BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79598_g1_i1 len=899 path=[877:0-898]

Length=899
                                                                      Score     E

ref|XP_009762176.1|  PREDICTED: uncharacterized protein LOC104214...    255   1e-80   
ref|XP_009606603.1|  PREDICTED: uncharacterized protein LOC104100939    251   4e-79   
ref|XP_004228475.1|  PREDICTED: uncharacterized protein LOC101252420    241   3e-75   
ref|XP_006362727.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    235   4e-73   
ref|XP_011090252.1|  PREDICTED: uncharacterized protein LOC105170...    233   6e-72   
emb|CDP09734.1|  unnamed protein product                                228   4e-70   
gb|ABK96437.1|  unknown                                                 199   1e-58   Populus trichocarpa x Populus deltoides
gb|EYU35989.1|  hypothetical protein MIMGU_mgv1a013002mg                199   1e-58   
ref|XP_011043769.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     198   2e-58   
ref|XP_002313623.2|  forkhead-associated domain-containing family...    197   4e-58   Populus trichocarpa [western balsam poplar]
ref|XP_002526687.1|  conserved hypothetical protein                     196   1e-57   Ricinus communis
ref|XP_006470187.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    195   4e-57   
gb|KDP22822.1|  hypothetical protein JCGZ_00409                         192   2e-56   
gb|KDO47649.1|  hypothetical protein CISIN_1g040067mg                   189   3e-55   
ref|XP_006446681.1|  hypothetical protein CICLE_v10016536mg             189   9e-55   
ref|XP_010243732.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    186   7e-54   
ref|XP_008231086.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     182   3e-52   
ref|XP_004295125.1|  PREDICTED: uncharacterized protein LOC101297045    181   5e-52   
emb|CDX82041.1|  BnaC08g35600D                                          181   8e-52   
ref|XP_010031626.1|  PREDICTED: probable serine/threonine-protein...    180   2e-51   
ref|XP_009117389.1|  PREDICTED: uncharacterized protein LOC103842515    179   3e-51   
ref|NP_001242194.1|  uncharacterized protein LOC100808269               179   4e-51   
gb|KHN08864.1|  Zeaxanthin epoxidase, chloroplastic                     179   4e-51   
gb|KCW50990.1|  hypothetical protein EUGRSUZ_J00617                     180   9e-51   
ref|XP_004502003.1|  PREDICTED: probable serine/threonine-protein...    177   2e-50   
ref|XP_002878556.1|  forkhead-associated domain-containing protein      173   6e-49   
gb|KHF99285.1|  Zeaxanthin epoxidase, chloroplastic                     173   7e-49   
ref|XP_003592233.1|  Zeaxanthin epoxidase                               173   7e-49   
ref|XP_010429074.1|  PREDICTED: uncharacterized protein LOC104713606    172   1e-48   
ref|XP_010416905.1|  PREDICTED: uncharacterized protein LOC104702696    172   1e-48   
ref|XP_003601330.1|  Zeaxanthin epoxidase                               173   1e-48   
ref|NP_179748.2|  SMAD/FHA domain-containing protein                    172   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010472149.1|  PREDICTED: uncharacterized protein LOC104751808    172   1e-48   
ref|XP_002273249.1|  PREDICTED: uncharacterized protein LOC100263360    172   1e-48   Vitis vinifera
ref|XP_008349827.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    171   5e-48   
ref|XP_009376098.1|  PREDICTED: uncharacterized protein LOC103964837    171   6e-48   
gb|KFK32887.1|  hypothetical protein AALP_AA6G300700                    169   3e-47   
ref|XP_010922882.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     168   6e-47   
ref|XP_006829838.1|  hypothetical protein AMTR_s00119p00102250          168   7e-47   
ref|XP_006404604.1|  hypothetical protein EUTSA_v10000320mg             168   7e-47   
ref|XP_010685506.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     168   7e-47   
emb|CBI24353.3|  unnamed protein product                                175   4e-45   
ref|XP_008792515.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     163   5e-45   
ref|XP_004149650.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    162   5e-45   
ref|XP_007146045.1|  hypothetical protein PHAVU_006G008100g             160   5e-45   
ref|XP_010544317.1|  PREDICTED: uncharacterized protein LOC104816966    161   2e-44   
ref|XP_007015531.1|  NADH:cytochrome B5 reductase 1                     166   4e-44   
dbj|BAJ92505.1|  predicted protein                                      159   1e-43   
gb|AEC10968.1|  hypothetical protein                                    159   2e-43   
ref|XP_010243734.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    157   3e-43   
ref|XP_009386736.1|  PREDICTED: uncharacterized protein LOC103973800    158   4e-43   
ref|XP_010093833.1|  FHA domain-containing protein                      154   1e-42   
ref|XP_010243733.1|  PREDICTED: uncharacterized protein LOC104587...    154   6e-42   
ref|XP_002985954.1|  hypothetical protein SELMODRAFT_446441             155   9e-42   
ref|XP_006379353.1|  hypothetical protein POPTR_0009s15850g             154   1e-41   
ref|XP_004978482.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    154   3e-41   
ref|XP_007205979.1|  hypothetical protein PRUPE_ppa012118mg             152   4e-41   
ref|XP_004977424.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    153   5e-41   
ref|XP_001757941.1|  predicted protein                                  152   1e-40   
ref|XP_011090253.1|  PREDICTED: uncharacterized protein LOC105170...    149   3e-40   
ref|XP_002984897.1|  hypothetical protein SELMODRAFT_446054             154   5e-40   
ref|XP_001756090.1|  predicted protein                                  150   3e-39   
ref|XP_003577863.1|  PREDICTED: uncharacterized protein LOC100835270    147   5e-39   
ref|XP_008449952.1|  PREDICTED: uncharacterized protein LOC103491680    147   6e-39   
ref|XP_002442729.1|  hypothetical protein SORBIDRAFT_08g001890          147   6e-39   Sorghum bicolor [broomcorn]
gb|ACN28698.1|  unknown                                                 146   1e-38   Zea mays [maize]
ref|XP_006662695.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    145   3e-38   
ref|NP_001150384.1|  FHA domain containing protein                      144   6e-38   Zea mays [maize]
ref|NP_001066037.1|  Os12g0124000                                       144   1e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663771.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    143   2e-37   
ref|NP_001065631.1|  Os11g0127800                                       143   3e-37   Oryza sativa Japonica Group [Japonica rice]
gb|EEC67581.1|  hypothetical protein OsI_34939                          143   4e-37   Oryza sativa Indica Group [Indian rice]
gb|ABA95708.2|  FHA domain containing protein, expressed                140   2e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008672946.1|  PREDICTED: FHA domain containing protein iso...    138   2e-35   
gb|ABK23956.1|  unknown                                                 135   2e-34   Picea sitchensis
gb|AAD23697.1|  unknown protein                                         133   2e-33   Arabidopsis thaliana [mouse-ear cress]
gb|ABA95709.1|  FHA domain containing protein, expressed                134   2e-33   Oryza sativa Japonica Group [Japonica rice]
gb|EMT21373.1|  hypothetical protein F775_26787                         131   6e-33   
gb|ABK23669.1|  unknown                                                 128   9e-32   Picea sitchensis
gb|ABK26653.1|  unknown                                                 121   6e-29   Picea sitchensis
gb|ABK22834.1|  unknown                                                 119   5e-28   Picea sitchensis
ref|XP_005644709.1|  SMAD/FHA domain-containing protein                 115   2e-27   
ref|XP_004502004.1|  PREDICTED: probable serine/threonine-protein...    116   2e-27   
ref|XP_002503308.1|  predicted protein                                98.6    2e-21   Micromonas commoda
gb|EMS51992.1|  hypothetical protein TRIUR3_21495                     89.7    1e-18   
ref|XP_005843548.1|  hypothetical protein CHLNCDRAFT_140170           90.5    1e-18   
ref|XP_003080696.1|  forkhead-associated domain-containing protei...  88.6    8e-18   
gb|KFM26549.1|  hypothetical protein F751_2136                        88.2    1e-17   
ref|XP_006384725.1|  hypothetical protein POPTR_0004s20540g           84.7    7e-17   
ref|XP_001692997.1|  predicted protein                                82.8    6e-16   Chlamydomonas reinhardtii
ref|XP_001419098.1|  predicted protein                                75.9    1e-13   Ostreococcus lucimarinus CCE9901
ref|XP_007513773.1|  predicted protein                                70.9    2e-11   
gb|ABG22342.1|  FHA domain containing protein, expressed              67.0    3e-10   
gb|EPS57360.1|  hypothetical protein M569_17458                       66.2    4e-10   
ref|XP_002956933.1|  hypothetical protein VOLCADRAFT_107456           64.7    1e-09   
ref|XP_003058427.1|  predicted protein                                63.2    1e-08   
ref|WP_022350182.1|  fHA domain-containing protein                    58.9    2e-06   
ref|WP_036514781.1|  hypothetical protein                             58.5    2e-06   
ref|WP_014063273.1|  signal peptide protein                           55.5    3e-06   
ref|WP_029915524.1|  hypothetical protein                             54.3    5e-06   
ref|XP_003062638.1|  predicted protein                                57.4    8e-06   
ref|WP_022464028.1|  fOG: FHA domain                                  56.6    9e-06   
ref|WP_033372494.1|  hypothetical protein                             53.5    9e-06   
ref|WP_013565725.1|  protein serine phosphatase with GAF(s) senso...  57.0    9e-06   
ref|WP_027428265.1|  hypothetical protein                             56.6    1e-05   
gb|ETX02374.1|  hypothetical protein ETSY2_35690                      53.5    1e-05   
ref|WP_022025104.1|  forkhead-associated domain-containing protein    53.5    1e-05   
gb|ELT87041.1|  hypothetical protein CAPTEDRAFT_113758                53.1    2e-05   
ref|WP_022303141.1|  putative uncharacterized protein                 56.2    2e-05   
ref|WP_012995733.1|  MULTISPECIES: signal peptide protein             52.8    2e-05   
ref|WP_029689419.1|  signal peptide protein                           52.8    2e-05   
ref|WP_012269067.1|  MULTISPECIES: signal peptide protein             52.8    2e-05   
gb|KHO63099.1|  signal peptide protein                                52.8    2e-05   
ref|WP_006569482.1|  signal peptide protein                           52.8    3e-05   
ref|WP_022154966.1|  fHA domain-containing protein                    55.1    3e-05   
ref|WP_003869421.1|  MULTISPECIES: signal peptide protein             52.4    3e-05   
gb|ETI81903.1|  FHA protein                                           51.6    4e-05   
ref|WP_016293272.1|  hypothetical protein                             55.1    4e-05   
ref|WP_003866600.1|  signal peptide protein                           52.4    4e-05   
ref|XP_005646300.1|  FAD/NAD(P)-binding domain-containing protein     55.1    4e-05   
gb|KFM26740.1|  PsbD mRNA maturation factor Nac2, chloroplastic       54.7    4e-05   
ref|XP_005844735.1|  hypothetical protein CHLNCDRAFT_138731           55.1    4e-05   
ref|WP_027295314.1|  hypothetical protein                             54.7    5e-05   
ref|WP_022588813.1|  signal peptide protein                           52.0    5e-05   
ref|WP_014148586.1|  hypothetical protein                             54.7    5e-05   
ref|WP_034232404.1|  hypothetical protein                             54.7    5e-05   
ref|WP_038110302.1|  signal peptide protein                           51.2    6e-05   
ref|WP_022305566.1|  fHA domain protein                               54.3    6e-05   
ref|WP_026505130.1|  hypothetical protein                             54.3    6e-05   
ref|WP_036940127.1|  hypothetical protein                             53.9    7e-05   
ref|WP_022500420.1|  fHA domain-containing protein                    52.4    8e-05   
ref|WP_025280909.1|  hypothetical protein                             52.8    8e-05   
ref|WP_032120338.1|  signal peptide protein                           51.6    8e-05   
ref|XP_007512359.1|  predicted protein                                53.5    9e-05   
gb|ESA33559.1|  fha domain-containing protein                         52.0    9e-05   
ref|WP_012639099.1|  FHA-domain containing protein                    52.8    9e-05   
ref|WP_035837634.1|  hypothetical protein                             50.4    1e-04   
ref|WP_036054502.1|  hypothetical protein                             51.2    1e-04   
ref|WP_031460416.1|  transcriptional regulator                        52.0    1e-04   
ref|WP_022118583.1|  putative uncharacterized protein                 50.8    2e-04   
ref|XP_002503779.1|  predicted protein                                52.8    2e-04   Micromonas commoda
ref|WP_038040214.1|  signal peptide protein                           52.0    2e-04   
ref|WP_022211499.1|  fHA domain-containing protein                    50.1    2e-04   
ref|WP_031158523.1|  signal peptide protein                           50.8    2e-04   
ref|WP_016310066.1|  hypothetical protein                             52.0    2e-04   
ref|WP_022864685.1|  signal peptide protein                           51.2    3e-04   
ref|WP_022806647.1|  MULTISPECIES: hypothetical protein               52.0    3e-04   
ref|WP_029665269.1|  hypothetical protein                             52.0    3e-04   
ref|WP_004623272.1|  FHA domain-containing protein [                  52.4    3e-04   
ref|WP_022804813.1|  hypothetical protein                             51.6    3e-04   
ref|WP_011186044.1|  hypothetical protein                             49.7    3e-04   
ref|WP_026524471.1|  hypothetical protein                             52.4    3e-04   
ref|WP_011026104.1|  signal peptide protein                           49.7    3e-04   
ref|WP_014433629.1|  hypothetical protein                             50.8    3e-04   
ref|WP_011563025.1|  FHA domain-containing protein                    51.6    3e-04   
ref|WP_026670308.1|  hypothetical protein                             52.0    3e-04   
ref|XP_003081796.1|  unnamed protein product                          52.4    3e-04   
gb|ETW93183.1|  hypothetical protein ETSY1_40330                      48.9    3e-04   
ref|WP_026910202.1|  signal peptide protein                           49.7    3e-04   
ref|WP_034464183.1|  hypothetical protein                             48.5    4e-04   
emb|CEF99501.1|  Plastid lipid-associated protein/fibrillin conse...  52.0    4e-04   
ref|WP_006722190.1|  hypothetical protein                             48.9    4e-04   
ref|WP_016230504.1|  hypothetical protein                             51.6    4e-04   
ref|WP_010075084.1|  signal peptide protein                           49.3    4e-04   
ref|WP_021937959.1|  fOG: FHA domain                                  52.0    4e-04   
ref|WP_037321164.1|  phosphopeptide-binding protein                   52.0    4e-04   
ref|WP_028460015.1|  transcriptional regulator                        50.4    4e-04   
ref|WP_012615434.1|  transcriptional regulator                        50.4    5e-04   
ref|WP_034926892.1|  hypothetical protein                             48.1    5e-04   
ref|WP_034427613.1|  hypothetical protein                             48.5    5e-04   
ref|WP_022067065.1|  fOG: FHA domain                                  51.6    5e-04   
gb|ABA95711.2|  FHA domain containing protein, expressed              48.9    5e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009610655.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic   51.6    5e-04   
ref|WP_021844532.1|  putative uncharacterized protein                 48.9    5e-04   
ref|WP_005945281.1|  hypothetical protein                             48.9    5e-04   
ref|WP_020074870.1|  hypothetical protein                             51.2    5e-04   
ref|WP_028027626.1|  hypothetical protein                             50.8    6e-04   
gb|KFE61034.1|  sigma-54 dependent transcriptional regulator, Fis...  50.8    7e-04   
ref|WP_012801540.1|  FHA domain-containing protein                    48.9    8e-04   
ref|WP_029947102.1|  hypothetical protein                             50.8    8e-04   
ref|WP_027892600.1|  hypothetical protein                             50.4    8e-04   
gb|AHI05308.1|  large Ala/Glu-rich protein                            51.2    8e-04   
ref|WP_031077583.1|  peptide-binding protein                          48.9    8e-04   
gb|AEV81059.2|  Oxoglutarate dehydrogenase inhibitor                  50.1    8e-04   
gb|KDP90614.1|  hypothetical protein W824_14115                       50.4    9e-04   
ref|WP_030440921.1|  signal peptide protein                           50.1    9e-04   
ref|WP_022213982.1|  fOG: FHA domain                                  50.8    9e-04   
ref|WP_019464818.1|  hypothetical protein                             48.5    0.001   
ref|WP_034454388.1|  hypothetical protein                             47.4    0.001   
emb|CBJ48848.1|  Chain A, Crystal Structure Of The Brct Repeat Re...  51.2    0.001   
gb|KFE70542.1|  serine/threonine protein kinase                       50.8    0.001   
ref|WP_015489875.1|  hypothetical protein containing putative FHA...  50.4    0.001   
ref|WP_012037861.1|  hypothetical protein                             50.4    0.001   
ref|WP_014440161.1|  signal peptide protein                           50.1    0.001   
ref|WP_018190852.1|  hypothetical protein                             50.4    0.001   
gb|KHD76364.1|  signal peptide protein                                50.1    0.001   
ref|WP_014687139.1|  signal peptide protein                           50.1    0.001   
ref|WP_038288502.1|  signal peptide protein [                         48.5    0.001   



