGQTYVYNFT+VGQ
Sbjct  67    AREGDRLVIKVVNHVQNNITIHWHGIRQLRSGWADGPAYIAQCPIQTGQTYVYNFTVVGQ  126

Query  482   RGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQAL  661
             RGTL+WHAHISWLR+TL+GPIIILP++   YPFP+P+KEVP+IFGEWWN D EAV++QAL
Sbjct  127   RGTLWWHAHISWLRSTLYGPIIILPKRGVPYPFPQPYKEVPIIFGEWWNADPEAVIAQAL  186

Query  662   QNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANH  841
             Q GGGPN+SDAYTINGLPGPLYNCSA +TF + VKPGKTYLLR+INAALNDELFF IANH
Sbjct  187   QTGGGPNVSDAYTINGLPGPLYNCSARDTFMLSVKPGKTYLLRIINAALNDELFFSIANH  246

Query  842   TVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNS  1021
             T+T V+ DA YVKPFETD ++I PGQT NVLLKTK   P +TF M ARPY TG GTFDNS
Sbjct  247   TLTTVDVDAIYVKPFETDTIIITPGQTTNVLLKTKPYHPEATFLMMARPYVTGNGTFDNS  306

Query  1022  TVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTV  1201
             TVAG+L+Y+ P  +IS     P+  P LP +  TSFVSNFT KLRSL N+Q+PANVP+ V
Sbjct  307   TVAGILQYQHPKPSISIKKL-PLFKPTLPALRDTSFVSNFTNKLRSLANAQYPANVPKNV  365

Query  1202  DKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSR-----KS  1363
             DK+FFFTVGLGTNPCPKN TCQGP N T FAAS+NNVSFVTPT A+LQ ++ R     +S
Sbjct  366   DKHFFFTVGLGTNPCPKNHTCQGPTNKTMFAASVNNVSFVTPTKALLQTHFIRSHSLHQS  425

Query  1364  NGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPL  1543
               V+ TD PS PL PFNYTGTPPNNT V+N TKV+VLPFN +VELV+QDTSILG E+HPL
Sbjct  426   QQVFTTDLPSSPLIPFNYTGTPPNNTMVMNGTKVMVLPFNTSVELVMQDTSILGVETHPL  485

Query  1544  HLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMH  1723
             HLHGYNF+VVGQGFGNFD KKDPA YNLVDPVERNT+GVP GGW AIRF ADNPGVWFMH
Sbjct  486   HLHGYNFFVVGQGFGNFDAKKDPAKYNLVDPVERNTVGVPVGGWVAIRFLADNPGVWFMH  545

Query  1724  CHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             CH EVH SWGL+MAW+V++GKLPNQKL PPPSDLPKC
Sbjct  546   CHLEVHTSWGLKMAWVVEDGKLPNQKLPPPPSDLPKC  582



>ref|XP_009354528.1| PREDICTED: laccase-17-like [Pyrus x bretschneideri]
Length=581

 Score =   895 bits (2312),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/585 (72%), Positives = 494/585 (84%), Gaps = 6/585 (1%)
 Frame = +2

Query  86    MGFLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIV  265
             MG    + PP L   FL    +    P  A+A    +TR+YKF I+++NVTRLCHTK+I+
Sbjct  1     MGVHLLSTPPFLR-LFLFSFITFCVIPQQALA---GITRNYKFQIKLRNVTRLCHTKTII  56

Query  266   TVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTG  445
             TVNG+FPGPRI+AREGD++L+KVVNHV NN+SIHWHGIRQ+R+GWADGPAY+TQCPIQTG
Sbjct  57    TVNGQFPGPRIIAREGDQLLIKVVNHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQTG  116

Query  446   QTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWW  625
              +YVYNFTI GQRGTLFWHAHISWLR+T++GP+IILP++   YPF KP+KEVP+IFGEWW
Sbjct  117   NSYVYNFTITGQRGTLFWHAHISWLRSTVYGPLIILPKRGVPYPFTKPYKEVPIIFGEWW  176

Query  626   NVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAA  805
             N D EA++SQALQ GGGPN+SDAYTINGLPGPLYNCSA + FK+KV+PGKTYLLR+INAA
Sbjct  177   NADPEAIISQALQTGGGPNVSDAYTINGLPGPLYNCSAKDAFKLKVQPGKTYLLRLINAA  236

Query  806   LNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAAR  985
             LNDELFF IANHT+ VVEADA YVKPFET  ++IAPGQT NVLLKTK N P +TFFM AR
Sbjct  237   LNDELFFSIANHTLKVVEADAVYVKPFETSTILIAPGQTTNVLLKTKPNFPNATFFMTAR  296

Query  986   PYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTK-PIALPPLPPINGTSFVSNFTGKLRSL  1162
             PY TGQGTFDNSTVAG+LEYE PS   +  + + P+  P LP +N TSF + F  KLRSL
Sbjct  297   PYVTGQGTFDNSTVAGILEYESPSKTKNLTTKRLPLFKPNLPALNDTSFATKFANKLRSL  356

Query  1163  GNSQFPANVPQTVDKNFFFTVGLGTNPCPK-NQTCQGPNGTKFAASLNNVSFVTPTTAIL  1339
                QFPANVPQ VDKNFFFT+GLGTNPC + NQTCQGPNGT FAAS+NN+SF  P TA+L
Sbjct  357   NTQQFPANVPQKVDKNFFFTIGLGTNPCSQNNQTCQGPNGTMFAASINNISFAMPNTALL  416

Query  1340  QAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSI  1519
             Q+++S +S+GVY+ DFP+ P+ PFNYTGTPPN+T V N TK++VLPFN+ VELV+QDTSI
Sbjct  417   QSHFSGQSSGVYSPDFPANPIVPFNYTGTPPNDTMVSNGTKLMVLPFNSRVELVMQDTSI  476

Query  1520  LGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRAD  1699
             LGAESHPLHLHG+NF+VVGQGFGNFDP KDP  +NLVDPVERNT+GVPSGGW AIRF AD
Sbjct  477   LGAESHPLHLHGFNFFVVGQGFGNFDPNKDPKMFNLVDPVERNTVGVPSGGWVAIRFLAD  536

Query  1700  NPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             NPGVWFMHCH E+H SWGL+M W+V +GKLPNQKLLPPP+DLPKC
Sbjct  537   NPGVWFMHCHLEIHTSWGLKMGWVVLDGKLPNQKLLPPPADLPKC  581



>ref|XP_008222248.1| PREDICTED: laccase-2 [Prunus mume]
Length=587

 Score =   895 bits (2312),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/584 (73%), Positives = 497/584 (85%), Gaps = 7/584 (1%)
 Frame = +2

Query  104   AFP--PLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNG  277
             AFP  P   A FL+ ++  +  P  + A    VTRHYKF+I+++NVTRLC TKSIV VNG
Sbjct  4     AFPLSPAFVAAFLLALSCFWSLPEFSAAAASGVTRHYKFDIKLKNVTRLCQTKSIVAVNG  63

Query  278   KFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYV  457
             KFPGPRI+AREGDR+LVKVVNHV NN+S+HWHGIRQ+++GWADGP+YITQCPIQT Q+YV
Sbjct  64    KFPGPRIIAREGDRILVKVVNHVQNNISLHWHGIRQLQSGWADGPSYITQCPIQTNQSYV  123

Query  458   YNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDT  637
             YNFTI GQRGTLFWHAHISWLRAT++GP+IILP+ N SYPFPKPHKEVP+IFGEWW  D 
Sbjct  124   YNFTITGQRGTLFWHAHISWLRATVYGPLIILPKHNASYPFPKPHKEVPIIFGEWWKADP  183

Query  638   EAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDE  817
             EAV+ QALQ G GPN+S+AYTINGLPGPLYNCS  +TF++KVKPGKTYLLR+INAA+NDE
Sbjct  184   EAVIRQALQTGAGPNVSEAYTINGLPGPLYNCSKKDTFRLKVKPGKTYLLRLINAAVNDE  243

Query  818   LFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFT  997
             LFF IANH++TVVEADA YVKPF+TD+L+I PGQT NVLL+TK + P +TF M ARPYFT
Sbjct  244   LFFSIANHSLTVVEADALYVKPFKTDILLITPGQTTNVLLRTKPSYPNATFLMLARPYFT  303

Query  998   GQGTFDNSTVAGVLEYEIPSLNISKNSTK--PIALPPLPPINGTSFVSNFTGKLRSLGNS  1171
             G GTFDNSTVAG+LEY+ PS   +  S K  P+  P LP IN TSFV+NF+ K RSL NS
Sbjct  304   GMGTFDNSTVAGILEYKNPSNPSASTSLKNPPLLKPTLPQINATSFVANFSAKFRSLANS  363

Query  1172  QFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAY  1348
             +FPANVP+TV K FFFTVGLGTNPCPKNQTCQGP N +KFAAS NN+SF+ PTTA+LQ++
Sbjct  364   KFPANVPKTVQKRFFFTVGLGTNPCPKNQTCQGPNNSSKFAASFNNISFILPTTALLQSH  423

Query  1349  YSRKSNGVYATDFPSVPLTPFNYTGTP--PNNTQVVNATKVVVLPFNATVELVLQDTSIL  1522
             +  KSNGV+ TDFP+ PL PFNYTGTP    NT V N TK VVL FN +VE+VLQ T IL
Sbjct  424   FFGKSNGVFTTDFPTNPLQPFNYTGTPSNNTNTNVSNGTKAVVLKFNTSVEVVLQGTGIL  483

Query  1523  GAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADN  1702
             GAESHP+HLHG+NF+VVGQGFGNF+P KDPA++NLVDPVERNTIGVPSGGWAAIRF ADN
Sbjct  484   GAESHPVHLHGFNFFVVGQGFGNFNPNKDPASFNLVDPVERNTIGVPSGGWAAIRFLADN  543

Query  1703  PGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             PGVW +HCHF+VHLSWGLRMAW+V++GKLPNQKL PPPSDLPKC
Sbjct  544   PGVWLLHCHFDVHLSWGLRMAWVVQDGKLPNQKLPPPPSDLPKC  587



>gb|KHN16224.1| Laccase-17 [Glycine soja]
Length=631

 Score =   894 bits (2310),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/591 (72%), Positives = 496/591 (84%), Gaps = 28/591 (5%)
 Frame = +2

Query  137   MIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGD  316
             M++ S+   P +A+   G +TRHY F+I+ QNV+RLCHTKS+VTVNG+FPGP I+AREGD
Sbjct  44    MLLFSMIIIPQLAL---GGITRHYHFDIKYQNVSRLCHTKSVVTVNGQFPGPHIVAREGD  100

Query  317   RVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLF  496
             R+L+KV NHV NN+SIHWHGIRQ+R+GWADGPAY+TQCPIQTGQ+YVYN+TI GQRGTLF
Sbjct  101   RLLIKVTNHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNYTIFGQRGTLF  160

Query  497   WHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGG  676
             WHAHISWLR+TL+GPIIILP++   YPF KP+KEVP+IFGEWWN D EAV++QALQ GGG
Sbjct  161   WHAHISWLRSTLYGPIIILPKQGAPYPFTKPYKEVPVIFGEWWNTDPEAVITQALQTGGG  220

Query  677   PNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVV  856
             PN+SDAYTINGLPGPLYNCSA +TFK+KVKPGKTYLLR+INAALNDELFF IANHT+TVV
Sbjct  221   PNVSDAYTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTLTVV  280

Query  857   EADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGV  1036
             + DA YVKPF+TD ++IAPGQT N LLKTK + P +TFFM+ARPY TGQGTFDNSTVA +
Sbjct  281   DVDAIYVKPFDTDTILIAPGQTSNGLLKTKSHYPNATFFMSARPYATGQGTFDNSTVAAI  340

Query  1037  LEYEIPSLNI-SKNSTKPIAL--PPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDK  1207
             LEYE+P   + S  S K ++L  P LP +N TSF +NF  KL SL ++QFPANVPQ VDK
Sbjct  341   LEYEVPPHFVHSTTSVKKLSLFKPILPALNDTSFATNFANKLHSLASAQFPANVPQKVDK  400

Query  1208  NFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATD  1384
             +FFFTVGLGT PCP+NQTCQGP N TKFAAS+NNVSF+ PTTA+LQA++  +SNGVY+  
Sbjct  401   HFFFTVGLGTTPCPQNQTCQGPTNATKFAASVNNVSFIQPTTALLQAHFFGQSNGVYSPY  460

Query  1385  FPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHP--------  1540
             FP  PL PFNYTGTPPNNT V N TKVVVLPFN +VELV+QDTSILGAESHP        
Sbjct  461   FPISPLVPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNF  520

Query  1541  -------------LHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAA  1681
                          LHLHG+NF+VVGQGFGNFDP KDPAN+NLVDPVERNT+GVPSGGW A
Sbjct  521   FVVGQGFGNFDPNLHLHGFNFFVVGQGFGNFDPNKDPANFNLVDPVERNTVGVPSGGWVA  580

Query  1682  IRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             IRF ADNPGVWFMHCH EVH SWGL+MAWIV +G+LPNQKLLPPP+DLPKC
Sbjct  581   IRFLADNPGVWFMHCHLEVHTSWGLKMAWIVLDGELPNQKLLPPPADLPKC  631



>ref|XP_007016584.1| Laccase 17 [Theobroma cacao]
 gb|EOY34203.1| Laccase 17 [Theobroma cacao]
Length=577

 Score =   894 bits (2309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/548 (76%), Positives = 484/548 (88%), Gaps = 1/548 (0%)
 Frame = +2

Query  194   VTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWH  373
             +TRHYKF+I++ NVTRLCHTKSIV+VNG+FPGPRI+AREGD++L+KVVNH+ NN+SIHWH
Sbjct  30    ITRHYKFDIKLHNVTRLCHTKSIVSVNGQFPGPRIVAREGDQLLIKVVNHLSNNISIHWH  89

Query  374   GIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIIL  553
             GIRQ+R+GWADGPAY+TQCPIQTGQ+YVYNFTIVGQRGTLFWHAHISWLRAT++GPI+IL
Sbjct  90    GIRQLRSGWADGPAYVTQCPIQTGQSYVYNFTIVGQRGTLFWHAHISWLRATVYGPIVIL  149

Query  554   PRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNC  733
             P++   YPF KP+KEVP+ FGEW+N D EAV+SQAL+ GGGPN+SDAYTINGLPGPLYNC
Sbjct  150   PKRGVPYPFAKPYKEVPITFGEWFNADPEAVISQALRRGGGPNVSDAYTINGLPGPLYNC  209

Query  734   SANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAP  913
             SA +TFK+KV+PGKTYLLR+INAALN+ELFF +ANHT+TVV+ DA YVKPFET+ L+I P
Sbjct  210   SAKDTFKLKVRPGKTYLLRLINAALNNELFFSVANHTLTVVDFDAIYVKPFETETLLITP  269

Query  914   GQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNI-SKNSTKPI  1090
             GQT NVLLKTK + P +TFFM ARPY TGQGTFDNSTVAG+LEYE+P  +  S     P+
Sbjct  270   GQTTNVLLKTKPSYPSATFFMTARPYVTGQGTFDNSTVAGILEYELPPDSFHSSIKMLPL  329

Query  1091  ALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQG  1270
               P LP +N TSF +NF  KLRSL ++Q+PANVPQ VDK+FFF VGLGT+PC +N+TCQG
Sbjct  330   FKPILPALNDTSFATNFANKLRSLASAQYPANVPQKVDKHFFFAVGLGTSPCQQNRTCQG  389

Query  1271  PNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVV  1450
             PNGTK AAS+NNVSF  PTTA+LQA++  +SNGVY  DFPS P+ PFNYTGT PNNT V 
Sbjct  390   PNGTKMAASVNNVSFAMPTTALLQAHFLGQSNGVYTPDFPSNPIIPFNYTGTTPNNTMVS  449

Query  1451  NATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLV  1630
             N TKVVVLPFN +VELV+QDTSILGAESHPLHLHG+NF+VVGQGFGNFDPKKD AN+NLV
Sbjct  450   NGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPKKDLANFNLV  509

Query  1631  DPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLP  1810
             DP+ERNT+GVPSGGW AIRF ADNPGVW MHCH EVH SWGL+MAWIV +GKLPNQKLLP
Sbjct  510   DPIERNTVGVPSGGWVAIRFLADNPGVWLMHCHLEVHTSWGLKMAWIVLDGKLPNQKLLP  569

Query  1811  PPSDLPKC  1834
             PP+DLPKC
Sbjct  570   PPADLPKC  577



>emb|CBI30527.3| unnamed protein product [Vitis vinifera]
Length=586

 Score =   894 bits (2309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/578 (73%), Positives = 486/578 (84%), Gaps = 4/578 (1%)
 Frame = +2

Query  113   PLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGP  292
             P +   FL  + +    P +A+AK   +TR YKF+I++  +TRLCHTK ++TVNGKFPGP
Sbjct  9     PAIVGVFLFALITSSLLPELALAKDAGITRRYKFDIKLVRMTRLCHTKGVITVNGKFPGP  68

Query  293   RIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTI  472
              +  REGD +LV+VVNHV NN+SIHWHGIRQ+R+GWADGPAYITQCPI+TGQ Y+YNFT+
Sbjct  69    LVTVREGDNLLVEVVNHVQNNISIHWHGIRQLRSGWADGPAYITQCPIRTGQRYMYNFTV  128

Query  473   VGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVS  652
              GQRGTLFWHAHISW+RAT+HGP+IILP+ N  YPF  P+KEVP+IFGEWWNVD EAV+S
Sbjct  129   SGQRGTLFWHAHISWIRATVHGPLIILPKPNVPYPFGNPYKEVPIIFGEWWNVDPEAVIS  188

Query  653   QALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRI  832
             QALQ G GPN+SDAYTINGLPGPLYNCSA +TFK+KVKP KTYLLR+INAA++DELFF I
Sbjct  189   QALQTGAGPNVSDAYTINGLPGPLYNCSAKDTFKLKVKPAKTYLLRLINAAVDDELFFSI  248

Query  833   ANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTF  1012
             ANHT+TVVE DA YVKPF+TD L+I PGQT NVLLKTK   P + FFM ARPY TGQGTF
Sbjct  249   ANHTITVVEVDAVYVKPFDTDTLLITPGQTTNVLLKTKPYFPKANFFMYARPYATGQGTF  308

Query  1013  DNSTVAGVLEYEIPSLN-ISKNSTK--PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPA  1183
             DNSTVAG+LEYE+ + +  +  STK  P   P LPP N TSF SNF+ K+RSL ++QFPA
Sbjct  309   DNSTVAGILEYELSNFSPFNSTSTKNLPFFKPALPPFNDTSFASNFSRKIRSLASAQFPA  368

Query  1184  NVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNG-TKFAASLNNVSFVTPTTAILQAYYSRK  1360
              VPQ V++ FFFTVGLGTNPCP+NQTCQGPN  TKF+AS+NNVSFV PTTAILQAY+  +
Sbjct  369   KVPQKVERRFFFTVGLGTNPCPRNQTCQGPNNRTKFSASINNVSFVLPTTAILQAYFFGQ  428

Query  1361  SNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHP  1540
             SNGVY TDFP+ P+TPFNYTG PPNNT V N TK VVLP+N +VELV+QDTSILGAESHP
Sbjct  429   SNGVYTTDFPNNPITPFNYTGNPPNNTMVSNGTKAVVLPYNTSVELVMQDTSILGAESHP  488

Query  1541  LHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFM  1720
             LHLHG+NF+VVGQGFGN+DP KDPA +NLVDP+ERNT+GVPSGGW AIRF ADNPGVWFM
Sbjct  489   LHLHGFNFFVVGQGFGNYDPNKDPAKFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFM  548

Query  1721  HCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             HCH EVH SWGL+M WIV EGKLPNQKL PPPSDLP C
Sbjct  549   HCHLEVHTSWGLKMVWIVLEGKLPNQKLPPPPSDLPTC  586



>ref|XP_010264408.1| PREDICTED: laccase-17-like [Nelumbo nucifera]
Length=591

 Score =   893 bits (2308),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/580 (73%), Positives = 494/580 (85%), Gaps = 13/580 (2%)
 Frame = +2

Query  125   ACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMA  304
             A  L+  + L  +P + V    + TRHY+F+I++QNVTRLCHTKSI+T NG+FPGPRI+A
Sbjct  15    ALRLLSFSCLCLWPGLLVF---ASTRHYEFHIKLQNVTRLCHTKSIITANGRFPGPRIVA  71

Query  305   REGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQR  484
             REGDRVL+KVV+HV NNVS+HWHGIRQ+++GWADGPAY+TQCPIQTGQ+YVYNF+I GQR
Sbjct  72    REGDRVLIKVVSHVQNNVSLHWHGIRQLQSGWADGPAYVTQCPIQTGQSYVYNFSITGQR  131

Query  485   GTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQ  664
             GTLFWHAH+SWLR+TL+GP IILP+KN SYPFPKP+KEVP++FGEWWN DTEAVV+QALQ
Sbjct  132   GTLFWHAHVSWLRSTLYGPFIILPKKNVSYPFPKPYKEVPIVFGEWWNADTEAVVTQALQ  191

Query  665   NGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHT  844
             +GGGPN+SDAYTINGLPGPLYNCS  +TFK+KV+PG+TYLLRMINA +++ELFF IANHT
Sbjct  192   SGGGPNVSDAYTINGLPGPLYNCSTKDTFKLKVRPGRTYLLRMINALVDEELFFSIANHT  251

Query  845   VTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNST  1024
             +TVVEADA YVKPF TD L+IAPGQT NVLLK K   P +TF +AARPYFTG GTFDNST
Sbjct  252   LTVVEADAVYVKPFHTDRLLIAPGQTTNVLLKAKPFFPNATFLIAARPYFTGLGTFDNST  311

Query  1025  VAGVLEYE--------IPSLNISKNSTK-PIALPPLPPINGTSFVSNFTGKLRSLGNSQF  1177
             VAG+LEY+        + ++N  K   K P+  P LPPIN TSFV+NF+ + RSL  +QF
Sbjct  312   VAGILEYDDEQPSNSTVSAINRKKKKQKLPLFRPTLPPINDTSFVANFSSRFRSLATTQF  371

Query  1178  PANVPQTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYS  1354
             PANVPQTVDK FFFTVGLGT+PCPKNQTCQGP N TKF+AS+NN SF  P+TAILQA+Y 
Sbjct  372   PANVPQTVDKRFFFTVGLGTSPCPKNQTCQGPNNSTKFSASINNNSFALPSTAILQAHYF  431

Query  1355  RKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAES  1534
              +  GVY TDFP+ P  PFNYTGTPPNNT V N TKVVVLPFN +VELVLQ TSILGAES
Sbjct  432   GQEKGVYTTDFPANPPFPFNYTGTPPNNTVVSNGTKVVVLPFNTSVELVLQGTSILGAES  491

Query  1535  HPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVW  1714
             HPLHLHG+NF+VVGQG GN+DP KDP N+NLVDPVERNTIGVPSGGW AIRF ADNPG W
Sbjct  492   HPLHLHGFNFFVVGQGSGNYDPNKDPPNFNLVDPVERNTIGVPSGGWVAIRFLADNPGAW  551

Query  1715  FMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             FMHCHFE+HLSWGL+M WIV +G+LPNQKL PPPSDLPKC
Sbjct  552   FMHCHFEIHLSWGLKMVWIVLDGELPNQKLPPPPSDLPKC  591



>ref|XP_002317505.2| hypothetical protein POPTR_0011s12100g [Populus trichocarpa]
 gb|EEE98117.2| hypothetical protein POPTR_0011s12100g [Populus trichocarpa]
Length=581

 Score =   893 bits (2308),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/578 (75%), Positives = 502/578 (87%), Gaps = 7/578 (1%)
 Frame = +2

Query  110   PPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPG  289
             PP   A FL    +L   P  A+A    +TRHYKF++ +QNVTRLCHT+S+VTVNGKFPG
Sbjct  8     PPAFLAVFLFSFVTLSVNPEPALA----ITRHYKFDVMLQNVTRLCHTRSMVTVNGKFPG  63

Query  290   PRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFT  469
             PRI+AREGDR+++++VNHV NN+SIHWHGIRQ+R+GWADGPAY+TQCPIQTGQ+YVYN+T
Sbjct  64    PRIVAREGDRLVIRMVNHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNYT  123

Query  470   IVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVV  649
             IVGQRGTL+WHAHISWLR+TLHGPII+LP+  T YPF KP+KEVP+IFGEW+N D EA++
Sbjct  124   IVGQRGTLWWHAHISWLRSTLHGPIILLPKLGTPYPFAKPYKEVPIIFGEWFNADPEAII  183

Query  650   SQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFR  829
             SQA+Q GGGPN+SDAYTINGLPGPLYNCSA +TFK+KVKPGKTYLLRMINAALNDELFF 
Sbjct  184   SQAMQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRMINAALNDELFFS  243

Query  830   IANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGT  1009
             IANHTVTVV+ DA YVKPF+ + L+I PGQT NVLLKTK + P + FFM+ARPY TGQGT
Sbjct  244   IANHTVTVVDVDAVYVKPFDAETLLITPGQTTNVLLKTKPDYPNAQFFMSARPYATGQGT  303

Query  1010  FDNSTVAGVLEYEIPS-LNISKNSTK--PIALPPLPPINGTSFVSNFTGKLRSLGNSQFP  1180
             FDNSTVAG+LEYE+P+  + S +STK  P+  P LPP+N TSF +NF+ KLRSL ++ FP
Sbjct  304   FDNSTVAGILEYEVPNKTSQSNHSTKKLPLYKPNLPPLNDTSFATNFSSKLRSLASADFP  363

Query  1181  ANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRK  1360
             ANVPQ VD+ FFFTVGLGTNPC KNQTCQGPNGT+FAAS+NNVSFV PTTA+LQA++  +
Sbjct  364   ANVPQKVDRQFFFTVGLGTNPCSKNQTCQGPNGTRFAASVNNVSFVMPTTALLQAHHFGQ  423

Query  1361  SNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHP  1540
             S GVY+  FP  PL PFNYTGTPPNNT V N TK+VVLPFN +VEL++Q TSILGAESHP
Sbjct  424   SRGVYSPYFPISPLIPFNYTGTPPNNTMVSNGTKLVVLPFNTSVELIMQGTSILGAESHP  483

Query  1541  LHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFM  1720
             LHLHG+NF+VVGQGFGNFDP KDPAN+NLVDPVERNT+GVPSGGW AIRF ADNPGVWFM
Sbjct  484   LHLHGFNFFVVGQGFGNFDPSKDPANFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFM  543

Query  1721  HCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             HCH EVH SWGL+MAW+V +GKLPNQKLLPPP+DLPKC
Sbjct  544   HCHLEVHTSWGLKMAWVVLDGKLPNQKLLPPPADLPKC  581



>emb|CAN60069.1| hypothetical protein VITISV_012401 [Vitis vinifera]
Length=573

 Score =   893 bits (2308),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/572 (76%), Positives = 499/572 (87%), Gaps = 7/572 (1%)
 Frame = +2

Query  131   FLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
               +++ SL+ FP +A A    +TRHYKFNI++QNVTRLCHTK+IV+VNG+FPGPRI+ARE
Sbjct  5     LFLVLNSLWLFPELASA---GITRHYKFNIKLQNVTRLCHTKNIVSVNGQFPGPRIIARE  61

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GDRV+V VVNHVPNNV+IHWHG+RQ+R+GWADGPAY+TQCPIQTGQTYVYNF I GQRGT
Sbjct  62    GDRVVVNVVNHVPNNVTIHWHGVRQLRSGWADGPAYVTQCPIQTGQTYVYNFXITGQRGT  121

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             LFWHAH+SWLR+T++GPIIILP+KN  YPF KP+KEVP+IFGEWWN D EAV++QALQNG
Sbjct  122   LFWHAHMSWLRSTVYGPIIILPKKNVPYPFVKPYKEVPIIFGEWWNADPEAVITQALQNG  181

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
             GGPN+SDAYTINGLPGPLYNCSA +TFK+KVKPGKTYLLR+INAALNDELFF IANHT+T
Sbjct  182   GGPNVSDAYTINGLPGPLYNCSAQDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTLT  241

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VV+ DA YVKPF+TD ++I PGQT N+LLK K + P +TF MAARPY TG+GTFDNSTVA
Sbjct  242   VVDVDAIYVKPFKTDTILITPGQTTNLLLKAKPHFPNATFLMAARPYATGRGTFDNSTVA  301

Query  1031  GVLEYEIP---SLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTV  1201
             G+L YE P   S + S     P+  P LPP+N TSF +NFT KLRSL NSQFPANVP+ V
Sbjct  302   GLLHYEPPQKSSPSASSFKNLPVFKPTLPPLNDTSFAANFTRKLRSLANSQFPANVPKKV  361

Query  1202  DKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYA  1378
             DK FFFTVGLGT+PCP+NQTCQGP N TKF+AS+NNVSFV PTTAILQA++ ++SNGVY 
Sbjct  362   DKRFFFTVGLGTSPCPQNQTCQGPNNSTKFSASVNNVSFVLPTTAILQAHFFQQSNGVYT  421

Query  1379  TDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGY  1558
             TDFP+ P+ PFNYTGTPPNNT   N TKVVVLPFN TVELVLQDTSILG ESHPLHLHG+
Sbjct  422   TDFPATPIFPFNYTGTPPNNTMASNGTKVVVLPFNTTVELVLQDTSILGIESHPLHLHGF  481

Query  1559  NFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEV  1738
             NF+VVGQGFGNFD KKDP  +NLVDPVERNT+GVPSGGW AIRF ADNPGVWFMHCH EV
Sbjct  482   NFFVVGQGFGNFDSKKDPPKFNLVDPVERNTVGVPSGGWVAIRFVADNPGVWFMHCHLEV  541

Query  1739  HLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             H SWGL+MAWIVK+GKLPNQKL PPPSDLP+C
Sbjct  542   HTSWGLKMAWIVKDGKLPNQKLPPPPSDLPQC  573



>ref|XP_004492322.1| PREDICTED: laccase-17-like [Cicer arietinum]
Length=580

 Score =   893 bits (2307),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/572 (74%), Positives = 491/572 (86%), Gaps = 6/572 (1%)
 Frame = +2

Query  131   FLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
             F +   SL  F    +A  G +TRHY F+IR QNVTRLCH+K++VTVNG+FPGPRI+ARE
Sbjct  11    FPLFFLSLINFCTFELALAG-ITRHYHFDIRYQNVTRLCHSKTMVTVNGQFPGPRIVARE  69

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GD++L+KVVNHV NN+SIHWHGIRQ+++GWADGPAY+TQCPIQTGQ+YVYN+TI GQRGT
Sbjct  70    GDQLLIKVVNHVQNNISIHWHGIRQLQSGWADGPAYVTQCPIQTGQSYVYNYTIKGQRGT  129

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             LFWHAHISWLR+T++GP+IILP+KN  YPF KPHKEVP+IFGEW+N DTEAV++QALQ G
Sbjct  130   LFWHAHISWLRSTVYGPLIILPKKNVQYPFAKPHKEVPIIFGEWFNADTEAVIAQALQTG  189

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
             GGPN+SDAYTINGLPGPLYNCS  +TFK+KV+ GKTYLLR INAALNDELFF IANHT+T
Sbjct  190   GGPNVSDAYTINGLPGPLYNCSKKDTFKLKVELGKTYLLRFINAALNDELFFSIANHTLT  249

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VVEADA YVKPFET+ ++IAPGQT NVLLKTK + P +TF M ARPY TG GTFDN+TVA
Sbjct  250   VVEADAVYVKPFETNTILIAPGQTTNVLLKTKPHYPNATFLMTARPYATGLGTFDNTTVA  309

Query  1031  GVLEYEIPSLNISKNSTK----PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQT  1198
             G+LEYEIP  N   ++      P+  P LP +N TSF + F+ KL SL ++QFPANVPQ 
Sbjct  310   GILEYEIP-FNTHHSAASLEKLPLFKPILPALNDTSFATKFSNKLNSLASAQFPANVPQK  368

Query  1199  VDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYA  1378
             VD++FFFTVGLGTNPC  N+TCQGPNGT FAAS+NNVSF+ PTTA+LQ+++  +SNGVYA
Sbjct  369   VDRHFFFTVGLGTNPCKNNKTCQGPNGTMFAASINNVSFILPTTALLQSHFFGQSNGVYA  428

Query  1379  TDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGY  1558
               FP+ PL PFNYTGTPPNNT V N TKVVVLPFN +VELV+QDTSILGAESHPLHLHG+
Sbjct  429   PYFPNSPLHPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGF  488

Query  1559  NFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEV  1738
             NF+VVGQGFGNFD  KDP N+NLVDPVERNTIGVPSGGW AIRF ADNPGVWFMHCH EV
Sbjct  489   NFFVVGQGFGNFDSNKDPKNFNLVDPVERNTIGVPSGGWVAIRFLADNPGVWFMHCHLEV  548

Query  1739  HLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             H SWGLRMAWIV +GKLPNQKLLPPP+DLPKC
Sbjct  549   HTSWGLRMAWIVLDGKLPNQKLLPPPADLPKC  580



>gb|KHN16229.1| Laccase-17 [Glycine soja]
Length=580

 Score =   892 bits (2306),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/570 (74%), Positives = 489/570 (86%), Gaps = 7/570 (1%)
 Frame = +2

Query  137   MIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGD  316
             M + SL   P +A+   G +TRHY F+I+ QNV+RLCHTKS+VTVNG+FPGPRI+AREGD
Sbjct  14    MFLFSLIIIPQLAL---GGITRHYHFDIKYQNVSRLCHTKSVVTVNGQFPGPRIVAREGD  70

Query  317   RVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLF  496
             R+L+KV +HV NN+SIHWHGIRQ+R+GWADGPAY+TQCPIQTGQ+YVYN+TI GQRGTLF
Sbjct  71    RLLIKVTSHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNYTIFGQRGTLF  130

Query  497   WHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGG  676
             WHAHISWLR+TL+GPIIILP++   YPF KP+KEVP+IFGEWWN D EAV++QALQ GGG
Sbjct  131   WHAHISWLRSTLYGPIIILPKQGAPYPFTKPYKEVPVIFGEWWNTDPEAVITQALQTGGG  190

Query  677   PNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVV  856
             PN+SDAYTINGLPGPLYNCSA +TFK+KVKPGK YLLR+INAALNDELFF IANHT+TVV
Sbjct  191   PNVSDAYTINGLPGPLYNCSAKDTFKLKVKPGKIYLLRLINAALNDELFFSIANHTLTVV  250

Query  857   EADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGV  1036
             EADA YVKPF T+ ++I PGQT NVLLKTK + P +TF M ARPY TG GTFDN+TVAG+
Sbjct  251   EADAVYVKPFATNTILITPGQTTNVLLKTKSHYPNATFLMTARPYATGLGTFDNTTVAGI  310

Query  1037  LEYEI-PSLNISKNSTK--PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDK  1207
             L+Y+  P+ + S  S K  P+  P LP +N TSF + F  KLRSL ++QFPANVPQ VD 
Sbjct  311   LQYKTPPNTHHSAASLKNLPLLKPILPALNDTSFATKFNNKLRSLASAQFPANVPQKVDT  370

Query  1208  NFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATD  1384
             +FFFTVGLGT PCP+NQTCQGP N TKFAAS+NNVSF+ PTTA+LQA++  +SNGVY+  
Sbjct  371   HFFFTVGLGTTPCPQNQTCQGPTNATKFAASVNNVSFIQPTTALLQAHFFGQSNGVYSPY  430

Query  1385  FPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNF  1564
             FP  PL PFNYTGTPPNNT V N TKVVVLPFN +VELV+QDTSILGAESHPLHLHG+NF
Sbjct  431   FPISPLVPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNF  490

Query  1565  YVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHL  1744
             +VVGQGFGNFDPKKDP N+NLVDPVERNT+GVPSGGW AIRF  DNPGVWFMHCH EVH 
Sbjct  491   FVVGQGFGNFDPKKDPVNFNLVDPVERNTVGVPSGGWVAIRFLTDNPGVWFMHCHLEVHT  550

Query  1745  SWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             SWGL+MAWIV +GKLPNQKLLPPP+DLP C
Sbjct  551   SWGLKMAWIVLDGKLPNQKLLPPPADLPNC  580



>ref|XP_006370270.1| hypothetical protein POPTR_0001s41160g [Populus trichocarpa]
 gb|ERP66839.1| hypothetical protein POPTR_0001s41160g [Populus trichocarpa]
Length=581

 Score =   892 bits (2305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/577 (73%), Positives = 495/577 (86%), Gaps = 7/577 (1%)
 Frame = +2

Query  113   PLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGP  292
             P   A FL    +LF  P  A+A    +TRHYKF++ +QNVTRLCHTKS+VTVNGKFPGP
Sbjct  9     PASLAVFLSSFVTLFVHPRPAIA----ITRHYKFDVMLQNVTRLCHTKSMVTVNGKFPGP  64

Query  293   RIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTI  472
              I+AREGDR+L+KVVNHV NN+SIHWHGIRQ+R+GWADGPAY+TQCPIQTGQ+YVYN+TI
Sbjct  65    CIVAREGDRLLIKVVNHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNYTI  124

Query  473   VGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVS  652
             VGQRGTL+WHAHISWLR+TL+GP+IILP+  T YPF KP KEVP+IFGEW+N D EA+++
Sbjct  125   VGQRGTLWWHAHISWLRSTLYGPLIILPKLGTPYPFAKPDKEVPIIFGEWFNADPEAIIN  184

Query  653   QALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRI  832
             QA+Q GGGPN+SDAYTINGLPGPLYNCSA  TFK+KVKPGKTYLLR+INAALN+ELFF I
Sbjct  185   QAMQTGGGPNVSDAYTINGLPGPLYNCSAKNTFKLKVKPGKTYLLRLINAALNEELFFSI  244

Query  833   ANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTF  1012
             ANHT+TVV  DA YVKPF+T+ L+IA GQT +VLLKTK + P + FFM+ARPY TGQGTF
Sbjct  245   ANHTLTVVGVDAIYVKPFDTETLLIASGQTTDVLLKTKPHHPDAKFFMSARPYVTGQGTF  304

Query  1013  DNSTVAGVLEYEIPSLNISKNSTK---PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPA  1183
             DNSTVAG+LEYE+    I  + T    P+  P LPP+N TSF +NFT KLRSL +++FPA
Sbjct  305   DNSTVAGILEYEVARKTIQSSHTSKRLPLYKPNLPPLNDTSFATNFTSKLRSLASAEFPA  364

Query  1184  NVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKS  1363
             NVPQ VD++FFFTVGLGTNPC KNQTCQGPNGT+FAAS+NNVSFV PT A+L+A++  +S
Sbjct  365   NVPQKVDRHFFFTVGLGTNPCSKNQTCQGPNGTRFAASVNNVSFVMPTKALLEAHHFGQS  424

Query  1364  NGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPL  1543
              GVY+ +FP  PL PF+YTGTP NNT V + TK+V+LPFN +VEL++QDTSILGAESHPL
Sbjct  425   KGVYSPNFPISPLIPFDYTGTPQNNTMVSHGTKLVMLPFNTSVELIMQDTSILGAESHPL  484

Query  1544  HLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMH  1723
             HLHG+NF+VVGQGFGNFDPKKDPAN+NLVDPVERNT+GVPSGGW AIRF ADNPGVWF+H
Sbjct  485   HLHGFNFFVVGQGFGNFDPKKDPANFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFLH  544

Query  1724  CHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             CH E+H+SWGL MAW+V +GKLPN +LLPPP DLPKC
Sbjct  545   CHVELHMSWGLMMAWVVLDGKLPNHRLLPPPVDLPKC  581



>ref|XP_010264410.1| PREDICTED: laccase-17-like [Nelumbo nucifera]
Length=583

 Score =   891 bits (2303),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/557 (75%), Positives = 484/557 (87%), Gaps = 5/557 (1%)
 Frame = +2

Query  179   AKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNV  358
             A H  +TRHYKFNI++QNVTRLCHTKSI TVNGKFPGPRI+AREGDR+++KVVNH+ NNV
Sbjct  27    ATHAGITRHYKFNIKLQNVTRLCHTKSIPTVNGKFPGPRIVAREGDRLVIKVVNHIQNNV  86

Query  359   SIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHG  538
             S+HWHGIRQ+R+GWADGPAY+TQCPIQ GQ+YVYNFTI GQRGT FWHAHISWLR+TL+G
Sbjct  87    SLHWHGIRQLRSGWADGPAYVTQCPIQRGQSYVYNFTITGQRGTFFWHAHISWLRSTLYG  146

Query  539   PIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPG  718
             PIIILP+++  YPF KP+KEVP+IFGEWWN DTEAV+ QALQ+G GPN+SDAYTINGLPG
Sbjct  147   PIIILPKRDVPYPFVKPYKEVPLIFGEWWNADTEAVIRQALQSGAGPNVSDAYTINGLPG  206

Query  719   PLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDL  898
             PLYNCSAN++FK+KVKPGKTYLLR+INAALNDELFF IA HT+TVVEAD  YVKPF+TD 
Sbjct  207   PLYNCSANDSFKLKVKPGKTYLLRLINAALNDELFFSIAKHTLTVVEADGIYVKPFDTDK  266

Query  899   LVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLN---IS  1069
             L+I PGQT +VLLKTK + P +TFFMAA PYFTG GTFDNST+AG+LEY+    N   I+
Sbjct  267   LLITPGQTTDVLLKTKPDFPNATFFMAASPYFTGLGTFDNSTIAGILEYDDQPSNSSAIN  326

Query  1070  KNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCP  1249
             +    P+  P LPPIN T+FV+NF+ ++RSL  +QFPANVPQTVDK FFFTVGLG++PCP
Sbjct  327   RKKQLPLFRPTLPPINDTAFVANFSSRIRSLATTQFPANVPQTVDKRFFFTVGLGSSPCP  386

Query  1250  KNQTCQGP-NGT-KFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTG  1423
             KNQ+CQGP NGT KFAAS+NN+SF  PTTAILQA++  +  GVY +DFP  P  PFNYTG
Sbjct  387   KNQSCQGPNNGTRKFAASVNNISFALPTTAILQAHFFGQEKGVYTSDFPINPPFPFNYTG  446

Query  1424  TPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPK  1603
             TPPNNT V N TKVVVLPFN +VELV+Q TSILGAESHPLHLHG+NF+VVGQGFG+FDP 
Sbjct  447   TPPNNTLVSNGTKVVVLPFNTSVELVMQGTSILGAESHPLHLHGFNFFVVGQGFGSFDPN  506

Query  1604  KDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEG  1783
             KDP N+NLVDP ERNT+GVPSGGW AIRF +DNPG WFMHCHFEVHLSWGLRM WIV +G
Sbjct  507   KDPPNFNLVDPAERNTVGVPSGGWVAIRFLSDNPGAWFMHCHFEVHLSWGLRMVWIVLDG  566

Query  1784  KLPNQKLLPPPSDLPKC  1834
             + PNQKL PPPSDLPKC
Sbjct  567   EHPNQKLPPPPSDLPKC  583



>ref|XP_007132049.1| hypothetical protein PHAVU_011G062600g [Phaseolus vulgaris]
 gb|ESW04043.1| hypothetical protein PHAVU_011G062600g [Phaseolus vulgaris]
Length=607

 Score =   891 bits (2303),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/586 (73%), Positives = 495/586 (84%), Gaps = 21/586 (4%)
 Frame = +2

Query  95    LFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVN  274
             LF AF  L    FL++ TS         +KHGSVTRHYKF+IR++NVTRLCHTKSIVTVN
Sbjct  37    LFVAF--LFVTSFLVLATS---------SKHGSVTRHYKFDIRLRNVTRLCHTKSIVTVN  85

Query  275   GKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTY  454
             GKFPGPR+ AREGDR++VKVVNHVPNNV+IHWHG+RQ+R+GWADGP+YITQCPIQTGQ+Y
Sbjct  86    GKFPGPRVAAREGDRIVVKVVNHVPNNVTIHWHGVRQLRSGWADGPSYITQCPIQTGQSY  145

Query  455   VYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVD  634
             VYNFTI GQRGTLFWHAHISWLRATL+GP+I+LPR N SYPF  P+KEVP++FGEWWN D
Sbjct  146   VYNFTIDGQRGTLFWHAHISWLRATLYGPLILLPRSNESYPFENPYKEVPILFGEWWNAD  205

Query  635   TEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSAN----ETFKVKVKPGKTYLLRMINA  802
              EAV++QALQ+G GPN+SDA+T NG PGPLYNCS N    ETF++KVKPGKTYLLR+INA
Sbjct  206   PEAVIAQALQSGAGPNVSDAHTFNGFPGPLYNCSNNETETETFRLKVKPGKTYLLRLINA  265

Query  803   ALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAA  982
             ALNDELFF IANHT+ +VEADA YVKPFE+ ++V+ PGQT NVLLKTK   P +TFFM A
Sbjct  266   ALNDELFFSIANHTLVIVEADATYVKPFESKIIVLGPGQTSNVLLKTKPEYPNATFFMLA  325

Query  983   RPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSL  1162
             RPYFTG GTFDNSTVAG+LEY+ P     KN   P   P LP IN TSFV+NF+ K RSL
Sbjct  326   RPYFTGMGTFDNSTVAGILEYKKPL--APKNI--PTFKPSLPAINDTSFVANFSSKFRSL  381

Query  1163  GNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAIL  1339
               +++PA VPQ VDK+FFFTVGLGT+PCPKNQTCQGP N +KFAAS+NN+SF  P+ A+L
Sbjct  382   NTAKYPAKVPQKVDKSFFFTVGLGTSPCPKNQTCQGPNNSSKFAASMNNISFTLPSVALL  441

Query  1340  QA-YYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTS  1516
             Q  ++ + +NG+Y TDFP+VPL  FNYTGTPPNNT+V N TK VV+ FN  V++VLQDTS
Sbjct  442   QQHFFGQANNGIYTTDFPAVPLRTFNYTGTPPNNTRVTNGTKTVVILFNTKVQVVLQDTS  501

Query  1517  ILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRA  1696
             ILGAESHPLHLHG+NFYVVGQGFGNF+P  DP N+NLVDPVERNT+GVPSGGW AIRF A
Sbjct  502   ILGAESHPLHLHGFNFYVVGQGFGNFNPITDPPNFNLVDPVERNTVGVPSGGWVAIRFLA  561

Query  1697  DNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             DNPGVW MHCHF+VHLSWGLRMAWIV++GKLPNQKL PPP+DLPKC
Sbjct  562   DNPGVWLMHCHFDVHLSWGLRMAWIVEDGKLPNQKLPPPPADLPKC  607



>ref|XP_010922297.1| PREDICTED: laccase-17-like [Elaeis guineensis]
Length=584

 Score =   890 bits (2299),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/575 (74%), Positives = 494/575 (86%), Gaps = 2/575 (0%)
 Frame = +2

Query  116   LLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPR  295
             LL A  +    +L      A A+   + RHY+F+IRM NVTRLCHTKSIVTVNG+FPGP+
Sbjct  10    LLMAALMFSTVTLLLSLGGAGAQQTGINRHYRFDIRMANVTRLCHTKSIVTVNGQFPGPK  69

Query  296   IMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIV  475
             I+AREGDRV+VKVVNHVP NV++HWHG+RQ+R+GWADGPAY+TQCPIQTGQ+YVYNFTIV
Sbjct  70    IVAREGDRVVVKVVNHVPYNVTLHWHGVRQLRSGWADGPAYVTQCPIQTGQSYVYNFTIV  129

Query  476   GQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQ  655
             GQRGTLFWHAHISWLRATL+GPIIILP +   YPF +P+KEVP+IFGEWWN DTEAV+SQ
Sbjct  130   GQRGTLFWHAHISWLRATLYGPIIILPARGVPYPFSRPYKEVPIIFGEWWNADTEAVISQ  189

Query  656   ALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIA  835
             ALQ GGGPN+SDAYTINGLPGPLYNCSA +TFK+KVKPGKTYLLRMINAALNDELFF IA
Sbjct  190   ALQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRMINAALNDELFFSIA  249

Query  836   NHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFD  1015
             NHT+T+V+ DA YVKPF+TD L+IAPGQT NVLL+T+ +   STF MAARPY TG G FD
Sbjct  250   NHTLTIVDVDAVYVKPFDTDTLIIAPGQTTNVLLRTRPSFFHSTFLMAARPYATGAGAFD  309

Query  1016  NSTVAGVLEYEIPSLNISKNSTK--PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANV  1189
             NSTVAG LEY+ P+ +   + +K  P+  P LP +N T+FV+NFT +LRSL  +QFPANV
Sbjct  310   NSTVAGFLEYQDPNTSSRASFSKKLPLFRPTLPSLNDTAFVANFTSRLRSLATAQFPANV  369

Query  1190  PQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNG  1369
             PQ+VD+ FFFTVGLGT+PCPKNQTCQGPNGTKFAA+++N+SF  PTTA+LQA++  +S G
Sbjct  370   PQSVDRRFFFTVGLGTSPCPKNQTCQGPNGTKFAATVSNISFTMPTTALLQAHFFGQSRG  429

Query  1370  VYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHL  1549
             VY+ DFP  PL PFNYTGTPPNNT V N TK++VLPFNATVELV+QDTSILGAESHPLHL
Sbjct  430   VYSPDFPYSPLIPFNYTGTPPNNTAVSNGTKLMVLPFNATVELVMQDTSILGAESHPLHL  489

Query  1550  HGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCH  1729
             HG+NF+VVGQG GN++P KDPAN+NLVDP ERNT+GVP+GGW AIRFRADNPGVWFMHCH
Sbjct  490   HGFNFFVVGQGSGNYNPAKDPANFNLVDPAERNTVGVPAGGWVAIRFRADNPGVWFMHCH  549

Query  1730  FEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
              EVH SWGL+MAW+V +G LPNQKL  PPSDLPKC
Sbjct  550   LEVHTSWGLKMAWLVLDGSLPNQKLPRPPSDLPKC  584



>emb|CBI31631.3| unnamed protein product [Vitis vinifera]
Length=1050

 Score =   889 bits (2298),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/572 (76%), Positives = 496/572 (87%), Gaps = 6/572 (1%)
 Frame = +2

Query  131   FLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
               +++ +L+ FP +A +    +TRHYKFNI++QNVTRLCHTKSIV+VNG+FPGP I+ARE
Sbjct  481   LFVVLNTLWLFPELASS--AGITRHYKFNIKLQNVTRLCHTKSIVSVNGQFPGPHIIARE  538

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GDRV+VKVVNHV NNV+IHWHG+RQ+R+GWADGPAY+TQCPIQTGQTYVYNFTI GQRGT
Sbjct  539   GDRVVVKVVNHVQNNVTIHWHGVRQLRSGWADGPAYVTQCPIQTGQTYVYNFTITGQRGT  598

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             LFWHAHISWLR+TL+GPIIILP+KN  YPF KP+KEVP+IFGEWWN D EAV++QALQNG
Sbjct  599   LFWHAHISWLRSTLYGPIIILPKKNVPYPFVKPYKEVPIIFGEWWNADPEAVITQALQNG  658

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
             GGPN+SDAYTINGLPGPLYNCSA +TFK+KVKPGKTYLLR+INAALNDELFF IANHT+T
Sbjct  659   GGPNVSDAYTINGLPGPLYNCSAQDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTLT  718

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VV+ DA YVKPF+TD ++I PGQT N+LLK K + P +TF MAARPY TG+GTFDNSTVA
Sbjct  719   VVDVDAIYVKPFKTDTILITPGQTTNLLLKAKPHFPNATFLMAARPYATGRGTFDNSTVA  778

Query  1031  GVLEYEIPSLNISKN---STKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTV  1201
             G+L YE P  +          P+  P LPP+N TSF +NFTGKLRSL N+QFPANVPQ V
Sbjct  779   GILHYEPPPKSSPSASSFKNLPLFKPTLPPLNDTSFAANFTGKLRSLANTQFPANVPQKV  838

Query  1202  DKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYA  1378
             D+ FFFTVGLGTNPCP+NQTCQGP N T F+AS+NNVSFV PTTAILQA++ ++S GVY 
Sbjct  839   DQRFFFTVGLGTNPCPQNQTCQGPTNITMFSASVNNVSFVLPTTAILQAHFFQQSKGVYT  898

Query  1379  TDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGY  1558
             TDFP+ P+ PFNYTGTPPNNT V N TKVVVLPFN +VELVLQDTSILG ESHPLHLHG+
Sbjct  899   TDFPTTPIFPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVLQDTSILGIESHPLHLHGF  958

Query  1559  NFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEV  1738
             NF+VVGQGFGNFD KKDP  +NLVDPVERNT+GVPSGGW AIRF ADNPGVWFMHCH EV
Sbjct  959   NFFVVGQGFGNFDSKKDPPKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEV  1018

Query  1739  HLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             H SWGL+MAWIV +GKLPNQKL PPPSDLPKC
Sbjct  1019  HTSWGLKMAWIVMDGKLPNQKLPPPPSDLPKC  1050


 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/448 (73%), Positives = 378/448 (84%), Gaps = 6/448 (1%)
 Frame = +2

Query  131   FLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
               +++ SL++ P +A      +TRHYKFNI +QNVTRLCHTKSIV+VNG+FPGP I+ARE
Sbjct  15    LFLVLNSLWYLPELA--NGSGITRHYKFNIELQNVTRLCHTKSIVSVNGQFPGPPIIARE  72

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GDRV+VKVVNHV NNV+IHWHG+RQ+R+GWADGPAY+TQCPIQTGQTYVYNFTI GQRGT
Sbjct  73    GDRVVVKVVNHVQNNVTIHWHGVRQLRSGWADGPAYVTQCPIQTGQTYVYNFTITGQRGT  132

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             LFWHAHISWLR+TL+GPIII P+KN  YPF KP+KEVP+IFGEWWN D EAV++QALQNG
Sbjct  133   LFWHAHISWLRSTLYGPIIIFPKKNVPYPFAKPYKEVPIIFGEWWNTDPEAVITQALQNG  192

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
             GGPN+SD YTINGLPGPLYNCSA +TFK+KVKPGKTYLLR+INAALNDELFF IANHT+T
Sbjct  193   GGPNVSDGYTINGLPGPLYNCSAQDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTLT  252

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VV+ DA YVKPF+TD ++I PGQT N+LLK K + P +TF MAARPY TG GTFDNSTVA
Sbjct  253   VVDVDAIYVKPFKTDTILITPGQTTNLLLKAKPHFPNATFLMAARPYATGSGTFDNSTVA  312

Query  1031  GVLEYEIPSLNISKN---STKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTV  1201
             G+L YE P  +          P+  P LPP+N TSF +NFT KLRSL N+QFPANVPQ V
Sbjct  313   GILHYEPPPKSSPSAPSFENLPLFKPTLPPLNDTSFAANFTRKLRSLANTQFPANVPQKV  372

Query  1202  DKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYA  1378
             DK FFFTVGLGTNPCP+NQTCQGP N T F+AS+NNVSFV PTTAILQA++ ++SNGVY 
Sbjct  373   DKRFFFTVGLGTNPCPQNQTCQGPNNSTMFSASVNNVSFVLPTTAILQAHFFQQSNGVYT  432

Query  1379  TDFPSVPLTPFNYTGTPPNNTQVVNATK  1462
             TDFP+ P+ PFNYTGTPPNNT V N TK
Sbjct  433   TDFPATPIFPFNYTGTPPNNTMVSNGTK  460



>gb|KDP44151.1| hypothetical protein JCGZ_05618 [Jatropha curcas]
Length=576

 Score =   889 bits (2297),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/548 (76%), Positives = 480/548 (88%), Gaps = 2/548 (0%)
 Frame = +2

Query  191   SVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHW  370
             ++TRHYKF+I++QNVTRLCHTKSIVTVNGKFPGPRI+AREGD++L+KVVNHV NN+S+HW
Sbjct  31    AITRHYKFDIKLQNVTRLCHTKSIVTVNGKFPGPRIVAREGDQLLIKVVNHVQNNISLHW  90

Query  371   HGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIII  550
             HGIRQ+R+GWADGPAYITQCPIQTGQ+YVYN+TI+GQRGTL+WHAHISWLR+TL+GPIII
Sbjct  91    HGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIIGQRGTLWWHAHISWLRSTLYGPIII  150

Query  551   LPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYN  730
             LP+    YPF KP+KE+P+IFGEW+N DTEA+++QALQ GGGPN+SDAYTINGLPGPLYN
Sbjct  151   LPKLGVPYPFAKPYKEIPIIFGEWFNADTEAIINQALQTGGGPNVSDAYTINGLPGPLYN  210

Query  731   CSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIA  910
             CSA +TFK+KVKPGKTY+LR+INAALNDELFF IANHT+TVV+ DA YVKPFET++L+IA
Sbjct  211   CSAQDTFKLKVKPGKTYMLRLINAALNDELFFSIANHTLTVVDVDAVYVKPFETEILLIA  270

Query  911   PGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKPI  1090
             PGQT NVLLKTK N P + FFM ARPY TG GTFDNSTVA +LEY+ PS   S     P+
Sbjct  271   PGQTSNVLLKTKPNFPNAKFFMTARPYVTGLGTFDNSTVAAILEYK-PSQTASIKKL-PL  328

Query  1091  ALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQG  1270
               P LPP+N T+F  NFT KL SL + ++PANVPQ VD+ FFFTVGLGTNPCP NQTCQG
Sbjct  329   YKPVLPPLNDTAFAINFTQKLFSLASKKYPANVPQKVDRQFFFTVGLGTNPCPHNQTCQG  388

Query  1271  PNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVV  1450
             PNGT FAAS+NNVSF  P TA+LQ+++  +S GVY  +FP  PL PFNYTG PPNNT V 
Sbjct  389   PNGTMFAASVNNVSFTMPNTALLQSHFFGQSKGVYKPNFPISPLIPFNYTGNPPNNTMVS  448

Query  1451  NATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLV  1630
             N TK+VVLPFN +VEL+LQDTSILGAESHPLHLHG+NF+VVGQGFGNFDP KDPA +NLV
Sbjct  449   NGTKLVVLPFNTSVELILQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDPAKFNLV  508

Query  1631  DPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLP  1810
             DPVERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH SWGL+MAW+V +GKLPNQKLLP
Sbjct  509   DPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWVVLDGKLPNQKLLP  568

Query  1811  PPSDLPKC  1834
             PP DLPKC
Sbjct  569   PPVDLPKC  576



>ref|XP_010920540.1| PREDICTED: laccase-10-like [Elaeis guineensis]
Length=575

 Score =   888 bits (2295),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/550 (75%), Positives = 479/550 (87%), Gaps = 3/550 (1%)
 Frame = +2

Query  188   GSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIH  367
              S+TRHYKF+I+ +NVTRLCHT+SIVTVNGKFPGP+I+AREGDRV+VKV+NH+ NNV+IH
Sbjct  28    ASITRHYKFDIQRKNVTRLCHTRSIVTVNGKFPGPKIVAREGDRVIVKVINHIKNNVTIH  87

Query  368   WHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPII  547
             WHG+RQI+ GWADGPAYITQCPIQ GQTYVYNFTIVGQRGTL WHAHISW+R TL+G II
Sbjct  88    WHGVRQIQTGWADGPAYITQCPIQRGQTYVYNFTIVGQRGTLLWHAHISWMRVTLYGAII  147

Query  548   ILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLY  727
             ILP++   YPFPKP+KE+P+IFGEW+N D EAV++QALQ G GPN+SDAYTINGLPGPLY
Sbjct  148   ILPKRGVPYPFPKPYKEIPVIFGEWFNADPEAVIAQALQTGAGPNVSDAYTINGLPGPLY  207

Query  728   NCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVI  907
             NCS  +TFK+KVKPGKTYLLRMINAALNDELFF IANHT+TVVE DA Y KPF +D ++I
Sbjct  208   NCSKVDTFKLKVKPGKTYLLRMINAALNDELFFSIANHTLTVVEVDAIYTKPFNSDTILI  267

Query  908   APGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYE-IPSLNISKNSTK  1084
              PGQT NVLL+TK + P +TF MAARPY TG GTFDN+T AG+LEY+  PS   +KN   
Sbjct  268   TPGQTTNVLLRTKPSFPGATFLMAARPYATGLGTFDNTTTAGLLEYKYTPSTPSNKN--L  325

Query  1085  PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTC  1264
             P++ P LP +N T+F +NFTGKLRSL N+QFPANVPQTVDK F+FTVGLGT+PCPKNQTC
Sbjct  326   PLSKPTLPSLNDTAFAANFTGKLRSLANAQFPANVPQTVDKRFYFTVGLGTSPCPKNQTC  385

Query  1265  QGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQ  1444
             QGPNGTKFAAS+NN+SF  P+TA+LQA++  +S GVY TDFPS P  PFNYTGTPPNNT 
Sbjct  386   QGPNGTKFAASVNNISFALPSTALLQAHFLGQSKGVYTTDFPSNPPFPFNYTGTPPNNTF  445

Query  1445  VVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYN  1624
             V N TK VVLPFNA+VELV+QDTSI G ESHPLHLHG+NF+VVGQGFGN+DP KDPA +N
Sbjct  446   VTNGTKAVVLPFNASVELVMQDTSIQGNESHPLHLHGFNFFVVGQGFGNYDPSKDPAKFN  505

Query  1625  LVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKL  1804
             L DP+ERNT GVP+GGW AIRF+ADNPGVWFMHCH +VH SWGLRMAW+V +G LPNQKL
Sbjct  506   LADPIERNTFGVPAGGWVAIRFQADNPGVWFMHCHLDVHTSWGLRMAWVVNDGPLPNQKL  565

Query  1805  LPPPSDLPKC  1834
             LPPPSDLPKC
Sbjct  566   LPPPSDLPKC  575



>ref|XP_010690924.1| PREDICTED: laccase-17-like [Beta vulgaris subsp. vulgaris]
Length=582

 Score =   888 bits (2295),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/580 (73%), Positives = 489/580 (84%), Gaps = 11/580 (2%)
 Frame = +2

Query  116   LLAACFLMIMTSLFFFPHMAV-AKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGP  292
             LL A F +I    F  P+ A+ A +  +TRHYKFNI++QNVTRLCHTKSIVTVNG+FPGP
Sbjct  7     LLIALFSII---CFMLPNNAIDASYTGITRHYKFNIKLQNVTRLCHTKSIVTVNGQFPGP  63

Query  293   RIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTI  472
             R++AREGDR+++KVVNHV NN++IHWHGIRQ+R+GWADGPAY+TQCPIQTGQTYVYNFTI
Sbjct  64    RVVAREGDRLVIKVVNHVQNNITIHWHGIRQLRSGWADGPAYVTQCPIQTGQTYVYNFTI  123

Query  473   VGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVS  652
              GQRGTL+WHAHISWLR+TL+GPIIILP++   YPFP+P+KEVP+IFGEWWN D EAV+S
Sbjct  124   TGQRGTLWWHAHISWLRSTLYGPIIILPKRGVPYPFPQPYKEVPLIFGEWWNADPEAVIS  183

Query  653   QALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRI  832
             QALQ GGGPN+SDAYTINGLPGPLYNCSA +TF + VKPGKTYLLR+INAALNDELFF I
Sbjct  184   QALQTGGGPNVSDAYTINGLPGPLYNCSAKDTFMLSVKPGKTYLLRIINAALNDELFFSI  243

Query  833   ANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTF  1012
             ANHT+T V+ DA YVKPFETD ++I PGQT NVLLKTK   P +TF M ARPY TG GTF
Sbjct  244   ANHTLTTVDVDAVYVKPFETDTIIITPGQTTNVLLKTKPYHPKATFLMMARPYVTGNGTF  303

Query  1013  DNSTVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVP  1192
             DNSTVAG+L Y+ P  +IS     P+  P LP +  TSFVSNFT KLRSL N+Q+PANVP
Sbjct  304   DNSTVAGILNYQHPKPSISIKKL-PLFKPTLPALRDTSFVSNFTNKLRSLANAQYPANVP  362

Query  1193  QTVDKNFFFTVGLGTNPCPKNQTCQGPNG-TKFAASLNNVSFVTPTTAILQAYYSRKSN-  1366
             + VDK+FFFTVGLGTNPCPKN TCQGPN  T FAAS+NNVSFV PT A+LQ ++ +  + 
Sbjct  363   KNVDKHFFFTVGLGTNPCPKNHTCQGPNNKTMFAASVNNVSFVMPTKALLQTHFIQSHSL  422

Query  1367  ----GVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAES  1534
                  V+ TD PS PL PFNYTG PPNNT V++ TKVV +PFN +VELV+QDTSILG ES
Sbjct  423   HQLQRVFTTDLPSSPLIPFNYTGMPPNNTMVIDGTKVVAVPFNTSVELVMQDTSILGVES  482

Query  1535  HPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVW  1714
             HPLHLHG+NF+VVGQGFGNFD +KDPA YNLVDPVERNT+GVPSGGW AIRF ADNPGVW
Sbjct  483   HPLHLHGFNFFVVGQGFGNFDAEKDPAKYNLVDPVERNTVGVPSGGWVAIRFFADNPGVW  542

Query  1715  FMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             FMHCH EVH SWGL+MAW+V++GKLPNQKL PPPSDLPKC
Sbjct  543   FMHCHLEVHTSWGLKMAWVVQDGKLPNQKLPPPPSDLPKC  582



>ref|XP_007016607.1| Laccase 17 [Theobroma cacao]
 gb|EOY34226.1| Laccase 17 [Theobroma cacao]
Length=581

 Score =   888 bits (2295),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/586 (73%), Positives = 489/586 (83%), Gaps = 8/586 (1%)
 Frame = +2

Query  86    MGFLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIV  265
             MG  F     LL A FL        +P   +     +TRHYKFNI++QNVTRLCHTKSIV
Sbjct  1     MGASFRPSTALLGA-FLSSFMIFCLYPKPVLG----ITRHYKFNIKLQNVTRLCHTKSIV  55

Query  266   TVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTG  445
             +VNG+FPGPRI+AREGD++L+KVVNHVPNN+SIHWHGIRQ+R+GWADGPAY+TQCPIQTG
Sbjct  56    SVNGRFPGPRIVAREGDQLLIKVVNHVPNNISIHWHGIRQLRSGWADGPAYVTQCPIQTG  115

Query  446   QTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWW  625
              +YVYN+TI GQRGTLFWHAHISWLRAT++GP+IILP+    YPF KP+ EV +IFGEW+
Sbjct  116   HSYVYNYTISGQRGTLFWHAHISWLRATVYGPLIILPKLGVPYPFAKPYNEVAVIFGEWF  175

Query  626   NVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAA  805
             N D EA+++QALQ GGGPN+SDAYTINGLPGPLYNCSA +TFK+KVK GKTYLLR+INAA
Sbjct  176   NADPEAIINQALQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVKLGKTYLLRVINAA  235

Query  806   LNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAAR  985
             LNDELFF IANHT+TVVEADA YVKPF T+ ++IAPGQT NVLLKTK   P +T+FM AR
Sbjct  236   LNDELFFSIANHTLTVVEADAVYVKPFNTETILIAPGQTTNVLLKTKPRYPNATYFMTAR  295

Query  986   PYFTGQGTFDNSTVAGVLEYEIPSLNI-SKNSTKPIAL--PPLPPINGTSFVSNFTGKLR  1156
             PY TGQ TFDNSTVAG+LEYE+P     S  S K ++L    LP +N TSF +NF  KLR
Sbjct  296   PYVTGQATFDNSTVAGILEYELPPNGFHSSISIKELSLFKSILPALNDTSFATNFASKLR  355

Query  1157  SLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAI  1336
             SL +++FPANVPQ VDK FFFT+GLGT+PC  NQTCQGPNGT FAAS+NNVSF  PT A+
Sbjct  356   SLASARFPANVPQKVDKQFFFTIGLGTSPCQHNQTCQGPNGTMFAASVNNVSFAMPTKAL  415

Query  1337  LQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTS  1516
             LQA++  +SNGVY TDFPS P  PFNYTGTP NNT V N TK+VVLPFN +VEL++QDTS
Sbjct  416   LQAHFFGQSNGVYTTDFPSDPTIPFNYTGTPTNNTMVSNGTKLVVLPFNTSVELIMQDTS  475

Query  1517  ILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRA  1696
             ILGAESHPLHLHG+NF+VVGQGFGNFDP KDP N+NLVDP+ERNT+GVPSGGW AIRF A
Sbjct  476   ILGAESHPLHLHGFNFFVVGQGFGNFDPNKDPKNFNLVDPIERNTVGVPSGGWVAIRFLA  535

Query  1697  DNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             DNPGVWFMHCH EVH SWGL+MAWIV +GKLPNQKLLPPP DLPKC
Sbjct  536   DNPGVWFMHCHLEVHTSWGLKMAWIVLDGKLPNQKLLPPPEDLPKC  581



>ref|XP_011094887.1| PREDICTED: laccase-17-like [Sesamum indicum]
Length=583

 Score =   888 bits (2294),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/578 (71%), Positives = 494/578 (85%), Gaps = 3/578 (1%)
 Frame = +2

Query  110   PPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPG  289
             P  ++   L ++ +   F  +A+A+ G +TRHYKFNI+M  VTRLCHTKS+VTVNGKFPG
Sbjct  6     PSRMSFGVLFLLLAFCIFCEIALAQDGGITRHYKFNIQMAKVTRLCHTKSMVTVNGKFPG  65

Query  290   PRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFT  469
             PRI+AREGDR+L++VVN+VPNN+SIHWHGIRQ+R+GWADGPAYITQCPIQTGQ+YVYNFT
Sbjct  66    PRIVAREGDRLLIEVVNNVPNNISIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNFT  125

Query  470   IVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVV  649
             +VGQRGTLFWHAHISWLR+T++GP+IILP+K   YPF KP+KEVP+IFGEW+N D EA++
Sbjct  126   VVGQRGTLFWHAHISWLRSTVYGPLIILPKKGVPYPFAKPYKEVPIIFGEWYNGDPEAII  185

Query  650   SQALQNGGGPNISDAYTINGLPGPLYNC-SANETFKVKVKPGKTYLLRMINAALNDELFF  826
             +QA+Q GGGPN+SDAYTINGLPGPLYNC SA +TFK+KVKPGKTYLLR+INAALN++LFF
Sbjct  186   NQAMQTGGGPNVSDAYTINGLPGPLYNCSSAKDTFKLKVKPGKTYLLRLINAALNEDLFF  245

Query  827   RIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQG  1006
              IANH++TVVEADA YVKPF++D++++ PGQT N+LL+TK   P + F MA  PY TG  
Sbjct  246   SIANHSLTVVEADAIYVKPFQSDIVLLTPGQTTNLLLETKSQSPSANFLMAVSPYVTGLA  305

Query  1007  TFDNSTVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPAN  1186
             TFDNST AG+LEYEIPS +   N   P+  P LP +N TSF +NFT K+RSL + Q+PAN
Sbjct  306   TFDNSTAAGILEYEIPSKSHHGNKRLPLFKPTLPAVNDTSFATNFTSKIRSLASPQYPAN  365

Query  1187  VPQTVDKNFFFTVGLGTNPCP--KNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRK  1360
             VPQ VDK+FFFTVGLGT+PC      +CQGPNGT+F+AS+NNVSFV P TA+LQA++S +
Sbjct  366   VPQNVDKHFFFTVGLGTSPCDHQNKSSCQGPNGTRFSASVNNVSFVQPNTALLQAHHSGQ  425

Query  1361  SNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHP  1540
             SNGVY+ DFP  PL  FNYTGTPPNNT V N TKVVVLPFN +VE+++QDTSILGAESHP
Sbjct  426   SNGVYSPDFPISPLHWFNYTGTPPNNTMVSNGTKVVVLPFNTSVEVIMQDTSILGAESHP  485

Query  1541  LHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFM  1720
             LHLHG+NF+VVGQGFGNFDPK+DP N+NLVDP+ERNT+GVP GGW AIRF ADNPGVWFM
Sbjct  486   LHLHGFNFFVVGQGFGNFDPKQDPKNFNLVDPIERNTVGVPPGGWVAIRFLADNPGVWFM  545

Query  1721  HCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             HCH E+H SWGL+MAW+V +GKLPNQKLLPPP DLPKC
Sbjct  546   HCHLEIHTSWGLKMAWLVLDGKLPNQKLLPPPKDLPKC  583



>ref|XP_002282823.1| PREDICTED: laccase-17 [Vitis vinifera]
Length=584

 Score =   888 bits (2294),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/572 (76%), Positives = 496/572 (87%), Gaps = 6/572 (1%)
 Frame = +2

Query  131   FLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
               +++ +L+ FP +A +    +TRHYKFNI++QNVTRLCHTKSIV+VNG+FPGP I+ARE
Sbjct  15    LFVVLNTLWLFPELASS--AGITRHYKFNIKLQNVTRLCHTKSIVSVNGQFPGPHIIARE  72

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GDRV+VKVVNHV NNV+IHWHG+RQ+R+GWADGPAY+TQCPIQTGQTYVYNFTI GQRGT
Sbjct  73    GDRVVVKVVNHVQNNVTIHWHGVRQLRSGWADGPAYVTQCPIQTGQTYVYNFTITGQRGT  132

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             LFWHAHISWLR+TL+GPIIILP+KN  YPF KP+KEVP+IFGEWWN D EAV++QALQNG
Sbjct  133   LFWHAHISWLRSTLYGPIIILPKKNVPYPFVKPYKEVPIIFGEWWNADPEAVITQALQNG  192

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
             GGPN+SDAYTINGLPGPLYNCSA +TFK+KVKPGKTYLLR+INAALNDELFF IANHT+T
Sbjct  193   GGPNVSDAYTINGLPGPLYNCSAQDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTLT  252

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VV+ DA YVKPF+TD ++I PGQT N+LLK K + P +TF MAARPY TG+GTFDNSTVA
Sbjct  253   VVDVDAIYVKPFKTDTILITPGQTTNLLLKAKPHFPNATFLMAARPYATGRGTFDNSTVA  312

Query  1031  GVLEYEIPSLNISKN---STKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTV  1201
             G+L YE P  +          P+  P LPP+N TSF +NFTGKLRSL N+QFPANVPQ V
Sbjct  313   GILHYEPPPKSSPSASSFKNLPLFKPTLPPLNDTSFAANFTGKLRSLANTQFPANVPQKV  372

Query  1202  DKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYA  1378
             D+ FFFTVGLGTNPCP+NQTCQGP N T F+AS+NNVSFV PTTAILQA++ ++S GVY 
Sbjct  373   DQRFFFTVGLGTNPCPQNQTCQGPTNITMFSASVNNVSFVLPTTAILQAHFFQQSKGVYT  432

Query  1379  TDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGY  1558
             TDFP+ P+ PFNYTGTPPNNT V N TKVVVLPFN +VELVLQDTSILG ESHPLHLHG+
Sbjct  433   TDFPTTPIFPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVLQDTSILGIESHPLHLHGF  492

Query  1559  NFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEV  1738
             NF+VVGQGFGNFD KKDP  +NLVDPVERNT+GVPSGGW AIRF ADNPGVWFMHCH EV
Sbjct  493   NFFVVGQGFGNFDSKKDPPKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEV  552

Query  1739  HLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             H SWGL+MAWIV +GKLPNQKL PPPSDLPKC
Sbjct  553   HTSWGLKMAWIVMDGKLPNQKLPPPPSDLPKC  584



>ref|XP_008385213.1| PREDICTED: laccase-17-like [Malus domestica]
Length=581

 Score =   887 bits (2293),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/577 (72%), Positives = 485/577 (84%), Gaps = 5/577 (1%)
 Frame = +2

Query  110   PPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPG  289
             PP     FL    +L   P  A+A    +TRHYKF I++QNVTRLCHTKSI+TVNG+FPG
Sbjct  8     PPPFLRLFLFSFITLCLIPQHALA---GITRHYKFEIKLQNVTRLCHTKSIITVNGQFPG  64

Query  290   PRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFT  469
             PRI+AREGD++L+KVVNHV NN+SIHWHGIRQ+R+GWADGPAY+TQCPIQTG +YVYNFT
Sbjct  65    PRIIAREGDQLLIKVVNHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQTGNSYVYNFT  124

Query  470   IVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVV  649
               GQRGTLFWHAHISWLR+T++GP+IILP++   YPF KP+KEVP+IFGEWWN D E ++
Sbjct  125   XTGQRGTLFWHAHISWLRSTIYGPLIILPKRGVPYPFTKPYKEVPIIFGEWWNADPEVII  184

Query  650   SQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFR  829
              QALQ GGGPN+SDAYTINGLPGPLYNCS  + FK+KV+PGKTYLLR+INAALNDELFF 
Sbjct  185   RQALQTGGGPNVSDAYTINGLPGPLYNCSTKDAFKLKVRPGKTYLLRLINAALNDELFFS  244

Query  830   IANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGT  1009
             IANHT+ VVEADA YVKPFET  ++IAPGQT NVLLKTK N P +TFFM ARPY TGQGT
Sbjct  245   IANHTLKVVEADAVYVKPFETRTILIAPGQTTNVLLKTKPNFPNATFFMTARPYVTGQGT  304

Query  1010  FDNSTVAGVLEYEIPSLNISKNSTK-PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPAN  1186
             FDNSTVAG+LEYE PS   +  + + P+  P LP +N TSF + F  KLRSL   QFPAN
Sbjct  305   FDNSTVAGILEYESPSKTKTLTTKRHPLFKPNLPALNDTSFATKFANKLRSLNTQQFPAN  364

Query  1187  VPQTVDKNFFFTVGLGTNPCPK-NQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKS  1363
             VPQ VDK+FFFT+GLGTNPC + NQTCQGPNGT FAAS+NN+SF  P TA+LQ+++S +S
Sbjct  365   VPQKVDKHFFFTIGLGTNPCSQNNQTCQGPNGTMFAASINNISFAMPNTALLQSHFSGQS  424

Query  1364  NGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPL  1543
             +GVY+ DFP+ P+ PFNYTGTPPN+T V N TK+VVLPFN+ VELV+QDTSILGAESHPL
Sbjct  425   SGVYSPDFPANPIVPFNYTGTPPNDTMVSNGTKLVVLPFNSRVELVMQDTSILGAESHPL  484

Query  1544  HLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMH  1723
             HLHG+NF+VVGQGFGNFD  KDP  +NLVDPVERNT+GVPSGGW AIRF ADNPGVWFMH
Sbjct  485   HLHGFNFFVVGQGFGNFDRNKDPKMFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMH  544

Query  1724  CHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             CH E+H SWGL+M W+V +G LPNQKLLPPP+DLPKC
Sbjct  545   CHLEIHTSWGLKMGWVVLDGXLPNQKLLPPPADLPKC  581



>ref|XP_011029469.1| PREDICTED: laccase-17-like [Populus euphratica]
Length=581

 Score =   887 bits (2291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/578 (74%), Positives = 501/578 (87%), Gaps = 7/578 (1%)
 Frame = +2

Query  110   PPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPG  289
             PP   A FL    +L   P  A+A    V++HYKF++ +QNVTRLCHTKS+VTVNGKFPG
Sbjct  8     PPAFLAVFLFSFVTLSVNPEPALA----VSKHYKFDVMLQNVTRLCHTKSMVTVNGKFPG  63

Query  290   PRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFT  469
             PRI+AREGDR++++VVNHV NN+SIHWHGIRQ+R+GWADGPAY+TQCPIQTGQ+YVYN+T
Sbjct  64    PRIVAREGDRLVIRVVNHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNYT  123

Query  470   IVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVV  649
             IVGQRGTL+WHAHISWLR+TL+GPII+LP+  T+YPF KP+KEVP+IFGEW+N D EA++
Sbjct  124   IVGQRGTLWWHAHISWLRSTLYGPIILLPKLGTTYPFAKPYKEVPIIFGEWFNADPEAII  183

Query  650   SQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFR  829
             +QA+Q GGGPN+SDAYTINGLPGPLYNCSA +TFK+KVK GKTYLLRMINAALNDELFF 
Sbjct  184   NQAMQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVKLGKTYLLRMINAALNDELFFS  243

Query  830   IANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGT  1009
             IANHTVTVV+ DA YVKPF+ + L+I PGQT NVLLKTK + P + FFM+ARPY TGQGT
Sbjct  244   IANHTVTVVDVDAVYVKPFDAETLLITPGQTTNVLLKTKHDYPNAQFFMSARPYATGQGT  303

Query  1010  FDNSTVAGVLEYEIPS-LNISKNSTK--PIALPPLPPINGTSFVSNFTGKLRSLGNSQFP  1180
             FDNSTVAG+LEYE+P+  + S +STK  P+  P LPP+N TSF +NF+ KLRSL ++ +P
Sbjct  304   FDNSTVAGILEYEVPNKTSQSNHSTKKLPLYKPNLPPLNDTSFATNFSSKLRSLASADYP  363

Query  1181  ANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRK  1360
             ANVPQ VD+ F FTVGLGTNPC KNQTCQGPNGT+FAAS+NNVSFV PTTA+LQA++  +
Sbjct  364   ANVPQKVDRQFVFTVGLGTNPCSKNQTCQGPNGTRFAASVNNVSFVMPTTALLQAHHFGQ  423

Query  1361  SNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHP  1540
             S GVY+  FP  PL PFNYTGTPPNNT V N TK+VVLPFN +VEL++QDTSILGAESHP
Sbjct  424   SKGVYSPYFPVSPLIPFNYTGTPPNNTMVSNGTKLVVLPFNTSVELIMQDTSILGAESHP  483

Query  1541  LHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFM  1720
             LHLHG+NF+VVGQ FGNFDP KDPAN+NLVDPVERNT+GVPSGGW AIRF ADNPGVWFM
Sbjct  484   LHLHGFNFFVVGQSFGNFDPSKDPANFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFM  543

Query  1721  HCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             HCH EVH SWGL+MAW+V +GKLPNQKLLPPP+DLPKC
Sbjct  544   HCHLEVHTSWGLKMAWVVLDGKLPNQKLLPPPADLPKC  581



>ref|XP_009375916.1| PREDICTED: laccase-2-like [Pyrus x bretschneideri]
Length=585

 Score =   887 bits (2291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/572 (74%), Positives = 499/572 (87%), Gaps = 3/572 (1%)
 Frame = +2

Query  128   CFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAR  307
              FL+ + SL   P  A+A  G VTR YKF+I+++NVTRLC TKSIVTVNGKFPGPRI+AR
Sbjct  14    AFLLALISLCASPEFAIAAAGGVTRQYKFDIKLKNVTRLCTTKSIVTVNGKFPGPRIIAR  73

Query  308   EGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRG  487
             EGDRVLVKVVNHVPNN+++HWHGIRQ+++GWADGP+Y+TQCPIQT Q+YVYNFTI+GQRG
Sbjct  74    EGDRVLVKVVNHVPNNITLHWHGIRQLQSGWADGPSYVTQCPIQTNQSYVYNFTIIGQRG  133

Query  488   TLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQN  667
             TLFWHAHISWLRAT++GP+IILP+++  YPFPKPHKEVP+IFGEWWNVD EAV+SQALQ 
Sbjct  134   TLFWHAHISWLRATVYGPLIILPKRHAPYPFPKPHKEVPVIFGEWWNVDPEAVISQALQT  193

Query  668   GGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTV  847
             G GPN+S+AYTINGLPGPLYNCS  +TF++KVKPGKTYLLR+INAALNDELFF IANH++
Sbjct  194   GNGPNVSNAYTINGLPGPLYNCSKKDTFRLKVKPGKTYLLRLINAALNDELFFSIANHSI  253

Query  848   TVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTV  1027
             TVVEADA YVK F+T++L+I PGQT NVLLK K + P +TF M ARPYFTG+GTFDNSTV
Sbjct  254   TVVEADAVYVKRFKTNILLITPGQTTNVLLKAKPHYPNATFLMLARPYFTGRGTFDNSTV  313

Query  1028  AGVLEY--EIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTV  1201
             AG+LEY     S + +   + P+  P LP IN TSFV+NFT KLRSL NS+FPANVP+TV
Sbjct  314   AGILEYKKPSNSSSSTSLKSHPLFRPILPQINATSFVANFTSKLRSLANSRFPANVPKTV  373

Query  1202  DKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYA  1378
             ++ FFFT+GLGTNPCPKNQTCQGP N TKFAAS+NN+SF  P+ A+LQ+++  +SN VY+
Sbjct  374   ERRFFFTIGLGTNPCPKNQTCQGPTNTTKFAASMNNISFALPSVAMLQSHFFAQSNSVYS  433

Query  1379  TDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGY  1558
             TDFP +P  PFNYTGTPPNNT V N TKVVVL FN +VELV+Q TSILGAESHPLHLHG+
Sbjct  434   TDFPIIPPKPFNYTGTPPNNTNVNNGTKVVVLKFNTSVELVMQGTSILGAESHPLHLHGF  493

Query  1559  NFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEV  1738
             NF+VVGQGFGNFDP KDP+N+NLVDPVERN++GVPSGGW AIRF ADNPGVW MHCHF+V
Sbjct  494   NFFVVGQGFGNFDPNKDPSNFNLVDPVERNSVGVPSGGWVAIRFLADNPGVWLMHCHFDV  553

Query  1739  HLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             HLSWGLRMAW+V++GKLPNQKL PPPSDLPKC
Sbjct  554   HLSWGLRMAWVVQDGKLPNQKLPPPPSDLPKC  585



>ref|XP_002317504.2| hypothetical protein POPTR_0011s12090g [Populus trichocarpa]
 gb|EEE98116.2| hypothetical protein POPTR_0011s12090g [Populus trichocarpa]
Length=581

 Score =   887 bits (2291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/578 (74%), Positives = 500/578 (87%), Gaps = 7/578 (1%)
 Frame = +2

Query  110   PPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPG  289
             PP   A FL    +L   P  A+A    +TRHYKF++ +QNVTRLCHTKS+VTVNGKFPG
Sbjct  8     PPAFLAVFLFSFVTLSVNPEPALA----ITRHYKFDVMLQNVTRLCHTKSMVTVNGKFPG  63

Query  290   PRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFT  469
             PRI+AREGDR+++ VVNHV NN+SIHWHGIRQ+R+GWADGPAY+TQCPIQTGQ+YVYN+T
Sbjct  64    PRIVAREGDRLVITVVNHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNYT  123

Query  470   IVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVV  649
             IVGQRGTL+WHAHISWLR+TL+GPII+LP+  T YPF KP+KEVP+IFGEW+N D EA++
Sbjct  124   IVGQRGTLWWHAHISWLRSTLYGPIILLPKLGTPYPFAKPYKEVPIIFGEWFNADPEAII  183

Query  650   SQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFR  829
             +QA+Q GGGPN+SDAYTINGLPGPLYNCSA +TFK+KVKPGKTYLLRMINAALNDELFF 
Sbjct  184   NQAMQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRMINAALNDELFFS  243

Query  830   IANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGT  1009
             IANHTVTVV+ DA YVKPF+ + L+I PGQT NVLLKTK + P + FFM+ARPY TGQGT
Sbjct  244   IANHTVTVVDVDAVYVKPFDAETLLITPGQTTNVLLKTKPDYPNAQFFMSARPYATGQGT  303

Query  1010  FDNSTVAGVLEYEIPS-LNISKNSTK--PIALPPLPPINGTSFVSNFTGKLRSLGNSQFP  1180
             FDNSTVAG+LEYE+P+  + S +STK  P+  P LPP+N TSF +NF+ KLRSL ++ FP
Sbjct  304   FDNSTVAGILEYEVPNKTSQSNHSTKKLPLYKPNLPPLNDTSFATNFSSKLRSLASADFP  363

Query  1181  ANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRK  1360
             ANVPQ VD+ F FTVGLGTNPC KNQTCQGPNGT+FAAS+NNVSFV P+TA+LQA++  +
Sbjct  364   ANVPQKVDRQFVFTVGLGTNPCSKNQTCQGPNGTRFAASVNNVSFVMPSTALLQAHHFGQ  423

Query  1361  SNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHP  1540
             S GVY+  F   PL PFNYTGTPPNNT V N TK+VVLPFN +VEL++QDTSILGAESHP
Sbjct  424   SRGVYSPYFAISPLIPFNYTGTPPNNTMVSNGTKLVVLPFNTSVELIMQDTSILGAESHP  483

Query  1541  LHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFM  1720
             LHLHG+NF+VVGQGFGNFDP KDPAN+NLVDPVERNT+GVPSGGW AIRF ADNPGVWFM
Sbjct  484   LHLHGFNFFVVGQGFGNFDPSKDPANFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFM  543

Query  1721  HCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             HCH EVH SWGL+MAW+V +GKLPNQKLLPPP+DLPKC
Sbjct  544   HCHLEVHTSWGLKMAWVVLDGKLPNQKLLPPPADLPKC  581



>ref|XP_006590981.1| PREDICTED: laccase-2-like isoform X2 [Glycine max]
 gb|KHN21934.1| Laccase-2 [Glycine soja]
Length=586

 Score =   886 bits (2290),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/582 (73%), Positives = 488/582 (84%), Gaps = 12/582 (2%)
 Frame = +2

Query  113   PLLAACFLMIMTSLFFFPH--MAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFP  286
             P L   FL   + L+ FP   +A +KHGS TRHYKF+IR++NVTRLCHTKS+VTVNGKFP
Sbjct  9     PSLFVAFLFATSFLWSFPEFVLATSKHGSATRHYKFDIRLRNVTRLCHTKSMVTVNGKFP  68

Query  287   GPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNF  466
             GPR++AREGDR++VKVVNHVPNNVSIHWHG+RQ+++GWADGP+YITQCPIQTGQ YVYNF
Sbjct  69    GPRVVAREGDRIVVKVVNHVPNNVSIHWHGVRQLQSGWADGPSYITQCPIQTGQNYVYNF  128

Query  467   TIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAV  646
             TIVGQRGTLFWHAH SWLRATL+GP+I+LPR+N SYPF KP+KEVP+IFGEWWN D EAV
Sbjct  129   TIVGQRGTLFWHAHFSWLRATLYGPLILLPRRNESYPFEKPYKEVPIIFGEWWNADPEAV  188

Query  647   VSQALQNGGGPNISDAYTINGLPGPLYNCSANE----TFKVKVKPGKTYLLRMINAALND  814
             ++QALQ G GPN+SDAYT NGLPGP YNCS NE    TF++KVKPGKTYLLR+INAALND
Sbjct  189   IAQALQTGAGPNVSDAYTFNGLPGPFYNCSNNETDTDTFRLKVKPGKTYLLRLINAALND  248

Query  815   ELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYF  994
             ELFF IANHT+  VEADA YVKPFE+D++V+ PGQT NVLLKTK   P + F M ARPYF
Sbjct  249   ELFFSIANHTLVTVEADATYVKPFESDIIVLGPGQTSNVLLKTKAEYPNANFLMLARPYF  308

Query  995   TGQGTFDNSTVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQ  1174
             TG GTFDNSTVAG LEY+   L   KN   P   P LP IN TSFV+NF+ K  SL    
Sbjct  309   TGMGTFDNSTVAGFLEYKNKPLAAPKNINIPTLKPFLPAINDTSFVANFSNKFFSLN---  365

Query  1175  FPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAIL-QAY  1348
              PA VPQ VDK+FFFT+GLGT+PCPKNQTCQGP N +KFAAS+NN+SF  P+ A+L Q +
Sbjct  366   -PAKVPQIVDKSFFFTIGLGTSPCPKNQTCQGPNNSSKFAASMNNISFTLPSIALLEQHF  424

Query  1349  YSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGA  1528
             + + +NG+Y TDFP++PL PFNYTGTPPNNT V N TK VV+PFN +V++VLQDTSILGA
Sbjct  425   FGQANNGIYTTDFPAMPLMPFNYTGTPPNNTLVGNGTKTVVIPFNTSVQVVLQDTSILGA  484

Query  1529  ESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPG  1708
             ESHPLHLHG+NFYVVGQGFGNF+P  DP  +NL DPVERNT+GVPSGGW AIRF ADNPG
Sbjct  485   ESHPLHLHGFNFYVVGQGFGNFNPNTDPQIFNLFDPVERNTVGVPSGGWVAIRFLADNPG  544

Query  1709  VWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             VW MHCHF+VHLSWGLRMAWIV++GKLPNQKL PPP+DLPKC
Sbjct  545   VWLMHCHFDVHLSWGLRMAWIVEDGKLPNQKLPPPPADLPKC  586



>gb|KHN16226.1| Laccase-17 [Glycine soja]
Length=578

 Score =   885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/570 (73%), Positives = 485/570 (85%), Gaps = 5/570 (1%)
 Frame = +2

Query  137   MIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGD  316
             + + SL  F     A  G+ TRHY F IR QNVTRLCHTKS+VTVNG+FPGPRI+AREGD
Sbjct  10    LFLLSLIIFGIFEHALAGT-TRHYHFEIRHQNVTRLCHTKSMVTVNGQFPGPRIVAREGD  68

Query  317   RVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLF  496
             R+L+KV NHV NN++IHWHGIRQ+++GWADGPAY+TQCPIQ GQ+YVYN+TIVGQRGTL+
Sbjct  69    RLLIKVTNHVSNNITIHWHGIRQLQSGWADGPAYVTQCPIQRGQSYVYNYTIVGQRGTLW  128

Query  497   WHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGG  676
             WHAHISWLR+TL+GP+IILP+ N  YPF KPHKEVP++FGEWWN D EAV++QALQ GGG
Sbjct  129   WHAHISWLRSTLYGPLIILPKLNAQYPFAKPHKEVPIVFGEWWNADPEAVITQALQTGGG  188

Query  677   PNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVV  856
             PN+SDAYTINGLPGPLYNCS  +TFK+KVKPGK YLLR+INAALNDELFF IANHT+TVV
Sbjct  189   PNVSDAYTINGLPGPLYNCSDKDTFKLKVKPGKIYLLRLINAALNDELFFSIANHTLTVV  248

Query  857   EADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGV  1036
             EADA YVKPF T+ ++I PGQT NVLLKTK + P +TF M ARPY TG GTFDN+TVAG+
Sbjct  249   EADAVYVKPFATNTILITPGQTTNVLLKTKSHYPNATFLMTARPYATGLGTFDNTTVAGI  308

Query  1037  LEYEI-PSLNISKNSTK--PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDK  1207
             L+Y+  P+ + S  S K  P+  P LP +N TSF + F  KLRSL ++QFPANVPQ VD 
Sbjct  309   LQYKTPPNTHHSAASLKNLPLLKPILPALNDTSFATKFNNKLRSLASAQFPANVPQKVDT  368

Query  1208  NFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATD  1384
             +FFFTVGLGT PCP+NQTCQGP N TKFAAS+NNVSF+ PTTA+LQ ++  +SNGVY  D
Sbjct  369   HFFFTVGLGTTPCPQNQTCQGPTNATKFAASVNNVSFIQPTTALLQTHFFGQSNGVYTAD  428

Query  1385  FPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNF  1564
             FP+ PL PFNYTGTPPNNT V N TKVVVLPFN +VELV+QDTSILGAESHPLHLHG+NF
Sbjct  429   FPAKPLIPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNF  488

Query  1565  YVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHL  1744
             + VGQGFGNFDP KDPAN+NL+DP+ERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH 
Sbjct  489   FAVGQGFGNFDPNKDPANFNLLDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHT  548

Query  1745  SWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             SWGL+MAW+V +GKLPNQKL PPP+DLPKC
Sbjct  549   SWGLKMAWVVLDGKLPNQKLFPPPADLPKC  578



>ref|XP_009354529.1| PREDICTED: laccase-17-like [Pyrus x bretschneideri]
Length=583

 Score =   885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/578 (72%), Positives = 487/578 (84%), Gaps = 7/578 (1%)
 Frame = +2

Query  113   PLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGP  292
             P     FL+ + +L   P    A   S+TRHYKF+I+ QNVTRLCHTKSIVTVNG+FPGP
Sbjct  9     PAFLRLFLLSLITLCLIPQHVFA---SITRHYKFDIKQQNVTRLCHTKSIVTVNGQFPGP  65

Query  293   RIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTI  472
             +I+AREGDRVL+KVVNHV NN+SIHWHGIRQ+R+GWADGPAY+TQCPIQ+G +YVYNFTI
Sbjct  66    QIVAREGDRVLIKVVNHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQSGNSYVYNFTI  125

Query  473   VGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVS  652
              GQRGTLFWHAHISWLR+T++GP+IILP+    YPF KP+KEVP+IFGEWWN D EAV+S
Sbjct  126   TGQRGTLFWHAHISWLRSTVYGPLIILPKHGVPYPFAKPYKEVPIIFGEWWNADPEAVIS  185

Query  653   QALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRI  832
             QALQ GGGPN+S+AYT NGLPGPLYNCSA + FK+KV+ GKTYLLR+INAALNDELFF I
Sbjct  186   QALQTGGGPNVSNAYTFNGLPGPLYNCSAKDAFKLKVQSGKTYLLRLINAALNDELFFSI  245

Query  833   ANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTF  1012
             ANHT+ VVEADA YVKPF+TD ++IAPGQT NVLLKTK + P +TFFM ARPY TG GTF
Sbjct  246   ANHTLKVVEADAIYVKPFDTDTVLIAPGQTTNVLLKTKPHFPSATFFMTARPYVTGLGTF  305

Query  1013  DNSTVAGVLEYEIPSLNISKN---STKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPA  1183
             DNSTVAG LEYE  S  +         P+  P LP +N TSF + F+ KLRSL N+QFPA
Sbjct  306   DNSTVAGFLEYESTSKALHTKLPMKKLPLFKPILPALNDTSFATKFSNKLRSLANAQFPA  365

Query  1184  NVPQTVDKNFFFTVGLGTNPCPK-NQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRK  1360
             NVPQ VD++FFFT+GLGT+PC   NQTCQGPNGT FAAS+NNVSF  PTTA+LQA++S +
Sbjct  366   NVPQKVDRHFFFTIGLGTSPCSSNNQTCQGPNGTMFAASVNNVSFAMPTTALLQAHFSGQ  425

Query  1361  SNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHP  1540
             SNGVY+ DFP  P+ PFNYTGTPPN+T V + TK++VLP+N +VE+V+QDTSILGAESHP
Sbjct  426   SNGVYSPDFPISPIIPFNYTGTPPNDTMVGDGTKLMVLPYNTSVEVVMQDTSILGAESHP  485

Query  1541  LHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFM  1720
             LHLHG+NF+VVGQGFGNFD  KDPAN+NLVDPVERNT+GVPSGGW AIRF ADNPGVWFM
Sbjct  486   LHLHGFNFFVVGQGFGNFDRNKDPANFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFM  545

Query  1721  HCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             HCH E+H SWGL+MAW+V +GKLPNQKLLPPP+DLP C
Sbjct  546   HCHLEIHTSWGLKMAWLVLDGKLPNQKLLPPPADLPTC  583



>ref|XP_010037821.1| PREDICTED: laccase-17-like [Eucalyptus grandis]
 gb|KCW49587.1| hypothetical protein EUGRSUZ_K03111 [Eucalyptus grandis]
Length=589

 Score =   885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/574 (72%), Positives = 478/574 (83%), Gaps = 2/574 (0%)
 Frame = +2

Query  116   LLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPR  295
             L+ A F   + +L F P +A AKHG VTRHYKF+I+MQNVTRLC TKSIVTVNG+ PGPR
Sbjct  17    LMRAAFF-TLCALVFLPALAQAKHGGVTRHYKFDIKMQNVTRLCQTKSIVTVNGQLPGPR  75

Query  296   IMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIV  475
             I+AREGDR+L+KVVN+V  NV+IHWHG+RQ+R+GWADGPAYITQCPIQTGQTYVYNFT+ 
Sbjct  76    IIAREGDRLLIKVVNNVQYNVTIHWHGVRQLRSGWADGPAYITQCPIQTGQTYVYNFTVT  135

Query  476   GQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQ  655
             GQRGTLFWHAHISWLRATL+GPI+ILP+K+ SYPFP+P KEVP++FGEWW  DTE ++SQ
Sbjct  136   GQRGTLFWHAHISWLRATLYGPIVILPKKHASYPFPQPFKEVPIVFGEWWKADTETIISQ  195

Query  656   ALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIA  835
             AL+ GG PN+SDAYT+NG PGPLYNCSA +TFK+KVKPGKTYLLR+INA LNDELFF IA
Sbjct  196   ALKTGGAPNLSDAYTMNGFPGPLYNCSAKDTFKLKVKPGKTYLLRLINAVLNDELFFSIA  255

Query  836   NHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFD  1015
             NHT+T+VE DA YVKPF+T  ++I PGQT NVLL+ K   P  TF MAARPY TG G FD
Sbjct  256   NHTLTIVETDAVYVKPFKTHTVLITPGQTTNVLLRAKSKAPNVTFVMAARPYATGPGAFD  315

Query  1016  NSTVAGVLEYEIPSL-NISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVP  1192
             N+TV G LEY  PS  +  K S  PI  P LP  N T+F   F  KLRSL  ++FPA VP
Sbjct  316   NTTVTGFLEYAKPSSPSKPKASKLPILKPTLPKFNDTAFAMKFAQKLRSLNTARFPAKVP  375

Query  1193  QTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGV  1372
             QTVDK FFFTVGLG NPCPKNQTCQGPN T  AAS+NNVSFV P+TA+LQA++ ++SNGV
Sbjct  376   QTVDKKFFFTVGLGVNPCPKNQTCQGPNNTMLAASINNVSFVMPSTALLQAHFFKQSNGV  435

Query  1373  YATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLH  1552
             Y TDFP+ P   FNYTGTPP+N  V + TKVVVLPFN TVELV+QDTSI+GAESHPLHLH
Sbjct  436   YTTDFPTKPPFKFNYTGTPPSNMLVTSGTKVVVLPFNTTVELVMQDTSIIGAESHPLHLH  495

Query  1553  GYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHF  1732
             G+NF+VVGQGFGNF PK+DP N+NLVDPVERNT+GVPSGGW AIRF ADNPGVWFMHCH 
Sbjct  496   GFNFFVVGQGFGNFKPKRDPKNFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHL  555

Query  1733  EVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             EVH SWGL+MAW+V +GK   QKL PPP+DLPKC
Sbjct  556   EVHTSWGLKMAWVVMDGKGRKQKLPPPPADLPKC  589



>ref|XP_003539077.1| PREDICTED: laccase-2-like isoform X1 [Glycine max]
Length=584

 Score =   885 bits (2287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/580 (73%), Positives = 488/580 (84%), Gaps = 10/580 (2%)
 Frame = +2

Query  113   PLLAACFLMIMTSLFFFPH--MAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFP  286
             P L   FL   + L+ FP   +A +KHGS TRHYKF+IR++NVTRLCHTKS+VTVNGKFP
Sbjct  9     PSLFVAFLFATSFLWSFPEFVLATSKHGSATRHYKFDIRLRNVTRLCHTKSMVTVNGKFP  68

Query  287   GPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNF  466
             GPR++AREGDR++VKVVNHVPNNVSIHWHG+RQ+++GWADGP+YITQCPIQTGQ YVYNF
Sbjct  69    GPRVVAREGDRIVVKVVNHVPNNVSIHWHGVRQLQSGWADGPSYITQCPIQTGQNYVYNF  128

Query  467   TIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAV  646
             TIVGQRGTLFWHAH SWLRATL+GP+I+LPR+N SYPF KP+KEVP+IFGEWWN D EAV
Sbjct  129   TIVGQRGTLFWHAHFSWLRATLYGPLILLPRRNESYPFEKPYKEVPIIFGEWWNADPEAV  188

Query  647   VSQALQNGGGPNISDAYTINGLPGPLYNCSAN--ETFKVKVKPGKTYLLRMINAALNDEL  820
             ++QALQ G GPN+SDAYT NGLPGP YNCS N  +TF++KVKPGKTYLLR+INAALNDEL
Sbjct  189   IAQALQTGAGPNVSDAYTFNGLPGPFYNCSNNDTDTFRLKVKPGKTYLLRLINAALNDEL  248

Query  821   FFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTG  1000
             FF IANHT+  VEADA YVKPFE+D++V+ PGQT NVLLKTK   P + F M ARPYFTG
Sbjct  249   FFSIANHTLVTVEADATYVKPFESDIIVLGPGQTSNVLLKTKAEYPNANFLMLARPYFTG  308

Query  1001  QGTFDNSTVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFP  1180
              GTFDNSTVAG LEY+   L   KN   P   P LP IN TSFV+NF+ K  SL     P
Sbjct  309   MGTFDNSTVAGFLEYKNKPLAAPKNINIPTLKPFLPAINDTSFVANFSNKFFSLN----P  364

Query  1181  ANVPQTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAIL-QAYYS  1354
             A VPQ VDK+FFFT+GLGT+PCPKNQTCQGP N +KFAAS+NN+SF  P+ A+L Q ++ 
Sbjct  365   AKVPQIVDKSFFFTIGLGTSPCPKNQTCQGPNNSSKFAASMNNISFTLPSIALLEQHFFG  424

Query  1355  RKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAES  1534
             + +NG+Y TDFP++PL PFNYTGTPPNNT V N TK VV+PFN +V++VLQDTSILGAES
Sbjct  425   QANNGIYTTDFPAMPLMPFNYTGTPPNNTLVGNGTKTVVIPFNTSVQVVLQDTSILGAES  484

Query  1535  HPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVW  1714
             HPLHLHG+NFYVVGQGFGNF+P  DP  +NL DPVERNT+GVPSGGW AIRF ADNPGVW
Sbjct  485   HPLHLHGFNFYVVGQGFGNFNPNTDPQIFNLFDPVERNTVGVPSGGWVAIRFLADNPGVW  544

Query  1715  FMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
              MHCHF+VHLSWGLRMAWIV++GKLPNQKL PPP+DLPKC
Sbjct  545   LMHCHFDVHLSWGLRMAWIVEDGKLPNQKLPPPPADLPKC  584



>ref|XP_003622953.1| Laccase [Medicago truncatula]
Length=604

 Score =   885 bits (2286),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/568 (75%), Positives = 487/568 (86%), Gaps = 8/568 (1%)
 Frame = +2

Query  140   IMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDR  319
             +  SL  F     A  G+ TRHY+F+I  QNVTRLCH K +VTVNG+FPGPRIMAREGDR
Sbjct  42    LFLSLINFCAFEFALAGT-TRHYQFDIGYQNVTRLCHNKRMVTVNGQFPGPRIMAREGDR  100

Query  320   VLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFW  499
             +++KVVN+V NN+SIHWHGIRQ+++GWADGPAY+TQCPIQTGQ+YVYN+TI GQRGTLFW
Sbjct  101   LVIKVVNNVQNNISIHWHGIRQLQSGWADGPAYVTQCPIQTGQSYVYNYTIKGQRGTLFW  160

Query  500   HAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGP  679
             HAHISWLR+TL+GP+IILP+KN  YPF KPHKEVPMIFGEW+N DTEA+++QALQ GGGP
Sbjct  161   HAHISWLRSTLYGPLIILPKKNVPYPFAKPHKEVPMIFGEWFNADTEAIIAQALQTGGGP  220

Query  680   NISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVE  859
             N+S+AYTINGLPGPLYN     TFK+KVKPGKTYLLR+INAALNDELFF +ANHT+ VVE
Sbjct  221   NVSEAYTINGLPGPLYN----YTFKLKVKPGKTYLLRLINAALNDELFFSVANHTLKVVE  276

Query  860   ADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVL  1039
             ADA YVKPFET+ ++IAPGQT NVLLKTK + P + F M+ARPY TGQGTFDN+TVAG+L
Sbjct  277   ADAIYVKPFETNTILIAPGQTTNVLLKTKSHYPNAAFLMSARPYATGQGTFDNTTVAGIL  336

Query  1040  EYEIPS-LNISKNSTKPIAL--PPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKN  1210
             EYEIPS  + S +S K I L  P LP +N TSF + F+ KLRSL + QFPANVPQ VDK+
Sbjct  337   EYEIPSNTHHSASSLKKIPLFKPTLPALNDTSFATKFSKKLRSLASPQFPANVPQKVDKH  396

Query  1211  FFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFP  1390
             FFFTVGLGTNPC  NQTCQGPNGT FAAS+NNVSF  PTTA+LQ++++ +S GVYA  FP
Sbjct  397   FFFTVGLGTNPCQSNQTCQGPNGTMFAASVNNVSFTMPTTALLQSHFTGQSRGVYAPYFP  456

Query  1391  SVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYV  1570
             S PL PFNYTGTPPNNT V N TKV VLPFN +VELV+QDTSILGAESHPLHLHG+NF+V
Sbjct  457   SSPLHPFNYTGTPPNNTMVSNGTKVTVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFV  516

Query  1571  VGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSW  1750
             VGQGFGN+D  KDP N+NLVDPVERNTIGVPSGGW AIRF ADNPGVWFMHCH EVH SW
Sbjct  517   VGQGFGNYDSNKDPKNFNLVDPVERNTIGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSW  576

Query  1751  GLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             GL+MAWIV +GKLPNQKLLPPP+DLPKC
Sbjct  577   GLKMAWIVLDGKLPNQKLLPPPADLPKC  604



>ref|XP_009630096.1| PREDICTED: laccase-17-like [Nicotiana tomentosiformis]
Length=601

 Score =   884 bits (2285),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/585 (71%), Positives = 491/585 (84%), Gaps = 7/585 (1%)
 Frame = +2

Query  86    MGFLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIV  265
             MG+ +H+    +AA     ++  +  P  A       TRHY FNI   NVTRLC TKSIV
Sbjct  22    MGYCYHSCSTSMAASLFFGISIFWLLPQSAFC----TTRHYTFNIVQHNVTRLCTTKSIV  77

Query  266   TVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTG  445
             +VNG+FPGPR++AREGDRV+VKVVNHV NN+SIHWHGIRQ+ +GWADGPAY+TQCPIQT 
Sbjct  78    SVNGRFPGPRLVAREGDRVIVKVVNHVSNNISIHWHGIRQLTSGWADGPAYVTQCPIQTN  137

Query  446   QTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWW  625
             Q+Y YNFTI+GQRGTLFWHAHISWLRAT++GPIIILP+ N SYPF KP+KE+P++FGEWW
Sbjct  138   QSYTYNFTIIGQRGTLFWHAHISWLRATVYGPIIILPQHNESYPFKKPYKEIPILFGEWW  197

Query  626   NVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAA  805
             NVD EAV++QALQ GGGPN+SDAYTING PGPLYNCS+ +TFK+KVKPGKTY+LR+INAA
Sbjct  198   NVDPEAVINQALQTGGGPNVSDAYTINGFPGPLYNCSSKDTFKLKVKPGKTYMLRLINAA  257

Query  806   LNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAAR  985
             LNDE+FF IANHT+T+VEADA Y KPF T+++ I PGQT NVLL+TK   P +TF MAA+
Sbjct  258   LNDEMFFSIANHTLTIVEADAVYSKPFNTNVVFITPGQTTNVLLRTKPYYPNATFLMAAQ  317

Query  986   PYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKPIAL--PPLPPINGTSFVSNFTGKLRS  1159
             PYFTGQGTFDNST AG+LEY+ P LN S  +   I L  P LP I  T FV+NFT K RS
Sbjct  318   PYFTGQGTFDNSTAAGILEYK-PPLNGSPTNKNKIKLFKPTLPNITATGFVANFTKKFRS  376

Query  1160  LGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAIL  1339
             L +++FPANVP+TVDK F FTVGLG++PCPKN TCQGPNGTKFAAS+NNVSF  PTTA+L
Sbjct  377   LASARFPANVPKTVDKRFLFTVGLGSSPCPKNTTCQGPNGTKFAASVNNVSFALPTTALL  436

Query  1340  QAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSI  1519
             Q+++  +SNGVY TDFP+ PL PFNYTGT PNNT V NATK VVLPFN++VE+VLQDT+I
Sbjct  437   QSHFFGQSNGVYTTDFPTNPLNPFNYTGTSPNNTLVTNATKTVVLPFNSSVEVVLQDTNI  496

Query  1520  LGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRAD  1699
             LGAE+HPLHLHGYNF+VVG+GFGNFDP KDPAN+NL DP+ERNT+GVP+GGW A RF AD
Sbjct  497   LGAENHPLHLHGYNFFVVGEGFGNFDPNKDPANFNLKDPIERNTVGVPAGGWIAFRFFAD  556

Query  1700  NPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             NPGVWFMHCHF+VH SWGLRMAWIV +G LP+QKL PPPSDLPKC
Sbjct  557   NPGVWFMHCHFDVHTSWGLRMAWIVLDGPLPSQKLPPPPSDLPKC  601



>ref|XP_006602563.1| PREDICTED: laccase-17-like [Glycine max]
Length=578

 Score =   884 bits (2285),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/570 (73%), Positives = 485/570 (85%), Gaps = 5/570 (1%)
 Frame = +2

Query  137   MIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGD  316
             + + SL  F     A  G+ TRHY F IR QNVTRLCHTKS+VTVNG+FPGPRI+AREGD
Sbjct  10    LFLLSLIIFGIFEHALAGT-TRHYHFEIRHQNVTRLCHTKSMVTVNGQFPGPRIVAREGD  68

Query  317   RVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLF  496
             R+L+KV NHV NN++IHWHGIRQ+++GWADGPAY+TQCPIQ GQ+YVYN+TIVGQRGTL+
Sbjct  69    RLLIKVTNHVSNNITIHWHGIRQLQSGWADGPAYVTQCPIQRGQSYVYNYTIVGQRGTLW  128

Query  497   WHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGG  676
             WHAHISWLR+TL+GP+IILP+ N  YPF KPHKEVP++FGEWWN D EAV++QALQ GGG
Sbjct  129   WHAHISWLRSTLYGPLIILPKLNAQYPFAKPHKEVPIVFGEWWNADPEAVITQALQTGGG  188

Query  677   PNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVV  856
             PN+SDAYTINGLPGPLYNCS  +TFK+KVKPGK YLLR+INAALNDELFF IANHT+TVV
Sbjct  189   PNVSDAYTINGLPGPLYNCSDKDTFKLKVKPGKIYLLRLINAALNDELFFSIANHTLTVV  248

Query  857   EADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGV  1036
             EADA YVKPF T+ ++I PGQT NVLLKTK + P +TF M ARPY +G GTFDN+TVAG+
Sbjct  249   EADAVYVKPFATNTILITPGQTTNVLLKTKSHYPNATFLMTARPYASGLGTFDNTTVAGI  308

Query  1037  LEYEI-PSLNISKNSTK--PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDK  1207
             L+Y+  P+ + S  S K  P+  P LP +N TSF + F  KLRSL ++QFPANVPQ VD 
Sbjct  309   LQYKTPPNTHHSAASLKNLPLLKPILPALNDTSFATKFNNKLRSLASAQFPANVPQKVDT  368

Query  1208  NFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATD  1384
             +FFFTVGLGT PCP+NQTCQGP N TKFAAS+NNVSF+ PTTA+LQ ++  +SNGVY  D
Sbjct  369   HFFFTVGLGTTPCPQNQTCQGPTNATKFAASVNNVSFIQPTTALLQTHFFGQSNGVYTAD  428

Query  1385  FPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNF  1564
             FP+ PL PFNYTGTPPNNT V N TKVVVLPFN +VELV+QDTSILGAESHPLHLHG+NF
Sbjct  429   FPAKPLIPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNF  488

Query  1565  YVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHL  1744
             + VGQGFGNFDP KDPAN+NL+DP+ERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH 
Sbjct  489   FAVGQGFGNFDPNKDPANFNLLDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHT  548

Query  1745  SWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             SWGL+MAW+V +GKLPNQKL PPP+DLPKC
Sbjct  549   SWGLKMAWVVLDGKLPNQKLFPPPADLPKC  578



>ref|XP_010046415.1| PREDICTED: laccase-17-like [Eucalyptus grandis]
 gb|KCW85638.1| hypothetical protein EUGRSUZ_B02428 [Eucalyptus grandis]
Length=585

 Score =   884 bits (2284),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/576 (72%), Positives = 488/576 (85%), Gaps = 5/576 (1%)
 Frame = +2

Query  119   LAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRI  298
             LA  FL+ + +  FFP  A+     VTRHYKF + +QNVTRLC+TKS+VT+NGKFPGPR+
Sbjct  11    LAGFFLVPLFASCFFPDPALVASEGVTRHYKFKVVLQNVTRLCYTKSMVTINGKFPGPRV  70

Query  299   MAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVG  478
             +AREGDR+L++VVNHVPNN+SIHWHG+RQ ++GWADGPAY+TQCPIQT Q+YVYN+TIVG
Sbjct  71    IAREGDRLLIEVVNHVPNNISIHWHGVRQHQSGWADGPAYVTQCPIQTDQSYVYNYTIVG  130

Query  479   QRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQA  658
             QRGTL+WHAHISWLR+TL+G +IILP+ N SYPF KPHKE+P+IFGEW+N DTEA++SQA
Sbjct  131   QRGTLWWHAHISWLRSTLYGSLIILPKHNDSYPFAKPHKEIPIIFGEWFNSDTEAIISQA  190

Query  659   LQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIAN  838
             LQ GGGPN+SDAYTINGLPGPLYNCSA +T+++KVKPGKTYLLR+INA LNDELFF IAN
Sbjct  191   LQTGGGPNVSDAYTINGLPGPLYNCSAKDTYRLKVKPGKTYLLRLINAVLNDELFFSIAN  250

Query  839   HTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDN  1018
             HT+TVVEADA Y+KPFET+ L+IAPGQT NVL+KTK   P +TF M ARPY TG GTFDN
Sbjct  251   HTLTVVEADATYLKPFETETLLIAPGQTTNVLIKTKPYYPKATFLMTARPYVTGLGTFDN  310

Query  1019  STVAGVLEYEIPSLNISKNSTK----PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPAN  1186
             STVAG+LEYE P LN    S      P+  P LPP+N T+F +NFT KLRSL   QFPAN
Sbjct  311   STVAGILEYE-PPLNEPHQSPSIKQLPLFKPTLPPLNDTAFATNFTTKLRSLATPQFPAN  369

Query  1187  VPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSN  1366
             VP  VD+ FFFTV LGT PC  NQTCQGP GT   A++NNVSF  PTTA+LQA+Y+ +SN
Sbjct  370   VPLKVDRRFFFTVSLGTIPCQGNQTCQGPYGTMLTAAVNNVSFTMPTTALLQAHYTGQSN  429

Query  1367  GVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLH  1546
             GVY+ DFPS P + FN+TGTPPNNT V N TK+VVLPFN +VEL++QDTSILGAE HPLH
Sbjct  430   GVYSPDFPSHPKSIFNFTGTPPNNTNVGNGTKLVVLPFNTSVELIMQDTSILGAERHPLH  489

Query  1547  LHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHC  1726
             LHG+NF+VVGQGFGNFDP KDPAN+NLVDPVERNT+GVPSGGW A RF ADNPGVWFMHC
Sbjct  490   LHGFNFFVVGQGFGNFDPNKDPANFNLVDPVERNTVGVPSGGWVATRFLADNPGVWFMHC  549

Query  1727  HFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             H EVH SWG++MAW+V +GKLPNQKLLPPP+DLPKC
Sbjct  550   HLEVHSSWGMKMAWLVLDGKLPNQKLLPPPADLPKC  585



>ref|XP_008222577.1| PREDICTED: laccase-17-like [Prunus mume]
Length=581

 Score =   884 bits (2283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/576 (73%), Positives = 485/576 (84%), Gaps = 5/576 (1%)
 Frame = +2

Query  113   PLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGP  292
             P     FL    +L   P  A+A   S+TRHYKF+I++QNVTRLC TKSIVTVNG+FPGP
Sbjct  9     PSFLTLFLFSFMTLCLSPQHALA---SITRHYKFDIQLQNVTRLCQTKSIVTVNGQFPGP  65

Query  293   RIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTI  472
             RI+AREGD++L+KV+NHV NN+SIHWHGIRQ+R GWADGPAY+TQCPIQTG +YVYNFTI
Sbjct  66    RIVAREGDQLLIKVINHVQNNISIHWHGIRQLRTGWADGPAYVTQCPIQTGHSYVYNFTI  125

Query  473   VGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVS  652
             VGQRGTL+WHAHISWLR+T++GP+IILP+    YPF KP+K VP+IFGEWWN D EAV+S
Sbjct  126   VGQRGTLWWHAHISWLRSTVYGPLIILPKLGVPYPFTKPYKAVPIIFGEWWNADPEAVIS  185

Query  653   QALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRI  832
             QALQ GGGPN+SDAYT+NGLPGPLYNCSA + FK+KV+ GKTYLLR+INAALNDELFF I
Sbjct  186   QALQTGGGPNVSDAYTLNGLPGPLYNCSAKDAFKLKVEAGKTYLLRLINAALNDELFFSI  245

Query  833   ANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTF  1012
             ANHT+ VVEADA YVKPFET  ++IAPGQT NVLLKTK + P +TFF+ ARPY TG GTF
Sbjct  246   ANHTLKVVEADAVYVKPFETHTILIAPGQTTNVLLKTKPSFPNATFFLTARPYVTGLGTF  305

Query  1013  DNSTVAGVLEYEI-PSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANV  1189
             DNSTVAG+LEYE  P+    K    P+  P LP +N TSF + F  KLRSL N+QFPANV
Sbjct  306   DNSTVAGILEYEFPPNTKTLKMKKLPLFKPNLPALNDTSFATKFNDKLRSLNNAQFPANV  365

Query  1190  PQTVDKNFFFTVGLGTNPCPK-NQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSN  1366
             P+ VDK FFFTVGLGTNPC + NQTCQGPNGT FAAS+NN+SF  P TA+LQ+++S +SN
Sbjct  366   PKKVDKRFFFTVGLGTNPCSQHNQTCQGPNGTMFAASINNISFAMPNTALLQSHFSGQSN  425

Query  1367  GVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLH  1546
             GVY  DFP+ P+ PFNYTG PPN+T V N TK+VVLPFN +VELV+QDTSILGAESHPLH
Sbjct  426   GVYTPDFPTNPIIPFNYTGVPPNDTMVSNGTKLVVLPFNTSVELVMQDTSILGAESHPLH  485

Query  1547  LHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHC  1726
             LHG+NF+VVGQGFGNFD  KDPA +NLVDPVERNT+GVPSGGW AIRF ADNPGVWFMHC
Sbjct  486   LHGFNFFVVGQGFGNFDRNKDPAKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHC  545

Query  1727  HFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             H E+H SWGL+MAW+V +GKLPNQKLLPPP+DLPKC
Sbjct  546   HLEIHTSWGLKMAWVVLDGKLPNQKLLPPPADLPKC  581



>ref|XP_010031544.1| PREDICTED: laccase-17-like [Eucalyptus grandis]
 gb|KCW50887.1| hypothetical protein EUGRSUZ_J00532 [Eucalyptus grandis]
Length=585

 Score =   883 bits (2282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/576 (72%), Positives = 492/576 (85%), Gaps = 5/576 (1%)
 Frame = +2

Query  119   LAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRI  298
             LA  FL+      F P  A+     +TRHYKFN+ +QNVTRLCHTKS++T+NGK+PGP++
Sbjct  11    LAGFFLVAFLVSCFCPEPALVAGEGMTRHYKFNVVLQNVTRLCHTKSVITINGKWPGPQV  70

Query  299   MAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVG  478
             +AREGDR+L++VVNHVPNN+SIHWHGIRQ+R+GWADGPAY+TQCPIQTGQ+Y+YN+TIVG
Sbjct  71    IAREGDRLLIEVVNHVPNNISIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYMYNYTIVG  130

Query  479   QRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQA  658
             QRGTL+WHAHISWLR+TL+GP+IILP+ N SYPF KPHKE+P++FGEW+N+DTEA+++QA
Sbjct  131   QRGTLWWHAHISWLRSTLYGPLIILPKHNASYPFVKPHKEIPIVFGEWFNLDTEAIINQA  190

Query  659   LQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIAN  838
             LQ GGGPN+S+AYTINGLPGPLYNCSA +T+++KVKPGKTYLLR+INAALNDELFF IAN
Sbjct  191   LQTGGGPNVSNAYTINGLPGPLYNCSAKDTYRLKVKPGKTYLLRLINAALNDELFFSIAN  250

Query  839   HTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDN  1018
             HT+TVVEADA YVKPFET+ L+IAPGQT NVLLKTK + P + F M ARPY TG GTFDN
Sbjct  251   HTLTVVEADAVYVKPFETETLLIAPGQTTNVLLKTKPHYPKAIFLMTARPYVTGLGTFDN  310

Query  1019  STVAGVLEYEIPSLNISKNSTK----PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPAN  1186
             STVAG+LEY+ P L+    S+     P+  P LPP+N T F +NFT KLRSL   QFPAN
Sbjct  311   STVAGILEYK-PPLDKPHWSSSIKQLPLFKPTLPPLNDTGFATNFTNKLRSLATPQFPAN  369

Query  1187  VPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSN  1366
             VPQ VD+ FFFTVGLGT PC  NQTCQGPNGT F A++NNVSF  PTTA+LQA+Y+ +SN
Sbjct  370   VPQKVDQRFFFTVGLGTMPCQGNQTCQGPNGTMFNAAINNVSFTMPTTALLQAHYTGQSN  429

Query  1367  GVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLH  1546
              VY+ DFPS P + FN+TGT PNNT V N TK+VVLPFN++VEL++QDTSILGAESHPLH
Sbjct  430   RVYSPDFPSYPKSIFNFTGTSPNNTNVGNGTKLVVLPFNSSVELIMQDTSILGAESHPLH  489

Query  1547  LHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHC  1726
             LHG+NF+VVGQGFGNFDP  DP  +NLVDPVERNT+GVPSGGW AIRF ADNPGVWFMHC
Sbjct  490   LHGFNFFVVGQGFGNFDPNNDPGKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHC  549

Query  1727  HFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             H EVH SWGL+MAW+V +GKLPNQKL PPP+DLPKC
Sbjct  550   HLEVHTSWGLKMAWLVLDGKLPNQKLPPPPADLPKC  585



>ref|XP_009760365.1| PREDICTED: laccase-17-like [Nicotiana sylvestris]
Length=580

 Score =   883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/585 (72%), Positives = 490/585 (84%), Gaps = 7/585 (1%)
 Frame = +2

Query  86    MGFLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIV  265
             MG+   +    +AA  L  ++  +  P  A       TRHY FNI   NVTRLC TKSIV
Sbjct  1     MGYCNLSCSTSVAASLLFGISIFWLLPQSAFC----TTRHYTFNIVQHNVTRLCTTKSIV  56

Query  266   TVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTG  445
             +VNG+FPGPR++AREGDRV+VKVVNHV  N+SIHWHGIRQ+ +GWADGPAY+TQCPIQT 
Sbjct  57    SVNGRFPGPRLVAREGDRVIVKVVNHVSKNISIHWHGIRQLTSGWADGPAYVTQCPIQTN  116

Query  446   QTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWW  625
             Q+Y YNFTI+GQRGTLFWHAHISWLRAT++GPIIILPRKN SYPF KP+KE+P+IFGEWW
Sbjct  117   QSYTYNFTIIGQRGTLFWHAHISWLRATVYGPIIILPRKNESYPFKKPYKEIPIIFGEWW  176

Query  626   NVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAA  805
             NVD EAV++QALQ GGGPN+SDAYTING PGPLYNCS+ +TFK +VKPGKTY+LR+INAA
Sbjct  177   NVDPEAVINQALQTGGGPNVSDAYTINGFPGPLYNCSSKDTFKFRVKPGKTYMLRLINAA  236

Query  806   LNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAAR  985
             LNDE+FF IANHT+T+VEADA Y KPF+T+++ I PGQT NVLL+TK   P +TF MAA+
Sbjct  237   LNDEMFFSIANHTLTIVEADAVYTKPFDTNVVFITPGQTTNVLLRTKPFHPNATFLMAAQ  296

Query  986   PYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKPIAL--PPLPPINGTSFVSNFTGKLRS  1159
             PYFTGQGTFDNSTVAG LEY+ P LN S  +   + L  P LP I  T FV+NFT K RS
Sbjct  297   PYFTGQGTFDNSTVAGFLEYK-PPLNGSPTNKNKLKLFKPTLPNITATGFVANFTKKFRS  355

Query  1160  LGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAIL  1339
             L ++QFPANVPQTVDK F FTVGLG++PCPKN TCQGPNGTKFAAS+NNVSF  PTTA+L
Sbjct  356   LASAQFPANVPQTVDKRFLFTVGLGSSPCPKNTTCQGPNGTKFAASVNNVSFALPTTALL  415

Query  1340  QAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSI  1519
             Q+++  +SNGVY TDFP+ PL PFNYTGTPPNNT V NATK VVLPFN++VE+VLQDT+I
Sbjct  416   QSHFFGQSNGVYTTDFPTNPLNPFNYTGTPPNNTLVTNATKTVVLPFNSSVEVVLQDTNI  475

Query  1520  LGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRAD  1699
             LGAE+HPLHLHGYNF+VVG+GFGNFDP KDPAN+NL DP+ERNT+GVP+GGW A RF AD
Sbjct  476   LGAENHPLHLHGYNFFVVGEGFGNFDPNKDPANFNLKDPIERNTVGVPAGGWIAFRFFAD  535

Query  1700  NPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             NPGVWFMHCHF+VH SWGLRMAWIV +G L +QKL PPPSDLPKC
Sbjct  536   NPGVWFMHCHFDVHTSWGLRMAWIVLDGPLQSQKLPPPPSDLPKC  580



>ref|XP_002282815.1| PREDICTED: laccase-17 [Vitis vinifera]
Length=584

 Score =   883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/572 (75%), Positives = 491/572 (86%), Gaps = 6/572 (1%)
 Frame = +2

Query  131   FLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
               +++ SL++ P +A      +TRHYKFNI +QNVTRLCHTKSIV+VNG+FPGP I+ARE
Sbjct  15    LFLVLNSLWYLPELA--NGSGITRHYKFNIELQNVTRLCHTKSIVSVNGQFPGPPIIARE  72

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GDRV+VKVVNHV NNV+IHWHG+RQ+R+GWADGPAY+TQCPIQTGQTYVYNFTI GQRGT
Sbjct  73    GDRVVVKVVNHVQNNVTIHWHGVRQLRSGWADGPAYVTQCPIQTGQTYVYNFTITGQRGT  132

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             LFWHAHISWLR+TL+GPIII P+KN  YPF KP+KEVP+IFGEWWN D EAV++QALQNG
Sbjct  133   LFWHAHISWLRSTLYGPIIIFPKKNVPYPFAKPYKEVPIIFGEWWNTDPEAVITQALQNG  192

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
             GGPN+SD YTINGLPGPLYNCSA +TFK+KVKPGKTYLLR+INAALNDELFF IANHT+T
Sbjct  193   GGPNVSDGYTINGLPGPLYNCSAQDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTLT  252

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VV+ DA YVKPF+TD ++I PGQT N+LLK K + P +TF MAARPY TG GTFDNSTVA
Sbjct  253   VVDVDAIYVKPFKTDTILITPGQTTNLLLKAKPHFPNATFLMAARPYATGSGTFDNSTVA  312

Query  1031  GVLEYEIPSLNISKN---STKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTV  1201
             G+L YE P  +          P+  P LPP+N TSF +NFT KLRSL N+QFPANVPQ V
Sbjct  313   GILHYEPPPKSSPSAPSFENLPLFKPTLPPLNDTSFAANFTRKLRSLANTQFPANVPQKV  372

Query  1202  DKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYA  1378
             DK FFFTVGLGTNPCP+NQTCQGP N T F+AS+NNVSFV PTTAILQA++ ++SNGVY 
Sbjct  373   DKRFFFTVGLGTNPCPQNQTCQGPNNSTMFSASVNNVSFVLPTTAILQAHFFQQSNGVYT  432

Query  1379  TDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGY  1558
             TDFP+ P+ PFNYTGTPPNNT V N TKVVVLPFN +VELVLQDTSILG ESHPLHLHG+
Sbjct  433   TDFPATPIFPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVLQDTSILGIESHPLHLHGF  492

Query  1559  NFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEV  1738
             NF+VVGQGFGNFD KKDP+ +NLVDPVERNT+GVPSGGW AIRF ADNPGVW MHCH EV
Sbjct  493   NFFVVGQGFGNFDAKKDPSKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWLMHCHLEV  552

Query  1739  HLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             H SWGL+M WIVK+GK+PNQKL PPPSDLPKC
Sbjct  553   HTSWGLKMGWIVKDGKMPNQKLPPPPSDLPKC  584



>gb|AES79165.2| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=580

 Score =   881 bits (2277),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/571 (73%), Positives = 485/571 (85%), Gaps = 4/571 (1%)
 Frame = +2

Query  131   FLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
             F +I  SL  F    +A  G +TRHY F+IR QNVTRLCH+KS+VTVNG+FPGPRI+ARE
Sbjct  11    FPLIFLSLINFCTFELALAG-ITRHYHFDIRYQNVTRLCHSKSMVTVNGQFPGPRIVARE  69

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GDR+++KVVNHV NN+SIHWHGIRQ+++GWADGPAY+TQCPIQT Q+YVYN+TI GQRGT
Sbjct  70    GDRLIIKVVNHVQNNISIHWHGIRQLQSGWADGPAYVTQCPIQTDQSYVYNYTIKGQRGT  129

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             LFWHAHISWLR+TL+GP+IILP+KN  YPF KPHKEV ++FGEW+N D EA+++QALQ G
Sbjct  130   LFWHAHISWLRSTLYGPLIILPKKNDQYPFAKPHKEVLILFGEWFNADPEAIIAQALQTG  189

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
             GGPN+SDAYTINGLPGPLYNCSAN+TFK+KVKPGKTYLLR+INAALNDELFF IANHT+ 
Sbjct  190   GGPNVSDAYTINGLPGPLYNCSANDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTLK  249

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VVEADA YVKPFET+ + IAPGQT NVLL TK + P + F M ARPY  G G FDN+TVA
Sbjct  250   VVEADAIYVKPFETNTIYIAPGQTTNVLLNTKSHYPNAAFLMTARPYAAGPGPFDNTTVA  309

Query  1031  GVLEYEI-PSLNISKNSTK--PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTV  1201
              +LEYEI P+ + S +S K  P+  P LP  N TSF + F+ KLRSL ++QFPANVP+ +
Sbjct  310   AILEYEIPPNTHHSASSLKKHPLFKPILPAFNDTSFATKFSNKLRSLASAQFPANVPKKI  369

Query  1202  DKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYAT  1381
             DK+FFFTVG+GTNPC  NQTCQG NGT F AS+NNVSF  PTTA+LQ+++  ++NG+Y T
Sbjct  370   DKHFFFTVGIGTNPCQSNQTCQGLNGTMFVASMNNVSFTMPTTALLQSHFFGQNNGIYTT  429

Query  1382  DFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYN  1561
             DFPS PL PFNYTGTPPNNT V N TKVVVLPFN +VELV+QDTSILGAESHPLHLHG+N
Sbjct  430   DFPSKPLNPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFN  489

Query  1562  FYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVH  1741
             F+VVGQGFGN+D  KDP  +NLVDPVERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH
Sbjct  490   FFVVGQGFGNYDSNKDPQKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVH  549

Query  1742  LSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
              SWGL MAWIV +GKLPNQKLLPPP+DLPKC
Sbjct  550   TSWGLSMAWIVLDGKLPNQKLLPPPADLPKC  580



>gb|AAB17194.1| laccase [Liriodendron tulipifera]
Length=585

 Score =   881 bits (2276),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/565 (74%), Positives = 494/565 (87%), Gaps = 4/565 (1%)
 Frame = +2

Query  152   LFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVK  331
             +F FP ++ AKH  +TRHYKFNIR+QNVTRLCHTKSIVTVNG+FPGP+I AREGDRV+VK
Sbjct  21    IFLFPELSHAKHAGITRHYKFNIRLQNVTRLCHTKSIVTVNGRFPGPKIFAREGDRVVVK  80

Query  332   VVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHI  511
             VVNHV NN+++HWHG+RQ+R+GWADGPAY+TQCPIQTGQTYVYNF I+ QRGTLFWHAHI
Sbjct  81    VVNHVQNNITLHWHGVRQLRSGWADGPAYVTQCPIQTGQTYVYNFRIISQRGTLFWHAHI  140

Query  512   SWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISD  691
             SWLRAT++GPI+ILP+    YPF KP+KEVP+IFGEW+N DTEA+++QALQ GGGPN+SD
Sbjct  141   SWLRATIYGPIVILPKHGVPYPFIKPYKEVPIIFGEWFNADTEAIITQALQTGGGPNVSD  200

Query  692   AYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAG  871
             AYTINGLPGPLYNCSA +TF++ VKPGKTYLLR+INAALNDELFF IANHT+T+V+ DA 
Sbjct  201   AYTINGLPGPLYNCSARDTFRLSVKPGKTYLLRLINAALNDELFFSIANHTLTIVDVDAI  260

Query  872   YVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEI  1051
             YVKPF+TD+L+I PGQT NVLLKTK + P +TFFM+ARPY TG+GTFDN+T  G+LEY+ 
Sbjct  261   YVKPFDTDILLITPGQTTNVLLKTKPHYPNATFFMSARPYATGRGTFDNTTTVGILEYQK  320

Query  1052  PSLNISKNSTK----PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFF  1219
             P+ +   N+      P+  P LP +N T+F +N+T +LRSL N+QFPANVPQTVD+ FFF
Sbjct  321   PNSSHPSNAIGIKNLPLFRPSLPGLNDTAFAANYTRRLRSLANAQFPANVPQTVDRRFFF  380

Query  1220  TVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVP  1399
             TVGLGT PCPKNQTCQGPNGTKFAAS+NNVSFV PTTA+LQ ++  +SNGVY T+FP+ P
Sbjct  381   TVGLGTQPCPKNQTCQGPNGTKFAASVNNVSFVLPTTALLQTHFFGQSNGVYTTNFPTNP  440

Query  1400  LTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQ  1579
               PFNYTGTPPNNT V N TKVVVLPFN +VELV+QDTSI GAESHPLHLHG+NF+VVGQ
Sbjct  441   PFPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVMQDTSIQGAESHPLHLHGFNFFVVGQ  500

Query  1580  GFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLR  1759
             GFGN++P KDP+N+NL+DPVERNT+GVP+GGW AIRF+ DNPGVWFMHCH EVH SWGL+
Sbjct  501   GFGNYNPNKDPSNFNLIDPVERNTVGVPAGGWVAIRFQTDNPGVWFMHCHLEVHTSWGLK  560

Query  1760  MAWIVKEGKLPNQKLLPPPSDLPKC  1834
             MAW+V +GKLPNQKL  PPSDLPKC
Sbjct  561   MAWVVLDGKLPNQKLPSPPSDLPKC  585



>ref|XP_010039666.1| PREDICTED: laccase-17-like [Eucalyptus grandis]
 gb|KCW45808.1| hypothetical protein EUGRSUZ_L00359 [Eucalyptus grandis]
Length=585

 Score =   880 bits (2275),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/576 (72%), Positives = 486/576 (84%), Gaps = 5/576 (1%)
 Frame = +2

Query  119   LAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRI  298
             LA  FL+ + +  FFP  A+     VTRHYKF + +QNVTRLC+TKS+VT+NGKFPGPR+
Sbjct  11    LAGFFLVALFASCFFPDPALVASEGVTRHYKFKVVLQNVTRLCYTKSMVTINGKFPGPRV  70

Query  299   MAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVG  478
             + REGDR+L++VVNHVPNN+SIHWHG+RQ ++GWADGPAY+TQCPIQT Q+YVYN+TIVG
Sbjct  71    IVREGDRLLIEVVNHVPNNISIHWHGVRQHQSGWADGPAYVTQCPIQTDQSYVYNYTIVG  130

Query  479   QRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQA  658
             QRGTL+WHAHISWLR+TL+G +IILP+ N SYPF KPHKE+P+IFGEW+N +TEA++SQA
Sbjct  131   QRGTLWWHAHISWLRSTLYGSLIILPKHNDSYPFAKPHKEIPIIFGEWFNSNTEAIISQA  190

Query  659   LQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIAN  838
             LQ GGGPN+SDAYTINGLPGPLYNCSA +T+++KVKPGKTYLLR+INA LNDELFF IAN
Sbjct  191   LQTGGGPNVSDAYTINGLPGPLYNCSAKDTYRLKVKPGKTYLLRLINAVLNDELFFSIAN  250

Query  839   HTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDN  1018
             HT+TVVEADA Y+KPFET+ L+IAPGQT NVL+KTK   P +TF M ARPY TG GTFDN
Sbjct  251   HTLTVVEADATYLKPFETETLLIAPGQTTNVLIKTKPYYPKATFLMTARPYVTGLGTFDN  310

Query  1019  STVAGVLEYEIPSLNISKNSTK----PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPAN  1186
             STVAG+LEYE P LN    S      P+  P LPP+N  +F +NFT KLRSL   QFPAN
Sbjct  311   STVAGILEYE-PPLNEPHQSPSIKQLPLFKPTLPPLNDRAFATNFTTKLRSLATPQFPAN  369

Query  1187  VPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSN  1366
             VP  VD+ FFFTV LGT PC  NQTCQGP GT   A++NNVSF  PTTA+LQA+Y+ +SN
Sbjct  370   VPLKVDRRFFFTVSLGTIPCQGNQTCQGPYGTMLTAAVNNVSFTMPTTALLQAHYTGQSN  429

Query  1367  GVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLH  1546
             GVY+ DFPS P + FN+TGTPPNNT V N TKVVVLPFN +VEL++QDTSILGAE HPLH
Sbjct  430   GVYSPDFPSHPKSIFNFTGTPPNNTNVGNGTKVVVLPFNTSVELIMQDTSILGAERHPLH  489

Query  1547  LHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHC  1726
             LHG+NF+VVGQGFGNFDP KDPAN+NLVDPVERNT+GVPSGGW A RF ADNPGVWFMHC
Sbjct  490   LHGFNFFVVGQGFGNFDPNKDPANFNLVDPVERNTVGVPSGGWVATRFLADNPGVWFMHC  549

Query  1727  HFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             H EVH SWG++MAW+V +GKLPNQKLLPPP+DLPKC
Sbjct  550   HLEVHSSWGMKMAWLVLDGKLPNQKLLPPPADLPKC  585



>ref|XP_008785574.1| PREDICTED: laccase-17-like [Phoenix dactylifera]
Length=584

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/575 (73%), Positives = 491/575 (85%), Gaps = 2/575 (0%)
 Frame = +2

Query  116   LLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPR  295
             LL A F+    +L        A+   +TRHY+F+IRM NVTRLCHTKSIVTVNG+FPGP+
Sbjct  10    LLVAAFMFSTLTLLLSLDGVRAQQTGITRHYRFDIRMANVTRLCHTKSIVTVNGQFPGPK  69

Query  296   IMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIV  475
             I+AREGDRV+VKVVNHV  NV++HWHG+RQ+R+GWADGPAY+TQCPI+ GQ+YVYNFTIV
Sbjct  70    IVAREGDRVVVKVVNHVQYNVTLHWHGVRQLRSGWADGPAYVTQCPIRRGQSYVYNFTIV  129

Query  476   GQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQ  655
              QRGTLFWHAHISWLRATL+GPIIILP +   YPF KP+KEVP++FGEWWN DTEAV+SQ
Sbjct  130   AQRGTLFWHAHISWLRATLYGPIIILPARGVPYPFSKPYKEVPIVFGEWWNADTEAVISQ  189

Query  656   ALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIA  835
             ALQ GGGPN+SDAYTINGLPGPLYNCSA +TFK+KVKPGKTYLLRMINAALNDELFF IA
Sbjct  190   ALQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRMINAALNDELFFSIA  249

Query  836   NHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFD  1015
             NHT+T+V+ DA YVKPF+TD L+IAPGQT NVLL++K + P +TF MAARPY TG GTFD
Sbjct  250   NHTLTIVDVDAVYVKPFDTDTLIIAPGQTTNVLLRSKPSFPHATFLMAARPYATGSGTFD  309

Query  1016  NSTVAGVLEYEIP--SLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANV  1189
             NSTVAG LEY+ P  S   S +   P+  P LP +N T+FV+NFT +LRSL  +QFPA V
Sbjct  310   NSTVAGFLEYQDPKTSSTASFDKKLPLFKPSLPSLNDTAFVANFTSRLRSLATAQFPAKV  369

Query  1190  PQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNG  1369
             P+TV++ FFFTVGLGT+PCPKNQTCQGPNGTKFAA+++N+SF  PTTA+LQA++  +S  
Sbjct  370   PRTVERQFFFTVGLGTSPCPKNQTCQGPNGTKFAATVSNISFAMPTTALLQAHFFGQSKR  429

Query  1370  VYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHL  1549
             VY+ DFP  PL PFNYTG+PPNNT V N TK++VLP+N TVELV+QDTSILGAESHPLHL
Sbjct  430   VYSPDFPYSPLIPFNYTGSPPNNTLVSNGTKLMVLPYNTTVELVMQDTSILGAESHPLHL  489

Query  1550  HGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCH  1729
             HG+NF+VVGQGFGN++P KDPA +NLVDPVERNT+GVP+GGW AIRFRADNPGVWFMHCH
Sbjct  490   HGFNFFVVGQGFGNYNPAKDPARFNLVDPVERNTVGVPAGGWVAIRFRADNPGVWFMHCH  549

Query  1730  FEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
              EVH SWGL+MAW+V +G LPNQKL PPPSDLP+C
Sbjct  550   LEVHTSWGLKMAWLVLDGSLPNQKLPPPPSDLPRC  584



>ref|XP_010541373.1| PREDICTED: laccase-17 [Tarenaya hassleriana]
Length=649

 Score =   879 bits (2272),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/574 (71%), Positives = 490/574 (85%), Gaps = 10/574 (2%)
 Frame = +2

Query  131   FLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
             F +++  L   P  A      +TRHYK  I+MQNVTRLCHT+SIV+VNG+FPGPR++ARE
Sbjct  80    FYVLVCILIVLPRPAFG----ITRHYKLEIKMQNVTRLCHTRSIVSVNGQFPGPRLVARE  135

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GDR+L+KVVNHV NN+SIHWHGIRQ+R+GWADGPAYITQCPIQTGQ+YVYN+TI+GQRGT
Sbjct  136   GDRLLIKVVNHVSNNISIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIIGQRGT  195

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             L++HAH+SWLR+T++GP+IILP++   YPF KP+KE+PMIFGEW+N D EA+++QAL+ G
Sbjct  196   LWYHAHVSWLRSTIYGPLIILPKRGVPYPFAKPYKEIPMIFGEWFNADPEAIINQALKTG  255

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
             GGPN+SDAYTINGLPGPLYNCSA +TF+++V+PGKTYLLR++NAALNDELFF IANHTVT
Sbjct  256   GGPNVSDAYTINGLPGPLYNCSAKDTFRLRVRPGKTYLLRLMNAALNDELFFSIANHTVT  315

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VVEADA YVKPFETD ++IAPGQT NVLLKTK   P ++FFM ARPY TGQGTFDNSTVA
Sbjct  316   VVEADAIYVKPFETDTILIAPGQTTNVLLKTKSQYPKASFFMTARPYVTGQGTFDNSTVA  375

Query  1031  GVLEYEIPSLNI---SKNSTKPIAL--PPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQ  1195
             G+LEYE P       SK S K + L  P LP +N T+F + F  KLRSL + +FPA VP+
Sbjct  376   GILEYEPPKSTKAIHSKTSIKNLQLLKPVLPALNDTNFATAFINKLRSLNSKRFPATVPK  435

Query  1196  TVDKNFFFTVGLGTNPCP-KNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGV  1372
              VD+ FFFTVGLGTNPC  KNQ+CQGPNGT FAAS+NN+SF+ PTTA+LQ++YS +S+GV
Sbjct  436   EVDQKFFFTVGLGTNPCSQKNQSCQGPNGTMFAASVNNISFIMPTTALLQSHYSGQSHGV  495

Query  1373  YATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLH  1552
             Y+  FP  PL PFNYTG PPNNT V N TK++VLPFN +VELV+QDTSILGAESHPLHLH
Sbjct  496   YSPYFPHDPLIPFNYTGNPPNNTMVSNGTKLLVLPFNTSVELVMQDTSILGAESHPLHLH  555

Query  1553  GYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHF  1732
             G+NF+VVGQGFGNFDPKKDP N+NLVDP+ERNT+GVPSGGW AIRF ADNPGVWFMHCH 
Sbjct  556   GFNFFVVGQGFGNFDPKKDPKNFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHL  615

Query  1733  EVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             EVH SWGL+MAW+V +G  P+QKLLPPP+DLP+C
Sbjct  616   EVHTSWGLKMAWLVLDGDTPDQKLLPPPADLPRC  649



>emb|CDP06592.1| unnamed protein product [Coffea canephora]
Length=563

 Score =   879 bits (2272),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/554 (74%), Positives = 481/554 (87%), Gaps = 10/554 (2%)
 Frame = +2

Query  194   VTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWH  373
             +TRHY+ NI M NVTRLCHTKS+V VNG+FPGPRI+AREGDR+L+KV NHV NN++IHWH
Sbjct  13    ITRHYELNITMLNVTRLCHTKSLVAVNGQFPGPRIVAREGDRLLIKVNNHVSNNITIHWH  72

Query  374   GIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIIL  553
             GIRQ+R+GWADGPAYITQCPIQTGQ+YVYN+TIVGQRGTLFWHAHISW+RAT++GP+IIL
Sbjct  73    GIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRGTLFWHAHISWIRATVYGPLIIL  132

Query  554   PRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNC  733
             P+++  YPF KPH+EVP+IFGEW+N DTEA++SQALQ GGGPN+SDAYT+NGLPGPLYNC
Sbjct  133   PKRHVQYPFAKPHEEVPVIFGEWFNADTEAIISQALQTGGGPNVSDAYTLNGLPGPLYNC  192

Query  734   SANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAP  913
             SA +TFK+KVK GKTYLLR+INAALNDELFF IANHT+TVVEADA YVKPFETD ++I P
Sbjct  193   SAKDTFKLKVKAGKTYLLRLINAALNDELFFSIANHTLTVVEADALYVKPFETDTILITP  252

Query  914   GQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKPIA  1093
             GQT NVLLKTK   P +TF M ARPY TG  TFDNSTVAG+LEYE    + S +S+ P++
Sbjct  253   GQTTNVLLKTKPQFPAATFLMLARPYATGAATFDNSTVAGILEYE---QSPSPDSSTPVS  309

Query  1094  L-------PPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPK  1252
             +       P LP +N T+F +NF  KLRSL N Q+PANVPQ +D++FFFTVGLGT+PC +
Sbjct  310   VMKLPLFRPTLPALNDTAFAANFLNKLRSLANRQYPANVPQNIDEHFFFTVGLGTSPCDQ  369

Query  1253  NQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPP  1432
              Q CQGPNGTKFAAS+NN+SF  PTTA+LQ+++S +S+GVY+ DFP  PL  FNYTG PP
Sbjct  370   TQGCQGPNGTKFAASVNNISFAQPTTALLQSHFSGQSSGVYSPDFPYNPLRWFNYTGNPP  429

Query  1433  NNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDP  1612
             NNT V NATKV+VLPFN +VEL++QDTSILGAESHPLHLHG+NF+VVGQGFGN+DP KDP
Sbjct  430   NNTMVGNATKVMVLPFNTSVELIMQDTSILGAESHPLHLHGFNFFVVGQGFGNYDPNKDP  489

Query  1613  ANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLP  1792
              N+NLVDPVERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH SWGL+MAW+V +GKL 
Sbjct  490   KNFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLR  549

Query  1793  NQKLLPPPSDLPKC  1834
             NQKLLPPP+DLPKC
Sbjct  550   NQKLLPPPADLPKC  563



>ref|XP_008358843.1| PREDICTED: laccase-17-like [Malus domestica]
Length=580

 Score =   879 bits (2272),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/579 (72%), Positives = 487/579 (84%), Gaps = 10/579 (2%)
 Frame = +2

Query  116   LLAACFLMIMTSLFFFPHMAVAKH----GSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKF  283
             LLA+ FL     LF F  +    H      +T HYKF I+ Q VTRLCHTKSIVTVNG+F
Sbjct  6     LLASPFL----RLFLFSFVMCLXHQHALAGITXHYKFEIKQQKVTRLCHTKSIVTVNGQF  61

Query  284   PGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYN  463
             PGP+I+AREGD++L+KVVNHV NN+SIHWHGIRQ+++GWADGPAY+TQCPIQTG +YVYN
Sbjct  62    PGPKIIAREGDQLLIKVVNHVQNNISIHWHGIRQLQSGWADGPAYVTQCPIQTGNSYVYN  121

Query  464   FTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEA  643
             FTI GQRGTLFWHAHISWLR+T++GP+IILP+ +  YPF KP+KEVP+IFGEWWN + EA
Sbjct  122   FTITGQRGTLFWHAHISWLRSTVYGPLIILPKXSVPYPFTKPYKEVPIIFGEWWNABPEA  181