>ref|XP_009762176.1| PREDICTED: uncharacterized protein LOC104214226 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009762183.1| PREDICTED: uncharacterized protein LOC104214226 isoform X2 [Nicotiana 
sylvestris]
Length=208

 Score =   255 bits (651),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 152/188 (81%), Gaps = 2/188 (1%)
 Frame = +2

Query  119  MELTTTTQSLSHSKIPKLFS--NGGATVFAQNSVNFLGYNCLPRNLQCTAKHLSSLGAIH  292
            M+LTT +QS+S++ +PKL S  +  AT+ + NS+N LG+NC+PR L+C A+ L   GAIH
Sbjct  1    MDLTTISQSISYANLPKLPSLFHSRATLCSSNSINILGFNCIPRKLKCNARQLRQFGAIH  60

Query  293  ASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPV  472
            AS  +  ST VS+ WLLE +GDGD +HIG PTA PG+ EI SGA+TVGRV+EKADMVIPV
Sbjct  61   ASVAESNSTNVSVTWLLEFIGDGDARHIGSPTAKPGSLEIPSGAVTVGRVAEKADMVIPV  120

Query  473  PTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFR  652
            PTVS  HA L+  E+ LVVTDLDSTNGTFI EKRLRPGVAAAALPG+ +TFGDT+LAIFR
Sbjct  121  PTVSAVHALLQSMEEYLVVTDLDSTNGTFIGEKRLRPGVAAAALPGSLLTFGDTNLAIFR  180

Query  653  VSKLEKVD  676
            V+KLEK++
Sbjct  181  VAKLEKME  188



>ref|XP_009606603.1| PREDICTED: uncharacterized protein LOC104100939 [Nicotiana tomentosiformis]
Length=209

 Score =   251 bits (640),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 154/200 (77%), Gaps = 5/200 (3%)
 Frame = +2

Query  119  MELTTTTQSLSHSKIPKLFS--NGGATVFAQNSVNFLGYNCLPRNLQCTA-KHLSSLGAI  289
            MELTTT+QSLS++ +PKL S       V + NS+N LG+NC+PR L+C A K L   GAI
Sbjct  1    MELTTTSQSLSYANLPKLPSLFPSRVNVCSSNSINILGFNCIPRKLKCNARKQLRQFGAI  60

Query  290  HASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIP  469
            HAS  +  ST VS+ WLLE +GDGD +HIG PTA PG+ EI SGA+TVGR++EKADMVIP
Sbjct  61   HASVAESNSTNVSVTWLLEFIGDGDARHIGSPTAKPGSLEIPSGAVTVGRLAEKADMVIP  120

Query  470  VPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIF  649
            VPTVS  HA L+  E+ LVVTDLDSTNGTFI EKRLRPGVAAAA PG+ +TFGDT+LAIF
Sbjct  121  VPTVSAVHALLQSMEEYLVVTDLDSTNGTFIGEKRLRPGVAAAASPGSLLTFGDTNLAIF  180

Query  650  RVSKLEKVD--DAPEEQEDD  703
            RV+KLEK++    PE+ E +
Sbjct  181  RVAKLEKMETPSEPEKAEAN  200



>ref|XP_004228475.1| PREDICTED: uncharacterized protein LOC101252420 [Solanum lycopersicum]
Length=202

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 149/188 (79%), Gaps = 2/188 (1%)
 Frame = +2

Query  119  MELTTTTQSLSHSKIPKL--FSNGGATVFAQNSVNFLGYNCLPRNLQCTAKHLSSLGAIH  292
            MELTTT+QS+S++ +PK+  F     T+ + NS+NFLGYNC+ + ++C+A+ L   G I+
Sbjct  1    MELTTTSQSISYANLPKIPSFFPSRVTISSSNSINFLGYNCITKKIKCSARQLRHFGPIY  60

Query  293  ASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPV  472
            AS  +  ST  S+ W+LE +GDGDT+HIG PTA P + EI SGA+ VGRV++KAD+VIPV
Sbjct  61   ASMVESNSTNGSVSWILEFIGDGDTRHIGSPTAKPRSLEIPSGAVIVGRVADKADVVIPV  120

Query  473  PTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFR  652
            PTVS  HARL++ ED LVVTDLDSTNGTFI EKRL PGVAAAALPG+ +TFGDT+LAIFR
Sbjct  121  PTVSAIHARLQNMEDYLVVTDLDSTNGTFIGEKRLVPGVAAAALPGSLVTFGDTNLAIFR  180

Query  653  VSKLEKVD  676
            V+K EK++
Sbjct  181  VAKFEKME  188



>ref|XP_006362727.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Solanum 
tuberosum]
Length=202

 Score =   235 bits (600),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 147/188 (78%), Gaps = 4/188 (2%)
 Frame = +2

Query  119  MELTTTTQSLSH---SKIPKLFSNGGATVFAQNSVNFLGYNCLPRNLQCTAKHLSSLGAI  289
            MELTTT+QS+S+    K+P  F +   T+ + NS+NFLG+NC+ + L+C+A+ L   G I
Sbjct  1    MELTTTSQSISYVNLQKVPSFFPSR-VTISSSNSINFLGFNCITKKLKCSARQLKHFGPI  59

Query  290  HASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIP  469
            +AS  +  ST  S+ W+LE +GDGDT+HIG PTA P + EI SGA+ VGRV++KAD+VIP
Sbjct  60   YASVVESNSTNGSVSWVLEFIGDGDTRHIGSPTAKPRSLEIPSGAVIVGRVADKADVVIP  119

Query  470  VPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIF  649
            VPTVS  HARL++ ED LVVTDLDSTNGTFI EKRL PGVAAAALPG+ +TFGDT+LAIF
Sbjct  120  VPTVSAIHARLQNMEDYLVVTDLDSTNGTFIGEKRLVPGVAAAALPGSLVTFGDTNLAIF  179

Query  650  RVSKLEKV  673
            RV+K EK+
Sbjct  180  RVAKFEKL  187



>ref|XP_011090252.1| PREDICTED: uncharacterized protein LOC105170974 isoform X1 [Sesamum 
indicum]
Length=211

 Score =   233 bits (593),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 115/196 (59%), Positives = 147/196 (75%), Gaps = 5/196 (3%)
 Frame = +2

Query  119  MELTTTTQSLSHSKIPKL---FSNGGATVFAQNSVNFLGYNCLPRNLQCTAKHLSSLGAI  289
            ME+TT   SLS++K       F    ++V AQ SVNFLGYNCLPR L+C+ + L + GAI
Sbjct  1    MEMTT--HSLSYAKTNSFSPGFFPAKSSVAAQFSVNFLGYNCLPRKLKCSGRQLRNFGAI  58

Query  290  HASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIP  469
             AS+   +S   S++WLLEP+GDGDT+HIGY  AMP  FEI+S  +TVGRV EKAD+VI 
Sbjct  59   RASDSGNSSADGSVRWLLEPIGDGDTRHIGYKIAMPSPFEIASNVVTVGRVPEKADIVIS  118

Query  470  VPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIF  649
            VPTVS  HAR++ T++ L++TDLDSTNGTFIDEKRL+PGV +AA PG  +TFGDT+LAIF
Sbjct  119  VPTVSALHARIQKTDENLLITDLDSTNGTFIDEKRLQPGVVSAASPGNLVTFGDTNLAIF  178

Query  650  RVSKLEKVDDAPEEQE  697
            RV KL++ + A E +E
Sbjct  179  RVYKLKQEEFAYEPEE  194



>emb|CDP09734.1| unnamed protein product [Coffea canephora]
Length=204

 Score =   228 bits (580),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 148/207 (71%), Gaps = 6/207 (3%)
 Frame = +2

Query  119  MELTTTTQSLSHSKI-PKLFSNGGATVFAQNSVNFL--GYNCLPRNLQCTAKHLSSLGAI  289
            ME+   T+SLS+ K+ PK  S   A VF   + N L   +NCLPR LQC+AK L +LGAI
Sbjct  1    MEIIVNTESLSYVKLLPKPLS--PAVVFPSRA-NVLSHNFNCLPRKLQCSAKQLRNLGAI  57

Query  290  HASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIP  469
            +AS    +ST V  KW+LEP+GDGDTKH+G   AMP AFEI+S  IT+GR ++K D+ IP
Sbjct  58   YASGADSSSTNVVEKWILEPIGDGDTKHLGEKIAMPNAFEIASSVITIGRTADKVDVAIP  117

Query  470  VPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIF  649
            VPTVSG HAR+   E  LV+TDLDSTNGTFID++RL+PGV A A+PG+RITFGD HLA+F
Sbjct  118  VPTVSGVHARIEKAEKSLVITDLDSTNGTFIDQRRLKPGVPAFAVPGSRITFGDVHLAVF  177

Query  650  RVSKLEKVDDAPEEQEDDGAKGGPSSS  730
            RVSKLE  + + E + +   + G  S+
Sbjct  178  RVSKLEVEEPSNEPEAEAKVEEGADSN  204



>gb|ABK96437.1| unknown [Populus trichocarpa x Populus deltoides]
Length=220

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 135/206 (66%), Gaps = 10/206 (5%)
 Frame = +2

Query  125  LTTTTQSLSHSKIPKLFSN-------GGATVFAQNSVNFLGYNCLPRNLQ---CTAKHLS  274
            +  TTQSLSH+K+P   ++         A++ A NS+ F         LQ     AK   
Sbjct  1    MDITTQSLSHAKLPGCSTSLATPIFHSKASLLAHNSITFQSPKNFFTQLQGVRIKAKKQR  60

Query  275  SLGAIHASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKA  454
            SLGA+HAS    T T V  +WLL PVGDGD+ HIG+   MP AFEI+S  +TVGR+ +KA
Sbjct  61   SLGAVHASGADSTLTDVEERWLLVPVGDGDSGHIGFKVKMPDAFEIASSEVTVGRLPDKA  120

Query  455  DMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDT  634
            DMVIPV TVS  HAR+++    LVVTDLDSTNGTFID+KRL PG + +  PG+RITFGDT
Sbjct  121  DMVIPVATVSALHARIQNKGGNLVVTDLDSTNGTFIDKKRLPPGASVSVSPGSRITFGDT  180

Query  635  HLAIFRVSKLEKVDDAPEEQEDDGAK  712
            HLA+F VSKL KV+ AP + E+   K
Sbjct  181  HLAMFLVSKLAKVESAPSKSEESQDK  206



>gb|EYU35989.1| hypothetical protein MIMGU_mgv1a013002mg [Erythranthe guttata]
Length=233

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 134/186 (72%), Gaps = 14/186 (8%)
 Frame = +2

Query  143  SLSHSKIPKLFSNGGATVFAQNSVNFLGY-NCLPRNLQCTAKHLS----SLGAI--HASE  301
            SLS++K   L S    T+FA   +NF+G+ N   R L+ + +         G I   A+ 
Sbjct  28   SLSYAKANSLIS---PTIFAHRPLNFVGFKNWQHRKLESSERKWEYSERKFGGIIIRAAA  84