Query  644   VVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELF  823
             ++SQALQ GGGPN+SDAYTING PGPLYNCSA + FK+KV+PGKTYLLR+INAALNDELF
Sbjct  182   IISQALQTGGGPNVSDAYTINGFPGPLYNCSAKDAFKLKVQPGKTYLLRLINAALNDELF  241

Query  824   FRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQ  1003
             F IANHT+ VVEADA YVKPFET  ++IAPGQT NVLLKTK N P +TFFM ARP+ TGQ
Sbjct  242   FSIANHTLKVVEADAIYVKPFETRTILIAPGQTTNVLLKTKPNFPNATFFMTARPFVTGQ  301

Query  1004  GTFDNSTVAGVLEYEIPSLNISKNSTK-PIALPPLPPINGTSFVSNFTGKLRSLGNSQFP  1180
             GTFDN+TVAG+LEY+ PS   + N+ + P+  P LP +N TSF + F  KLRSL   QFP
Sbjct  302   GTFDNTTVAGILEYDSPSKTKTLNTKRLPLLKPNLPALNDTSFATKFANKLRSLNTPQFP  361

Query  1181  ANVPQTVDKNFFFTVGLGTNPCPK-NQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSR  1357
             ANVPQ VDK+FFFT+GLGTNPC + NQ CQGPNGT FAAS+NN+SF  P TA+LQ+++S 
Sbjct  362   ANVPQKVDKHFFFTIGLGTNPCSQNNQRCQGPNGTMFAASVNNISFAMPNTALLQSHFSG  421

Query  1358  KSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESH  1537
             +S+GVY  DFP+ P+TPFNYTG PPN+T V N TK++VLPFN+ VELV+QDTSILGAESH
Sbjct  422   QSSGVYTPDFPTNPITPFNYTGPPPNDTMVSNGTKLMVLPFNSRVELVMQDTSILGAESH  481

Query  1538  PLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWF  1717
             PLHLHG+NF+VVGQGFGNFDP KDP  +NLVDPVERNT+GVPSGGW AIRF ADNPGVWF
Sbjct  482   PLHLHGFNFFVVGQGFGNFDPNKDPKKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWF  541

Query  1718  MHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             MHCH E+H SWGL+M W+V +GKLPNQKLLPPP+DLPKC
Sbjct  542   MHCHLEIHTSWGLKMGWVVLDGKLPNQKLLPPPADLPKC  580



>ref|XP_010535559.1| PREDICTED: laccase-17 [Tarenaya hassleriana]
Length=580

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/587 (71%), Positives = 490/587 (83%), Gaps = 21/587 (4%)
 Frame = +2

Query  92    FLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTV  271
               F+AF     AC L+++    F           +TRHYK  I+MQNVTRLCHT+SIV+V
Sbjct  9     LFFYAF-----ACILIVLPRPAF----------GITRHYKLEIKMQNVTRLCHTRSIVSV  53

Query  272   NGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQT  451
             NG+FPGPR++AREGDR+L+KV+NHVPNN+S+HWHGIRQ+R+GWADGPAYITQCPIQTGQ+
Sbjct  54    NGQFPGPRLVAREGDRLLIKVMNHVPNNISMHWHGIRQLRSGWADGPAYITQCPIQTGQS  113

Query  452   YVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNV  631
             YVYN+T+VGQRGTL++HAHISWLR+TL+GPIIILP+    YPF KP+KEVPMIFGEW+N 
Sbjct  114   YVYNYTVVGQRGTLWYHAHISWLRSTLYGPIIILPKYGVPYPFEKPYKEVPMIFGEWFNA  173

Query  632   DTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALN  811
             D EA+++QALQ GGGPN+SDAYTINGLPGPLYNCSA +TFK++V+PGKTYLLR+INAALN
Sbjct  174   DPEAIINQALQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLRVRPGKTYLLRLINAALN  233

Query  812   DELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPY  991
             DELFF IANHTVTVVEADA YVKPFETD ++IAPGQT NVLLKTK   P +TF M ARPY
Sbjct  234   DELFFSIANHTVTVVEADAIYVKPFETDTILIAPGQTTNVLLKTKPKYPSATFLMTARPY  293

Query  992   FTGQGTFDNSTVAGVLEYEIP---SLNISKNSTK--PIALPPLPPINGTSFVSNFTGKLR  1156
              TGQGTFDNSTVAG+LEYE P       SK S K  P+  P LP +N T+F + F  +LR
Sbjct  294   VTGQGTFDNSTVAGILEYEQPRNAKAIHSKTSIKNLPLFKPVLPALNDTNFATKFVNQLR  353

Query  1157  SLGNSQFPANVPQTVDKNFFFTVGLGTNPCP-KNQTCQGPNGTKFAASLNNVSFVTPTTA  1333
             SL + ++PANVP+ VD+ FFFTVGLGTNPC  KNQTCQGPNGT FAAS+NN+SF  PT A
Sbjct  354   SLDSKKYPANVPKEVDQKFFFTVGLGTNPCSTKNQTCQGPNGTMFAASINNISFTMPTAA  413

Query  1334  ILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDT  1513
             +LQ++Y  +SNGVY TDFP  PL PFNYTG PPNNT V N TK++VLPFN +VELV+QDT
Sbjct  414   LLQSHYFGRSNGVYRTDFPFDPLFPFNYTGNPPNNTMVSNGTKLLVLPFNTSVELVMQDT  473

Query  1514  SILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFR  1693
             SILG ESHPLHLHG+NF+VVGQGFGNF+PKKDP N+N+VDP+ERNT+GVPSGGW AIRF 
Sbjct  474   SILGLESHPLHLHGFNFFVVGQGFGNFNPKKDPKNFNVVDPIERNTVGVPSGGWVAIRFL  533

Query  1694  ADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             ADNPGVWFMHCH EVH SWGL+MAW+V +G   NQKLLPPP+DLPKC
Sbjct  534   ADNPGVWFMHCHLEVHTSWGLKMAWLVLDGDKSNQKLLPPPADLPKC  580



>gb|AAB17192.1| laccase [Liriodendron tulipifera]
Length=585

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/562 (74%), Positives = 495/562 (88%), Gaps = 4/562 (1%)
 Frame = +2

Query  161   FPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVN  340
             FP +A A    +TRHYKF+IR+QNVTRLCHTKSIVTVNG+FPGP+I+AREGDRV+VKVVN
Sbjct  24    FPEIARANQEGITRHYKFDIRLQNVTRLCHTKSIVTVNGQFPGPKIVAREGDRVVVKVVN  83

Query  341   HVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWL  520
             HV NN+++HWHG+RQ+R+GWADGPAY+TQCPIQTGQTYVYNFTI+GQ GTLFWHAHISWL
Sbjct  84    HVQNNITLHWHGVRQLRSGWADGPAYVTQCPIQTGQTYVYNFTIIGQTGTLFWHAHISWL  143

Query  521   RATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYT  700
             R+TL+GPI+ILP++   YPF KP+KEV +IFGEW+NVDTEA+++QALQ GGGPN+SDAYT
Sbjct  144   RSTLYGPIVILPKRGIPYPFIKPYKEVSIIFGEWFNVDTEAIITQALQTGGGPNVSDAYT  203

Query  701   INGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVK  880
             INGLPGPLYNCSA +TF++ VKPGKTYLLR+INAALNDELFF IANHT+T+V+ DA YVK
Sbjct  204   INGLPGPLYNCSARDTFRLSVKPGKTYLLRLINAALNDELFFSIANHTLTIVDVDAVYVK  263

Query  881   PFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSL  1060
             PF+T++L+I PGQT NVL+KTK + P +TFFM ARPY TG GTFDNST  G+LEY+ P+ 
Sbjct  264   PFDTNILLITPGQTTNVLIKTKPHYPNATFFMGARPYATGLGTFDNSTTVGLLEYQKPNS  323

Query  1061  NISKNSTK----PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVG  1228
             + S N+      P+  P LP +N T+F +N+T +LRSL N+QFPANVPQT++K+FFFTVG
Sbjct  324   SHSSNAVGMKQLPLFRPSLPSLNDTAFAANYTKRLRSLANAQFPANVPQTINKSFFFTVG  383

Query  1229  LGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTP  1408
             LG+ PCPKNQTCQGPNGTKFAAS+NNVSFV PTTA+LQ ++  +SNGVY  +FP+ P  P
Sbjct  384   LGSEPCPKNQTCQGPNGTKFAASVNNVSFVMPTTALLQGHFFGQSNGVYTANFPTNPQFP  443

Query  1409  FNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFG  1588
             FNYTGTPPNNT V N TKVVVLPFNA+VELV+QDTSILGAESHPLHLHG+NF+VVGQGFG
Sbjct  444   FNYTGTPPNNTMVSNGTKVVVLPFNASVELVMQDTSILGAESHPLHLHGFNFFVVGQGFG  503

Query  1589  NFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAW  1768
             N++P KDP+N+NLVDPVERNT+GVPSG W AIRF+ADNPGVWFMHCH EVH SWGL+MAW
Sbjct  504   NYNPNKDPSNFNLVDPVERNTVGVPSGSWVAIRFQADNPGVWFMHCHLEVHTSWGLKMAW  563

Query  1769  IVKEGKLPNQKLLPPPSDLPKC  1834
             +V +GKLPNQKL PPPSDLPKC
Sbjct  564   VVLDGKLPNQKLPPPPSDLPKC  585



>gb|EYU26609.1| hypothetical protein MIMGU_mgv1a003496mg [Erythranthe guttata]
Length=581

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/574 (71%), Positives = 489/574 (85%), Gaps = 1/574 (0%)
 Frame = +2

Query  116   LLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPR  295
             L++    M +TSL     +      ++TRHY+FNI+MQ VTRLCHTKSIVTVNGKFPGPR
Sbjct  8     LVSTTGFMFLTSLIMALSLFPQPAQAITRHYEFNIKMQKVTRLCHTKSIVTVNGKFPGPR  67

Query  296   IMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIV  475
             ++AREGDR+++KV N+V NN++IHWHGIRQ+R+GWADGPAY+TQCPIQTGQ+YVYNFT+V
Sbjct  68    VVAREGDRLVIKVKNNVSNNITIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNFTVV  127

Query  476   GQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQ  655
             GQRGTL+WHAHISWLR+TL+GP+IILP+ N  YPF KP+KEVP+IFGEW+N DTEA++SQ
Sbjct  128   GQRGTLWWHAHISWLRSTLYGPLIILPKANVPYPFQKPYKEVPIIFGEWFNADTEAIISQ  187

Query  656   ALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIA  835
             ALQ GGGPN+SDAYTINGLPGPLYNCSA +TFK++VKPGKTYLLR+INAALNDELFF IA
Sbjct  188   ALQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLRVKPGKTYLLRLINAALNDELFFSIA  247

Query  836   NHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFD  1015
             NH++TVV+ADA YVKPFETD +++ PGQT NVLLKTK N P +TF M ARPY TGQGTFD
Sbjct  248   NHSLTVVDADAVYVKPFETDTILLTPGQTSNVLLKTKPNYPGATFLMTARPYVTGQGTFD  307

Query  1016  NSTVAGVLEYEIPSL-NISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVP  1192
             NSTVA +LEYE P L +++     P+    LPP+N TSFV+ F  KLRSL + ++PANVP
Sbjct  308   NSTVAAILEYESPFLHSVASMKKLPLYRSILPPLNDTSFVTKFAKKLRSLDSREYPANVP  367

Query  1193  QTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGV  1372
             Q VDK F FTVGLGT+PC +N TCQGPNG++FAAS++N+SFV  TTA+LQA+Y+ +S+GV
Sbjct  368   QKVDKQFLFTVGLGTSPCGQNNTCQGPNGSRFAASVSNISFVQSTTALLQAHYTGQSSGV  427

Query  1373  YATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLH  1552
             Y+ DFP  P   FNYTG PPNNT V N TK++VLP+N++VELV+QDTSILGAESHPLHLH
Sbjct  428   YSPDFPFSPKNWFNYTGNPPNNTIVANGTKLMVLPYNSSVELVMQDTSILGAESHPLHLH  487

Query  1553  GYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHF  1732
             G+NF+VVG GFGN++P  DP  +NLVDPVERNT+GVPSGGW AIRF ADNPGVWFMHCH 
Sbjct  488   GFNFFVVGLGFGNYNPNTDPQKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHL  547

Query  1733  EVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             EVH SWGL+MAW+V +G LPNQKLLPPPSDLPKC
Sbjct  548   EVHTSWGLKMAWLVLDGNLPNQKLLPPPSDLPKC  581



>ref|XP_007207546.1| hypothetical protein PRUPE_ppa017421mg [Prunus persica]
 gb|EMJ08745.1| hypothetical protein PRUPE_ppa017421mg [Prunus persica]
Length=581

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/585 (71%), Positives = 489/585 (84%), Gaps = 6/585 (1%)
 Frame = +2

Query  86    MGFLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIV  265
             MG    + PP L   FL    +L   P  A+A   S+TRHYKF+I++QNVTRLC TKSIV
Sbjct  1     MGVPLISSPPFLT-LFLFSFMTLCLSPQHALA---SITRHYKFDIKLQNVTRLCQTKSIV  56

Query  266   TVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTG  445
             TVNG+FPGPRI+AREGD++L+KV+NHV NN+S+HWHGIRQ+R GWADGPAY+TQCPIQTG
Sbjct  57    TVNGQFPGPRIVAREGDQLLIKVINHVQNNISVHWHGIRQLRTGWADGPAYVTQCPIQTG  116

Query  446   QTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWW  625
              +YVYNFTIVGQRGTL+WHAHISWLR+T++GP+IILP+    YPF KP+K VP+IFGEWW
Sbjct  117   HSYVYNFTIVGQRGTLWWHAHISWLRSTVYGPLIILPKLGVPYPFTKPYKAVPIIFGEWW  176

Query  626   NVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAA  805
             N D EAV+SQALQ GGGPN+SDAYT+NGLPGPLYNCSA + FK+KV+ GKTYLLR+INAA
Sbjct  177   NADPEAVISQALQTGGGPNVSDAYTLNGLPGPLYNCSAKDAFKLKVEAGKTYLLRLINAA  236

Query  806   LNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAAR  985
             LNDELFF IANHT+ VVEADA YVKPFET  ++IAPGQT NVLLKTK + P +TFF+ AR
Sbjct  237   LNDELFFSIANHTLKVVEADAVYVKPFETHTILIAPGQTTNVLLKTKPSFPNATFFLTAR  296

Query  986   PYFTGQGTFDNSTVAGVLEYEI-PSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSL  1162
             PY TG GTFDNSTVAG+L YE  P+    K    P+  P LP +N TSF + F  KLRSL
Sbjct  297   PYVTGLGTFDNSTVAGILVYEFPPNTKTLKMKKLPLFKPNLPALNDTSFATKFNDKLRSL  356

Query  1163  GNSQFPANVPQTVDKNFFFTVGLGTNPCPK-NQTCQGPNGTKFAASLNNVSFVTPTTAIL  1339
              N++FPANVPQ VDK+FFFTVGLGTNPC + N+TCQGPNGT FAAS+NN+SF  P TA+L
Sbjct  357   NNARFPANVPQKVDKHFFFTVGLGTNPCSQHNRTCQGPNGTMFAASINNISFAMPNTALL  416

Query  1340  QAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSI  1519
             Q+++S +SNGVY  DFP+ P+ PFNYTG PPN+T V N TK+VVL FN +VELV+QDTSI
Sbjct  417   QSHFSSQSNGVYTPDFPTNPIIPFNYTGAPPNDTMVSNGTKLVVLQFNTSVELVMQDTSI  476

Query  1520  LGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRAD  1699
             LGAESHPLHLHG+NF+VVGQGFGNFD  KDPA +NLVDPVERNT+GVPSGGW AIRF AD
Sbjct  477   LGAESHPLHLHGFNFFVVGQGFGNFDRNKDPAKFNLVDPVERNTVGVPSGGWVAIRFLAD  536

Query  1700  NPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             NPGVWFMHCH E+H SWGL+MAW+V +GKLPNQKLLPPP+DLPKC
Sbjct  537   NPGVWFMHCHLEIHTSWGLKMAWVVLDGKLPNQKLLPPPADLPKC  581



>ref|XP_010654256.1| PREDICTED: laccase-17-like isoform X2 [Vitis vinifera]
Length=573

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/577 (71%), Positives = 484/577 (84%), Gaps = 9/577 (2%)
 Frame = +2

Query  119   LAACFLMIM----TSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFP  286
             +++CFL +M     +L+  P + +AKH  +TRHY F+I++Q VTRLC TKSIVTVNG+FP
Sbjct  1     MSSCFLRVMLFALCALWNLPELVLAKHAGITRHYNFDIKLQKVTRLCQTKSIVTVNGQFP  60

Query  287   GPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNF  466
             GPRI+AREGDRVL+KVVN+V NN++IHWHGIRQ+R+GWADGPAY+TQCPIQTGQ+YVYNF
Sbjct  61    GPRIIAREGDRVLIKVVNNVQNNITIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNF  120

Query  467   TIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAV  646
             TI GQRGTLFWHAHISWLRATL+GP++ILP++   YPFP+P KEVP+IFGEWW  DTE +
Sbjct  121   TITGQRGTLFWHAHISWLRATLYGPLVILPKRGVPYPFPQPFKEVPIIFGEWWKADTETM  180

Query  647   VSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFF  826
             ++QA+Q GG PN+SDAYTINGLPGPLYNCSA +TF++KVKPGKTYLLR+INAALNDELFF
Sbjct  181   INQAMQTGGAPNVSDAYTINGLPGPLYNCSAKDTFRLKVKPGKTYLLRLINAALNDELFF  240

Query  827   RIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQG  1006
              IANHTVTVVE DA YVKPF+T+ LVI PGQT N+LLKTK + P +TF MAAR Y TG  
Sbjct  241   SIANHTVTVVEVDAVYVKPFKTNTLVITPGQTTNILLKTKSHSPNATFLMAARSYATGPA  300

Query  1007  TFDNSTVAGVLEYEIPSLNISKNSTKPIAL-PPLPPINGTSFVSNFTGKLRSLGNSQFPA  1183
              FDNST AG+LEYE    ++SK++ KP  L P LP  N T F   F+ KLRSL +++FPA
Sbjct  301   AFDNSTTAGILEYE----HMSKSNRKPSVLKPALPMFNDTIFAMKFSKKLRSLASNKFPA  356

Query  1184  NVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKS  1363
              VPQTV++ FFFTVGLG   C +NQ C GPN T  AA++NNVSFV P+TA+LQA++  KS
Sbjct  357   KVPQTVNRRFFFTVGLGLIQCSRNQACPGPNNTMVAAAINNVSFVQPSTALLQAHFFGKS  416

Query  1364  NGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPL  1543
              GVY TDFP+ P   FNYTGTPP+N  V + TKVVVLPFN  VELVLQDTSI+GAESHPL
Sbjct  417   KGVYTTDFPANPTFKFNYTGTPPSNILVNSGTKVVVLPFNTRVELVLQDTSIIGAESHPL  476

Query  1544  HLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMH  1723
             HLHG+NFYVVGQGFGNFDPKKDPAN+NLVDP+ERNT+GVPSGGW AIRFRADNPGVWFMH
Sbjct  477   HLHGFNFYVVGQGFGNFDPKKDPANFNLVDPIERNTVGVPSGGWVAIRFRADNPGVWFMH  536

Query  1724  CHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             CH EVH SWGL+MAW+V +GK PNQKL PPPSDLPKC
Sbjct  537   CHLEVHTSWGLKMAWVVTDGKRPNQKLPPPPSDLPKC  573



>ref|XP_008778964.1| PREDICTED: laccase-17-like [Phoenix dactylifera]
Length=584

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/575 (73%), Positives = 490/575 (85%), Gaps = 2/575 (0%)
 Frame = +2

Query  116   LLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPR  295
             LL A F+    +L        A+   +TRHY+F+IRM NVTRLCHTKSIVTVNG+FPGP+
Sbjct  10    LLVAAFMFSTLTLLLSLDGVRAQQTGITRHYRFDIRMANVTRLCHTKSIVTVNGQFPGPK  69

Query  296   IMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIV  475
             I+AREGDRV+VKVVNHV  NV++HWHG+RQ+R+GWADGPAY+TQCPI+ GQ+YVYNFTIV
Sbjct  70    IVAREGDRVVVKVVNHVQYNVTLHWHGVRQLRSGWADGPAYVTQCPIRRGQSYVYNFTIV  129

Query  476   GQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQ  655
              QRGTLFWHAHISWLRATL+GPIIILP +   YPF KP+KEVP++FGEWWN DTEAV+SQ
Sbjct  130   AQRGTLFWHAHISWLRATLYGPIIILPARGVPYPFSKPYKEVPIVFGEWWNADTEAVISQ  189

Query  656   ALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIA  835
             ALQ GGGPN+SDAYTINGLPGPLYNCSA +TFK+KVKPGKTYLLRMINAALNDELFF IA
Sbjct  190   ALQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRMINAALNDELFFSIA  249

Query  836   NHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFD  1015
             NHT+T+V+ DA YVKPF+TD L+IAPGQT NVLL++K + P +TF MAARPY TG GTFD
Sbjct  250   NHTLTIVDVDAVYVKPFDTDTLIIAPGQTTNVLLRSKPSFPHATFLMAARPYATGSGTFD  309

Query  1016  NSTVAGVLEYEIP--SLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANV  1189
             NSTVAG LEY+ P  S   S +   P+  P LP +N T+FV+NFT +LRSL  +QFPA V
Sbjct  310   NSTVAGFLEYQDPKTSSTASFDKKLPLFKPSLPSLNDTAFVANFTSRLRSLATAQFPAKV  369

Query  1190  PQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNG  1369
             P+TV++ FFFTVGLGT+PCPKNQTCQGPNGTKFAA+++N+SF  PTTA+LQA++  +S  
Sbjct  370   PRTVERQFFFTVGLGTSPCPKNQTCQGPNGTKFAATVSNISFAMPTTALLQAHFFGQSKR  429

Query  1370  VYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHL  1549
             VY+ DFP  PL PFNYTG+PPNNT V N TK++VLP+N TVELV+QDTSILGAESHPLHL
Sbjct  430   VYSPDFPYSPLIPFNYTGSPPNNTLVSNGTKLMVLPYNTTVELVMQDTSILGAESHPLHL  489

Query  1550  HGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCH  1729
             HG+NF+VVGQGFGN++P KDPA +NLVDPVERNT+GVP+GGW AIRFRADNPGVWFMHCH
Sbjct  490   HGFNFFVVGQGFGNYNPAKDPARFNLVDPVERNTVGVPAGGWVAIRFRADNPGVWFMHCH  549

Query  1730  FEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
              EVH SWGL+MAW+V +G LPNQKL PPPSDLP C
Sbjct  550   LEVHTSWGLKMAWLVLDGSLPNQKLPPPPSDLPNC  584



>ref|XP_008778578.1| PREDICTED: laccase-10-like [Phoenix dactylifera]
Length=577

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/559 (73%), Positives = 485/559 (87%), Gaps = 6/559 (1%)
 Frame = +2

Query  164   PHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNH  343
             P +++A   S+TRHYKF+I+ +NVTRLCHT+SIVTVNG+FPGP+I+AREGDRV+V+VVNH
Sbjct  23    PELSLA---SITRHYKFDIQRKNVTRLCHTRSIVTVNGEFPGPKIVAREGDRVIVRVVNH  79

Query  344   VPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLR  523
             V NNV+IHWHG+RQI+ GWADGPAY+TQCPIQTGQ+YVYNFTIVGQRGTLFWHAHISW+R
Sbjct  80    VKNNVTIHWHGVRQIQTGWADGPAYVTQCPIQTGQSYVYNFTIVGQRGTLFWHAHISWMR  139

Query  524   ATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTI  703
              TL+GPIIILP++   YPF KP+KE+P++FGEW+N D EAV++QALQ G GPN+SDAYTI
Sbjct  140   VTLYGPIIILPKRGVPYPFAKPYKEIPIMFGEWFNTDPEAVIAQALQTGAGPNVSDAYTI  199

Query  704   NGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKP  883
             NGLPGPLYNCS  +TFK+KVKPGKTYLLRM+NAALNDELFF IANHT+TVV+ DA Y KP
Sbjct  200   NGLPGPLYNCS-KDTFKLKVKPGKTYLLRMVNAALNDELFFSIANHTLTVVDVDAIYTKP  258

Query  884   FETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLN  1063
             F+TD+++I PGQT NVLL+TK + P ++F MAARPY TG G FDN+T AG+LEY  P ++
Sbjct  259   FKTDIILITPGQTTNVLLQTKPSLPCASFLMAARPYATGLGAFDNTTTAGLLEYLPPGVS  318

Query  1064  ISKNSTKPIAL--PPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGT  1237
                  +K + L  P LP +N T+F +NFTGKLRSL N+QFPANVPQTVD+ F+FTVGLGT
Sbjct  319   SPSTPSKNLTLSRPTLPSLNDTAFAANFTGKLRSLANAQFPANVPQTVDRRFYFTVGLGT  378

Query  1238  NPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNY  1417
             +PCP NQTCQGPNGTKFAAS+NN+SF  P+TA+LQA++  +S GVY TDFPS P  PFNY
Sbjct  379   SPCPTNQTCQGPNGTKFAASVNNISFALPSTALLQAHFFGQSKGVYRTDFPSNPPFPFNY  438

Query  1418  TGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFD  1597
             TGTPPNN+ V N TK+VVLPFNA+VELV+QDTSI G ESHPLHLHG+NF+VVGQGFGN+D
Sbjct  439   TGTPPNNSFVTNGTKLVVLPFNASVELVMQDTSIQGIESHPLHLHGFNFFVVGQGFGNYD  498

Query  1598  PKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVK  1777
             P KDPA +NL DP+ERNT+GVP+GGW AIRFRADNPGVWFMHCH +VH  WGLRMAW+V 
Sbjct  499   PAKDPAKFNLADPIERNTVGVPAGGWVAIRFRADNPGVWFMHCHLDVHTVWGLRMAWVVN  558

Query  1778  EGKLPNQKLLPPPSDLPKC  1834
             +G LP+QKLLPPPSDLPKC
Sbjct  559   DGPLPSQKLLPPPSDLPKC  577



>ref|XP_004294637.1| PREDICTED: laccase-17-like [Fragaria vesca subsp. vesca]
Length=584

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/573 (73%), Positives = 485/573 (85%), Gaps = 8/573 (1%)
 Frame = +2

Query  131   FLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
             FL+ + +L     +A A   S+T+HYKF I++QNVTRLCHTKSIVTVNG+FPGPRI+ARE
Sbjct  15    FLLSVLTLCLSSELAAA---SITKHYKFEIKLQNVTRLCHTKSIVTVNGQFPGPRIVARE  71

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GD +L+KVVNHVPNN+SIHWHGIRQ+R+GWADGPAY+TQCPIQTG +YVYN+TIVGQRGT
Sbjct  72    GDNLLIKVVNHVPNNISIHWHGIRQLRSGWADGPAYVTQCPIQTGNSYVYNYTIVGQRGT  131

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             L+WHAH+SWLR+T++GP+IILP++   YPF KP+KEVP+IFGEWWN D EAV++QALQ G
Sbjct  132   LWWHAHLSWLRSTVYGPLIILPKRGAPYPFIKPYKEVPIIFGEWWNADPEAVINQALQTG  191

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
             GGPN+SDAYTINGLPGPLYNCSA +TFK+KV+ GKTYLLR+IN ALNDELFF IANHT+ 
Sbjct  192   GGPNVSDAYTINGLPGPLYNCSAKDTFKLKVQAGKTYLLRLINGALNDELFFSIANHTLK  251

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VVE DA YVKPF+T+ ++I PGQT NVLLKTK N P +TF M ARPY TG GTFDNSTVA
Sbjct  252   VVETDAVYVKPFKTNTILITPGQTTNVLLKTKPNFPNATFLMTARPYVTGLGTFDNSTVA  311

Query  1031  GVLEYEIPSLNISKNSTK-PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDK  1207
             G+LEYE  +L+ +    K P+  P LP +N TSFV+ F  KLRSL   QFPANVPQ VDK
Sbjct  312   GILEYEATTLHSTLPMKKLPLHKPILPALNDTSFVTKFVSKLRSLNTPQFPANVPQKVDK  371

Query  1208  NFFFTVGLGTNPCPK----NQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVY  1375
             + FFTVGLG+NPC +    NQTCQGPNGT FAAS+NNVSF  PTTA+LQ+++S +S GVY
Sbjct  372   HLFFTVGLGSNPCSQQQNSNQTCQGPNGTMFAASINNVSFTMPTTALLQSHFSGQSKGVY  431

Query  1376  ATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHG  1555
             ++DFP  PLTPFNYTG P NNT V N TK++VLPFN +VELVLQ TSILGAESHPLHLHG
Sbjct  432   SSDFPISPLTPFNYTGPPLNNTNVGNGTKLMVLPFNTSVELVLQGTSILGAESHPLHLHG  491

Query  1556  YNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFE  1735
             +NF+VVGQGFGNFD  KDP  +NLVDPVERNT+GVPSGGW AIRF ADNPGVWFMHCH E
Sbjct  492   FNFFVVGQGFGNFDQNKDPKKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLE  551

Query  1736  VHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             VH SWGL+MAW+V +GKLPNQKLLPPPSDLP C
Sbjct  552   VHTSWGLKMAWVVLDGKLPNQKLLPPPSDLPTC  584



>ref|XP_003530894.1| PREDICTED: laccase-17-like [Glycine max]
Length=578

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/570 (73%), Positives = 483/570 (85%), Gaps = 5/570 (1%)
 Frame = +2

Query  137   MIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGD  316
             + + SL  F     A  G+ T+HY F IR QNVTRLCHTKSIVTVNG+FPGPRI+AREGD
Sbjct  10    LFLLSLIIFCMFEHALAGT-TKHYNFEIRHQNVTRLCHTKSIVTVNGQFPGPRIVAREGD  68

Query  317   RVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLF  496
             R+L+KV NHV NN++IHWHGIRQ+++GWADGP+Y+TQCPIQTGQT+VYN+TIVGQRGTL+
Sbjct  69    RLLIKVTNHVQNNITIHWHGIRQLQSGWADGPSYVTQCPIQTGQTFVYNYTIVGQRGTLW  128

Query  497   WHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGG  676
             WHAHISWLR+TL+GP+IILP+ N  YPF KPHKEVP+IFGEWWN D EA+++QALQ GGG
Sbjct  129   WHAHISWLRSTLYGPLIILPKLNAQYPFAKPHKEVPIIFGEWWNADPEAIITQALQTGGG  188

Query  677   PNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVV  856
             PN+SDAYTINGLPGPLYNCS  +TFK+KVKPGK YLLR+INAALNDELFF IANHT+TVV
Sbjct  189   PNVSDAYTINGLPGPLYNCSHKDTFKLKVKPGKIYLLRLINAALNDELFFSIANHTLTVV  248

Query  857   EADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGV  1036
             E DA YVKPF T+ ++I PGQT NV+LKT  + P +TF M ARPY TG GTFDN+TVA +
Sbjct  249   ETDAVYVKPFATNTILITPGQTTNVILKTNSHYPNATFLMTARPYATGLGTFDNTTVAAI  308

Query  1037  LEYEIPS-LNISKNSTK--PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDK  1207
             LEY+ PS  + S  S K  P+  P LP +N TSF + FT KLRSL ++QFPANVPQ VDK
Sbjct  309   LEYKTPSNTHHSAASLKNLPLLKPILPALNDTSFATKFTNKLRSLASAQFPANVPQKVDK  368

Query  1208  NFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATD  1384
             +FFFTVGLGT PCP+NQTCQGP N TKF+AS+NNVSF+ PTTA+LQ ++  +SN VY  D
Sbjct  369   HFFFTVGLGTTPCPQNQTCQGPTNSTKFSASVNNVSFIQPTTALLQTHFFGQSNRVYTPD  428

Query  1385  FPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNF  1564
             FP+ PL PFNYTGTPPNNT V N TKVVVLPFN +VELV+QDTSILGAESHPLHLHG+NF
Sbjct  429   FPTKPLVPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNF  488

Query  1565  YVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHL  1744
             +VVGQGFGN+DP KDPAN+NL DP+ERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH 
Sbjct  489   FVVGQGFGNYDPNKDPANFNLDDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHT  548

Query  1745  SWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             SWGL+MAW+V +GKLPNQKL PPP+DLP C
Sbjct  549   SWGLKMAWVVLDGKLPNQKLFPPPADLPMC  578



>gb|KHN24984.1| Laccase-17 [Glycine soja]
Length=559

 Score =   876 bits (2264),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/553 (74%), Positives = 475/553 (86%), Gaps = 4/553 (1%)
 Frame = +2

Query  188   GSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIH  367
                T+HY F IR QNVTRLCHTKSIVTVNG+FPGPRI+AREGDR+L+KV NHV NN++IH
Sbjct  7     AGTTKHYNFEIRHQNVTRLCHTKSIVTVNGQFPGPRIVAREGDRLLIKVTNHVQNNITIH  66

Query  368   WHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPII  547
             WHGIRQ+++GWADGP+Y+TQCPIQTGQT+VYN+TIVGQRGTL+WHAHISWLR+TL+GP+I
Sbjct  67    WHGIRQLQSGWADGPSYVTQCPIQTGQTFVYNYTIVGQRGTLWWHAHISWLRSTLYGPLI  126

Query  548   ILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLY  727
             ILP+ N  YPF KPHKEVP+IFGEWWN D EA+++QALQ GGGPN+SDAYTINGLPGPLY
Sbjct  127   ILPKLNAQYPFAKPHKEVPIIFGEWWNADPEAIITQALQTGGGPNVSDAYTINGLPGPLY  186

Query  728   NCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVI  907
             NCS  +TFK+KVKPGK YLLR+INAALNDELFF IANHT+TVVE DA YVKPF T+ ++I
Sbjct  187   NCSHKDTFKLKVKPGKIYLLRLINAALNDELFFSIANHTLTVVETDAVYVKPFATNTILI  246

Query  908   APGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPS-LNISKNSTK  1084
              PGQT NV+LKT  + P +TF M ARPY TG GTFDN+TVA +LEY+ PS  + S  S K
Sbjct  247   TPGQTTNVILKTNSHYPNATFLMTARPYATGLGTFDNTTVAAILEYKTPSNTHHSAASLK  306

Query  1085  --PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQ  1258
               P+  P LP +N TSF + FT KLRSL ++QFPANVPQ VDK+FFFTVGLGT PCP+NQ
Sbjct  307   NLPLLKPILPALNDTSFATKFTNKLRSLASAQFPANVPQKVDKHFFFTVGLGTTPCPQNQ  366

Query  1259  TCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPN  1435
             TCQGP N TKF+AS+NNVSF+ PTTA+LQ ++  +SN VY  DFP+ PL PFNYTGTPPN
Sbjct  367   TCQGPTNSTKFSASVNNVSFIQPTTALLQTHFFGQSNRVYTPDFPTKPLVPFNYTGTPPN  426

Query  1436  NTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPA  1615
             NT V N TKVVVLPFN +VELV+QDTSILGAESHPLHLHG+NF+VVGQGFGN+DP KDPA
Sbjct  427   NTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNYDPNKDPA  486

Query  1616  NYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPN  1795
             N+NL DP+ERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH SWGL+MAW+V +GKLPN
Sbjct  487   NFNLDDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWVVLDGKLPN  546

Query  1796  QKLLPPPSDLPKC  1834
             QKL PPP+DLP C
Sbjct  547   QKLFPPPADLPMC  559



>ref|XP_004246869.2| PREDICTED: laccase-17-like [Solanum lycopersicum]
Length=568

 Score =   875 bits (2261),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/567 (73%), Positives = 484/567 (85%), Gaps = 9/567 (2%)
 Frame = +2

Query  134   LMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREG  313
             LMI + L       ++   + TRHYKF I+MQNVTRLCHTKSIVTVNG+FPGP+I+AREG
Sbjct  11    LMIASCL-------LSSVSAATRHYKFEIKMQNVTRLCHTKSIVTVNGQFPGPKIVAREG  63

Query  314   DRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTL  493
             DR+ ++VVNHV NN+SIHWHGIRQ+R+GWADGPAY+TQCPIQ GQ YVYNFTI+GQRGT 
Sbjct  64    DRLEIEVVNHVHNNISIHWHGIRQVRSGWADGPAYVTQCPIQNGQKYVYNFTIIGQRGTF  123

Query  494   FWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGG  673
             +WHAHISWLR+TL+GPIIILP KNT YPF KP+KE+P+IFGEW+N DTEA++SQALQ GG
Sbjct  124   WWHAHISWLRSTLYGPIIILPNKNTPYPFAKPYKEIPIIFGEWFNADTEAIISQALQTGG  183

Query  674   GPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTV  853
             GPN+SDAYTINGLPGPLYN SA +TFK+KVKP KTYLLR+INAALNDELFF IANHT+ +
Sbjct  184   GPNVSDAYTINGLPGPLYNFSAKDTFKLKVKPEKTYLLRLINAALNDELFFSIANHTLQI  243

Query  854   VEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAG  1033
             ++AD  YVKPFET+ L+I PGQT NVLLKTK + P +TF+M ARPY TG GTFDNSTVAG
Sbjct  244   IDADGVYVKPFETNTLIITPGQTHNVLLKTKSHFPNATFYMTARPYVTGPGTFDNSTVAG  303

Query  1034  VLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNF  1213
             +LEYE  +    KN   P+  P LP +N T+FV+NFT +LRSL + Q+PANVPQ VD+  
Sbjct  304   ILEYESKTKLHLKN--LPLFKPLLPALNDTNFVTNFTNRLRSLASPQYPANVPQNVDRRL  361

Query  1214  FFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPS  1393
             FFTVGLGT+PC KN+TCQGPNGTKF+AS+NNVSFV PTTA+LQ+++  +S GVY  DFP 
Sbjct  362   FFTVGLGTSPCDKNKTCQGPNGTKFSASINNVSFVLPTTALLQSHFFGQSKGVYKPDFPY  421

Query  1394  VPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVV  1573
              PL  FNYTG PPNNT V N TK++VLPFN +VELV+QDTSILG ESHPLHLHG+NF+VV
Sbjct  422   SPLNWFNYTGNPPNNTLVANDTKLMVLPFNTSVELVMQDTSILGLESHPLHLHGFNFFVV  481

Query  1574  GQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWG  1753
             GQGFGNFDPKKDP+N+NLVDP+ERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH SWG
Sbjct  482   GQGFGNFDPKKDPSNFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWG  541

Query  1754  LRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             L+MAW+V++GKLPNQKL PPP DLPKC
Sbjct  542   LKMAWLVQDGKLPNQKLPPPPMDLPKC  568



>ref|XP_002520231.1| laccase, putative [Ricinus communis]
 gb|EEF42143.1| laccase, putative [Ricinus communis]
Length=580

 Score =   875 bits (2261),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/579 (72%), Positives = 487/579 (84%), Gaps = 12/579 (2%)
 Frame = +2

Query  113   PLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGP  292
             P     FL+   +L   P+ A+A    VTR Y+FNI +QNVTRLCH+KS+VTVNG+FPGP
Sbjct  9     PSFLGTFLLSFITLCLHPNPALA----VTRDYEFNIMLQNVTRLCHSKSMVTVNGQFPGP  64

Query  293   RIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTI  472
             RIMAREGDR+L+KVVN+V NN+SIHWHGIRQ+R+GWADGPAYI QCPIQTGQ+YVYN+TI
Sbjct  65    RIMAREGDRLLIKVVNNVQNNISIHWHGIRQLRSGWADGPAYIAQCPIQTGQSYVYNYTI  124

Query  473   VGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVS  652
             +GQRGTL+WHAHISWLR+TL+GP+IILP+    YPF KP+KEV ++FGEW+N DTEAV+ 
Sbjct  125   IGQRGTLWWHAHISWLRSTLYGPLIILPKHGVPYPFAKPYKEVSIVFGEWFNADTEAVIK  184

Query  653   QALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRI  832
             QALQ GGGPN+SDAYTINGLPGPLYNCSA +TF++KVK GKTYLLR+INAALNDELFF I
Sbjct  185   QALQTGGGPNVSDAYTINGLPGPLYNCSAKDTFRLKVKLGKTYLLRIINAALNDELFFSI  244

Query  833   ANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTF  1012
             ANHT+ VVE DA YVKPF+T  ++I+PGQT NVLLKTK + P +TF M ARPY TGQGTF
Sbjct  245   ANHTMKVVEVDAVYVKPFDTKTILISPGQTTNVLLKTKLHYPNATFLMTARPYVTGQGTF  304

Query  1013  DNSTVAGVLEYEIP-----SLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQF  1177
             DNSTVAG+LEYE       SL+I+K        P LP +N TSF + F+ +LRSL +++F
Sbjct  305   DNSTVAGILEYEPSQKTHHSLSINKLQ---FFKPKLPVLNDTSFATKFSSQLRSLDSAEF  361

Query  1178  PANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSR  1357
             PANVPQ VDK FFFTVGLGT+PCPKNQTCQGPNGT FAAS+NNVSF  P  A+LQA++S 
Sbjct  362   PANVPQKVDKQFFFTVGLGTSPCPKNQTCQGPNGTMFAASVNNVSFDMPDIALLQAHFSG  421

Query  1358  KSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESH  1537
             +SNGVY  +FPS PL PFNYTG PPNNT V + TKVVVLPFN +VEL++QDTSILGAESH
Sbjct  422   QSNGVYNPNFPSSPLFPFNYTGNPPNNTMVSSGTKVVVLPFNTSVELIMQDTSILGAESH  481

Query  1538  PLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWF  1717
             PLHLHG+NF+VVGQGFGNFD  KDP  +NLVDPVERNT+GVPSGGW A+RF ADNPGVWF
Sbjct  482   PLHLHGFNFFVVGQGFGNFDRNKDPTKFNLVDPVERNTVGVPSGGWVAVRFLADNPGVWF  541

Query  1718  MHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             MHCH EVH SWGL+MAW+V +GKLPNQKLLPPP+DLPKC
Sbjct  542   MHCHLEVHTSWGLKMAWVVLDGKLPNQKLLPPPADLPKC  580



>ref|XP_002268628.2| PREDICTED: laccase-17-like isoform X1 [Vitis vinifera]
Length=577

 Score =   875 bits (2260),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/577 (71%), Positives = 482/577 (84%), Gaps = 5/577 (1%)
 Frame = +2

Query  119   LAACFLMIM----TSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFP  286
             +++CFL +M     +L+  P + +AKH  +TRHY F+I++Q VTRLC TKSIVTVNG+FP
Sbjct  1     MSSCFLRVMLFALCALWNLPELVLAKHAGITRHYNFDIKLQKVTRLCQTKSIVTVNGQFP  60

Query  287   GPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNF  466
             GPRI+AREGDRVL+KVVN+V NN++IHWHGIRQ+R+GWADGPAY+TQCPIQTGQ+YVYNF
Sbjct  61    GPRIIAREGDRVLIKVVNNVQNNITIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNF  120

Query  467   TIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAV  646
             TI GQRGTLFWHAHISWLRATL+GP++ILP++   YPFP+P KEVP+IFGEWW  DTE +
Sbjct  121   TITGQRGTLFWHAHISWLRATLYGPLVILPKRGVPYPFPQPFKEVPIIFGEWWKADTETM  180

Query  647   VSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFF  826
             ++QA+Q GG PN+SDAYTINGLPGPLYNCSA +TF++KVKPGKTYLLR+INAALNDELFF
Sbjct  181   INQAMQTGGAPNVSDAYTINGLPGPLYNCSAKDTFRLKVKPGKTYLLRLINAALNDELFF  240

Query  827   RIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQG  1006
              IANHTVTVVE DA YVKPF+T+ LVI PGQT N+LLKTK + P +TF MAAR Y TG  
Sbjct  241   SIANHTVTVVEVDAVYVKPFKTNTLVITPGQTTNILLKTKSHSPNATFLMAARSYATGPA  300

Query  1007  TFDNSTVAGVLEYE-IPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPA  1183
              FDNST AG+LEYE + S++ +KN    +  P LP  N T F  +F+ KLRSL  ++FPA
Sbjct  301   AFDNSTTAGILEYEHMSSMSNTKNKRPSVHRPALPTFNDTLFAMSFSKKLRSLATTKFPA  360

Query  1184  NVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKS  1363
              VPQTV + FFFTVGLG   C +NQ C GPN T  AA++NNVSFV P+TA+LQA++  KS
Sbjct  361   KVPQTVSRRFFFTVGLGLIQCSRNQACPGPNNTMVAAAINNVSFVQPSTALLQAHFFGKS  420

Query  1364  NGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPL  1543
              GVY TDFP+ P   FNYTGTPP+N  V + TKVVVLPFN  VELVLQDTSI+GAESHPL
Sbjct  421   KGVYTTDFPANPPFKFNYTGTPPSNILVNSGTKVVVLPFNTRVELVLQDTSIIGAESHPL  480

Query  1544  HLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMH  1723
             HLHG+NF+VVGQGFGNFDPKKDP+N+NLVDP+ERNT+GVPSGGW AIRFRADNPGVWFMH
Sbjct  481   HLHGFNFHVVGQGFGNFDPKKDPSNFNLVDPIERNTVGVPSGGWVAIRFRADNPGVWFMH  540

Query  1724  CHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             CH EVH SWGL+MAW+V +GK PNQKL PPP+DLPKC
Sbjct  541   CHLEVHTSWGLKMAWVVMDGKRPNQKLPPPPADLPKC  577



>ref|XP_009364426.1| PREDICTED: laccase-2-like [Pyrus x bretschneideri]
Length=584

 Score =   875 bits (2260),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/578 (75%), Positives = 496/578 (86%), Gaps = 2/578 (0%)
 Frame = +2

Query  107   FPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFP  286
             F P     FL+ + SL   P  A+A  GSVTRHYKF+I+++NVTRLC TKSIVTVNGKFP
Sbjct  7     FSPTFLVAFLLALISLLASPEFAIAAAGSVTRHYKFDIKLKNVTRLCTTKSIVTVNGKFP  66

Query  287   GPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNF  466
             GPRI+AREGDRVLV VVNHVPNN++IHWHGIRQ++NGWADGP+YITQCPIQT Q+YVYNF
Sbjct  67    GPRIIAREGDRVLVNVVNHVPNNMTIHWHGIRQLQNGWADGPSYITQCPIQTNQSYVYNF  126

Query  467   TIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAV  646
             TI+GQRGTLFWHAHISWLRAT++GP+IILP+++  YPFPKPHKEVP+IFGEWWNVDTEAV
Sbjct  127   TIIGQRGTLFWHAHISWLRATVYGPLIILPKRHAPYPFPKPHKEVPIIFGEWWNVDTEAV  186

Query  647   VSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFF  826
             +SQALQ G GPN+S+AYTINGLPGPLYNCS  +TF +KVKPGKTYLLR+INAA+NDELFF
Sbjct  187   ISQALQTGNGPNVSNAYTINGLPGPLYNCSKKDTFSLKVKPGKTYLLRLINAAVNDELFF  246

Query  827   RIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQG  1006
              IANH++TVVEADA YVKPF T++L I PGQT NVLLK K   P +TF M ARPYFTG+G
Sbjct  247   SIANHSLTVVEADAVYVKPFTTNILFITPGQTTNVLLKAKPQYPNATFLMLARPYFTGRG  306

Query  1007  TFDNSTVAGVLEY-EIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPA  1183
             TFDNSTVAG+LEY E  + + S +   P+  P LP IN TSFV+NFT K RSL +S+FPA
Sbjct  307   TFDNSTVAGILEYKEHSNSSSSTSLKSPLFRPILPQINATSFVANFTSKFRSLASSKFPA  366

Query  1184  NVPQTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRK  1360
             NVP+TV+K FFFTVGLGTNPCPKNQTCQGP N TKFAAS+NN SF  P+ A+LQ+++  +
Sbjct  367   NVPRTVEKRFFFTVGLGTNPCPKNQTCQGPTNTTKFAASINNNSFALPSVALLQSHFFAQ  426

Query  1361  SNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHP  1540
             SN VY TDFP++P  PFNYTGTPPNNT V N TKVVVL FN +VELVLQ TSILGAESHP
Sbjct  427   SNSVYTTDFPTIPPKPFNYTGTPPNNTNVSNGTKVVVLKFNTSVELVLQGTSILGAESHP  486

Query  1541  LHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFM  1720
             LHLHG+NF+VVGQGFGNFDP KDP  +NLVDPVERNT GVP+ GWAAIRF ADNPGVW M
Sbjct  487   LHLHGFNFFVVGQGFGNFDPNKDPPKFNLVDPVERNTYGVPARGWAAIRFLADNPGVWLM  546

Query  1721  HCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             HCHF+VHLSWGLRMAW+V++GKLPNQKL PPPSDLPKC
Sbjct  547   HCHFDVHLSWGLRMAWVVQDGKLPNQKLPPPPSDLPKC  584



>ref|XP_009354571.1| PREDICTED: laccase-17-like [Pyrus x bretschneideri]
Length=545

 Score =   875 bits (2260),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/543 (75%), Positives = 471/543 (87%), Gaps = 2/543 (0%)
 Frame = +2

Query  212   FNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIR  391
               I+++NVTRLCHTKSI+TVNG+FPGPRI+AREGD++L+KV NHV NN+SIHWHGIRQ+R
Sbjct  3     LQIKLRNVTRLCHTKSIITVNGQFPGPRIIAREGDQLLIKVANHVQNNISIHWHGIRQLR  62

Query  392   NGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTS  571
             +GWADGPAY+TQCPIQTG +YVYNFTI GQRGTLFWHAHISWLR+T++GP+IILP++   
Sbjct  63    SGWADGPAYVTQCPIQTGNSYVYNFTITGQRGTLFWHAHISWLRSTVYGPLIILPKRGVP  122

Query  572   YPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETF  751
             YPF KP+KEVP+IFGEWWN D EA++SQALQ GGGPN+SDAYTINGLPGPLYNCSA + F
Sbjct  123   YPFTKPYKEVPIIFGEWWNADPEAIISQALQTGGGPNVSDAYTINGLPGPLYNCSAKDAF  182

Query  752   KVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNV  931
             K+KV PGKTYLLR+INAALNDELFF IANHT+ VVEADA YVKPFET  ++IAPGQT NV
Sbjct  183   KLKVHPGKTYLLRLINAALNDELFFSIANHTLKVVEADAVYVKPFETRTILIAPGQTTNV  242

Query  932   LLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTK-PIALPPLP  1108
             LLKTK N P +TFFM ARPY TGQGTFDNSTVAG+LEYE PS   +  + + P+  P LP
Sbjct  243   LLKTKPNFPNATFFMTARPYVTGQGTFDNSTVAGILEYESPSKTKNLTTKRLPLFKPKLP  302

Query  1109  PINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPC-PKNQTCQGPNGTK  1285
              +N TSF + F  KLRSL   QFPANVPQ VDKNFFFT+GLGTNPC P NQTCQGPNGT 
Sbjct  303   ALNDTSFATKFGNKLRSLNTQQFPANVPQKVDKNFFFTIGLGTNPCSPNNQTCQGPNGTM  362

Query  1286  FAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKV  1465
             FAAS+NN+SF  P TA+LQ+++S +S+GVY+ DFP+ P+ PFNYTGTPPN+T V N TK+
Sbjct  363   FAASINNISFAMPNTALLQSHFSGQSSGVYSPDFPANPIVPFNYTGTPPNDTMVSNGTKL  422

Query  1466  VVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVER  1645
             VVLPFN+ VELV+QDTSILGAESHPLHLHG+NF+VVGQGFGNFD  KDP  +NLVDPVER
Sbjct  423   VVLPFNSRVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDRNKDPKMFNLVDPVER  482

Query  1646  NTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDL  1825
             NT+GVPSGGW AIRF ADNPGVWFMHCH E+H SWGL+M W+V +GKLPNQKLLPPP+DL
Sbjct  483   NTVGVPSGGWVAIRFLADNPGVWFMHCHLEIHTSWGLKMGWVVLDGKLPNQKLLPPPADL  542

Query  1826  PKC  1834
             PKC
Sbjct  543   PKC  545



>ref|XP_006429124.1| hypothetical protein CICLE_v10011358mg [Citrus clementina]
 gb|ESR42364.1| hypothetical protein CICLE_v10011358mg [Citrus clementina]
Length=581

 Score =   874 bits (2259),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/578 (70%), Positives = 474/578 (82%), Gaps = 1/578 (0%)
 Frame = +2

Query  101   HAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGK  280
             H  P  +     + + +++  P  A+AKH  VTRHYKFNI M+NV RLC TKSIVTVNG+
Sbjct  5     HLLPSAILKAMFLALFAMWILPEPALAKHARVTRHYKFNIEMKNVRRLCQTKSIVTVNGQ  64

Query  281   FPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVY  460
             FPGPRI+AREGDR+L+KVVNHV  NV++HWHG+RQ+R+GWADGPAYITQCPIQTGQ+YVY
Sbjct  65    FPGPRIIAREGDRLLIKVVNHVKYNVTLHWHGVRQLRSGWADGPAYITQCPIQTGQSYVY  124

Query  461   NFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTE  640
             NFT+ GQRGTLFWHAHISWLRATL+GPI+ILP+++ SYPFP+P KEVPMIFGEWW  DTE
Sbjct  125   NFTVTGQRGTLFWHAHISWLRATLYGPIVILPKRHASYPFPQPFKEVPMIFGEWWKADTE  184

Query  641   AVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDEL  820
              +++QALQ G  PNISDA+TINGLPGPLYNCSA +TFK+KVKPGKTYLLRMINAALNDEL
Sbjct  185   KIINQALQTGAAPNISDAFTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRMINAALNDEL  244

Query  821   FFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTG  1000
             FF IANHT+TVVE DA YVKP +T +++I PGQT NVLLK K   P ++F +AARPY TG
Sbjct  245   FFSIANHTLTVVETDAVYVKPIKTKVVLITPGQTTNVLLKAKHKSPNASFLIAARPYATG  304

Query  1001  QGTFDNSTVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFP  1180
               +FDN+T AGVLEYE P+ N +KN   P+  P LP  N T+F   F+ K+RSL  ++FP
Sbjct  305   PASFDNTTTAGVLEYEQPN-NANKNKKLPLLKPALPKFNDTNFAMQFSKKIRSLATAKFP  363

Query  1181  ANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRK  1360
             A VP+ VD+ FFFTVGLG +PCP+NQTCQGPN T  AAS+NNVSF  P  A+LQA++  K
Sbjct  364   AKVPRKVDRRFFFTVGLGLSPCPQNQTCQGPNNTMLAASINNVSFAQPNIALLQAHFFNK  423

Query  1361  SNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHP  1540
             S GVY TDFP+ P   FNYTGTPP+N  V + T+ V LPFNA+VE+V+QDTSI+GAESHP
Sbjct  424   SKGVYTTDFPANPPFKFNYTGTPPSNIMVSSGTRAVALPFNASVEVVMQDTSIIGAESHP  483

Query  1541  LHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFM  1720
             LHLHG+NF+VVGQGFGNFDP KDPA +NLVDP ERNT+GVPSGGW AIRF ADNPG WFM
Sbjct  484   LHLHGFNFFVVGQGFGNFDPSKDPAKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFM  543

Query  1721  HCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             HCH EVH SWGL+MAWIV +GK P QKL PPPSDLPKC
Sbjct  544   HCHLEVHTSWGLKMAWIVNDGKGPKQKLPPPPSDLPKC  581



>ref|XP_006341212.1| PREDICTED: laccase-17-like [Solanum tuberosum]
Length=571

 Score =   874 bits (2258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/549 (74%), Positives = 477/549 (87%), Gaps = 2/549 (0%)
 Frame = +2

Query  194   VTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWH  373
             +TRHY FNI   NVTRLC TKSIV+VNG+FPGP I+AREGDRV+VKV+N V NN+SIHWH
Sbjct  23    ITRHYTFNIVKHNVTRLCTTKSIVSVNGRFPGPHIIAREGDRVIVKVINQVSNNISIHWH  82

Query  374   GIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIIL  553
             GIRQ+ NGWADGPAY+TQCPIQ  ++Y YNFTI+GQRGTLFWHAHISWLRAT++GPIIIL
Sbjct  83    GIRQLANGWADGPAYVTQCPIQFNKSYTYNFTIIGQRGTLFWHAHISWLRATVYGPIIIL  142

Query  554   PRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNC  733
             PR+N SYPF KPHK++P++FGEWWNVDTEAV++QALQ GGGPN+SDAYTINGLPGPLYNC
Sbjct  143   PRRNESYPFKKPHKQIPIMFGEWWNVDTEAVINQALQTGGGPNVSDAYTINGLPGPLYNC  202

Query  734   SANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAP  913
             S+ +TFK+KVKPGKTY+LR+INAALNDELFF IANHT+T+V+ DA Y KPF T+++ I P
Sbjct  203   SSKDTFKLKVKPGKTYMLRLINAALNDELFFSIANHTLTIVDTDAIYTKPFNTNVVFITP  262

Query  914   GQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTK-PI  1090
             GQT NVLLKTK + P +TF MAA+PYF+G GTFDNSTVAG+LEYE P  +   N TK  +
Sbjct  263   GQTTNVLLKTKPHYPNATFLMAAQPYFSGLGTFDNSTVAGILEYESPLHSSPTNKTKTKL  322

Query  1091  ALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQG  1270
               P LP +  TSFV+NFT   RSL N++FPANVPQ +DK F FT+GLG+NPCPKN TCQG
Sbjct  323   FKPTLPNMTSTSFVANFTKNFRSLANTRFPANVPQNIDKRFLFTIGLGSNPCPKNMTCQG  382

Query  1271  PNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTP-PNNTQV  1447
             PNGTKF+AS+NN+SFV PTTA+LQ++Y  +SNG+Y TDFP+ PL PFNYTG+P PNNT V
Sbjct  383   PNGTKFSASVNNISFVLPTTALLQSHYFGQSNGIYTTDFPATPLNPFNYTGSPQPNNTFV  442

Query  1448  VNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNL  1627
              NATK+VVLPFN++VE+VLQDTSILGAE+HPLHLHG+NF+VVG+GFGNFDP  DP N+NL
Sbjct  443   TNATKLVVLPFNSSVEVVLQDTSILGAENHPLHLHGHNFFVVGEGFGNFDPNNDPINFNL  502

Query  1628  VDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLL  1807
              DP+ERNT+GVP+GGW A RF ADNPGVWFMHCHFEVH SWGLRMAWIV +G LP+QKL 
Sbjct  503   KDPIERNTVGVPAGGWIAFRFFADNPGVWFMHCHFEVHTSWGLRMAWIVLDGSLPSQKLP  562

Query  1808  PPPSDLPKC  1834
             PPPSDLPKC
Sbjct  563   PPPSDLPKC  571



>gb|EYU26602.1| hypothetical protein MIMGU_mgv1a003840mg [Erythranthe guttata]
Length=560

 Score =   874 bits (2257),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/563 (72%), Positives = 484/563 (86%), Gaps = 5/563 (1%)
 Frame = +2

Query  149   SLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLV  328
             +L  F H A A    +TRHY+FNI+MQ VTRLCHTKSIVTVNGKFPGPR++AREGDR+++
Sbjct  2     ALSLFSHPAQA----ITRHYEFNIKMQKVTRLCHTKSIVTVNGKFPGPRVVAREGDRLVI  57

Query  329   KVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAH  508
             KV N+V NN++IHWHGIRQ+R+GWADGPAY+TQCPIQTGQ+YVYNFT+VGQRGTL+WHAH
Sbjct  58    KVKNNVSNNITIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNFTVVGQRGTLWWHAH  117

Query  509   ISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNIS  688
             ISWLR+TL+GP++ILP+ N  YPF KP+KEVP+IFGEW+N DTEA++SQALQ GGGPN+S
Sbjct  118   ISWLRSTLYGPLVILPKANVPYPFLKPYKEVPIIFGEWFNADTEAIISQALQTGGGPNVS  177

Query  689   DAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADA  868
             DAYTINGLPGPLYNCSA +TFK++VKPGKTYLLR+INAALNDELFF IANH++TVV+ADA
Sbjct  178   DAYTINGLPGPLYNCSAKDTFKLRVKPGKTYLLRLINAALNDELFFSIANHSLTVVDADA  237

Query  869   GYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYE  1048
              YVKPFETD +++ PGQT NVLLKTK N P +TF M ARPY TGQGTFDNSTVA +LEYE
Sbjct  238   VYVKPFETDTILLTPGQTSNVLLKTKPNYPGATFLMTARPYVTGQGTFDNSTVAAILEYE  297

Query  1049  IPSL-NISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTV  1225
              P L +++     P+    LPP+N TSFV+ F  KLRSL + ++PANVPQ VDK F FTV
Sbjct  298   SPFLHSVASMKKLPLYRSILPPLNDTSFVTKFAKKLRSLDSREYPANVPQKVDKQFLFTV  357

Query  1226  GLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLT  1405
             GLGT+PC  N TCQGPNG++FAAS++N+SFV  TTA+LQA+Y+ +S+GVY+ DFP  P  
Sbjct  358   GLGTSPCGHNNTCQGPNGSRFAASVSNISFVQSTTALLQAHYTGQSSGVYSPDFPFSPKN  417

Query  1406  PFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGF  1585
              FNYTG PPNNT V N TK++VLP+N++VELV+QDTSILGAESHPLHLHG+NF+VVG GF
Sbjct  418   WFNYTGNPPNNTIVANGTKLMVLPYNSSVELVMQDTSILGAESHPLHLHGFNFFVVGLGF  477

Query  1586  GNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMA  1765
             GN++P  DP  +NLVDPVERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH SWGL+MA
Sbjct  478   GNYNPNTDPQKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMA  537

Query  1766  WIVKEGKLPNQKLLPPPSDLPKC  1834
             W+V +G LPNQKLLPPPSDLPKC
Sbjct  538   WLVLDGNLPNQKLLPPPSDLPKC  560



>ref|XP_011019838.1| PREDICTED: laccase-17-like [Populus euphratica]
Length=579

 Score =   873 bits (2256),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/579 (70%), Positives = 478/579 (83%), Gaps = 7/579 (1%)
 Frame = +2

Query  119   LAACFLMIMT----SLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFP  286
             + + FL I+     +L+ F  +AVAKH S+TRHYKF+I+MQNVTR+C TKSIVTVNG+ P
Sbjct  1     MGSAFLRILVTSLCALWIFSELAVAKHASITRHYKFDIKMQNVTRMCRTKSIVTVNGQIP  60

Query  287   GPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNF  466
             GPRI+AREGDR+L+KVVNHV  NV++HWHGIRQ+R+GWADGPAY+TQCPIQTGQ+Y+YNF
Sbjct  61    GPRIIAREGDRLLIKVVNHVQYNVTLHWHGIRQLRSGWADGPAYVTQCPIQTGQSYIYNF  120

Query  467   TIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAV  646
             T+ GQRGTLFWHAHISWLRATLHGPI+ILP+K  SYPFP+PHKEVP+IFGEWW  DTE +
Sbjct  121   TVTGQRGTLFWHAHISWLRATLHGPIVILPKKGVSYPFPQPHKEVPIIFGEWWKADTEKI  180

Query  647   VSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFF  826
             +SQALQ GG PNISDAYTING PG LYNCSA +TFK+KVKPGKTYLLR+INAALNDELFF
Sbjct  181   ISQALQTGGAPNISDAYTINGHPGLLYNCSAKDTFKLKVKPGKTYLLRLINAALNDELFF  240

Query  827   RIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQG  1006
              IANH++TVVEADA YVKPF+T +++I PGQT NVLL  K   P STF MAARPY TG  
Sbjct  241   SIANHSLTVVEADAVYVKPFKTHIVLITPGQTTNVLLMAKAKAPNSTFLMAARPYATGPA  300

Query  1007  TFDNSTVAGVLEYEI-PSLNISKNSTK--PIALPPLPPINGTSFVSNFTGKLRSLGNSQF  1177
             +FDN+T AG+LEY+  PS   SK+  K  P+  P LP  N T+F + F  K+RSL N++F
Sbjct  301   SFDNTTTAGILEYDHNPSATNSKSKNKKLPLLKPSLPVFNDTTFATKFVKKIRSLANARF  360

Query  1178  PANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSR  1357
             PA VP+ VD+ FFFT+GLG  PC +N+TCQGPN T  AAS+NNVSFV P  A+LQ+++  
Sbjct  361   PAKVPKKVDRRFFFTIGLGLLPCSQNKTCQGPNNTMLAASVNNVSFVQPNIALLQSHFLN  420

Query  1358  KSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESH  1537
             +S GVY TDFP+ P   FNYTGTPP+N      TKVVVLPFN +VELV+QDTSI+GAESH
Sbjct  421   RSKGVYTTDFPTNPPFKFNYTGTPPSNIMTAKGTKVVVLPFNTSVELVMQDTSIIGAESH  480

Query  1538  PLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWF  1717
             PLHLHG+NF VVGQGFGNFDPKKDP  +NLVDP ERNT+GVPSGGW AIRF ADNPGVWF
Sbjct  481   PLHLHGFNFVVVGQGFGNFDPKKDPVKFNLVDPAERNTVGVPSGGWVAIRFLADNPGVWF  540

Query  1718  MHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             MHCH EVH SWGL+MAW+V +GK P+QKL PPPSDLPKC
Sbjct  541   MHCHLEVHTSWGLKMAWVVNDGKRPSQKLPPPPSDLPKC  579



>ref|XP_009597231.1| PREDICTED: laccase-17-like [Nicotiana tomentosiformis]
Length=568

 Score =   873 bits (2256),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/548 (75%), Positives = 477/548 (87%), Gaps = 2/548 (0%)
 Frame = +2

Query  191   SVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHW  370
             + TRHYKF I+MQNVTRLCHTKS+VTVNG+FPGP+++AREGDR+ ++V+NHV NN+SIHW
Sbjct  23    ATTRHYKFEIKMQNVTRLCHTKSMVTVNGQFPGPKVVAREGDRLEIEVLNHVQNNISIHW  82

Query  371   HGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIII  550
             HGIRQ+R+GWADGPAYITQCPIQTGQ+YVYNFTI+GQRGT +WHAHISWLR+T++GPIII
Sbjct  83    HGIRQLRSGWADGPAYITQCPIQTGQSYVYNFTIIGQRGTFWWHAHISWLRSTVYGPIII  142

Query  551   LPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYN  730
             LP+KNT YPF KP+KEVP+IFGEW+N DTEA+++QALQ GGGPN+SDAYTINGLPGPLYN
Sbjct  143   LPKKNTPYPFAKPYKEVPIIFGEWFNADTEAIIAQALQTGGGPNVSDAYTINGLPGPLYN  202

Query  731   CSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIA  910
             CSA +TFK+K+KPGKTYLLR+INAALNDELFF IANHT+ V++AD  YVKPFETD L+I 
Sbjct  203   CSAKDTFKLKMKPGKTYLLRLINAALNDELFFSIANHTLRVIDADGVYVKPFETDTLIIT  262

Query  911   PGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKPI  1090
             PGQT NVLLKTK + P +TF+M ARPY TG GTFDNSTVAG+LEYE  S    KN   P+
Sbjct  263   PGQTHNVLLKTKPHFPNATFYMTARPYVTGPGTFDNSTVAGILEYESKSKPHLKN--LPL  320

Query  1091  ALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQG  1270
               P LP +N T+FV+NFT +LRSL   QFPANVP  VDK+ FFTVGLGT+PC +N+TCQG
Sbjct  321   FKPLLPALNDTTFVTNFTSRLRSLATPQFPANVPLNVDKHLFFTVGLGTSPCDQNKTCQG  380

Query  1271  PNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVV  1450
             PNGTKF+AS+NN+SFV PTTA+LQ+++  KS GVY  DFP  PL  FNYTG PPNNT V 
Sbjct  381   PNGTKFSASVNNISFVQPTTALLQSHFLGKSKGVYKPDFPYSPLNWFNYTGNPPNNTLVK  440

Query  1451  NATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLV  1630
             N TK++VLPFN +VELV+QDTSILGAESHPLHLHG+NF+VVGQGFGNFD  KDPAN+NL 
Sbjct  441   NDTKLMVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDGNKDPANFNLA  500

Query  1631  DPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLP  1810
             DP+ERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH SWGL+MAW+V +GKLPNQKL  
Sbjct  501   DPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGKLPNQKLPL  560

Query  1811  PPSDLPKC  1834
             PP DLPKC
Sbjct  561   PPRDLPKC  568



>gb|KDP35659.1| hypothetical protein JCGZ_09097 [Jatropha curcas]
Length=574

 Score =   873 bits (2256),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/553 (75%), Positives = 473/553 (86%), Gaps = 7/553 (1%)
 Frame = +2

Query  188   GSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIH  367
              S+TRHYKF I+++NVTRLC+T SI+TVNGKFPGPRI+AREGDR++VKVVNH P N+SIH
Sbjct  25    ASITRHYKFEIKLKNVTRLCNTTSILTVNGKFPGPRIVAREGDRLVVKVVNHSPKNISIH  84

Query  368   WHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPII  547
             WHGIRQ++ GW DGP+YITQCPIQT Q+YVYNFTIVGQRGTLFWHAHISWLRATL+GPII
Sbjct  85    WHGIRQLQTGWYDGPSYITQCPIQTNQSYVYNFTIVGQRGTLFWHAHISWLRATLYGPII  144

Query  548   ILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLY  727
             ILP+    YPFPKP+K+VP++FGEW++VD + +++Q+LQ GGGPN+SDAYTINGLPG  Y
Sbjct  145   ILPKLGVPYPFPKPYKQVPILFGEWFHVDPDEIINQSLQTGGGPNVSDAYTINGLPGQFY  204

Query  728   NCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVI  907
             NCSA +T+K+KVKP KTYLLR+INAALNDELF  IANHTVTVVE DA YVKPFETD L+I
Sbjct  205   NCSAKDTYKLKVKPRKTYLLRLINAALNDELFVSIANHTVTVVEVDATYVKPFETDKLLI  264

Query  908   APGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKP  1087
              PGQT NVLLKTK + P STFF+AARPY TG GTFDNSTV  ++EYEI S   S   T  
Sbjct  265   TPGQTTNVLLKTKPDFPNSTFFIAARPYATGMGTFDNSTVTAIIEYEIES---SPTHTIK  321

Query  1088  IALPPLPPI----NGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKN  1255
               LPPL PI    N T F  NF+ +LRSL + ++PANVPQ VDK FFFTVGLGTNPCPKN
Sbjct  322   KQLPPLNPILPALNDTPFAFNFSTRLRSLASLEYPANVPQKVDKRFFFTVGLGTNPCPKN  381

Query  1256  QTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPN  1435
             QTCQGPNGTKFAAS+NN+SF  PTTA+LQ+Y+ R SNGVY+TDFPS P+ PF+YTGTP N
Sbjct  382   QTCQGPNGTKFAASVNNISFAFPTTAMLQSYFFRNSNGVYSTDFPSQPIIPFDYTGTPSN  441

Query  1436  NTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPA  1615
             NT V+N TKVVVLPFN +VE+VLQDTSILG ESHPLHLHGYNFYV+G GFGNFDP  DPA
Sbjct  442   NTMVINGTKVVVLPFNTSVEVVLQDTSILGNESHPLHLHGYNFYVIGSGFGNFDPNNDPA  501

Query  1616  NYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPN  1795
              +N+VDPVERNTIGVPSGGW A +F ADNPGVW MHCHF+VHLSWGLRMAWIV +G LPN
Sbjct  502   KFNVVDPVERNTIGVPSGGWVAFQFLADNPGVWLMHCHFDVHLSWGLRMAWIVLDGNLPN  561

Query  1796  QKLLPPPSDLPKC  1834
             QKL PPPSDLPKC
Sbjct  562   QKLPPPPSDLPKC  574



>ref|XP_002309069.1| hypothetical protein POPTR_0006s08780g [Populus trichocarpa]
 gb|EEE92592.1| hypothetical protein POPTR_0006s08780g [Populus trichocarpa]
Length=579

 Score =   873 bits (2256),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/579 (70%), Positives = 480/579 (83%), Gaps = 7/579 (1%)
 Frame = +2

Query  119   LAACFLMIMT----SLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFP  286
             + + FL I+     +L+ F  + VAKH  +TRHYKF+I++QNVTRLC TKSIVTVNG+ P
Sbjct  1     MGSAFLRILVTALCALWIFSELVVAKHAGITRHYKFDIKLQNVTRLCRTKSIVTVNGQIP  60

Query  287   GPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNF  466
             GPRI+AREGDR+L+KVVNHV  NV++HWHGIRQ+R+GWADGPAY+TQCPIQTGQ+YVYNF
Sbjct  61    GPRIIAREGDRLLIKVVNHVQYNVTLHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNF  120

Query  467   TIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAV  646
             T+ GQRGTLFWHAHISWLRATL+GPI+ILP+K  SYPFP PHKEVP+IFGEWW  DTE +
Sbjct  121   TVTGQRGTLFWHAHISWLRATLYGPIVILPKKGVSYPFPLPHKEVPIIFGEWWKADTEKI  180

Query  647   VSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFF  826
             +SQAL+ GG PNISDAYTING PG LYNCSA +TFK+KVKPGKTYLLR+INAALNDELFF
Sbjct  181   ISQALKTGGAPNISDAYTINGHPGLLYNCSAKDTFKLKVKPGKTYLLRLINAALNDELFF  240

Query  827   RIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQG  1006
              IANH++TVVEADA YVKPF+T +++I PGQT NVLL  K   P STF MAARPY TG G
Sbjct  241   SIANHSLTVVEADAVYVKPFKTHIVLITPGQTTNVLLMAKAKAPNSTFLMAARPYATGPG  300

Query  1007  TFDNSTVAGVLEYEI-PSLNISKNSTK--PIALPPLPPINGTSFVSNFTGKLRSLGNSQF  1177
             +FDN+T AG+LEY+  PS   SK+  K  P+  P LP  N T+F + F  K+RSL N++F
Sbjct  301   SFDNTTTAGILEYDQNPSATNSKSKNKKLPLLKPSLPVFNDTTFATKFVKKIRSLANARF  360

Query  1178  PANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSR  1357
             PA VP+ VD+ FFFT+GLG+ PC +N+TCQGPN T FAAS+NNVSFV P  A+LQ+++  
Sbjct  361   PAKVPKKVDRRFFFTIGLGSLPCSQNKTCQGPNNTMFAASVNNVSFVQPNIALLQSHFLN  420

Query  1358  KSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESH  1537
             +S GVY TDFP+ P   FNYTGTPP+NT     TKVVVLPFN +VELV+QDTSI+GAESH
Sbjct  421   RSKGVYTTDFPTNPPFKFNYTGTPPSNTMTAKGTKVVVLPFNTSVELVMQDTSIIGAESH  480

Query  1538  PLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWF  1717
             PLHLHG+NF+VVGQGFGNFDPKKDP  +NLVDP ERNT+GVPSGGW AIRF ADNPGVWF
Sbjct  481   PLHLHGFNFFVVGQGFGNFDPKKDPVKFNLVDPAERNTVGVPSGGWVAIRFLADNPGVWF  540

Query  1718  MHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             MHCH EVH SWGL+MAW+V +GK P+QKL PPPSDLPKC
Sbjct  541   MHCHLEVHTSWGLKMAWVVNDGKRPSQKLPPPPSDLPKC  579



>ref|XP_004246425.1| PREDICTED: laccase-17-like [Solanum lycopersicum]
Length=571

 Score =   873 bits (2256),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/549 (74%), Positives = 477/549 (87%), Gaps = 2/549 (0%)
 Frame = +2

Query  194   VTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWH  373
             +TRHY FNI   NVTRLC TKSIV+VNG+FPGPRI+AREGDRV+VKV+N V NN+SIHWH
Sbjct  23    ITRHYTFNIVKHNVTRLCTTKSIVSVNGRFPGPRIIAREGDRVIVKVINQVSNNISIHWH  82

Query  374   GIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIIL  553
             GIRQ+ NGWADGPAY+TQCPIQ  ++Y YNFTI+GQRGTLFWHAHISWLRAT++GPIIIL
Sbjct  83    GIRQLANGWADGPAYVTQCPIQFNKSYTYNFTIIGQRGTLFWHAHISWLRATVYGPIIIL  142