Query  302  GQITSTAV---SIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPV  472
            G+ + TAV   S++W+L+P+GDGD KHIGY TAMPGAFEI+S  +TVGRV EKAD+VI V
Sbjct  85   GE-SGTAVVDASVRWILQPIGDGDFKHIGYKTAMPGAFEIASDVVTVGRVREKADIVISV  143

Query  473  PTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFR  652
            PTVSG HAR+R TE+ L++TDLDSTNGT+IDEKRL+PGV +AA PG  I FGD +LAIFR
Sbjct  144  PTVSGLHARIRKTEENLLITDLDSTNGTYIDEKRLQPGVVSAASPGNLIIFGDANLAIFR  203

Query  653  VSKLEK  670
            VSKLEK
Sbjct  204  VSKLEK  209



>ref|XP_011043769.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Populus euphratica]
Length=220

 Score =   198 bits (503),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 144/218 (66%), Gaps = 14/218 (6%)
 Frame = +2

Query  125  LTTTTQSLSHSKIPKLFSNGGATVFAQNSVNFLGYNCL----PRN-------LQCTAKHL  271
            +  TTQSLSH K+P   ++    +F  +  + L +N +    P+N       ++  AK  
Sbjct  1    MDITTQSLSHVKLPGCSTSLATPIF-HSKASLLAHNSIIFQSPKNFFTQLQGVRIKAKKQ  59

Query  272  SSLGAIHASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEK  451
             SLGA+HAS  + T T V  +WLL PVGDGD+ HIG+   MP AFEI+S  +TVGR+ +K
Sbjct  60   RSLGAVHASGAESTLTDVEERWLLVPVGDGDSGHIGFKVKMPDAFEIASSEVTVGRLPDK  119

Query  452  ADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGD  631
            ADMVIPV TVS  HAR+++    LVVTDLDSTNGTFID+KRL PG + +  PG+RITFGD
Sbjct  120  ADMVIPVATVSALHARIQNKGGNLVVTDLDSTNGTFIDKKRLPPGASVSVSPGSRITFGD  179

Query  632  THLAIFRVSKLEKVDDAPEEQED--DGAKGGPSSS*NE  739
            THLA+F VSKL KV+ AP + E+  D  + G ++  NE
Sbjct  180  THLAMFLVSKLAKVESAPSKSEESQDEVEIGSATESNE  217



>ref|XP_002313623.2| forkhead-associated domain-containing family protein [Populus 
trichocarpa]
 gb|EEE87578.2| forkhead-associated domain-containing family protein [Populus 
trichocarpa]
Length=220

 Score =   197 bits (501),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 139/216 (64%), Gaps = 15/216 (7%)
 Frame = +2

Query  125  LTTTTQSLSHSKIP--------KLFSNGGATVFAQNSVNFLGYNCLPRNLQ---CTAKHL  271
            +  TTQSLSH+K+P         +F +  A++ A NS+ F         LQ     AK  
Sbjct  1    MDITTQSLSHAKLPGCSTSLATPIF-HSKASLLAHNSITFQSPKNFFTQLQGVRIKAKKQ  59

Query  272  SSLGAIHASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEK  451
             SLGA+HAS    T T V  +WLL PVGDGD+ HIG+   MP AFEI+S  +TVGR+ +K
Sbjct  60   RSLGAVHASGADSTLTDVEERWLLVPVGDGDSGHIGFKVKMPDAFEIASSEVTVGRLPDK  119

Query  452  ADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGD  631
            ADMVIPV TVS  HAR+++    LVVTDLDSTNGTFID+KRL PG + +  PG+RI FGD
Sbjct  120  ADMVIPVATVSALHARIQNKGGNLVVTDLDSTNGTFIDKKRLPPGASVSVSPGSRIIFGD  179

Query  632  THLAIFRVSKLEKVDDAP---EEQEDDGAKGGPSSS  730
            THLA+F VSKL KV+ AP   EE +D+     P+ S
Sbjct  180  THLAMFLVSKLAKVESAPSKSEESQDEVEIDSPTES  215



>ref|XP_002526687.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35709.1| conserved hypothetical protein [Ricinus communis]
Length=219

 Score =   196 bits (497),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 130/195 (67%), Gaps = 14/195 (7%)
 Frame = +2

Query  119  MELTTTTQSLSHSKIPKLFSNGGATVFAQNSVNFLGYNCLP------------RNLQCTA  262
            M+LT   QSLSH+KIP   ++    +F  +  + L +N +P               +   
Sbjct  1    MDLTAA-QSLSHAKIPGCSASIAPPIF-HSKTSLLAHNLIPFHSSKVTLLPQQHGFRIKT  58

Query  263  KHLSSLGAIHASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRV  442
            +   SLG IHASEG+ T   V  KW+LEPVGDGD++HIGY   MP AFEI+S  +TVGR+
Sbjct  59   RKHRSLGPIHASEGENTVRDVQDKWILEPVGDGDSRHIGYQVKMPDAFEIASNEVTVGRL  118

Query  443  SEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRIT  622
             EKADMVIPV TVSG HARL+   + L+VTDLDSTNGTFI+EKRL PGV AAA  G+ IT
Sbjct  119  PEKADMVIPVATVSGVHARLQKKGENLLVTDLDSTNGTFINEKRLSPGVVAAASSGSFIT  178

Query  623  FGDTHLAIFRVSKLE  667
            FGD HLA+FR SK+E
Sbjct  179  FGDIHLAMFRASKIE  193



>ref|XP_006470187.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Citrus sinensis]
Length=231

 Score =   195 bits (495),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 131/192 (68%), Gaps = 11/192 (6%)
 Frame = +2

Query  170  LFSNGGATVFAQNSVNFLGYNCLPRNLQ---CTAKHLSSLGAIHASEGQITSTAVSI---  331
            +F +  + + + NSV F     L   LQ     AK   +LGAI ASE   +ST  +    
Sbjct  31   IFRSKASLLVSSNSVPFHSSRTLLTQLQGLRIKAKKHRNLGAISASEADSSSTTTTTSTD  90

Query  332  ----KWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHAR  499
                +WLL+PVGDGDT HIG+   MP AFEI+S  +TVGR+ E+ADMVIPV TVSG HAR
Sbjct  91   VAAERWLLQPVGDGDTSHIGFKVPMPDAFEIASTEVTVGRLPERADMVIPVATVSGLHAR  150

Query  500  LRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLEKVDD  679
            ++   D L+VTDLDSTNGTFIDEKRLRPGV A A PG+RITFGDTHLA+FRVSK++ V +
Sbjct  151  IQKKGDSLLVTDLDSTNGTFIDEKRLRPGVVAVASPGSRITFGDTHLAMFRVSKIDTV-E  209

Query  680  APEEQEDDGAKG  715
            AP + E+   KG
Sbjct  210  APSKTEESEEKG  221



>gb|KDP22822.1| hypothetical protein JCGZ_00409 [Jatropha curcas]
Length=216

 Score =   192 bits (489),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 138/209 (66%), Gaps = 7/209 (3%)
 Frame = +2

Query  119  MELTTTTQSLSHSKI-PKLFSNGGATVFAQNSVNFLGYNCLPRNLQCT---AKHLSSLGA  286
            ME+T   QSLSH+ + P +F N     FA  S+ F   N +  +LQ     A+   +LG 
Sbjct  1    MEMTA--QSLSHASVSPPIFHNSKPYFFAHKSIPFHSPNTISTHLQFVRIRARKQRNLGP  58

Query  287  IHASEGQITSTAVSI-KWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMV  463
            I+ SE + T T +   +WLLEP GDGD++HIG+   MP AFEI S  +TVGR+++KAD+V
Sbjct  59   INVSESETTFTQLQQDRWLLEPAGDGDSRHIGFKVNMPDAFEIVSSEVTVGRLADKADVV  118

Query  464  IPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLA  643
            IPV TVSG HAR+      L++TDLDSTNGTFI+EK+L PGVAA+  PG+ ITFGD HLA
Sbjct  119  IPVATVSGVHARIEKKGGNLLITDLDSTNGTFINEKKLIPGVAASVPPGSFITFGDIHLA  178

Query  644  IFRVSKLEKVDDAPEEQEDDGAKGGPSSS  730
            +FRV KLE V+ A   + ++  +   +SS
Sbjct  179  MFRVKKLENVEAASNPEPEESKQKAETSS  207



>gb|KDO47649.1| hypothetical protein CISIN_1g040067mg, partial [Citrus sinensis]
Length=195

 Score =   189 bits (479),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 126/184 (68%), Gaps = 11/184 (6%)
 Frame = +2

Query  194  VFAQNSVNFLGYNCLPRNLQ---CTAKHLSSLGAIHASEGQITSTAVSI-------KWLL  343
            + + NSV F     L   LQ     AK   +LGAI ASE   ++T  +        +WLL
Sbjct  3    LVSSNSVPFHSSRTLLTQLQGLRIKAKKHRNLGAIRASEADSSTTTTTTSTDVAAERWLL  62

Query  344  EPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCL  523
            +PVGDGDT HIG+   MP AFEI+S  +TVGR+ E+ADMVIPV TVSG HAR++   D L
Sbjct  63   QPVGDGDTSHIGFKVPMPDAFEIASTEVTVGRLPERADMVIPVATVSGLHARIQKKGDSL  122

Query  524  VVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLEKVDDAPEEQEDD  703
            +VTDLDSTNGTFIDEKRLR GV A A PG+RITFGDTHLA+FRVSK++ V +AP + E+ 
Sbjct  123  LVTDLDSTNGTFIDEKRLRSGVVAVASPGSRITFGDTHLAMFRVSKIDTV-EAPSKTEES  181

Query  704  GAKG  715
              KG
Sbjct  182  EEKG  185



>ref|XP_006446681.1| hypothetical protein CICLE_v10016536mg [Citrus clementina]
 gb|ESR59921.1| hypothetical protein CICLE_v10016536mg [Citrus clementina]
Length=231

 Score =   189 bits (479),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 130/192 (68%), Gaps = 11/192 (6%)
 Frame = +2

Query  170  LFSNGGATVFAQNSVNFLGYNCLPRNLQ---CTAKHLSSLGAIHASEGQITST-------  319
            +F +  + + + NS+ F     L   LQ     AK   +LGAI ASE   ++T       
Sbjct  31   IFRSKASLLVSSNSIPFHSSRTLHTQLQGLRIKAKKHRNLGAIRASEADSSTTTTTTSTD  90

Query  320  AVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHAR  499
              +++WLL+PVGDGDT H+G+   MP AFEI+S  +TVGR+ E+ADMVIPV TVSG HAR
Sbjct  91   VAAVRWLLQPVGDGDTSHLGFKVPMPDAFEIASTEVTVGRLPERADMVIPVATVSGLHAR  150

Query  500  LRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLEKVDD  679
            ++   D L+VTDLDSTNGTFIDEKRLR GV A A PG+RITFGDTHLA+F VSK++ V +
Sbjct  151  IQKKGDSLLVTDLDSTNGTFIDEKRLRSGVVAVASPGSRITFGDTHLAMFCVSKIDTV-E  209

Query  680  APEEQEDDGAKG  715
            AP + E+   KG
Sbjct  210  APSKTEESEEKG  221



>ref|XP_010243732.1| PREDICTED: zeaxanthin epoxidase, chloroplastic isoform X1 [Nelumbo 
nucifera]
Length=220

 Score =   186 bits (472),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 118/172 (69%), Gaps = 4/172 (2%)
 Frame = +2

Query  188  ATVFAQNSVNFLGYNCLPRNLQCTAKHLSSLGAIHASEGQITSTAVSIKWLLEPVGDGDT  367
            +T FA  S  F       +N+Q     L  L   +AS  +  S+  + KWLLEPVGDGD+
Sbjct  35   STSFASVSFKFFPQKL--QNIQLKGIQLRKLRPTNASAAETPSSENAEKWLLEPVGDGDS  92

Query  368  KHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDST  547
            +HIG+   MP AFEI+S  +TVGR+ EKADMVIPV TVSG HAR+   E  L+VTDL+ST
Sbjct  93   RHIGFKVPMPDAFEIASSVVTVGRLPEKADMVIPVATVSGLHARIEKKEGNLMVTDLEST  152

Query  548  NGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLEKVD--DAPEEQE  697
            NGTFID+KRLRPGV A   PG+ ITFGDTHLA+FRVSKLE  D  + PE+ E
Sbjct  153  NGTFIDDKRLRPGVVAILSPGSCITFGDTHLAMFRVSKLENKDLPNKPEDSE  204



>ref|XP_008231086.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Prunus mume]
Length=219

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 134/205 (65%), Gaps = 11/205 (5%)
 Frame = +2

Query  119  MELTTTTQ-SLSHSKIPK-----LFSNGGATVFAQNSVNFLGYNCLPRN---LQCTAKHL  271
            ME+T     S+SH+K+P+       ++  + + +  S+ F   N + +    L+   K L
Sbjct  1    MEITAQHHLSISHTKLPRPSSSSFRASAASLLASTTSLPFQCSNNIIQGQGVLRIKGKQL  60

Query  272  SSLGAIHASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEK  451
             S+G I+AS  +  S     KWLLEPVGDGDT+HIG+   MP AFEISS  +TVGR+ E+
Sbjct  61   RSIGPIYASSSKAQSPPPPQKWLLEPVGDGDTRHIGFKVPMPSAFEISSDEVTVGRLPEE  120

Query  452  ADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGD  631
            ADMVI V TVSG HAR++  E  L+VTDLDSTNGTFID+KRL  GV A   PG+ +TFGD
Sbjct  121  ADMVISVATVSGVHARIQKKEGKLLVTDLDSTNGTFIDDKRLSAGVVATVPPGSCLTFGD  180

Query  632  THLAIFRVSKLEKVDDA--PEEQED  700
             HLA+FRVSKLE V+ A  P+  ED
Sbjct  181  EHLAVFRVSKLENVEAASNPDPSED  205



>ref|XP_004295125.1| PREDICTED: uncharacterized protein LOC101297045 [Fragaria vesca 
subsp. vesca]
Length=218

 Score =   181 bits (460),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 99/193 (51%), Positives = 126/193 (65%), Gaps = 13/193 (7%)
 Frame = +2

Query  119  MELTTTTQSLSH----SKIPKLFSNGGATVFAQNSVNFLGYNCLPRNLQCTA--KHLSSL  280
            ME+T    +LSH    S  P+L  +  + V +      L + C    LQ  +  + L   
Sbjct  1    MEITVALSALSHFSAASPPPRLLPSSSSLVAS------LPFYCSNTQLQGVSIKRKLHPP  54

Query  281  GAIHASEG-QITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKAD  457
              + AS   Q  ST VS +WLLEPVGDGDT+HIG+   MP AFEI+S  +TVGR+ EKAD
Sbjct  55   TPVSASSNTQTPSTDVSERWLLEPVGDGDTRHIGFKVQMPSAFEIASNVVTVGRLPEKAD  114

Query  458  MVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTH  637
            +VIPV TVSG HAR+R  +  L+VTDLDSTNGTFID++RLRPGV A   PG+ +TFGD H
Sbjct  115  LVIPVATVSGLHARIRKKDGNLLVTDLDSTNGTFIDDQRLRPGVVATLSPGSCVTFGDEH  174

Query  638  LAIFRVSKLEKVD  676
            LA+FRVSKL+  +
Sbjct  175  LAVFRVSKLDNAE  187



>emb|CDX82041.1| BnaC08g35600D [Brassica napus]
Length=210

 Score =   181 bits (458),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 130/209 (62%), Gaps = 20/209 (10%)
 Frame = +2

Query  119  MELTTTTQSLSHSKIPKLFSNGGATVFAQNSVNFLGYNCLPR-----NLQCTAKH-----  268
            ME+T T+Q  S  K      NG +    +N    +  NCL       N+  TAK      
Sbjct  1    MEITATSQLCSQVKFSIFCLNGNS---KRNQNGAVSVNCLKEIKQFSNISFTAKKKHRNQ  57

Query  269  ------LSSLGAIHASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAIT  430
                   +    +  ++ Q ++T    +WLL+PVGDGDT+HIGY   MP  FEISSG +T
Sbjct  58   APVVRTTTRASVVDENQPQASATTKGERWLLQPVGDGDTRHIGYKVEMPAPFEISSGQVT  117

Query  431  VGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPG  610
            +GR+ EKAD+VIPV TVSG HA +    D L+VTD++STNGTFI++KRL PGVAA A PG
Sbjct  118  IGRLPEKADVVIPVATVSGVHATIDTQRDNLLVTDMNSTNGTFIEDKRLIPGVAAPAFPG  177

Query  611  TRITFGDTHLAIFRVSKLE-KVDDAPEEQ  694
            TRITFGDT+LAIFRV KL+ + ++ P E+
Sbjct  178  TRITFGDTNLAIFRVFKLQDRQEEEPTEK  206



>ref|XP_010031626.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280133 
[Eucalyptus grandis]
Length=231

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 113/149 (76%), Gaps = 4/149 (3%)
 Frame = +2

Query  242  RNLQCTAKHLSS-LGAIHAS---EGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFE  409
            R  +  AKH    LG ++AS   EG  ++  V+ KWLL+PVGDGDT+HIG+   MPGAFE
Sbjct  58   RGAKIRAKHRQRILGPVYASSEAEGPPSADVVAEKWLLQPVGDGDTRHIGFKVDMPGAFE  117

Query  410  ISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGV  589
            I+S  +TVGR+ EKADMVIPV TVSG HAR++  E  L+VTDLDSTNGTFID+++LRPGV
Sbjct  118  IASNLVTVGRLPEKADMVIPVATVSGLHARIQKKEGSLLVTDLDSTNGTFIDDRKLRPGV  177

Query  590  AAAALPGTRITFGDTHLAIFRVSKLEKVD  676
            AA   PG+ ITFGDTHLA+F VSKL+  +
Sbjct  178  AATVPPGSCITFGDTHLAMFLVSKLQTAE  206



>ref|XP_009117389.1| PREDICTED: uncharacterized protein LOC103842515 [Brassica rapa]
 emb|CDY13809.1| BnaA09g43110D [Brassica napus]
Length=213

 Score =   179 bits (455),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 105/211 (50%), Positives = 134/211 (64%), Gaps = 21/211 (10%)
 Frame = +2

Query  119  MELTTTTQSLSHSKIP---KLFSNGGATVFAQNSVNFLGYNCLPR-----NLQCTAK--H  268
            ME+TTT+Q  S  K      LF   G +   QN    +  NCL       N+  TAK  H
Sbjct  1    MEITTTSQLCSQVKFSISSSLFCLNGNSKRTQNGA--VSVNCLKEIKPFSNISFTAKKKH  58

Query  269  LSSLGAIHAS-------EGQIT-STAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGA  424
             +    +  +       E Q + S++   +WLL+PVGDGDT+HIGY   MP  FEISSG 
Sbjct  59   RNQASVVRTTTRASVVDENQPSASSSKGERWLLQPVGDGDTRHIGYKVEMPAPFEISSGQ  118

Query  425  ITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAAL  604
            +T+GR+ EKAD+VIPV TVSG HA +    D L+VTD++STNGTFI++KRL PGVAA A 
Sbjct  119  VTIGRLPEKADVVIPVATVSGVHATIDTQGDNLLVTDMNSTNGTFIEDKRLIPGVAAPAF  178

Query  605  PGTRITFGDTHLAIFRVSKLE-KVDDAPEEQ  694
            PGTRITFGDT+LAIFRV KL+ K ++ P E+
Sbjct  179  PGTRITFGDTNLAIFRVFKLQDKQEEEPTEK  209



>ref|NP_001242194.1| uncharacterized protein LOC100808269 [Glycine max]
 gb|ACU20457.1| unknown [Glycine max]
Length=222

 Score =   179 bits (454),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 131/194 (68%), Gaps = 13/194 (7%)
 Frame = +2

Query  140  QSLSHSKIPK----------LFSNGGATVFAQNSVNFLGYNCLPRNL-QCTAKHLSSL-G  283
            QSLS +KIPK          L  +  AT  A +SV +  ++ L   L +  A    +L G
Sbjct  7    QSLSLAKIPKSQTSPLLNSPLLFHSNATSVAFSSVPYHHHHLLKCFLFRSKANEKQNLVG  66

Query  284  AIHASEGQIT-STAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADM  460
             + ASE   T +T  + +WLLEPVGDGDT+HIG+   MPG +EI+S  +TVGRV +KAD+
Sbjct  67   VLRASEAATTPTTNDAERWLLEPVGDGDTRHIGFKVEMPGLYEIASSEVTVGRVPDKADL  126

Query  461  VIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHL  640
            VIPV TVSG HAR++  +  L+VTDLDSTNGTFI++KRLRPGV A   PG+ ITFGDTHL
Sbjct  127  VIPVATVSGVHARIQKKQGNLLVTDLDSTNGTFINDKRLRPGVVATISPGSCITFGDTHL  186

Query  641  AIFRVSKLEKVDDA  682
            A+FRVSK+E V  A
Sbjct  187  AMFRVSKVEDVKPA  200



>gb|KHN08864.1| Zeaxanthin epoxidase, chloroplastic [Glycine soja]
Length=222

 Score =   179 bits (454),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 131/194 (68%), Gaps = 13/194 (7%)
 Frame = +2

Query  140  QSLSHSKIPK----------LFSNGGATVFAQNSVNFLGYNCLPRNL-QCTAKHLSSL-G  283
            QSLS +KIPK          L  +  AT  A +SV +  ++ L   L +  A    +L G
Sbjct  7    QSLSLAKIPKSQTSPLLNSPLLFHSNATSVAFSSVPYHHHHLLKCFLFRSKANEKQNLVG  66

Query  284  AIHASEGQIT-STAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADM  460
             + ASE   T +T  + +WLLEPVGDGDT+HIG+   MPG +EI+S  +TVGRV +KAD+
Sbjct  67   VLRASEAATTPTTNDAERWLLEPVGDGDTRHIGFKVEMPGPYEIASSEVTVGRVPDKADL  126

Query  461  VIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHL  640
            VIPV TVSG HAR++  +  L+VTDLDSTNGTFI++KRLRPGV A   PG+ ITFGDTHL
Sbjct  127  VIPVATVSGVHARIQKKQGNLLVTDLDSTNGTFINDKRLRPGVVATISPGSCITFGDTHL  186

Query  641  AIFRVSKLEKVDDA  682
            A+FRVSK+E V  A
Sbjct  187  AMFRVSKVEDVKPA  200



>gb|KCW50990.1| hypothetical protein EUGRSUZ_J00617 [Eucalyptus grandis]
Length=273

 Score =   180 bits (456),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 113/149 (76%), Gaps = 4/149 (3%)
 Frame = +2

Query  242  RNLQCTAKHLSS-LGAIHAS---EGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFE  409
            R  +  AKH    LG ++AS   EG  ++  V+ KWLL+PVGDGDT+HIG+   MPGAFE
Sbjct  100  RGAKIRAKHRQRILGPVYASSEAEGPPSADVVAEKWLLQPVGDGDTRHIGFKVDMPGAFE  159

Query  410  ISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGV  589
            I+S  +TVGR+ EKADMVIPV TVSG HAR++  E  L+VTDLDSTNGTFID+++LRPGV
Sbjct  160  IASNLVTVGRLPEKADMVIPVATVSGLHARIQKKEGSLLVTDLDSTNGTFIDDRKLRPGV  219

Query  590  AAAALPGTRITFGDTHLAIFRVSKLEKVD  676
            AA   PG+ ITFGDTHLA+F VSKL+  +
Sbjct  220  AATVPPGSCITFGDTHLAMFLVSKLQTAE  248



>ref|XP_004502003.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280133-like 
isoform X1 [Cicer arietinum]
Length=226

 Score =   177 bits (450),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 110/150 (73%), Gaps = 1/150 (1%)
 Frame = +2

Query  260  AKHLSSLGAIHAS-EGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVG  436
            AK   +LGAIHAS E    +T  + KWLL+P+GDGDT+HIG+   MPGA+EI+S  +TVG
Sbjct  63   AKQKGTLGAIHASLEAATPTTNATEKWLLKPIGDGDTRHIGFKVEMPGAYEIASSEVTVG  122

Query  437  RVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTR  616
            RV EKAD+VIPV TVSG HAR+R  +  L+V DLDSTNGTFID+KRL+PGV A    G+ 
Sbjct  123  RVPEKADLVIPVATVSGVHARIRKNQGKLLVMDLDSTNGTFIDDKRLKPGVVATVSSGSC  182

Query  617  ITFGDTHLAIFRVSKLEKVDDAPEEQEDDG  706
            I FGD +LA+FRV K+E   DA   +E +G
Sbjct  183  IIFGDANLAMFRVLKVEDEKDADTAEETEG  212



>ref|XP_002878556.1| forkhead-associated domain-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH54815.1| forkhead-associated domain-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=204

 Score =   173 bits (438),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = +2

Query  332  KWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHT  511
            +WLL+PVGDGDT+HIGY  AMP  FEI+SG +T+GR+ EKAD+VIPV TVSG HA +   
Sbjct  81   RWLLQPVGDGDTRHIGYKVAMPAPFEITSGQVTIGRLPEKADVVIPVATVSGVHATINTN  140

Query  512  EDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLEKVDDAPEE  691
            E+ L+VTD++STNGTFI++KRL PGVAA A PGTRITFGDT+LAIFRV KL+  +++ E+
Sbjct  141  ENNLLVTDMNSTNGTFIEDKRLIPGVAAPAFPGTRITFGDTNLAIFRVFKLQDREESTEK  200



>gb|KHF99285.1| Zeaxanthin epoxidase, chloroplastic [Gossypium arboreum]
Length=219

 Score =   173 bits (439),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 130/204 (64%), Gaps = 15/204 (7%)
 Frame = +2

Query  134  TTQSLSHSKIPKL-------FSNGGATVFAQNSV----NFLGYNCLPRNLQCTAKHLSSL  280
            T +SLS +K+P         F    A++ A N V    +   Y    +  +   +   ++
Sbjct  2    TARSLSQAKLPSCSANLSPSFLQSKASLSASNLVVPFQSSKNYGVRLKFDRNRLRKQRNV  61

Query  281  GAIHASEGQI-TSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKAD  457
            G I ASE +  TST V+ +WLLEP GDGD++HIG+   MP AFEI+S  +TVGR+ +KAD
Sbjct  62   GVIFASESESNTSTDVTDRWLLEPAGDGDSRHIGFKVLMPDAFEIASSEVTVGRLPDKAD  121

Query  458  MVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTH  637
            +VIPV TVSG HAR++     L+VTDLDSTNGTFI+++RLRPGV +   PG+ + FGD H
Sbjct  122  VVIPVATVSGIHARIQKKGGNLLVTDLDSTNGTFINDQRLRPGVVSKVPPGSFLIFGDIH  181

Query  638  LAIFRVSKLEKV---DDAPEEQED  700
            LA+FRVSKLE V   +  PEE  D
Sbjct  182  LAMFRVSKLENVAGIESKPEESAD  205



>ref|XP_003592233.1| Zeaxanthin epoxidase [Medicago truncatula]
Length=227

 Score =   173 bits (439),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 117/165 (71%), Gaps = 2/165 (1%)
 Frame = +2

Query  260  AKHLSSLGAIHASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGR  439
            A+   +LGAIHAS+    +T  + +W+LEPVGDGD++HIG+    PGA+EI+S  +TVGR
Sbjct  63   AQEKVNLGAIHASKATTPTTTTTQRWILEPVGDGDSRHIGFKVERPGAYEITSNEVTVGR  122