Query  554   PRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNC  733
             PR+N SYPF KP+K++P++FGEWWNVDTEAV++QALQ GGGPN+SDAYTINGLPGPLYNC
Sbjct  143   PRRNESYPFKKPYKQIPIMFGEWWNVDTEAVINQALQTGGGPNVSDAYTINGLPGPLYNC  202

Query  734   SANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAP  913
             S+ +TFK+KVKPGKTY+LR+INAALNDE+FF IANHT+T+V+ADA Y KPF T+++ I P
Sbjct  203   SSKDTFKLKVKPGKTYMLRLINAALNDEMFFSIANHTLTIVDADAIYTKPFNTNVVFITP  262

Query  914   GQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTK-PI  1090
             GQT NVLLKTK + P +TF MAA+PYF+G GTFDNSTVAG+LEYE P  N   N +K  +
Sbjct  263   GQTTNVLLKTKPHYPNATFLMAAQPYFSGLGTFDNSTVAGILEYESPLHNSPTNKSKIKL  322

Query  1091  ALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQG  1270
               P LP I  TSFV+NFT   RSL N+ FPANVP  VDK F FT+GLG+NPCPKN TCQG
Sbjct  323   FKPTLPNITSTSFVANFTKNFRSLANTPFPANVPLNVDKRFLFTIGLGSNPCPKNMTCQG  382

Query  1271  PNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTP-PNNTQV  1447
             PNGTKFAAS+NN+SF+ PTTA+LQ++Y  +SNG+Y TDFP  PL PFNYTG+P PNNT V
Sbjct  383   PNGTKFAASVNNISFILPTTALLQSHYFGQSNGIYTTDFPVTPLNPFNYTGSPQPNNTFV  442

Query  1448  VNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNL  1627
              NATKVVVLPFN++VE+VLQDTSILGAE+HPLHLHG+NF+VVG+GFGNFDP  DP+N+NL
Sbjct  443   TNATKVVVLPFNSSVEVVLQDTSILGAENHPLHLHGHNFFVVGEGFGNFDPNNDPSNFNL  502

Query  1628  VDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLL  1807
              DP++RNT+GVP+GGW A RF ADNPGVWFMHCHFEVH SWGLRMAWIV +G LP+QKL 
Sbjct  503   KDPIQRNTVGVPAGGWIAFRFFADNPGVWFMHCHFEVHTSWGLRMAWIVLDGSLPSQKLP  562

Query  1808  PPPSDLPKC  1834
             PPPSDLPKC
Sbjct  563   PPPSDLPKC  571



>ref|XP_006480874.1| PREDICTED: laccase-17-like isoform X1 [Citrus sinensis]
Length=581

 Score =   873 bits (2255),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/578 (70%), Positives = 474/578 (82%), Gaps = 1/578 (0%)
 Frame = +2

Query  101   HAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGK  280
             H  P  +     + + +++  P  A+AKH  VTRHYKFNI M+NV RLC TKSIVTVNG+
Sbjct  5     HLLPSAILKAMFLALFAMWILPEPALAKHARVTRHYKFNIEMKNVRRLCQTKSIVTVNGQ  64

Query  281   FPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVY  460
             FPGPRI+AREGDR+L+KVVNHV  NV++HWHG+RQ+R+GWADGPAYITQCPIQTGQ+YVY
Sbjct  65    FPGPRIIAREGDRLLIKVVNHVKYNVTLHWHGVRQLRSGWADGPAYITQCPIQTGQSYVY  124

Query  461   NFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTE  640
             NFT+ GQRGTLFWHAHISWLRATL+GPI+ILP+++ SYPFP+P KEVPMIFGEWW  DTE
Sbjct  125   NFTVTGQRGTLFWHAHISWLRATLYGPIVILPKRHASYPFPQPFKEVPMIFGEWWKADTE  184

Query  641   AVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDEL  820
              +++QALQ G  PNISDA+TINGLPGPLYNCSA +TFK+KVKPGKTYLLRMINAALNDEL
Sbjct  185   KIINQALQTGAAPNISDAFTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRMINAALNDEL  244

Query  821   FFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTG  1000
             FF IANHT+TVVE DA YVKP +T +++I PGQT NVLLK K   P ++F +AARPY TG
Sbjct  245   FFSIANHTLTVVETDAVYVKPIKTKVVLITPGQTTNVLLKAKHKSPNASFLIAARPYATG  304

Query  1001  QGTFDNSTVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFP  1180
               +FDN+T AGVLEYE P+ N +KN   P+  P LP  N T+F   F+ K+RSL  ++FP
Sbjct  305   PASFDNTTTAGVLEYEQPN-NANKNKKLPLLKPALPKFNDTNFAMQFSKKIRSLATAKFP  363

Query  1181  ANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRK  1360
             A VP+ VD+ FFFTVGLG +PCP+NQTCQGPN T  AAS+NNVSF  P  A+LQA++  K
Sbjct  364   AKVPRKVDRLFFFTVGLGLSPCPQNQTCQGPNNTMLAASINNVSFAQPNIALLQAHFFNK  423

Query  1361  SNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHP  1540
             S GVY TDFP+ P   FNYTGTPP+N  V + T+ V LPFNA+VE+V+QDTSI+GAESHP
Sbjct  424   SKGVYTTDFPANPPFKFNYTGTPPSNILVSSGTRAVALPFNASVEVVMQDTSIIGAESHP  483

Query  1541  LHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFM  1720
             LHLHG+NF+VVGQGFGNFDP KDPA +NLVDP ERNT+GVPSGGW AIRF ADNPG WFM
Sbjct  484   LHLHGFNFFVVGQGFGNFDPSKDPAKFNLVDPAERNTVGVPSGGWVAIRFLADNPGAWFM  543

Query  1721  HCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             HCH EVH SWGL+MAWIV +GK P QKL PPPSDLPKC
Sbjct  544   HCHLEVHTSWGLKMAWIVNDGKGPKQKLPPPPSDLPKC  581



>ref|XP_002531565.1| laccase, putative [Ricinus communis]
 gb|EEF30831.1| laccase, putative [Ricinus communis]
Length=577

 Score =   872 bits (2254),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/575 (72%), Positives = 481/575 (84%), Gaps = 8/575 (1%)
 Frame = +2

Query  113   PLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGP  292
             P +AA        L   P+ AVA    VTRHY FNI  Q +TRLCHT+S++TVNGKFPGP
Sbjct  10    PSMAAALAFTFCILSLLPNFAVA----VTRHYTFNIVNQTITRLCHTRSVLTVNGKFPGP  65

Query  293   RIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTI  472
             R++AREGDRV++KVVNHV +NV+IHWHGIRQ+  GWADGPAYITQCPIQTGQ+Y YNFTI
Sbjct  66    RLVAREGDRVIIKVVNHVSSNVTIHWHGIRQLTTGWADGPAYITQCPIQTGQSYTYNFTI  125

Query  473   VGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVS  652
              GQRGTL WHAHISWLR++L+GPIII PR+N SYPF KP+KE+P++ GEW+NVD EAV++
Sbjct  126   TGQRGTLLWHAHISWLRSSLYGPIIIFPRRNESYPFQKPYKEIPILLGEWFNVDPEAVIA  185

Query  653   QALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRI  832
             QALQ G GPN+SDAYTINGLPGPLYNCS+ +TFK+KVKPGKTYLLR+INAALNDELFF I
Sbjct  186   QALQIGAGPNVSDAYTINGLPGPLYNCSSKDTFKLKVKPGKTYLLRIINAALNDELFFSI  245

Query  833   ANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTF  1012
             A+HT+TVVEADA Y KPFETD L+I PGQT NVLLKTK + P +T+ MAARPYFTGQGTF
Sbjct  246   ASHTLTVVEADAIYTKPFETDTLLITPGQTTNVLLKTKPSLPNATYLMAARPYFTGQGTF  305

Query  1013  DNSTVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVP  1192
             DNST A +LEY+ PS NIS+    P+  P LPPIN T FV+N T + RSL N++FPANVP
Sbjct  306   DNSTAAAILEYKHPS-NISRQ--LPLFKPTLPPINATGFVANITRRFRSLANAKFPANVP  362

Query  1193  QTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNG  1369
             Q VD+ FFFTVGLGTNPCP N TCQGP N TKF+AS+NNVSF+ P+ ++LQ+YY  KSNG
Sbjct  363   QNVDRKFFFTVGLGTNPCPANTTCQGPTNTTKFSASINNVSFLMPSVSLLQSYYFGKSNG  422

Query  1370  VYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHL  1549
             ++  DFP  P TPFNYTGTPPNNT V N T+ ++L FN +VELV+QDTSILGAESHPLHL
Sbjct  423   IFTADFPQNPPTPFNYTGTPPNNTNVSNGTRALMLRFNTSVELVMQDTSILGAESHPLHL  482

Query  1550  HGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCH  1729
             HG+NF+VVGQGFGN++  KDPAN+NLVDP+ERNT+GVP+GGW AIRF ADNPGVWFMHCH
Sbjct  483   HGFNFFVVGQGFGNYNSNKDPANFNLVDPMERNTVGVPAGGWVAIRFLADNPGVWFMHCH  542

Query  1730  FEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
              +VH SWGLRMAW+V  G  PNQKL PPPSDLPKC
Sbjct  543   LDVHTSWGLRMAWLVLNGPQPNQKLQPPPSDLPKC  577



>ref|XP_006341009.1| PREDICTED: laccase-17-like [Solanum tuberosum]
Length=568

 Score =   872 bits (2253),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/567 (73%), Positives = 483/567 (85%), Gaps = 9/567 (2%)
 Frame = +2

Query  134   LMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREG  313
             LMI + L   P ++ A     TRHYKF I+MQNVTRLCHTKSIVTVNG+FPGPRI+AREG
Sbjct  11    LMIASCLL--PSVSAA-----TRHYKFEIKMQNVTRLCHTKSIVTVNGQFPGPRIVAREG  63

Query  314   DRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTL  493
             DR+ ++VVNHV NN+SIHWHGIRQ+R+GWADGPAY+TQCPIQTGQ Y+YNFTI+GQRGT 
Sbjct  64    DRLEIEVVNHVHNNISIHWHGIRQVRSGWADGPAYVTQCPIQTGQKYLYNFTIIGQRGTF  123

Query  494   FWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGG  673
             +WHAHISWLR+TL+GPIIILP+KNT YPF KP+KEVP+IFGEW+N DTEA++SQALQ GG
Sbjct  124   WWHAHISWLRSTLYGPIIILPKKNTPYPFAKPYKEVPIIFGEWFNADTEAIISQALQTGG  183

Query  674   GPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTV  853
             GPN+SDAYTINGLPGPLYNCS  +TFK+KVKPGKTYLLR+INAALNDELFF IANHT+ +
Sbjct  184   GPNVSDAYTINGLPGPLYNCSTKDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTLQI  243

Query  854   VEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAG  1033
             ++AD  YVKPFET+ L+I PGQT NVLLKTK + P +TF+M ARPY TG GTFDNSTVAG
Sbjct  244   IDADGVYVKPFETNTLIITPGQTHNVLLKTKPHFPNATFYMTARPYVTGLGTFDNSTVAG  303

Query  1034  VLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNF  1213
             +LEYE  +    KN   P+  P LP +N T+FV+NFT +LRSL + QF ANVPQ VDK  
Sbjct  304   ILEYESKTELHLKN--LPLFKPLLPALNDTNFVTNFTSRLRSLASPQFLANVPQNVDKRL  361

Query  1214  FFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPS  1393
             FFTVGLGT+PC + +TCQGPNGTKF+AS+NNVSF+ PTTA+LQ+++  +S GVY  DFP 
Sbjct  362   FFTVGLGTSPCDQIKTCQGPNGTKFSASINNVSFILPTTALLQSHFFGQSKGVYKPDFPY  421

Query  1394  VPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVV  1573
              PL  FNYTG PPNNT V N TK++VLPFN +VELV+QDTSILG ESHPLHLHG+NF+VV
Sbjct  422   SPLNWFNYTGNPPNNTLVHNDTKLMVLPFNTSVELVMQDTSILGLESHPLHLHGFNFFVV  481

Query  1574  GQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWG  1753
             GQGFGNFDP KDP+N+NLVDP+ERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH SWG
Sbjct  482   GQGFGNFDPNKDPSNFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWG  541

Query  1754  LRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             L MAW+V+ GKLPNQKL PPP DLPKC
Sbjct  542   LEMAWLVQNGKLPNQKLPPPPMDLPKC  568



>ref|XP_011095204.1| PREDICTED: laccase-17-like [Sesamum indicum]
Length=579

 Score =   872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/550 (78%), Positives = 482/550 (88%), Gaps = 4/550 (1%)
 Frame = +2

Query  194   VTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWH  373
             +TRHY FNI   NVTRLC TKSI++VNGKFPGPR++AREGD+VLVKVVN+V NNV+IHWH
Sbjct  31    MTRHYTFNIVQHNVTRLCTTKSIISVNGKFPGPRLIAREGDQVLVKVVNNVMNNVTIHWH  90

Query  374   GIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIIL  553
             G+RQ+R+GWADGPAY+TQCPIQTGQ+Y YNFTI GQRGTLFWHAHISWLRATL+GPIIIL
Sbjct  91    GVRQLRSGWADGPAYVTQCPIQTGQSYTYNFTITGQRGTLFWHAHISWLRATLYGPIIIL  150

Query  554   PRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNC  733
             PR+N SYPF KP+KEVP+IFGEWWNVD EAV++QALQ GGGPN+SDAYTINGLPGPLYNC
Sbjct  151   PRQNESYPFRKPYKEVPIIFGEWWNVDPEAVINQALQTGGGPNVSDAYTINGLPGPLYNC  210

Query  734   SAN---ETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLV  904
             S+     TFK+KVKPGKTY+LR+INAA+NDELFF IANH VT+VEADA YVKPF T ++ 
Sbjct  211   SSKGNINTFKLKVKPGKTYMLRLINAAMNDELFFSIANHNVTIVEADAVYVKPFVTSVVF  270

Query  905   IAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTK  1084
             I PGQT NVLLKTK   P +TF MAARPYFTGQGTFDNSTVAG LEYE P L+IS +  K
Sbjct  271   ITPGQTTNVLLKTKPYYPNATFLMAARPYFTGQGTFDNSTVAGFLEYEHP-LHISFDKNK  329

Query  1085  PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTC  1264
              I  P LPPIN T  V+NFT   RSL + ++ ANVPQTVDK FFFTVGLG++PCP+N TC
Sbjct  330   TIFKPSLPPINATGVVANFTKMFRSLNSPKYTANVPQTVDKQFFFTVGLGSSPCPQNATC  389

Query  1265  QGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQ  1444
             QGPNGTKFAAS+NNVSF  PTTA+LQAY+S+ S G+Y TDFPS P  PFNYTG+PPNNTQ
Sbjct  390   QGPNGTKFAASVNNVSFALPTTALLQAYFSKNSYGIYTTDFPSNPPNPFNYTGSPPNNTQ  449

Query  1445  VVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYN  1624
             V N T+VVVLPFN +VELVLQDTSILGAESHPLHLHG+NF+VVG+GFGN+DP KDPAN+N
Sbjct  450   VSNGTRVVVLPFNTSVELVLQDTSILGAESHPLHLHGFNFFVVGEGFGNYDPYKDPANFN  509

Query  1625  LVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKL  1804
             LVDPVERNTIGVPSGGW AIRF ADNPGVWFMHCHF+VH SWGLRMAWIV +G+LP+QKL
Sbjct  510   LVDPVERNTIGVPSGGWVAIRFLADNPGVWFMHCHFDVHTSWGLRMAWIVLDGQLPSQKL  569

Query  1805  LPPPSDLPKC  1834
              PPPSDLPKC
Sbjct  570   PPPPSDLPKC  579



>ref|XP_010443793.1| PREDICTED: laccase-17 [Camelina sativa]
Length=611

 Score =   872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/577 (71%), Positives = 483/577 (84%), Gaps = 14/577 (2%)
 Frame = +2

Query  131   FLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
              L I + +   P  A      +TRHY   I+MQNVTRLCHTKS+V+VNG+FPGP+++ARE
Sbjct  40    LLAIFSCVLLLPQPAFG----ITRHYTLEIKMQNVTRLCHTKSLVSVNGQFPGPKLIARE  95

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GD++L+KVVN VPNN+SIHWHGIRQ+R+GWADGPAYITQCPIQTGQ+YVYN+TIVGQRGT
Sbjct  96    GDQLLIKVVNQVPNNISIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRGT  155

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             LF+HAHISWLRAT++GP+IILP++   YPF KPHKEVPMIFGEW+N D EA++ QA Q G
Sbjct  156   LFYHAHISWLRATVYGPLIILPKRGVPYPFAKPHKEVPMIFGEWFNADPEAIIRQATQTG  215

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
             GGPN+SDAYTINGLPGPLYNCSA +TF+++VKPGKTYLLR+INAALNDELFF IANHTVT
Sbjct  216   GGPNVSDAYTINGLPGPLYNCSAKDTFRLRVKPGKTYLLRLINAALNDELFFSIANHTVT  275

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VVEADA YVKPFETD ++IAPGQT NVLLKTK + P ++FFM+ARPY TGQGTFDNSTVA
Sbjct  276   VVEADAIYVKPFETDTILIAPGQTTNVLLKTKPSYPSASFFMSARPYVTGQGTFDNSTVA  335

Query  1031  GVLEYEIPSLNISKNSTK------PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVP  1192
             G+LEYE PS       ++      P+  P LP +N T+F + F+ KLRSL +  FPANVP
Sbjct  336   GILEYE-PSKQTKDAHSRTKIKNLPLFKPTLPALNDTNFATKFSNKLRSLNSKNFPANVP  394

Query  1193  QTVDKNFFFTVGLGTNPC--PKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKS  1363
               VD+ FFFTVGLGTNPC    NQTCQGP N T FAAS++N+SF  PT A+LQ++YS +S
Sbjct  395   LNVDRKFFFTVGLGTNPCNHKNNQTCQGPTNTTMFAASISNISFTMPTKALLQSHYSGQS  454

Query  1364  NGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPL  1543
             +GVY+  FP  P+ PFNYTGTPPNNT V N T ++VLP+N +VELV+QDTSILGAESHPL
Sbjct  455   HGVYSPKFPWSPIVPFNYTGTPPNNTMVSNGTNLMVLPYNTSVELVMQDTSILGAESHPL  514

Query  1544  HLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMH  1723
             HLHG+NF+VVGQGFGNFDP KDP N+NLVDP+ERNTIGVPSGGWAAIRF ADNPGVWFMH
Sbjct  515   HLHGFNFFVVGQGFGNFDPNKDPKNFNLVDPIERNTIGVPSGGWAAIRFLADNPGVWFMH  574

Query  1724  CHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             CH EVH SWGLRMAW+V +G  P+QKLLPPP+DLPKC
Sbjct  575   CHLEVHTSWGLRMAWLVLDGDKPDQKLLPPPADLPKC  611



>ref|XP_010557244.1| PREDICTED: laccase-2-like [Tarenaya hassleriana]
Length=574

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/574 (71%), Positives = 486/574 (85%), Gaps = 10/574 (2%)
 Frame = +2

Query  116   LLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPR  295
             +L AC + I        H+ VA  G +TR YKF+I+++NVTRLC T+SI+TVNGKFPGPR
Sbjct  10    VLVACLIAISN------HVNVASAG-ITRRYKFDIQLKNVTRLCKTRSILTVNGKFPGPR  62

Query  296   IMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIV  475
             ++AREGD +L+KVVNHV  N+SIHWHGIRQ+R+GWADGPAYITQCPI+TGQ+YVYNFT+ 
Sbjct  63    VIAREGDNLLIKVVNHVSTNISIHWHGIRQLRSGWADGPAYITQCPIRTGQSYVYNFTVT  122

Query  476   GQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQ  655
             GQRGTL+WHAHI+W+RAT++GP+IILP+ + SYPFPKP+K++P+IFGEW+NVD +AV+ Q
Sbjct  123   GQRGTLWWHAHITWVRATVYGPLIILPKLHDSYPFPKPYKQIPIIFGEWFNVDPQAVIQQ  182

Query  656   ALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIA  835
             ALQ GGGPN SDA+TINGLPGPLYNCSA +T+K+KVKPGKTYLLR+INAALND+LFF IA
Sbjct  183   ALQTGGGPNASDAHTINGLPGPLYNCSAKDTYKLKVKPGKTYLLRLINAALNDQLFFGIA  242

Query  836   NHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFD  1015
             NHT+TVVEADA YVKPF+T++LVI PGQT NVLLKTK   P +TFFM AR YF GQGT D
Sbjct  243   NHTLTVVEADASYVKPFKTNVLVIGPGQTTNVLLKTKHVSPNATFFMLARTYFVGQGTID  302

Query  1016  NSTVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQ  1195
             N+TVAG+LEYE  + N  K  T+P+  P LP IN T FV+NF+   RSL +S+FP +VP+
Sbjct  303   NTTVAGILEYERKASNSPK--TRPVLKPALPAINATGFVANFSNMFRSLASSKFPVDVPK  360

Query  1196  TVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTP-TTAILQAYYSRKSNGV  1372
             TVD+ FFFTVGLGTNPCPKNQTCQGPNGTKFAAS+NNVSFV P TT++L++Y+  KSN V
Sbjct  361   TVDRKFFFTVGLGTNPCPKNQTCQGPNGTKFAASINNVSFVLPNTTSLLRSYFFGKSNRV  420

Query  1373  YATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLH  1552
             + TDFPS P+ PFNYTG PPNNT V   TKVVVL +N TVELV QDTSILGAESHPLHLH
Sbjct  421   FTTDFPSSPIFPFNYTGMPPNNTMVARGTKVVVLKYNTTVELVFQDTSILGAESHPLHLH  480

Query  1553  GYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHF  1732
             G+NFYVVGQGFGNFDP +DP  +NL+DPVERNT  VP+GGW A+RFRADNPGVW MHCH 
Sbjct  481   GFNFYVVGQGFGNFDPTRDPKRFNLLDPVERNTALVPAGGWIAVRFRADNPGVWLMHCHI  540

Query  1733  EVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             E+HLSWGL MAW+V +G LPNQKL PPPSD PKC
Sbjct  541   EIHLSWGLTMAWVVLDGDLPNQKLPPPPSDFPKC  574



>emb|CDP01507.1| unnamed protein product [Coffea canephora]
Length=584

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/575 (71%), Positives = 485/575 (84%), Gaps = 14/575 (2%)
 Frame = +2

Query  131   FLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
             F+ +M      P  A+     +TRHY+ NI M NVTRLCHTKS+V VNG+FPGPRI+A E
Sbjct  17    FVALMALSLLLPQHALG----ITRHYELNITMLNVTRLCHTKSLVAVNGQFPGPRIVAGE  72

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GDR+L+KV NHV NN++IHWHGIRQ+R+GWADGPAYITQCPIQTGQ+YVYN+TIVGQRGT
Sbjct  73    GDRLLIKVNNHVSNNITIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRGT  132

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             LFWHAHISWLRAT +GP+IILP+ +  YPF KP++EVP+IFGEW+N DTEA++SQAL+ G
Sbjct  133   LFWHAHISWLRATAYGPLIILPKHHVPYPFAKPYEEVPIIFGEWFNADTEAIISQALRTG  192

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
             GGPN+SDAYTINGLPGPLYNCSA +TF++KVK GKTYLLR+INAALNDELFF IANHT+T
Sbjct  193   GGPNVSDAYTINGLPGPLYNCSAKDTFRLKVKAGKTYLLRLINAALNDELFFSIANHTLT  252

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VVEADA YVKPFETD ++IAPGQT NVLLKTK   P +TF M A PYFTG GTFDNSTVA
Sbjct  253   VVEADANYVKPFETDTILIAPGQTTNVLLKTKPQFPAATFLMLATPYFTGAGTFDNSTVA  312

Query  1031  GVLEYEIPSLNISKNSTKPIAL-------PPLPPINGTSFVSNFTGKLRSLGNSQFPANV  1189
             G++EYE    + S NST  I++       P LP +N TSF +NF+ KLRSL + Q+PANV
Sbjct  313   GIVEYE---QSTSLNSTTAISVKKLPLFRPTLPALNDTSFAANFSNKLRSLASPQYPANV  369

Query  1190  PQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNG  1369
             P  +DK  FFTVGLGT+PC + Q CQGPNGTKFAAS+NN+SFV PTTA+LQ+++S +S+G
Sbjct  370   PWNIDKQVFFTVGLGTSPCDQPQGCQGPNGTKFAASVNNISFVQPTTALLQSHFSGQSSG  429

Query  1370  VYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHL  1549
             VY+ DFP  PL   NYTG PPNNT V NATKV+V+PFN +VEL++QDTSILGAESHPLHL
Sbjct  430   VYSPDFPFNPLHWLNYTGNPPNNTMVGNATKVLVVPFNTSVELIMQDTSILGAESHPLHL  489

Query  1550  HGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCH  1729
             HG+NF+VVGQGFGN+DP KDP N+NLVDP+ERNT+GVPSGGW AIRF ADNPG+WFMHCH
Sbjct  490   HGFNFFVVGQGFGNYDPNKDPKNFNLVDPIERNTVGVPSGGWVAIRFLADNPGMWFMHCH  549

Query  1730  FEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
              EVH SWGL+MAW+V +GKLPNQKLLPPP+DLPKC
Sbjct  550   LEVHTSWGLKMAWLVLDGKLPNQKLLPPPADLPKC  584



>ref|XP_007208011.1| hypothetical protein PRUPE_ppa003319mg [Prunus persica]
 gb|EMJ09210.1| hypothetical protein PRUPE_ppa003319mg [Prunus persica]
Length=585

 Score =   870 bits (2248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/583 (71%), Positives = 476/583 (82%), Gaps = 18/583 (3%)
 Frame = +2

Query  128   CFLMIMTSLFFF-------PHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFP  286
             CF  +   LF F       P  A  K    TRHY FNI   NVTRLC+T+SI++VNGKFP
Sbjct  7     CFTSMAALLFSFFIAASWMPEFAAGK----TRHYTFNIEYHNVTRLCNTRSILSVNGKFP  62

Query  287   GPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNF  466
             GPR++AREGD+VL+KVVNHV NN++IHWHGIRQ++ GWADGPAYITQCPIQTGQ Y YNF
Sbjct  63    GPRLVAREGDQVLIKVVNHVSNNITIHWHGIRQLQTGWADGPAYITQCPIQTGQAYTYNF  122

Query  467   TIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAV  646
             TI GQRGTL WHAHISWLR+TLHGPIIILP++N SYPF KP+KEVP+I GEW+NVD EAV
Sbjct  123   TITGQRGTLLWHAHISWLRSTLHGPIIILPKRNESYPFVKPYKEVPIILGEWFNVDPEAV  182

Query  647   VSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFF  826
             +SQALQ G GPN+SDAYTINGLPGPLYNCS+ + FK+KVKPGKTYLLR+INAALNDELFF
Sbjct  183   ISQALQTGAGPNVSDAYTINGLPGPLYNCSSRDVFKLKVKPGKTYLLRLINAALNDELFF  242

Query  827   RIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQG  1006
              IANH++TVVEADA Y KPFETD+L+IAPGQT N+LLKTK   P +TF + ARPYFTG G
Sbjct  243   SIANHSLTVVEADAVYTKPFETDILLIAPGQTTNILLKTKPTSPNATFLILARPYFTGGG  302

Query  1007  TFDNSTVAGVLEYEIP-SLNISKNSTKPIALPPLPPING------TSFVSNFTGKLRSLG  1165
             T DN+T AG+LEY+ P + + +     P+  P LPPIN       T FV N   K RSL 
Sbjct  303   TLDNTTTAGILEYKHPNTTHHTSIKALPLFRPSLPPINATKFVNVTQFVENLAKKFRSLA  362

Query  1166  NSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQA  1345
               QFPANVPQTVD+ FFFT+GLGT+PCP+N TCQGPNG KFAAS+NN SF  P+TA+LQA
Sbjct  363   TKQFPANVPQTVDRRFFFTLGLGTSPCPQNSTCQGPNGLKFAASVNNFSFALPSTAMLQA  422

Query  1346  YYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILG  1525
             ++S +S+GVY TDFP+ PL  FNYTGTPPN T V NATK VVLPFN +VELVLQDTSILG
Sbjct  423   HFSGQSSGVYTTDFPTKPLVAFNYTGTPPNITNVSNATKAVVLPFNTSVELVLQDTSILG  482

Query  1526  AESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNP  1705
             AESHPLHLHGYNF++VG GFGN+DP KDPAN+NLVDP ERNT GVP+GGW AIRF ADNP
Sbjct  483   AESHPLHLHGYNFFIVGLGFGNYDPTKDPANFNLVDPAERNTAGVPAGGWIAIRFFADNP  542

Query  1706  GVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             GVWFMHCH ++H SWGLRMAWIV++G  PNQKL PPPSDLP+C
Sbjct  543   GVWFMHCHLDIHTSWGLRMAWIVQDGPQPNQKLPPPPSDLPQC  585



>ref|XP_009120521.1| PREDICTED: laccase-17-like [Brassica rapa]
Length=573

 Score =   870 bits (2247),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/571 (72%), Positives = 481/571 (84%), Gaps = 7/571 (1%)
 Frame = +2

Query  131   FLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
             F ++++ LF  P  A      +TRHY  +I+M NVTRLCHTKS+V+VNG+FPGP+++ARE
Sbjct  7     FAVVLSCLFLLPDPAFG----ITRHYTLDIKMHNVTRLCHTKSLVSVNGQFPGPKLIARE  62

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GD++L+KVVNHVPNN+SIHWHGIRQ+R+GWADGPAYITQCPIQTGQ+YVYN+TI GQRGT
Sbjct  63    GDQLLIKVVNHVPNNISIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIAGQRGT  122

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             LF+HAHISWLRAT++GPIIILP++   YPFPKPHKEVPMIFGEW+N D EA++ QA Q G
Sbjct  123   LFYHAHISWLRATVYGPIIILPKRGVPYPFPKPHKEVPMIFGEWFNADPEAIIRQATQTG  182

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
             GGPN+SDAYTINGLPGPLYNCSA +TF+++VKPGKTYLLR+INAALNDELFF IANHTVT
Sbjct  183   GGPNVSDAYTINGLPGPLYNCSAKDTFRLRVKPGKTYLLRLINAALNDELFFSIANHTVT  242

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VVEADA YVKPFETD ++IAPGQT N+LLKTK + P ++F M ARPY TGQGTFDNSTVA
Sbjct  243   VVEADAIYVKPFETDTILIAPGQTTNLLLKTKPSYPNASFLMTARPYVTGQGTFDNSTVA  302

Query  1031  GVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKN  1210
             GVLEYE P    +     P+  P LP +N T+F + F+ KLRSL + +FPANVP  VD+ 
Sbjct  303   GVLEYEQPKHAKTSIKNLPLFAPVLPALNDTNFAAKFSNKLRSLNSKRFPANVPLKVDRK  362

Query  1211  FFFTVGLGTNPC--PKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYAT  1381
             FFFTVGLGT PC    NQTCQGP N T FAAS++N+SF  PT A+LQ++YS +SNGVY+ 
Sbjct  363   FFFTVGLGTTPCNHKNNQTCQGPTNTTMFAASISNISFTMPTKALLQSHYSGQSNGVYSP  422

Query  1382  DFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYN  1561
             +FP  P+ PFNYTGTPPNNT V   T V+VL +N +VELV+QDTSILGAESHPLHLHG+N
Sbjct  423   NFPWNPVVPFNYTGTPPNNTMVRTGTNVMVLRYNTSVELVMQDTSILGAESHPLHLHGFN  482

Query  1562  FYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVH  1741
             F+VVGQGFGNFDPKKDP N+NLVDP+ERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH
Sbjct  483   FFVVGQGFGNFDPKKDPKNFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVH  542

Query  1742  LSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
              SWGLRMAW+V +G  P+QKLLPPP DLPKC
Sbjct  543   TSWGLRMAWLVLDGDKPDQKLLPPPVDLPKC  573



>ref|XP_007026983.1| Laccase 17 isoform 1 [Theobroma cacao]
 ref|XP_007026984.1| Laccase 17 isoform 1 [Theobroma cacao]
 gb|EOY07485.1| Laccase 17 isoform 1 [Theobroma cacao]
 gb|EOY07486.1| Laccase 17 isoform 1 [Theobroma cacao]
Length=577

 Score =   869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/548 (75%), Positives = 470/548 (86%), Gaps = 5/548 (1%)
 Frame = +2

Query  197   TRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHG  376
             TRHY FNI   NVTRLCHT++I+TVN +FPGPR++AREGDRV+VKVVNH+ NNVSIHWHG
Sbjct  33    TRHYTFNIDYHNVTRLCHTRTILTVNRQFPGPRLVAREGDRVIVKVVNHISNNVSIHWHG  92

Query  377   IRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILP  556
             IRQ+  GWADGP+Y+TQCPIQT Q+Y+YNFTI GQRGTL WHAHISWLRAT++GPIIILP
Sbjct  93    IRQLTTGWADGPSYVTQCPIQTNQSYIYNFTITGQRGTLLWHAHISWLRATIYGPIIILP  152

Query  557   RKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCS  736
             ++N SYPF KPHKEV ++FGEW+N D EA++SQALQ G  PN+SDAYTIN LPGPLYNCS
Sbjct  153   KRNESYPFVKPHKEVTILFGEWFNTDPEAIISQALQTGAAPNVSDAYTINSLPGPLYNCS  212

Query  737   ANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPG  916
             + +T+K+KVKPGKTYLLR+INAALNDELFF IANHTVTVVE DA Y KPFETD L+I PG
Sbjct  213   SKDTYKLKVKPGKTYLLRLINAALNDELFFSIANHTVTVVEGDAIYTKPFETDKLLITPG  272

Query  917   QTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLN-ISKNSTKPIA  1093
             QT NVLLKTK   P ++F MAARPYFTGQGT DNST  G+LEYE P  +  SKN T  + 
Sbjct  273   QTTNVLLKTKPEFPNASFLMAARPYFTGQGTIDNSTTVGILEYEHPKHHKSSKNLT--LL  330

Query  1094  LPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGP  1273
              P LPPIN T+FV+NFTGK RSL N++FPANVP+TVDK FFFTVGLGT+PCP+N TCQGP
Sbjct  331   QPTLPPINATAFVANFTGKFRSLANAKFPANVPKTVDKKFFFTVGLGTSPCPQNTTCQGP  390

Query  1274  -NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVV  1450
              N +KFAAS+NN+SF  P+ AILQAYY  + NGVY TDFP+ PL PFNYTGTPPNNT V+
Sbjct  391   NNSSKFAASVNNMSFALPSVAILQAYYFGQ-NGVYTTDFPTQPLIPFNYTGTPPNNTNVM  449

Query  1451  NATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLV  1630
             N T+ VVLPFN +VELV+QDTSILGAESHPLHLHGYNF+VVGQGFGNFDP KDPA +NLV
Sbjct  450   NGTRTVVLPFNTSVELVMQDTSILGAESHPLHLHGYNFFVVGQGFGNFDPNKDPAKFNLV  509

Query  1631  DPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLP  1810
             DP+ERNT GVP+GGW AIRF ADNPGVWFMHCH +VH SWGL+MAWIV +G  PNQKL P
Sbjct  510   DPMERNTAGVPAGGWLAIRFFADNPGVWFMHCHLDVHTSWGLKMAWIVLDGPQPNQKLQP  569

Query  1811  PPSDLPKC  1834
             PPSDLP+C
Sbjct  570   PPSDLPQC  577



>ref|XP_010455850.1| PREDICTED: laccase-17-like [Camelina sativa]
Length=577

 Score =   869 bits (2245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/577 (71%), Positives = 483/577 (84%), Gaps = 14/577 (2%)
 Frame = +2

Query  131   FLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
              L I + +   P  A A    +TRHY   I+MQNVTRLCHTKS+V+VNG+FPGP+++ARE
Sbjct  6     LLAIFSCVLLLPQPAFA----ITRHYTLEIKMQNVTRLCHTKSLVSVNGQFPGPKLIARE  61

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GD++L+KVVN VPNN+SIHWHGIRQ+R GWADGPAYITQCPIQTGQ+YVYN+TIVGQRGT
Sbjct  62    GDQLLIKVVNQVPNNISIHWHGIRQLRTGWADGPAYITQCPIQTGQSYVYNYTIVGQRGT  121

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             LF+HAHISWLRAT++GP+IILP++   YPF KPHKEVPMIFGEW+N D EA++ QA Q G
Sbjct  122   LFYHAHISWLRATVYGPLIILPKRGVPYPFAKPHKEVPMIFGEWFNADPEAIIRQATQTG  181

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
             GGPN+SDAYTINGLPGPLYNCSA +TF+++VKPGKTYLLR+INAALNDELFF IANHTVT
Sbjct  182   GGPNVSDAYTINGLPGPLYNCSAKDTFRLRVKPGKTYLLRLINAALNDELFFSIANHTVT  241

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VVEADA YVKPFETD ++IAPGQT NVLLKTK + P ++FFM+ARPY TGQGTFDNSTVA
Sbjct  242   VVEADAIYVKPFETDTILIAPGQTTNVLLKTKPSYPSASFFMSARPYVTGQGTFDNSTVA  301

Query  1031  GVLEYEIPSLNISKNSTK------PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVP  1192
             G+LEYE PS     + ++      P+  P LP +N T+F + F+ KLRSL +  FPANVP
Sbjct  302   GILEYE-PSKQTKDDHSRTKIKNLPLFKPTLPALNDTNFATKFSNKLRSLNSKNFPANVP  360

Query  1193  QTVDKNFFFTVGLGTNPC--PKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKS  1363
               VD+ FFFTVGLGTNPC    NQTCQGP N T FAAS++N+SF  PT A+LQ++YS +S
Sbjct  361   LNVDRKFFFTVGLGTNPCNHKNNQTCQGPTNTTMFAASISNISFTMPTKALLQSHYSGQS  420

Query  1364  NGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPL  1543
             +GVY+  FP  P+ PFNYTGTPPNNT V N T ++VLP+N +VELV+QDTSILGAESHPL
Sbjct  421   HGVYSPKFPWSPIVPFNYTGTPPNNTMVSNGTNLMVLPYNTSVELVMQDTSILGAESHPL  480

Query  1544  HLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMH  1723
             HLHG+NF+VVGQGFGNFD  KDP N+NLVDP+ERNTIGVPSGGWAAIRF ADNPGVWFMH
Sbjct  481   HLHGFNFFVVGQGFGNFDANKDPKNFNLVDPIERNTIGVPSGGWAAIRFLADNPGVWFMH  540

Query  1724  CHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             CH EVH SWGLRMAW+V +G  P+QKLLPPP+DLPKC
Sbjct  541   CHLEVHTSWGLRMAWLVLDGDKPDQKLLPPPADLPKC  577



>ref|XP_006429120.1| hypothetical protein CICLE_v10011363mg [Citrus clementina]
 gb|ESR42360.1| hypothetical protein CICLE_v10011363mg [Citrus clementina]
Length=578

 Score =   868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/549 (73%), Positives = 469/549 (85%), Gaps = 0/549 (0%)
 Frame = +2

Query  188   GSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIH  367
               +TRHY FNI+  NVTRLCHT++I++VNG+FPGP ++AREGDRVL+KV NHV NNV+IH
Sbjct  30    AGITRHYTFNIKYHNVTRLCHTRNIISVNGQFPGPSLVAREGDRVLIKVTNHVSNNVTIH  89

Query  368   WHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPII  547
             WHG+RQ+ +GWADGPAY+TQCPIQTGQ+Y YNFTI GQRGTL WHAHISWLR+TL+GPII
Sbjct  90    WHGVRQVTSGWADGPAYVTQCPIQTGQSYTYNFTITGQRGTLLWHAHISWLRSTLYGPII  149

Query  548   ILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLY  727
             ILP++N SYPF KPHKE+P++FGEW+NVD EA++SQALQ G GPN+SDAYTINGLPGPLY
Sbjct  150   ILPKRNESYPFQKPHKEIPILFGEWFNVDPEAIISQALQTGAGPNVSDAYTINGLPGPLY  209

Query  728   NCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVI  907
             NCS+ +T+K+KVKPGKTYLLR+INAALNDELFF IANHT+TVVEADA YVKPF+TD L+I
Sbjct  210   NCSSKDTYKLKVKPGKTYLLRLINAALNDELFFSIANHTLTVVEADAVYVKPFDTDKLLI  269

Query  908   APGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKP  1087
              PGQT NVLL+TK   P +TFFM ARPYF+G GT DNST AG+LEY+ PS +   +    
Sbjct  270   TPGQTANVLLRTKPYFPNATFFMQARPYFSGMGTIDNSTTAGILEYKHPSNHSISSKKLQ  329

Query  1088  IALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQ  1267
             +  P LP IN TSF  NFT K RSL + ++PANVPQ VD+ FFFTVGLG+NPCPKN TCQ
Sbjct  330   LYKPTLPSINDTSFAVNFTRKFRSLASVKYPANVPQIVDRKFFFTVGLGSNPCPKNTTCQ  389

Query  1268  GPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQV  1447
             GPNGTKF+AS+NNVSFV P+TAILQ+Y+  ++NGVY TDFP  P  PFNYTGTPPNNT V
Sbjct  390   GPNGTKFSASVNNVSFVLPSTAILQSYFFGQNNGVYTTDFPVKPPMPFNYTGTPPNNTNV  449

Query  1448  VNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNL  1627
              N T+ V+LPFN +VELV+QDTSILGAESHPLHLHG+NF+VVG GFGN+DP KD  N+NL
Sbjct  450   SNGTRTVLLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGLGFGNYDPDKDLMNFNL  509

Query  1628  VDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLL  1807
             VDP+ERNTIGVP+GGW AIRF ADNPGVWFMHCH +VH SWGLRMAWIV+ G  PNQ L 
Sbjct  510   VDPMERNTIGVPAGGWVAIRFFADNPGVWFMHCHLDVHTSWGLRMAWIVQNGAQPNQTLP  569

Query  1808  PPPSDLPKC  1834
             PPPSDLPKC
Sbjct  570   PPPSDLPKC  578



>emb|CDY31581.1| BnaA10g12900D [Brassica napus]
Length=573

 Score =   868 bits (2243),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/571 (72%), Positives = 480/571 (84%), Gaps = 7/571 (1%)
 Frame = +2

Query  131   FLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
             F ++++ LF  P  A      +TRHY  +I+M NVTRLCHTKS+V+VNG+FPGP+++ARE
Sbjct  7     FAVVLSCLFLLPDPAFG----ITRHYTLDIKMHNVTRLCHTKSLVSVNGQFPGPKLIARE  62

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GD++L+KVVNHVPNN+SIHWHGIRQ+R+GWADGPAYITQCPIQTGQ+YVYN+TI GQRGT
Sbjct  63    GDQLLIKVVNHVPNNISIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIAGQRGT  122

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             LF+HAHISWLRAT++GPIIILP+    YPFPKPHKEVPMIFGEW+N D EA++ QA Q G
Sbjct  123   LFYHAHISWLRATVYGPIIILPKLGVPYPFPKPHKEVPMIFGEWFNADPEAIIRQATQTG  182

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
             GGPN+SDAYTINGLPGPLYNCSA +TF+++VKPGKTYLLR+INAALNDELFF IANHTVT
Sbjct  183   GGPNVSDAYTINGLPGPLYNCSAKDTFRLRVKPGKTYLLRLINAALNDELFFSIANHTVT  242

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VVEADA YVKPFETD ++IAPGQT N+LLKTK + P ++F M ARPY TGQGTFDNSTVA
Sbjct  243   VVEADAVYVKPFETDTILIAPGQTTNLLLKTKPSYPNASFLMTARPYVTGQGTFDNSTVA  302

Query  1031  GVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKN  1210
             GVLEYE P    +     P+  P LP +N T+F + F+ KLRSL + +FPANVP  VD+ 
Sbjct  303   GVLEYEQPKHAKTSIKNLPLFAPVLPALNDTNFAAKFSNKLRSLNSKRFPANVPLKVDRK  362

Query  1211  FFFTVGLGTNPC--PKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYAT  1381
             FFFTVGLGT PC    NQTCQGP N T FAAS++N+SF  PT A+LQ++YS +SNGVY+ 
Sbjct  363   FFFTVGLGTTPCNHKNNQTCQGPTNTTMFAASISNISFTMPTKALLQSHYSGQSNGVYSP  422

Query  1382  DFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYN  1561
             +FP  P+ PFNYTGTPPNNT V   T V+VL +N +VELV+QDTSILGAESHPLHLHG+N
Sbjct  423   NFPWNPVVPFNYTGTPPNNTMVRTGTNVMVLRYNTSVELVMQDTSILGAESHPLHLHGFN  482

Query  1562  FYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVH  1741
             F+VVGQGFGNFDPKKDP N+NLVDP+ERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH
Sbjct  483   FFVVGQGFGNFDPKKDPKNFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVH  542

Query  1742  LSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
              SWGLRMAW+V +G  P+QKLLPPP DLPKC
Sbjct  543   TSWGLRMAWLVLDGDKPDQKLLPPPVDLPKC  573



>gb|KDO51175.1| hypothetical protein CISIN_1g008090mg [Citrus sinensis]
Length=578

 Score =   868 bits (2243),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/549 (73%), Positives = 469/549 (85%), Gaps = 0/549 (0%)
 Frame = +2

Query  188   GSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIH  367
               +TRHY FNI+  NVTRLCHT++I++VNG+FPGP ++AREGDRVL+KV NHV NNV+IH
Sbjct  30    AGITRHYTFNIKYHNVTRLCHTRNIISVNGQFPGPSLVAREGDRVLIKVTNHVSNNVTIH  89

Query  368   WHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPII  547
             WHG+RQ+ +GWADGPAY+TQCPIQTGQ+Y YNFTI GQRGTL WHAHISWLR+TL+GPII
Sbjct  90    WHGVRQVTSGWADGPAYVTQCPIQTGQSYTYNFTITGQRGTLLWHAHISWLRSTLYGPII  149

Query  548   ILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLY  727
             ILP++N SYPF KPHKE+P++FGEW+NVD EA++SQALQ G GPN+SDAYTINGLPGPLY
Sbjct  150   ILPKRNESYPFQKPHKEIPILFGEWFNVDPEAIISQALQTGAGPNVSDAYTINGLPGPLY  209

Query  728   NCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVI  907
             NCS+ +T+K+KVKPGKTYLLR+INAALNDELFF IANHT+TVVEADA YVKPF+TD L+I
Sbjct  210   NCSSKDTYKLKVKPGKTYLLRLINAALNDELFFSIANHTLTVVEADAVYVKPFDTDKLLI  269

Query  908   APGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKP  1087
              PGQT NVLL+TK   P +TFFM ARPYF+G GT DNST AG+LEY+ PS +   +    
Sbjct  270   TPGQTANVLLRTKPYFPNATFFMQARPYFSGMGTIDNSTTAGILEYKHPSNHSISSKKLQ  329

Query  1088  IALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQ  1267
             +  P LP IN TSF  NFT K RSL + ++PANVPQ VD+ FFFTVGLG+NPCPKN TCQ
Sbjct  330   LYKPTLPSINDTSFAVNFTRKFRSLASVKYPANVPQIVDRKFFFTVGLGSNPCPKNTTCQ  389

Query  1268  GPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQV  1447
             GPNGTKF+AS+NNVSFV P+TAILQ+Y+  ++NGVY TDFP  P  PFNYTGTPPNNT V
Sbjct  390   GPNGTKFSASVNNVSFVLPSTAILQSYFFGQNNGVYTTDFPVKPPMPFNYTGTPPNNTNV  449

Query  1448  VNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNL  1627
              N T+ V+LPFN +VELV+QDTSILGAESHPLHLHG+NF+VVG GFGN+DP KD  N+NL
Sbjct  450   SNGTRTVLLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGLGFGNYDPDKDLMNFNL  509

Query  1628  VDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLL  1807
             VDP+ERNTIGVP+GGW AIRF ADNPGVWFMHCH +VH SWGLRMAWIV+ G  PNQ L 
Sbjct  510   VDPMERNTIGVPAGGWVAIRFFADNPGVWFMHCHLDVHTSWGLRMAWIVQNGAQPNQTLP  569

Query  1808  PPPSDLPKC  1834
             PPPSDLPKC
Sbjct  570   PPPSDLPKC  578



>gb|KHN16225.1| Laccase-17, partial [Glycine soja]
Length=540

 Score =   868 bits (2242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/540 (75%), Positives = 470/540 (87%), Gaps = 4/540 (1%)
 Frame = +2

Query  227   QNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWAD  406
             QNVTRLCHTKS+VTVNG+FPGPRI+AREGDR+L+KV NHV NN++IHWHGIRQ+++GWAD
Sbjct  1     QNVTRLCHTKSMVTVNGQFPGPRIVAREGDRLLIKVTNHVSNNITIHWHGIRQLQSGWAD  60

Query  407   GPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPK  586
             GPAY+TQCPIQ GQ+YVYN+TIVGQRGTL+WHAHISWLR+TL+GP+IILP+ N  YPF K
Sbjct  61    GPAYVTQCPIQRGQSYVYNYTIVGQRGTLWWHAHISWLRSTLYGPLIILPKLNAQYPFAK  120

Query  587   PHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVK  766
             PHKEVP++FGEWWN D EAV++QALQ GGGPN+SDAYTINGLPGPLYNCS  +TFK+KVK
Sbjct  121   PHKEVPIVFGEWWNADPEAVITQALQTGGGPNVSDAYTINGLPGPLYNCSDKDTFKLKVK  180

Query  767   PGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTK  946
             PGK YLLR+INAALNDELFF IANHT+TVVEADA YVKPF T+ ++I PGQT NVLLKTK
Sbjct  181   PGKIYLLRLINAALNDELFFSIANHTLTVVEADAVYVKPFATNTILITPGQTTNVLLKTK  240

Query  947   DNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEI-PSLNISKNSTK--PIALPPLPPIN  1117
              + P +TF M ARPY TG GTFDN+TVAG+L+Y+  P+ + S  S K  P+  P LP +N
Sbjct  241   SHYPNATFLMTARPYATGLGTFDNTTVAGILQYKTPPNTHHSAASLKNLPLLKPILPALN  300

Query  1118  GTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAA  1294
              TSF + F  KLRSL ++QFPANVPQ VD +FFFTVGLGT PCP+NQTCQGP N TKFAA
Sbjct  301   DTSFATKFNNKLRSLASAQFPANVPQKVDTHFFFTVGLGTTPCPQNQTCQGPTNATKFAA  360

Query  1295  SLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVL  1474
             S+NNVSF+ PTTA+LQ ++  +SNGVY  DFP+ PL PFNYTGTPPNNT V N TKVVVL
Sbjct  361   SVNNVSFIQPTTALLQTHFFGQSNGVYTADFPAKPLIPFNYTGTPPNNTMVSNGTKVVVL  420

Query  1475  PFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTI  1654
             PFN +VELV+QDTSILGAESHPLHLHG+NF+ VGQGFGNFDP KDPAN+NL+DP+ERNT+
Sbjct  421   PFNTSVELVMQDTSILGAESHPLHLHGFNFFAVGQGFGNFDPNKDPANFNLLDPIERNTV  480

Query  1655  GVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             GVPSGGW AIRF ADNPGVWFMHCH EVH SWGL+MAW+V +GKLPNQKL PPP+DLPKC
Sbjct  481   GVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWVVLDGKLPNQKLFPPPADLPKC  540



>ref|XP_010483648.1| PREDICTED: laccase-17-like [Camelina sativa]
Length=611

 Score =   868 bits (2242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/577 (71%), Positives = 482/577 (84%), Gaps = 14/577 (2%)
 Frame = +2

Query  131   FLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
              L I + +   P  A      +TRHY   I+MQNVTRLCHTKS+V+VNG+FPGP+++ARE
Sbjct  40    LLAIFSFVLLLPQPAFG----ITRHYTLEIKMQNVTRLCHTKSLVSVNGQFPGPKLIARE  95

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GD++L+KVVN VPNN+SIHWHGIRQ+R+GWADGPAYITQCPIQTGQ+YVYN+TIVGQRGT
Sbjct  96    GDQLLIKVVNQVPNNISIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRGT  155

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             LF+HAHISWLRAT++GP+IILP++   YPF KPHKEVPMIFGEW+N D EA++ QA Q G
Sbjct  156   LFYHAHISWLRATVYGPLIILPKRGVPYPFAKPHKEVPMIFGEWFNADPEAIIRQATQTG  215

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
             GGPN+SDAYTINGLPGPLYNCSA +TF+++VKPGKTYLLR+INAALNDELFF IANHTVT
Sbjct  216   GGPNVSDAYTINGLPGPLYNCSAKDTFRLRVKPGKTYLLRLINAALNDELFFSIANHTVT  275

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VVEADA YVKPFETD ++IAPGQT NVLLKTK + P ++FFM+ARPY TGQGTFDNSTVA
Sbjct  276   VVEADAIYVKPFETDTILIAPGQTTNVLLKTKPSYPSASFFMSARPYVTGQGTFDNSTVA  335

Query  1031  GVLEYEIPSLNISKNSTK------PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVP  1192
             G+LEYE PS       ++       +  P LP +N T+F + F+ KLRSL +  FPANVP
Sbjct  336   GILEYE-PSKQTKDAHSRTNIKNHQVFKPTLPALNDTNFATKFSNKLRSLNSKNFPANVP  394

Query  1193  QTVDKNFFFTVGLGTNPC--PKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKS  1363
               VD+ FFFTVGLGTNPC    NQTCQGP N T FAAS++N+SF  PT A+LQ++YS +S
Sbjct  395   LNVDRKFFFTVGLGTNPCNHKNNQTCQGPTNTTMFAASISNISFTMPTKALLQSHYSGQS  454

Query  1364  NGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPL  1543
             +GVY+  FP  P+ PFNYTGTPPNNT V N T ++VLP+N +VELV+QDTSILGAESHPL
Sbjct  455   HGVYSPKFPWSPIVPFNYTGTPPNNTMVSNGTNLMVLPYNTSVELVMQDTSILGAESHPL  514

Query  1544  HLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMH  1723
             HLHG+NF+VVGQGFGNFDP KDP N+NLVDP+ERNTIGVPSGGWAAIRF ADNPGVWFMH
Sbjct  515   HLHGFNFFVVGQGFGNFDPNKDPKNFNLVDPIERNTIGVPSGGWAAIRFLADNPGVWFMH  574

Query  1724  CHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             CH EVH SWGLRMAW+V +G  P+QKLLPPP+DLPKC
Sbjct  575   CHLEVHTSWGLRMAWLVLDGDKPDQKLLPPPADLPKC  611



>ref|XP_009416147.1| PREDICTED: laccase-4-like [Musa acuminata subsp. malaccensis]
Length=582

 Score =   868 bits (2242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/575 (72%), Positives = 482/575 (84%), Gaps = 2/575 (0%)
 Frame = +2

Query  116   LLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPR  295
             LL   FL+   +L      AVA    +TRHYKF+I+M N TRLCHTKSIVTVNG+FPGP+
Sbjct  8     LLVKAFLLSCIALLALSDAAVAPPTGITRHYKFDIQMANATRLCHTKSIVTVNGQFPGPK  67

Query  296   IMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIV  475
             I+AREGDRV+VKVVNHV +NV++HWHGIRQ+R+GWADGPAY+TQCPIQTG +YVYNFTIV
Sbjct  68    IVAREGDRVVVKVVNHVEHNVTLHWHGIRQLRSGWADGPAYVTQCPIQTGHSYVYNFTIV  127

Query  476   GQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQ  655
             GQRGT FWHAHISWLRATL+GPI++LP+    YPF KP+KEVP+I GEWW  D EAV+SQ
Sbjct  128   GQRGTFFWHAHISWLRATLYGPIVVLPQLGVPYPFAKPYKEVPVILGEWWKADAEAVISQ  187

Query  656   ALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIA  835
             AL+ GGGPN+SDAYTINGLPGP YNCSA +TFK+KVKPG TYLLR+INAALNDELFF IA
Sbjct  188   ALETGGGPNVSDAYTINGLPGPFYNCSAKDTFKLKVKPGTTYLLRLINAALNDELFFGIA  247

Query  836   NHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFD  1015
             NHT+TVV+ DA YVKPFE+D L+I+PGQT +VLL+ K + P + FFM+A PY TG GTFD
Sbjct  248   NHTLTVVDVDAVYVKPFESDALLISPGQTTDVLLRAKPDYPNAMFFMSASPYVTGSGTFD  307

Query  1016  NSTVAGVLEYEIP--SLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANV  1189
             NSTVAGVLEY  P  S   S NS  P+  P LP +N TSF +NFTGKLRSL  ++FPANV
Sbjct  308   NSTVAGVLEYRNPNSSSRASFNSKLPLYKPTLPSLNDTSFFANFTGKLRSLATARFPANV  367

Query  1190  PQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNG  1369
             PQ VD+  FFTVGLG++PCP+NQ CQGPNGTKF+A++NNVSF  PTTA+LQA++  +S G
Sbjct  368   PQAVDRRVFFTVGLGSSPCPENQMCQGPNGTKFSATVNNVSFALPTTALLQAHFLGQSRG  427

Query  1370  VYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHL  1549
             VY  DFP  PL PFNYTGTPPNNT V N TK++VLPFN +VELV+QDTSILGAESHPLHL
Sbjct  428   VYMPDFPVTPLMPFNYTGTPPNNTLVGNGTKLMVLPFNTSVELVMQDTSILGAESHPLHL  487

Query  1550  HGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCH  1729
             HG+NF+VVGQGFGN+DP KDP  +NLVDPVERNT+GVP+GGW AIRF ADNPGVWFMHCH
Sbjct  488   HGFNFFVVGQGFGNYDPAKDPTKFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCH  547

Query  1730  FEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
              EVH SWGL+MAW+V +G LP+QKL PPPSDLPKC
Sbjct  548   LEVHTSWGLKMAWLVLDGSLPHQKLPPPPSDLPKC  582



>ref|NP_200810.1| laccase 17 [Arabidopsis thaliana]
 sp|Q9FJD5.1|LAC17_ARATH RecName: Full=Laccase-17; AltName: Full=Benzenediol:oxygen oxidoreductase 
17; AltName: Full=Diphenol oxidase 17; AltName: 
Full=Urishiol oxidase 17; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB08370.1| laccase (diphenol oxidase) [Arabidopsis thaliana]
 gb|AAU05482.1| At5g60020 [Arabidopsis thaliana]
 gb|AAU95426.1| At5g60020 [Arabidopsis thaliana]
 gb|AED97267.1| laccase 17 [Arabidopsis thaliana]
Length=577

 Score =   868 bits (2242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/576 (71%), Positives = 484/576 (84%), Gaps = 12/576 (2%)
 Frame = +2

Query  131   FLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
              L + + +   P  A      +TRHY   I+MQNVTRLCHTKS+V+VNG+FPGP+++ARE
Sbjct  6     LLAVFSCVLLLPQPAFG----ITRHYTLEIKMQNVTRLCHTKSLVSVNGQFPGPKLIARE  61

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GD+VL+KVVN VPNN+S+HWHGIRQ+R+GWADGPAYITQCPIQTGQ+YVYN+TIVGQRGT
Sbjct  62    GDQVLIKVVNQVPNNISLHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRGT  121

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             L++HAHISWLR+T++GP+IILP++   YPF KPHKEVPMIFGEW+N DTEA++ QA Q G
Sbjct  122   LWYHAHISWLRSTVYGPLIILPKRGVPYPFAKPHKEVPMIFGEWFNADTEAIIRQATQTG  181

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
             GGPN+SDAYTINGLPGPLYNCSA +TF+++VKPGKTYLLR+INAALNDELFF IANHTVT
Sbjct  182   GGPNVSDAYTINGLPGPLYNCSAKDTFRLRVKPGKTYLLRLINAALNDELFFSIANHTVT  241

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VVEADA YVKPFET+ ++IAPGQT NVLLKTK + P ++FFM ARPY TGQGTFDNSTVA
Sbjct  242   VVEADAIYVKPFETETILIAPGQTTNVLLKTKSSYPSASFFMTARPYVTGQGTFDNSTVA  301

Query  1031  GVLEYEIPSLNI---SKNSTKPIAL--PPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQ  1195
             G+LEYE P       S+ S K + L  P LP +N T+F + F+ KLRSL +  FPANVP 
Sbjct  302   GILEYEPPKQTKGAHSRTSIKNLQLFKPILPALNDTNFATKFSNKLRSLNSKNFPANVPL  361

Query  1196  TVDKNFFFTVGLGTNPC--PKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSN  1366
              VD+ FFFTVGLGTNPC    NQTCQGP N T FAAS++N+SF  PT A+LQ++YS +S+
Sbjct  362   NVDRKFFFTVGLGTNPCNHKNNQTCQGPTNTTMFAASISNISFTMPTKALLQSHYSGQSH  421

Query  1367  GVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLH  1546
             GVY+  FP  P+ PFNYTGTPPNNT V N T ++VLP+N +VELV+QDTSILGAESHPLH
Sbjct  422   GVYSPKFPWSPIVPFNYTGTPPNNTMVSNGTNLMVLPYNTSVELVMQDTSILGAESHPLH  481

Query  1547  LHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHC  1726
             LHG+NF+VVGQGFGNFDP KDP N+NLVDP+ERNT+GVPSGGWAAIRF ADNPGVWFMHC
Sbjct  482   LHGFNFFVVGQGFGNFDPNKDPRNFNLVDPIERNTVGVPSGGWAAIRFLADNPGVWFMHC  541

Query  1727  HFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             H EVH SWGLRMAW+V +G  P+QKLLPPP+DLPKC
Sbjct  542   HLEVHTSWGLRMAWLVLDGDKPDQKLLPPPADLPKC  577



>ref|XP_006480879.1| PREDICTED: laccase-17-like [Citrus sinensis]
Length=567

 Score =   868 bits (2242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/549 (73%), Positives = 468/549 (85%), Gaps = 0/549 (0%)
 Frame = +2

Query  188   GSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIH  367
               +TRHY FNI+  NVTRLCHT++I++VNG+FPGP ++ REGDRVL+KV NHV NNV+IH
Sbjct  19    AGITRHYTFNIKYHNVTRLCHTRNIISVNGQFPGPSLLVREGDRVLIKVTNHVSNNVTIH  78

Query  368   WHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPII  547
             WHG+RQ+ +GWADGPAY+TQCPIQTGQ+Y YNFTI GQRGTL WHAHISWLR+TL+GPII
Sbjct  79    WHGVRQVTSGWADGPAYVTQCPIQTGQSYTYNFTITGQRGTLLWHAHISWLRSTLYGPII  138

Query  548   ILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLY  727
             ILP++N SYPF KPHKE+P++FGEW+NVD EA++SQALQ G GPN+SDAYTINGLPGPLY
Sbjct  139   ILPKRNESYPFQKPHKEIPILFGEWFNVDPEAIISQALQTGAGPNVSDAYTINGLPGPLY  198

Query  728   NCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVI  907
             NCS+ +T+K+KVKPGKTYLLR+INAALNDELFF IANHT+TVVEADA YVKPF+TD L+I
Sbjct  199   NCSSKDTYKLKVKPGKTYLLRLINAALNDELFFSIANHTLTVVEADAVYVKPFDTDKLLI  258

Query  908   APGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKP  1087
              PGQT NVLL+TK   P +TFFM ARPYF+G GT DNST AG+LEY+ PS +   +    
Sbjct  259   TPGQTANVLLRTKPYFPNATFFMQARPYFSGMGTIDNSTTAGILEYKHPSNHSISSKKLQ  318

Query  1088  IALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQ  1267
             +  P LP IN TSF  NFT K RSL + ++PANVPQ VD+ FFFTVGLG+NPCPKN TCQ
Sbjct  319   LYKPTLPSINDTSFAVNFTRKFRSLASVKYPANVPQIVDRKFFFTVGLGSNPCPKNTTCQ  378

Query  1268  GPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQV  1447
             GPNGTKF+AS+NNVSFV P+TAILQ+Y+  ++NGVY TDFP  P  PFNYTGTPPNNT V
Sbjct  379   GPNGTKFSASVNNVSFVLPSTAILQSYFFGQNNGVYTTDFPVKPPMPFNYTGTPPNNTNV  438

Query  1448  VNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNL  1627
              N T+ V+LPFN +VELV+QDTSILGAESHPLHLHG+NF+VVG GFGN+DP KD  N+NL
Sbjct  439   SNGTRTVLLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGLGFGNYDPDKDLMNFNL  498

Query  1628  VDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLL  1807
             VDP+ERNTIGVP+GGW AIRF ADNPGVWFMHCH +VH SWGLRMAWIV+ G  PNQ L 
Sbjct  499   VDPMERNTIGVPAGGWVAIRFFADNPGVWFMHCHLDVHTSWGLRMAWIVQNGAQPNQTLP  558

Query  1808  PPPSDLPKC  1834
             PPPSDLPKC
Sbjct  559   PPPSDLPKC  567



>ref|XP_006280235.1| hypothetical protein CARUB_v10026150mg [Capsella rubella]
 gb|EOA13133.1| hypothetical protein CARUB_v10026150mg [Capsella rubella]
Length=577

 Score =   868 bits (2242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/577 (72%), Positives = 486/577 (84%), Gaps = 14/577 (2%)
 Frame = +2

Query  131   FLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
              L I + +   P  A      +TRHY   I+MQNVTRLCHTKS+V+VNG+FPGP+++ARE
Sbjct  6     LLAIFSCVLLLPLPAFG----ITRHYTLEIKMQNVTRLCHTKSLVSVNGQFPGPKLIARE  61

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GD++L+KV+N VPNN+SIHWHGIRQ+R+GWADGPAYITQCPIQTGQ+YVYN+TIVGQRGT
Sbjct  62    GDQLLIKVINQVPNNISIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRGT  121

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             LF+HAHISWLRAT++GP+IILP++   YPF KPHKEVPMIFGEW+N D EA++ QA Q G
Sbjct  122   LFYHAHISWLRATVYGPLIILPKRGVPYPFAKPHKEVPMIFGEWFNADPEAIIRQATQTG  181

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
             GGPN+SDAYTINGLPGPLYNCSA +TF+++VKPGKTYLLR+INAALNDELFF IANHTVT
Sbjct  182   GGPNVSDAYTINGLPGPLYNCSAKDTFRLRVKPGKTYLLRLINAALNDELFFSIANHTVT  241

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VVEADA YVKPFETD ++IAPGQT NVLLKTK + P ++FFM ARPY TGQGTFDNSTVA
Sbjct  242   VVEADAIYVKPFETDTILIAPGQTTNVLLKTKPSYPSASFFMFARPYVTGQGTFDNSTVA  301

Query  1031  GVLEYEIPSLNI----SKNSTKPIAL--PPLPPINGTSFVSNFTGKLRSLGNSQFPANVP  1192
             G+LEYE PS +I    S+ S K + L  P LP +N T+F + F+ KLRSL +  FPANVP
Sbjct  302   GILEYE-PSKHIKDAHSRASIKNLQLFRPTLPALNDTNFATKFSNKLRSLNSKNFPANVP  360

Query  1193  QTVDKNFFFTVGLGTNPC--PKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKS  1363
               VD+ FFFTVGLGTNPC    NQTCQGP N T FAAS++N+SF  PT A+LQ++YS +S
Sbjct  361   LNVDRKFFFTVGLGTNPCNHKNNQTCQGPTNTTMFAASISNISFTMPTKALLQSHYSGQS  420

Query  1364  NGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPL  1543
             +GVY+  FP  P+ PFNYTGTPPNNT V N T ++VLP+N +VELV+QDTSILGAESHPL
Sbjct  421   HGVYSPKFPWSPIVPFNYTGTPPNNTNVSNGTNLMVLPYNTSVELVMQDTSILGAESHPL  480

Query  1544  HLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMH  1723
             HLHG+NF+VVGQGFGNFDP KDP N+NLVDP+ERNTIGVPSGGWAAIRF ADNPGVWFMH
Sbjct  481   HLHGFNFFVVGQGFGNFDPNKDPKNFNLVDPIERNTIGVPSGGWAAIRFLADNPGVWFMH  540

Query  1724  CHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             CH EVH SWGLRMAW+V +G  P+QKLLPPP+DLPKC
Sbjct  541   CHLEVHTSWGLRMAWLVLDGDKPDQKLLPPPADLPKC  577



>ref|XP_003606701.1| Laccase [Medicago truncatula]
 gb|AES88898.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=585

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/563 (73%), Positives = 481/563 (85%), Gaps = 7/563 (1%)
 Frame = +2

Query  119   LAACFLMIMTSLFFFPH--MAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGP  292
             L A FL + T L   P   +A ++HGSVTRHYKF+IR+ NVTRLCHTKS+VTVNGKFPGP
Sbjct  15    LFAAFLFVTTFLLTSPGFVLATSQHGSVTRHYKFDIRLANVTRLCHTKSMVTVNGKFPGP  74

Query  293   RIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTI  472
             RI+ REGDR+LVKVVNHVPNN+S+HWHG+RQ+R+GW+DGP+YITQCPIQTGQ+YVYNFTI
Sbjct  75    RIVVREGDRLLVKVVNHVPNNISLHWHGVRQLRSGWSDGPSYITQCPIQTGQSYVYNFTI  134

Query  473   VGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVS  652
             VGQRGTLFWHAH SWLRAT++GP+I+LPR N SYPF KP+KEVP++FGEWWN D EAV++
Sbjct  135   VGQRGTLFWHAHFSWLRATVYGPLILLPRHNESYPFQKPYKEVPILFGEWWNADPEAVIA  194

Query  653   QALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRI  832
             QALQ GGGPN+SDAYTING PGPLYNCS  +T+K+KVKPGKTYLLR+INAALNDELFF I
Sbjct  195   QALQTGGGPNVSDAYTINGFPGPLYNCS-KDTYKLKVKPGKTYLLRLINAALNDELFFSI  253

Query  833   ANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTF  1012
             ANHT+ +VEADA Y+KPFE++ +++ PGQT NVLLKTK N P STF+M ARPYFTGQGTF
Sbjct  254   ANHTLIIVEADASYIKPFESNTIILGPGQTTNVLLKTKPNYPNSTFYMLARPYFTGQGTF  313

Query  1013  DNSTVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVP  1192
             DNSTVAG+LEY  P  N   N   PI  P LP IN T+FV+NF+ K  SL + ++PANVP
Sbjct  314   DNSTVAGILEYTKP--NDQTNLNLPILKPVLPVINDTNFVANFSNKFLSLNSPKYPANVP  371

Query  1193  QTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNG  1369
             +T+DKNFFF VGLGT+PCPKNQTCQGP N +KFAAS+NNVSF  P+ A+LQ ++   +NG
Sbjct  372   KTIDKNFFFIVGLGTSPCPKNQTCQGPNNSSKFAASMNNVSFALPSIALLQQHFFGANNG  431

Query  1370  VYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHL  1549
              + TDFP VPL PFNYTGTPPNNT V N TK VV+P+N  V+++LQDTSILGAESHPLHL
Sbjct  432   -FTTDFPVVPLRPFNYTGTPPNNTLVSNGTKTVVIPYNTRVQVILQDTSILGAESHPLHL  490

Query  1550  HGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCH  1729
             HG+NF+VVGQGFGNF+   DPA +NLVDPVERNT+ VPSGGW AIRF ADNPGVW MHCH
Sbjct  491   HGFNFFVVGQGFGNFNASSDPAKFNLVDPVERNTVAVPSGGWVAIRFLADNPGVWLMHCH  550

Query  1730  FEVHLSWGLRMAWIVKEGKLPNQ  1798
             F+VHLSWGLRMAWIV++GKLP+Q
Sbjct  551   FDVHLSWGLRMAWIVEDGKLPDQ  573



>ref|XP_008240736.1| PREDICTED: laccase-17-like [Prunus mume]
Length=586

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/583 (71%), Positives = 477/583 (82%), Gaps = 18/583 (3%)
 Frame = +2

Query  128   CFLMIMTSLFFF-------PHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFP  286
             CF  +   LF F       P  A  K    TRHY FNI+  NVTRLC+T+SI++VNGKFP
Sbjct  8     CFTSMAALLFSFFIAASWMPEFAAGK----TRHYTFNIKYHNVTRLCNTRSILSVNGKFP  63

Query  287   GPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNF  466
             GPR++AREGD+VL+KVVNHV NN++IHWHGIRQ++ GWADGPAYITQCPIQTGQ Y YNF
Sbjct  64    GPRLVAREGDQVLIKVVNHVSNNITIHWHGIRQLQTGWADGPAYITQCPIQTGQAYTYNF  123

Query  467   TIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAV  646
             TI GQRGTL WHAHISWLR+TLHGPIIILP++N SYPF KP+KEVP+I GEW+NVD EAV
Sbjct  124   TITGQRGTLLWHAHISWLRSTLHGPIIILPKRNESYPFVKPYKEVPIILGEWFNVDPEAV  183

Query  647   VSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFF  826
             +SQALQ G GPN+SDAYTINGLPGPLYNCS+ + FK+KV+PGKTYLLR+INAALNDELFF
Sbjct  184   ISQALQTGAGPNVSDAYTINGLPGPLYNCSSRDVFKLKVEPGKTYLLRLINAALNDELFF  243

Query  827   RIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQG  1006
              IANH++TVVEADA Y KPFETD+L+IAPGQT N+LLKTK   P +TF + ARPYFTG G
Sbjct  244   SIANHSLTVVEADAVYTKPFETDILLIAPGQTTNILLKTKPTSPNATFLILARPYFTGGG  303

Query  1007  TFDNSTVAGVLEYEIP-SLNISKNSTKPIALPPLPPING------TSFVSNFTGKLRSLG  1165
             T DN+T AG+LEY+ P + + +     P+  P LPPIN       T FV N   K RSL 
Sbjct  304   TLDNTTTAGILEYKHPNTTHHTSIKALPLFRPSLPPINATKFVNVTQFVDNLAKKFRSLA  363

Query  1166  NSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQA  1345
               QFPANVPQTVD+ FFFT+GLGT+PCP+N TCQGPNG KFAAS+NN SF  P+TA+LQA
Sbjct  364   TKQFPANVPQTVDRRFFFTLGLGTSPCPQNSTCQGPNGLKFAASINNFSFALPSTAMLQA  423

Query  1346  YYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILG  1525
             ++S +S+GVY TDFP+ PL  FNYTGTPPN T V NAT+ VVLPFN +VELVLQ TSILG
Sbjct  424   HFSGQSSGVYTTDFPTKPLVAFNYTGTPPNITNVSNATRAVVLPFNTSVELVLQGTSILG  483

Query  1526  AESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNP  1705
             AESHPLHLHGYNF++VG+GFGN+DP KDPAN+NLVDP ERNT GVP+GGW AIRF ADNP
Sbjct  484   AESHPLHLHGYNFFIVGRGFGNYDPTKDPANFNLVDPAERNTAGVPAGGWIAIRFFADNP  543

Query  1706  GVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             GVWFMHCH +VH SWGLRMAWIV++G  PNQKL PPPSDLPKC
Sbjct  544   GVWFMHCHLDVHTSWGLRMAWIVQDGPQPNQKLPPPPSDLPKC  586



>ref|XP_007140515.1| hypothetical protein PHAVU_008G119200g, partial [Phaseolus vulgaris]
 gb|ESW12509.1| hypothetical protein PHAVU_008G119200g, partial [Phaseolus vulgaris]
Length=580

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/552 (74%), Positives = 480/552 (87%), Gaps = 7/552 (1%)
 Frame = +2

Query  191   SVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHW  370
             S+TRHY FN+   NVTRLCHT++I++VNGKFPGPR++AREGDRVLVKVVNHV NNV+IHW
Sbjct  32    SITRHYTFNVEYLNVTRLCHTRNILSVNGKFPGPRLVAREGDRVLVKVVNHVSNNVTIHW  91

Query  371   HGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIII  550
             HGIRQI +GWADGPAY+TQCPIQT Q+Y YNFTIVGQRGTL WHAHISWLRAT++GPIII
Sbjct  92    HGIRQITSGWADGPAYVTQCPIQTNQSYTYNFTIVGQRGTLLWHAHISWLRATIYGPIII  151

Query  551   LPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYN  730
             LP+ N SYPF KP+KE+P++FGEW+NVD EA++SQALQNGGGP++SDAYTING PGPLYN
Sbjct  152   LPKHNESYPFQKPYKEIPILFGEWFNVDPEAIISQALQNGGGPDVSDAYTINGFPGPLYN  211

Query  731   CSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIA  910
             CS+ +T+ +KVKPGKTYLLR+INAALN+ELFF IANHT+TVVEADA Y KPF+TD L+IA
Sbjct  212   CSSKDTYTLKVKPGKTYLLRLINAALNEELFFSIANHTLTVVEADARYTKPFDTDTLLIA  271

Query  911   PGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKPI  1090
             PGQT NVLLKTK   P +++ MAARPYFTG+GTFDNST AG+L Y+ P   +  +S K +
Sbjct  272   PGQTTNVLLKTKPYFPNASYQMAARPYFTGRGTFDNSTTAGILLYKQP---LHHSSLKNL  328

Query  1091  AL--PPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTC  1264
              L  P LPPIN T+FV+NFTGK RSL N++FP NVPQ VD+NFFFTVGLGT+PCPKN TC
Sbjct  329   TLLKPTLPPINATNFVANFTGKFRSLANAKFPVNVPQKVDRNFFFTVGLGTSPCPKNTTC  388

Query  1265  QGP-NGTKFAASLNNVSFVTPTT-AILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNN  1438
             QGP N TKFAAS+NN+SF  P++ +I+QAYYS ++N V+ TDFP+ PL PFNYTGTPPNN
Sbjct  389   QGPSNNTKFAASVNNISFALPSSVSIMQAYYSGQTNMVFKTDFPATPLNPFNYTGTPPNN  448

Query  1439  TQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPAN  1618
             T V N TK+VVL FN +VE+VLQDT+ILGAESHPLHLHGY+F++VGQGFGN+DP  DPA 
Sbjct  449   TMVTNDTKLVVLKFNTSVEVVLQDTNILGAESHPLHLHGYDFFIVGQGFGNYDPNNDPAK  508

Query  1619  YNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQ  1798
             +NLVDPVERNT GVP+GGW AIRF+ADNPGVWFMHCH ++H SWGLRMAW+V +G  PNQ
Sbjct  509   FNLVDPVERNTAGVPAGGWIAIRFKADNPGVWFMHCHLDLHTSWGLRMAWLVLDGPGPNQ  568

Query  1799  KLLPPPSDLPKC  1834
             KL PPPSDLPKC
Sbjct  569   KLQPPPSDLPKC  580



>ref|XP_008359106.1| PREDICTED: laccase-17-like [Malus domestica]
Length=583

 Score =   866 bits (2238),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/562 (73%), Positives = 475/562 (85%), Gaps = 7/562 (1%)
 Frame = +2

Query  113   PLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGP  292
             P     FL+ + +L   P    A   S+TRHYKF+I+ QNVTRLCHTKSIVTVNG+FPGP
Sbjct  9     PEFLRLFLLSLITLCLIPQHVFA---SITRHYKFDIKQQNVTRLCHTKSIVTVNGQFPGP  65

Query  293   RIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTI  472
             +I+AREGDRVL+KVVNHV NN+SIHWHGIRQ+R+GWADGPAY+TQCPIQ+G +YVYNFTI
Sbjct  66    QIVAREGDRVLIKVVNHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQSGNSYVYNFTI  125

Query  473   VGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVS  652
              GQRGTLFWHAHISWLR+T++GP+IILP++   YPF KP+KEVP+IFGEWWN D EAV+S
Sbjct  126   TGQRGTLFWHAHISWLRSTVYGPLIILPKRGVPYPFAKPYKEVPIIFGEWWNADPEAVIS  185

Query  653   QALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRI  832
             QALQ GGGPN+SDAYT NGLPGPLYNCSA + FK+KV+ GKTYLLR+INAALNDELFF I
Sbjct  186   QALQTGGGPNVSDAYTFNGLPGPLYNCSAKDAFKLKVRSGKTYLLRLINAALNDELFFSI  245

Query  833   ANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTF  1012
             ANHT+ VVEADA YVKPF+TD ++IAPGQT NVLLKTK + P +TFFM ARPY TG GTF
Sbjct  246   ANHTLKVVEADAIYVKPFDTDTVLIAPGQTTNVLLKTKPHFPSATFFMTARPYVTGLGTF  305

Query  1013  DNSTVAGVLEYEIPSLNISKN---STKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPA  1183
             DNSTVAG+LEYE  S  +         P+  P LP +N TSF + F+ KLRSL N+QFPA
Sbjct  306   DNSTVAGILEYESTSKALHTTLPMKKLPLFKPILPALNDTSFATKFSNKLRSLANAQFPA  365

Query  1184  NVPQTVDKNFFFTVGLGTNPCPK-NQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRK  1360
             NVPQ VD++FFFT+GLGTNPC   NQTCQGPNGT FAAS+NNVSF  PTTA+LQA++S +
Sbjct  366   NVPQKVDRHFFFTIGLGTNPCSSNNQTCQGPNGTMFAASVNNVSFAMPTTALLQAHFSGQ  425

Query  1361  SNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHP  1540
             SNGVY+ DFPS P+ PFNYTGTPPN+T V N TK++VLP+N +VELV+QDTSILGAESHP
Sbjct  426   SNGVYSPDFPSSPIIPFNYTGTPPNDTMVGNGTKLMVLPYNTSVELVMQDTSILGAESHP  485

Query  1541  LHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFM  1720
             LHLHG+NF+VVGQGFGNFD  KDPAN+NLVDPVERNT+GVPSGGW AIRF ADNPGVWFM
Sbjct  486   LHLHGFNFFVVGQGFGNFDRNKDPANFNLVDPVERNTVGVPSGGWVAIRFVADNPGVWFM  545

Query  1721  HCHFEVHLSWGLRMAWIVKEGK  1786
             HCH E+H SWGL+MAW+V +GK
Sbjct  546   HCHLEIHTSWGLKMAWLVLDGK  567



>ref|XP_006341211.1| PREDICTED: laccase-17-like [Solanum tuberosum]
Length=568

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/548 (74%), Positives = 473/548 (86%), Gaps = 2/548 (0%)
 Frame = +2

Query  191   SVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHW  370
             + TRHYKF I+MQNVTRLCHTKSIVTVNG+FPGPRI+AREGDR+ ++VVNHV NN+SIHW
Sbjct  23    AATRHYKFEIKMQNVTRLCHTKSIVTVNGQFPGPRIVAREGDRLEIEVVNHVHNNISIHW  82

Query  371   HGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIII  550
             HGIRQ+R+GWADGPAY+TQCP      Y+YNFTI+GQRGT +WHAHISWLR+TL+GPIII
Sbjct  83    HGIRQVRSGWADGPAYVTQCPNSNWPKYLYNFTIIGQRGTFWWHAHISWLRSTLYGPIII  142

Query  551   LPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYN  730
             LP+KNT YPF KP+KEVP+IFGEW+N DTEA++SQALQ GGGPN+SDAYTINGLPGPLYN
Sbjct  143   LPKKNTPYPFAKPYKEVPIIFGEWFNADTEAIISQALQTGGGPNVSDAYTINGLPGPLYN  202

Query  731   CSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIA  910
             CS  +TFK+KVKPGKTYLLR+INAALNDELFF IANHT+ +++AD  YVKPFET+ L+I 
Sbjct  203   CSTKDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTLQIIDADGVYVKPFETNTLIIT  262

Query  911   PGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKPI  1090
             PGQT NVLLKTK + P +TF+M ARPY TG GTFDNSTVAG+LEYE  +    KN   P+
Sbjct  263   PGQTHNVLLKTKPHFPNATFYMTARPYVTGLGTFDNSTVAGILEYESKTKLHLKN--LPL  320

Query  1091  ALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQG  1270
               P LP +N T+FV+NFT +LRSL + QFPANVPQ +DK  FFTVGLGT+PC +N+TCQG
Sbjct  321   FKPLLPALNDTNFVTNFTSRLRSLASPQFPANVPQNIDKRLFFTVGLGTSPCDQNKTCQG  380

Query  1271  PNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVV  1450
             PNGTKF+AS+NNVSF+ PTTA+LQ+++  +S GVY  DFP  PL  FNYTG PPNNT V 
Sbjct  381   PNGTKFSASINNVSFILPTTALLQSHFFGQSKGVYKPDFPYSPLNWFNYTGNPPNNTLVH  440

Query  1451  NATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLV  1630
             N TK+VVLPFN +VELV+QDTSILG ESHPLHLHG+NF+VVGQGFGNFDP KDP+N+NLV
Sbjct  441   NDTKLVVLPFNTSVELVMQDTSILGLESHPLHLHGFNFFVVGQGFGNFDPNKDPSNFNLV  500

Query  1631  DPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLP  1810
             DP+ERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH SWGL+MAW+V+ GKLPNQKL P
Sbjct  501   DPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVQNGKLPNQKLPP  560

Query  1811  PPSDLPKC  1834
             PP DLPKC
Sbjct  561   PPMDLPKC  568



>ref|XP_006856866.1| hypothetical protein AMTR_s00055p00190270 [Amborella trichopoda]
 gb|ERN18333.1| hypothetical protein AMTR_s00055p00190270 [Amborella trichopoda]
Length=583

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/571 (71%), Positives = 481/571 (84%), Gaps = 5/571 (1%)
 Frame = +2

Query  128   CFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAR  307
             C L  M SL   P +A AKH  +TRHYKFNI  +N+ RLCHTK +VTVNG+ PGP ++AR
Sbjct  16    CVLSAMGSL---PQLAEAKHAGITRHYKFNIVAENIRRLCHTKPVVTVNGQVPGPTLVAR  72

Query  308   EGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRG  487
             EGDRVLVKVVNH   N++IHWHG+RQ+++GWADGPAY+TQCPIQTG+TYVYNFTI GQRG
Sbjct  73    EGDRVLVKVVNHAQYNITIHWHGVRQLQSGWADGPAYVTQCPIQTGKTYVYNFTITGQRG  132

Query  488   TLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQN  667
             TL WHAH SWLR+T++G I+ILP+++  +PFPKPHK++P+IFGEWWNVD EAV+SQALQ 
Sbjct  133   TLLWHAHASWLRSTVYGAIVILPKRHVPFPFPKPHKDIPIIFGEWWNVDPEAVISQALQT  192

Query  668   GGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTV  847
             GG PN+SDAYTING PGPLYNCSA +TF++ V+PGKTYLLR+INAALNDELFF IANH++
Sbjct  193   GGAPNVSDAYTINGHPGPLYNCSAKDTFRLMVEPGKTYLLRLINAALNDELFFSIANHSL  252

Query  848   TVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTV  1027
             TVVEADA YVKPF T+++V+APGQT NVLL TK  P  +TF M+ARPY TG  TFDNST 
Sbjct  253   TVVEADAIYVKPFSTNVVVLAPGQTTNVLLTTKSQPANATFLMSARPYATGPATFDNSTT  312

Query  1028  AGVLEYEIPSLNISKNSTKPIAL--PPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTV  1201
             AG+L+Y   +L    +ST    L  P LP IN T+FV++FT KL+SL N+QFPANVPQ V
Sbjct  313   AGILQYHQTNLTSPSSSTSKFRLLSPTLPTINDTNFVTSFTQKLKSLANNQFPANVPQKV  372

Query  1202  DKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYAT  1381
             DK FFFTVGLGT+PCPKNQTCQGPNGTK  AS+NNVSFV P+ A+LQA++S K  GVY T
Sbjct  373   DKQFFFTVGLGTSPCPKNQTCQGPNGTKLTASINNVSFVLPSIAMLQAHFSAKLAGVYTT  432

Query  1382  DFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYN  1561
             DFP+ P  PFNYTG+PPNNT V++ TK VVL FN +VE+VLQDT ILGAESHPLHLHG+N
Sbjct  433   DFPNNPPFPFNYTGSPPNNTMVISGTKTVVLKFNTSVEVVLQDTGILGAESHPLHLHGFN  492

Query  1562  FYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVH  1741
             F+V+GQGFGN+DP KDPA +NLVDP+ERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH
Sbjct  493   FFVMGQGFGNYDPSKDPAKFNLVDPMERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVH  552

Query  1742  LSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
              SWGL+MAW+V +GKLPNQKLLPPPSDLP+C
Sbjct  553   TSWGLKMAWVVMDGKLPNQKLLPPPSDLPQC  583



>ref|XP_002269038.2| PREDICTED: laccase-17 isoform X2 [Vitis vinifera]
Length=577

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/577 (70%), Positives = 477/577 (83%), Gaps = 5/577 (1%)
 Frame = +2

Query  119   LAACFLMIM----TSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFP  286
             + +C + I+     +++F P + +AKH   TRHYKF+I++Q VTRLC TKSIVTVNG+FP
Sbjct  1     MGSCIMRIIMFAVCAMWFLPDLVLAKHAGSTRHYKFDIKLQTVTRLCQTKSIVTVNGQFP  60

Query  287   GPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNF  466
             GPRI+AREGDRV++KVVNHV NN++IHWHGIRQ+R+GWADGPAYITQCPIQTGQ+YVYNF
Sbjct  61    GPRIIAREGDRVIIKVVNHVQNNITIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNF  120

Query  467   TIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAV  646
             TI GQRGTLFWHAHISWLRAT++G ++ILP++   YPFP+P KEVP+IFGEWW  D E +
Sbjct  121   TITGQRGTLFWHAHISWLRATVYGSLVILPKRGVPYPFPQPFKEVPIIFGEWWKADIETM  180

Query  647   VSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFF  826
             ++QA+Q GG PN+SDAYT+NGLPGPLYNCSA + F++KVKPGKTYLLR+INAALNDELFF
Sbjct  181   INQAMQTGGAPNVSDAYTMNGLPGPLYNCSAKDAFRLKVKPGKTYLLRLINAALNDELFF  240

Query  827   RIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQG  1006
              IANHTVTVVE DA YVKPF+T+ LVI PGQT N+LLKTK + P +TF MAAR Y TG  
Sbjct  241   SIANHTVTVVEVDAVYVKPFKTNTLVITPGQTTNILLKTKSHSPNATFLMAARSYATGPA  300

Query  1007  TFDNSTVAGVLEYE-IPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPA  1183
              FDNST AG+LEYE   S++ +KN    +  P LP  N T F   F+ KLRSL +++FPA
Sbjct  301   AFDNSTTAGILEYEHKSSVSNTKNRKPSVLKPALPMFNDTIFAMKFSKKLRSLASNKFPA  360

Query  1184  NVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKS  1363
              VPQTV++ FFFTVGLG   C +NQ C GPN T  AA++NNVSFV P+TA+LQA++  KS
Sbjct  361   KVPQTVNRRFFFTVGLGLIQCSRNQACPGPNNTMVAAAINNVSFVQPSTALLQAHFFGKS  420

Query  1364  NGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPL  1543
              GVY TDFP+ P   FNYTGTPP+N  V + TKVVVLPFN  VELVLQDTSI+GAESHPL
Sbjct  421   KGVYTTDFPANPPFKFNYTGTPPSNILVNSGTKVVVLPFNTRVELVLQDTSIIGAESHPL  480

Query  1544  HLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMH  1723
             HLHG+NFYVVGQGFGNFDPKKDPAN+NLVDP+ERNT+GVPSGGW AIRF ADNPGVWFMH
Sbjct  481   HLHGFNFYVVGQGFGNFDPKKDPANFNLVDPIERNTVGVPSGGWVAIRFHADNPGVWFMH  540

Query  1724  CHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             CH EVH SWGL+MAW+V +GK PNQKL PPPSDLPKC
Sbjct  541   CHLEVHTSWGLKMAWVVMDGKRPNQKLPPPPSDLPKC  577



>emb|CDX88735.1| BnaA03g09140D [Brassica napus]
Length=573

 Score =   865 bits (2234),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/574 (71%), Positives = 483/574 (84%), Gaps = 12/574 (2%)
 Frame = +2

Query  131   FLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
                + +S+   P  A  K    TRHY  +I+M NVTRLCHTKS+V+VNGKFPGP+++ARE
Sbjct  6     LFAVFSSVLLLPEPAFGK----TRHYTLDIKMHNVTRLCHTKSLVSVNGKFPGPKLIARE  61

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GD++L+KVVNHVPNN+S+HWHGIRQ+R+GWADGPAYITQCPIQTGQ+YVYN+T+VGQRGT
Sbjct  62    GDQLLIKVVNHVPNNISLHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTVVGQRGT  121

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             L++HAHISWLRAT++GP+IILP+    YPF KPHKEVPM+FGEW+N DTEA++ QA Q G
Sbjct  122   LWYHAHISWLRATVYGPLIILPKHGVPYPFHKPHKEVPMVFGEWFNADTEAIIRQATQTG  181

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
             GGPN+SDAYTINGLPGPLYNCSA +TF+++VKPGKTYLLR+INAALNDELFF IANHTVT
Sbjct  182   GGPNVSDAYTINGLPGPLYNCSAKDTFRLRVKPGKTYLLRLINAALNDELFFSIANHTVT  241

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VVEADA YVKPFETD ++IAPGQT N+LLKTK + P ++F M ARPY TGQGTFDNSTVA
Sbjct  242   VVEADAIYVKPFETDTILIAPGQTTNLLLKTKQSYPKASFLMTARPYVTGQGTFDNSTVA  301

Query  1031  GVLEYEIP---SLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTV  1201
             G+LEYE P     +I KN    +  P LP +N T+F + F+ KLRSL + +FPANVP  V
Sbjct  302   GILEYEQPKHTKTSIKKNLQ--LFTPVLPALNDTNFATKFSNKLRSLNSKKFPANVPLKV  359

Query  1202  DKNFFFTVGLGTNPC--PKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGV  1372
             D+ FFFTVGLGTNPC    NQTCQGP N T FAAS++N+SF  PT A+LQ++YS +SNGV
Sbjct  360   DRKFFFTVGLGTNPCNHKNNQTCQGPTNTTMFAASISNISFTMPTKALLQSHYSGQSNGV  419

Query  1373  YATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLH  1552
             Y+ +FP  P+ PFNYTGTPPNNT V   T ++VLP+N +VELV+QDTSILGAESHPLHLH
Sbjct  420   YSPNFPWSPIVPFNYTGTPPNNTMVSTGTNLMVLPYNTSVELVMQDTSILGAESHPLHLH  479

Query  1553  GYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHF  1732
             G+NF+VVGQGFGNFD K+DP N+NLVDP+ERNT+GVPSGGWAAIRF ADNPGVWFMHCH 
Sbjct  480   GFNFFVVGQGFGNFDAKEDPKNFNLVDPIERNTVGVPSGGWAAIRFLADNPGVWFMHCHL  539

Query  1733  EVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             EVH SWGLRMAW+V +G  P+QKLLPPP+DLPKC
Sbjct  540   EVHTSWGLRMAWLVLDGDKPDQKLLPPPADLPKC  573



>ref|XP_008359730.1| PREDICTED: laccase-17-like [Malus domestica]
Length=586

 Score =   865 bits (2234),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/582 (71%), Positives = 481/582 (83%), Gaps = 16/582 (3%)
 Frame = +2

Query  110   PPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPG  289
             P L   C   I+ SL   P  AV     +TRHY FN++  NVTRLC+T+SIV+VNG+FPG
Sbjct  14    PLLFGFC---IVASLM--PEFAVG----ITRHYTFNVKYHNVTRLCNTRSIVSVNGQFPG  64

Query  290   PRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFT  469
             PR++AREGD+VL+KVVNH+ NNV+IHWHG+RQ+R+GWADGPAYITQCPIQTGQ+Y YNFT
Sbjct  65    PRLVAREGDQVLIKVVNHISNNVTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYTYNFT  124

Query  470   IVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVV  649
             I GQRGTL WHAHISWLR+TL+GPIIILP+ N SYPF KP+KEVP++ GEW+NVD EAV+
Sbjct  125   IQGQRGTLLWHAHISWLRSTLYGPIIILPKLNESYPFMKPYKEVPILLGEWFNVDPEAVI  184

Query  650   SQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFR  829
             +QALQ GGGPN+SDAYTINGLPGPLYNCS+ + FK+KVKP KTYLLR+INAALNDELFF 
Sbjct  185   NQALQTGGGPNVSDAYTINGLPGPLYNCSSKDVFKLKVKPXKTYLLRLINAALNDELFFS  244

Query  830   IANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGT  1009
             IANHT+TVVEADA Y KPFETD L+I PGQT NVLLKTK N P +TF + ARPYFTG GT
Sbjct  245   IANHTLTVVEADAVYTKPFETDTLLITPGQTTNVLLKTKPNSPNATFLILARPYFTGAGT  304

Query  1010  FDNSTVAGVLEYEIP-SLNISKNSTKPIALPPLPPINGTSFVS------NFTGKLRSLGN  1168
              DN+T AG+LEYE P + + +   T P+  P LPPIN T FV+      N   K RSL +
Sbjct  305   LDNTTTAGILEYEHPVTTHHASIKTLPLFKPSLPPINATKFVNVTQFVLNLANKFRSLAS  364

Query  1169  SQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAY  1348
              +FPANVPQTVD+NFFFTVGLGT+PCP+N TCQGPNG KFAAS+NN SF  P+TA+LQA+
Sbjct  365   KKFPANVPQTVDRNFFFTVGLGTSPCPQNSTCQGPNGLKFAASINNFSFALPSTAMLQAH  424

Query  1349  YSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGA  1528
             +S +SNG+Y TDFP+ PL  FNYTGTPPN T V NATK +VLPFN +VELVLQDTSILGA
Sbjct  425   FSGQSNGIYTTDFPANPLVKFNYTGTPPNVTNVANATKALVLPFNTSVELVLQDTSILGA  484

Query  1529  ESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPG  1708
             ESHPLHLHG+NFY+VGQG GN+DP K+PA +NLVDP ERNT GVP+GGW A+RF ADNPG
Sbjct  485   ESHPLHLHGFNFYIVGQGIGNYDPNKBPAKFNLVDPXERNTAGVPAGGWIAVRFXADNPG  544

Query  1709  VWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             VWFMHCH ++H SWGL+MAWIV++G   NQKL PPPSDLPKC
Sbjct  545   VWFMHCHLDIHTSWGLKMAWIVQDGPQANQKLPPPPSDLPKC  586



>gb|AAB17193.1| laccase [Liriodendron tulipifera]
Length=586

 Score =   865 bits (2234),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/561 (73%), Positives = 494/561 (88%), Gaps = 4/561 (1%)
 Frame = +2

Query  164   PHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNH  343
             P +A +KH  +TRHYKF+I+M+NVTRLCHT++I+TVNG+FPGP+I+AREGDRV+VKVVNH
Sbjct  26    PELAHSKHARITRHYKFDIQMRNVTRLCHTRNILTVNGQFPGPKIIAREGDRVVVKVVNH  85

Query  344   VPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLR  523
             V NNV++HWHG+RQ+R+GWADGPAY+TQCPIQTGQ++VYNFTIVGQRGTLFWHAHISWLR
Sbjct  86    VANNVTLHWHGVRQLRSGWADGPAYVTQCPIQTGQSFVYNFTIVGQRGTLFWHAHISWLR  145

Query  524   ATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTI  703
             +TL+GPI+ILP++   YPF KP+K VP+IFGEW+NVD EA+++QALQ G GPN+SDA+TI
Sbjct  146   STLYGPIVILPKRGVPYPFAKPYKSVPIIFGEWFNVDPEAIITQALQTGAGPNVSDAFTI  205

Query  704   NGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKP  883
             NGLPGPLYNCSA +TF++ V+PGKTYLLR+INAALNDELFF IANHT+T+V+ DA YVKP
Sbjct  206   NGLPGPLYNCSAKDTFRLSVEPGKTYLLRLINAALNDELFFSIANHTLTIVDVDAIYVKP  265

Query  884   FETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLN  1063
             F+TD+L+I PGQT NVLLKTK + P +TFFM+ARPY TG+G FDN+T  G+LEY+ P+ +
Sbjct  266   FDTDILLITPGQTTNVLLKTKPHYPNATFFMSARPYATGRGAFDNTTTIGILEYQKPNSS  325

Query  1064  ISKNSTK----PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGL  1231
                N+      P+  P LP  N T+F +N+T +LRSL N++FPANVPQTVD+ FFFTVGL
Sbjct  326   HPSNAIGIKDLPLFRPSLPGFNDTTFAANYTRRLRSLANAKFPANVPQTVDRRFFFTVGL  385

Query  1232  GTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPF  1411
             GT PCP NQTCQGPNGTKF+AS+NNVS+V PTTA+LQA++  +SNGVY+T+FP+ P  PF
Sbjct  386   GTQPCPNNQTCQGPNGTKFSASINNVSYVQPTTALLQAHFFGQSNGVYSTNFPTKPPFPF  445

Query  1412  NYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGN  1591
             NYTGTPPNNT V N TKVVVLPFN TVELVLQDTSI GAESHPLHLHGYNF+V+GQGFGN
Sbjct  446   NYTGTPPNNTMVSNGTKVVVLPFNTTVELVLQDTSIQGAESHPLHLHGYNFFVIGQGFGN  505

Query  1592  FDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWI  1771
             ++P KDP+N+NL+DPVERNT+GVP+GGW AIRF+ADNPGVWFMHCH EVH SWGL+MAW+
Sbjct  506   YNPNKDPSNFNLIDPVERNTVGVPAGGWVAIRFQADNPGVWFMHCHLEVHTSWGLKMAWV  565

Query  1772  VKEGKLPNQKLLPPPSDLPKC  1834
             V +GKLPNQKL PPPSDLP+C
Sbjct  566   VLDGKLPNQKLPPPPSDLPQC  586



>ref|XP_008785569.1| PREDICTED: laccase-17-like [Phoenix dactylifera]
Length=576

 Score =   864 bits (2233),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/585 (70%), Positives = 483/585 (83%), Gaps = 11/585 (2%)
 Frame = +2

Query  86    MGFLFHAFPP--LLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKS  259
             MGF   AFPP       FL+ ++     P ++      +TRHYKF+IR+QN+TRLCHT+S
Sbjct  1     MGF---AFPPPTFSMGTFLLALSIFLVLPELSAG----ITRHYKFDIRLQNLTRLCHTRS  53

Query  260   IVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQ  439
              VTVNG+FPGP+I+ REGDRV+VKVVNH+ NN++IHWHGIRQ+++ WADGPAYITQCPIQ
Sbjct  54    AVTVNGQFPGPKIVVREGDRVVVKVVNHIQNNITIHWHGIRQLQSQWADGPAYITQCPIQ  113

Query  440   TGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGE  619
             TGQ+YVY+FTI GQRGTL+WHAH SWLRAT++GP IILP++  SYPFPKPHKEVPM+ GE
Sbjct  114   TGQSYVYDFTITGQRGTLWWHAHHSWLRATVYGPFIILPKRGASYPFPKPHKEVPMLLGE  173

Query  620   WWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMIN  799
             W+N D EA++SQALQ G GPN+S+A+TINGLPGPLYNCSA +TFK+KVKPGKTYLLR+IN
Sbjct  174   WFNEDPEAIISQALQTGAGPNVSEAHTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRLIN  233

Query  800   AALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMA  979
             AALND+L+F IANH++TVVE DA YVKPF+TD ++I PG+T NVLL+ K   P +TFFMA
Sbjct  234   AALNDDLYFSIANHSMTVVETDASYVKPFDTDTILIGPGETTNVLLRAKPASPNATFFMA  293

Query  980   ARPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRS  1159
             AR Y TG GT DN+TVAG+LEY   S +  K    P+  P LP IN T+  +NF+ KLRS
Sbjct  294   ARTYNTGLGTIDNTTVAGLLEYSCTSSSSIKK--LPLLKPTLPAINDTAAAANFSTKLRS  351

Query  1160  LGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAIL  1339
             L ++QFPANVP+TVD+ F+FTVGLGT PCPKNQTCQGPNGTKFAAS+NNVSFV P+ A+L
Sbjct  352   LASTQFPANVPRTVDRRFYFTVGLGTRPCPKNQTCQGPNGTKFAASINNVSFVFPSMALL  411

Query  1340  QAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSI  1519
             QA+Y  +SNGVY +DFP  P  PFNYTGTPPNNT V N T+ VVLPFN  VELV+QDTSI
Sbjct  412   QAHYLARSNGVYTSDFPHNPPFPFNYTGTPPNNTFVRNGTRAVVLPFNTNVELVMQDTSI  471

Query  1520  LGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRAD  1699
              GAESHPLHLHGYNF++VGQG GN+DP  DPA +NLVDPVERNT GVPSGGW AIRFRAD
Sbjct  472   QGAESHPLHLHGYNFFIVGQGSGNYDPVNDPARFNLVDPVERNTAGVPSGGWIAIRFRAD  531

Query  1700  NPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             NPGVW MHCHF+VHLSWGL MAW+V +G LP QKL PPPSDLPKC
Sbjct  532   NPGVWLMHCHFDVHLSWGLVMAWVVNDGALPGQKLPPPPSDLPKC  576



>ref|XP_009782930.1| PREDICTED: laccase-4-like [Nicotiana sylvestris]
Length=579

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/555 (72%), Positives = 467/555 (84%), Gaps = 0/555 (0%)
 Frame = +2

Query  170   MAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVP  349
             +A+AKH  +TRHYKFNI+MQN+TRLC TKSIVTVNG+FPGPRI+AREGDR+++KVVNHV 
Sbjct  25    LALAKHAGITRHYKFNIQMQNMTRLCQTKSIVTVNGQFPGPRIIAREGDRLVIKVVNHVQ  84

Query  350   NNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRAT  529
              N++IHWHG+RQ+R+GWADGPAYITQCPIQTGQ+YVYNFTI GQRGTLFWHAHISWLR T
Sbjct  85    YNLTIHWHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLFWHAHISWLRVT  144

Query  530   LHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTING  709
             L+GPI+ILP+K  +YPFP+P KE+P++FGEWW  DTE ++S+ALQ GG PNISDAYTING
Sbjct  145   LYGPIVILPKKGAAYPFPQPFKEIPILFGEWWKADTETIISKALQTGGAPNISDAYTING  204

Query  710   LPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFE  889
             LPG  YNCSA +TFK+KVKPGKTYLLR++NAALNDELFF IANH +TVVE DA YVKPF+
Sbjct  205   LPGLFYNCSAKDTFKLKVKPGKTYLLRLVNAALNDELFFSIANHNLTVVEVDAVYVKPFK  264

Query  890   TDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNIS  1069
             T+ ++I PGQT NVLLKTK   P +TF MAARPY TG   FDNST  G+LEY  PS N  
Sbjct  265   TNTILITPGQTTNVLLKTKHFHPNATFLMAARPYATGPAAFDNSTTTGILEYHQPSNNTK  324

Query  1070  KNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCP  1249
             K++T P+  P LP  N T+F ++F  K+RSL N +FPANVP+ VDK+FFFTVGLG NPCP
Sbjct  325   KSNTFPLLKPKLPIFNDTTFATSFVKKIRSLANGKFPANVPKKVDKHFFFTVGLGLNPCP  384

Query  1250  KNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTP  1429
             KNQTCQGPN TK AAS+NN+SFV P  A+LQ+++  +S GVY TDFP+ P   FNYTG P
Sbjct  385   KNQTCQGPNNTKLAASVNNISFVQPNVALLQSHFFNQSKGVYTTDFPANPPFKFNYTGNP  444

Query  1430  PNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKD  1609
             PNN  V   TKVVVLPFN +VELV+QDTSI+ AESHPLHLHG+NF+VVGQGFGN++  KD
Sbjct  445   PNNIFVTTGTKVVVLPFNTSVELVMQDTSIISAESHPLHLHGFNFFVVGQGFGNYNSSKD  504

Query  1610  PANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKL  1789
             PAN+NLVDP ERNT+GVP GGW AIRF ADNPGVWFMHCH EVH SWGL+MAW+V +GK 
Sbjct  505   PANFNLVDPAERNTVGVPPGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWMVMDGKG  564

Query  1790  PNQKLLPPPSDLPKC  1834
             P QKL PPP+DLPKC
Sbjct  565   PKQKLPPPPADLPKC  579



>ref|XP_010541371.1| PREDICTED: laccase-17-like [Tarenaya hassleriana]
Length=582

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/592 (70%), Positives = 491/592 (83%), Gaps = 21/592 (4%)
 Frame = +2

Query  77    TIIMGFLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTK  256
             T+ +   F  F  L + C L+++ S  F           +TRHYK  I+MQNVTRLCHT+
Sbjct  6     TMTLSMKFQHFLALFS-CLLVLLPSPAF----------GITRHYKLEIKMQNVTRLCHTR  54

Query  257   SIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPI  436
             SIV+VNGKFPGPR++AREGDR+L+KVVN+V N +    HGIRQ+R+GWADGPAYITQCPI
Sbjct  55    SIVSVNGKFPGPRLVAREGDRLLIKVVNYVSNRM----HGIRQLRSGWADGPAYITQCPI  110

Query  437   QTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFG  616
             QTGQ+YVYN+TI+GQRGTL++HAHISWLR+T++GP+IILP++   YPF KP++EVPMIFG
Sbjct  111   QTGQSYVYNYTIIGQRGTLWYHAHISWLRSTIYGPLIILPKRGVPYPFAKPYREVPMIFG  170

Query  617   EWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMI  796
             EW+N D EA+++QAL+ GGGPN+SDAYTINGLPGPLYNCSA +TF+++VKPGKTYLLR+I
Sbjct  171   EWFNADPEAIINQALKTGGGPNVSDAYTINGLPGPLYNCSAKDTFRLRVKPGKTYLLRLI  230

Query  797   NAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFM  976
             NAALNDELFF IANHTVTVVEADA YVKPFETD ++IAPGQT NVLLKTK   P ++FFM
Sbjct  231   NAALNDELFFSIANHTVTVVEADAIYVKPFETDTILIAPGQTTNVLLKTKSQYPKASFFM  290

Query  977   AARPYFTGQGTFDNSTVAGVLEYEIPSLNI---SKNSTKPIAL--PPLPPINGTSFVSNF  1141
              ARPY TGQGTFDNSTVAG+LEYE P       SK S K + L  P LP +N T+F + F
Sbjct  291   TARPYVTGQGTFDNSTVAGILEYEPPKSTKAIHSKTSIKNLQLLKPVLPALNDTNFATTF  350

Query  1142  TGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPC-PKNQTCQGPNGTKFAASLNNVSFV  1318
             T KLRSL + +FPANVP  VD+ FFFTVGLGT PC  KNQTCQGPNGT FAAS+NN+SF+
Sbjct  351   TNKLRSLNSKRFPANVPTEVDQKFFFTVGLGTKPCNQKNQTCQGPNGTMFAASVNNISFI  410

Query  1319  TPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVEL  1498
              PTTA+LQ++YS +S+GVY+  FP  PL PFNYTG PPNNT V N TK++VLPFN +VEL
Sbjct  411   MPTTALLQSHYSGQSHGVYSPYFPHDPLIPFNYTGNPPNNTMVGNGTKLLVLPFNTSVEL  470

Query  1499  VLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWA  1678
             V+QDTSILGAESHPLHLHG+NF+VVGQGFGNFDP +DP N+NLVDP+ERNT+GVPSGGW 
Sbjct  471   VMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNEDPKNFNLVDPIERNTVGVPSGGWV  530

Query  1679  AIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             AIRF ADNPGVWFMHCH EVH SWGL+MAW+V +G  P+QKLLPPP+DLPKC
Sbjct  531   AIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVLDGDKPDQKLLPPPADLPKC  582



>ref|XP_006363101.1| PREDICTED: laccase-17-like [Solanum tuberosum]
Length=569

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/573 (72%), Positives = 485/573 (85%), Gaps = 8/573 (1%)
 Frame = +2

Query  119   LAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRI  298
             +   FL+ + +L    +++ A     TRHYKF I++QNVTRLCHTKS+VTVNGKFPGPRI
Sbjct  4     IGRLFLVSIIALCLLHNVSAA-----TRHYKFEIKLQNVTRLCHTKSMVTVNGKFPGPRI  58

Query  299   MAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVG  478
             +AREGDR+ ++V+N+V NN+SIHWHGIRQIR+GWADGPAY+TQCPIQ GQ YVYNFTI+G
Sbjct  59    VAREGDRLEIEVINNVQNNISIHWHGIRQIRSGWADGPAYVTQCPIQIGQKYVYNFTIIG  118

Query  479   QRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQA  658
             QRGT +WHAHISWLR+TL+GPIIILP+KN  YPF KP+KEVP+IFGEW+N DTEA++SQA
Sbjct  119   QRGTFWWHAHISWLRSTLYGPIIILPKKNNPYPFTKPYKEVPIIFGEWFNGDTEAIISQA  178

Query  659   LQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIAN  838
             LQ GGGPN+SDAYTINGLPGPLYNCS  +TFK+KVKPGKTYLLR+INAALNDELFF IAN
Sbjct  179   LQTGGGPNVSDAYTINGLPGPLYNCSTKDTFKLKVKPGKTYLLRLINAALNDELFFSIAN  238

Query  839   HTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDN  1018
             HT+ V++AD  YVKPFET+ ++I PGQT NVLLKTK + P + F+M ARPY TG GTFDN
Sbjct  239   HTLQVIDADGVYVKPFETNTIIITPGQTHNVLLKTKPHFPNAKFYMLARPYVTGPGTFDN  298

Query  1019  STVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQT  1198
             STVAG+LEYE  S +  KN   PI  P LP +N T FV+NFT KLRSL   QFPANVP  
Sbjct  299   STVAGILEYESKSKHHLKN--LPIFKPSLPSLNDTIFVTNFTSKLRSLATPQFPANVPLN  356

Query  1199  VDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTT-AILQAYYSRKSNGVY  1375
             VD++ FFT+GLGT+PC +N+TCQGPNGTKF+AS+NNVSF+ PTT A+LQ+++  +S GVY
Sbjct  357   VDRHLFFTIGLGTSPCDQNKTCQGPNGTKFSASINNVSFILPTTNALLQSHFFGQSKGVY  416

Query  1376  ATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHG  1555
               DFP  PL  FNYTG PPNNT V N TK++VLPFN +VELV+QDTSILG ESHPLHLHG
Sbjct  417   KPDFPYSPLHWFNYTGNPPNNTLVNNDTKLMVLPFNTSVELVMQDTSILGLESHPLHLHG  476

Query  1556  YNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFE  1735
             +NF+VVGQGFGN+DP KDP+N+NLVDP+ERNT+GVPSGGW AIRF ADNPGVWFMHCH E
Sbjct  477   FNFFVVGQGFGNYDPNKDPSNFNLVDPIERNTVGVPSGGWVAIRFLADNPGVWFMHCHLE  536

Query  1736  VHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             VH SWGL+MAW+V++GKLPNQKL PPP DLPKC
Sbjct  537   VHTSWGLKMAWLVQDGKLPNQKLPPPPMDLPKC  569



>ref|XP_002864664.1| hypothetical protein ARALYDRAFT_496140 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40923.1| hypothetical protein ARALYDRAFT_496140 [Arabidopsis lyrata subsp. 
lyrata]
Length=577

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/576 (70%), Positives = 482/576 (84%), Gaps = 12/576 (2%)
 Frame = +2

Query  131   FLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
              L + + +   P  A      +TRHY   I+MQNVTRLCHTKS+V+VNG+FPGP+++ARE
Sbjct  6     LLAVFSCVLLLPQPAFG----ITRHYTLEIKMQNVTRLCHTKSLVSVNGQFPGPKLIARE  61

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GD++L+KVVN V NN+SIHWHGIRQ+R+GWADGPAYITQCPIQTGQ+YVYN+TIVGQRGT
Sbjct  62    GDQLLIKVVNQVSNNISIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRGT  121

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             L++HAHISWLR+T++GP+IILP++   YPF KPHKEVPMIFGEW+N D EA++ QA Q G
Sbjct  122   LWYHAHISWLRSTVYGPLIILPKRGVPYPFAKPHKEVPMIFGEWFNADPEAIIRQATQTG  181

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
             GGPN+SDAYTINGLPGPLYNCSA +TF+++VKPGKTYLLR+INAALNDELFF IANHTVT
Sbjct  182   GGPNVSDAYTINGLPGPLYNCSAKDTFRLRVKPGKTYLLRLINAALNDELFFSIANHTVT  241

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VVEADA YVKPFE D ++IAPGQT NVLLKTK + P ++FFM ARPY TGQGTFDNSTVA
Sbjct  242   VVEADAIYVKPFEMDTILIAPGQTTNVLLKTKSSYPSASFFMTARPYVTGQGTFDNSTVA  301

Query  1031  GVLEYEIPSLNI---SKNSTKPIAL--PPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQ  1195
             G+LEYE P       S+ S K + L  P LP +N T+F + F+ KLRSL +  FPANVP 
Sbjct  302   GILEYEPPKQTKDAHSRTSIKNLQLFKPILPALNDTNFATKFSNKLRSLNSKNFPANVPL  361

Query  1196  TVDKNFFFTVGLGTNPC--PKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSN  1366
              +D+ FFFTVGLGTNPC    NQTCQGP N T FAAS++N+SF+ PT A+LQ++YS +S+
Sbjct  362   NIDRKFFFTVGLGTNPCNHKNNQTCQGPTNTTMFAASISNISFIMPTKALLQSHYSGQSH  421

Query  1367  GVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLH  1546
             GVY+  FP  P+ PFNYTGTPPNNT + N T ++VLP+N +VELV+QDTSILGAESHPLH
Sbjct  422   GVYSPKFPWSPIVPFNYTGTPPNNTMISNGTNLMVLPYNTSVELVMQDTSILGAESHPLH  481

Query  1547  LHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHC  1726
             LHG+NF+VVGQGFGNFDP KDP N+NLVDP+ERNTIGVPSGGWAAIRF ADNPGVWFMHC
Sbjct  482   LHGFNFFVVGQGFGNFDPNKDPKNFNLVDPIERNTIGVPSGGWAAIRFLADNPGVWFMHC  541

Query  1727  HFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             H EVH SWGLRMAW+V +G  P+QKLLPPP+DLPKC
Sbjct  542   HLEVHTSWGLRMAWLVLDGDKPDQKLLPPPADLPKC  577



>ref|XP_002308164.1| hypothetical protein POPTR_0006s08740g [Populus trichocarpa]
 gb|EEE91687.1| hypothetical protein POPTR_0006s08740g [Populus trichocarpa]
Length=580

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/577 (71%), Positives = 479/577 (83%), Gaps = 10/577 (2%)
 Frame = +2

Query  113   PLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGP  292
             P +AA  L+     FFF  +      ++TR Y FNI  +N TRLCHT+S+VTVNG+FPGP
Sbjct  11    PSMAALQLLC----FFFFSLVPDFAAAITRQYTFNITHKNFTRLCHTRSLVTVNGQFPGP  66

Query  293   RIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTI  472
             R++AREGD+VLVKVVNHV  N++IHWHG+RQ+  GWADGPAY+TQCPIQTGQ Y YNFTI
Sbjct  67    RLVAREGDQVLVKVVNHVAENITIHWHGVRQLTTGWADGPAYVTQCPIQTGQAYTYNFTI  126

Query  473   VGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVS  652
              GQRGTL WHAHISWLR++L+GPIIILP+ N SYPF KP+KE+P++FGEW+NVD EAV++
Sbjct  127   TGQRGTLLWHAHISWLRSSLYGPIIILPKLNESYPFKKPYKEIPILFGEWFNVDPEAVIA  186

Query  653   QALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRI  832
             QALQ G GPN+SDAYTINGLPGPLYNCSA +T+K+KVKPGKTYLLR+INAALNDELFF I
Sbjct  187   QALQTGAGPNVSDAYTINGLPGPLYNCSAKDTYKLKVKPGKTYLLRLINAALNDELFFSI  246

Query  833   ANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTF  1012
             ANHT+TVVEADA YVKPFE D L+I+PGQT NVLLKTK + P +TF+M A PYF+G G+F
Sbjct  247   ANHTLTVVEADAVYVKPFEADTLLISPGQTTNVLLKTKPHLPNATFYMFAGPYFSGMGSF  306

Query  1013  DNSTVAGVLEYEIPSLNISKNSTK--PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPAN  1186
             DNST AGVL Y+ PS   S N  K  P   P LPPIN T FV+NFT K RSL N++FPAN
Sbjct  307   DNSTTAGVLVYKHPS---SNNHLKKLPTLKPTLPPINATGFVANFTKKFRSLANAKFPAN  363

Query  1187  VPQTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKS  1363
             VPQTVD+ FFFTVGLGTNPCPKN TCQGP N TKFAAS+NNVSFV P+ A+LQ+Y+  +S
Sbjct  364   VPQTVDRKFFFTVGLGTNPCPKNTTCQGPNNNTKFAASINNVSFVLPSVALLQSYFFGQS  423

Query  1364  NGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPL  1543
             NGV+ +DFP  P  PFNYTGTPPNNT V N TK VVL FN +VELV+Q TSI+ AESHPL
Sbjct  424   NGVFTSDFPQNPTIPFNYTGTPPNNTMVSNGTKAVVLTFNTSVELVMQGTSIVAAESHPL  483

Query  1544  HLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMH  1723
             HLHG+NF+VVGQGFGN+DP KDP+N+NLVDP+ERNT GVP+GGW AIRF ADNPGVWFMH
Sbjct  484   HLHGFNFFVVGQGFGNYDPNKDPSNFNLVDPMERNTAGVPAGGWIAIRFLADNPGVWFMH  543

Query  1724  CHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             CH +VH SWGLRMAWIV +G  PNQK+ PPPSDLPKC
Sbjct  544   CHLDVHTSWGLRMAWIVLDGPQPNQKIPPPPSDLPKC  580



>gb|ABW81073.1| unknown [Cleome spinosa]
Length=563

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/557 (72%), Positives = 477/557 (86%), Gaps = 3/557 (1%)
 Frame = +2

Query  173   AVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPN  352
             A  +   +TRHYKFNI+++NVTRLC T+SI+TVNG+FPGPR++AREGD +L+KVVNHV  
Sbjct  7     ANVESAGITRHYKFNIQLKNVTRLCKTRSILTVNGEFPGPRVIAREGDNLLIKVVNHVST  66

Query  353   NVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATL  532
             N+SIHWHGIRQ+R+GWADGPAYITQCPIQTGQ+YVYNFT+ GQRGTL+WHAHI+W+RAT+
Sbjct  67    NISIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNFTVTGQRGTLWWHAHITWIRATV  126

Query  533   HGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGL  712
             +GP+IILP+ N S+PFPKP+K++P+IFGEW+N D +AV+ QALQ G GPN SDA+TINGL
Sbjct  127   YGPLIILPKLNDSFPFPKPYKQIPIIFGEWFNADPQAVLQQALQTGAGPNASDAHTINGL  186

Query  713   PGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFET  892
             PGPLYNCS N+T+K+KVKP KTYLLR+INAALNDELFF IANHT+TVVEADA YVKPF+T
Sbjct  187   PGPLYNCSTNDTYKLKVKPRKTYLLRLINAALNDELFFSIANHTLTVVEADASYVKPFQT  246

Query  893   DLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISK  1072
             D+LVI PGQT NVLL+TK   P +TFFM AR YF GQGT DN+TVAG+LEY+        
Sbjct  247   DVLVIGPGQTTNVLLRTKRVSPNATFFMLARTYFVGQGTIDNTTVAGILEYKQNLRCNGS  306

Query  1073  NS--TKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPC  1246
             NS  TKP+ +P LPPIN TSFVSNFT   RSL + +FP +VP+TVD+ F FTVGLGTNPC
Sbjct  307   NSLKTKPVLMPTLPPINATSFVSNFTNMFRSLASPRFPIDVPKTVDRKFLFTVGLGTNPC  366

Query  1247  PKNQTCQGPNGTKFAASLNNVSFVTP-TTAILQAYYSRKSNGVYATDFPSVPLTPFNYTG  1423
             P+NQTCQGPNGT F+AS+NNVSFV P TT++LQ+Y+  KSNGV+ TDFP+ P+  FNYTG
Sbjct  367   PENQTCQGPNGTMFSASMNNVSFVLPNTTSLLQSYFFGKSNGVFTTDFPNAPIFEFNYTG  426

Query  1424  TPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPK  1603
              PPNNT V+N TK+VVL +N TVELVLQDTSILG+ESHP+HLHG++FYVVGQGFGNFDP 
Sbjct  427   MPPNNTMVMNGTKLVVLKYNTTVELVLQDTSILGSESHPMHLHGFDFYVVGQGFGNFDPT  486

Query  1604  KDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEG  1783
             +DP  +NL+DPVERNT  VP+GGW A+RFRADNPGVW MHCH E+HLSWG+ MAW+V +G
Sbjct  487   RDPKRFNLLDPVERNTAFVPAGGWVAVRFRADNPGVWLMHCHIEIHLSWGMTMAWLVLDG  546

Query  1784  KLPNQKLLPPPSDLPKC  1834
              LPNQKL PPPSD PKC
Sbjct  547   DLPNQKLPPPPSDFPKC  563



>ref|XP_004246355.1| PREDICTED: laccase-4-like [Solanum lycopersicum]
Length=579

 Score =   862 bits (2228),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/568 (70%), Positives = 475/568 (84%), Gaps = 0/568 (0%)
 Frame = +2

Query  131   FLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
             FL+++  L     +A+AKH  +TRHYKFNI+MQNVTRLC TK+IVTVNGKFPGPRI+ARE
Sbjct  12    FLLVIFFLVLVDTLALAKHEGITRHYKFNIQMQNVTRLCQTKNIVTVNGKFPGPRIIARE  71

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GDR+++KVVN+V +NV+IHWHG+RQ+R+GWADGPAYITQCPIQ GQ+YVYNFTI GQRGT
Sbjct  72    GDRLVIKVVNNVQHNVTIHWHGVRQLRSGWADGPAYITQCPIQRGQSYVYNFTITGQRGT  131

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             LFWHAHISWLR TL+GPI+ILP+K  +YPFP+P KEVP++FGEWW  DTE +V+QALQ G
Sbjct  132   LFWHAHISWLRVTLYGPIVILPKKGVAYPFPQPFKEVPILFGEWWKADTEKIVNQALQTG  191

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
             G PNISDAYTINGLPG L+NCSA +TFK+KVKPGKTYLLR++NAALNDELFF IANH++T
Sbjct  192   GPPNISDAYTINGLPGLLHNCSAKDTFKLKVKPGKTYLLRVVNAALNDELFFSIANHSLT  251

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VVE DA YVKPF  ++++I PGQT NVLLKTK   P +TF M+ARPY TG  +FDNST  
Sbjct  252   VVEVDAVYVKPFNANIILITPGQTTNVLLKTKHFHPKATFLMSARPYATGPASFDNSTTT  311

Query  1031  GVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKN  1210
             G+LEY   S N  K++  P+    LP  N T+F ++F  K+RSL N++FPANVP+ VDK+
Sbjct  312   GILEYHQHSNNTKKSNKFPLLNSKLPIFNDTTFATSFVKKIRSLANAKFPANVPKRVDKH  371

Query  1211  FFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFP  1390
             FFFTVGLG NPCPKNQTCQGPN TK AAS+NNVSFV P  A+LQ++Y  +S GVY TDFP
Sbjct  372   FFFTVGLGLNPCPKNQTCQGPNNTKLAASVNNVSFVQPNVALLQSHYFNQSKGVYTTDFP  431

Query  1391  SVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYV  1570
               P   FNYTG PPNN+ V + TKVV+LPFN +VELV+QDTSI+ AESHPLHLHG+NF+V
Sbjct  432   VNPPFKFNYTGNPPNNSFVTSGTKVVMLPFNTSVELVMQDTSIISAESHPLHLHGFNFFV  491

Query  1571  VGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSW  1750
             VGQGFGN++  KDPAN+NLVDP ERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH SW
Sbjct  492   VGQGFGNYNSSKDPANFNLVDPAERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSW  551

Query  1751  GLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             GL+M W+V +GK P QKLLPPP+DLPKC
Sbjct  552   GLKMVWMVTDGKSPKQKLLPPPADLPKC  579



>ref|XP_003622947.1| Laccase [Medicago truncatula]
Length=560

 Score =   862 bits (2228),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/568 (72%), Positives = 472/568 (83%), Gaps = 18/568 (3%)
 Frame = +2

Query  131   FLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
             F +I  SL  F    +A  G +TRHY F+IR QNVTRLCH+KS+VTVNG+FPGPRI+ARE
Sbjct  11    FPLIFLSLINFCTFELALAG-ITRHYHFDIRYQNVTRLCHSKSMVTVNGQFPGPRIVARE  69

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GDR+++KVVNHV NN+SIHWHGIRQ+++GWADGPAY+TQCPIQT Q+YVYN+TI GQRGT
Sbjct  70    GDRLIIKVVNHVQNNISIHWHGIRQLQSGWADGPAYVTQCPIQTDQSYVYNYTIKGQRGT  129

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             LFWHAHISWLR+TL+GP+IILP+KN  YPF KPHKEV ++FGEW+N D EA+++QALQ G
Sbjct  130   LFWHAHISWLRSTLYGPLIILPKKNDQYPFAKPHKEVLILFGEWFNADPEAIIAQALQTG  189

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
             GGPN+SDAYTINGLPGPLYNCSAN+TFK+KVKPGKTYLLR+INAALNDELFF IANHT+ 
Sbjct  190   GGPNVSDAYTINGLPGPLYNCSANDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTLK  249

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VVEADA YVKPFET+ + IAPGQT NVLL TK + P + F M ARPY  G G FDN+TVA
Sbjct  250   VVEADAIYVKPFETNTIYIAPGQTTNVLLNTKSHYPNAAFLMTARPYAAGPGPFDNTTVA  309

Query  1031  GVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKN  1210
                               P+  P LP  N TSF + F+ KLRSL ++QFPANVP+ +DK+
Sbjct  310   -----------------HPLFKPILPAFNDTSFATKFSNKLRSLASAQFPANVPKKIDKH  352

Query  1211  FFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFP  1390
             FFFTVG+GTNPC  NQTCQG NGT F AS+NNVSF  PTTA+LQ+++  ++NG+Y TDFP
Sbjct  353   FFFTVGIGTNPCQSNQTCQGLNGTMFVASMNNVSFTMPTTALLQSHFFGQNNGIYTTDFP  412

Query  1391  SVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYV  1570
             S PL PFNYTGTPPNNT V N TKVVVLPFN +VELV+QDTSILGAESHPLHLHG+NF+V
Sbjct  413   SKPLNPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFV  472

Query  1571  VGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSW  1750
             VGQGFGN+D  KDP  +NLVDPVERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH SW
Sbjct  473   VGQGFGNYDSNKDPQKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSW  532

Query  1751  GLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             GL MAWIV +GKLPNQKLLPPP+DLPKC
Sbjct  533   GLSMAWIVLDGKLPNQKLLPPPADLPKC  560



>ref|XP_006400889.1| hypothetical protein EUTSA_v10013109mg [Eutrema salsugineum]
 gb|ESQ42342.1| hypothetical protein EUTSA_v10013109mg [Eutrema salsugineum]
Length=572

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/550 (73%), Positives = 474/550 (86%), Gaps = 3/550 (1%)
 Frame = +2

Query  194   VTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWH  373
             +TRHY  +I+MQNVTRLCHTKSIV+VNG+FPGP+++AREGD++L+KVVNHVPNN+SIHWH
Sbjct  23    ITRHYTLDIKMQNVTRLCHTKSIVSVNGQFPGPKLIAREGDQLLIKVVNHVPNNISIHWH  82

Query  374   GIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIIL  553
             GIRQ+R+GWADGPAYITQCPIQTGQ+YVYN+TIVGQRGTLF+HAHISWLRAT++GPIIIL
Sbjct  83    GIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRGTLFYHAHISWLRATVYGPIIIL  142

Query  554   PRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNC  733
             P++   YPF KP+KEVPMIFGEW+N D EA++ QA Q GGGPN+SDAYTINGLPGPLYNC
Sbjct  143   PKRGVPYPFAKPYKEVPMIFGEWFNADPEAIIRQATQTGGGPNVSDAYTINGLPGPLYNC  202

Query  734   SANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAP  913
             SA +TF+++VKPGKTYLLR+INAALNDELFF IANHTVTVVEADA YVKPFETD ++IAP
Sbjct  203   SAKDTFRLRVKPGKTYLLRLINAALNDELFFSIANHTVTVVEADAIYVKPFETDTILIAP  262

Query  914   GQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKPIA  1093
             GQT NVLLKTK + P ++FFM ARPY TGQGTFDNSTVAG+L+YE P    +     P+ 
Sbjct  263   GQTTNVLLKTKPSYPSASFFMTARPYVTGQGTFDNSTVAGILDYEPPKHARTSIKDLPLF  322

Query  1094  LPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPC--PKNQTCQ  1267
              P LP +N T+F + F+ KLRSL + +FPA VP  VD+ FFFTVGLGT PC    NQTCQ
Sbjct  323   TPVLPALNDTNFATKFSNKLRSLNSKKFPAKVPLKVDRKFFFTVGLGTKPCNHKNNQTCQ  382

Query  1268  GP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQ  1444
             GP N T FAAS++N+SF  PT A+LQ++YS +S+GVY+ ++P  P+  FNYTGTPPNNT 
Sbjct  383   GPTNTTMFAASISNISFTMPTKALLQSHYSGQSHGVYSPNYPWDPIVKFNYTGTPPNNTM  442

Query  1445  VVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYN  1624
             V N T ++VL +N +VELV+QDTSILGAESHPLHLHG+NF+VVGQGFGNFDP KDP N+N
Sbjct  443   VSNGTNLMVLRYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDPKNFN  502

Query  1625  LVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKL  1804
             LVDP+ERNT+GVPSGGWAAIRF ADNPGVWFMHCH EVH SWGLRMAW+V +G  PNQKL
Sbjct  503   LVDPIERNTVGVPSGGWAAIRFLADNPGVWFMHCHLEVHTSWGLRMAWLVLDGDKPNQKL  562

Query  1805  LPPPSDLPKC  1834
             LPPP+DLPKC
Sbjct  563   LPPPADLPKC  572



>ref|XP_010685719.1| PREDICTED: laccase-17-like [Beta vulgaris subsp. vulgaris]
Length=586

 Score =   862 bits (2226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/572 (72%), Positives = 485/572 (85%), Gaps = 13/572 (2%)
 Frame = +2

Query  152   LFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVK  331
             L FF ++ +  HG +TRHY+F+I++ NVT LC TKSI+TVNGKFPGPRI+AREGDRV+V+
Sbjct  17    LLFFANVWLC-HG-ITRHYRFDIKLHNVTHLCKTKSIITVNGKFPGPRIIAREGDRVIVQ  74

Query  332   VVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHI  511
             VVNHV NNVSIHWHGIRQ+ + WADGPAY+TQCPIQT  +YVYNFTI GQRGTLFWHAHI
Sbjct  75    VVNHVKNNVSIHWHGIRQLGSQWADGPAYVTQCPIQTNHSYVYNFTIKGQRGTLFWHAHI  134

Query  512   SWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISD  691
             SWLRAT++GPIIILPR+N SYPFPKPHKE  ++FGEWWN DTEAV+SQALQ+GGGPN+SD
Sbjct  135   SWLRATVYGPIIILPRRNESYPFPKPHKEKTIVFGEWWNNDTEAVISQALQSGGGPNVSD  194

Query  692   AYTINGLPGPLYNCSAN-----ETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVV  856
             AYT NG PGPLYN         +T+K+KVKPGKTYLLR++NAALNDELFF IANHT+TVV
Sbjct  195   AYTFNGFPGPLYNSCIGAKGMADTYKLKVKPGKTYLLRLVNAALNDELFFSIANHTMTVV  254

Query  857   EADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGV  1036
             +ADA YVKPF+T++L+IAPGQT NVLLKTK  P  +T+ MA RPYF G GTFDN+T A +
Sbjct  255   DADALYVKPFKTNILLIAPGQTTNVLLKTKPKPSHTTYLMAVRPYFVGSGTFDNTTAAAI  314

Query  1037  LEYEIPSLNISKNSTKPI-----ALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTV  1201
             LEY  PS + S  + K I      LP LP IN TSFV+NFT K RSL N+ +P NVP+TV
Sbjct  315   LEYITPSKSSSSPTHKIINVTSKDLPRLPSINDTSFVTNFTRKFRSLNNANYPTNVPKTV  374

Query  1202  DKNFFFTVGLGTNPCPKNQTCQGPNG-TKFAASLNNVSFVTPTTAILQAYYSRKSNGVYA  1378
             DK+FFFTVGLGTNPCPKNQTCQGPN  TKFAA++NN+S   P+TA+LQ+++  ++NGVY+
Sbjct  375   DKHFFFTVGLGTNPCPKNQTCQGPNNRTKFAATINNISMALPSTALLQSHFFGQNNGVYS  434

Query  1379  TDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGY  1558
              +FP VPL  FNYTGTPPNNT V+N TK++V+P+N  VELV+QDTSI+ AESHPLHLHGY
Sbjct  435   PNFPQVPLIKFNYTGTPPNNTNVMNGTKLLVIPYNTNVELVMQDTSIISAESHPLHLHGY  494

Query  1559  NFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEV  1738
             +FYVVGQGFGNF+PK DPANYNLVDPV RNTIGVPSGGW AIRFRADNPGVWFMHCHFEV
Sbjct  495   DFYVVGQGFGNFNPKTDPANYNLVDPVARNTIGVPSGGWVAIRFRADNPGVWFMHCHFEV  554

Query  1739  HLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             H+SWGLRMAW+V +GKLPNQK+  PP+DLPKC
Sbjct  555   HISWGLRMAWLVLDGKLPNQKVPRPPADLPKC  586



>ref|XP_010654257.1| PREDICTED: laccase-17 isoform X1 [Vitis vinifera]
Length=577

 Score =   861 bits (2225),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/568 (71%), Positives = 469/568 (83%), Gaps = 1/568 (0%)
 Frame = +2

Query  134   LMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREG  313
             L    + +  P +  AKH   TRHYKF+I++Q VTRLC TKSIVTVNG+FPGPRI+AREG
Sbjct  10    LFAFCAFWVLPELVFAKHAGTTRHYKFDIKLQTVTRLCQTKSIVTVNGQFPGPRIIAREG  69

Query  314   DRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTL  493
             DRV++KVVNHV NN++IHWHGIRQ+R+GWADGPAYITQCPIQTGQ+YVYNFTI GQRGTL
Sbjct  70    DRVIIKVVNHVQNNITIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQRGTL  129

Query  494   FWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGG  673
             FWHAHISWLRAT++G ++ILP++   YPFP+P KEVP+IFGEWW  D E +++QA+Q GG
Sbjct  130   FWHAHISWLRATVYGSLVILPKRGVPYPFPQPFKEVPIIFGEWWKADIETMINQAMQTGG  189

Query  674   GPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTV  853
              PN+SDAYT+NGLPGPLYNCSA + F++KVKPGKTYLLR+INAALNDELFF IANHTVTV
Sbjct  190   APNVSDAYTMNGLPGPLYNCSAKDAFRLKVKPGKTYLLRLINAALNDELFFSIANHTVTV  249

Query  854   VEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAG  1033
             VE DA YVKPF+T+ LVI PGQT N+LLKTK + P +TF MAAR Y TG   FDNST AG
Sbjct  250   VEVDAVYVKPFKTNTLVITPGQTTNILLKTKSHSPNATFLMAARSYATGPAAFDNSTTAG  309

Query  1034  VLEYE-IPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKN  1210
             +LEYE   S++ +KN    +  P LP  N T F   F+ KLRSL +++FPA VPQTV++ 
Sbjct  310   ILEYEHKSSVSNTKNRKPSVLKPALPMFNDTIFAMKFSKKLRSLASNKFPAKVPQTVNRR  369

Query  1211  FFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFP  1390
             FFFTVGLG   C +NQ C GPN T  AA++NNVSFV P+TA+LQA++  KS GVY TDFP
Sbjct  370   FFFTVGLGLIQCSRNQACPGPNNTMVAAAINNVSFVQPSTALLQAHFFGKSKGVYTTDFP  429

Query  1391  SVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYV  1570
             + P   FNYTGTPP+N  V + TKVVVLPFN  VELVLQDTSI+GAESHPLHLHG+NFYV
Sbjct  430   ANPPFKFNYTGTPPSNILVNSGTKVVVLPFNTRVELVLQDTSIIGAESHPLHLHGFNFYV  489

Query  1571  VGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSW  1750
             VGQGFGNFDPKKDPAN+NLVDP+ERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH SW
Sbjct  490   VGQGFGNFDPKKDPANFNLVDPIERNTVGVPSGGWVAIRFHADNPGVWFMHCHLEVHTSW  549

Query  1751  GLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             GL+MAW+V +GK PNQKL PPPSDLPKC
Sbjct  550   GLKMAWVVMDGKRPNQKLPPPPSDLPKC  577



>ref|XP_002531562.1| laccase, putative [Ricinus communis]
 gb|EEF30828.1| laccase, putative [Ricinus communis]
Length=585

 Score =   861 bits (2225),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/585 (70%), Positives = 475/585 (81%), Gaps = 2/585 (0%)
 Frame = +2

Query  86    MGFLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIV  265
             MGF  H    +L    +  + SL  FP M VAKH  +TRHYKF I +QNVTRLC TKSIV
Sbjct  1     MGFNSHLTRAMLIRATVFALFSLCIFPEMIVAKHAGITRHYKFTIILQNVTRLCQTKSIV  60

Query  266   TVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTG  445
             TVNG+FPGPRI+AREGDR+L+KVVNHV  NV++HWHG+RQ+R+GWADGPAYI QCPIQTG
Sbjct  61    TVNGQFPGPRIIAREGDRLLIKVVNHVQYNVTLHWHGVRQLRSGWADGPAYIAQCPIQTG  120

Query  446   QTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWW  625
             Q+YVYNFT+ GQRGTLFWHAHISWLRA+L+GPI+ILP+K+ SYPFP+PHKEVP+IFGEWW
Sbjct  121   QSYVYNFTVTGQRGTLFWHAHISWLRASLYGPIVILPKKDASYPFPQPHKEVPIIFGEWW  180

Query  626   NVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAA  805
               DTE +++QA++ GG PN+SDA+TINGLPGPLYNCSA +TFK+KVKPGKTY+LR+INAA
Sbjct  181   KADTEVIINQAMRTGGAPNVSDAFTINGLPGPLYNCSAKDTFKLKVKPGKTYMLRLINAA  240

Query  806   LNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAAR  985
             LNDELFF IANHT+TVVE DA YVKPF+T  ++I PGQT NVLLK K   P +TF MAAR
Sbjct  241   LNDELFFSIANHTLTVVETDAVYVKPFKTHTVIITPGQTTNVLLKAKAKAPNATFLMAAR  300

Query  986   PYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTK--PIALPPLPPINGTSFVSNFTGKLRS  1159
             PY TG   FDN+T AG+LEYE PSL+ SKN +K  P+  P LP  N T+F   F+ K+RS
Sbjct  301   PYATGPAAFDNTTTAGILEYENPSLSSSKNKSKKFPLLKPSLPMFNDTAFSMRFSKKVRS  360

Query  1160  LGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAIL  1339
             L   +FPA VPQ VD++FFFTVGLG  PC +NQTCQGPN T+ AAS+NNVSFV P  A+L
Sbjct  361   LATVKFPAKVPQKVDRHFFFTVGLGILPCSRNQTCQGPNNTRVAASINNVSFVQPNIALL  420

Query  1340  QAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSI  1519
             QA++  +S GVY TDFP+ P   FNYTGTPP N    + TKVVVLPFN  VELVLQDT I
Sbjct  421   QAHFFDQSKGVYTTDFPANPPFKFNYTGTPPTNIMATSGTKVVVLPFNTNVELVLQDTGI  480

Query  1520  LGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRAD  1699
             + AESHPLHLHG+NF+VVGQGFGNFD K DPA +NL DP ERNTIGVPSGGW AIRF AD
Sbjct  481   ISAESHPLHLHGFNFFVVGQGFGNFDAKNDPAKFNLFDPAERNTIGVPSGGWVAIRFLAD  540

Query  1700  NPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             NPG WFMHCH EVH SWGL+MAWIV +GK P+QKL PPPSDLPKC
Sbjct  541   NPGAWFMHCHLEVHTSWGLKMAWIVTDGKRPHQKLPPPPSDLPKC  585



>ref|XP_009419259.1| PREDICTED: laccase-4-like [Musa acuminata subsp. malaccensis]
Length=581

 Score =   861 bits (2224),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/575 (72%), Positives = 483/575 (84%), Gaps = 5/575 (1%)
 Frame = +2

Query  116   LLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPR  295
             LL   FL +   +  FP  +V + G +TRHYKF+++M NVTRLC TKSIVTVNG+FPGPR
Sbjct  10    LLTGVFLFLSVLVSAFP--SVVQSG-ITRHYKFDVQMANVTRLCSTKSIVTVNGQFPGPR  66

Query  296   IMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIV  475
             I+AREGDRV VKV+NHVP NV+IHWHG+RQ+R+GWADGPAY+TQCPI TG++YVYNFTIV
Sbjct  67    IVAREGDRVAVKVINHVPYNVTIHWHGVRQLRSGWADGPAYVTQCPIPTGRSYVYNFTIV  126

Query  476   GQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQ  655
             GQRGTLFWHAHISWLRATL+GPIIILP     YPF KP++EVP+IFGEWW  DTEA++ Q
Sbjct  127   GQRGTLFWHAHISWLRATLYGPIIILPELGVPYPFTKPYREVPVIFGEWWKADTEAIIHQ  186

Query  656   ALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIA  835
             ALQ GGGPN+SDAYTINGLPGPLYNCSA +TFK+KVKPGKTYLLR+INAALN+ELFF IA
Sbjct  187   ALQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVKPGKTYLLRLINAALNNELFFSIA  246

Query  836   NHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFD  1015
             NHTVTVV+ D  YVKPF+ + L+I+PGQT +VLL  K   P + FFM AR Y TG GTFD
Sbjct  247   NHTVTVVDVDGVYVKPFDAETLLISPGQTTDVLLHAKPYYPDAMFFMTARSYATGSGTFD  306

Query  1016  NSTVAGVLEYEIPSLNISKNSTK--PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANV  1189
             NSTVA VLEY+ PS +     TK  P+  P LP  N TSF +NFTG+LRSL  ++FPANV
Sbjct  307   NSTVAAVLEYQNPSRSSPAVFTKNLPLHKPTLPAFNDTSFAANFTGRLRSLATTRFPANV  366

Query  1190  PQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNG  1369
             PQTVD+ F FTVGLGT+PCPKNQTCQGPNGTKF+A++NN+SF +PTTA+LQA++  +S  
Sbjct  367   PQTVDRRFLFTVGLGTSPCPKNQTCQGPNGTKFSATVNNISFASPTTALLQAHFFGQSRN  426

Query  1370  VYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHL  1549
             VY+ DFP VPL PFNYTGTPPNNT V N TK+VVLPFN +VELV+QDTSILG ESHPLHL
Sbjct  427   VYSPDFPVVPLMPFNYTGTPPNNTMVSNGTKLVVLPFNTSVELVMQDTSILGTESHPLHL  486

Query  1550  HGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCH  1729
             HGYNF+VVGQGFGN+DP  DPA +NLVDP ERNT+GVP+GGW AIRF ADNPGVWFMHCH
Sbjct  487   HGYNFFVVGQGFGNYDPANDPAKFNLVDPAERNTVGVPAGGWVAIRFLADNPGVWFMHCH  546

Query  1730  FEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
              E H+SWGL+MAW+V +G+LPNQKL PPPSDLPKC
Sbjct  547   IEAHMSWGLKMAWLVLDGELPNQKLPPPPSDLPKC  581



>ref|XP_009345405.1| PREDICTED: laccase-17-like [Pyrus x bretschneideri]
Length=575

 Score =   861 bits (2224),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/580 (70%), Positives = 475/580 (82%), Gaps = 16/580 (3%)
 Frame = +2

Query  116   LLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPR  295
             L + C + ++T  F           S+TRHY FNI   NVTRLC+T+SI++VN KFPGPR
Sbjct  5     LFSFCVVALLTPEF---------ASSITRHYTFNIEYHNVTRLCNTRSILSVNKKFPGPR  55

Query  296   IMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIV  475
             ++AREGD+VL+KV+NHV NNV+IHWHG++Q+R+GWADGPAYITQCPIQ GQ+Y YNFTI 
Sbjct  56    LVAREGDKVLIKVINHVSNNVTIHWHGVKQLRSGWADGPAYITQCPIQMGQSYTYNFTIQ  115

Query  476   GQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQ  655
             GQRGTL WHAHISWLR+T++GPIIILP++N SYPF KP+KEVP+I GEW+NVD EAV++Q
Sbjct  116   GQRGTLLWHAHISWLRSTIYGPIIILPKRNESYPFVKPYKEVPIILGEWFNVDPEAVINQ  175

Query  656   ALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIA  835
             ALQ G GPN+SDA+TINGLPGPLYNCS+ + FK+KVKPGKTYLLR+INAALNDELFF IA
Sbjct  176   ALQTGAGPNVSDAFTINGLPGPLYNCSSKDVFKLKVKPGKTYLLRLINAALNDELFFSIA  235

Query  836   NHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFD  1015
             NHT+TVVEADA Y KPFETD L+I PGQT NVLLKTK N P +TF + A PYFTG GT D
Sbjct  236   NHTLTVVEADAVYTKPFETDTLLITPGQTTNVLLKTKPNSPNATFLILASPYFTGGGTLD  295

Query  1016  NSTVAGVLEYEIPSLNI-SKNSTKPIALPPLPPINGTSFVS------NFTGKLRSLGNSQ  1174
             N+T AG+LEYE P  N  + N T P+  P LPP N T FV+      N   K RSL + +
Sbjct  296   NTTTAGILEYEHPITNRHTSNKTLPLFKPSLPPFNATKFVNVTQFVQNLAKKFRSLASKK  355

Query  1175  FPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYS  1354
             FPANVPQTVDK FFFTVGLGT PCP+N TCQGPNG KFAAS+NN SF  P+TA+LQA++S
Sbjct  356   FPANVPQTVDKKFFFTVGLGTAPCPQNSTCQGPNGLKFAASVNNFSFALPSTAMLQAHFS  415

Query  1355  RKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAES  1534
              +SNGVY TDFP+ PL  FNYTGTPPN+T V N TK +VLPFN +VELVLQDTSILGAES
Sbjct  416   GQSNGVYTTDFPANPLVTFNYTGTPPNDTNVANGTKALVLPFNTSVELVLQDTSILGAES  475

Query  1535  HPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVW  1714
             HPLHLHG+NF+VVGQGFGN+DP KDPA +NLVDP+ERNT GVP+GGW A+RF ADNPGVW
Sbjct  476   HPLHLHGFNFFVVGQGFGNYDPNKDPAKFNLVDPIERNTGGVPAGGWIAVRFLADNPGVW  535

Query  1715  FMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
              MHCH ++H SWGLRMAWIV++G   NQKL PPPSDLPKC
Sbjct  536   LMHCHLDIHTSWGLRMAWIVQDGPQANQKLPPPPSDLPKC  575



>emb|CDY09232.1| BnaA02g06580D [Brassica napus]
Length=572

 Score =   860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/550 (73%), Positives = 474/550 (86%), Gaps = 3/550 (1%)
 Frame = +2

Query  194   VTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWH  373
             +TRHY  +I+M NVTRLCHTKS+V+VNGKFPGP+I+AREGD++L+KVVNHVPNN+S+HWH
Sbjct  23    ITRHYTLDIKMHNVTRLCHTKSLVSVNGKFPGPKIIAREGDQLLIKVVNHVPNNISLHWH  82

Query  374   GIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIIL  553
             GIRQ+R+GWADGPAYITQCPIQTGQ+YVYN+TIVGQRGTL++HAHISWLRAT++GP+IIL
Sbjct  83    GIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRGTLWYHAHISWLRATVYGPLIIL  142

Query  554   PRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNC  733
             P+    YPFPKPHKEVPM+FGEW+N DTEA++ QA   GGGPN+SDAYTINGLPGPLYNC
Sbjct  143   PKHGVPYPFPKPHKEVPMVFGEWFNADTEAIIRQATLTGGGPNVSDAYTINGLPGPLYNC  202

Query  734   SANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAP  913
             SA +TF+++VK GKTYLLR+INAALNDELFF IANHTVTVVEADA YVKPFET+ ++IAP
Sbjct  203   SAKDTFRLRVKAGKTYLLRIINAALNDELFFSIANHTVTVVEADAVYVKPFETNTILIAP  262

Query  914   GQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKPIA  1093
             GQT NVLLKTK + P ++FFM ARPY TGQGTFDN+TVAG+LEYE P    +     P+ 
Sbjct  263   GQTTNVLLKTKPSYPSASFFMTARPYATGQGTFDNTTVAGILEYEQPKHAKTNIKNLPLF  322