Query  440  VSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRI  619
            V EKAD+VIPV TVSG HAR+R  +D L+V DLDSTNGTFI +KRL+PGV      G+ I
Sbjct  123  VPEKADLVIPVATVSGVHARIRIKQDNLLVIDLDSTNGTFIGDKRLKPGVVTTVSSGSYI  182

Query  620  TFGDTHLAIFRVSKL-EKVDDAPEEQEDDGAKGGPSSS*NEEAWN  751
            TFGDT+LA+FRVSK+ EK  D   E E +    G S S  E ++N
Sbjct  183  TFGDTNLAMFRVSKIEEKAADTVGEPEGELENDGKSDS-TETSYN  226



>ref|XP_010429074.1| PREDICTED: uncharacterized protein LOC104713606 [Camelina sativa]
Length=206

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = +2

Query  332  KWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHT  511
            +WLL+PVGDGDT+HIG+  AMP  FEISSG +T+GR+ EKAD+VIPV TVSG HA +   
Sbjct  83   RWLLQPVGDGDTRHIGFKVAMPAPFEISSGQVTIGRLPEKADVVIPVATVSGVHATINTN  142

Query  512  EDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLEKVDDAPEE  691
            ED L+VTD++STNGTFI++KRL PGVAA A PGTRITFGDT+LAIFRV KL+  + + E+
Sbjct  143  EDNLLVTDMNSTNGTFIEDKRLIPGVAAPAFPGTRITFGDTNLAIFRVFKLQDSEVSTEK  202



>ref|XP_010416905.1| PREDICTED: uncharacterized protein LOC104702696 [Camelina sativa]
Length=206

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = +2

Query  332  KWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHT  511
            +WLL+PVGDGDT+HIG+  AMP  FEISSG +T+GR+ EKAD+VIPV TVSG HA +   
Sbjct  83   RWLLQPVGDGDTRHIGFKVAMPAPFEISSGQVTIGRLPEKADVVIPVATVSGVHATINTN  142

Query  512  EDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLEKVDDAPEE  691
            ED L+VTD++STNGTFI++KRL PGVAA A PGTRITFGDT+LAIFRV KL+  + + E+
Sbjct  143  EDNLLVTDMNSTNGTFIEDKRLIPGVAAPAFPGTRITFGDTNLAIFRVFKLQDSEVSTEK  202



>ref|XP_003601330.1| Zeaxanthin epoxidase [Medicago truncatula]
 gb|AES71581.1| smad/FHA domain protein [Medicago truncatula]
 gb|AFK48852.1| unknown [Medicago truncatula]
 gb|KEH35121.1| smad/FHA domain protein [Medicago truncatula]
Length=228

 Score =   173 bits (438),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 136/215 (63%), Gaps = 13/215 (6%)
 Frame = +2

Query  92   IKKSHQPRNMELTTTTQSLSHSKIPKLFSNGGATVFAQNSVNFLGYNCLPRN-----LQC  256
            +K  + P+  +  T + SL +S +  L SN  +  F  NS     + C         +  
Sbjct  5    VKSLYLPKIPKSQTCSGSLLNSPL-LLHSNATSVTF--NSATHHLHKCFLFQQPGGVIHP  61

Query  257  TAKHLSSLGAIHASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVG  436
             A+   +LGAIHAS+    +T  + +W+LEPVGDGD++HIG+    PGA+EI+S  +TVG
Sbjct  62   KAQEKVNLGAIHASKATTPTTTTTQRWILEPVGDGDSRHIGFKVERPGAYEITSNEVTVG  121

Query  437  RVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTR  616
            RV EKAD+VIPV TVSG HAR+R  +D L+V DLDSTNGTFI +KRL+PGV      G+ 
Sbjct  122  RVPEKADLVIPVATVSGVHARIRIKQDNLLVIDLDSTNGTFIGDKRLKPGVVTTVSSGSY  181

Query  617  ITFGDTHLAIFRVSKLEK-----VDDAPEEQEDDG  706
            ITFGDT+LA+FRVSK+E+     V +   E E+DG
Sbjct  182  ITFGDTNLAMFRVSKIEEKAADTVGEPEGELENDG  216



>ref|NP_179748.2| SMAD/FHA domain-containing protein [Arabidopsis thaliana]
 dbj|BAC43312.1| unknown protein [Arabidopsis thaliana]
 gb|ABD42997.1| At2g21530 [Arabidopsis thaliana]
 gb|AEC07191.1| SMAD/FHA domain-containing protein [Arabidopsis thaliana]
Length=209

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = +2

Query  332  KWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHT  511
            +WLL+PVGDGDT+HIGY  AMP  FEISSG +T+GR+ EKAD+VIPV TVSG HA +   
Sbjct  86   RWLLKPVGDGDTRHIGYKVAMPAPFEISSGQVTIGRLPEKADVVIPVATVSGVHATINTN  145

Query  512  EDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLEKVDDAPEE  691
            E  L+VTD++STNGTFI++KRL PGVAA A PGTRITFGDT+LAIFRV KL+  +++ E+
Sbjct  146  EKNLLVTDMNSTNGTFIEDKRLIPGVAAPAFPGTRITFGDTNLAIFRVFKLQDSEESIEK  205



>ref|XP_010472149.1| PREDICTED: uncharacterized protein LOC104751808 [Camelina sativa]
Length=206

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = +2

Query  332  KWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHT  511
            +WLL+PVGDGDT+HIG+  AMP  FEISSG +T+GR+ EKAD+VIPV TVSG HA +   
Sbjct  83   RWLLQPVGDGDTRHIGFKVAMPAPFEISSGQVTIGRLPEKADVVIPVATVSGVHATINTN  142

Query  512  EDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLEKVDDAPEE  691
            ED L+VTD++STNGTFI++KRL PGVAA A PGTRITFGDT+LAIFRV KL+  + + E+
Sbjct  143  EDNLLVTDMNSTNGTFIEDKRLIPGVAAPAFPGTRITFGDTNLAIFRVFKLQDSEVSTEK  202



>ref|XP_002273249.1| PREDICTED: uncharacterized protein LOC100263360 [Vitis vinifera]
Length=208

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 127/212 (60%), Gaps = 24/212 (11%)
 Frame = +2

Query  140  QSLSHSKIPK----------LFSNGGATVFAQNSVNFLGYNCLPRNL---QCTAKHLSSL  280
            Q  +H  +PK           F N   ++   +S++F+    L   L   +  A+    +
Sbjct  2    QVTAHYSLPKPLCCSASLSPFFINSKTSLLPSHSLSFIYCKSLSTQLYGLRIKARQRRKV  61

Query  281  GAIHASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADM  460
              + AS           +WLLEP+GDGDT+HIG+  A PGA+EI+S  +TVGR+ +KAD+
Sbjct  62   SPVFASTENNAE-----RWLLEPIGDGDTRHIGFKVARPGAYEIASSVVTVGRLPDKADL  116

Query  461  VIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHL  640
            VIPV TVSG HAR++  E  L+VTDLDSTNGTFID+K+L PGVAA   PG+ ITFGD HL
Sbjct  117  VIPVATVSGLHARIQKKEGGLLVTDLDSTNGTFIDDKKLSPGVAAPVSPGSCITFGDIHL  176

Query  641  AIFRVSKLEKV------DDAPEEQEDDGAKGG  718
            AIFRVSKLE        +D+P + E D    G
Sbjct  177  AIFRVSKLENAEVTKESEDSPVKPEADSPTEG  208



>ref|XP_008349827.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Malus domestica]
Length=223

 Score =   171 bits (433),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 98/125 (78%), Gaps = 2/125 (2%)
 Frame = +2

Query  332  KWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHT  511
            KWLLEPVGDGD++HIG+   MP AFEISS  +TVGR+ EKADMVIPV TVSG HAR++  
Sbjct  86   KWLLEPVGDGDSRHIGFKVPMPNAFEISSNEVTVGRLPEKADMVIPVATVSGVHARIQKK  145

Query  512  EDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLEKVDDA--P  685
            E  L+VTDLDSTNGTFID+KRL  GV A   PG+ +TFGD HLA+FRVSKLE V+ A  P
Sbjct  146  EGKLLVTDLDSTNGTFIDDKRLSAGVVATVPPGSCLTFGDEHLAVFRVSKLENVEAASNP  205

Query  686  EEQED  700
            +  +D
Sbjct  206  DPSQD  210



>ref|XP_009376098.1| PREDICTED: uncharacterized protein LOC103964837 [Pyrus x bretschneideri]
Length=223

 Score =   171 bits (433),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 97/125 (78%), Gaps = 2/125 (2%)
 Frame = +2

Query  332  KWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHT  511
            KWLLEPVGDGD++HIG+   MP AFEISS  +TVGR+ EKADMVIPV TVSG HAR++  
Sbjct  86   KWLLEPVGDGDSRHIGFKVPMPNAFEISSNEVTVGRLPEKADMVIPVATVSGVHARIQKQ  145

Query  512  EDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLEKVDDA--P  685
            E  L+VTDLDSTNGTFID KRL  GV A   PG+ +TFGD HLA+FRVSKLE V+ A  P
Sbjct  146  EGKLLVTDLDSTNGTFIDNKRLSAGVVATVPPGSCLTFGDEHLAVFRVSKLENVEAASNP  205

Query  686  EEQED  700
            +  +D
Sbjct  206  DPSQD  210



>gb|KFK32887.1| hypothetical protein AALP_AA6G300700 [Arabis alpina]
Length=214

 Score =   169 bits (427),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 116/169 (69%), Gaps = 8/169 (5%)
 Frame = +2

Query  209  SVNFLGY-NCLPRNLQCTAK----HLSSLGAIHAS--EGQI-TSTAVSIKWLLEPVGDGD  364
            SVN+L        N+  TAK    H   L    AS  E Q  TS +   +WLL+PVGDGD
Sbjct  42   SVNYLQETEQFSTNISFTAKKKRSHALVLKTTRASLDEDQSPTSGSGGERWLLQPVGDGD  101

Query  365  TKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDS  544
            T+HIGY   MP  FEISSG +T+GR+ EKAD+VIPV TVSG HA +    D L+VTD++S
Sbjct  102  TRHIGYKVEMPKPFEISSGQVTIGRLPEKADVVIPVATVSGVHATINTQGDNLLVTDMNS  161

Query  545  TNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLEKVDDAPEE  691
            TNGTFI+++RL PGVAA A PGTRITFGDT+LAIFRV KL+   ++ E+
Sbjct  162  TNGTFIEDRRLIPGVAAPAFPGTRITFGDTNLAIFRVFKLQDRQESTEK  210



>ref|XP_010922882.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Elaeis guineensis]
Length=221

 Score =   168 bits (426),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 112/158 (71%), Gaps = 5/158 (3%)
 Frame = +2

Query  209  SVNFLGYNC--LPRNLQCTAKHLSSLGAIHASEGQITSTAVSIKWLLEPVGDGDTKHIGY  382
            S++F G +   LP     T K  SS   + +S  +      S +WLLEP+GDGDT+HIG+
Sbjct  40   SISFQGSSSKQLP---HLTTKKESSWSPLRSSPTEDPLPDPSERWLLEPIGDGDTRHIGF  96

Query  383  PTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFI  562
               +PGAFEI+S  +TVGR  EKAD+VIPV TVS  HARL+  +  L+V DLDSTNGT++
Sbjct  97   RVPLPGAFEIASDVVTVGRTPEKADIVIPVATVSSVHARLKKRDGSLLVMDLDSTNGTYV  156

Query  563  DEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLEKVD  676
            ++++L+PG  AAA PG+ ITFGDTHLA+FRVSK+E+ +
Sbjct  157  NDQKLKPGAVAAAFPGSSITFGDTHLAMFRVSKIEEAE  194



>ref|XP_006829838.1| hypothetical protein AMTR_s00119p00102250 [Amborella trichopoda]
 gb|ERM97254.1| hypothetical protein AMTR_s00119p00102250 [Amborella trichopoda]
Length=216

 Score =   168 bits (425),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 101/141 (72%), Gaps = 0/141 (0%)
 Frame = +2

Query  242  RNLQCTAKHLSSLGAIHASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSG  421
            R L       +    ++AS  +   T    KWLLEPVGDGD++HIGY   +P AFEI+S 
Sbjct  51   RKLLLNTSPCARFRPVNASSIERNPTKSEGKWLLEPVGDGDSRHIGYKVPLPDAFEIASN  110

Query  422  AITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAA  601
             +TVGR++EKADMVIPV TVSG HARL   E  L+VTDLDSTNGT+I+EKRL PG++AAA
Sbjct  111  VVTVGRLAEKADMVIPVATVSGLHARLEKREGNLMVTDLDSTNGTYINEKRLNPGISAAA  170

Query  602  LPGTRITFGDTHLAIFRVSKL  664
             PG+ I FGDTHLA FR+ KL
Sbjct  171  SPGSCIVFGDTHLAAFRLLKL  191



>ref|XP_006404604.1| hypothetical protein EUTSA_v10000320mg [Eutrema salsugineum]
 gb|ESQ46057.1| hypothetical protein EUTSA_v10000320mg [Eutrema salsugineum]
Length=211

 Score =   168 bits (425),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 102/134 (76%), Gaps = 3/134 (2%)
 Frame = +2

Query  311  TSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGA  490
            TS A   +WLL+PVGDGDT+HIGY   MP  FEISSG +TVGR+ EKAD+VIPV TVSG 
Sbjct  81   TSGAGGERWLLQPVGDGDTRHIGYKVDMPAPFEISSGQVTVGRLPEKADVVIPVATVSGV  140

Query  491  HARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLEK  670
            HA +    D L+VTD++STNGTFI++KRL PGVA+ A PGTRITFGDT+LAIFRV KL+ 
Sbjct  141  HATIDTKGDNLLVTDMNSTNGTFIEDKRLIPGVASPAFPGTRITFGDTNLAIFRVFKLQ-  199

Query  671  VDDAPEEQEDDGAK  712
              D+ E  E   A+
Sbjct  200  --DSKESSEKPAAE  211