Query  1094  LPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPC--PKNQTCQ  1267
              P LP +N T+F + F+ KLRSL + +FPANVPQ VD+ FFFTVGLGTNPC    NQTCQ
Sbjct  323   TPVLPALNDTNFATKFSNKLRSLNSKKFPANVPQEVDRKFFFTVGLGTNPCNHKNNQTCQ  382

Query  1268  GP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQ  1444
             GP N T FAAS++N+SF  PT A+LQ++YS +SNGVY+ +FP  P+ PFNYTGTPPNNT 
Sbjct  383   GPTNTTMFAASISNISFTLPTKALLQSHYSGRSNGVYSPNFPWSPIVPFNYTGTPPNNTM  442

Query  1445  VVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYN  1624
             V   T ++VL +N +VELV+QDTSILGAESHPLHLHG+NF+VVGQGFGNFDP KDP  +N
Sbjct  443   VSTGTNLMVLRYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDPKKFN  502

Query  1625  LVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKL  1804
             LVDP+ERNT+GVPSGGWAAIRF ADNPGVWFMHCH EVH SWGLRMAW+V +G  P+QKL
Sbjct  503   LVDPIERNTVGVPSGGWAAIRFLADNPGVWFMHCHLEVHTSWGLRMAWLVLDGDKPDQKL  562

Query  1805  LPPPSDLPKC  1834
             +PPP+DLPKC
Sbjct  563   IPPPADLPKC  572



>ref|XP_004507172.1| PREDICTED: laccase-2-like [Cicer arietinum]
Length=594

 Score =   860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/567 (71%), Positives = 479/567 (84%), Gaps = 8/567 (1%)
 Frame = +2

Query  119   LAACFLMIMTSLFFFPH--MAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGP  292
             L   FL   + L+ FP   +A + HGSVTRHYKF+IR+ NVTRLCHTKSIVTVNGKFPGP
Sbjct  17    LFGVFLFATSFLWTFPEFVLATSHHGSVTRHYKFDIRLANVTRLCHTKSIVTVNGKFPGP  76

Query  293   RIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTI  472
             R++AREGDR+L+KVVNHVPNN+++HWHG+RQ+R+GW+DGP+YITQCPI+ GQ+YVYNF+I
Sbjct  77    RVVAREGDRILIKVVNHVPNNITLHWHGVRQVRSGWSDGPSYITQCPIKRGQSYVYNFSI  136

Query  473   VGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVS  652
             VGQRGTLFWHAH SWLRAT++GP+I+LPR N SYPF KP+KE+P++FGEWWN D EAV++
Sbjct  137   VGQRGTLFWHAHFSWLRATVYGPLILLPRHNESYPFLKPYKELPILFGEWWNADPEAVIA  196

Query  653   QALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRI  832
             QALQ GGGPN+SDAYT NGLPGPLYNCS  +T+K+KVKPGKTYLLR+INAALNDELFF I
Sbjct  197   QALQTGGGPNVSDAYTFNGLPGPLYNCSK-DTYKLKVKPGKTYLLRLINAALNDELFFSI  255

Query  833   ANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTF  1012
             ANHT+ +VEADA YVKPFE+  +++ PGQT NVLLKTK   P +TFFM ARPYFTG GTF
Sbjct  256   ANHTLIIVEADASYVKPFESHTILLGPGQTTNVLLKTKPQYPNATFFMLARPYFTGMGTF  315

Query  1013  DNSTVAGVLEYEIPSLNISKN---STKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPA  1183
             DNSTVAG+LEY     N + N   ST     P LP IN T+FV+NF+ K  SL + ++PA
Sbjct  316   DNSTVAGILEYTKNVANTNSNVNSSTTSKYFPLLPSINDTTFVANFSNKFVSLNSVKYPA  375

Query  1184  NVPQTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQA-YYSR  1357
             NVP+T+DKNFFFTVGLGT+PCPKNQTCQGP N +KFA S+NN SF  P+ A+LQ  ++ +
Sbjct  376   NVPKTIDKNFFFTVGLGTSPCPKNQTCQGPNNSSKFAGSMNNESFALPSIALLQQHFFGQ  435

Query  1358  KSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESH  1537
              +NG+Y TDFP +PL PFNYTGTPPNNT+V N TK VV+P+N  V++VLQDTSILGAESH
Sbjct  436   ANNGIYTTDFPVLPLRPFNYTGTPPNNTRVSNGTKTVVIPYNTRVQVVLQDTSILGAESH  495

Query  1538  PLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWF  1717
             PLHLHG+NF+V+GQGFGNFDP  DP  +NLVDPVERNT+GVP+GGW AIRF ADNPGVW 
Sbjct  496   PLHLHGFNFFVIGQGFGNFDPSNDPNKFNLVDPVERNTVGVPAGGWVAIRFLADNPGVWL  555

Query  1718  MHCHFEVHLSWGLRMAWIVKEGKLPNQ  1798
             MHCHF+VHLSWGLRMAWIV++GK PNQ
Sbjct  556   MHCHFDVHLSWGLRMAWIVEDGKFPNQ  582



>ref|XP_011019845.1| PREDICTED: laccase-2-like [Populus euphratica]
Length=580

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/575 (72%), Positives = 474/575 (82%), Gaps = 6/575 (1%)
 Frame = +2

Query  113   PLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGP  292
             P +AA  L         P  A A    +TR Y FNI  +N TRLCHT+S+VTVNGKFPGP
Sbjct  11    PSMAALQLFCFFIFSLVPDFAAA----ITRQYTFNITYKNFTRLCHTRSLVTVNGKFPGP  66

Query  293   RIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTI  472
             R++AREGD+VLVKVVNHV  N++IHWHG+RQ+ +GWADGPAYITQCPIQTGQ Y YNFTI
Sbjct  67    RLVAREGDQVLVKVVNHVAENITIHWHGVRQLTSGWADGPAYITQCPIQTGQAYTYNFTI  126

Query  473   VGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVS  652
              GQRGTL WHAHISWLR++L+GPIIILP+ N SYPF KP+KE+P++FGEW+NVD EAV++
Sbjct  127   TGQRGTLLWHAHISWLRSSLYGPIIILPKLNESYPFKKPYKEIPILFGEWFNVDPEAVIA  186

Query  653   QALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRI  832
             QALQ G GPN+SDAYTINGLPGPLYNCSA +T+K+KVKPGKTYLLR+INAALNDELFF I
Sbjct  187   QALQTGAGPNVSDAYTINGLPGPLYNCSAKDTYKLKVKPGKTYLLRLINAALNDELFFSI  246

Query  833   ANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTF  1012
             ANHT+TVVEADA YVKPFE D L+I PGQT NVLLKTK + P +TF+M A PYF+G G+F
Sbjct  247   ANHTLTVVEADAVYVKPFEADTLLITPGQTTNVLLKTKPHLPNATFYMFAGPYFSGMGSF  306

Query  1013  DNSTVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVP  1192
             DNST AG L Y+ PS N +     P   P LPP N T FV+NFT K RSL N++FPANVP
Sbjct  307   DNSTTAGFLVYKHPSGN-NHLKKLPSLKPTLPPTNATGFVANFTKKFRSLANAKFPANVP  365

Query  1193  QTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNG  1369
             QTVD+ FFFTVGLGT+PCPKN TCQGP N TKFAAS+NNVSFV P+ A+LQ+Y+  +SNG
Sbjct  366   QTVDRKFFFTVGLGTHPCPKNTTCQGPNNNTKFAASINNVSFVLPSVALLQSYFFGQSNG  425

Query  1370  VYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHL  1549
             V+ +DFP  P  PFNYTGTPPNNT V N TK VVL FN +VELV+Q TSILGAESHPLHL
Sbjct  426   VFTSDFPQNPTIPFNYTGTPPNNTMVSNGTKTVVLAFNTSVELVMQGTSILGAESHPLHL  485

Query  1550  HGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCH  1729
             HGYNF+VVGQGFGN+DP KDP+N+NLVDPVERNT GVP+GGW AIRF ADNPG+WFMHCH
Sbjct  486   HGYNFFVVGQGFGNYDPNKDPSNFNLVDPVERNTAGVPAGGWVAIRFLADNPGLWFMHCH  545

Query  1730  FEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
              +VH SWGLRMAWIV +G  PNQK+ PPPSDLPKC
Sbjct  546   LDVHTSWGLRMAWIVLDGPQPNQKIPPPPSDLPKC  580



>ref|XP_010039668.1| PREDICTED: laccase-17-like [Eucalyptus grandis]
 gb|KCW45807.1| hypothetical protein EUGRSUZ_L00355 [Eucalyptus grandis]
Length=545

 Score =   860 bits (2221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/542 (74%), Positives = 469/542 (87%), Gaps = 5/542 (1%)
 Frame = +2

Query  221   RMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGW  400
              + NVTRLC+TKS+VT+NGKFPGPR++AREGDR+L++VVNHVPNN+SIHWHG+RQ+++GW
Sbjct  5     HVANVTRLCYTKSMVTINGKFPGPRVIAREGDRLLIEVVNHVPNNISIHWHGVRQLQSGW  64

Query  401   ADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPF  580
             ADGPAY+TQCPIQT Q+YVYN+TIVGQRGTL+WHAHISWLR+TL+G +IILP+ N SYPF
Sbjct  65    ADGPAYVTQCPIQTNQSYVYNYTIVGQRGTLWWHAHISWLRSTLYGSLIILPKHNDSYPF  124

Query  581   PKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVK  760
              KPHKE+P+IFGEW+N DTEA++SQALQ GGGPN+SDAYTINGLPGPLYNCSA +T+++K
Sbjct  125   AKPHKEIPIIFGEWFNSDTEAIISQALQTGGGPNVSDAYTINGLPGPLYNCSAKDTYRLK  184

Query  761   VKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLK  940
             VKPGKTYLLR+INA LNDELFF IANHT+TVVEADA Y+KPFET+ L+IAPGQT NVL+K
Sbjct  185   VKPGKTYLLRLINAVLNDELFFSIANHTLTVVEADATYLKPFETETLLIAPGQTTNVLIK  244

Query  941   TKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTK----PIALPPLP  1108
             TK   P +TF M ARPY TG GTFDNSTVAG+LEYE P LN    S      P+  P LP
Sbjct  245   TKPYYPKATFLMTARPYVTGLGTFDNSTVAGILEYE-PPLNEPHQSPSIKQLPLFKPTLP  303

Query  1109  PINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKF  1288
             P+N T+F +NFT KLRSL   QFPANVP  VD+ FFFTV LGT PC  NQTCQGP GT F
Sbjct  304   PLNDTAFATNFTTKLRSLATPQFPANVPLKVDRRFFFTVSLGTIPCQGNQTCQGPYGTMF  363

Query  1289  AASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVV  1468
              A++NNVSF  PTTA+LQA+Y+ +SNGVY+ DFPS P + FN+TGTPPNNT V N TK+V
Sbjct  364   TAAVNNVSFTMPTTALLQAHYTGQSNGVYSPDFPSHPKSIFNFTGTPPNNTNVGNGTKLV  423

Query  1469  VLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERN  1648
             VLPFN +VEL++QDTSILGAE HPLHLHG+NF+VVGQGFGNFDP KDPAN+NLVDPVERN
Sbjct  424   VLPFNTSVELIMQDTSILGAEGHPLHLHGFNFFVVGQGFGNFDPNKDPANFNLVDPVERN  483

Query  1649  TIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLP  1828
             T+GVPSGGW A RF ADNPGVWFMHCH EVH SWGL+MAW+V +GKLPNQKLLPPP+DLP
Sbjct  484   TVGVPSGGWVATRFLADNPGVWFMHCHLEVHSSWGLKMAWLVLDGKLPNQKLLPPPADLP  543

Query  1829  KC  1834
             KC
Sbjct  544   KC  545



>ref|XP_009131958.1| PREDICTED: laccase-17 [Brassica rapa]
Length=573

 Score =   859 bits (2219),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/574 (70%), Positives = 482/574 (84%), Gaps = 12/574 (2%)
 Frame = +2

Query  131   FLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
                + +S+   P  A  K    TRHY  +I+M NVTRLCHTKS+V+VNG+FPGP+++ARE
Sbjct  6     LFAVFSSVLLLPEPAFGK----TRHYTLDIKMHNVTRLCHTKSLVSVNGEFPGPKLIARE  61

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GD++L+KVVNHVPNN+S+HWHGIRQ+R+GWADGPAYITQCPIQTGQ+YVYN+T+VGQRGT
Sbjct  62    GDQLLIKVVNHVPNNISLHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTVVGQRGT  121

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             L++HAHISWLRAT++GP+IILP+    YPF KPHKEVPM+FGEW+N DTEA++ QA   G
Sbjct  122   LWYHAHISWLRATVYGPLIILPKHGVPYPFHKPHKEVPMVFGEWFNADTEAIIRQATLTG  181

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
             GGP++SDAYTINGLPGPLYNCSA +TF+++VKPGKTYLLR+INAALNDELFF IANHTVT
Sbjct  182   GGPSVSDAYTINGLPGPLYNCSAKDTFRLRVKPGKTYLLRLINAALNDELFFSIANHTVT  241

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VVEADA YVKPFETD ++IAPGQT N+LLKTK + P ++F M ARPY TGQGTFDNSTVA
Sbjct  242   VVEADAIYVKPFETDTILIAPGQTTNLLLKTKQSYPKASFLMTARPYVTGQGTFDNSTVA  301

Query  1031  GVLEYEIP---SLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTV  1201
             G+LEYE P     +I KN    +  P LP +N T+F + F+ KLRSL + +FPANVP  V
Sbjct  302   GILEYEQPKHTKTSIKKNLQ--LFTPVLPALNDTNFATKFSNKLRSLNSKKFPANVPLKV  359

Query  1202  DKNFFFTVGLGTNPC--PKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGV  1372
             D+ FFFTVGLGTNPC    NQTCQGP N T FAAS++N+SF  PT A+LQ++YS +SNGV
Sbjct  360   DRKFFFTVGLGTNPCNHKNNQTCQGPTNTTMFAASISNISFTMPTKALLQSHYSGQSNGV  419

Query  1373  YATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLH  1552
             Y+ +FP  P+ PFNYTGTPPNNT V   T ++VLP+N +VELV+QDTSILGAESHPLHLH
Sbjct  420   YSPNFPWSPIVPFNYTGTPPNNTMVSTGTNLMVLPYNTSVELVMQDTSILGAESHPLHLH  479

Query  1553  GYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHF  1732
             G+NF+VVGQGFGNFD K+DP N+NLVDP+ERNT+GVPSGGWAAIRF ADNPGVWFMHCH 
Sbjct  480   GFNFFVVGQGFGNFDAKEDPKNFNLVDPIERNTVGVPSGGWAAIRFLADNPGVWFMHCHL  539

Query  1733  EVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             EVH SWGLRMAW+V +G  P+QKLLPPP+DLPKC
Sbjct  540   EVHTSWGLRMAWLVLDGDKPDQKLLPPPADLPKC  573



>ref|XP_006363100.1| PREDICTED: laccase-4-like [Solanum tuberosum]
Length=579

 Score =   858 bits (2218),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/555 (71%), Positives = 468/555 (84%), Gaps = 0/555 (0%)
 Frame = +2

Query  170   MAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVP  349
             + +AKH  +TRHYKFNI+MQNVTRLC TK+IVTVNGKFPGPRI+AREGDR+++KVVN+V 
Sbjct  25    LTLAKHEGITRHYKFNIQMQNVTRLCQTKNIVTVNGKFPGPRIIAREGDRLVIKVVNNVQ  84

Query  350   NNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRAT  529
             +NV+IHWHG+RQ+R+GWADGPAYITQCPIQ GQ+YVYNFTI+GQRGTLFWHAHISWLR T
Sbjct  85    HNVTIHWHGVRQLRSGWADGPAYITQCPIQRGQSYVYNFTIIGQRGTLFWHAHISWLRVT  144

Query  530   LHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTING  709
             L+GPI+ILP+K  +YPFP+P KEVP++FGEWW  DTE +++QALQ GG PNISDAYTING
Sbjct  145   LYGPIVILPKKGVAYPFPQPFKEVPILFGEWWKADTEKIINQALQTGGPPNISDAYTING  204

Query  710   LPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFE  889
             LPG LYNCSA +TFK+KVKPGKTYLLR++NAALNDELFF IANH +TVVE DA YVKPF 
Sbjct  205   LPGLLYNCSAKDTFKLKVKPGKTYLLRVVNAALNDELFFSIANHNLTVVEVDAVYVKPFN  264

Query  890   TDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNIS  1069
             T++++I PGQT N+LLKTK   P +TF M+ARPY TG  +FDNST  G+LEY  PS N  
Sbjct  265   TNIILITPGQTTNILLKTKHFHPNATFLMSARPYATGPASFDNSTTTGILEYHKPSNNTK  324

Query  1070  KNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCP  1249
             K++  P+  P LP  N T+F ++F  K+RSL N++FPANVP+ VDK FFFTVGLG NPCP
Sbjct  325   KSNIFPLLKPKLPIFNDTTFATSFVKKIRSLANAKFPANVPKKVDKQFFFTVGLGLNPCP  384

Query  1250  KNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTP  1429
             KNQTCQGPN TK AAS+NNVSFV P  A+LQ++Y  +S GVY TDFP  P   FNYTG P
Sbjct  385   KNQTCQGPNNTKLAASVNNVSFVQPNVALLQSHYFNQSKGVYTTDFPVNPPFKFNYTGNP  444

Query  1430  PNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKD  1609
             PNN+ V + TKVV+LPFN +VELV+QDTSI+ AESHPLHLHG+NF+VVGQGFGN++   D
Sbjct  445   PNNSFVTSGTKVVMLPFNTSVELVMQDTSIISAESHPLHLHGFNFFVVGQGFGNYNSSND  504

Query  1610  PANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKL  1789
             PAN+NLVDP ERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH SWGL+M W+V +GK 
Sbjct  505   PANFNLVDPAERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMVWMVNDGKS  564

Query  1790  PNQKLLPPPSDLPKC  1834
             P QKL PPP+DLPKC
Sbjct  565   PKQKLPPPPADLPKC  579



>ref|XP_008369916.1| PREDICTED: laccase-17-like [Malus domestica]
Length=586

 Score =   858 bits (2216),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/580 (70%), Positives = 475/580 (82%), Gaps = 10/580 (2%)
 Frame = +2

Query  125   ACFLMIMTSLFFFPHMAVAK---HGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPR  295
             AC   +   LF F  +A+        +TRHY FNI+  NVTRLC+T+SIV+VN KFPGPR
Sbjct  7     ACSTSMAAFLFSFCVVALLTPEFASGITRHYTFNIKYHNVTRLCNTRSIVSVNEKFPGPR  66

Query  296   IMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIV  475
             ++AREGD+VL+KVVNHV NNV+IHWHG++Q+R+GWADGPAY+TQCPIQ GQ+Y YNFTI 
Sbjct  67    LVAREGDQVLIKVVNHVSNNVTIHWHGVKQLRSGWADGPAYVTQCPIQMGQSYTYNFTIQ  126

Query  476   GQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQ  655
             GQRGTL WHAH+SWLR+T++GPIIILP++N SYPF KP+KEVP++ GEW+NVD EAV++Q
Sbjct  127   GQRGTLLWHAHVSWLRSTIYGPIIILPKRNESYPFVKPYKEVPILLGEWFNVDPEAVINQ  186

Query  656   ALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIA  835
             ALQ GGGPN+SDA+TINGLPGPLYNCS+ + FK+KVKPGKTYLLR+INAALNDELFF IA
Sbjct  187   ALQTGGGPNVSDAFTINGLPGPLYNCSSKDVFKLKVKPGKTYLLRLINAALNDELFFSIA  246

Query  836   NHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFD  1015
             NHT+TVVEADA Y KPFETD L+IAPGQT NVLLKTK N P +TF + A PYFTG+GT D
Sbjct  247   NHTLTVVEADAVYTKPFETDTLLIAPGQTTNVLLKTKPNSPXATFLILASPYFTGRGTLD  306

Query  1016  NSTVAGVLEYEIPSLNISKN-STKPIALPPLPPINGTSFVS------NFTGKLRSLGNSQ  1174
             N+T AG+LEYE P   +  +  T P+  P LPP N T FV+      N   K RSL + +
Sbjct  307   NTTTAGILEYEHPITTLHTSIKTLPLFKPSLPPFNATKFVNVTQFVQNLAKKFRSLASKK  366

Query  1175  FPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYS  1354
             FPANVPQTVDK FFFT GLGT PCP+N TCQGPNG KFAAS+NN SF  P+TA+LQA++S
Sbjct  367   FPANVPQTVDKKFFFTXGLGTAPCPQNSTCQGPNGLKFAASVNNFSFALPSTAMLQAHFS  426

Query  1355  RKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAES  1534
              +SNGVY TDFP+ PL  FNYTGTPPN T V N TK +VLPFN +VELVLQDTSILGAES
Sbjct  427   GQSNGVYTTDFPANPLVTFNYTGTPPNVTNVANGTKALVLPFNTSVELVLQDTSILGAES  486

Query  1535  HPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVW  1714
             HPLHLHG+NF+VVGQGFGN+DP KDPA +NLVDP+ERNT GVP+GGW A RF ADNPGVW
Sbjct  487   HPLHLHGFNFFVVGQGFGNYDPNKDPAXFNLVDPIERNTAGVPAGGWIAXRFLADNPGVW  546

Query  1715  FMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
              MHCH ++H SWGLRMAWIV++G   NQKL PPPSDLPKC
Sbjct  547   LMHCHLDIHTSWGLRMAWIVQDGPQANQKLPPPPSDLPKC  586



>ref|XP_002278275.1| PREDICTED: laccase-17 [Vitis vinifera]
 emb|CBI31652.3| unnamed protein product [Vitis vinifera]
Length=583

 Score =   858 bits (2216),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/572 (75%), Positives = 493/572 (86%), Gaps = 7/572 (1%)
 Frame = +2

Query  131   FLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
               +++ +L   P +A A    +TRHYKFNI++ +VTRLCHTKSIV+VNG+FPGPRI+ARE
Sbjct  15    LFLVLNTLLVVPELASA---GITRHYKFNIKLHSVTRLCHTKSIVSVNGQFPGPRIIARE  71

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GDRV+V VVN+V NNV+IHWHGIRQ+++GWADGPAY+TQCPIQTGQ+YVYNFTI GQRGT
Sbjct  72    GDRVVVTVVNNVQNNVTIHWHGIRQLQSGWADGPAYVTQCPIQTGQSYVYNFTITGQRGT  131

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             LFWHAHISWLR+T++GPIIILP+KN  YPF KP+KEVP+IFGEWWN D EAV++QALQNG
Sbjct  132   LFWHAHISWLRSTVYGPIIILPKKNVPYPFAKPYKEVPIIFGEWWNADPEAVITQALQNG  191

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
             GGPN+SDAYTINGLPGPLYNCSA +TFK+KVKPGKTYLLR+INAALNDELFF IANHT+T
Sbjct  192   GGPNVSDAYTINGLPGPLYNCSAQDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTLT  251

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VV+ DA YVKPF+TD ++I PGQT N+LLK K + P +TF MAARPY TG+GTFDNSTVA
Sbjct  252   VVDVDAIYVKPFKTDTILITPGQTTNLLLKAKPHFPNATFLMAARPYATGRGTFDNSTVA  311

Query  1031  GVLEYEIPSLNISKN---STKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTV  1201
             G+L YE PS +          P+  P LPP+N TSF +NFT KLRSL NS+FPANVP+ V
Sbjct  312   GLLHYEPPSKSSPSASSFKNLPVFKPTLPPLNDTSFAANFTRKLRSLANSEFPANVPKKV  371

Query  1202  DKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYA  1378
             DK FFFTVGLGTNPCP+NQTCQGP N TKF+AS+NNVSFV PTTAILQA++ ++S GVY 
Sbjct  372   DKRFFFTVGLGTNPCPQNQTCQGPSNNTKFSASVNNVSFVLPTTAILQAHFFQQSKGVYT  431

Query  1379  TDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGY  1558
             TDFP+ P  PFNYTGTPPNNT V N TKVVVLPFN +VELVLQDTSILG ESHPLHLHG+
Sbjct  432   TDFPTTPTFPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVLQDTSILGIESHPLHLHGF  491

Query  1559  NFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEV  1738
             NF++VGQGFGNFD KKDP  +NLVDPVERNT+GVPSGGW AIRF ADNPGVWFMHCH EV
Sbjct  492   NFFLVGQGFGNFDSKKDPPKFNLVDPVERNTVGVPSGGWVAIRFFADNPGVWFMHCHLEV  551

Query  1739  HLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             H SWGL+MAWIV +GKLPNQKL PPPSDLP+C
Sbjct  552   HTSWGLKMAWIVTDGKLPNQKLPPPPSDLPQC  583



>ref|XP_007150345.1| hypothetical protein PHAVU_005G145800g [Phaseolus vulgaris]
 gb|ESW22339.1| hypothetical protein PHAVU_005G145800g [Phaseolus vulgaris]
Length=590

 Score =   857 bits (2214),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/561 (70%), Positives = 480/561 (86%), Gaps = 9/561 (2%)
 Frame = +2

Query  173   AVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPN  352
             A + +G+VTRHY+F+IR++N+TRLCHTK++VTVNGKFPGPR++AREGDR++VKV+NHVPN
Sbjct  32    ATSNYGAVTRHYQFDIRLKNITRLCHTKNVVTVNGKFPGPRVIAREGDRLVVKVINHVPN  91

Query  353   NVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATL  532
             N++IHWHG+RQ+R+GW+DGP+YITQCP+Q+GQ+Y+YNF++VGQRGTLFWHAH SWLRATL
Sbjct  92    NITIHWHGVRQLRSGWSDGPSYITQCPVQSGQSYMYNFSLVGQRGTLFWHAHHSWLRATL  151

Query  533   HGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGL  712
             +GP+IILPR N SYPF KP+KEVP++FGEWWNVD EAV++QAL  GGGPN+SDAYT+NGL
Sbjct  152   YGPLIILPRSNESYPFAKPYKEVPILFGEWWNVDPEAVIAQALHTGGGPNVSDAYTMNGL  211

Query  713   PGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFET  892
             PGPLYNCS+++TF +KVKPGKTYLLR+INAA+N+ELFF IANHT+TVVEADA YVKPF +
Sbjct  212   PGPLYNCSSDDTFNLKVKPGKTYLLRLINAAVNNELFFSIANHTMTVVEADAAYVKPFNS  271

Query  893   DLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEI------P  1054
             D++VI PGQT NV+LKTK     +TFFM ARP+F G+GTFDNS +AG+L+YE       P
Sbjct  272   DIIVIGPGQTTNVVLKTKPEYINATFFMLARPFFNGKGTFDNSKLAGILKYENNDNDNPP  331

Query  1055  SLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLG  1234
             S    KN T  +  P LP  N  SFV+NF+ K RSL ++++PANVPQ VD++FFFT+GLG
Sbjct  332   SEPDLKNRT--LLKPTLPAFNDASFVANFSRKFRSLNSAEYPANVPQRVDRSFFFTIGLG  389

Query  1235  TNPCPKNQTCQGPNG-TKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPF  1411
             + PCP+NQTC+GPN  TKFAAS+NN+SF  P+ AILQ ++S + N VY TDFP VPL PF
Sbjct  390   SIPCPRNQTCEGPNKRTKFAASMNNISFNLPSVAILQQHFSGQDNSVYTTDFPVVPLRPF  449

Query  1412  NYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGN  1591
             NYTGTPPNNT V + TKVV +P+N  V++VLQDTSILGAESHPLHLHG+N +VVGQGFGN
Sbjct  450   NYTGTPPNNTMVKSGTKVVAIPYNTRVQVVLQDTSILGAESHPLHLHGFNMFVVGQGFGN  509

Query  1592  FDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWI  1771
             FDP  DP N+NLVDPVERNTIGVPS GW AIRF ADNPGVW MHCH ++HLSW LRMAWI
Sbjct  510   FDPMTDPLNFNLVDPVERNTIGVPSAGWVAIRFLADNPGVWLMHCHIDLHLSWELRMAWI  569

Query  1772  VKEGKLPNQKLLPPPSDLPKC  1834
             V  GKL +QKL PPPSDLPKC
Sbjct  570   VNNGKLSHQKLPPPPSDLPKC  590



>ref|XP_007026973.1| Laccase 17 [Theobroma cacao]
 gb|EOY07475.1| Laccase 17 [Theobroma cacao]
Length=583

 Score =   857 bits (2213),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/569 (70%), Positives = 470/569 (83%), Gaps = 1/569 (0%)
 Frame = +2

Query  131   FLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
              L+ + ++   P +A+AKH  +TRHYKF+IRMQNVTRLC TKSIVTVNG+FPGPRI+ARE
Sbjct  15    LLLALCAVSLLPDLALAKHAGITRHYKFDIRMQNVTRLCQTKSIVTVNGQFPGPRIIARE  74

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GDR+L+KVVNHV  NV++HWHGIRQ+R GWADGPAYITQCPIQTGQ+YVYNFTI GQRGT
Sbjct  75    GDRLLIKVVNHVQYNVTLHWHGIRQLRTGWADGPAYITQCPIQTGQSYVYNFTITGQRGT  134

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             LFWHAHISWLRATL+GPI+ILP+++ SYPFP+P KEVP+IFGEWW  DTE +++QA+  G
Sbjct  135   LFWHAHISWLRATLYGPIVILPKRHASYPFPQPFKEVPIIFGEWWKADTETIINQAMATG  194

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
             G PNISDA+TINGLPGP YNCSA ETFK+KVKPGKTYLLR+INAALNDELFFRIANHTVT
Sbjct  195   GAPNISDAFTINGLPGPSYNCSAKETFKLKVKPGKTYLLRLINAALNDELFFRIANHTVT  254

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VVEADA YVKPF+TD+L+I PGQT NVLLK K   P + F ++ARPY TG  TFDN+T  
Sbjct  255   VVEADAVYVKPFKTDVLLITPGQTTNVLLKAKSKTPGANFALSARPYATGPATFDNTTTI  314

Query  1031  GVLEYEI-PSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDK  1207
             G+LEYEI  S + S N   P+    LP  N +++   F  K+RSL  ++FPA VP+ VD+
Sbjct  315   GILEYEISASASNSNNKKLPLLKAKLPQFNDSTYAMKFNQKIRSLATAKFPAKVPKNVDR  374

Query  1208  NFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDF  1387
              FFFTVGLG  PC +NQTCQGPN T+ AA++NNVSFV P  A+LQAY+  +S GVY T+F
Sbjct  375   RFFFTVGLGILPCSQNQTCQGPNNTRPAAAVNNVSFVQPNIALLQAYFFNRSKGVYTTNF  434

Query  1388  PSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFY  1567
             P+ P   FNYTGTPP N  + + TKVVVLPFN +VELV+QDTSILGAESHPLHLHG+NF+
Sbjct  435   PANPPVKFNYTGTPPKNIMLDSGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFF  494

Query  1568  VVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLS  1747
             V+GQG GNFDPKKDPA +NL DP ERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH S
Sbjct  495   VLGQGVGNFDPKKDPAKFNLRDPAERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTS  554

Query  1748  WGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             WGL+MAW+V +G    QKLLPPP+DLPKC
Sbjct  555   WGLKMAWVVNDGNGRKQKLLPPPADLPKC  583



>ref|XP_004514389.1| PREDICTED: laccase-17-like [Cicer arietinum]
Length=579

 Score =   856 bits (2211),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/582 (71%), Positives = 480/582 (82%), Gaps = 11/582 (2%)
 Frame = +2

Query  98    FHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNG  277
             FH+F  L    F   + +LF  P + V    S+TRHY FNI   NVTRLCHT++I++VNG
Sbjct  6     FHSFQSLKVLLFGFCVITLF--PELVV----SITRHYTFNIEYLNVTRLCHTRNILSVNG  59

Query  278   KFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYV  457
             KFPGPR++AREGDRVLVKVVNH+ NNV+IHWHGIRQ   GW+DGPAY+TQCPIQT QTY 
Sbjct  60    KFPGPRLVAREGDRVLVKVVNHISNNVTIHWHGIRQKTTGWSDGPAYVTQCPIQTNQTYT  119

Query  458   YNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDT  637
             YNFTI GQRGTLFWHAHISWLRATL+GPIIILP+KN SYPF KP++E+P++FGEW+NVD 
Sbjct  120   YNFTITGQRGTLFWHAHISWLRATLYGPIIILPKKNESYPFEKPYREIPILFGEWFNVDP  179

Query  638   EAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDE  817
             EAV++QALQ GGGPN+SDAYTINGLPGP YNCS+ +TFK+KVKP KTYLLR+INAALN+E
Sbjct  180   EAVINQALQTGGGPNVSDAYTINGLPGPFYNCSSKDTFKLKVKPNKTYLLRIINAALNEE  239

Query  818   LFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFT  997
             LFF IANHT+TVVEADA Y+KPF TD++VI PGQT NV+LKTK   P STF M ARPY T
Sbjct  240   LFFSIANHTLTVVEADARYIKPFNTDIIVITPGQTTNVILKTKPYFPNSTFLMIARPYVT  299

Query  998   GQGTFDNSTVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQF  1177
             G GTFDNST AG+L+Y+    + +KN   P   P LP IN T+FVSNFT K +SL NS+F
Sbjct  300   GLGTFDNSTPAGILQYKQQHKSPTKN--LPFLKPTLPFINDTNFVSNFTRKFKSLANSKF  357

Query  1178  PANVPQTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYS  1354
             P NVP+ VDK  FFTVGLGT+PCP+N TCQGP N TKFAAS+NN SFV P+ +I+++YY+
Sbjct  358   PINVPKKVDKKLFFTVGLGTSPCPENTTCQGPTNNTKFAASVNNYSFVLPSVSIMESYYN  417

Query  1355  --RKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGA  1528
                 +NGVY TDFP  PL PFNYTGTPPNNT V N TK+VVL FN +VEL+LQDTSILGA
Sbjct  418   FGNSNNGVYKTDFPDNPLNPFNYTGTPPNNTMVNNDTKLVVLKFNTSVELILQDTSILGA  477

Query  1529  ESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPG  1708
             ESHPLHLHGY+F+VVGQGFGN+D  KDP+N+NL DPVERNT+GVP+GGW AIRF ADNPG
Sbjct  478   ESHPLHLHGYDFFVVGQGFGNYDSNKDPSNFNLFDPVERNTVGVPAGGWVAIRFFADNPG  537

Query  1709  VWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             VWFMHCH ++H SWGLRMAWIV +G   NQKL PPPSDLPKC
Sbjct  538   VWFMHCHLDIHTSWGLRMAWIVLDGPESNQKLQPPPSDLPKC  579



>emb|CAA74105.1| laccase [Populus trichocarpa]
Length=580

 Score =   856 bits (2211),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/577 (71%), Positives = 476/577 (82%), Gaps = 10/577 (2%)
 Frame = +2

Query  113   PLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGP  292
             P +AA  L+     FFF  +      ++TR Y FNI  +N TRLCHT+S+VTVNG+FPGP
Sbjct  11    PSMAALQLLC----FFFFSLVPDFAAAITRQYTFNITHKNFTRLCHTRSLVTVNGQFPGP  66

Query  293   RIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTI  472
             R++AREGD+VLVKVVNHV  N++IHWHG+RQ+  GWADGPAY+TQCPIQTGQ Y YNFTI
Sbjct  67    RLVAREGDQVLVKVVNHVAENITIHWHGVRQLTTGWADGPAYVTQCPIQTGQAYTYNFTI  126

Query  473   VGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVS  652
              GQRGTL WHAHISWLR++L+GPIIILP+ N SYPF KP+KE+P++FGEW+NVD EAV++
Sbjct  127   TGQRGTLLWHAHISWLRSSLYGPIIILPKLNESYPFKKPYKEIPILFGEWFNVDPEAVIA  186

Query  653   QALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRI  832
             QALQ G GPN+SDAYTINGLPGPLYNCSA +T+K+KVKPGKTYLLR+INAALNDELFF I
Sbjct  187   QALQTGAGPNVSDAYTINGLPGPLYNCSAKDTYKLKVKPGKTYLLRLINAALNDELFFSI  246

Query  833   ANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTF  1012
             ANHT+TVVEADA YVKPFE D L+I+PGQT NVLLKTK + P +TF+M A PYF+G G+F
Sbjct  247   ANHTLTVVEADAVYVKPFEADTLLISPGQTTNVLLKTKPHLPNATFYMFAGPYFSGMGSF  306

Query  1013  DNSTVAGVLEYEIPSLNISKNSTK--PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPAN  1186
             DNST AGVL Y+ PS   S N  K  P   P LPPIN T FV+NFT K RSL N++FPAN
Sbjct  307   DNSTTAGVLVYKHPS---SNNHLKKLPTLKPTLPPINATGFVANFTKKFRSLANAKFPAN  363

Query  1187  VPQTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKS  1363
             VPQTVD+ FFFTVGLGTNPCPKN TCQG  N TKFAAS+NNVSFV P+ A+LQ+Y+    
Sbjct  364   VPQTVDRKFFFTVGLGTNPCPKNTTCQGTNNNTKFAASINNVSFVLPSVALLQSYFLWTV  423

Query  1364  NGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPL  1543
             NGV+ +DFP  P  PFNYTGTPPNNT V N TK VVL FN +VELV+Q TSI+ AESHPL
Sbjct  424   NGVFTSDFPQNPTIPFNYTGTPPNNTMVSNGTKAVVLTFNTSVELVMQGTSIVAAESHPL  483

Query  1544  HLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMH  1723
             HLHG+NF+VVGQGFGN+DP KDP+N+NLVDP+ERNT GVP+GGW AIRF ADNPGVWFMH
Sbjct  484   HLHGFNFFVVGQGFGNYDPNKDPSNFNLVDPMERNTAGVPAGGWIAIRFLADNPGVWFMH  543

Query  1724  CHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             CH +VH SWGLRMAWIV +G  PNQK+ PPPSDLPKC
Sbjct  544   CHLDVHTSWGLRMAWIVLDGPQPNQKIPPPPSDLPKC  580



>emb|CDX71061.1| BnaC03g11450D [Brassica napus]
Length=573

 Score =   855 bits (2210),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/574 (70%), Positives = 479/574 (83%), Gaps = 12/574 (2%)
 Frame = +2

Query  131   FLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
                + +SL   P  A  K    TRHY  +I+M NVTRLCHTKS+V+VNGKFPGP+++ARE
Sbjct  6     LFAVFSSLLLLPEPAFGK----TRHYTLDIKMHNVTRLCHTKSLVSVNGKFPGPKLIARE  61

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GD++L+KVVNHVPNN+S+HWHGIRQ+R+GWADGPAYITQCPIQTGQ+YVYN+T+VGQRGT
Sbjct  62    GDQLLIKVVNHVPNNLSLHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTVVGQRGT  121

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             L++HAHISWLRAT++GP+IILP+    YPF KPHKEVPM+FGEW+N DTEA++ QA Q G
Sbjct  122   LWYHAHISWLRATVYGPLIILPKHGVPYPFHKPHKEVPMVFGEWFNADTEAIIRQATQTG  181

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
             GGPN+SDAYTINGLPGPLYNCSA +TF+++VKPGKTYLLR+INAALNDELFF IANHTVT
Sbjct  182   GGPNVSDAYTINGLPGPLYNCSAKDTFRLRVKPGKTYLLRLINAALNDELFFSIANHTVT  241

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VVEADA YVKPFETD ++IAPGQT N+LLKTK + P ++F M ARPY TGQGTFDNSTVA
Sbjct  242   VVEADAIYVKPFETDTILIAPGQTTNLLLKTKQSYPKASFLMTARPYATGQGTFDNSTVA  301

Query  1031  GVLEYEIPSLN---ISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTV  1201
             G+LEYE P      I KN    +  P LP +N T+F + F+ KLRSL + ++PANVP  V
Sbjct  302   GILEYEQPKHTKTFIKKNLQ--LFTPVLPALNDTNFATKFSNKLRSLNSKRYPANVPLKV  359

Query  1202  DKNFFFTVGLGTNPC--PKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGV  1372
             D+ FFFTVGLGTNPC    NQTCQGP N T FAAS++N+SF  PT A+LQ++YS +SNGV
Sbjct  360   DRKFFFTVGLGTNPCNHKNNQTCQGPTNTTMFAASISNISFTMPTKALLQSHYSGQSNGV  419

Query  1373  YATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLH  1552
             Y+ +FP   + PFNYTGTPPNNT V   T V+VLP+N +VELV+QDTSILGAESHPLHLH
Sbjct  420   YSPNFPWNTIVPFNYTGTPPNNTMVSTGTNVMVLPYNTSVELVMQDTSILGAESHPLHLH  479

Query  1553  GYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHF  1732
             G+NF+VVGQGFGNFD K+DP  +NLVDP+ERNT+GVPSGGWAAIRF ADNPGVWFMHCH 
Sbjct  480   GFNFFVVGQGFGNFDAKEDPKKFNLVDPIERNTVGVPSGGWAAIRFLADNPGVWFMHCHL  539

Query  1733  EVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             EVH SWGLRMAW+V +G   +QKLLPPP+DLPKC
Sbjct  540   EVHTSWGLRMAWLVLDGDKSDQKLLPPPADLPKC  573



>ref|XP_010654259.1| PREDICTED: laccase-2-like [Vitis vinifera]
 emb|CBI30535.3| unnamed protein product [Vitis vinifera]
Length=579

 Score =   855 bits (2210),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/549 (76%), Positives = 475/549 (87%), Gaps = 3/549 (1%)
 Frame = +2

Query  194   VTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWH  373
             VTRHY FNI + NVTRLC TKSI++VNG+FPGP ++AREGDRV+VKVVN V NNV+IHWH
Sbjct  32    VTRHYTFNITLHNVTRLCQTKSIISVNGRFPGPPVVAREGDRVVVKVVNKVSNNVTIHWH  91

Query  374   GIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIIL  553
             G+RQ+R+ WADGP Y+TQCPIQTGQTY YNFTI GQRGTL WHAHISWLRATL+GPIIIL
Sbjct  92    GVRQLRSAWADGPTYVTQCPIQTGQTYTYNFTITGQRGTLLWHAHISWLRATLYGPIIIL  151

Query  554   PRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNC  733
             PR+N SYPFPKPHKEV +IFGEWWN D EAV+SQALQ+GGGPN+SDAYTINGLPGPLYNC
Sbjct  152   PRRNESYPFPKPHKEVTIIFGEWWNADPEAVISQALQSGGGPNVSDAYTINGLPGPLYNC  211

Query  734   SANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAP  913
             S+ +T+K+KVKPGKTYLLR+INAALNDELFF IANHT+TVVE DA YVKPF+T++LVI P
Sbjct  212   SSKDTYKLKVKPGKTYLLRLINAALNDELFFSIANHTLTVVEGDATYVKPFDTNVLVITP  271

Query  914   GQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKPIA  1093
             GQT NVLLKTK   P STF MAARPYFTGQGTFDNST AG+LEY  PS   S  +  P+ 
Sbjct  272   GQTTNVLLKTKPYFPNSTFLMAARPYFTGQGTFDNSTTAGILEYVNPSKPTSSQNKLPLL  331

Query  1094  LPPLPPI--NGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQ  1267
              P LPP+  N T FV+NFT K RSL  ++FPANVPQTVDK FFFT+GLG+NPCPK+ TCQ
Sbjct  332   KPTLPPVNPNATGFVTNFTRKFRSLATAKFPANVPQTVDKRFFFTIGLGSNPCPKDMTCQ  391

Query  1268  GPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQV  1447
             GPNGTKF+AS+NN+SF+ P+ +I+QAY+  + NGVY TDFP+ P  PFNYTGTPPNNT V
Sbjct  392   GPNGTKFSASVNNISFILPSVSIMQAYFFGQ-NGVYTTDFPTYPPVPFNYTGTPPNNTMV  450

Query  1448  VNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNL  1627
              N T+VVVLPFN +VELV+QDTSILGAESHP HLHGYNFYVVGQG GN+DP  DPAN+NL
Sbjct  451   SNGTRVVVLPFNTSVELVMQDTSILGAESHPFHLHGYNFYVVGQGIGNYDPNTDPANFNL  510

Query  1628  VDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLL  1807
             VDPVERNT GVP+GGW AIRF+ADNPGVWFMHCH +VH SWGLRMAWIV +G+ PNQKL 
Sbjct  511   VDPVERNTFGVPAGGWVAIRFQADNPGVWFMHCHLDVHTSWGLRMAWIVLDGQQPNQKLP  570

Query  1808  PPPSDLPKC  1834
             PPPSDLPKC
Sbjct  571   PPPSDLPKC  579



>ref|XP_006846061.1| hypothetical protein AMTR_s00012p00061860 [Amborella trichopoda]
 gb|ERN07736.1| hypothetical protein AMTR_s00012p00061860 [Amborella trichopoda]
Length=579

 Score =   855 bits (2209),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/564 (71%), Positives = 478/564 (85%), Gaps = 2/564 (0%)
 Frame = +2

Query  116   LLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPR  295
             L A    ++++++     ++ +KH  +TRHYKFNIR++N+TRLCHTK ++TVNG  PGPR
Sbjct  5     LSAFAMALLLSTILLKSELSESKHAGITRHYKFNIRLENMTRLCHTKQVITVNGLVPGPR  64

Query  296   IMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIV  475
             I+AREGDR+LVKVVNHVPNNV++HWHG+RQ+++GWADGPAY+TQCPIQTGQ+YVYNFTI+
Sbjct  65    IVAREGDRLLVKVVNHVPNNVTLHWHGVRQLQSGWADGPAYVTQCPIQTGQSYVYNFTII  124

Query  476   GQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQ  655
             GQRGTLFWHAH+SWLR+TL+GP++ILP++   YPF KPH+EVP+IFGEWWNVD+EAV+SQ
Sbjct  125   GQRGTLFWHAHVSWLRSTLYGPLVILPKRAIPYPFAKPHEEVPIIFGEWWNVDSEAVISQ  184

Query  656   ALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIA  835
             ALQ GGGPNISDAYTING PGPLYNCSA +TF+++V+PGKTYLLR+INAALNDELFF IA
Sbjct  185   ALQTGGGPNISDAYTINGHPGPLYNCSAKDTFRLEVEPGKTYLLRLINAALNDELFFSIA  244

Query  836   NHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFD  1015
             NH+VTVVE DA YVKPF T++++I PGQT NVLL  K  P  +TF MAARPY TG GTFD
Sbjct  245   NHSVTVVETDAIYVKPFTTEVVLITPGQTTNVLLTAKSQPFGTTFVMAARPYVTGLGTFD  304

Query  1016  NSTVAGVLEYEIPSLNISKNS--TKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANV  1189
             NST  G+L Y IPS   S  S    P+ LP LPP+N T+F +NF+ +LRSL  +QFPANV
Sbjct  305   NSTTVGLLHYNIPSFVNSSASRPKLPLLLPTLPPLNDTAFATNFSRRLRSLATNQFPANV  364

Query  1190  PQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNG  1369
             PQ VDK F FTVGLGT+PCPKNQTCQGPNGTKFAAS+NNVSFV PTTA+LQ+Y+  +S G
Sbjct  365   PQRVDKRFLFTVGLGTSPCPKNQTCQGPNGTKFAASVNNVSFVLPTTALLQSYFFGQSVG  424

Query  1370  VYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHL  1549
             +Y TDFP  P  PFNYTG+PPNNT     TK+ VL FN +VELVLQDT ILGAESHPLHL
Sbjct  425   IYTTDFPDNPPIPFNYTGSPPNNTLASFGTKLEVLKFNTSVELVLQDTGILGAESHPLHL  484

Query  1550  HGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCH  1729
             HG+NF+VVGQGFGN+DP KDPA +NLVDPVERNTIGVPSGGW A+RF ADNPGVWFMHCH
Sbjct  485   HGFNFFVVGQGFGNYDPSKDPAKFNLVDPVERNTIGVPSGGWVALRFLADNPGVWFMHCH  544

Query  1730  FEVHLSWGLRMAWIVKEGKLPNQK  1801
              EVH SWGL+MAW+V +GKLP+QK
Sbjct  545   LEVHTSWGLKMAWLVLDGKLPSQK  568



>gb|KFK27539.1| hypothetical protein AALP_AA8G396300 [Arabis alpina]
Length=575

 Score =   855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/553 (73%), Positives = 474/553 (86%), Gaps = 6/553 (1%)
 Frame = +2

Query  194   VTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWH  373
             +TRHY  +I+M NVTRLCHTKS+V+VNG+FPGP+++AREGD+VL+KV+N+V NN+SIHWH
Sbjct  23    ITRHYTLDIKMHNVTRLCHTKSLVSVNGQFPGPKLIAREGDQVLIKVINNVSNNISIHWH  82

Query  374   GIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIIL  553
             GIRQ+R+GWADGPAYITQCPIQTGQ+YVYN+TIVGQRGTL++HAHISWLR+T++GP+IIL
Sbjct  83    GIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRGTLWYHAHISWLRSTVYGPLIIL  142

Query  554   PRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNC  733
             P++   YPF KPHKEVPM FGEW+N D EA++ QA Q GGGPN+SDAYTINGLPGPLYNC
Sbjct  143   PKRGVPYPFAKPHKEVPMTFGEWFNADPEAIIRQATQTGGGPNVSDAYTINGLPGPLYNC  202

Query  734   SANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAP  913
             SA +TFK++VKPGKTYLLR+INAALNDELFF IANHTVTVVEADA YVKPFETD ++IAP
Sbjct  203   SAKDTFKLRVKPGKTYLLRLINAALNDELFFSIANHTVTVVEADAIYVKPFETDTILIAP  262

Query  914   GQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISKN-STKPI  1090
             GQT N+LLKTK + P ++FFM ARPY TGQGTFDN+TVAG+LEYE P      +   K +
Sbjct  263   GQTTNILLKTKSSYPSASFFMTARPYATGQGTFDNTTVAGILEYEPPKHTKDAHLKIKNL  322

Query  1091  AL--PPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPC--PKNQ  1258
              L  P LP +N T+F + F+ KLRSL +  FPANVP  VD+ FFFTVGLGTNPC    NQ
Sbjct  323   QLFKPVLPALNDTNFATKFSNKLRSLNSKTFPANVPLNVDRQFFFTVGLGTNPCNHKNNQ  382

Query  1259  TCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPN  1435
             TCQGP N T FAAS++N+SF+ PT A+LQ++YS +S GVY+  FP  P+ PFNYTGTPPN
Sbjct  383   TCQGPTNTTMFAASISNISFIMPTKALLQSHYSGQSRGVYSPQFPWNPIVPFNYTGTPPN  442

Query  1436  NTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPA  1615
             NT V N T ++VLP+N +VELV+QDTSILGAESHPLHLHG+NF+VVGQGFGNFDP KDP 
Sbjct  443   NTNVSNGTNLMVLPYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDPK  502

Query  1616  NYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPN  1795
             N+NLVDP+ERNTIGVPSGGWAAIRF ADNPGVWFMHCH EVH SWGLRMAW+V +G  P+
Sbjct  503   NFNLVDPIERNTIGVPSGGWAAIRFLADNPGVWFMHCHLEVHTSWGLRMAWLVLDGDKPD  562

Query  1796  QKLLPPPSDLPKC  1834
             QKLLPPP+DLPKC
Sbjct  563   QKLLPPPADLPKC  575



>ref|XP_008387791.1| PREDICTED: laccase-17-like [Malus domestica]
Length=586

 Score =   855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/580 (69%), Positives = 473/580 (82%), Gaps = 16/580 (3%)
 Frame = +2

Query  116   LLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPR  295
             L + C + ++T  F            +TRH  FNI+  NVTRLC+T+SIV+VN KFPGPR
Sbjct  16    LFSFCVVALLTPEF---------XSGITRHXTFNIKYHNVTRLCNTRSIVSVNEKFPGPR  66

Query  296   IMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIV  475
             ++AREGD+VL+KVVNHV NNV+IHWHG++Q+R+GWADGPAY+TQCPIQ GQ+Y YNFTI 
Sbjct  67    LVAREGDQVLIKVVNHVSNNVTIHWHGVKQLRSGWADGPAYVTQCPIQMGQSYTYNFTIQ  126

Query  476   GQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQ  655
             GQRGTL WHAH+SWLR+T++GPIIILP++N SYPF KP+KEVP++ GEW+NVD EAV++Q
Sbjct  127   GQRGTLLWHAHVSWLRSTIYGPIIILPKRNESYPFVKPYKEVPILLGEWFNVDPEAVINQ  186

Query  656   ALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIA  835
             ALQ GGGPN+SDA+TINGLPGPLYNCS+ + FK+KVKPGKTYLLR+INAALNDELFF IA
Sbjct  187   ALQTGGGPNVSDAFTINGLPGPLYNCSSKDVFKLKVKPGKTYLLRLINAALNDELFFSIA  246

Query  836   NHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFD  1015
             NHT+TVVEADA Y KPFETD L+IAPGQT NVLLKTK N P +TF + A PYFTG+GT D
Sbjct  247   NHTLTVVEADAVYTKPFETDTLLIAPGQTTNVLLKTKPNSPXATFLILASPYFTGRGTLD  306

Query  1016  NSTVAGVLEYEIPSLNISKN-STKPIALPPLPPINGTSFVS------NFTGKLRSLGNSQ  1174
             N+T AG+LEYE P   +  +  T P+  P LPP N T FV+      N   K RSL + +
Sbjct  307   NTTTAGILEYEHPITTLHTSIKTLPLFKPSLPPFNATKFVNVTQFVQNLAKKFRSLASKK  366

Query  1175  FPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYS  1354
             FPANVPQTVDK FFFT GLGT PCP+N TCQGPNG KFAAS+NN SF  P+TA+LQA++S
Sbjct  367   FPANVPQTVDKKFFFTXGLGTAPCPQNSTCQGPNGLKFAASVNNFSFALPSTAMLQAHFS  426

Query  1355  RKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAES  1534
              +SNGVY TDFP+ PL  FNYTGTPPN T V N TK +VLPFN +VELVLQDTSILGAES
Sbjct  427   GQSNGVYTTDFPANPLVTFNYTGTPPNVTNVANGTKALVLPFNTSVELVLQDTSILGAES  486

Query  1535  HPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVW  1714
             HPLHLHG+NF+VVGQGFGN+DP KDPA +NLVDP+ERNT GVP+GGW A RF ADNPGVW
Sbjct  487   HPLHLHGFNFFVVGQGFGNYDPNKDPAKFNLVDPIERNTAGVPAGGWIAXRFLADNPGVW  546

Query  1715  FMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
              MHCH ++H SWGLRMAWIV++G   NQKL PPPSDLPKC
Sbjct  547   LMHCHLDIHTSWGLRMAWIVQDGPQANQKLPPPPSDLPKC  586



>ref|XP_010414434.1| PREDICTED: laccase-2 isoform X1 [Camelina sativa]
 ref|XP_010414435.1| PREDICTED: laccase-2 isoform X2 [Camelina sativa]
Length=585

 Score =   854 bits (2207),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/576 (69%), Positives = 480/576 (83%), Gaps = 7/576 (1%)
 Frame = +2

Query  119   LAACFL--MIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGP  292
             +A C L  +++  L    +   A    +TRHY+F+I+++N+TRLC TK+IVTVNGKFPGP
Sbjct  13    MATCVLHYLLVAFLIAISYNIDAASAGITRHYQFDIQLKNITRLCKTKTIVTVNGKFPGP  72

Query  293   RIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTI  472
             ++ AREGD + +KVVNHV NN+SIHWHGIRQ+R+GWADGP+Y+TQCPI+TGQ+YVYNFT+
Sbjct  73    KVTAREGDNLQIKVVNHVSNNISIHWHGIRQLRSGWADGPSYVTQCPIRTGQSYVYNFTV  132

Query  473   VGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVS  652
              GQRGTL+WHAHI W+RAT++GP+IILP+ + SYPFPKP+K+VP+IFGEW+N D +AV+ 
Sbjct  133   TGQRGTLWWHAHIQWMRATVYGPLIILPKLHQSYPFPKPYKQVPIIFGEWFNADPQAVLQ  192

Query  653   QALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRI  832
             QALQ GGGPN SDA+T NGLPGPLYNCS  +T+K+ VKPGKTYLLR+INAALNDELFF I
Sbjct  193   QALQTGGGPNASDAHTFNGLPGPLYNCSTKDTYKLMVKPGKTYLLRLINAALNDELFFTI  252

Query  833   ANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTF  1012
             ANHT+TVVEADA YVKPF+T+++++ PGQT NVLLKTK + P +TF+M ARPYFT QGT 
Sbjct  253   ANHTLTVVEADASYVKPFQTNIVLLGPGQTTNVLLKTKPSNPNATFYMLARPYFTSQGTI  312

Query  1013  DNSTVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVP  1192
             DN+TVAG+L+YE P    SKN +  I  P LPPIN TS+ +NFT   RSL +S FPANVP
Sbjct  313   DNTTVAGILQYE-PHSKSSKNLS--IIKPSLPPINSTSYAANFTKMFRSLASSTFPANVP  369

Query  1193  QTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPT-TAILQAYYSRKSN  1366
             ++VDK +FFTVGLGTNPCPKNQTCQGP N TKFAAS+NNVSF+ P  T++LQ+Y++ KS 
Sbjct  370   KSVDKKYFFTVGLGTNPCPKNQTCQGPTNTTKFAASINNVSFILPNKTSLLQSYFTGKSK  429

Query  1367  GVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLH  1546
              V+ TDFPS P+ PFNYTGTPPNNT V   TKVVVL +N TVELVLQ TSILG E+HP+H
Sbjct  430   SVFMTDFPSAPIFPFNYTGTPPNNTMVSRGTKVVVLKYNTTVELVLQGTSILGIEAHPIH  489

Query  1547  LHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHC  1726
             LHG+NFYVVGQGFGNF+P  DP  YNLVDPVERNTI VPSGGW AIRF ADNPGVW MHC
Sbjct  490   LHGFNFYVVGQGFGNFNPASDPKQYNLVDPVERNTINVPSGGWVAIRFLADNPGVWLMHC  549

Query  1727  HFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             H E+HLSWGL MAW+V +G LPNQKLLPPPSD PKC
Sbjct  550   HIEIHLSWGLTMAWVVLDGDLPNQKLLPPPSDYPKC  585



>emb|CAN72263.1| hypothetical protein VITISV_037366 [Vitis vinifera]
Length=574

 Score =   854 bits (2207),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/571 (74%), Positives = 486/571 (85%), Gaps = 16/571 (3%)
 Frame = +2

Query  134   LMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREG  313
              +++ +L+ FP +A +    +TRHYKFNI++QNVTRLCHTKSIV+VNG+FPGP I+AREG
Sbjct  16    FIVLNTLWLFPELASS--AGITRHYKFNIKLQNVTRLCHTKSIVSVNGQFPGPHIIAREG  73

Query  314   DRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTL  493
             DRV+VKVVNHV NNV+IHWHG+RQ+R+GWADGPAY+TQCPIQTGQTYVYNFTI GQRGTL
Sbjct  74    DRVVVKVVNHVQNNVTIHWHGVRQLRSGWADGPAYVTQCPIQTGQTYVYNFTITGQRGTL  133

Query  494   FWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGG  673
             FWHAHISWLR+TL+GPIIILP+KN  YPF KP+KEVP+IFGEWWN D EAV++QALQNGG
Sbjct  134   FWHAHISWLRSTLYGPIIILPKKNVPYPFFKPYKEVPIIFGEWWNADPEAVITQALQNGG  193

Query  674   GPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTV  853
             GPN+SDAYTINGLPGPLYNCSA +TFK+KVKPGKTYLLR+INAALNDELFF IANHT+TV
Sbjct  194   GPNVSDAYTINGLPGPLYNCSAQDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTLTV  253

Query  854   VEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAG  1033
             V+ DA YVKPF+TD ++I PGQT N+LLK K + P +TF MAA PY TG+GTFDNSTVAG
Sbjct  254   VDVDAIYVKPFKTDTILITPGQTTNLLLKAKPHFPNATFLMAAXPYATGRGTFDNSTVAG  313

Query  1034  VLEYEIP---SLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVD  1204
             +L YE P   S + S     P+  P LPP+N TSF +NFTGKLRSL N+QFPANVPQ VD
Sbjct  314   ILHYEPPPKSSXSASSFKNLPLFKPTLPPLNDTSFAANFTGKLRSLANTQFPANVPQKVD  373

Query  1205  KNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYAT  1381
             + FFFT          NQTCQGP N T F+AS+NNVSFV PTTAILQA++ ++S GVY T
Sbjct  374   QRFFFT----------NQTCQGPTNITMFSASVNNVSFVLPTTAILQAHFFQQSKGVYTT  423

Query  1382  DFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYN  1561
             DFP+ P+ PFNYTGTPPNNT V N TKVVVLPFN +VELVLQDTSILG ESHPLHLHG+N
Sbjct  424   DFPTTPIFPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVLQDTSILGIESHPLHLHGFN  483

Query  1562  FYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVH  1741
             F+VVGQGFGNFD KKD   +NLVDPVERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH
Sbjct  484   FFVVGQGFGNFDSKKDSPKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVH  543

Query  1742  LSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
              SWGL+MAWIV +GKLPNQKL PPPSDLPKC
Sbjct  544   TSWGLKMAWIVMDGKLPNQKLPPPPSDLPKC  574



>ref|XP_010256880.1| PREDICTED: laccase-4-like [Nelumbo nucifera]
Length=583

 Score =   853 bits (2205),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/558 (74%), Positives = 472/558 (85%), Gaps = 4/558 (1%)
 Frame = +2

Query  173   AVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPN  352
             A+    S+TRHYKF+IR+QNVTRLC TKSI TVNG+FPGPRI+AREGDRV+VKV+NHV +
Sbjct  26    ALLVQASITRHYKFDIRLQNVTRLCQTKSIATVNGQFPGPRIVAREGDRVVVKVINHVQH  85

Query  353   NVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATL  532
             NV++HWHGIRQ+++GWADGPAY+TQCPIQTGQ YVYNFTI GQ GTLFWHAHISWLRATL
Sbjct  86    NVTLHWHGIRQLQSGWADGPAYVTQCPIQTGQAYVYNFTISGQTGTLFWHAHISWLRATL  145

Query  533   HGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGL  712
             +GPIIILP+ N SYPFPKP+KEV MIFGEWWN D EAV++QALQ GGGPN+SDAYTINGL
Sbjct  146   YGPIIILPKPNASYPFPKPYKEVTMIFGEWWNADPEAVITQALQTGGGPNVSDAYTINGL  205

Query  713   PGPLYNCSANETFKVKVKPG-KTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFE  889
             PGP YNCSA +TFK+KVKPG K YLLR+INAALNDELFF IANH++TVVEADA YVKPF+
Sbjct  206   PGPFYNCSARDTFKLKVKPGGKIYLLRLINAALNDELFFSIANHSLTVVEADAVYVKPFD  265

Query  890   TDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNIS  1069
             TD LVI PGQT NVL+KTK + P +TF MAARPYF+G GTFDNST AG+LEY+ PS N S
Sbjct  266   TDNLVITPGQTTNVLVKTKPHFPSATFLMAARPYFSGLGTFDNSTTAGILEYQKPSYNSS  325

Query  1070  ---KNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTN  1240
                 N   P+  P LP I  TS VSNFT + RSL  +QFPANVPQ+VDK FFFTVG+G+ 
Sbjct  326   VSINNKQLPLFQPTLPAITDTSVVSNFTNRFRSLATAQFPANVPQSVDKRFFFTVGIGSI  385

Query  1241  PCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYT  1420
             PCP+NQTCQGPNG K A  +NN+SFV PTTAIL+A++  +S GVY TDFP+ P  PFNYT
Sbjct  386   PCPQNQTCQGPNGIKLAGYVNNISFVLPTTAILEAHFLGQSKGVYTTDFPTNPPFPFNYT  445

Query  1421  GTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDP  1600
             GTPPNNT V   TK  VLPFN +VELV+Q TS LG E+HPLHLHG+NF+VVGQGFGNFDP
Sbjct  446   GTPPNNTMVTTGTKAAVLPFNTSVELVMQGTSTLGTENHPLHLHGFNFFVVGQGFGNFDP  505

Query  1601  KKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKE  1780
              KDP N+NLVDP+ERNT+GVP+GGW AIRF ADNPG WFMHCHFE H SWGLRM WIV +
Sbjct  506   NKDPPNFNLVDPIERNTVGVPAGGWIAIRFLADNPGAWFMHCHFEAHTSWGLRMVWIVLD  565

Query  1781  GKLPNQKLLPPPSDLPKC  1834
             GKLPN+KL PPPSDLPKC
Sbjct  566   GKLPNKKLPPPPSDLPKC  583



>ref|XP_008803092.1| PREDICTED: laccase-17-like [Phoenix dactylifera]
Length=577

 Score =   853 bits (2205),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/551 (72%), Positives = 476/551 (86%), Gaps = 3/551 (1%)
 Frame = +2

Query  188   GSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIH  367
              S+TRHYKF+I+MQNVTRLCHT+SI TVNG+FPGP+I+AREGDRV+V+VVNHV NNV+IH
Sbjct  28    ASITRHYKFDIKMQNVTRLCHTRSIATVNGRFPGPKIVAREGDRVIVRVVNHVKNNVTIH  87

Query  368   WHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPII  547
             WHG+RQ+R GWADGPAY+TQCPIQTGQ+YVYNFTI+GQRGTLFWHAHISW+R TL+GPI+
Sbjct  88    WHGVRQLRTGWADGPAYMTQCPIQTGQSYVYNFTILGQRGTLFWHAHISWMRVTLYGPIV  147

Query  548   ILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLY  727
             ILP++   YPF KP+KE+P+IFGEW+NVD EAV++QAL+ G GPN+SDAYTINGLPGPLY
Sbjct  148   ILPKRGVPYPFAKPYKEIPIIFGEWFNVDAEAVIAQALRTGAGPNVSDAYTINGLPGPLY  207

Query  728   NCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVI  907
             NCS  +TFK+KVKPGKTYLLRMINAALNDELFF IA+H +TVVE DA Y KPF TD+++I
Sbjct  208   NCS-KDTFKLKVKPGKTYLLRMINAALNDELFFSIADHNLTVVEVDAIYTKPFNTDIVLI  266

Query  908   APGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKP  1087
              PGQT NVLL+TK + P +TF MAARPY TG GTFDN+T AG+LEY  P+ ++     + 
Sbjct  267   TPGQTTNVLLQTKPSLPSATFLMAARPYATGLGTFDNTTTAGLLEYLPPTFSLPSTLAEN  326

Query  1088  IAL--PPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQT  1261
             +AL  P LP +N T+F ++F+ K+RSL N+QFPANVPQTVD+ F+FTVGLGT+PCP+NQT
Sbjct  327   LALLKPTLPSLNDTAFAASFSSKVRSLANAQFPANVPQTVDRRFYFTVGLGTSPCPRNQT  386

Query  1262  CQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNT  1441
             CQGPNGTKFAAS+NN+SF  P+T +L++++  +S GVY TDFP+ P  PFNYTGTPPNNT
Sbjct  387   CQGPNGTKFAASVNNISFALPSTPLLESHFLGQSKGVYTTDFPNNPPFPFNYTGTPPNNT  446

Query  1442  QVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANY  1621
              V N TKVVVLPFN +VELV+QDTSI GAESHPLHLHGYNF+VVG+G GN+D  KDPA +
Sbjct  447   FVTNGTKVVVLPFNTSVELVMQDTSIQGAESHPLHLHGYNFFVVGRGSGNYDASKDPAKF  506

Query  1622  NLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQK  1801
             NL DP+E NT+GVP+GGW AIRFRADNPGVWFMHCH +VH SWGL MAW V +G LP+QK
Sbjct  507   NLADPIEMNTVGVPAGGWVAIRFRADNPGVWFMHCHLDVHTSWGLGMAWAVNDGMLPSQK  566

Query  1802  LLPPPSDLPKC  1834
             LLPPPSDLPKC
Sbjct  567   LLPPPSDLPKC  577



>emb|CDP06596.1| unnamed protein product [Coffea canephora]
Length=578

 Score =   853 bits (2205),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/569 (70%), Positives = 472/569 (83%), Gaps = 9/569 (2%)
 Frame = +2

Query  98    FHAF-PPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVN  274
             FH F PP        +   +   P  A+      TRHY FNI   NVTRLCHTKSIV+VN
Sbjct  7     FHHFSPPHYLPILFFVCCVVSLLPKPALC----ATRHYTFNIVQHNVTRLCHTKSIVSVN  62

Query  275   GKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTY  454
             G+FPGPR++AREGD++++KVVNHV NN++IHWHG+RQ+R GWADGPAY+TQCPIQTG TY
Sbjct  63    GQFPGPRLVAREGDQLIIKVVNHVANNITIHWHGVRQLRTGWADGPAYVTQCPIQTGHTY  122

Query  455   VYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVD  634
              YNFT+ G RGTLFWHAHISWLR+T++GP+II PR+N SYPF KP+KEVP++FGEWWN D
Sbjct  123   TYNFTLTGHRGTLFWHAHISWLRSTVYGPLIIFPRRNESYPFEKPYKEVPIMFGEWWNAD  182

Query  635   TEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALND  814
              EAV+SQALQ GG PN+SDAYTINGLPGPLYNCS  +TFK+KV+PGKTY+LR+INAA+ND
Sbjct  183   PEAVISQALQTGGAPNVSDAYTINGLPGPLYNCSHKDTFKLKVQPGKTYMLRLINAAMND  242

Query  815   ELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYF  994
             EL+F IANH+VTVVEADA YVKPF+TD++VI PGQT NVLLKTK   P +TF MAA PYF
Sbjct  243   ELYFSIANHSVTVVEADALYVKPFKTDVVVITPGQTTNVLLKTKPTSPTATFIMAAAPYF  302

Query  995   TGQGTFDNSTVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQ  1174
             TGQGT DNSTVAG+LEY+    + +  + K +  P LP +N TSFV+NFT K RSL  ++
Sbjct  303   TGQGTIDNSTVAGILEYQ----HDASIANKTVVNPTLPAVNATSFVANFTRKFRSLATAK  358

Query  1175  FPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYS  1354
             FPANVPQTV K F+FT+GLGT+PCP N TCQGPNGTKFAAS+NN+SF  P+TA+LQ+Y+ 
Sbjct  359   FPANVPQTVQKRFYFTIGLGTSPCPANTTCQGPNGTKFAASVNNISFPLPSTALLQSYFF  418

Query  1355  RKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAES  1534
              KSNGV+ TDFP+ P  P+NYTGTPPNNT V NAT+ VVL FN +VE+VLQDTSILGAES
Sbjct  419   GKSNGVFTTDFPTQPTNPYNYTGTPPNNTIVTNATRTVVLQFNTSVEVVLQDTSILGAES  478

Query  1535  HPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVW  1714
             HPLHLHG+NF+VVG+GFGN+DP KDPAN+NLVDPVERNT+G+PSGGW AIRF ADNPGVW
Sbjct  479   HPLHLHGFNFFVVGEGFGNYDPNKDPANFNLVDPVERNTVGIPSGGWLAIRFFADNPGVW  538

Query  1715  FMHCHFEVHLSWGLRMAWIVKEGKLPNQK  1801
              MHCHF+VH SWGLRMAWIV  G LPN+K
Sbjct  539   LMHCHFDVHTSWGLRMAWIVLNGFLPNEK  567



>ref|XP_007026975.1| Laccase 17 [Theobroma cacao]
 gb|EOY07477.1| Laccase 17 [Theobroma cacao]
Length=583

 Score =   853 bits (2205),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/584 (69%), Positives = 475/584 (81%), Gaps = 2/584 (0%)
 Frame = +2

Query  86    MGFLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIV  265
             MG +         A FL  + +++  P +A+AKH  +TRHYKFNIRMQNVTRLC TKSIV
Sbjct  1     MGSVLLTSSAFFRALFLA-LCAVWLLPDLALAKHAGITRHYKFNIRMQNVTRLCQTKSIV  59

Query  266   TVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTG  445
             TVNG+FPGPRI+AREGDR+L+KVVNHV  NV++HWHGIRQ+R GWADGPAYITQCPIQTG
Sbjct  60    TVNGQFPGPRIIAREGDRLLIKVVNHVQYNVTLHWHGIRQLRTGWADGPAYITQCPIQTG  119

Query  446   QTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWW  625
             Q+YVYNFTI GQRGTLFWHAHISWLRATL+GPI+ILP+++ S+PFP+P KEVP+IFGEWW
Sbjct  120   QSYVYNFTITGQRGTLFWHAHISWLRATLYGPIVILPKRHASFPFPQPFKEVPIIFGEWW  179

Query  626   NVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAA  805
               DTE +++QA+  GG PNISDA+TINGLPGP YNCSA ETFK+KVKPGKTYLLR+INAA
Sbjct  180   KADTETIINQAMATGGAPNISDAFTINGLPGPSYNCSAKETFKLKVKPGKTYLLRLINAA  239

Query  806   LNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAAR  985
             LNDELFFRIANHTVTVVEADA YVKPF+TD+++I PGQT NVLLK K   P + F ++AR
Sbjct  240   LNDELFFRIANHTVTVVEADAVYVKPFKTDIVLITPGQTTNVLLKAKSKAPGANFALSAR  299

Query  986   PYFTGQGTFDNSTVAGVLEYE-IPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSL  1162
             PY TG  TFDN+T  G+LEYE   S + SKN   P+    LP  N +++   F  KLRSL
Sbjct  300   PYATGIATFDNTTTIGILEYEKSASASNSKNKKLPLLKAKLPQFNDSTYAMKFNQKLRSL  359

Query  1163  GNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQ  1342
               ++FP  V + VD+ FFFTVGLG  PC +NQTCQGPN T+ AA++NNVSFV P  A+LQ
Sbjct  360   ATTKFPVKVSKNVDRRFFFTVGLGILPCSQNQTCQGPNNTRPAAAVNNVSFVQPNIALLQ  419

Query  1343  AYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSIL  1522
             A++  +S GVY T+FP+ P   FNYTGTPP N  + + TKVVVLPFN +VELV+QDTSIL
Sbjct  420   AHFFNRSKGVYTTNFPANPPFKFNYTGTPPRNIMLDSGTKVVVLPFNTSVELVMQDTSIL  479

Query  1523  GAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADN  1702
             GAESHPLHLHG+NF+V+GQG GNFDPKKDPA +NLVDP ERNT+GVPSGGW AIRF ADN
Sbjct  480   GAESHPLHLHGFNFFVLGQGVGNFDPKKDPAKFNLVDPAERNTVGVPSGGWVAIRFLADN  539

Query  1703  PGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             PGVWFMHCH EVH SWGL+MAW+V +GK   QKLLPPP+DLPKC
Sbjct  540   PGVWFMHCHLEVHTSWGLKMAWVVNDGKGRKQKLLPPPADLPKC  583



>ref|XP_010414436.1| PREDICTED: laccase-2 isoform X3 [Camelina sativa]
Length=591

 Score =   853 bits (2204),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/579 (69%), Positives = 479/579 (83%), Gaps = 7/579 (1%)
 Frame = +2

Query  119   LAACFL--MIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGP  292
             +A C L  +++  L    +   A    +TRHY+F+I+++N+TRLC TK+IVTVNGKFPGP
Sbjct  13    MATCVLHYLLVAFLIAISYNIDAASAGITRHYQFDIQLKNITRLCKTKTIVTVNGKFPGP  72

Query  293   RIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTI  472
             ++ AREGD + +KVVNHV NN+SIHWHGIRQ+R+GWADGP+Y+TQCPI+TGQ+YVYNFT+
Sbjct  73    KVTAREGDNLQIKVVNHVSNNISIHWHGIRQLRSGWADGPSYVTQCPIRTGQSYVYNFTV  132

Query  473   VGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVS  652
              GQRGTL+WHAHI W+RAT++GP+IILP+ + SYPFPKP+K+VP+IFGEW+N D +AV+ 
Sbjct  133   TGQRGTLWWHAHIQWMRATVYGPLIILPKLHQSYPFPKPYKQVPIIFGEWFNADPQAVLQ  192

Query  653   QALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRI  832
             QALQ GGGPN SDA+T NGLPGPLYNCS  +T+K+ VKPGKTYLLR+INAALNDELFF I
Sbjct  193   QALQTGGGPNASDAHTFNGLPGPLYNCSTKDTYKLMVKPGKTYLLRLINAALNDELFFTI  252