>ref|XP_010685506.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=223

 Score =   168 bits (425),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 128/201 (64%), Gaps = 14/201 (7%)
 Frame = +2

Query  137  TQSLSHSKIPKLFSNGGATV-----FAQNSVNFLGYNCLPRNLQCTAKHLSSL----GAI  289
            +QSL ++KI K  ++   +      F Q   + L Y    +N+     +L  L    G +
Sbjct  6    SQSLFYAKISKPLNSCSTSTSNFPSFLQCKTSLLAYQS-AKNVGFKRLNLPLLQRKVGIV  64

Query  290  HASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEI-SSGAITVGRVSEKADMVI  466
             A+EG  +   V+  WLL+PVGDGD KHIG+  AMPGA+EI SS  + +GR  +KAD+VI
Sbjct  65   CAAEGATSPANVAQGWLLDPVGDGDWKHIGFKVAMPGAYEIFSSDELVIGRAQDKADLVI  124

Query  467  PVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAI  646
            PV TVSG HAR+++ E  L++TDLDSTNGT+I+EKR+ PG  A A PG+ +TFGD HLAI
Sbjct  125  PVATVSGLHARIQNKEGNLLITDLDSTNGTYINEKRVPPGATAVAPPGSLLTFGDNHLAI  184

Query  647  FRVSKLEKV---DDAPEEQED  700
            FRV K++K    +   EE ED
Sbjct  185  FRVQKIQKTLQKETETEESED  205



>emb|CBI24353.3| unnamed protein product [Vitis vinifera]
Length=1195

 Score =   175 bits (443),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 97/217 (45%), Positives = 132/217 (61%), Gaps = 19/217 (9%)
 Frame = +2

Query  101   SHQPRNMELTTTTQSLSHSKIPK----------LFSNGGATVFAQNSVNFLGYNCLPRNL  250
             +H  R++      Q  +H  +PK           F N   ++   +S++F+    L   L
Sbjct  976   THWHRSLAPEKKMQVTAHYSLPKPLCCSASLSPFFINSKTSLLPSHSLSFIYCKSLSTQL  1035

Query  251   ---QCTAKHLSSLGAIHASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSG  421
                +  A+    +  + AS     +   + +WLLEP+GDGDT+HIG+  A PGA+EI+S 
Sbjct  1036  YGLRIKARQRRKVSPVFAS-----TENNAERWLLEPIGDGDTRHIGFKVARPGAYEIASS  1090

Query  422   AITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAA  601
              +TVGR+ +KAD+VIPV TVSG HAR++  E  L+VTDLDSTNGTFID+K+L PGVAA  
Sbjct  1091  VVTVGRLPDKADLVIPVATVSGLHARIQKKEGGLLVTDLDSTNGTFIDDKKLSPGVAAPV  1150

Query  602   LPGTRITFGDTHLAIFRVSKLEKVDDAPEEQEDDGAK  712
              PG+ ITFGD HLAIFRVSKLE   +  +E ED   K
Sbjct  1151  SPGSCITFGDIHLAIFRVSKLENA-EVTKESEDSPVK  1186



>ref|XP_008792515.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Phoenix dactylifera]
Length=219

 Score =   163 bits (413),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 111/166 (67%), Gaps = 0/166 (0%)
 Frame = +2

Query  248  LQCTAKHLSSLGAIHASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAI  427
            L  T K  SS  A+ +S  +      S +WLLEP+GDGDT+HIG+   +P AFEI+S A+
Sbjct  52   LHLTTKKESSWSALKSSPDESPLPDSSERWLLEPIGDGDTRHIGFRVPLPDAFEITSDAV  111

Query  428  TVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALP  607
            TVGR  EKAD+VIPV TVSG HARL+  +  L+V DLDSTNGT++++++L+PG  A   P
Sbjct  112  TVGRTPEKADIVIPVATVSGLHARLKKKDGSLLVMDLDSTNGTYVNDQKLKPGAVATVSP  171

Query  608  GTRITFGDTHLAIFRVSKLEKVDDAPEEQEDDGAKGGPSSS*NEEA  745
            G+ I FGDTHLA+FRVSK+ + +   +  E +       SS N EA
Sbjct  172  GSCIIFGDTHLAMFRVSKIAEAEVISKTDESENRPEADVSSDNVEA  217



>ref|XP_004149650.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004164512.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN54033.1| hypothetical protein Csa_4G269160 [Cucumis sativus]
Length=183

 Score =   162 bits (410),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 113/168 (67%), Gaps = 5/168 (3%)
 Frame = +2

Query  206  NSVNFLGY-NCLPRNLQCTAKHLSSLGAIHASEGQ--ITSTAVSIKWLLEPVGDGDTKHI  376
            +S++F  Y N L  +L  T   LSSL       G+  +     S +WLL PVGDG+ KHI
Sbjct  7    SSLSFFNYSNSLTPSLHRT--RLSSLSIQFRPRGRSLLQPLQASSRWLLVPVGDGEWKHI  64

Query  377  GYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGT  556
            G    MP AFEI S  +TVGR+ +KAD+VIPV TVS  HAR+++ ED L+V DLDSTNGT
Sbjct  65   GSKVEMPDAFEIVSNEVTVGRLPDKADIVIPVATVSAQHARIKNQEDRLLVIDLDSTNGT  124

Query  557  FIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLEKVDDAPEEQED  700
            FI++KRL PGV AA   G  ITFGD HLA+F+V+KL+ V+ A + QE+
Sbjct  125  FINDKRLNPGVVAAVSSGNSITFGDIHLAMFQVAKLKTVEAASKIQEE  172



>ref|XP_007146045.1| hypothetical protein PHAVU_006G008100g [Phaseolus vulgaris]
 gb|ESW18039.1| hypothetical protein PHAVU_006G008100g [Phaseolus vulgaris]
Length=141

 Score =   160 bits (406),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +2

Query  353  GDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVT  532
            GDGDT+HIGY   MPGA+EI+S  +TVGRV +KAD+VIPV TVSG HAR++  +  L+VT
Sbjct  10   GDGDTRHIGYKVQMPGAYEIASSEVTVGRVPDKADLVIPVATVSGVHARIKKKQGNLLVT  69

Query  533  DLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLEKV  673
            DLDSTNGTFI++KRLRPGVAA   PG  ITFGDTHLA+FRVSK+E V
Sbjct  70   DLDSTNGTFINDKRLRPGVAATVSPGNSITFGDTHLAMFRVSKVENV  116



>ref|XP_010544317.1| PREDICTED: uncharacterized protein LOC104816966 [Tarenaya hassleriana]
Length=216

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 99/126 (79%), Gaps = 1/126 (1%)
 Frame = +2

Query  305  QITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVS  484
            Q T TA +++WLLEPVGDGD KHIGY   +PG FEISS  +TVGR+ +KA+MVIPV TVS
Sbjct  70   QPTGTA-TVRWLLEPVGDGDWKHIGYRVQLPGPFEISSNEVTVGRLPDKANMVIPVATVS  128

Query  485  GAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKL  664
            G HAR++     L++TDLDSTNGTFID+KRL PGV A+   G+RITFGDT+LAIF+  +L
Sbjct  129  GLHARIQKKGGELLITDLDSTNGTFIDDKRLAPGVTASVPEGSRITFGDTNLAIFQAFRL  188

Query  665  EKVDDA  682
            E ++ A
Sbjct  189  ETIESA  194



>ref|XP_007015531.1| NADH:cytochrome B5 reductase 1 [Theobroma cacao]
 gb|EOY33150.1| NADH:cytochrome B5 reductase 1 [Theobroma cacao]
Length=420

 Score =   166 bits (420),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 123/193 (64%), Gaps = 11/193 (6%)
 Frame = +2

Query  125  LTTTTQSLSHSKIPKL-------FSNGGATVFAQN-SVNFLGYNCLPRNLQ---CTAKHL  271
            +  T QSLS +K+P         F +  ATV A N +V F         L+     ++  
Sbjct  1    MEMTAQSLSQAKLPSCSTSLSPPFLHSKATVAASNFAVPFQSSKSYVTKLKFDRIRSRKQ  60

Query  272  SSLGAIHASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEK  451
             +LG I+ASEG+ TST V+ +WLLEP GDGDT+HIG+   MP AFEI+S  +TVGR+ +K
Sbjct  61   RNLGVIYASEGESTSTDVTDRWLLEPAGDGDTRHIGFKVQMPDAFEIASREVTVGRLPDK  120

Query  452  ADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGD  631
            AD+VIPV TVSG HAR++  E  L+VTDLDSTNGTFI+++RLRPGV A   PG+ + FG 
Sbjct  121  ADVVIPVATVSGIHARIQKKEGNLLVTDLDSTNGTFINDQRLRPGVVATVPPGSFLIFGC  180

Query  632  THLAIFRVSKLEK  670
                 F+  KL K
Sbjct  181  LDPEEFKEFKLVK  193



>dbj|BAJ92505.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88560.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=220

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = +2

Query  275  SLGAIHASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKA  454
            SL    AS G  ++   + +W+LEP GDGD KHIGY  A PGA EI+SGA+TVGRV E A
Sbjct  63   SLRCSSASTGSPSAVVSTERWILEPAGDGDWKHIGYRVARPGAIEIASGAMTVGRVPENA  122

Query  455  DMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDT  634
            D+VIPV TVSG HARL   +  LVVTD+DSTNGT+++E++L PG   A  PG+ + FGD 
Sbjct  123  DVVIPVATVSGVHARLEKKDGSLVVTDMDSTNGTYVNERKLVPGFPVAVQPGSLLIFGDI  182

Query  635  HLAIFRVSKLEKVDDAPEEQEDD  703
            HLA+FRV K   VD A E  +DD
Sbjct  183  HLAMFRVRK-TIVDVAAEASKDD  204



>gb|AEC10968.1| hypothetical protein [Camellia sinensis]
Length=223

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 103/145 (71%), Gaps = 5/145 (3%)
 Frame = +2

Query  209  SVNFLGYN-CLPRNLQCTA----KHLSSLGAIHASEGQITSTAVSIKWLLEPVGDGDTKH  373
            SV FLG+N  +P  L CT     +  + +  I AS  + T+T  S +WLLEPVGDGD++H
Sbjct  50   SVPFLGFNKNIPTKLPCTRLKTRQQRNLVVPISASGAETTATDDSERWLLEPVGDGDSRH  109

Query  374  IGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNG  553
            +GY  +MP AFEI+S  +T+GR  EKADMVIPV TVSG HAR++  +  L VTDLDSTNG
Sbjct  110  LGYKVSMPSAFEITSKIVTIGRAPEKADMVIPVATVSGLHARIQKKDGSLFVTDLDSTNG  169

Query  554  TFIDEKRLRPGVAAAALPGTRITFG  628
            TFI EKRLRPGVAA A  G+ ITFG
Sbjct  170  TFIGEKRLRPGVAATAPFGSYITFG  194



>ref|XP_010243734.1| PREDICTED: zeaxanthin epoxidase, chloroplastic isoform X3 [Nelumbo 
nucifera]
Length=185

 Score =   157 bits (398),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 101/153 (66%), Gaps = 2/153 (1%)
 Frame = +2

Query  188  ATVFAQNSVNFLGYNCLPRNLQCTAKHLSSLGAIHASEGQITSTAVSIKWLLEPVGDGDT  367
            +T FA  S  F       +N+Q     L  L   +AS  +  S+  + KWLLEPVGDGD+
Sbjct  35   STSFASVSFKFFPQKL--QNIQLKGIQLRKLRPTNASAAETPSSENAEKWLLEPVGDGDS  92

Query  368  KHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDST  547
            +HIG+   MP AFEI+S  +TVGR+ EKADMVIPV TVSG HAR+   E  L+VTDL+ST
Sbjct  93   RHIGFKVPMPDAFEIASSVVTVGRLPEKADMVIPVATVSGLHARIEKKEGNLMVTDLEST  152

Query  548  NGTFIDEKRLRPGVAAAALPGTRITFGDTHLAI  646
            NGTFID+KRLRPGV A   PG+ ITFG   L +
Sbjct  153  NGTFIDDKRLRPGVVAILSPGSCITFGRHELWV  185



>ref|XP_009386736.1| PREDICTED: uncharacterized protein LOC103973800 [Musa acuminata 
subsp. malaccensis]
Length=222

 Score =   158 bits (400),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = +2

Query  335  WLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTE  514
            WLL+PVGDGD++HIG+   +P AF I+S A+TVGR+ +KADMVIPV TVSG HARL    
Sbjct  87   WLLQPVGDGDSRHIGFKVPLPDAFVIASDAVTVGRLPDKADMVIPVATVSGVHARLEKKG  146

Query  515  DCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLEKVD  676
              L++TDLDSTNGT+ID+K+LRPG      PG+ ITFGDTHLA+FRVSK+E+ D
Sbjct  147  GTLLITDLDSTNGTYIDDKKLRPGAVTTVPPGSCITFGDTHLAMFRVSKIEQED  200



>ref|XP_010093833.1| FHA domain-containing protein [Morus notabilis]
 gb|EXB54684.1| FHA domain-containing protein [Morus notabilis]
Length=135

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +2

Query  353  GDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVT  532
            GDGDT+HIG+  AMP AFEI+S  +TVGR+ +KAD+VIPV TVS  HAR++     LVVT
Sbjct  5    GDGDTRHIGFKVAMPNAFEIASDEVTVGRLPDKADLVIPVATVSARHARIQKKAGSLVVT  64

Query  533  DLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLEKVDDAPEEQE  697
            DLDSTNGTFI++KRL PGVAA   PG+ ITFGD HLAIFR SKLE+  ++P   E
Sbjct  65   DLDSTNGTFINDKRLAPGVAATVSPGSYITFGDIHLAIFRASKLERTVESPSNSE  119



>ref|XP_010243733.1| PREDICTED: uncharacterized protein LOC104587718 isoform X2 [Nelumbo 
nucifera]
Length=203

 Score =   154 bits (390),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 98/146 (67%), Gaps = 2/146 (1%)
 Frame = +2