Query  833   ANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTF  1012
             ANHT+TVVEADA YVKPF+T+++++ PGQT NVLLKTK + P +TF+M ARPYFT QGT 
Sbjct  253   ANHTLTVVEADASYVKPFQTNIVLLGPGQTTNVLLKTKPSNPNATFYMLARPYFTSQGTI  312

Query  1013  DNSTVAGVLEYE---IPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPA  1183
             DN+TVAG+L+YE     S N+S      I  P LPPIN TS+ +NFT   RSL +S FPA
Sbjct  313   DNTTVAGILQYEPHSKSSKNLSIIKNLSIIKPSLPPINSTSYAANFTKMFRSLASSTFPA  372

Query  1184  NVPQTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPT-TAILQAYYSR  1357
             NVP++VDK +FFTVGLGTNPCPKNQTCQGP N TKFAAS+NNVSF+ P  T++LQ+Y++ 
Sbjct  373   NVPKSVDKKYFFTVGLGTNPCPKNQTCQGPTNTTKFAASINNVSFILPNKTSLLQSYFTG  432

Query  1358  KSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESH  1537
             KS  V+ TDFPS P+ PFNYTGTPPNNT V   TKVVVL +N TVELVLQ TSILG E+H
Sbjct  433   KSKSVFMTDFPSAPIFPFNYTGTPPNNTMVSRGTKVVVLKYNTTVELVLQGTSILGIEAH  492

Query  1538  PLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWF  1717
             P+HLHG+NFYVVGQGFGNF+P  DP  YNLVDPVERNTI VPSGGW AIRF ADNPGVW 
Sbjct  493   PIHLHGFNFYVVGQGFGNFNPASDPKQYNLVDPVERNTINVPSGGWVAIRFLADNPGVWL  552

Query  1718  MHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             MHCH E+HLSWGL MAW+V +G LPNQKLLPPPSD PKC
Sbjct  553   MHCHIEIHLSWGLTMAWVVLDGDLPNQKLLPPPSDYPKC  591



>ref|XP_010245131.1| PREDICTED: laccase-17-like [Nelumbo nucifera]
Length=589

 Score =   852 bits (2202),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/582 (69%), Positives = 486/582 (84%), Gaps = 11/582 (2%)
 Frame = +2

Query  116   LLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPR  295
             +L    +M+M++L+  P + VA++   TR+YKF+I++Q VTRLCHTKSIVTVNG FPGP+
Sbjct  10    ILMGALIMVMSTLWPLPELIVAEYSGKTRYYKFDIKLQTVTRLCHTKSIVTVNGLFPGPQ  69

Query  296   IMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIV  475
             I A+EGDR+L++VVNHVPNN+++HWHGIRQ+ +GWADGPAY+TQCPIQTGQTYVYNFTI+
Sbjct  70    ITAQEGDRLLIEVVNHVPNNITLHWHGIRQLGSGWADGPAYVTQCPIQTGQTYVYNFTII  129

Query  476   GQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQ  655
             GQRGTL WHAHISWLR+TL+GPIII+P+ + SYPF  P+KEVP+I GEWWN D EA++S+
Sbjct  130   GQRGTLLWHAHISWLRSTLYGPIIIIPKPDDSYPFANPYKEVPIILGEWWNGDPEAIISE  189

Query  656   ALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIA  835
             ALQ G GPN+SDAYTINGLPGPLYNCSA +TFK+ VK GKTYLLRMINAAL++ELFF IA
Sbjct  190   ALQAGRGPNVSDAYTINGLPGPLYNCSAKDTFKLTVKTGKTYLLRMINAALDEELFFSIA  249

Query  836   NHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFD  1015
             NH++TVVE DA YVKPF TD L+IAPGQT NVLL+TK + P +TFFMAARPYFTG GTFD
Sbjct  250   NHSLTVVEVDAVYVKPFHTDTLLIAPGQTTNVLLETKPDYPKATFFMAARPYFTGSGTFD  309

Query  1016  NSTVAGVLEYEIPSLNISKNSTKPIALPP---------LPPINGTSFVSNFTGKLRSLGN  1168
             NST AG+LEYE  + +I  NS   I++ P         LPP+N  + V++F   LRSL  
Sbjct  310   NSTAAGILEYEYQAPSI--NSPSLISISPKDIPLLKPSLPPLNDIALVTSFQKSLRSLAT  367

Query  1169  SQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAY  1348
             +QFP NVPQTVD+ FFFTVGLGT PCPKN+TCQGPNG +F+AS+NNVSF  PTTA+LQA+
Sbjct  368   TQFPCNVPQTVDRRFFFTVGLGTRPCPKNRTCQGPNGAQFSASVNNVSFTLPTTALLQAH  427

Query  1349  YSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGA  1528
             +  ++NG+Y TDFP+ P   F+YTGTPP++T V   TKVV L FN +VELV+QDTS+LG 
Sbjct  428   FFGQANGIYTTDFPTNPPFSFDYTGTPPHDTVVNCGTKVVELAFNTSVELVMQDTSLLGT  487

Query  1529  ESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPG  1708
             +SHPLHLHG+NF+VVGQGFGN+DP K P N+NLVDPVERNT+GVPSGGW A+RF ADNPG
Sbjct  488   DSHPLHLHGFNFFVVGQGFGNYDPNKHPPNFNLVDPVERNTVGVPSGGWVAVRFLADNPG  547

Query  1709  VWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             VWFMHCH E+H SWGLRMAW+V +G+LP QKL PPPSDLPKC
Sbjct  548   VWFMHCHLELHTSWGLRMAWVVMDGELPRQKLPPPPSDLPKC  589



>ref|XP_009338594.1| PREDICTED: laccase-17-like [Pyrus x bretschneideri]
 ref|XP_009338602.1| PREDICTED: laccase-17-like [Pyrus x bretschneideri]
Length=585

 Score =   852 bits (2202),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/585 (69%), Positives = 475/585 (81%), Gaps = 2/585 (0%)
 Frame = +2

Query  86    MGFLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIV  265
             MGF   +      A F ++   L  FP  A AKH   TRHYKF+I++QNVTRLC TKSIV
Sbjct  1     MGFSLPSSTAFSMAIFFVVCAFLCMFPEPAFAKHARFTRHYKFDIKLQNVTRLCQTKSIV  60

Query  266   TVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTG  445
             TVNG+FPGPRI+AREGDR+++KVVNHV +N+++HWHG+RQ+++GWADGPAYITQCPIQ G
Sbjct  61    TVNGQFPGPRIIAREGDRLVIKVVNHVQHNLTLHWHGVRQMKSGWADGPAYITQCPIQIG  120

Query  446   QTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWW  625
             Q+Y+YNFTI GQRGTLFWHAHISWLRAT++GPI+ILP+++  YPFP+P KEVP+IFGEWW
Sbjct  121   QSYIYNFTITGQRGTLFWHAHISWLRATVYGPIVILPKRHVPYPFPQPFKEVPIIFGEWW  180

Query  626   NVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAA  805
               DTE V+SQALQ G GPN+SDAYTINGLPGPLYNCSA +T+K+KVKPGKTYLLR+INAA
Sbjct  181   KADTETVISQALQTGLGPNVSDAYTINGLPGPLYNCSAKDTYKLKVKPGKTYLLRLINAA  240

Query  806   LNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAAR  985
             LNDELFF IANHT+TVVEADA YVKPF+T  ++I PGQT NVLL+TK   P + F MAAR
Sbjct  241   LNDELFFSIANHTLTVVEADAVYVKPFKTQTVLITPGQTTNVLLRTKFKSPNAKFVMAAR  300

Query  986   PYFTGQGTFDNSTVAGVLEYEIPSLNI-SKNSTKPIALPPLPPINGTSFVSNFTGKLRSL  1162
             PY +G   FDNST  G+LEYE+ S +  +KN  K +  P LP +N T F   +  K+ SL
Sbjct  301   PYVSGPAAFDNSTTTGLLEYEVASSSTNNKNKKKQLFTPVLPKLNDTLFSMKYNKKILSL  360

Query  1163  GNSQFP-ANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAIL  1339
              N +FP ANVP+TV K+FFFTVGLG  PC KNQTCQGPN T+ AA++NNV+FV P TA+L
Sbjct  361   ANPKFPAANVPKTVQKHFFFTVGLGVLPCSKNQTCQGPNNTRLAAAINNVTFVQPNTALL  420

Query  1340  QAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSI  1519
             QA++  +S GVY TDFP+ P   FNYTG+PP+N  V + TKVVVLPFN TVE+VLQDTSI
Sbjct  421   QAHFFNQSKGVYTTDFPANPAFKFNYTGSPPSNIAVSSGTKVVVLPFNTTVEVVLQDTSI  480

Query  1520  LGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRAD  1699
             +GAESHPLHLHG+NF+V+G G GNFDPK DP  YNLVDP ERNT+GVPSGGW AIRF AD
Sbjct  481   IGAESHPLHLHGFNFFVLGLGSGNFDPKNDPKKYNLVDPAERNTVGVPSGGWVAIRFLAD  540

Query  1700  NPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             NPGVWFMHCH EVH SWGL+MAW+V +GK  NQKL PPPSDLPKC
Sbjct  541   NPGVWFMHCHLEVHTSWGLKMAWVVLDGKRRNQKLPPPPSDLPKC  585



>ref|XP_009388612.1| PREDICTED: laccase-4-like [Musa acuminata subsp. malaccensis]
Length=539

 Score =   852 bits (2201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/539 (73%), Positives = 459/539 (85%), Gaps = 2/539 (0%)
 Frame = +2

Query  224   MQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWA  403
             M +VTRLC+TKSI+TVNG++PGP I AR+GDRV+V VVNHV +NV+IHWHG+RQ+R+GWA
Sbjct  1     MADVTRLCYTKSIITVNGQYPGPTIFARDGDRVIVDVVNHVRDNVTIHWHGVRQLRSGWA  60

Query  404   DGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFP  583
             DGPAY+TQCPIQ+GQ+YVYNFTIVGQRGTLFWHAHISWLR TLHG IIILP     YPF 
Sbjct  61    DGPAYVTQCPIQSGQSYVYNFTIVGQRGTLFWHAHISWLRTTLHGAIIILPELGVPYPFI  120

Query  584   KPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKV  763
             +P+KEVP+IFGEWW  DTE V+SQAL+NGG PNISDA+TINGLPGPLYNCS  +TFK+ V
Sbjct  121   EPYKEVPVIFGEWWKADTEVVISQALENGGEPNISDAFTINGLPGPLYNCSVKDTFKLMV  180

Query  764   KPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKT  943
              PGK+YLLR+INAALNDELFF IANHTVTVVE DAGYVKPFE D ++I+PGQTMNVLL  
Sbjct  181   SPGKSYLLRLINAALNDELFFSIANHTVTVVEVDAGYVKPFEADTILISPGQTMNVLLDA  240

Query  944   KDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKPIAL--PPLPPIN  1117
             K N P + F M+ARPY TG G FDN+TVA +L+Y  PS + S   +K +AL  P LP  N
Sbjct  241   KPNYPNAIFSMSARPYSTGSGAFDNTTVAAILKYRNPSNSSSAGFSKELALYIPVLPAFN  300

Query  1118  GTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAAS  1297
              TSF +NFTGKLRSL  +Q+PANVPQTVD+ FFFTVGLGT+PCP NQTCQGPNGTKF+++
Sbjct  301   DTSFAANFTGKLRSLATAQYPANVPQTVDRRFFFTVGLGTDPCPTNQTCQGPNGTKFSST  360

Query  1298  LNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLP  1477
             +NN+SF  PTTA+LQA++  +S GVY  DFP+ PL PF+YTGTPPNNT V + TK++VLP
Sbjct  361   VNNISFTEPTTALLQAHFFGQSEGVYTPDFPAFPLMPFDYTGTPPNNTNVSHGTKLLVLP  420

Query  1478  FNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIG  1657
             FN +VELV+QDTSILG ESHPLHLHGYNF+VVG+GFGNFDP  DPA +NLVDPVERNT+G
Sbjct  421   FNTSVELVMQDTSILGTESHPLHLHGYNFFVVGEGFGNFDPASDPAEFNLVDPVERNTVG  480

Query  1658  VPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             VP GGW AIRF ADNPGVWFMHCH E+HLSWGL MAW+V +G LPNQKL PPPSDLPKC
Sbjct  481   VPDGGWVAIRFLADNPGVWFMHCHIEIHLSWGLTMAWLVLDGALPNQKLPPPPSDLPKC  539



>ref|XP_009414328.1| PREDICTED: laccase-17-like [Musa acuminata subsp. malaccensis]
Length=582

 Score =   852 bits (2200),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/552 (74%), Positives = 480/552 (87%), Gaps = 3/552 (1%)
 Frame = +2

Query  188   GSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIH  367
             GS TR YKF+IR+QNVTRLC T+SIVTVNGKFPGP+IMAREGDRV+VKVVNHV NNV+IH
Sbjct  31    GSTTRRYKFDIRLQNVTRLCRTRSIVTVNGKFPGPKIMAREGDRVVVKVVNHVTNNVTIH  90

Query  368   WHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPII  547
             WHG+RQ+R GW DGPAY+TQCPI+TGQ++VYNFTIVGQRGTLFWHAHISW+RATL+GPI+
Sbjct  91    WHGVRQLRTGWYDGPAYVTQCPIRTGQSFVYNFTIVGQRGTLFWHAHISWMRATLYGPIV  150

Query  548   ILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLY  727
             ILP++   YPFPKP+KE+P+IFGEW+NVD EA+++QAL+ G GPNISDAYTINGLPGPLY
Sbjct  151   ILPKRGVPYPFPKPYKEIPVIFGEWFNVDPEAIIAQALRTGAGPNISDAYTINGLPGPLY  210

Query  728   NCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVI  907
             NCS  +TF++KVKPGKTYLLRMINAALNDELFF IANHT+TVV+ DA YVKPFE D++ I
Sbjct  211   NCSKKDTFELKVKPGKTYLLRMINAALNDELFFSIANHTLTVVDVDAVYVKPFEADIVHI  270

Query  908   APGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKP  1087
             APGQT NVLL TK +PP +TF MAARPY TG GTFDN+T AG+L Y  P+ + S +  K 
Sbjct  271   APGQTTNVLLHTKPSPPDATFLMAARPYATGSGTFDNTTTAGLLVYLPPNASSSSSHVKN  330

Query  1088  IAL--PPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQT  1261
             +AL  P LP +N T++ +N+TGKLRSL ++QFPANVP+TV++ F+FTVGLGT+PC KNQT
Sbjct  331   LALFRPTLPALNDTAYTTNYTGKLRSLASAQFPANVPKTVERRFYFTVGLGTSPCAKNQT  390

Query  1262  CQGPNGTKFAASLNNVSFVTPTT-AILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNN  1438
             CQGPNGTKFAAS+NN+SF  PT+ A+LQA+Y  ++ GVY TDFP  P  PFNYTGTPPN+
Sbjct  391   CQGPNGTKFAASVNNISFALPTSAALLQAHYFGQTKGVYDTDFPDTPPFPFNYTGTPPND  450

Query  1439  TQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPAN  1618
             T V NATKVVVLPFN +VELV+QDTSI GAESHPLHLHG+NF+VVG GFGN+DP KDP  
Sbjct  451   TFVTNATKVVVLPFNTSVELVMQDTSIQGAESHPLHLHGFNFFVVGTGFGNYDPSKDPRR  510

Query  1619  YNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQ  1798
             +NL DP+ERNT+GVP GGW AIRF ADNPGVWFMHCH EVH SWGLRMAW+V +G LPNQ
Sbjct  511   FNLADPIERNTVGVPVGGWVAIRFLADNPGVWFMHCHLEVHTSWGLRMAWVVNDGWLPNQ  570

Query  1799  KLLPPPSDLPKC  1834
             KL+PPPSDLP+C
Sbjct  571   KLVPPPSDLPRC  582



>gb|AAB17191.1| laccase [Liriodendron tulipifera]
Length=570

 Score =   852 bits (2200),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/556 (73%), Positives = 485/556 (87%), Gaps = 1/556 (0%)
 Frame = +2

Query  167   HMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHV  346
              +A A H   T HYKF++++++V RLC+ KSI+TVNG+FPGP+++AREGDRV+V+VVN+V
Sbjct  16    ELAFATHTGSTWHYKFDVQLKSVKRLCNRKSILTVNGRFPGPKLVAREGDRVVVEVVNNV  75

Query  347   PNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRA  526
              NNV++HWHGIRQ++NGWADGP+YITQCPIQTGQTYVYNFTIVGQRGTLFWHAH SWLRA
Sbjct  76    QNNVTVHWHGIRQLQNGWADGPSYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHFSWLRA  135

Query  527   TLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTIN  706
             TL+GP+I+LP +N +YPF KP KEVP+IFGEWWN +TEAV++Q+LQ G GPN+SDAYTIN
Sbjct  136   TLYGPLIVLPMQNATYPFGKPDKEVPIIFGEWWNANTEAVINQSLQTGAGPNVSDAYTIN  195

Query  707   GLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPF  886
             G+PGPLYNCSA +TFK+KVKPGKTYLLR+INAALNDELFF IA+HT+TVVE DA YVKPF
Sbjct  196   GMPGPLYNCSAKDTFKLKVKPGKTYLLRLINAALNDELFFGIASHTITVVEVDATYVKPF  255

Query  887   ETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNI  1066
                +L+I PGQT NVLLK K   P +TFFM+ARPY TG GTFDN+T  G+LEY+ P+ ++
Sbjct  256   NMKILLIGPGQTTNVLLKAKPYYPNATFFMSARPYATGLGTFDNTTTVGLLEYQRPNSSL  315

Query  1067  SKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPC  1246
             S    + I    LP +N T++ + ++ +LRSL N+QFPANVPQTVDK+FFFT+GL  +PC
Sbjct  316   SSTKLQ-IFKASLPALNDTAYAAKYSQRLRSLANAQFPANVPQTVDKHFFFTIGLSADPC  374

Query  1247  PKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGT  1426
             PKNQTCQGPNGTKF+AS+NN+SFV PTTA+LQA++  +SNGVY T FP+ PL PFNYTGT
Sbjct  375   PKNQTCQGPNGTKFSASMNNISFVLPTTALLQAHFFGQSNGVYNTTFPNNPLFPFNYTGT  434

Query  1427  PPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKK  1606
             PPNNT V + TKVVV+PFN +VE+VLQ+TSILG ESH LHLHGYNF+VVGQGFGNFDP K
Sbjct  435   PPNNTFVSHGTKVVVIPFNTSVEVVLQNTSILGMESHLLHLHGYNFFVVGQGFGNFDPDK  494

Query  1607  DPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGK  1786
             DPA +NLVDP+ERNT+GVPSGGWAAIRFRADNPGVWFMHCHF+VHLSWGL+MAW+V +GK
Sbjct  495   DPAKFNLVDPIERNTVGVPSGGWAAIRFRADNPGVWFMHCHFDVHLSWGLKMAWVVLDGK  554

Query  1787  LPNQKLLPPPSDLPKC  1834
             LPNQKLLPPPSDLPKC
Sbjct  555   LPNQKLLPPPSDLPKC  570



>ref|XP_009338597.1| PREDICTED: laccase-17-like [Pyrus x bretschneideri]
 ref|XP_009338600.1| PREDICTED: laccase-17-like [Pyrus x bretschneideri]
Length=586

 Score =   851 bits (2198),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/581 (69%), Positives = 472/581 (81%), Gaps = 18/581 (3%)
 Frame = +2

Query  116   LLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPR  295
             L + C + ++T  F            +TRHY FNI+  NVTRLC+T+SIV+VN KFPGPR
Sbjct  16    LFSFCVVALLTPEF---------ASGITRHYTFNIKYHNVTRLCNTRSIVSVNKKFPGPR  66

Query  296   IMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIV  475
             ++AREGD+VL+KV+NHV NNV+IHWHG++Q+R+GWADGPAYITQCPIQ GQ+Y YNFTI 
Sbjct  67    LVAREGDKVLIKVINHVSNNVTIHWHGVKQLRSGWADGPAYITQCPIQMGQSYTYNFTIQ  126

Query  476   GQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQ  655
             GQRGTL WHAHISWLR+T++GPIIILP++N SYPF KP+KEVP+I GEW+NVD EAV++Q
Sbjct  127   GQRGTLLWHAHISWLRSTIYGPIIILPKRNESYPFVKPYKEVPIILGEWFNVDPEAVINQ  186

Query  656   ALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIA  835
             ALQ G GPN+SDA+TINGLPGPLYNCS+ + FK+KVKPGKTYLLR+INAALNDELFF IA
Sbjct  187   ALQTGAGPNVSDAFTINGLPGPLYNCSSKDVFKLKVKPGKTYLLRLINAALNDELFFSIA  246

Query  836   NHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFD  1015
             NHT+TVVEADA Y KPFETD L+I PGQT NVLLKTK N P +TF + A PYFTG GT D
Sbjct  247   NHTLTVVEADAVYTKPFETDTLLITPGQTTNVLLKTKPNSPNATFLILASPYFTGGGTLD  306

Query  1016  NSTVAGVLEYEIPSLNISKNSTK--PIALPPLPPINGTSFVS------NFTGKLRSLGNS  1171
             N+T AG+LEYE P +     S K  P+  P LPP N T FV+      N   K RSL + 
Sbjct  307   NTTTAGILEYEHP-ITTRHTSIKNLPLFKPSLPPFNATKFVNVTQFVQNLAKKFRSLASK  365

Query  1172  QFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYY  1351
             +FPANVPQTVDK FFFTVGLGT PCP+N TCQGPNG KFAAS+NN SF  P+TA+LQA++
Sbjct  366   KFPANVPQTVDKKFFFTVGLGTAPCPQNSTCQGPNGLKFAASVNNFSFALPSTAMLQAHF  425

Query  1352  SRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAE  1531
             S +SNGVY TDFP+ PL  FNYTGTPPN+T V N TK +VLPFN +VELVLQDTSILGAE
Sbjct  426   SGQSNGVYTTDFPANPLVTFNYTGTPPNDTNVANGTKALVLPFNTSVELVLQDTSILGAE  485

Query  1532  SHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGV  1711
             SHPLHLHG+NF+VVGQGFGN+DP KDPA +NLVDP+ERNT  V +GGW A+RF ADNPGV
Sbjct  486   SHPLHLHGFNFFVVGQGFGNYDPNKDPAKFNLVDPIERNTGSVQAGGWIAVRFLADNPGV  545

Query  1712  WFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             W MHCH ++H SWGLRMAWIV++G   NQKL PPPSDLPKC
Sbjct  546   WLMHCHLDIHTSWGLRMAWIVQDGPQANQKLPPPPSDLPKC  586



>gb|KEH22909.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=578

 Score =   851 bits (2198),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/582 (71%), Positives = 471/582 (81%), Gaps = 15/582 (3%)
 Frame = +2

Query  98    FHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNG  277
             FH+F       FL  +  +  FP + V +    TRHY FNI  +NVTRLCHT++I++VNG
Sbjct  9     FHSF-----KVFLFGLCVIILFPELVVCR----TRHYTFNIEYKNVTRLCHTRTILSVNG  59

Query  278   KFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYV  457
             KFPGPR++AREGDRVLVKVVNH+ NNV+IHWHGIRQ   GW+DGPAY+TQCPIQT QTY 
Sbjct  60    KFPGPRLVAREGDRVLVKVVNHISNNVTIHWHGIRQKTTGWSDGPAYVTQCPIQTNQTYT  119

Query  458   YNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDT  637
             YNFTI GQRGTLFWHAHISWLRATL+GPIIILP+ N SYPF KPHKE+P++FGEW+NVD 
Sbjct  120   YNFTITGQRGTLFWHAHISWLRATLYGPIIILPKHNESYPFQKPHKEIPILFGEWFNVDP  179

Query  638   EAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDE  817
             EAV++QALQ GGGPN+SDAYTINGLPGP YNCS+ +TFK+KVKP KTYLLR+INAALN+E
Sbjct  180   EAVINQALQTGGGPNVSDAYTINGLPGPFYNCSSKDTFKLKVKPNKTYLLRIINAALNEE  239

Query  818   LFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFT  997
             LFF IANHT+ VVEADA Y KPF T+ L+I PGQT NVLLKTK + P + F M ARPY T
Sbjct  240   LFFSIANHTLIVVEADARYTKPFNTNTLLITPGQTTNVLLKTKPDFPNTNFLMIARPYIT  299

Query  998   GQGTFDNSTVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQF  1177
             G GTFDNST AG+L Y+  + +I          P LP +N T+FVSNFT K RSL NS+F
Sbjct  300   GLGTFDNSTPAGILHYKQHNSSIKNLR---FLKPTLPSLNDTNFVSNFTKKFRSLANSKF  356

Query  1178  PANVPQTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYS  1354
             P NVP+ VDK FFFTVGLGT PCPKN TCQGP N TKFAAS+NN SFV P+ +I+QAYY 
Sbjct  357   PINVPKKVDKKFFFTVGLGTFPCPKNSTCQGPNNNTKFAASVNNFSFVLPSVSIMQAYYF  416

Query  1355  RK--SNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGA  1528
              K  SNGVY TDFP  PL PFNYTGT PNNT V N TK+VVL FN +VELVLQDTSILGA
Sbjct  417   GKSNSNGVYKTDFPETPLNPFNYTGTSPNNTMVNNDTKLVVLNFNTSVELVLQDTSILGA  476

Query  1529  ESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPG  1708
             ESHPLHLHGY+F+VVGQGFGN+D  KDPA +NLVDPVERNT+GVP+GGW AIRF ADNPG
Sbjct  477   ESHPLHLHGYDFFVVGQGFGNYDANKDPAKFNLVDPVERNTVGVPAGGWVAIRFFADNPG  536

Query  1709  VWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             VWFMHCH ++H SWGLRMAW+V +G   NQKL PPPSDLPKC
Sbjct  537   VWFMHCHLDIHTSWGLRMAWLVLDGPDSNQKLQPPPSDLPKC  578



>ref|XP_008442532.1| PREDICTED: laccase-17-like [Cucumis melo]
Length=584

 Score =   850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/571 (71%), Positives = 478/571 (84%), Gaps = 9/571 (2%)
 Frame = +2

Query  125   ACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMA  304
             A FL +++   F P +A AK    TRHY FNIR QNVT+L HT  ++TVN + PGP ++A
Sbjct  22    AVFLCVLSC--FLPELAFAK----TRHYTFNIRYQNVTKLGHTVKVLTVNHQLPGPPLVA  75

Query  305   REGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQR  484
             REGDRVL+KV+NHV  NV+IHWHG+RQ++ GWADGPAY+TQCPIQTGQ+Y YNFT+ GQR
Sbjct  76    REGDRVLIKVINHVAENVTIHWHGVRQLQTGWADGPAYVTQCPIQTGQSYTYNFTLNGQR  135

Query  485   GTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQ  664
             GTL WHAHISWLRAT++GPIIILPR+N SYPF KP+K+VP+IFGEW+NV+ E+V+ QALQ
Sbjct  136   GTLLWHAHISWLRATIYGPIIILPRRNESYPFEKPYKQVPIIFGEWFNVNPESVIQQALQ  195

Query  665   NGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHT  844
              GGGPN+SDAYTINGLPGPLYN S+ +TFK+KVK GKTYLLR+INAALNDELFF IANH+
Sbjct  196   TGGGPNVSDAYTINGLPGPLYNSSSKDTFKLKVKAGKTYLLRLINAALNDELFFSIANHS  255

Query  845   VTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPM-STFFMAARPYFTGQGTFDNS  1021
             +TVV+ DA Y+KPF+T++++++PGQT NVLLKT  N P+ STF MAARPYF GQGTFDNS
Sbjct  256   LTVVDVDASYIKPFQTNVVLLSPGQTSNVLLKTNPNFPINSTFLMAARPYFAGQGTFDNS  315

Query  1022  TVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTV  1201
             T  G+L Y      +  + T  I  P LP IN T+FV+NF+ KLRSL  ++FP NVPQTV
Sbjct  316   TTVGILHYGPGHSPLPTSITTLI--PNLPTINDTNFVANFSRKLRSLATAKFPVNVPQTV  373

Query  1202  DKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYAT  1381
             DK FFFTVGLGT PCPKN TCQGPNGTKFAAS+NN+SF  P+TAI++AY+SR++NGVY T
Sbjct  374   DKQFFFTVGLGTAPCPKNATCQGPNGTKFAASVNNISFALPSTAIMEAYFSRRANGVYRT  433

Query  1382  DFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYN  1561
             DFP  P+ PFNYTGTPPNNT V N T +VVLPFNA+VE+VLQ TSILGAESHPLHLHG+N
Sbjct  434   DFPVKPVFPFNYTGTPPNNTVVSNRTSLVVLPFNASVEVVLQGTSILGAESHPLHLHGFN  493

Query  1562  FYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVH  1741
             FY+VG+GFGNFDP KDPAN+NLVDPVERNT GVP+ GW A RF ADNPGVWFMHCH +VH
Sbjct  494   FYIVGEGFGNFDPNKDPANFNLVDPVERNTAGVPAAGWIAFRFFADNPGVWFMHCHLDVH  553

Query  1742  LSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
              SWGLRMAWIV +G  PNQKL PPP+DLPKC
Sbjct  554   TSWGLRMAWIVLDGPKPNQKLPPPPADLPKC  584



>emb|CBI30529.3| unnamed protein product [Vitis vinifera]
Length=584

 Score =   850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/577 (69%), Positives = 474/577 (82%), Gaps = 25/577 (4%)
 Frame = +2

Query  119   LAACFLMIM----TSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFP  286
             +++CFL +M     +L+  P + +AKH  +TRHY F+I++Q VTRLC TKSIVTVNG+FP
Sbjct  28    MSSCFLRVMLFALCALWNLPELVLAKHAGITRHYNFDIKLQKVTRLCQTKSIVTVNGQFP  87

Query  287   GPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNF  466
             GPRI+AREGDRVL+KVVN+V NN++IHWHGIRQ+R+GWADGPAY+TQCPIQTGQ+YVYNF
Sbjct  88    GPRIIAREGDRVLIKVVNNVQNNITIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNF  147

Query  467   TIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAV  646
             TI GQRGTLFWHAHISWLRATL+GP++ILP++   YPFP+P KEVP+IFGEWW  DTE +
Sbjct  148   TITGQRGTLFWHAHISWLRATLYGPLVILPKRGVPYPFPQPFKEVPIIFGEWWKADTETM  207

Query  647   VSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFF  826
             ++QA+Q GG PN+SDAYTINGLPGPLYNCSA +TF++KVKPGKTYLLR+INAALNDELFF
Sbjct  208   INQAMQTGGAPNVSDAYTINGLPGPLYNCSAKDTFRLKVKPGKTYLLRLINAALNDELFF  267

Query  827   RIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQG  1006
              IANHTVTVVE DA YVKPF+T+ LVI PGQT N+LLKTK + P +TF MAAR Y TG  
Sbjct  268   SIANHTVTVVEVDAVYVKPFKTNTLVITPGQTTNILLKTKSHSPNATFLMAARSYATGPA  327

Query  1007  TFDNSTVAGVLEYE-IPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPA  1183
              FDNST AG+LEYE + S++ +KN  +P                    KLRSL  ++FPA
Sbjct  328   AFDNSTTAGILEYEHMSSMSNTKNK-RP-------------------SKLRSLATTKFPA  367

Query  1184  NVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKS  1363
              VPQTV + FFFTVGLG   C +NQ C GPN T  AA++NNVSFV P+TA+LQA++  KS
Sbjct  368   KVPQTVSRRFFFTVGLGLIQCSRNQACPGPNNTMVAAAINNVSFVQPSTALLQAHFFGKS  427

Query  1364  NGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPL  1543
              GVY TDFP+ P   FNYTGTPP+N  V + TKVVVLPFN  VELVLQDTSI+GAESHPL
Sbjct  428   KGVYTTDFPANPPFKFNYTGTPPSNILVNSGTKVVVLPFNTRVELVLQDTSIIGAESHPL  487

Query  1544  HLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMH  1723
             HLHG+NF+VVGQGFGNFDPKKDP+N+NLVDP+ERNT+GVPSGGW AIRFRADNPGVWFMH
Sbjct  488   HLHGFNFHVVGQGFGNFDPKKDPSNFNLVDPIERNTVGVPSGGWVAIRFRADNPGVWFMH  547

Query  1724  CHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             CH EVH SWGL+MAW+V +GK PNQKL PPP+DLPKC
Sbjct  548   CHLEVHTSWGLKMAWVVMDGKRPNQKLPPPPADLPKC  584



>ref|XP_004137936.1| PREDICTED: laccase-17-like [Cucumis sativus]
 gb|KGN58862.1| hypothetical protein Csa_3G734150 [Cucumis sativus]
Length=583

 Score =   850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/571 (71%), Positives = 475/571 (83%), Gaps = 9/571 (2%)
 Frame = +2

Query  125   ACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMA  304
             A FL +++   F P +A AK    TRHY FNIR QNVT+L HT  ++TVN + PGP ++A
Sbjct  21    AVFLCVLSC--FLPELAFAK----TRHYTFNIRYQNVTKLRHTVRVLTVNHQLPGPPLVA  74

Query  305   REGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQR  484
             REGDRVL+KV+NHV  NV+IHWHG+RQ++ GWADGPAY+TQCPIQTGQ+Y YNFT+ GQR
Sbjct  75    REGDRVLIKVINHVAENVTIHWHGVRQLQTGWADGPAYVTQCPIQTGQSYTYNFTLNGQR  134

Query  485   GTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQ  664
             GTL WHAHISWLRAT+HGPIIILPR+N SYPF  PHKEV +I GEW+NV+ E+V+ QALQ
Sbjct  135   GTLLWHAHISWLRATIHGPIIILPRRNESYPFENPHKEVAIILGEWFNVNPESVIQQALQ  194

Query  665   NGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHT  844
              GGGPN+SDAYTING PGPLYN S+ +TFK+KVK G TYLLR+INAALNDELFF IANH+
Sbjct  195   TGGGPNVSDAYTINGHPGPLYNSSSKDTFKLKVKAGNTYLLRLINAALNDELFFSIANHS  254

Query  845   VTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPM-STFFMAARPYFTGQGTFDNS  1021
             +TVV+ DA Y+KPF+TD+++++PGQT NVLLKT  N P+ STF MAARPYFTGQGTFDNS
Sbjct  255   LTVVDVDASYIKPFQTDVVLLSPGQTSNVLLKTNPNFPINSTFLMAARPYFTGQGTFDNS  314

Query  1022  TVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTV  1201
             T  G+L Y      +    T  I  P LP IN T+FV+NF+ KLRSL  ++FP NVPQTV
Sbjct  315   TTVGILHYGPGHSPLPTPITTLI--PNLPAINDTNFVTNFSRKLRSLATAKFPVNVPQTV  372

Query  1202  DKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYAT  1381
             DK FFFTVGLGT PCPKN TCQGPNGTKFAAS+NN+SF  P+TAIL+AY+SR++NGVY T
Sbjct  373   DKQFFFTVGLGTAPCPKNATCQGPNGTKFAASVNNISFALPSTAILEAYFSRRANGVYRT  432

Query  1382  DFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYN  1561
             DFP  P+ PFNYTGTPPNNT V N+T +VVLPFNA+VE+VLQ TSILGAESHPLHLHG+N
Sbjct  433   DFPVKPVFPFNYTGTPPNNTLVSNSTSLVVLPFNASVEVVLQGTSILGAESHPLHLHGFN  492

Query  1562  FYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVH  1741
             FY+VG+GFGNFDP KDPAN+NLVDPVERNT GVP+GGW A RF ADNPGVWFMHCH +VH
Sbjct  493   FYIVGEGFGNFDPNKDPANFNLVDPVERNTAGVPAGGWIAFRFFADNPGVWFMHCHLDVH  552

Query  1742  LSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
              SWGLRMAWIV +G  PNQKL PPP+DLPKC
Sbjct  553   TSWGLRMAWIVLDGPKPNQKLPPPPADLPKC  583



>gb|KDP42231.1| hypothetical protein JCGZ_02961 [Jatropha curcas]
Length=574

 Score =   850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/560 (73%), Positives = 471/560 (84%), Gaps = 6/560 (1%)
 Frame = +2

Query  161   FPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVN  340
              P +A+A    +TRHYKFNI   NVTRLC TKS+VTVNG+FPGPRI+AREGD++LVKVVN
Sbjct  19    LPPVAIA---GITRHYKFNIVSTNVTRLCTTKSMVTVNGQFPGPRIVAREGDQLLVKVVN  75

Query  341   HVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWL  520
             HV +NV+IHWHGIRQ++ GWADGP+Y+TQCPIQT  TYVYNFTI GQRGTL WHAH SWL
Sbjct  76    HVSSNVTIHWHGIRQLQTGWADGPSYVTQCPIQTNNTYVYNFTIRGQRGTLLWHAHFSWL  135

Query  521   RATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYT  700
             RAT++GPIIILP +N+SYPFPKP+KE  ++ GEW+N D EA+++QALQ GG PN+SDAYT
Sbjct  136   RATVYGPIIILPPRNSSYPFPKPYKEFTILLGEWYNTDPEAIINQALQTGGAPNVSDAYT  195

Query  701   INGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVK  880
             INGLPGPLYNCSAN+T+K+ VK GKTYLLR+IN A++ +LFF +ANH +TVVEADA YV+
Sbjct  196   INGLPGPLYNCSANDTYKLTVKQGKTYLLRVINGAVDSDLFFTVANHNLTVVEADARYVQ  255

Query  881   PFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSL  1060
             PFETD+L+I+ GQT NVLLKTK   P +TFF+ ARPY T QG  DNSTVA +LEYEIPS 
Sbjct  256   PFETDILLISAGQTTNVLLKTKPIYPNATFFILARPYSTSQGPIDNSTVAAILEYEIPS-  314

Query  1061  NISKNSTKP-IALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGT  1237
             N SK S+KP I  P LP IN T+   +F  K   L NSQFPANVPQ VD+ FFFTVGLGT
Sbjct  315   NFSKASSKPPIITPSLPQINDTNTAMSFATKFHRLVNSQFPANVPQKVDQQFFFTVGLGT  374

Query  1238  NPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSN-GVYATDFPSVPLTPFN  1414
             +PCP+NQTCQGPNGTKFAAS+NN+SFV P  AIL++YY  +SN GVY T FP  PLTPFN
Sbjct  375   SPCPQNQTCQGPNGTKFAASVNNISFVQPGRAILESYYFNQSNYGVYTTGFPRFPLTPFN  434

Query  1415  YTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNF  1594
             YTGTPPNNT V N T+VVVLPFNA+VE+VLQDTSI G ESHPLHLHGY+FYVVGQGFGNF
Sbjct  435   YTGTPPNNTFVTNGTRVVVLPFNASVEVVLQDTSIFGTESHPLHLHGYDFYVVGQGFGNF  494

Query  1595  DPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIV  1774
             DP  DP N+NLVDPVE NT+GVP+GGW AIRF ADNPG WFMHCHF+VHLSWGL M WIV
Sbjct  495   DPYNDPKNFNLVDPVELNTVGVPAGGWVAIRFFADNPGAWFMHCHFDVHLSWGLSMVWIV  554

Query  1775  KEGKLPNQKLLPPPSDLPKC  1834
              +G+LPNQKLLPPPSDLPKC
Sbjct  555   LDGELPNQKLLPPPSDLPKC  574



>ref|XP_004294638.1| PREDICTED: laccase-17-like [Fragaria vesca subsp. vesca]
Length=581

 Score =   850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/577 (71%), Positives = 484/577 (84%), Gaps = 8/577 (1%)
 Frame = +2

Query  119   LAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRI  298
             L   F++   +L   P +A+A   S+TRHY F++++QNV RLCHTKSIVT+NG+FPGPRI
Sbjct  8     LVRLFVLCCITLGLIPQLALA---SITRHYTFDVQLQNVKRLCHTKSIVTINGQFPGPRI  64

Query  299   MAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVG  478
             +AREGDR+L+KVVNHV +N+SIHWHGIRQ++ GWADGPAYITQCPIQTG +YVYNFTIVG
Sbjct  65    VAREGDRLLIKVVNHVQSNISIHWHGIRQLQTGWADGPAYITQCPIQTGNSYVYNFTIVG  124

Query  479   QRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQA  658
             QRGTL+WHAHISWLR+T++GP+II+P++   YPF KP+KEVP+IFGEWWN DTEAV+ QA
Sbjct  125   QRGTLWWHAHISWLRSTIYGPLIIIPKRGVPYPFTKPYKEVPIIFGEWWNADTEAVIKQA  184

Query  659   LQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIAN  838
             LQ GGGPN+SDAYTINGLPGPLYNCSA +TFK+KV+ GKTY+LR+INAALNDELFF IAN
Sbjct  185   LQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLKVQAGKTYMLRIINAALNDELFFSIAN  244

Query  839   HTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDN  1018
             HT+ VVEADA YVKPF+T+ ++IAPGQT+NVLLKTK + P +TFFM ARPY TG GTFDN
Sbjct  245   HTLKVVEADAVYVKPFDTNTILIAPGQTINVLLKTKPSHPNATFFMTARPYVTGLGTFDN  304

Query  1019  STVAGVLEYEIPSLNISKNSTK-PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQ  1195
             STVAG+LEYE  +L+ +    K P+  P LP +N TSF + F+ KLRSL   QFPANVPQ
Sbjct  305   STVAGILEYESTALHSTLPMKKLPLHKPILPVLNDTSFATKFSNKLRSLNTPQFPANVPQ  364

Query  1196  TVDKNFFFTVGLGTNPCPK----NQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKS  1363
              VDK  FFT+GLGTNPC +    NQTCQGPN T FAAS+NN+SF  P TA+LQ+++  +S
Sbjct  365   KVDKRLFFTIGLGTNPCSQQKHNNQTCQGPNVTMFAASINNISFTMPNTALLQSHFFGQS  424

Query  1364  NGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPL  1543
             NGVY+  FP  PL PFNYTG   NNT V N TK++VLPFN +VELVLQDTSILGAESHPL
Sbjct  425   NGVYSPYFPISPLIPFNYTGAQLNNTNVSNGTKLMVLPFNTSVELVLQDTSILGAESHPL  484

Query  1544  HLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMH  1723
             HLHG+NF+VVGQGFGN+D  KDP  +NL+DPVERNT+GVPSGGW AIRF ADNPGVWFMH
Sbjct  485   HLHGFNFFVVGQGFGNYDQNKDPKKFNLIDPVERNTVGVPSGGWVAIRFLADNPGVWFMH  544

Query  1724  CHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             CH E+H SWGLRMAW+V +GKLPNQKLLPPP DLPKC
Sbjct  545   CHLEIHTSWGLRMAWLVLDGKLPNQKLLPPPLDLPKC  581



>gb|KHF97742.1| Laccase-17 -like protein [Gossypium arboreum]
Length=583

 Score =   849 bits (2194),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/574 (68%), Positives = 469/574 (82%), Gaps = 1/574 (0%)
 Frame = +2

Query  116   LLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPR  295
             L  A F + + S++  P +A+AKH  +TRHYKFNI+MQNVTRLC TKSIVTVNG+FPGPR
Sbjct  10    LSKALFFLSLCSVWLLPDLALAKHAGITRHYKFNIKMQNVTRLCQTKSIVTVNGQFPGPR  69

Query  296   IMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIV  475
             I+AREGDR+L+KVVNHV  NV+IHWHGIRQ+R+GWADGPAY+TQCPIQTGQ+YVYNFTI 
Sbjct  70    IIAREGDRLLIKVVNHVQYNVTIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNFTIT  129

Query  476   GQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQ  655
             GQRGTLFWHAHISWLRATL+GPI+ILP+++ SYPFP+P KEVP++FGEWW  DTE +++Q
Sbjct  130   GQRGTLFWHAHISWLRATLYGPIVILPKRHASYPFPQPFKEVPIVFGEWWKADTETIINQ  189

Query  656   ALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIA  835
             A+  GG PNISDA+TINGLPGP YNCSA ETFK+KVKPGKTYLLR++NAALNDELFFR+A
Sbjct  190   AMATGGAPNISDAFTINGLPGPSYNCSAKETFKLKVKPGKTYLLRLVNAALNDELFFRVA  249

Query  836   NHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFD  1015
             NHT+TVVEADA YVKPF+TD++VI PGQT NVLLK K   P + F M+ARPY TG  TFD
Sbjct  250   NHTLTVVEADAVYVKPFKTDIVVITPGQTTNVLLKAKSKTPNAKFAMSARPYATGPATFD  309

Query  1016  NSTVAGVLEYEIPSLNISKNSTK-PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVP  1192
             N+T  G+LEY+  +   S N+   P+    LP  N +++   F  K+RSL   +FP  VP
Sbjct  310   NTTTIGILEYKKSASASSSNNMNIPLLKAKLPQFNDSTYAMKFNQKIRSLATRKFPVKVP  369

Query  1193  QTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGV  1372
             + VD+ FFFTVGLG  PC KNQTCQGPN  + AA +NNVSFV P TA+LQA++  +S GV
Sbjct  370   KKVDRRFFFTVGLGILPCSKNQTCQGPNNIRPAAGINNVSFVQPNTALLQAHFFNRSKGV  429

Query  1373  YATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLH  1552
             Y T+FP+ P   FNYTGTPP N  + + TK+V L +N  VELV+QDTSILGAESHPLHLH
Sbjct  430   YTTNFPTNPPFKFNYTGTPPKNIMLDSGTKLVSLNYNTNVELVMQDTSILGAESHPLHLH  489

Query  1553  GYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHF  1732
             G+NF+V+ QG GNFDPKKDPA +NL+DP ERNT+GVPSGGW AIRF ADNPGVWFMHCH 
Sbjct  490   GFNFFVLAQGIGNFDPKKDPAKFNLIDPAERNTVGVPSGGWVAIRFLADNPGVWFMHCHL  549

Query  1733  EVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             EVH SWGL+MAW+V +GK P QKL+PPP+DLPKC
Sbjct  550   EVHTSWGLKMAWVVNDGKGPKQKLMPPPADLPKC  583



>ref|XP_010043504.1| PREDICTED: laccase-17 [Eucalyptus grandis]
Length=572

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/565 (73%), Positives = 476/565 (84%), Gaps = 15/565 (3%)
 Frame = +2

Query  158   FFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVV  337
             F P +A   H  +TRHY FNI M++ TRLCHTK ++TVNGKFPGPRI+AREGDRV+VKVV
Sbjct  17    FLPEVA---HAGITRHYTFNIEMKSETRLCHTKRMITVNGKFPGPRIVAREGDRVIVKVV  73

Query  338   NHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISW  517
             NHV NN+SIHWHGIRQ+++GWADGP+YITQCPIQT Q+YVYNFTI GQRGTLFWHAHISW
Sbjct  74    NHVSNNISIHWHGIRQLQSGWADGPSYITQCPIQTNQSYVYNFTITGQRGTLFWHAHISW  133

Query  518   LRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAY  697
             LRAT++GP+II P++   YPF KP KEVPM+FGEW+N DTEA++SQALQ GGGPN+SDAY
Sbjct  134   LRATVYGPLIIFPKRGVPYPFAKPDKEVPMLFGEWFNADTEAIISQALQTGGGPNVSDAY  193

Query  698   TINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYV  877
             TING PGPLYNCS+ +TFK+KV PGKTYLLR+INAALNDELFFRIANH+ TVVEADA YV
Sbjct  194   TINGKPGPLYNCSS-DTFKLKVTPGKTYLLRLINAALNDELFFRIANHSFTVVEADAVYV  252

Query  878   KPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPS  1057
             KPF+TD+LVIAPGQT NVLLK K NP  ST+ MAARPYFTGQGTFDN+T+AG LEY   S
Sbjct  253   KPFKTDILVIAPGQTTNVLLKAKPNPHKSTYLMAARPYFTGQGTFDNTTMAGFLEYVQSS  312

Query  1058  LNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGT  1237
              NI+      ++LP LP IN TS V+NF+ K R L + Q+PA VPQTV K FFFTVGLG 
Sbjct  313   GNITLPKNLTLSLPTLPAINATSVVANFSQKFRHLNSRQYPAQVPQTVQKRFFFTVGLGN  372

Query  1238  NPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNY  1417
             +PC KNQTCQGPNGTKFAAS+NNVSF  P+TA+LQ+Y+ +KSNGV+ TDFP+ PL PFNY
Sbjct  373   SPCSKNQTCQGPNGTKFAASVNNVSFALPSTALLQSYFFKKSNGVFTTDFPATPLRPFNY  432

Query  1418  TGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFD  1597
             TGTPPN T V N TKVVVLPFN +VELV+Q TSILGAESHPLHLHG+NFYVVGQGFGNF+
Sbjct  433   TGTPPNKTFVSNGTKVVVLPFNTSVELVMQGTSILGAESHPLHLHGFNFYVVGQGFGNFN  492

Query  1598  PKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVK  1777
                DPA +NLVDPVERNT+GVP+ GW AIRF ADNPG+    C F+VHLSWGL+MAWIV+
Sbjct  493   QSTDPAKFNLVDPVERNTVGVPAAGWVAIRFLADNPGL----C-FDVHLSWGLKMAWIVQ  547

Query  1778  EGKLPN------QKLLPPPSDLPKC  1834
             +GKLPN      QKL PPPSDLPKC
Sbjct  548   DGKLPNQKLPPPQKLPPPPSDLPKC  572



>ref|XP_010047833.1| PREDICTED: laccase-17-like [Eucalyptus grandis]
 gb|KCW88962.1| hypothetical protein EUGRSUZ_A01282 [Eucalyptus grandis]
Length=571

 Score =   848 bits (2192),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/569 (71%), Positives = 468/569 (82%), Gaps = 5/569 (1%)
 Frame = +2

Query  131   FLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
               +  T L  F  +A  K    TRHY F+I   N+TRLCHT+S+++VN ++PGP ++ARE
Sbjct  7     LFIFCTLLLGFLKLAEGK----TRHYTFHIDSHNMTRLCHTRSVLSVNKQYPGPPLVARE  62

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GD +LVKVVNHV  NV+IHWHG+RQ+R GWADGPAY+TQCPIQT Q+Y YNFT+ GQRGT
Sbjct  63    GDNILVKVVNHVAANVTIHWHGVRQLRTGWADGPAYVTQCPIQTNQSYTYNFTLTGQRGT  122

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             L WHAH+SWLR+++HGPIIILP++N SYPF KP KEVP+IFGEW+NVD EAV++QALQ+G
Sbjct  123   LLWHAHVSWLRSSIHGPIIILPKRNESYPFEKPSKEVPIIFGEWFNVDPEAVIAQALQSG  182

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
             GGPN+SDAYTINGLPGPLYNCS+ +TFK+KVKPGKTYLLR+INAALNDELFF IANHTVT
Sbjct  183   GGPNVSDAYTINGLPGPLYNCSSKDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTVT  242

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VVE DA Y KPF    L + PGQTMNVLLKTK + P STF MAA PYFTG GTFDNSTVA
Sbjct  243   VVEVDAVYTKPFSAGCLHLTPGQTMNVLLKTKTDFPNSTFLMAAWPYFTGMGTFDNSTVA  302

Query  1031  GVLEYEIP-SLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDK  1207
             G+LEYE P S N       P   P LPP+N T FV+ FTG+LRSL +++FPANVPQ VD+
Sbjct  303   GILEYEHPKSSNYPPLKKLPQYKPTLPPMNSTGFVAKFTGQLRSLASAKFPANVPQKVDR  362

Query  1208  NFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDF  1387
              FFFTVGLGT+PCPKN TCQGPNGTKFAAS+NN+SFV P+ A+LQA++  +SNGVY TDF
Sbjct  363   KFFFTVGLGTSPCPKNTTCQGPNGTKFAASVNNISFVLPSVALLQAHFFGQSNGVYTTDF  422

Query  1388  PSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFY  1567
             P+ P   FNYTGTPPNNT V N TK VVL +N +VELV+QDTSILG ESH LHLHG+NF+
Sbjct  423   PTNPPVQFNYTGTPPNNTMVTNGTKTVVLAYNTSVELVMQDTSILGTESHALHLHGFNFF  482

Query  1568  VVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLS  1747
             VVGQG GN++P KDP  +NLVDP+ERNT GVPSGGW AIRF ADNPGVWFMHCH +VH S
Sbjct  483   VVGQGSGNYNPNKDPTKFNLVDPIERNTFGVPSGGWVAIRFLADNPGVWFMHCHLDVHTS  542

Query  1748  WGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             WGL+MAWIV +G  PNQKL PPPSDLPKC
Sbjct  543   WGLKMAWIVLDGPQPNQKLPPPPSDLPKC  571



>emb|CAN80346.1| hypothetical protein VITISV_003134 [Vitis vinifera]
Length=611

 Score =   848 bits (2192),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/544 (74%), Positives = 469/544 (86%), Gaps = 4/544 (1%)
 Frame = +2

Query  86    MGFLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIV  265
             MG  F   PP +   F+    +L   P +A+A+   +TRHYKF+I++QNVTRLCHTKSI+
Sbjct  1     MGVSFLPSPPFVGV-FVFSCMALCLLPELALAQDSGITRHYKFDIKLQNVTRLCHTKSIL  59

Query  266   TVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTG  445
             TVNG+FPGPRI+AREGDR+L+KVVNHV NN+SIHWHGIRQ+R+GWADGPAY+TQCPIQTG
Sbjct  60    TVNGQFPGPRIVAREGDRLLIKVVNHVQNNISIHWHGIRQLRSGWADGPAYVTQCPIQTG  119

Query  446   QTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWW  625
             Q+YVYNFT+VGQRGTLFWHAHISWLR+TL+GP+IILP++N  YPF KPHKEVP+IFGEWW
Sbjct  120   QSYVYNFTVVGQRGTLFWHAHISWLRSTLYGPLIILPKRNVPYPFEKPHKEVPIIFGEWW  179

Query  626   NVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAA  805
             N DTEAV+SQALQ GGGPN+SDAYTINGLPGPLYNCSA +TFK++VK  KTYLLR+INAA
Sbjct  180   NADTEAVISQALQTGGGPNVSDAYTINGLPGPLYNCSAKDTFKLRVKASKTYLLRLINAA  239

Query  806   LNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAAR  985
             LNDELFF IANHT+TVV+ADA YVKPFETD L+IAPGQT NVLLKTK + P + F + AR
Sbjct  240   LNDELFFSIANHTLTVVDADAIYVKPFETDTLLIAPGQTTNVLLKTKPHFPNAAFLITAR  299

Query  986   PYFTGQGTFDNSTVAGVLEYEIPSLNI-SKNSTK--PIALPPLPPINGTSFVSNFTGKLR  1156
             PY TG GTFDNSTVAG+LEYE+PS +  S  S K  P+  P LPP+N TSF +NFT +LR
Sbjct  300   PYVTGLGTFDNSTVAGILEYELPSASPHSTVSIKKLPLFKPTLPPLNDTSFATNFTNRLR  359

Query  1157  SLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAI  1336
             SL + QFPANVPQ VD++FFFT+GLGT+PC +NQTCQGPNGTKFAAS+NNVSF + TTA+
Sbjct  360   SLASPQFPANVPQKVDRHFFFTIGLGTSPCDQNQTCQGPNGTKFAASVNNVSFASSTTAL  419

Query  1337  LQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTS  1516
             LQA++S +SNGVY  DFP  P+ PFNYTGTPPNNT V N TKVVVLPFN +VELV+QDTS
Sbjct  420   LQAHFSGQSNGVYNPDFPITPIIPFNYTGTPPNNTLVSNGTKVVVLPFNTSVELVMQDTS  479

Query  1517  ILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRA  1696
             ILGAESHPLHLHG+NF+VVGQGFGN+DP KDPAN+NLVDP+ERNT+GVPSGGW AIRF A
Sbjct  480   ILGAESHPLHLHGFNFFVVGQGFGNYDPNKDPANFNLVDPIERNTVGVPSGGWVAIRFLA  539

Query  1697  DNPG  1708
             DNP 
Sbjct  540   DNPA  543



>gb|EEC71780.1| hypothetical protein OsI_04394 [Oryza sativa Indica Group]
Length=577

 Score =   848 bits (2191),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/576 (68%), Positives = 475/576 (82%), Gaps = 7/576 (1%)
 Frame = +2

Query  116   LLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPR  295
             LL +  L +   L F  ++A        R Y+F+++  NVTRLC +KSIVTVNG+FPGP 
Sbjct  6     LLRSSILAVAALLLFSVNLAKGD----IREYQFDVKTTNVTRLCSSKSIVTVNGQFPGPT  61

Query  296   IMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIV  475
             + AREGD V+++V+NH P N+SIHWHGIRQ+R+GWADGPAYITQCPIQ G +YVY +TI 
Sbjct  62    VFAREGDLVVIRVINHSPYNMSIHWHGIRQLRSGWADGPAYITQCPIQPGGSYVYKYTIT  121

Query  476   GQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQ  655
             GQRGTL+WHAHISWLRAT++GPIIILP+    YPFP P KEVP++FGEWW  DTEAV+SQ
Sbjct  122   GQRGTLWWHAHISWLRATVYGPIIILPKAGVPYPFPAPDKEVPVVFGEWWKADTEAVISQ  181

Query  656   ALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIA  835
             A Q GGGPN+SDA+TINGLPGPLYNCSA +TFK+KV+ GKTY+LR+INAALNDELFF IA
Sbjct  182   ATQTGGGPNVSDAFTINGLPGPLYNCSAKDTFKLKVEAGKTYMLRLINAALNDELFFSIA  241

Query  836   NHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTG-QGTF  1012
              HT+TVV+ DA YVKPF  D L+I PGQT NVLL TK + P +TF+M A PY T   GTF
Sbjct  242   GHTLTVVDVDAVYVKPFTVDTLLITPGQTTNVLLTTKPSYPGATFYMLAAPYSTAMSGTF  301

Query  1013  DNSTVAGVLEYEIPSLNISK--NSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPAN  1186
             DN+TVAG+LEYE PS + +   N   P+  P LP IN TSFVSN+T KLRSL  +++PAN
Sbjct  302   DNTTVAGILEYEDPSSHSTAAFNKNLPVLRPTLPQINDTSFVSNYTAKLRSLATAEYPAN  361

Query  1187  VPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSN  1366
             VPQ VD  FFFTVGLGT+PC  N TCQGPNG++FAA++NNVSFV P+TA+LQ++Y+ +SN
Sbjct  362   VPQQVDTRFFFTVGLGTHPCAVNGTCQGPNGSRFAAAVNNVSFVLPSTALLQSHYTGRSN  421

Query  1367  GVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLH  1546
             GVYA++FP++PL+PFNYTGTPPNNT V N T++VVLP+ A+VELV+Q TS+LGAESHP H
Sbjct  422   GVYASNFPAMPLSPFNYTGTPPNNTNVSNGTRLVVLPYGASVELVMQGTSVLGAESHPFH  481

Query  1547  LHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHC  1726
             LHG+NF+VVGQGFGNFDP  DPA YNLVDPVERNT+GVP+ GW AIRF ADNPGVWFMHC
Sbjct  482   LHGFNFFVVGQGFGNFDPVNDPAKYNLVDPVERNTVGVPAAGWVAIRFLADNPGVWFMHC  541

Query  1727  HFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             H EVH+SWGL+MAW+V++G LPNQK+LPPPSDLPKC
Sbjct  542   HLEVHVSWGLKMAWVVQDGSLPNQKILPPPSDLPKC  577



>ref|XP_006846265.1| hypothetical protein AMTR_s00012p00245710 [Amborella trichopoda]
 gb|ERN07940.1| hypothetical protein AMTR_s00012p00245710 [Amborella trichopoda]
Length=579

 Score =   848 bits (2191),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/576 (70%), Positives = 481/576 (84%), Gaps = 6/576 (1%)
 Frame = +2

Query  113   PLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGP  292
             P   A  L  + +L+  P   +A     TRHY F++R++N+TRLCHT+ +VTVNG  PGP
Sbjct  8     PTFMAILLWTLCALWLGPRHTLAS----TRHYLFSVRLKNMTRLCHTRQVVTVNGMVPGP  63

Query  293   RIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTI  472
             +I+AREGD+V++KVVNHVPNNV+IHWHG+RQ+++GWADGPAY+TQCPIQTGQTYVYNFTI
Sbjct  64    KIVAREGDQVVIKVVNHVPNNVTIHWHGVRQLQSGWADGPAYVTQCPIQTGQTYVYNFTI  123

Query  473   VGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVS  652
              GQRGTL WHAH +WLR+T++GPI+ILP++   YPFP+PH+E+P+IFGEW+NVD EAV++
Sbjct  124   TGQRGTLLWHAHATWLRSTIYGPIVILPKRGVPYPFPEPHEEIPIIFGEWFNVDPEAVLA  183

Query  653   QALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRI  832
             QALQ GGGPN+SD+YTING PGPLYNCSA +TFK+KV+ GKTYLLR+I+AALNDELFF I
Sbjct  184   QALQTGGGPNVSDSYTINGHPGPLYNCSAKDTFKLKVERGKTYLLRLISAALNDELFFSI  243

Query  833   ANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTF  1012
             ANH++TVVEADA YVKPF TD+++I PGQT NVLL  K NPP +TF MAARPY TGQG+F
Sbjct  244   ANHSLTVVEADAIYVKPFTTDIVLITPGQTTNVLLTAKPNPPKTTFVMAARPYVTGQGSF  303

Query  1013  DNSTVAGVLEYEIPSL-NISKNSTK-PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPAN  1186
             DNST  G+LEY  PSL N S + TK P+ LP LP +N T+F +NF+ + RSL + QFPAN
Sbjct  304   DNSTTTGILEYHSPSLGNSSPSITKLPLLLPTLPALNDTNFAANFSRRFRSLASKQFPAN  363

Query  1187  VPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSN  1366
             VPQTVD+ F FTVGLGTNPCP NQTCQGPNG+ F AS+NNVSF  PTTA+LQA++  +S 
Sbjct  364   VPQTVDRKFLFTVGLGTNPCPNNQTCQGPNGSMFTASINNVSFSMPTTAMLQAHFFGQSA  423

Query  1367  GVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLH  1546
             GVY TDFP  P  PFNYTG PPNNT V++ TKV VL FN +VELVLQDT ILGAESHPLH
Sbjct  424   GVYTTDFPENPPIPFNYTGAPPNNTLVMSGTKVEVLRFNTSVELVLQDTGILGAESHPLH  483

Query  1547  LHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHC  1726
             LHG+NF++VGQGFGN+DP KDPA +NLVDP+ERNT GVPSGGW A+RF ADNPGVW MHC
Sbjct  484   LHGFNFFIVGQGFGNYDPSKDPAKFNLVDPMERNTAGVPSGGWLALRFLADNPGVWLMHC  543

Query  1727  HFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             H EVH SWGL+MAW+V +G LPNQKL PPPSDLPKC
Sbjct  544   HLEVHTSWGLKMAWLVSDGTLPNQKLPPPPSDLPKC  579



>ref|XP_004246356.1| PREDICTED: laccase-17-like [Solanum lycopersicum]
Length=569

 Score =   848 bits (2191),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/546 (73%), Positives = 470/546 (86%), Gaps = 3/546 (1%)
 Frame = +2

Query  200   RHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGI  379
             RHYKF I++QNVTRLCHTK+IVTVNGKFPGP I+AREGDR+ ++V+N+V NN+SIHWHGI
Sbjct  26    RHYKFEIKLQNVTRLCHTKNIVTVNGKFPGPPIVAREGDRLEIEVINNVQNNISIHWHGI  85

Query  380   RQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPR  559
             RQIR+GWADGPAY+TQCPIQ GQ YVYNFTI+GQRGT +WHAHISWLR+TL+GPIIILP+
Sbjct  86    RQIRSGWADGPAYVTQCPIQIGQKYVYNFTIIGQRGTFWWHAHISWLRSTLYGPIIILPK  145

Query  560   KNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSA  739
             KN  YPF KP+KEVP+IFGEW+N DTE ++SQALQ GGGPN+SDAYTINGLPGPLYNCS 
Sbjct  146   KNNPYPFTKPYKEVPIIFGEWFNGDTETIISQALQTGGGPNVSDAYTINGLPGPLYNCSK  205

Query  740   NETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQ  919
              +TFK+KVKPGKTYLLR+INAALNDELFF IANHT+ V++AD  YVKPFET+ ++I PGQ
Sbjct  206   KDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTLQVIDADGVYVKPFETNTIIITPGQ  265

Query  920   TMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKPIALP  1099
             T NVLLKTK + P + F+M ARPY TG GTFDNSTVAG+LEYE  S    KN +  I  P
Sbjct  266   THNVLLKTKPHFPNAKFYMLARPYVTGPGTFDNSTVAGILEYESKSKPHLKNLS--IFKP  323

Query  1100  PLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNG  1279
              LP +N T FV++FT KLRSL   QFPANVP  VD++ FFT+GLGT+PC +N+TCQGPNG
Sbjct  324   SLPSLNDTIFVTDFTSKLRSLATPQFPANVPLYVDRHLFFTIGLGTSPCDQNKTCQGPNG  383

Query  1280  TKFAASLNNVSFVTPTT-AILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNA  1456
             TKF+AS+NNVSF+ PTT ++LQ+++  +S GVY  DFP  PL  FNYTG PPNNT V N 
Sbjct  384   TKFSASINNVSFILPTTNSLLQSHFFGQSKGVYKPDFPYSPLNWFNYTGNPPNNTLVNND  443

Query  1457  TKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDP  1636
             TK++VLPFN +VELV+QDTSILG ESHPLHLHG+NF+VVGQGFGN+DP KDP+N+NLVDP
Sbjct  444   TKLMVLPFNTSVELVMQDTSILGLESHPLHLHGFNFFVVGQGFGNYDPNKDPSNFNLVDP  503

Query  1637  VERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPP  1816
             +ERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH SWGL+MAW+V++GKLPNQKL PPP
Sbjct  504   IERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLKMAWLVQDGKLPNQKLPPPP  563

Query  1817  SDLPKC  1834
              DLPKC
Sbjct  564   MDLPKC  569



>ref|XP_009126628.1| PREDICTED: laccase-17-like [Brassica rapa]
Length=572

 Score =   848 bits (2190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/550 (72%), Positives = 469/550 (85%), Gaps = 3/550 (1%)
 Frame = +2

Query  194   VTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWH  373
             +TRHY  +I+M NVTRLCHTKS+V+VNGKFPGP+I+AREGD++L+KVVNHVPNN+S+HWH
Sbjct  23    ITRHYTLDIKMHNVTRLCHTKSLVSVNGKFPGPKIIAREGDQLLIKVVNHVPNNISLHWH  82

Query  374   GIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIIL  553
             GIRQ+R+GWADGPAYITQCPIQTGQ+YVYN+TIVGQRGTL++HAHISWLRAT++GP+IIL
Sbjct  83    GIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRGTLWYHAHISWLRATVYGPLIIL  142

Query  554   PRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNC  733
             P+    YPFPKPHKEVPM+FGEW++  TEA++ QA   GGGPN+SDAYTINGLPGPLY C
Sbjct  143   PKHGVPYPFPKPHKEVPMVFGEWFSAVTEAIIRQATLTGGGPNVSDAYTINGLPGPLYTC  202

Query  734   SANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAP  913
             SA +TF+++VK GKTYLLR+INAALNDELFF IANHTVTVVEADA YVKPFET+ ++IAP
Sbjct  203   SAKDTFRLRVKAGKTYLLRIINAALNDELFFSIANHTVTVVEADAVYVKPFETNTILIAP  262

Query  914   GQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTKPIA  1093
             GQT NVLLKTK + P ++FFM ARPY TGQGTFDN+TVAG+LEYE P  + +     P+ 
Sbjct  263   GQTTNVLLKTKPSYPSASFFMTARPYATGQGTFDNTTVAGILEYEQPKHSKTNIKNLPLF  322

Query  1094  LPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPC--PKNQTCQ  1267
              P LP +N T+F + F+ KLRSL + +FPANVPQ VD+ FFFT GLG  PC    NQTC 
Sbjct  323   TPVLPALNDTNFATKFSNKLRSLNSQKFPANVPQEVDRKFFFTGGLGNTPCNHKNNQTCL  382

Query  1268  GP-NGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQ  1444
             GP N T FAAS++N+SF  PT A+LQ++YS +SNGVY+ +FP  P+ PFNYTGTPPNNT 
Sbjct  383   GPTNTTMFAASISNISFTLPTKALLQSHYSGRSNGVYSPNFPWSPIVPFNYTGTPPNNTM  442

Query  1445  VVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYN  1624
             V   T V+VL +N +VELV+QDTSILGAESHPLHLHG+NF+VVGQGFGNFDPK DP  +N
Sbjct  443   VSTGTNVMVLRYNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPKNDPKKFN  502

Query  1625  LVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKL  1804
             LVDP+ERNT+GVPSGGWAAIRF ADNPGVWFMHCH EVH SWGLRMAW+V +G  P+QKL
Sbjct  503   LVDPIERNTVGVPSGGWAAIRFLADNPGVWFMHCHLEVHTSWGLRMAWLVLDGDKPDQKL  562

Query  1805  LPPPSDLPKC  1834
             LPPP+DLPKC
Sbjct  563   LPPPADLPKC  572



>ref|XP_002520232.1| laccase, putative [Ricinus communis]
 gb|EEF42144.1| laccase, putative [Ricinus communis]
Length=578

 Score =   848 bits (2190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/568 (69%), Positives = 471/568 (83%), Gaps = 4/568 (1%)
 Frame = +2

Query  131   FLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
             FL++  +L  +  + VA    +TRHYKF+I  QNVTRLCHTK++VTVNG+FPGPRI+A+E
Sbjct  15    FLLVFITLCLYYELTVA----ITRHYKFDIMEQNVTRLCHTKTMVTVNGQFPGPRIVAKE  70

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GDR+L++V NHV +N+SIHWHGIRQ+R+GWADGPAYITQCPIQTGQ+YVYN+TIVGQRGT
Sbjct  71    GDRLLIQVTNHVKHNISIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRGT  130

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             L+WHAHISWLR T++GPIII  + +  +PF KP+KEVP+IFGEW+N D +AV+ +AL+ G
Sbjct  131   LWWHAHISWLRTTVYGPIIIHSKSSIHHPFVKPNKEVPIIFGEWFNADPDAVIKEALKTG  190

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
             GGPN+SDAYTING PGPL NCS  +T+++ VKPGKTY+LR+INAALNDELFF IANHT+T
Sbjct  191   GGPNVSDAYTINGFPGPLSNCSTKDTYRLHVKPGKTYMLRLINAALNDELFFSIANHTLT  250

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VVE DA YVKPF T +LVIAPGQT NVLL+TK + P +TFFM ARPY TGQGTFDNS+VA
Sbjct  251   VVEVDAVYVKPFHTKILVIAPGQTTNVLLQTKPHYPEATFFMTARPYATGQGTFDNSSVA  310

Query  1031  GVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKN  1210
              +L+Y+  S +   N   P+  P LP +N +SFV  +T KLRSL + +FPANVPQ +D+ 
Sbjct  311   AILQYKATSKSNRSNKKIPLFKPSLPALNDSSFVMKYTNKLRSLASEEFPANVPQRIDRR  370

Query  1211  FFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFP  1390
             FFFT+GLGT PCP+N+TCQGPNG KFAAS NNVSF  PT A+LQ+++  ++ GVY  DFP
Sbjct  371   FFFTIGLGTKPCPRNETCQGPNGAKFAASANNVSFTMPTKALLQSHFLGQAKGVYTLDFP  430

Query  1391  SVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYV  1570
                L  FNYTG PPNNT V   TKVV L FN ++EL++QDTSILG ESHPLHLHG+NF+V
Sbjct  431   RTVLFRFNYTGNPPNNTMVSTGTKVVKLHFNTSIELIMQDTSILGVESHPLHLHGFNFFV  490

Query  1571  VGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSW  1750
             VGQGFGNFDPKKDP+ +NLVDPVERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH SW
Sbjct  491   VGQGFGNFDPKKDPSKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSW  550

Query  1751  GLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             GL+MAW+V +GK PNQKLLPPP+DLP C
Sbjct  551   GLKMAWVVNDGKHPNQKLLPPPADLPNC  578



>ref|XP_002520541.1| laccase, putative [Ricinus communis]
 gb|EEF41954.1| laccase, putative [Ricinus communis]
Length=579

 Score =   848 bits (2190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/565 (71%), Positives = 469/565 (83%), Gaps = 5/565 (1%)
 Frame = +2

Query  143   MTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRV  322
             M+ L   P  A A    +TRHYKF+I M N TRLC+TKS+VTVNG+FPGP ++AREGDRV
Sbjct  19    MSCLLSLPQFANA---GITRHYKFDIVMANYTRLCYTKSMVTVNGQFPGPPLIAREGDRV  75

Query  323   LVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWH  502
             LVKVVNHV NN++IHWHG+RQ+++GWADGPAYI QCPIQT  T+VYNFTI GQRGTL WH
Sbjct  76    LVKVVNHVSNNITIHWHGVRQLQSGWADGPAYIAQCPIQTNNTFVYNFTITGQRGTLLWH  135

Query  503   AHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPN  682
             AH S LRAT++GPIIILP+ N SYPFPKP+KEV ++FGEW N D E +++QALQ GG PN
Sbjct  136   AHYSALRATVYGPIIILPQLNASYPFPKPYKEVTILFGEWQNSDPEEIINQALQTGGPPN  195

Query  683   ISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEA  862
             +S+A+TINGLPGPLYNCSA +T++++VKPGK YLLR+I+A ++ +LFF IANH+VTVVEA
Sbjct  196   VSNAFTINGLPGPLYNCSAKDTYRLRVKPGKIYLLRIISATIDHDLFFTIANHSVTVVEA  255

Query  863   DAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLE  1042
             DAGY+KPF+TDLL+I+PGQT NVLL+TK   P + F M ARPY T QG  DN+TVAG+LE
Sbjct  256   DAGYIKPFKTDLLLISPGQTTNVLLETKPIAPNAKFLMLARPYSTSQGAIDNTTVAGILE  315

Query  1043  YEIPSLNISKNSTKPIAL-PPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFF  1219
             YE  SLN S    +PI + P LPPIN T+  +N+T + R L N QFP NVPQ VDK FFF
Sbjct  316   YET-SLNSSSKCERPIFIKPSLPPINSTAIAANYTRRFRRLVNDQFPINVPQKVDKKFFF  374

Query  1220  TVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVP  1399
             TVGLG NPCP+NQTCQGPNGTKF+AS+NN SFV P+TAILQAYY RKSNGVY TDFP VP
Sbjct  375   TVGLGANPCPENQTCQGPNGTKFSASVNNNSFVLPSTAILQAYYFRKSNGVYTTDFPGVP  434

Query  1400  LTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQ  1579
               PFNYTG PPNNT V N TKV+VLPFNA+VE+VLQ TSILG ESHP HLHG+NF+VVGQ
Sbjct  435   PEPFNYTGPPPNNTFVSNGTKVMVLPFNASVEVVLQGTSILGIESHPFHLHGFNFFVVGQ  494

Query  1580  GFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLR  1759
             GFGNFDP KDP NYNLVDPVE NT+ VPSGGW AIRF  DNPGVWFMHCHF+VHLSWGL 
Sbjct  495   GFGNFDPNKDPKNYNLVDPVELNTVAVPSGGWVAIRFSTDNPGVWFMHCHFDVHLSWGLD  554

Query  1760  MAWIVKEGKLPNQKLLPPPSDLPKC  1834
             M W+V +GKLPN+KL PPPSDLPKC
Sbjct  555   MTWLVLDGKLPNEKLPPPPSDLPKC  579



>ref|XP_004137934.1| PREDICTED: laccase-17-like [Cucumis sativus]
 ref|XP_004156653.1| PREDICTED: laccase-17-like [Cucumis sativus]
 gb|KGN58859.1| hypothetical protein Csa_3G734120 [Cucumis sativus]
Length=572

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/550 (71%), Positives = 462/550 (84%), Gaps = 0/550 (0%)
 Frame = +2

Query  185   HGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSI  364
             +  +TRHYKF I++QNVTRLC TK+IVTVNG+FPGPRI+AREGDR+L+KVVNHV NN+S+
Sbjct  23    NARITRHYKFQIQLQNVTRLCQTKTIVTVNGQFPGPRIIAREGDRLLIKVVNHVQNNISL  82

Query  365   HWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPI  544
             HWHG+RQ R+GWADGPAY+TQCPIQTGQ+YVYNFT+ GQRGTLFWHAHISWLR+TL+GPI
Sbjct  83    HWHGVRQRRSGWADGPAYVTQCPIQTGQSYVYNFTVDGQRGTLFWHAHISWLRSTLYGPI  142