Query  188  ATVFAQNSVNFLGYNCLPRNLQCTAKHLSSLGAIHASEGQITSTAVSIKWLLEPVGDGDT  367
            +T FA  S  F       +N+Q     L  L   +AS  +  S+  + KWLLEPVGDGD+
Sbjct  35   STSFASVSFKFFPQKL--QNIQLKGIQLRKLRPTNASAAETPSSENAEKWLLEPVGDGDS  92

Query  368  KHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDST  547
            +HIG+   MP AFEI+S  +TVGR+ EKADMVIPV TVSG HAR+   E  L+VTDL+ST
Sbjct  93   RHIGFKVPMPDAFEIASSVVTVGRLPEKADMVIPVATVSGLHARIEKKEGNLMVTDLEST  152

Query  548  NGTFIDEKRLRPGVAAAALPGTRITF  625
            NGTFID+KRLRPGV A   PG+ ITF
Sbjct  153  NGTFIDDKRLRPGVVAILSPGSCITF  178



>ref|XP_002985954.1| hypothetical protein SELMODRAFT_446441 [Selaginella moellendorffii]
 gb|EFJ13131.1| hypothetical protein SELMODRAFT_446441 [Selaginella moellendorffii]
Length=238

 Score =   155 bits (392),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = +2

Query  308  ITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSG  487
            + + AV  KWLLEP+GDGD +HIG    +P AFE+S+ A TVGRV++KAD+VIPV TVSG
Sbjct  99   LAAAAVDTKWLLEPIGDGDCRHIGEEVPLPSAFELSTDAATVGRVADKADIVIPVGTVSG  158

Query  488  AHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLE  667
             HARL   +  L+VTDLDSTNGTF++ +R+RPG      PG+ ITFGD HLA F+VS +E
Sbjct  159  LHARLEKRDSMLMVTDLDSTNGTFVNNRRVRPGAVTPVPPGSSITFGDEHLAQFKVSMIE  218

Query  668  KVDDAPE  688
            K ++  E
Sbjct  219  KGEENTE  225



>ref|XP_006379353.1| hypothetical protein POPTR_0009s15850g [Populus trichocarpa]
 gb|ERP57150.1| hypothetical protein POPTR_0009s15850g [Populus trichocarpa]
Length=201

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 107/172 (62%), Gaps = 11/172 (6%)
 Frame = +2

Query  188  ATVFAQNSVNFLGYNCLPRNLQ---CTAKHLSSLGAIHASEGQITSTAVSIKWLLEPVGD  358
            A++ A NS+ F         LQ     AK   SLGA+HAS    T T V  +WLL PVGD
Sbjct  27   ASLLAHNSITFQSPKNFFTQLQGVRIKAKKQRSLGAVHASGADSTLTDVEERWLLVPVGD  86

Query  359  GDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPV-----PTVSGAHARLRHTEDCL  523
            GD+ HIG+   MP AFEI+S  +TVGR+ +KADMVIPV      T+S  HAR+++    L
Sbjct  87   GDSGHIGFKVKMPDAFEIASSEVTVGRLPDKADMVIPVATGVGSTLSALHARIQNKGGNL  146

Query  524  VVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGD---THLAIFRVSKLEK  670
            VVTDLDSTNGTFID+KRL PG + +  PG+RITFG    T   IF   K EK
Sbjct  147  VVTDLDSTNGTFIDKKRLPPGASVSVSPGSRITFGIITLTRYTIFSRKKKEK  198



>ref|XP_004978482.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Setaria 
italica]
Length=226

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 93/124 (75%), Gaps = 2/124 (2%)
 Frame = +2

Query  326  SIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLR  505
            S++W+L+P GDGD +HIGY  A PGAFEI+S A+TVGRV++KAD+V+PV TVSG HARL 
Sbjct  85   SVRWVLDPAGDGDWRHIGYKVARPGAFEIASDAVTVGRVADKADIVLPVATVSGTHARLE  144

Query  506  HTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLEKVDDAP  685
              +  L VTDLDSTNGT+I+E+RL PG      PG+ I FGD HLA+FRV K+  + + P
Sbjct  145  KKDGRLFVTDLDSTNGTYINERRLNPGFPIPIDPGSLIIFGDIHLAMFRVRKM--IVEVP  202

Query  686  EEQE  697
             E +
Sbjct  203  SETQ  206



>ref|XP_007205979.1| hypothetical protein PRUPE_ppa012118mg [Prunus persica]
 gb|EMJ07178.1| hypothetical protein PRUPE_ppa012118mg [Prunus persica]
Length=183

 Score =   152 bits (383),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 114/181 (63%), Gaps = 11/181 (6%)
 Frame = +2

Query  119  MELTTTTQ-SLSHSKIPKLFSNGGATVFAQN---SVNFLGYNCLPRNLQ------CTAKH  268
            ME+T     S+SH+K+P+ FS+      A +   S   L + C    LQ         K 
Sbjct  1    MEITAQHHLSISHTKLPRPFSSSSFRASAASLLASTTSLPFQCSNNILQGQGVLRIKGKQ  60

Query  269  L-SSLGAIHASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVS  445
            L S+ G I+AS  +  S     KWLLEPVGDGDT+HIG+   MP AFEIS+  +TVGR+ 
Sbjct  61   LRSTFGPIYASSSKAQSPPPPQKWLLEPVGDGDTRHIGFKVPMPSAFEISADEVTVGRLP  120

Query  446  EKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITF  625
            E+ADMVIPV TVSG HAR++  E  L+VTDLDSTNGTFID+KRL  GV A   PG+ +TF
Sbjct  121  EEADMVIPVATVSGVHARIQKKEGKLLVTDLDSTNGTFIDDKRLSAGVVATVPPGSCLTF  180

Query  626  G  628
            G
Sbjct  181  G  181



>ref|XP_004977424.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Setaria 
italica]
Length=220

 Score =   153 bits (386),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 95/131 (73%), Gaps = 5/131 (4%)
 Frame = +2

Query  326  SIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLR  505
            S++W+L+P GDGD +HIGY  A PGAFEI+S A+TVGRV++KAD+V+PV TVSG HARL 
Sbjct  83   SVRWVLDPAGDGDWRHIGYKVARPGAFEIASDAVTVGRVADKADIVLPVATVSGTHARLE  142

Query  506  HTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKL-----EK  670
              +  L VTDLDSTNGT+I+E+RL PG      PG+ I FGD HLA+FRV K+      +
Sbjct  143  KKDGRLFVTDLDSTNGTYINERRLNPGFPIPIDPGSLIIFGDIHLAMFRVRKMIVEATSE  202

Query  671  VDDAPEEQEDD  703
             D A EE + +
Sbjct  203  TDAAREETKTE  213



>ref|XP_001757941.1| predicted protein [Physcomitrella patens]
 gb|EDQ77183.1| predicted protein [Physcomitrella patens]
Length=239

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 96/135 (71%), Gaps = 3/135 (2%)
 Frame = +2

Query  287  IHASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVI  466
            + AS  Q TST  SIKW+L+PVGDG+T H+  P  +P  FE++S A T+GRV ++AD+VI
Sbjct  78   LRASALQQTSTN-SIKWVLDPVGDGNTSHLDAPVPLPSGFELASDAATIGRVKDRADVVI  136

Query  467  PVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAI  646
            PV TVSG HARL   +  L +TDLDSTNGTFI+ +R+RPG      PG+ ITFGD HLA+
Sbjct  137  PVATVSGVHARLEKKKGVLYITDLDSTNGTFINNRRIRPGAVTPVAPGSHITFGDEHLAV  196

Query  647  FRVSKLEKVDDAPEE  691
            FR  +LE  D +P E
Sbjct  197  FRFLQLE--DSSPAE  209



>ref|XP_011090253.1| PREDICTED: uncharacterized protein LOC105170974 isoform X2 [Sesamum 
indicum]
Length=169

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 113/196 (58%), Gaps = 47/196 (24%)
 Frame = +2

Query  119  MELTTTTQSLSHSKIPKL---FSNGGATVFAQNSVNFLGYNCLPRNLQCTAKHLSSLGAI  289
            ME+TT   SLS++K       F    ++V AQ SVNFLGYNCLPR L+C+ + L + GAI
Sbjct  1    MEMTT--HSLSYAKTNSFSPGFFPAKSSVAAQFSVNFLGYNCLPRKLKCSGRQLRNFGAI  58

Query  290  HASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIP  469
             AS+   +S   S++WLLEP+                                       
Sbjct  59   RASDSGNSSADGSVRWLLEPI---------------------------------------  79

Query  470  VPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIF  649
               VS  HAR++ T++ L++TDLDSTNGTFIDEKRL+PGV +AA PG  +TFGDT+LAIF
Sbjct  80   ---VSALHARIQKTDENLLITDLDSTNGTFIDEKRLQPGVVSAASPGNLVTFGDTNLAIF  136

Query  650  RVSKLEKVDDAPEEQE  697
            RV KL++ + A E +E
Sbjct  137  RVYKLKQEEFAYEPEE  152



>ref|XP_002984897.1| hypothetical protein SELMODRAFT_446054 [Selaginella moellendorffii]
 gb|EFJ14147.1| hypothetical protein SELMODRAFT_446054 [Selaginella moellendorffii]
Length=354

 Score =   154 bits (388),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = +2

Query  308  ITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSG  487
              + AV  KWLLEP+GDGD +HIG    +P AFE+S+ A TVGRV++KAD+VIPV TVSG
Sbjct  215  FAAAAVDTKWLLEPIGDGDCRHIGEEVPLPSAFELSTDAATVGRVADKADIVIPVGTVSG  274

Query  488  AHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLE  667
             HARL   +  L+VTDLDSTNGTF++ +R+RPG      PG+ ITFGD HLA F+VS +E
Sbjct  275  LHARLEKRDSMLMVTDLDSTNGTFVNNRRVRPGAVTPVPPGSSITFGDEHLAQFKVSMIE  334

Query  668  KVDDAPE  688
            K ++  E
Sbjct  335  KGEENTE  341



>ref|XP_001756090.1| predicted protein [Physcomitrella patens]
 gb|EDQ78956.1| predicted protein [Physcomitrella patens]
Length=274

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 95/135 (70%), Gaps = 3/135 (2%)
 Frame = +2

Query  287  IHASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVI  466
            +  S  Q TST  S++W+L+P GDG+T H+G P  +P  FE++S  +TVGRV +KAD+VI
Sbjct  108  LRVSALQQTSTK-SVRWVLDPCGDGNTSHLGAPVPLPSGFELASDNVTVGRVKDKADVVI  166

Query  467  PVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAI  646
            PV TVSG HARL      L VTDLDSTNGT+I+ +R+RPG      PG+ ITFGD HLA+
Sbjct  167  PVATVSGVHARLEKKSGVLYVTDLDSTNGTYINNRRIRPGAVTPVPPGSYITFGDEHLAV  226

Query  647  FRVSKLEKVDDAPEE  691
            FR  +LE  +D+P E
Sbjct  227  FRYLQLE--EDSPAE  239



>ref|XP_003577863.1| PREDICTED: uncharacterized protein LOC100835270 [Brachypodium 
distachyon]
Length=222

 Score =   147 bits (372),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 97/131 (74%), Gaps = 10/131 (8%)
 Frame = +2

Query  332  KWLLEPVGDGDTKHIGYPTAMPGAFEI-SSGAITVGRVSEKADMVIPVPTVSGAHARLRH  508
            KW+LEP GDGD +HIGY  A PGA EI +SGA+TVGRV EKAD+ +PV TVSG HARL  
Sbjct  80   KWVLEPAGDGDWRHIGYRVARPGAIEIPTSGAVTVGRVPEKADVAVPVATVSGVHARLEI  139

Query  509  TED-CLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLEKVDDAP  685
             +D  L VTD+DSTNGT+++E++L PG A A  PG+ + FGD HLA+FRV+K+  V DAP
Sbjct  140  KDDGTLAVTDMDSTNGTYVNERKLVPGFAVAVNPGSLLIFGDIHLAMFRVTKV--VVDAP  197

Query  686  ------EEQED  700
                  +EQE+
Sbjct  198  PVTAAGDEQEE  208



>ref|XP_008449952.1| PREDICTED: uncharacterized protein LOC103491680 [Cucumis melo]
Length=228

 Score =   147 bits (372),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +2

Query  353  GDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVT  532
            GDG+ KHIG    MP AFEI S  +TVGR+ +KAD+VIPV TVSG HAR+++ ED L+V 
Sbjct  102  GDGEWKHIGSKVEMPDAFEIVSNEVTVGRLPDKADIVIPVATVSGQHARIKNQEDKLLVI  161

Query  533  DLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLEKVDDAPEEQED  700
            DLDSTNGTFID+KRL PGV AA   G  ITFGD HLA+F+VSKL+ V+ A + QE+
Sbjct  162  DLDSTNGTFIDDKRLNPGVVAAVSSGNCITFGDIHLAMFQVSKLKTVEAASKIQEE  217



>ref|XP_002442729.1| hypothetical protein SORBIDRAFT_08g001890 [Sorghum bicolor]
 gb|EES16567.1| hypothetical protein SORBIDRAFT_08g001890 [Sorghum bicolor]
Length=231

 Score =   147 bits (372),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 101/136 (74%), Gaps = 5/136 (4%)
 Frame = +2

Query  311  TSTAVSI-KWLLEPVGDGDTKHIGYPTAMPGAFEI-SSGAITVGRVSEKADMVIPVPTVS  484
            +STAV+  KW+L+P GDGD +HIGY  A PGA EI S  A+TVGRV++KAD+V+P+ TVS
Sbjct  82   SSTAVTTEKWILDPAGDGDWRHIGYKVARPGAIEIISDDAVTVGRVADKADIVLPIATVS  141

Query  485  GAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKL  664
            G HARL      L+VTDLDSTNGT+I+E+RL PG   A  PG+ + FGD HLA+FRV K+
Sbjct  142  GTHARLEKKGGSLLVTDLDSTNGTYINERRLNPGFPIAIDPGSFLIFGDIHLAMFRVRKM  201