Query  545   IILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPL  724
             IILP+ +  YPFP+P KEVP+IFGEWW  DTE V++QA+QNGG PNISDA+T NGLPGP 
Sbjct  143   IILPKTHQPYPFPQPFKEVPIIFGEWWKADTENVINQAMQNGGAPNISDAFTFNGLPGPS  202

Query  725   YNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLLV  904
             YNCSA +TFK+KVKPGK+YLLR+INAALNDELFF IANHT+TVVEADA YVKPF+TD+++
Sbjct  203   YNCSAQDTFKLKVKPGKSYLLRLINAALNDELFFSIANHTLTVVEADAVYVKPFKTDVIL  262

Query  905   IAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTK  1084
             I PGQTMNVLL TK N P +TF +AARPY T    FDN+TV G+LEYE     ++KN   
Sbjct  263   ITPGQTMNVLLHTKSNSPNATFLIAARPYATAPVAFDNTTVTGLLEYEPTKSLLNKNKKL  322

Query  1085  PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTC  1264
             P+  P LP  N TSF   F GK+RSL NS+FPA VP  V   FFFTVGLG  PC +N++C
Sbjct  323   PLHKPVLPRFNDTSFSIKFNGKIRSLANSKFPAKVPMRVKWRFFFTVGLGLLPCRRNRSC  382

Query  1265  QGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQ  1444
             QGPN T+ +AS+NNV+FV P TA+LQ+++  KSNGVY TDFP+ P   FNYTGTPP N+ 
Sbjct  383   QGPNNTRLSASINNVTFVQPNTALLQSHFFNKSNGVYTTDFPANPPIKFNYTGTPPKNSM  442

Query  1445  VVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYN  1624
             V + TKVV+LP+N+ VELVLQDTSI+ AESHPLHLHG+NF+VVGQG GNFDP KDP  +N
Sbjct  443   VSSGTKVVMLPYNSAVELVLQDTSIVTAESHPLHLHGFNFFVVGQGIGNFDPNKDPPKFN  502

Query  1625  LVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKL  1804
             LVDP ERNT+GVPSGGW AIRF ADNPG WFMHCH EVH SWGL+MAWIV++GKLPNQKL
Sbjct  503   LVDPAERNTVGVPSGGWVAIRFIADNPGAWFMHCHLEVHTSWGLKMAWIVEDGKLPNQKL  562

Query  1805  LPPPSDLPKC  1834
              PPPSDLPKC
Sbjct  563   PPPPSDLPKC  572



>ref|XP_010683867.1| PREDICTED: laccase-17-like [Beta vulgaris subsp. vulgaris]
Length=569

 Score =   847 bits (2187),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/570 (70%), Positives = 471/570 (83%), Gaps = 5/570 (1%)
 Frame = +2

Query  131   FLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
             FL+I +S    P +  AKH S+TR YKF I+MQNVTRLC TKSIVTVNG+FPGPRI+ARE
Sbjct  3     FLLICSSTID-PQLVSAKHLSITRRYKFEIKMQNVTRLCQTKSIVTVNGQFPGPRIIARE  61

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GDR+ +KVVNHV NNV+IHWHGIRQ+R+GWADGPAY+TQCPIQTGQ+YVYNFT+ GQRGT
Sbjct  62    GDRLEIKVVNHVKNNVTIHWHGIRQLRSGWADGPAYVTQCPIQTGQSYVYNFTVKGQRGT  121

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             LFWHAHISWLRATL+GPI+ILP++   YPFP P KEVP+IFGEWW  DTE V++QA++ G
Sbjct  122   LFWHAHISWLRATLYGPIVILPKRGVPYPFPHPFKEVPIIFGEWWKADTETVINQAMKTG  181

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
               PN+SDA+TING PGPLYNCSA ++FK+KVKPGKTYLLR+INAALNDELFF IANHT+T
Sbjct  182   SAPNLSDAFTINGFPGPLYNCSAKDSFKLKVKPGKTYLLRLINAALNDELFFSIANHTLT  241

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             +VEADA Y KP +T+ ++I PGQT NVLLK K + P ++F MAARPY TG  TFDN+T A
Sbjct  242   IVEADAIYTKPIKTNTILITPGQTTNVLLKAKKHHPHASFLMAARPYATGPATFDNTTTA  301

Query  1031  GVLEYEI-PSLNISKNSTK-PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVD  1204
              VLEY   PS N   N TK P+  P LP  N TSF + FT KL+SL N++FPANVP+ +D
Sbjct  302   AVLEYAYNPSQN--SNVTKIPLIKPKLPFFNDTSFAAKFTSKLKSLANTRFPANVPKKID  359

Query  1205  KNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATD  1384
             ++FFFTVGLG   C KNQ C GPN T   A++NNVSFV P  A+LQA++ R+SNGV+AT+
Sbjct  360   RHFFFTVGLGLLQCSKNQNCSGPNNTMVGAAINNVSFVLPNIALLQAHFFRQSNGVFATN  419

Query  1385  FPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNF  1564
             FP+ P   FNYTG PP+N  +   TKVVVLPFNA+VE+VLQDTSI+GAESHPLHLHG+NF
Sbjct  420   FPTKPPFKFNYTGNPPSNIILSKGTKVVVLPFNASVEVVLQDTSIIGAESHPLHLHGFNF  479

Query  1565  YVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHL  1744
             +VVGQGFGNFD KKDP N+NL+DP+ERNT+GVPSGGW AIRFRADNPG WFMHCH EVH 
Sbjct  480   FVVGQGFGNFDSKKDPTNFNLIDPIERNTVGVPSGGWVAIRFRADNPGAWFMHCHLEVHT  539

Query  1745  SWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             SWGL+MAWIV +GK  NQKL PPP+D+PKC
Sbjct  540   SWGLKMAWIVMDGKRKNQKLPPPPADIPKC  569



>ref|XP_008240716.1| PREDICTED: laccase-17-like [Prunus mume]
Length=584

 Score =   847 bits (2187),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/571 (70%), Positives = 472/571 (83%), Gaps = 1/571 (0%)
 Frame = +2

Query  125   ACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMA  304
             A F  +   L  FP  A+AKH  VTRHYKFNI+ QNV RLC TKSIVTVNG+FPGPRI+A
Sbjct  14    AIFFAVCAFLCVFPEPALAKHARVTRHYKFNIKSQNVKRLCQTKSIVTVNGQFPGPRIIA  73

Query  305   REGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQR  484
             REGDR+++KVVN V +N+++HWHGIRQ+R+GWADGPAYITQCPIQTGQ+YVYNFTI GQR
Sbjct  74    REGDRLVIKVVNRVQHNLTLHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYNFTITGQR  133

Query  485   GTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQ  664
             GTL+WHAHISWLRAT++GPI+ILP+++  YPFP+P +EVP+IFGEWW  DTEAV+SQALQ
Sbjct  134   GTLWWHAHISWLRATVYGPIVILPKRHIPYPFPQPFQEVPIIFGEWWKADTEAVISQALQ  193

Query  665   NGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHT  844
              G GPN+SDAYTINGLPGPLYNCSA +T+K+KVKPG+TYLLR+INAAL++ELFF IANHT
Sbjct  194   TGSGPNVSDAYTINGLPGPLYNCSAKDTYKLKVKPGRTYLLRLINAALDNELFFSIANHT  253

Query  845   VTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNST  1024
             VTVVEADA Y+KPF+   ++I PGQT NVLL+TK   P +TF MAARPY TG   FDNST
Sbjct  254   VTVVEADAVYIKPFKIQTVLITPGQTTNVLLRTKFKSPKATFVMAARPYVTGPAAFDNST  313

Query  1025  VAGVLEYEIPSLNISKN-STKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTV  1201
               G+LEYE  S+  +KN    P+  P LP +N T F  N+  K+RSL N++FPANVP+ V
Sbjct  314   TTGLLEYETSSVKANKNKKKLPLLKPVLPKLNDTLFSMNYNKKIRSLANAKFPANVPKAV  373

Query  1202  DKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYAT  1381
             +KNFFFTVGLG + C K QTCQGPN T+  A++NNV+FV P TA+LQA++  +S GVY T
Sbjct  374   NKNFFFTVGLGVSTCSKKQTCQGPNNTRVVAAVNNVTFVQPNTALLQAHFFNQSKGVYTT  433

Query  1382  DFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYN  1561
             DFP+ P   FNYTGTPP+N  V + TKVVVLPFN +VELVLQDTSI+GAESHPLHLHG+N
Sbjct  434   DFPANPPFKFNYTGTPPSNIAVSSGTKVVVLPFNTSVELVLQDTSIIGAESHPLHLHGFN  493

Query  1562  FYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVH  1741
             F+VVG G GNFDPK DP  YNLVDP ERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH
Sbjct  494   FFVVGFGSGNFDPKNDPKKYNLVDPAERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVH  553

Query  1742  LSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
              SWGL+MAW+V +GK  NQKLLPPPSDLPKC
Sbjct  554   TSWGLKMAWVVLDGKRRNQKLLPPPSDLPKC  584



>ref|XP_006445791.1| hypothetical protein CICLE_v10018047mg [Citrus clementina]
 ref|XP_006485483.1| PREDICTED: laccase-17-like [Citrus sinensis]
 gb|ESR59031.1| hypothetical protein CICLE_v10018047mg [Citrus clementina]
Length=582

 Score =   847 bits (2187),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/573 (69%), Positives = 470/573 (82%), Gaps = 1/573 (0%)
 Frame = +2

Query  116   LLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPR  295
             +L A FL    +L+    +A+AKH  +TRHYKF+I+MQN+TRLC TKSIVTVNG+FPGPR
Sbjct  11    ILRAMFLGFF-ALWILSELALAKHEGITRHYKFHIKMQNITRLCQTKSIVTVNGQFPGPR  69

Query  296   IMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIV  475
             I+AREGDR+L++V+N+V  NV+IHWHG+RQ+R+GWADGPAY+TQCPIQTGQ+YVYNFT+ 
Sbjct  70    IIAREGDRLLIRVINNVKYNVTIHWHGVRQLRSGWADGPAYVTQCPIQTGQSYVYNFTVT  129

Query  476   GQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQ  655
             GQRGTLFWHAHISWLRATL+GPIIILP++  SYPFP+P +EVP+IFGEWW  D E ++++
Sbjct  130   GQRGTLFWHAHISWLRATLYGPIIILPKQQASYPFPQPFEEVPIIFGEWWKADMETIINE  189

Query  656   ALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIA  835
             A+Q GG PNISDA+TINGLPGP YNC+A +TFK+KV PGKTYLLRMINAALNDELFF IA
Sbjct  190   AMQTGGAPNISDAFTINGLPGPFYNCAAKDTFKLKVTPGKTYLLRMINAALNDELFFSIA  249

Query  836   NHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFD  1015
             NHT+TVVE DA YVKP ET +++I PGQ+ NVLLK K   P + F +AARPY TG  +FD
Sbjct  250   NHTLTVVETDAVYVKPIETKVVLITPGQSTNVLLKAKSKAPNANFLIAARPYATGPASFD  309

Query  1016  NSTVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQ  1195
             N+T AGVLEY+ P+   +KN         LP  N T+FV  F  K+RSL  ++FPA VP+
Sbjct  310   NTTTAGVLEYDQPNGITTKNLPLLKPAALLPKFNDTNFVMQFNKKIRSLATAKFPAKVPK  369

Query  1196  TVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVY  1375
              VD+ FFFTVGLG +PCP+NQTCQGPN  K AAS+NNVSFV P  A+LQA++  +S GVY
Sbjct  370   KVDRRFFFTVGLGLSPCPQNQTCQGPNNMKLAASVNNVSFVQPNVALLQAHFFNRSKGVY  429

Query  1376  ATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHG  1555
              TDFP+ P   FNYTGTPP+N  V + TKVVVLPFNA+VE+V+QDTSI+ AESHPLHLHG
Sbjct  430   TTDFPANPPFKFNYTGTPPSNIMVGSGTKVVVLPFNASVEVVMQDTSIIVAESHPLHLHG  489

Query  1556  YNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFE  1735
             +NF+VV QGFGNFDP KDPA +NLVDP ERNT+GVPSGGW AIRF ADNPGVWFMHCH E
Sbjct  490   FNFFVVAQGFGNFDPNKDPAKFNLVDPAERNTVGVPSGGWVAIRFLADNPGVWFMHCHLE  549

Query  1736  VHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             VH SWGL+MAWIV +GK P QKL PPPSDLPKC
Sbjct  550   VHTSWGLKMAWIVNDGKGPKQKLPPPPSDLPKC  582



>ref|XP_006409959.1| hypothetical protein EUTSA_v10016434mg [Eutrema salsugineum]
 gb|ESQ51412.1| hypothetical protein EUTSA_v10016434mg [Eutrema salsugineum]
Length=578

 Score =   846 bits (2186),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/570 (69%), Positives = 478/570 (84%), Gaps = 4/570 (1%)
 Frame = +2

Query  137   MIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGD  316
             +++  LF   +   A    +TR YKF+I+++N+TRLC TK+IVTVNGKFPGP++ AREGD
Sbjct  9     LLVAFLFAISYNINAASAGITRRYKFDIQLKNITRLCKTKTIVTVNGKFPGPKVTAREGD  68

Query  317   RVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLF  496
              + +KVVNHV NN+SIHWHGIRQ+R+GWADGP+Y+TQCPIQTGQ+YVYNFT++GQRGTL+
Sbjct  69    NLQIKVVNHVSNNISIHWHGIRQLRSGWADGPSYVTQCPIQTGQSYVYNFTVIGQRGTLW  128

Query  497   WHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGG  676
             WHAHI W+RAT++GP+IILP+ +  YPFPKP+K+VP++FGEW+N D +AVV QALQ GGG
Sbjct  129   WHAHIQWMRATVYGPLIILPKLHQPYPFPKPYKQVPIMFGEWFNADPQAVVQQALQTGGG  188

Query  677   PNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVV  856
             PN SDA+T NGLPGPLYNCS  +T+K+ VKPGKTYLLR+INAAL+DELFF IANHT+TVV
Sbjct  189   PNASDAHTFNGLPGPLYNCSTKDTYKLTVKPGKTYLLRLINAALDDELFFTIANHTLTVV  248

Query  857   EADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGV  1036
             EADA YVKPF+T+++++ PGQT NVLLKTK   P +TF+M ARPYFTGQGT DN+TVAGV
Sbjct  249   EADASYVKPFQTNIVLLGPGQTTNVLLKTKPIYPNATFYMLARPYFTGQGTIDNTTVAGV  308

Query  1037  LEYEIPSLNISKNSTK--PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKN  1210
             L+Y+    +   NS+K  P+  P LPPIN TS+ +NFT   RSL +S+FPANVP+TVDK 
Sbjct  309   LKYQHEPTSNHFNSSKNLPVIKPSLPPINSTSYAANFTKMFRSLASSRFPANVPKTVDKK  368

Query  1211  FFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPT-TAILQAYYSRKSNGVYATD  1384
             +FFTVGLGTNPCPKNQTCQGP N TKF A++NNVSF+ P  T++LQ+Y+  KSN ++ T+
Sbjct  369   YFFTVGLGTNPCPKNQTCQGPTNTTKFTAAINNVSFILPNKTSLLQSYFLGKSNRIFMTN  428

Query  1385  FPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNF  1564
             FPS P+ PFNYTG PPNNT V   TK+VVL +N TVELVLQ TSILG E+HP+HLHG+NF
Sbjct  429   FPSAPIFPFNYTGMPPNNTMVSKGTKLVVLKYNTTVELVLQGTSILGIEAHPVHLHGFNF  488

Query  1565  YVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHL  1744
             YVVGQGFGNFDP +DP  YNL+DPVERNTI VPSGGW AIRF ADNPGVWFMHCH E+HL
Sbjct  489   YVVGQGFGNFDPIRDPKRYNLIDPVERNTINVPSGGWVAIRFLADNPGVWFMHCHIEIHL  548

Query  1745  SWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             SWGL MAW+V +G LPNQKLLPPPSD PKC
Sbjct  549   SWGLTMAWVVLDGDLPNQKLLPPPSDFPKC  578



>emb|CAN73336.1| hypothetical protein VITISV_033042 [Vitis vinifera]
Length=547

 Score =   846 bits (2186),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/569 (73%), Positives = 474/569 (83%), Gaps = 37/569 (7%)
 Frame = +2

Query  131   FLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
               +++ SL+F P +A      +TRHYKFNI +QNVTRLCHTKSIV+VNG+FPGP I+ARE
Sbjct  15    LFLVLNSLWFLPELA--NGSGITRHYKFNIELQNVTRLCHTKSIVSVNGQFPGPPIIARE  72

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GDRV+VKVVNHV NNV+IHWHG+RQ+R+GWADGPAY+TQCPIQTGQTYVYNFTI GQRGT
Sbjct  73    GDRVVVKVVNHVQNNVTIHWHGVRQLRSGWADGPAYVTQCPIQTGQTYVYNFTITGQRGT  132

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             LFWHAHISWLR+TL+GPIII P+KN  YPF KP+KEVP+IFGEWWN D EAV++QALQNG
Sbjct  133   LFWHAHISWLRSTLYGPIIIFPKKNVPYPFAKPYKEVPIIFGEWWNTDPEAVITQALQNG  192

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
             GGPN+SDAYTINGLPGPLYNCSA +TFK+KVKPGKTYLLR+INAALNDELFF IANHT+T
Sbjct  193   GGPNVSDAYTINGLPGPLYNCSAQDTFKLKVKPGKTYLLRLINAALNDELFFSIANHTLT  252

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VV+ DA YVKPF+TD ++I PGQT N+LLK K + P +TF MAARPY TG+GTFDNSTVA
Sbjct  253   VVDVDAIYVKPFKTDTILITPGQTTNLLLKAKPHFPNATFLMAARPYATGRGTFDNSTVA  312

Query  1031  GVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKN  1210
                                               +NFT KLRSL N+QFPANVPQ VDK 
Sbjct  313   ----------------------------------ANFTRKLRSLANTQFPANVPQKVDKR  338

Query  1211  FFFTVGLGTNPCPKNQTCQGPN-GTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDF  1387
             FFFTVGLGTNPCP+NQTCQGPN  T F+AS+NNVSFV PTTAILQA++ ++SNGVY TDF
Sbjct  339   FFFTVGLGTNPCPQNQTCQGPNNSTMFSASVNNVSFVLPTTAILQAHFFQQSNGVYTTDF  398

Query  1388  PSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFY  1567
             P+ P+ PFNYTGTPPNNT V N TKVVVLPFN +VELVLQDTSILG ESHPLHLHG+NF+
Sbjct  399   PATPIFPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVLQDTSILGIESHPLHLHGFNFF  458

Query  1568  VVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLS  1747
             VVGQGFGNFD KKDP+ +NLVDPVERNT+GVPSGGW AIRF ADNPGVW MHCH EVH S
Sbjct  459   VVGQGFGNFDAKKDPSKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWLMHCHLEVHTS  518

Query  1748  WGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             WGL+M  IVK+GK+PNQKL PPPSDLPKC
Sbjct  519   WGLKMGXIVKDGKMPNQKLPPPPSDLPKC  547



>ref|XP_007026974.1| Laccase 17 [Theobroma cacao]
 gb|EOY07476.1| Laccase 17 [Theobroma cacao]
Length=583

 Score =   845 bits (2183),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/569 (69%), Positives = 467/569 (82%), Gaps = 1/569 (0%)
 Frame = +2

Query  131   FLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMARE  310
             FL+ + ++   P +AVAKH  +TRHY F+IRMQNVTRLC TKSIVTVNG+FPGPRI+ARE
Sbjct  15    FLLALCAVSLLPDLAVAKHAGITRHYNFDIRMQNVTRLCQTKSIVTVNGQFPGPRIIARE  74

Query  311   GDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGT  490
             GDR+L+KVVNHV  NV++HWHGIRQ+R GWADGPAYITQCPIQTGQ+YVYNFTI GQRGT
Sbjct  75    GDRLLIKVVNHVQYNVTLHWHGIRQLRTGWADGPAYITQCPIQTGQSYVYNFTITGQRGT  134

Query  491   LFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNG  670
             LFWHAHISWLRATL+GPI+ILP+++ SYPFP+P KEVP+IFGEWW  DTE +++QA+  G
Sbjct  135   LFWHAHISWLRATLYGPIVILPKRHASYPFPQPFKEVPIIFGEWWKADTETIINQAMATG  194

Query  671   GGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVT  850
             G PNISDA+TINGLPGP YNCSA ETFK+KVKPGKTYLLR+INAALNDELFFRIANHTVT
Sbjct  195   GAPNISDAFTINGLPGPSYNCSAKETFKLKVKPGKTYLLRLINAALNDELFFRIANHTVT  254

Query  851   VVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVA  1030
             VVEADA YVKPF+TD+++I PGQT NVLLK K     + F ++ARPY TG  TFDN+T  
Sbjct  255   VVEADAVYVKPFKTDIVLITPGQTTNVLLKAKSKTSGANFALSARPYATGPATFDNTTTI  314

Query  1031  GVLEYE-IPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDK  1207
             G+LEYE   S + S N   P+    LP  N +++   F  K+RSL  ++FPA VP+ VD+
Sbjct  315   GILEYEKSASASNSNNKKLPLLKAKLPEFNDSTYAMKFNQKIRSLATAKFPAKVPKNVDR  374

Query  1208  NFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDF  1387
              FFFTVGLG  PC + QTCQGPN T+ AA++NNVSFV P  A+LQA++  +S GVY T+F
Sbjct  375   RFFFTVGLGILPCSQKQTCQGPNNTRPAAAVNNVSFVQPNIALLQAHFFNRSKGVYTTNF  434

Query  1388  PSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFY  1567
             P+ P   FNY GTPP N  + + TKV+VLPFN +VELV+QDTSILGAESHPLHLHG+NF+
Sbjct  435   PANPPFKFNYIGTPPKNIMLDSGTKVMVLPFNTSVELVMQDTSILGAESHPLHLHGFNFF  494

Query  1568  VVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLS  1747
             V+GQG GNFD KKDPA +NLVDP ERNT+GVPSGGW AIRF ADNPGVWFMHCH EVH S
Sbjct  495   VLGQGVGNFDSKKDPAKFNLVDPAERNTVGVPSGGWVAIRFLADNPGVWFMHCHLEVHTS  554

Query  1748  WGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             WGL+MAW+V +GK   QKLLPPP+D+PKC
Sbjct  555   WGLKMAWVVNDGKGRKQKLLPPPADIPKC  583



>emb|CDY65666.1| BnaC04g54790D [Brassica napus]
Length=578

 Score =   845 bits (2182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/570 (70%), Positives = 475/570 (83%), Gaps = 4/570 (1%)
 Frame = +2

Query  137   MIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGD  316
             +++T L    +   A    +TRHY F+I+++N+TRLC TK+IV VNGKFPGP++ AREGD
Sbjct  9     LLVTFLITITYGIDAASAGITRHYTFHIQLKNITRLCKTKTIVAVNGKFPGPKVTAREGD  68

Query  317   RVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLF  496
              + +KVVNHV NN+SIHWHGIRQ+R+GWADGP+Y+TQCPIQTGQ+YVYNFTI+GQRGTL+
Sbjct  69    NLQIKVVNHVSNNISIHWHGIRQLRSGWADGPSYVTQCPIQTGQSYVYNFTIIGQRGTLW  128

Query  497   WHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGG  676
             WHAHI W+RAT++GP+IILP+ +  YPFPKP+K+VP+IFGEW+N D +AVV QALQ G G
Sbjct  129   WHAHIQWMRATVYGPLIILPKLHQPYPFPKPYKQVPIIFGEWFNADPQAVVQQALQTGAG  188

Query  677   PNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVV  856
             PN SDA+T NGLPGPLYNCS  ET+K+ VKPGKTYLL++INAAL+DELFF IANHT+TVV
Sbjct  189   PNASDAHTFNGLPGPLYNCSTKETYKLVVKPGKTYLLQLINAALDDELFFIIANHTLTVV  248

Query  857   EADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGV  1036
             EADA YVKPF+T+++++ PGQT NVLLKTK   P +TF+M ARPYFTGQGT DN+TVAG+
Sbjct  249   EADASYVKPFQTNIVLLGPGQTTNVLLKTKHIYPNATFYMLARPYFTGQGTIDNTTVAGI  308

Query  1037  LEYEIPSLNISKNSTK--PIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKN  1210
             L+Y     +   NS+K  P+  P LPPIN TS+ +NFT   RSL NS+FPANVP+ VDK 
Sbjct  309   LKYHHKPTSNHFNSSKNLPVIKPFLPPINSTSYAANFTKMFRSLANSRFPANVPKIVDKK  368

Query  1211  FFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTP-TTAILQAYYSRKSNGVYATD  1384
             FFFTVGLGTNPCPKNQTCQGP N TKFAA++NNVSF+ P TT++LQ+Y+S  S  V+ T+
Sbjct  369   FFFTVGLGTNPCPKNQTCQGPTNTTKFAAAINNVSFILPNTTSLLQSYFSGMSKKVFTTN  428

Query  1385  FPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNF  1564
             FPS P+ PFNYTG PPNNT V   TKVVVL +N TVELVLQ TSILG E+HP+HLHGYNF
Sbjct  429   FPSTPVFPFNYTGVPPNNTMVSRGTKVVVLKYNTTVELVLQGTSILGIEAHPIHLHGYNF  488

Query  1565  YVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHL  1744
             YVVGQGFGNFDP +DP  YNLVDPVERNTI VPSGGW AIRF ADNPGVWFMHCH E+HL
Sbjct  489   YVVGQGFGNFDPTRDPKQYNLVDPVERNTINVPSGGWVAIRFLADNPGVWFMHCHIEIHL  548

Query  1745  SWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             SWGL MAW+V +G+LPNQKL PPPSD PKC
Sbjct  549   SWGLTMAWVVLDGELPNQKLPPPPSDFPKC  578



>ref|XP_007208294.1| hypothetical protein PRUPE_ppa003308mg [Prunus persica]
 gb|EMJ09493.1| hypothetical protein PRUPE_ppa003308mg [Prunus persica]
Length=586

 Score =   845 bits (2182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/586 (68%), Positives = 472/586 (81%), Gaps = 3/586 (1%)
 Frame = +2

Query  86    MGFLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIV  265
             MG      P    A    +   L  FP  A+AKH  VTRHYKFNI+ QNV RLC TKSIV
Sbjct  1     MGSSLLQSPAFSMAILFAVCAFLCVFPEPALAKHARVTRHYKFNIKSQNVKRLCQTKSIV  60

Query  266   TVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTG  445
             TVNG+FPGPRI+AREGDR+++KVVNHV +N+++HWHGIRQ+R+GWADGPAYITQCPIQTG
Sbjct  61    TVNGQFPGPRIIAREGDRLVIKVVNHVQHNLTLHWHGIRQLRSGWADGPAYITQCPIQTG  120

Query  446   QTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWW  625
             Q+YVYNFT+ GQRGTL+WHAHISWLRAT++GPI+ILP+++  YPFP+P +EVP+IFGEWW
Sbjct  121   QSYVYNFTVTGQRGTLWWHAHISWLRATVYGPIVILPKRHVPYPFPQPFQEVPIIFGEWW  180

Query  626   NVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAA  805
               DTEAV+SQALQ G GPN+SDAYTINGLPGPLYNCSA +T+K+KVKPG+TYLLR+INAA
Sbjct  181   KADTEAVISQALQTGSGPNVSDAYTINGLPGPLYNCSAKDTYKLKVKPGRTYLLRLINAA  240

Query  806   LNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAAR  985
             L++ELFF IANHT+TVVE DA Y+KPF+T  ++I PGQT NVLL+TK   P +TF MAAR
Sbjct  241   LDNELFFSIANHTLTVVETDAVYIKPFKTQTVLITPGQTTNVLLRTKSKSPKATFVMAAR  300

Query  986   PYFTGQGTFDNSTVAGVLEYEIPSL---NISKNSTKPIALPPLPPINGTSFVSNFTGKLR  1156
             PY TG   FDNST  G LEYE  S+           P+  P LP +N T F  N+  K+R
Sbjct  301   PYVTGPAAFDNSTTTGRLEYETSSVKANKNKNKKKLPLLKPVLPKLNDTLFSMNYNKKIR  360

Query  1157  SLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAI  1336
             SL N++FPANVP+ V+KNFFFTVGLG + C KNQTCQGPN T+  A++NNV+FV P TA+
Sbjct  361   SLANAKFPANVPKAVNKNFFFTVGLGVSTCSKNQTCQGPNNTRVVAAINNVTFVQPNTAL  420

Query  1337  LQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTS  1516
             LQA++  +S GVY TDFP+ P   FNYTGTPP+N  V + TKVVVLPFN +VELVLQDTS
Sbjct  421   LQAHFFNQSKGVYTTDFPANPPFKFNYTGTPPSNIAVSSGTKVVVLPFNTSVELVLQDTS  480

Query  1517  ILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRA  1696
             I+GAESHPLHLHG+NF+VVG G GNFDPK DP  YNLVDP ERNT+GVPSGGW AIRF A
Sbjct  481   IIGAESHPLHLHGFNFFVVGFGSGNFDPKNDPKKYNLVDPAERNTVGVPSGGWVAIRFLA  540

Query  1697  DNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             DNPGVWFMHCH EVH SWGL+MAW+V +GK  NQKLLPPPSDLPKC
Sbjct  541   DNPGVWFMHCHLEVHTSWGLKMAWVVLDGKRRNQKLLPPPSDLPKC  586



>ref|NP_001044773.1| Os01g0842500 [Oryza sativa Japonica Group]
 dbj|BAB86452.1| putative laccase LAC5-6 [Oryza sativa Japonica Group]
 dbj|BAF06687.1| Os01g0842500 [Oryza sativa Japonica Group]
 gb|EAZ14116.1| hypothetical protein OsJ_04040 [Oryza sativa Japonica Group]
 dbj|BAG90005.1| unnamed protein product [Oryza sativa Japonica Group]
Length=577

 Score =   844 bits (2181),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/576 (68%), Positives = 473/576 (82%), Gaps = 7/576 (1%)
 Frame = +2

Query  116   LLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPR  295
             LL +  L +   L F  ++A        R Y+F+++  NVTRLC +KSIVTVNG+FPGP 
Sbjct  6     LLRSSILAVAALLLFSVNLAKGD----IREYQFDVKTTNVTRLCSSKSIVTVNGQFPGPT  61

Query  296   IMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIV  475
             + AREGD V+++V+NH P N+SIHWHGIRQ+R+GWADGPAYITQCPIQ G +YVY +TI 
Sbjct  62    VFAREGDLVVIRVINHSPYNMSIHWHGIRQLRSGWADGPAYITQCPIQPGGSYVYKYTIT  121

Query  476   GQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQ  655
             GQRGTL+WHAHISWLRAT++GPIIILP+    YPFP P KEVP++FGEWW  DTEAV+SQ
Sbjct  122   GQRGTLWWHAHISWLRATVYGPIIILPKAGVPYPFPAPDKEVPVVFGEWWKADTEAVISQ  181

Query  656   ALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIA  835
             A Q GGGPN+SDA+TINGLPGPLYNCSA +TFK+KV+ GKTY+LR+INAALNDELFF IA
Sbjct  182   ATQTGGGPNVSDAFTINGLPGPLYNCSAKDTFKLKVEAGKTYMLRLINAALNDELFFSIA  241

Query  836   NHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTG-QGTF  1012
              HT+TVV+ DA YVKPF  D L+I PGQT NVLL TK + P +TF+M A PY T   GTF
Sbjct  242   GHTLTVVDVDAVYVKPFTVDTLLITPGQTTNVLLTTKPSYPGATFYMLAAPYSTAMSGTF  301

Query  1013  DNSTVAGVLEYEIPSLNISK--NSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPAN  1186
             DN+TVAG+LEYE PS + +   N   P+  P LP IN TSFVSN+T KLRS   +++PAN
Sbjct  302   DNTTVAGILEYEDPSSHSTAAFNKNLPVLRPTLPQINDTSFVSNYTAKLRSFATAEYPAN  361

Query  1187  VPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSN  1366
             VPQ VD  FFFTVGLGT+PC  N TCQGPNG++FAA++NNVSFV P+TA+LQ++Y+ +SN
Sbjct  362   VPQQVDTRFFFTVGLGTHPCAVNGTCQGPNGSRFAAAVNNVSFVLPSTALLQSHYTGRSN  421

Query  1367  GVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLH  1546
             GVYA++FP++PL+PFNYTGTPPNNT V N T++VVLP+ A+VELV+Q TS+LGAESHP H
Sbjct  422   GVYASNFPAMPLSPFNYTGTPPNNTNVSNGTRLVVLPYGASVELVMQGTSVLGAESHPFH  481

Query  1547  LHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHC  1726
             LHG+NF+VVGQGFGNFDP  DPA YNLVDPVERNT+GVP+ GW AIRF  DNPGVWFMHC
Sbjct  482   LHGFNFFVVGQGFGNFDPVNDPAKYNLVDPVERNTVGVPAAGWVAIRFLVDNPGVWFMHC  541

Query  1727  HFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             H EVH+SWGL+MAW+V++G LPNQK+LPPPSDLPKC
Sbjct  542   HLEVHVSWGLKMAWVVQDGSLPNQKILPPPSDLPKC  577



>ref|XP_003551482.1| PREDICTED: laccase-17-like [Glycine max]
Length=576

 Score =   844 bits (2181),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/581 (72%), Positives = 486/581 (84%), Gaps = 12/581 (2%)
 Frame = +2

Query  98    FHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNG  277
             F +F  L    F   + +LF  P   V    S+TRHY FN+   NVTRLCHT++I++VNG
Sbjct  6     FPSFASLRVLLFCFCVMTLF--PEFVV----SITRHYTFNVEYLNVTRLCHTRNILSVNG  59

Query  278   KFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYV  457
             KFPGPR++AREGDRV+VKVVNHV NNV+IHWHGIRQ+  GWADGPAY+TQCPIQT Q+Y 
Sbjct  60    KFPGPRLVAREGDRVVVKVVNHVSNNVTIHWHGIRQMTTGWADGPAYVTQCPIQTNQSYT  119

Query  458   YNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDT  637
             YNFTIVGQRGTL WHAHISWLRAT++GPIIILP++N SYPF KPHKE+P++FGEW+NVD 
Sbjct  120   YNFTIVGQRGTLLWHAHISWLRATIYGPIIILPKQNESYPFEKPHKEIPILFGEWFNVDP  179

Query  638   EAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDE  817
             EAV+SQALQ GGGPN+SDAYTINGLPGPLYNCS+ +T+ +KVKPGKTYLLR+INAALN+E
Sbjct  180   EAVISQALQTGGGPNVSDAYTINGLPGPLYNCSSKDTYTLKVKPGKTYLLRLINAALNEE  239

Query  818   LFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFT  997
             LFF IANHT+TVVEADA Y KPF+TD L+IAPGQT NV LKTK   P +TF MAARPYFT
Sbjct  240   LFFSIANHTLTVVEADAKYTKPFDTDTLLIAPGQTTNVFLKTKPYFPNATFQMAARPYFT  299

Query  998   GQGTFDNSTVAGVLEYEIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQF  1177
             G+GTFDNST AG L Y+  S N+ KN T  +  P LPPIN TSFV+NFT K RSL +++F
Sbjct  300   GRGTFDNSTTAGTLIYKQHS-NV-KNLT--LLKPTLPPINATSFVANFTAKFRSLASAKF  355

Query  1178  PANVPQTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTT-AILQAYY  1351
             P  VPQ VD+ FFFTVGLGTNPCPKN TCQGP N TKFAAS+NN+SF  P++ +I+QAYY
Sbjct  356   PVKVPQKVDRKFFFTVGLGTNPCPKNTTCQGPSNNTKFAASVNNISFALPSSVSIMQAYY  415

Query  1352  SRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAE  1531
             S ++NGV+ TDFP+ PL PFNYTGTPPNNT V N TK+VVL FN +VELVLQDTSILGAE
Sbjct  416   SSQANGVFKTDFPATPLNPFNYTGTPPNNTMVTNDTKLVVLKFNTSVELVLQDTSILGAE  475

Query  1532  SHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGV  1711
             SHPLHLHGY+F+VVGQGFGN+DP  DPA +NL+DPVERNT GVP+GGW AIRF ADNPGV
Sbjct  476   SHPLHLHGYDFFVVGQGFGNYDPNNDPARFNLIDPVERNTAGVPAGGWIAIRFFADNPGV  535

Query  1712  WFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             WFMHCH ++H SWGLRMAW+V +G  PNQKL PPPSDLPKC
Sbjct  536   WFMHCHLDLHTSWGLRMAWLVLDGPEPNQKLQPPPSDLPKC  576



>ref|XP_008785568.1| PREDICTED: laccase-17-like [Phoenix dactylifera]
Length=567

 Score =   843 bits (2179),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/551 (73%), Positives = 471/551 (85%), Gaps = 4/551 (1%)
 Frame = +2

Query  188   GSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIH  367
               +TRHY FN+R+QNVTRLCHTKS+VTVNG+FPGPRI+ REGD+V+VKV+NHV NN++IH
Sbjct  19    AGITRHYMFNVRLQNVTRLCHTKSMVTVNGQFPGPRIVVREGDQVVVKVINHVQNNITIH  78

Query  368   WHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHGPII  547
             WHG+RQ+R+GWADGPAYITQCPIQTGQ+YVYNFT+VGQRGTL+WHAH SWLRAT++GPI+
Sbjct  79    WHGVRQLRSGWADGPAYITQCPIQTGQSYVYNFTVVGQRGTLWWHAHHSWLRATVYGPIV  138

Query  548   ILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPGPLY  727
             ILP +   YPFP P+KEVP++FGEW+N D EAV++QALQ GGGPN+S+AYTING PGPL 
Sbjct  139   ILPARGVRYPFPNPYKEVPILFGEWFNEDPEAVIAQALQTGGGPNVSEAYTINGFPGPLS  198

Query  728   NCSA--NETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDLL  901
             NCSA   +TFK+KVKPGKTYLLR+INAALND+LFF IANH +TVVE DA YVKPFETD +
Sbjct  199   NCSAKAQDTFKLKVKPGKTYLLRLINAALNDDLFFSIANHYMTVVETDANYVKPFETDTI  258

Query  902   VIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISKNST  1081
             +I PG+T NVLL+TK   P +TFFMAARPY TG GTFDN+TVAG+LEY   S +  K   
Sbjct  259   LIGPGETTNVLLRTKPASPNATFFMAARPYNTGLGTFDNTTVAGLLEYTSTSSSSMKK--  316

Query  1082  KPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQT  1261
              P+  P LP IN T+  +NF+ KLRSL ++QFPANV +TVD+ F+FTVGLGT PCPKNQT
Sbjct  317   LPLLKPTLPAINDTAAAANFSSKLRSLASTQFPANVARTVDRRFYFTVGLGTRPCPKNQT  376

Query  1262  CQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNT  1441
             CQGPNGTKFAAS+NNVSF  P+ A+LQA+Y  +S GVY TDFP+ P  PFNYTGTPPNNT
Sbjct  377   CQGPNGTKFAASVNNVSFSLPSMALLQAHYQGQSKGVYTTDFPNNPPFPFNYTGTPPNNT  436

Query  1442  QVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANY  1621
              V N TKVVVLPFN +VELV+QDTSI GAESHPLHLHG+N Y+VGQGFGN++P KDPA +
Sbjct  437   FVSNGTKVVVLPFNTSVELVMQDTSIQGAESHPLHLHGHNIYIVGQGFGNYNPLKDPARF  496

Query  1622  NLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQK  1801
             NLVDPVERNT GVPSGGW AIRFRADNPGVW MHCHF+VHLSWGL MAW+V +G LP QK
Sbjct  497   NLVDPVERNTAGVPSGGWIAIRFRADNPGVWLMHCHFDVHLSWGLTMAWVVNDGALPGQK  556

Query  1802  LLPPPSDLPKC  1834
             L PPPSDLPKC
Sbjct  557   LPPPPSDLPKC  567



>ref|XP_010906603.1| PREDICTED: laccase-17-like [Elaeis guineensis]
Length=576

 Score =   844 bits (2180),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/581 (70%), Positives = 484/581 (83%), Gaps = 12/581 (2%)
 Frame = +2

Query  104   AFPPLL--AACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNG  277
             AFP L      FL+ ++     P  +      +TRH+KF+I++QNVTRLCHT+S+VTVNG
Sbjct  4     AFPSLTFPMGAFLVALSIFLVLPEFSAG----ITRHFKFDIKLQNVTRLCHTRSMVTVNG  59

Query  278   KFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYV  457
             +FPGP+I+ REGDRV+VKVVNHV NN++IHWHGIRQ RNGWADGPAY+TQCPIQTGQ+YV
Sbjct  60    RFPGPKIVVREGDRVVVKVVNHVQNNITIHWHGIRQFRNGWADGPAYVTQCPIQTGQSYV  119

Query  458   YNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDT  637
             Y+FTIVGQRGTL+WHAH SWLRAT++GP++ILP++   YPFPKP+KEVP++ GEW+N D 
Sbjct  120   YDFTIVGQRGTLWWHAHHSWLRATVYGPLVILPKRGIPYPFPKPYKEVPILLGEWFNEDP  179

Query  638   EAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDE  817
             EAV++QALQ G GPN+S+AYTINGLPGPLYNCSA +TFK+ VKPGK YLLR+INAALND+
Sbjct  180   EAVIAQALQTGAGPNVSEAYTINGLPGPLYNCSAKDTFKLNVKPGKRYLLRLINAALNDD  239

Query  818   LFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFT  997
             LFF IANH++TVVE DA YVKP + D ++I PG+T N+LL TK   P +TFFM ARPY T
Sbjct  240   LFFSIANHSMTVVETDASYVKPLQMDTILIGPGETTNILLHTKPASPNATFFMLARPYNT  299

Query  998   GQGTFDNSTVAGVLEYEIPSLNISKNSTKPIAL--PPLPPINGTSFVSNFTGKLRSLGNS  1171
             G GT DN+TVAG+L+Y     + S  +  P+ L  P LP IN T+  +NF+ KLRSL ++
Sbjct  300   GLGTIDNTTVAGLLDYA----STSNKNLFPVVLLKPTLPAINDTAAAANFSTKLRSLASA  355

Query  1172  QFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYY  1351
             QFPANVPQTVD+ F+FTVGLGT+PCPKNQTCQGPNGTKFAAS+NNVSF  P+ A+LQA+Y
Sbjct  356   QFPANVPQTVDRRFYFTVGLGTSPCPKNQTCQGPNGTKFAASVNNVSFAFPSMALLQAHY  415

Query  1352  SRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAE  1531
               +S GVY TDFP+ P   FNYTGTPPNNT V NATKVV LPFN +VELV+QDTSI GAE
Sbjct  416   MEQSKGVYTTDFPNNPPFQFNYTGTPPNNTFVTNATKVVALPFNTSVELVMQDTSIQGAE  475

Query  1532  SHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGV  1711
             SHPLHLHG NFYVVGQGFGN+DP KDPA +NLVDPVERNT GVPSGGWAAIRFRADNPGV
Sbjct  476   SHPLHLHGNNFYVVGQGFGNYDPMKDPAKFNLVDPVERNTAGVPSGGWAAIRFRADNPGV  535

Query  1712  WFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             W MHCHF+VHLSWGLRMAW+V +G LP+QKLLPPPSDLPKC
Sbjct  536   WLMHCHFDVHLSWGLRMAWVVNDGPLPSQKLLPPPSDLPKC  576



>gb|KHN14002.1| Laccase-17 [Glycine soja]
Length=555

 Score =   843 bits (2177),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/561 (74%), Positives = 478/561 (85%), Gaps = 10/561 (2%)
 Frame = +2

Query  158   FFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVV  337
              FP   V    S+TRHY FN+   NVTRLCHT++I++VNGKFPGPR++AREGDRV+VKVV
Sbjct  3     LFPEFVV----SITRHYTFNVEYLNVTRLCHTRNILSVNGKFPGPRLVAREGDRVVVKVV  58

Query  338   NHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISW  517
             NHV NNV+IHWHGIRQ+  GWADGPAY+TQCPIQT Q+Y YNFTIVGQRGTL WHAHISW
Sbjct  59    NHVSNNVTIHWHGIRQMTTGWADGPAYVTQCPIQTNQSYTYNFTIVGQRGTLLWHAHISW  118

Query  518   LRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAY  697
             LRAT++GPIIILP++N SYPF KPHKE+P++FGEW+NVD EAV+SQALQ GGGPN+SDAY
Sbjct  119   LRATIYGPIIILPKQNESYPFEKPHKEIPILFGEWFNVDPEAVISQALQTGGGPNVSDAY  178

Query  698   TINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYV  877
             TINGLPGPLYNCS+ +T+ +KVKPGKTYLLR+INAALN+ELFF IANHT+TVVEADA Y 
Sbjct  179   TINGLPGPLYNCSSKDTYTLKVKPGKTYLLRLINAALNEELFFSIANHTLTVVEADAKYT  238

Query  878   KPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPS  1057
             KPF+TD L+IAPGQT NV LKTK   P +TF MAARPYFTG+GTFDNST AG L Y+  S
Sbjct  239   KPFDTDTLLIAPGQTTNVFLKTKPYFPNATFQMAARPYFTGRGTFDNSTTAGTLIYKQHS  298

Query  1058  LNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGT  1237
              N+ KN T  +  P LPPIN TSFV+NFT K RSL +++FP  VPQ VD+ FFFTVGLGT
Sbjct  299   -NV-KNLT--LLKPTLPPINATSFVANFTAKFRSLASAKFPVKVPQKVDRKFFFTVGLGT  354

Query  1238  NPCPKNQTCQGP-NGTKFAASLNNVSFVTPTT-AILQAYYSRKSNGVYATDFPSVPLTPF  1411
             NPCPKN TCQGP N TKFAAS+NN+SF  P++ +I+QAYYS ++NGV+ TDFP+ PL PF
Sbjct  355   NPCPKNTTCQGPSNNTKFAASVNNISFALPSSVSIMQAYYSSQANGVFKTDFPATPLNPF  414

Query  1412  NYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGN  1591
             NYTGTPPNNT V N TK+VVL FN +VELVLQDTSILGAESHPLHLHGY+F+VVGQGFGN
Sbjct  415   NYTGTPPNNTMVTNDTKLVVLKFNTSVELVLQDTSILGAESHPLHLHGYDFFVVGQGFGN  474

Query  1592  FDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWI  1771
             +DP  DPA +NL+DPVERNT GVP+GGW AIRF ADNPGVWFMHCH ++H SWGLRMAW+
Sbjct  475   YDPNNDPARFNLIDPVERNTAGVPAGGWIAIRFFADNPGVWFMHCHLDLHTSWGLRMAWL  534

Query  1772  VKEGKLPNQKLLPPPSDLPKC  1834
             V +G  PNQKL PPPSDLPKC
Sbjct  535   VLDGPEPNQKLQPPPSDLPKC  555



>ref|XP_003552179.1| PREDICTED: laccase-17-like [Glycine max]
Length=584

 Score =   844 bits (2180),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/585 (67%), Positives = 475/585 (81%), Gaps = 3/585 (1%)
 Frame = +2

Query  86    MGFLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIV  265
             MG  +   P  + A F+ ++ +L   P +  AKH  VTRHYKFNI+MQN TRLC TK+IV
Sbjct  1     MGCAYLNMPGFMRAMFV-VLCALMILPELTHAKHARVTRHYKFNIKMQNFTRLCQTKNIV  59

Query  266   TVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTG  445
             TVNG+FPGPRI+AREGDR++VKVVNHV  NV++HWHGIRQ+++ WADGPAYITQCPIQTG
Sbjct  60    TVNGRFPGPRIIAREGDRIMVKVVNHVQYNVTLHWHGIRQLKSAWADGPAYITQCPIQTG  119

Query  446   QTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWW  625
             Q++VYNFT++GQRGTL+WHAHISWLR TL+GPI+ILP+++  YPFP+P +EVP+I GEWW
Sbjct  120   QSFVYNFTVIGQRGTLWWHAHISWLRTTLYGPIVILPKRHVPYPFPQPFREVPIILGEWW  179

Query  626   NVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAA  805
               DTEAV++QA+Q G  PN+SDA+TINGLPGP+ NC+A ETFK+KVKPGKTYLLR+INAA
Sbjct  180   KADTEAVINQAMQTGLAPNVSDAHTINGLPGPVSNCAAKETFKLKVKPGKTYLLRLINAA  239

Query  806   LNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAAR  985
             LNDE+FF IANHT+T+VEADA YVKPF T +++I PGQT+NVLLK K   P +TF ++ R
Sbjct  240   LNDEMFFSIANHTLTMVEADAVYVKPFSTKVVLITPGQTVNVLLKAKSKAPNATFAISTR  299

Query  986   PYFTGQGTFDNSTVAGVLEYEIPSLNISKNSTK--PIALPPLPPINGTSFVSNFTGKLRS  1159
             PY TG   FDN+T  G LEY+ PSL  SK++TK  P+     P  N T F  NF  K+RS
Sbjct  300   PYATGPAAFDNTTATGFLEYKKPSLASSKSNTKKLPLLRAVFPKFNDTVFAMNFHNKVRS  359

Query  1160  LGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAIL  1339
             L +++FPA VP+TVD+ FFFTVGLG + C KNQ CQGPN T+ AA++NNV+FVTP  A+L
Sbjct  360   LASARFPAKVPKTVDRRFFFTVGLGISQCSKNQQCQGPNNTRVAAAVNNVTFVTPNIALL  419

Query  1340  QAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSI  1519
             QA++  KS GVY TDFP+ P   FNYTGTPP+N  V + TK VVLP+N +VELVLQDTSI
Sbjct  420   QAHFFNKSKGVYTTDFPANPPFKFNYTGTPPSNIFVSSGTKAVVLPYNTSVELVLQDTSI  479

Query  1520  LGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRAD  1699
             +GAESHPLHLHG+NF++VGQG GNFDPKKDP  +NLVDP ERNT GVPSGGW A+RF AD
Sbjct  480   IGAESHPLHLHGFNFFIVGQGNGNFDPKKDPKKFNLVDPAERNTAGVPSGGWVAVRFLAD  539

Query  1700  NPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             NPGVWFMHCH EVH SWGL+MAWIV++GK  NQKL PPPSDLPKC
Sbjct  540   NPGVWFMHCHLEVHTSWGLKMAWIVQDGKRRNQKLPPPPSDLPKC  584



>ref|XP_010683865.1| PREDICTED: laccase-17-like [Beta vulgaris subsp. vulgaris]
Length=584

 Score =   844 bits (2180),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/582 (68%), Positives = 470/582 (81%), Gaps = 3/582 (1%)
 Frame = +2

Query  92    FLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTV  271
             FL H+   L    FL++ TS+    + A+AKH  +TR Y F ++MQNVTRLC TKSIVT+
Sbjct  5     FLSHSLSYLHYTLFLLVCTSMAGHKY-ALAKHTGITRRYNFEVKMQNVTRLCQTKSIVTI  63

Query  272   NGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQT  451
             NG+FPGP+I+ REGDR+ + V+NHV  NV++HWHG+RQ+R+GWADGPAYITQCPIQ+GQ+
Sbjct  64    NGQFPGPKIVTREGDRLEITVINHVKYNVTVHWHGVRQLRSGWADGPAYITQCPIQSGQS  123

Query  452   YVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNV  631
             YVYNFTI GQRGTLFWHAHISWLR TL+GPIIILP+    YPFP P+KEVP++FGEWW  
Sbjct  124   YVYNFTITGQRGTLFWHAHISWLRVTLYGPIIILPKHGDFYPFPHPYKEVPIVFGEWWKA  183

Query  632   DTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALN  811
             DTEAV++QA++ G  PN+SDA+TINGLPGPLYNCS  + FK+KVKPGKTYLLR+INAALN
Sbjct  184   DTEAVINQAMKTGSAPNLSDAFTINGLPGPLYNCSTKDVFKLKVKPGKTYLLRLINAALN  243

Query  812   DELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPY  991
             DELFF IANHT+TVVE DA Y KPF+T++++I PGQT NVLL T +  P ++F MAARPY
Sbjct  244   DELFFSIANHTLTVVEVDAIYTKPFKTNIILITPGQTTNVLLTTNNYHPNASFLMAARPY  303

Query  992   FTGQGTFDNSTVAGVLEY-EIPSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGN  1168
              TG  TFDN+T A +LEY   PSL   +   K I  P LP  N TSF + FT KLRSL N
Sbjct  304   ATGPATFDNTTTAAILEYAHDPSLKHKRTKPKLIK-PKLPFFNDTSFAAKFTNKLRSLAN  362

Query  1169  SQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAY  1348
             S+FPANVP+ +D++FFFTVGLG  PCP NQTCQGPN T  AA++NNVSF+ P  A+LQA+
Sbjct  363   SKFPANVPKKIDRHFFFTVGLGLLPCPNNQTCQGPNNTMIAAAVNNVSFIQPKIALLQAH  422

Query  1349  YSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGA  1528
             +  +SNGV+ TDFP+ P   FNYTGTPPNN  +   TKVV LPFN +VELV+QDTSI+GA
Sbjct  423   FFSQSNGVFTTDFPTKPPFSFNYTGTPPNNLMLNKGTKVVTLPFNTSVELVMQDTSIIGA  482

Query  1529  ESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPG  1708
             ESHPLHLHG+NF+VVGQGFGNFD KKDP  +NLVDP+ERNT+GVPSGGW AIRFRADNPG
Sbjct  483   ESHPLHLHGFNFFVVGQGFGNFDSKKDPTKFNLVDPIERNTVGVPSGGWVAIRFRADNPG  542

Query  1709  VWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             VWFMHCH EVH SWGL+MAWIV +G   NQKLLPPPSDLP C
Sbjct  543   VWFMHCHLEVHTSWGLKMAWIVSDGNEKNQKLLPPPSDLPTC  584



>ref|XP_002458747.1| hypothetical protein SORBIDRAFT_03g039530 [Sorghum bicolor]
 gb|EES03867.1| hypothetical protein SORBIDRAFT_03g039530 [Sorghum bicolor]
Length=579

 Score =   843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/577 (68%), Positives = 477/577 (83%), Gaps = 8/577 (1%)
 Frame = +2

Query  119   LAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRI  298
             L  C+++I   + FF   +V       R Y+F+++M NVTRLC +KSIVTVNG+FPGP +
Sbjct  6     LLPCYVLITVLVLFF---SVDVTEGAIREYQFDVQMTNVTRLCSSKSIVTVNGQFPGPPV  62

Query  299   MAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVG  478
              AREGD V+++VVNHVP N+SIHWHG+RQ+R+GWADGPAYITQCPIQ+GQ+YVY FTI G
Sbjct  63    FAREGDFVVIRVVNHVPYNMSIHWHGVRQLRSGWADGPAYITQCPIQSGQSYVYKFTITG  122

Query  479   QRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQA  658
             QRGTL+WHAHISWLRAT++G I+ILP+    YPFP P+KEVP+IFGEWW  DTEAV+SQA
Sbjct  123   QRGTLWWHAHISWLRATVYGAIVILPKPGVPYPFPAPYKEVPVIFGEWWTADTEAVISQA  182

Query  659   LQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIAN  838
             LQ GGGPN+SDA+TINGLPGPLYNCSA +TFK+KVKPGKTY+LR+INAALNDELFF IA 
Sbjct  183   LQTGGGPNVSDAFTINGLPGPLYNCSAKDTFKLKVKPGKTYMLRIINAALNDELFFSIAG  242

Query  839   HTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQ-GTFD  1015
             H +TVV+ DA Y+KP   D ++I PGQT NVLL TK + P +T++M A PY T + GTFD
Sbjct  243   HPLTVVDVDAVYIKPITVDTILITPGQTTNVLLTTKPSYPGATYYMLAAPYSTARPGTFD  302

Query  1016  NSTVAGVLEYEIPSL---NISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPAN  1186
             N+TVAG+LEYE P+    + + N   P   P LP IN TSFV+N+T KLRSL  +++PA 
Sbjct  303   NTTVAGILEYEDPTSPPPHAAFNKNLPALKPTLPQINDTSFVANYTAKLRSLATAEYPAA  362

Query  1187  VPQTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTTAILQAYYSRKS  1363
             VPQ VD+ FFFTVGLGT+PC  N TCQGP N ++FAAS+NNVSFV PTTA+LQ++++ KS
Sbjct  363   VPQEVDRRFFFTVGLGTHPCAVNGTCQGPTNSSRFAASVNNVSFVLPTTALLQSHFAGKS  422

Query  1364  NGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPL  1543
              GVY+++FP+ PL PFNYTGTPPNNT V N TK+VVLP+ A+VELVLQ TSILGAESHPL
Sbjct  423   KGVYSSNFPAAPLVPFNYTGTPPNNTNVANGTKLVVLPYGASVELVLQGTSILGAESHPL  482

Query  1544  HLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMH  1723
             HLHG+NF+VVGQGFGNFDP KDPA YNLVDPVERNT+GVP+ GW AIRFRADNPGVWFMH
Sbjct  483   HLHGFNFFVVGQGFGNFDPAKDPAKYNLVDPVERNTVGVPAAGWVAIRFRADNPGVWFMH  542

Query  1724  CHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             CH EVH+SWGL+MAW+V +G  PN+KLLPPPSDLP+C
Sbjct  543   CHLEVHVSWGLKMAWLVLDGDRPNEKLLPPPSDLPRC  579



>ref|XP_003530212.1| PREDICTED: laccase-17-like [Glycine max]
Length=579

 Score =   843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/582 (72%), Positives = 486/582 (84%), Gaps = 11/582 (2%)
 Frame = +2

Query  98    FHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNG  277
             F +F  L    F   + +LF  P   V    S+TRHY FN+   NVTRLCHT++I++VNG
Sbjct  6     FPSFASLRVLLFGFCVITLF--PEFVV----SITRHYTFNVEYLNVTRLCHTRNILSVNG  59

Query  278   KFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYV  457
             KFPGPR++AREGDRV+VKVVNHV NNVSIHWHGIRQI  GWADGPAY+TQCPIQT Q+Y 
Sbjct  60    KFPGPRLVAREGDRVVVKVVNHVSNNVSIHWHGIRQITTGWADGPAYVTQCPIQTNQSYT  119

Query  458   YNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDT  637
             YNFTIVGQRGTL WHAHISWLRAT++GPIIILP+ N S+PF KPHKE+P++FGEW+NVD 
Sbjct  120   YNFTIVGQRGTLLWHAHISWLRATIYGPIIILPKHNESFPFEKPHKEIPILFGEWFNVDP  179

Query  638   EAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDE  817
             EAV+SQALQ GGGPN+SDAYTINGLPGPLYNCS+ +T+ +KVKPGKTYLLR+INAALN+E
Sbjct  180   EAVISQALQTGGGPNVSDAYTINGLPGPLYNCSSKDTYTLKVKPGKTYLLRLINAALNEE  239

Query  818   LFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFT  997
             LFF IANHT+TVVEADA Y KPF+TD L+IAPGQT NVLLKTK   P +TF M+ARPYFT
Sbjct  240   LFFSIANHTLTVVEADARYTKPFDTDTLLIAPGQTTNVLLKTKPYFPNATFQMSARPYFT  299

Query  998   GQGTFDNSTVAGVLEYEIPSLNIS-KNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQ  1174
             G+GTFDNST AG L Y+ P  N S KN T  +  P LPPIN TSFV+NFT K RSL +++
Sbjct  300   GRGTFDNSTTAGTLIYKQPLKNSSVKNLT--LLKPTLPPINATSFVANFTAKFRSLASAK  357

Query  1175  FPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGP-NGTKFAASLNNVSFVTPTT-AILQAY  1348
             FPA VPQ VD+ FFFTVGLGT+PCPKN TCQGP N TKFAAS+NN+SF  P++ +I+QAY
Sbjct  358   FPAKVPQKVDRKFFFTVGLGTSPCPKNTTCQGPSNNTKFAASVNNISFALPSSVSIMQAY  417

Query  1349  YSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGA  1528
             YS ++NGV+ TDFP+ PL PFNYTGTPPNNT V N TK+VVL FN +VE+VLQDTSILGA
Sbjct  418   YSGQANGVFKTDFPATPLNPFNYTGTPPNNTMVTNDTKLVVLKFNTSVEVVLQDTSILGA  477

Query  1529  ESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPG  1708
             ESHPLHLHGY+F++VGQGFGN+DP  DPA +NL+DPVERNT+GVP+GGW A RF ADNPG
Sbjct  478   ESHPLHLHGYDFFIVGQGFGNYDPNNDPAKFNLIDPVERNTVGVPAGGWIAFRFLADNPG  537

Query  1709  VWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             VWFMHCH ++H SWGLRMAW+V +G  P QKL PPPSDLPKC
Sbjct  538   VWFMHCHLDLHTSWGLRMAWLVLDGPGPKQKLQPPPSDLPKC  579



>ref|XP_006293883.1| hypothetical protein CARUB_v10022868mg, partial [Capsella rubella]
 gb|EOA26781.1| hypothetical protein CARUB_v10022868mg, partial [Capsella rubella]
Length=593

 Score =   843 bits (2179),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/554 (71%), Positives = 469/554 (85%), Gaps = 5/554 (1%)
 Frame = +2

Query  179   AKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNV  358
             A    +TRHY+F+I+++N+TRLC TK+IVTVNGKFPGP++ AREGD + +KVVNHV NN+
Sbjct  43    AASAGITRHYQFDIQLKNITRLCKTKTIVTVNGKFPGPKVTAREGDNLQIKVVNHVSNNI  102

Query  359   SIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHG  538
             SIHWHGIRQ+R GWADGP+Y+TQCPI+TGQ+YVYNFT+ GQRGTL+WHAHI W+RAT++G
Sbjct  103   SIHWHGIRQLRTGWADGPSYVTQCPIRTGQSYVYNFTVTGQRGTLWWHAHIQWMRATVYG  162

Query  539   PIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPG  718
             P+IILP+ +  YPFPKP+K+VP+IFGEW+N D +AVV QALQ GGGPN SDA+T NGLPG
Sbjct  163   PLIILPKLHQPYPFPKPYKQVPIIFGEWFNADPQAVVQQALQTGGGPNASDAHTFNGLPG  222

Query  719   PLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDL  898
             PLYNCS  +T+K+ VKPGKTYLLR+INAAL+DELFF IANHT+TVVEADA YVKPF+T +
Sbjct  223   PLYNCSTKDTYKLMVKPGKTYLLRLINAALDDELFFTIANHTLTVVEADASYVKPFQTSI  282

Query  899   LVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISKNS  1078
             +++ PGQT NVLLKTK + P +TF+M ARPYFTGQGT DN+TVAG+L+Y+  S + SKN 
Sbjct  283   VLLGPGQTTNVLLKTKPSYPNATFYMLARPYFTGQGTIDNTTVAGILQYQHHSKS-SKNL  341

Query  1079  TKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQ  1258
             +  I  P LPPIN TS+ +NFT   RSL +S FPANVP+TVDK FFFTVGLGTNPCPKNQ
Sbjct  342   S--IIKPSLPPINSTSYAANFTKMFRSLASSTFPANVPKTVDKKFFFTVGLGTNPCPKNQ  399

Query  1259  TCQGP-NGTKFAASLNNVSFVTPT-TAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPP  1432
             TCQGP N TKFAAS+NNVSF+ P  T++LQ+Y+  KS  V+ TDFP+ P+ PFNYTGTPP
Sbjct  400   TCQGPTNTTKFAASINNVSFILPNKTSLLQSYFLGKSKNVFMTDFPTAPIFPFNYTGTPP  459

Query  1433  NNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDP  1612
             NNT V   TKVVVL +N TVELVLQ TSILG E+HP+HLHG+NF+VVGQGFGNF+P  DP
Sbjct  460   NNTMVSRGTKVVVLKYNTTVELVLQGTSILGIEAHPIHLHGFNFFVVGQGFGNFNPAIDP  519

Query  1613  ANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLP  1792
               YNLVDPVERNTI VPSGGW AIRF ADNPGVW MHCH E+HLSWGL MAW+V +G LP
Sbjct  520   KQYNLVDPVERNTINVPSGGWVAIRFLADNPGVWLMHCHIEIHLSWGLTMAWVVLDGDLP  579

Query  1793  NQKLLPPPSDLPKC  1834
             NQK+LPPPSD PKC
Sbjct  580   NQKILPPPSDFPKC  593



>ref|XP_004302731.1| PREDICTED: laccase-17-like [Fragaria vesca subsp. vesca]
Length=585

 Score =   843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/592 (69%), Positives = 483/592 (82%), Gaps = 16/592 (3%)
 Frame = +2

Query  86    MGFLFHAFPPLLAACFLMIMTSLFFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIV  265
             MG+L H   P +AA    +  +    P +A  K    TRHY FNI+  NVTRLC T+ IV
Sbjct  1     MGYL-HV--PAMAAWLFGLCVAAALMPELAEGK----TRHYTFNIQYHNVTRLCSTRKIV  53

Query  266   TVNGKFPGPRIMAREGDRVLVKVVNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTG  445
             TVNGKFPGPR++AREGDRVLVKVVNH+  NV+IHWHGIRQ+R+GWADGPAYITQCPIQTG
Sbjct  54    TVNGKFPGPRLVAREGDRVLVKVVNHIKENVTIHWHGIRQLRSGWADGPAYITQCPIQTG  113

Query  446   QTYVYNFTIVGQRGTLFWHAHISWLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWW  625
             Q+Y YNFTI+GQRGTL++HAHISWLR+TL+GPII+LPR+N SYPF KP+KE+P+I GEW+
Sbjct  114   QSYTYNFTIIGQRGTLWYHAHISWLRSTLYGPIILLPRRNESYPFVKPYKEIPIILGEWF  173

Query  626   NVDTEAVVSQALQNGGGPNISDAYTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAA  805
               D EAV++QALQ GGGPN+SDAYT+NGLPGP+YNCS+N+ FK+KVKPGKTY LR+INAA
Sbjct  174   KTDPEAVINQALQTGGGPNVSDAYTLNGLPGPMYNCSSNDVFKLKVKPGKTYHLRLINAA  233

Query  806   LNDELFFRIANHTVTVVEADAGYVKPFETDLLVIAPGQTMNVLLKTKDNPPMSTFFMAAR  985
             LNDELFF +ANH++TVV ADA YVKPF TD+L+I PGQT  VLLKTK N P +TF +  R
Sbjct  234   LNDELFFSVANHSLTVVCADATYVKPFTTDILLITPGQTTGVLLKTKPNFPNATFLILTR  293

Query  986   PYFTGQGTFDNSTVAGVLEYEIP---SLNISKNSTKPIALPPLPPINGTSFVS------N  1138
             PYFTG GT DN+T AG+L+YE P   S   S   T P+  P LPPINGT FV+      N
Sbjct  294   PYFTGAGTLDNTTAAGILKYEHPLSSSGTPSSIKTLPLLKPSLPPINGTKFVNVTQFVQN  353

Query  1139  FTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQTCQGPNGTKFAASLNNVSFV  1318
                K RSL ++++PA VPQTVD+ FFFTVGLGT+PCPKN TCQGPNG KFAA++NNVSF 
Sbjct  354   LASKYRSLDSAKYPAKVPQTVDRKFFFTVGLGTSPCPKNTTCQGPNGQKFAAAINNVSFA  413

Query  1319  TPTTAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPPNNTQVVNATKVVVLPFNATVEL  1498
              P+ A+LQ ++  +SN  Y TDFPS P+  FNYTGTPPNNT V+N+T+ VV+PFN TVEL
Sbjct  414   MPSVAMLQTHFFAQSNVTYRTDFPSNPIVQFNYTGTPPNNTNVINSTRAVVIPFNTTVEL  473

Query  1499  VLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDPANYNLVDPVERNTIGVPSGGWA  1678
             VLQDTSILGAESHPLHLHG+NFY+VGQGFGNFD  KDPA +NLVDPVERNT+GVP+GGWA
Sbjct  474   VLQDTSILGAESHPLHLHGFNFYIVGQGFGNFDQNKDPAKFNLVDPVERNTVGVPAGGWA  533

Query  1679  AIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLPNQKLLPPPSDLPKC  1834
             AIRF ADNPGVWFMHCH E+H SWGL+MAWIV++G  PNQKL PPP+DLP+C
Sbjct  534   AIRFLADNPGVWFMHCHLEIHTSWGLKMAWIVQDGPQPNQKLPPPPADLPQC  585



>ref|XP_004166507.1| PREDICTED: LOW QUALITY PROTEIN: laccase-17-like [Cucumis sativus]
Length=574

 Score =   842 bits (2176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/561 (72%), Positives = 469/561 (84%), Gaps = 7/561 (1%)
 Frame = +2

Query  155   FFFPHMAVAKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKV  334
             F F  +A AK    TRHY FNIR QNVT+L HT  ++TVN + PGP ++AREGDRVL+KV
Sbjct  20    FGFFELAFAK----TRHYTFNIRYQNVTKLRHTVRVLTVNHQLPGPPLVAREGDRVLIKV  75

Query  335   VNHVPNNVSIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHIS  514
             +NHV  NV+IHWHG+RQ++ GWADGPAY+TQCPIQTGQ+Y YNFT+ GQRGTL WHAHIS
Sbjct  76    INHVAENVTIHWHGVRQLQTGWADGPAYVTQCPIQTGQSYTYNFTLNGQRGTLLWHAHIS  135

Query  515   WLRATLHGPIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDA  694
             WLRAT+HGPIIILPR+N SYPF  PHKEV +I GEW+NV+ E+V+ QALQ GGGPN+SDA
Sbjct  136   WLRATIHGPIIILPRRNESYPFENPHKEVAIILGEWFNVNPESVIQQALQTGGGPNVSDA  195

Query  695   YTINGLPGPLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGY  874
             YTING PGPLYN S+ +TFK+KVK G TYLLR+INAALNDELFF IANH++TVV+ DA Y
Sbjct  196   YTINGHPGPLYNSSSKDTFKLKVKAGNTYLLRLINAALNDELFFSIANHSLTVVDVDASY  255

Query  875   VKPFETDLLVIAPGQTMNVLLKTKDNPPM-STFFMAARPYFTGQGTFDNSTVAGVLEYEI  1051
             +KPF+TD+++++PGQT NVLLKT  N P+ STF MAARPYFTGQGTFDNST  G+L Y  
Sbjct  256   IKPFQTDVVLLSPGQTSNVLLKTNPNFPINSTFLMAARPYFTGQGTFDNSTTVGILHYGP  315

Query  1052  PSLNISKNSTKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGL  1231
                 +    T  I  P LP IN T+FV+NF+ KLRSL  ++FP NVPQTVDK FFFTVGL
Sbjct  316   GHSPLPTPITTLI--PNLPAINDTNFVTNFSRKLRSLATAKFPVNVPQTVDKQFFFTVGL  373

Query  1232  GTNPCPKNQTCQGPNGTKFAASLNNVSFVTPTTAILQAYYSRKSNGVYATDFPSVPLTPF  1411
             GT PCPKN TCQGPNGTKFAAS+NN+SF  P+TAIL+AY+SR++NGVY TDFP  P+ PF
Sbjct  374   GTAPCPKNATCQGPNGTKFAASVNNISFALPSTAILEAYFSRRANGVYRTDFPVKPVFPF  433

Query  1412  NYTGTPPNNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGN  1591
             NYTGTPPNNT V N+T +VVLPFNA+VE+VLQ TSILGAESHPLHLHG+NFY+VG+GFGN
Sbjct  434   NYTGTPPNNTLVSNSTSLVVLPFNASVEVVLQGTSILGAESHPLHLHGFNFYIVGEGFGN  493

Query  1592  FDPKKDPANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWI  1771
             FDP KDPAN+NLVDPVERNT GVP+GGW A RF ADNPGVWFMHCH +VH SWGLRMAWI
Sbjct  494   FDPNKDPANFNLVDPVERNTAGVPAGGWIAFRFFADNPGVWFMHCHLDVHTSWGLRMAWI  553

Query  1772  VKEGKLPNQKLLPPPSDLPKC  1834
             V +G  PNQKL PPP+DLPKC
Sbjct  554   VLDGPKPNQKLPPPPADLPKC  574



>gb|ABW81166.1| unknown [Capsella rubella]
Length=573

 Score =   842 bits (2176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/554 (71%), Positives = 469/554 (85%), Gaps = 5/554 (1%)
 Frame = +2

Query  179   AKHGSVTRHYKFNIRMQNVTRLCHTKSIVTVNGKFPGPRIMAREGDRVLVKVVNHVPNNV  358
             A    +TRHY+F+I+++N+TRLC TK+IVTVNGKFPGP++ AREGD + +KVVNHV NN+
Sbjct  23    AASAGITRHYQFDIQLKNITRLCKTKTIVTVNGKFPGPKVTAREGDNLQIKVVNHVSNNI  82

Query  359   SIHWHGIRQIRNGWADGPAYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHISWLRATLHG  538
             SIHWHGIRQ+R GWADGP+Y+TQCPI+TGQ+YVYNFT+ GQRGTL+WHAHI W+RAT++G
Sbjct  83    SIHWHGIRQLRTGWADGPSYVTQCPIRTGQSYVYNFTVTGQRGTLWWHAHIQWMRATVYG  142

Query  539   PIIILPRKNTSYPFPKPHKEVPMIFGEWWNVDTEAVVSQALQNGGGPNISDAYTINGLPG  718
             P+IILP+ +  YPFPKP+K+VP+IFGEW+N D +AVV QALQ GGGPN SDA+T NGLPG
Sbjct  143   PLIILPKLHQPYPFPKPYKQVPIIFGEWFNADPQAVVQQALQTGGGPNASDAHTFNGLPG  202

Query  719   PLYNCSANETFKVKVKPGKTYLLRMINAALNDELFFRIANHTVTVVEADAGYVKPFETDL  898
             PLYNCS  +T+K+ VKPGKTYLLR+INAAL+DELFF IANHT+TVVEADA YVKPF+T +
Sbjct  203   PLYNCSTKDTYKLMVKPGKTYLLRLINAALDDELFFTIANHTLTVVEADASYVKPFQTSI  262

Query  899   LVIAPGQTMNVLLKTKDNPPMSTFFMAARPYFTGQGTFDNSTVAGVLEYEIPSLNISKNS  1078
             +++ PGQT NVLLKTK + P +TF+M ARPYFTGQGT DN+TVAG+L+Y+  S + SKN 
Sbjct  263   VLLGPGQTTNVLLKTKPSYPNATFYMLARPYFTGQGTIDNTTVAGILQYQHHSQS-SKNL  321

Query  1079  TKPIALPPLPPINGTSFVSNFTGKLRSLGNSQFPANVPQTVDKNFFFTVGLGTNPCPKNQ  1258
             +  I  P LPPIN TS+ +NFT   RSL +S FPANVP+TVDK FFFTVGLGTNPCPKNQ
Sbjct  322   S--IIKPSLPPINSTSYAANFTKMFRSLASSTFPANVPKTVDKKFFFTVGLGTNPCPKNQ  379

Query  1259  TCQGP-NGTKFAASLNNVSFVTPT-TAILQAYYSRKSNGVYATDFPSVPLTPFNYTGTPP  1432
             TCQGP N TKFAAS+NNVSF+ P  T++LQ+Y+  KS  V+ TDFP+ P+ PFNYTGTPP
Sbjct  380   TCQGPTNTTKFAASINNVSFILPNKTSLLQSYFLGKSKNVFMTDFPTAPIFPFNYTGTPP  439

Query  1433  NNTQVVNATKVVVLPFNATVELVLQDTSILGAESHPLHLHGYNFYVVGQGFGNFDPKKDP  1612
             NNT V   TKVVVL +N TVELVLQ TSILG E+HP+HLHG+NF+VVGQGFGNF+P  DP
Sbjct  440   NNTMVSRGTKVVVLKYNTTVELVLQGTSILGIEAHPIHLHGFNFFVVGQGFGNFNPAIDP  499

Query  1613  ANYNLVDPVERNTIGVPSGGWAAIRFRADNPGVWFMHCHFEVHLSWGLRMAWIVKEGKLP  1792
               YNLVDPVERNTI VPSGGW AIRF ADNPGVW MHCH E+HLSWGL MAW+V +G LP
Sbjct  500   KQYNLVDPVERNTINVPSGGWVAIRFLADNPGVWLMHCHIEIHLSWGLTMAWVVLDGDLP  559

Query  1793  NQKLLPPPSDLPKC  1834
             NQK+LPPPSD PKC
Sbjct  560   NQKILPPPSDFPKC  573



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6406512166935