Query  665  EKVDDAPEEQEDDGAK  712
             +V+ A    ED+GA+
Sbjct  202  -RVEVA--STEDEGAQ  214



>gb|ACN28698.1| unknown [Zea mays]
 tpg|DAA59222.1| TPA: FHA domain containing protein [Zea mays]
 gb|AIB05147.1| FHA transcription factor, partial [Zea mays]
Length=212

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 101/140 (72%), Gaps = 8/140 (6%)
 Frame = +2

Query  314  STAVSI---KWLLEPVGDGDTKHIGYPTAMPGAFEISS--GAITVGRVSEKADMVIPVPT  478
            STAVS    +W+L+P GDGD +HIGY  A PGA EI S   A+TVGRV++KAD+V+PV T
Sbjct  65   STAVSSSSERWVLDPAGDGDWRHIGYKVARPGAIEIVSEDTAVTVGRVADKADIVLPVAT  124

Query  479  VSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVS  658
            VSGAHARL      L+VTDLDSTNGT+I+E+RL PG  A+  PG+ + FGD HLA+FRV 
Sbjct  125  VSGAHARLEKKGGSLLVTDLDSTNGTYINERRLNPGFPASVDPGSLLIFGDIHLAMFRVR  184

Query  659  KLEKVDDAP--EEQEDDGAK  712
            K   V +AP    +E +GA+
Sbjct  185  KTVVV-EAPSTSTEEAEGAQ  203



>ref|XP_006662695.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Oryza brachyantha]
Length=218

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 95/133 (71%), Gaps = 8/133 (6%)
 Frame = +2

Query  332  KWLLEPVGDGDTKHIGYPTAMPGAFEISS-GAITVGRVSEKADMVIPVPTVSGAHARLRH  508
            +W+LEP GDGD +HIGY  A PG F+I+S  A+TVGRV E+AD+V+ V TVSGAHARL  
Sbjct  79   RWVLEPAGDGDWRHIGYRVARPGGFQIASEAAVTVGRVPEQADIVLSVATVSGAHARLEK  138

Query  509  TEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLEKVDDAPE  688
             E  L+VTDLDSTNGT+I+E+RL PG      PG+ + FGD HLA+FRVSK+  V D P 
Sbjct  139  KEGRLLVTDLDSTNGTYINERRLTPGFPTPIDPGSLLIFGDIHLAMFRVSKM--VIDVPS  196

Query  689  -----EQEDDGAK  712
                 EQE + A+
Sbjct  197  DTNGAEQEAEIAQ  209



>ref|NP_001150384.1| FHA domain containing protein [Zea mays]
 gb|ACG38872.1| FHA domain containing protein [Zea mays]
Length=213

 Score =   144 bits (364),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 96/131 (73%), Gaps = 5/131 (4%)
 Frame = +2

Query  332  KWLLEPVGDGDTKHIGYPTAMPGAFEISS--GAITVGRVSEKADMVIPVPTVSGAHARLR  505
            +W+L+P GDGD +HIGY  A PGA EI S   A+TVGRV++KAD+V+PV TVSGAHARL 
Sbjct  75   RWVLDPAGDGDWRHIGYKVARPGAIEIVSEDTAVTVGRVADKADIVLPVATVSGAHARLE  134

Query  506  HTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLEKVDDAP  685
                 L+VTDLDSTNGT+I+E+RL PG  A+  PG+ + FGD HLA+FRV K   V +AP
Sbjct  135  KKGGSLLVTDLDSTNGTYINERRLNPGFPASVDPGSLLIFGDIHLAMFRVRKTVVV-EAP  193

Query  686  --EEQEDDGAK  712
                +E +GA+
Sbjct  194  STSTEEAEGAQ  204



>ref|NP_001066037.1| Os12g0124000 [Oryza sativa Japonica Group]
 gb|ABA95710.2| FHA domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29056.1| Os12g0124000 [Oryza sativa Japonica Group]
Length=228

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 89/121 (74%), Gaps = 3/121 (2%)
 Frame = +2

Query  332  KWLLEPVGDGDTKHIGYPTAMPGAFEISS-GAITVGRVSEKADMVIPVPTVSGAHARLRH  508
            +W+LEP GDGD +HIGY  A PG F+I+S  A+TVGRV E+AD+V+ V TVSG HARL  
Sbjct  88   RWVLEPAGDGDWRHIGYRVARPGGFQIASEAAVTVGRVPEQADIVLSVATVSGTHARLEK  147

Query  509  TEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLEKVDDAPE  688
             E  L+VTDL+STNGT+I+E+RL PG      PG+ + FGD HLA+FRVSK+  V D P 
Sbjct  148  KEGSLLVTDLESTNGTYINERRLSPGFPTPIDPGSLLIFGDIHLAMFRVSKM--VVDVPS  205

Query  689  E  691
            +
Sbjct  206  D  206



>ref|XP_006663771.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Oryza brachyantha]
Length=218

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = +2

Query  326  SIKWLLEPVGDGDTKHIGYPTAMPGAFEISS-GAITVGRVSEKADMVIPVPTVSGAHARL  502
            S +W+LEP GDG+ +HIGY  A PG F+I+S  A+TVGRV E+AD+V+ V TVSGAHARL
Sbjct  77   SERWVLEPAGDGEWRHIGYRVARPGGFQIASEAAVTVGRVPEQADIVLSVATVSGAHARL  136

Query  503  RHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKL  664
               E  L+VTDLDSTNGT+I+E+RL PG      PG+ + FGD HLA+FRVSK+
Sbjct  137  EKKEGRLLVTDLDSTNGTYINERRLTPGFPTPIDPGSLLIFGDIHLAMFRVSKM  190



>ref|NP_001065631.1| Os11g0127800 [Oryza sativa Japonica Group]
 gb|ABA91284.1| FHA domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27476.1| Os11g0127800 [Oryza sativa Japonica Group]
 gb|EAZ17270.1| hypothetical protein OsJ_32789 [Oryza sativa Japonica Group]
 dbj|BAG96373.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96480.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96544.1| unnamed protein product [Oryza sativa Japonica Group]
Length=230

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 92/131 (70%), Gaps = 4/131 (3%)
 Frame = +2

Query  332  KWLLEPVGDGDTKHIGYPTAMPGAFEISS-GAITVGRVSEKADMVIPVPTVSGAHARLRH  508
            +W+LEP GDGD +HIGY  A PG F+I+S  A+TVGRV E+AD+V+ V TVSG HARL  
Sbjct  91   RWVLEPAGDGDWRHIGYRVARPGGFQIASEAAVTVGRVPEQADIVLSVATVSGTHARLEK  150

Query  509  TEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKL---EKVDD  679
             E  L+VTDL+STNGT+I+E+RL PG      PG+ + FGD HLA+FRVSK+      D 
Sbjct  151  KEGSLLVTDLESTNGTYINERRLTPGFPTPIDPGSLLIFGDIHLAMFRVSKMIVDVSSDT  210

Query  680  APEEQEDDGAK  712
               EQE + A+
Sbjct  211  NEAEQEAETAQ  221



>gb|EEC67581.1| hypothetical protein OsI_34939 [Oryza sativa Indica Group]
Length=230

 Score =   143 bits (360),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 85/112 (76%), Gaps = 1/112 (1%)
 Frame = +2

Query  332  KWLLEPVGDGDTKHIGYPTAMPGAFEISS-GAITVGRVSEKADMVIPVPTVSGAHARLRH  508
            +W+LEP GDGD +HIGY  A PG F+I+S  A+TVGRV E+AD+V+ V TVSG HARL  
Sbjct  91   RWVLEPAGDGDWRHIGYRVARPGGFQIASEAAVTVGRVPEQADIVLSVATVSGTHARLEK  150

Query  509  TEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKL  664
             E  L+VTDL+STNGT+I+E+RL PG      PG+ + FGD HLA+FRVSK+
Sbjct  151  KEGSLLVTDLESTNGTYINERRLTPGFPTPIDPGSLLIFGDIHLAMFRVSKM  202



>gb|ABA95708.2| FHA domain containing protein, expressed [Oryza sativa Japonica 
Group]
Length=278

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 89/122 (73%), Gaps = 4/122 (3%)
 Frame = +2

Query  332  KWLLEPVGDGDTKHIGYPTAMPGAFEISS-GAITVGRVSEKADMVIPVPT-VSGAHARLR  505
            +W+LEP GDGD +HIGY  A PG F+I+S  A+TVGRV E+AD+V+ V T VSG HARL 
Sbjct  137  RWVLEPAGDGDWRHIGYRVARPGGFQIASEAAVTVGRVPEQADIVLSVATAVSGTHARLE  196

Query  506  HTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLEKVDDAP  685
              E  L+VTDL+STNGT+I+E+RL PG      PG+ + FGD HLA+FRVSK+  V D P
Sbjct  197  KKEGSLLVTDLESTNGTYINERRLSPGFPTPIDPGSLLIFGDIHLAMFRVSKM--VVDVP  254

Query  686  EE  691
             +
Sbjct  255  SD  256



>ref|XP_008672946.1| PREDICTED: FHA domain containing protein isoform X1 [Zea mays]
Length=210

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 99/140 (71%), Gaps = 10/140 (7%)
 Frame = +2

Query  314  STAVSI---KWLLEPVGDGDTKHIGYPTAMPGAFEISS--GAITVGRVSEKADMVIPVPT  478
            STAVS    +W+L+P GDGD +HIGY  A PGA EI S   A+TVGRV++KAD+V+PV T
Sbjct  65   STAVSSSSERWVLDPAGDGDWRHIGYKVARPGAIEIVSEDTAVTVGRVADKADIVLPVAT  124

Query  479  VSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVS  658
              GAHARL      L+VTDLDSTNGT+I+E+RL PG  A+  PG+ + FGD HLA+FRV 
Sbjct  125  --GAHARLEKKGGSLLVTDLDSTNGTYINERRLNPGFPASVDPGSLLIFGDIHLAMFRVR  182

Query  659  KLEKVDDAP--EEQEDDGAK  712
            K   V +AP    +E +GA+
Sbjct  183  KTVVV-EAPSTSTEEAEGAQ  201



>gb|ABK23956.1| unknown [Picea sitchensis]
Length=215

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 94/150 (63%), Gaps = 2/150 (1%)
 Frame = +2

Query  242  RNLQCTAKHLSSLGAIHASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSG  421
            + ++  ++ +  L  I AS  Q   +  + KW+ E VGDGD+ HIG   + P AFE++  
Sbjct  55   KRIKVESRSIDRLHPIRASASQ--PSGGTDKWVFEFVGDGDSSHIGQAVSPPKAFELTLD  112

Query  422  AITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAA  601
              TVGR+ EKAD+VIPV TVSG HARL   E  L V+D++STNGT+ID  RL PG     
Sbjct  113  VATVGRLPEKADIVIPVATVSGIHARLERKEGILFVSDMNSTNGTYIDNTRLSPGAVTVL  172

Query  602  LPGTRITFGDTHLAIFRVSKLEKVDDAPEE  691
              G+ ITFGD +LA FR SK E +D + EE
Sbjct  173  SAGSCITFGDINLATFRFSKKEGIDSSIEE  202



>gb|AAD23697.1| unknown protein [Arabidopsis thaliana]
Length=235

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 82/123 (67%), Gaps = 24/123 (20%)
 Frame = +2

Query  332  KWLLEPVGDGDTKHIGYPTAMPGAFEISS--------------GAITVGRVSEKADMVIP  469
            +WLL+PVGDGDT+HIGY  AMP  FEISS              G +T+GR+ EKAD+VIP
Sbjct  86   RWLLKPVGDGDTRHIGYKVAMPAPFEISSFLVFAKITKMGIEQGQVTIGRLPEKADVVIP  145

Query  470  VPT----------VSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRI  619
            V T          VSG HA +   E  L+VTD++STNGTFI++KRL PGVAA A PGTRI
Sbjct  146  VATESNTPSLLTSVSGVHATINTNEKNLLVTDMNSTNGTFIEDKRLIPGVAAPAFPGTRI  205

Query  620  TFG  628
            TFG
Sbjct  206  TFG  208



>gb|ABA95709.1| FHA domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG87173.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC68775.1| hypothetical protein OsI_37309 [Oryza sativa Indica Group]
 gb|EEE52677.1| hypothetical protein OsJ_35061 [Oryza sativa Japonica Group]
Length=271

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 86/121 (71%), Gaps = 9/121 (7%)
 Frame = +2

Query  332  KWLLEPVGDGDTKHIGYPTAMPGAFEISS-GAITVGRVSEKADMVIPVPTVSGAHARLRH  508
            +W+LEP GDGD +HIGY  A PG F+I+S  A+TVGRV E+AD+V+ V TVSG HARL  
Sbjct  137  RWVLEPAGDGDWRHIGYRVARPGGFQIASEAAVTVGRVPEQADIVLSVATVSGTHARLEK  196

Query  509  TEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLEKVDDAPE  688
             E  L+VTDL+STNGT+I+E+RL PG        T I  GD HLA+FRVSK+  V D P 
Sbjct  197  KEGSLLVTDLESTNGTYINERRLSPGFP------TPIDPGDIHLAMFRVSKM--VVDVPS  248

Query  689  E  691
            +
Sbjct  249  D  249



>gb|EMT21373.1| hypothetical protein F775_26787 [Aegilops tauschii]
Length=215

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +2

Query  332  KWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHT  511
            +W+LEP GDGD KHIGY  A PGA EI+S A+TVGRV E AD+VIPV TVSG HARL   
Sbjct  87   RWILEPAGDGDWKHIGYRVARPGAIEIASEAMTVGRVPENADVVIPVATVSGVHARLEKK  146

Query  512  EDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFG  628
            +  LVVTD+DSTNGT+++E++L PG   A  PG+ + FG
Sbjct  147  DGNLVVTDMDSTNGTYVNERKLVPGFPVAVQPGSLLIFG  185



>gb|ABK23669.1| unknown [Picea sitchensis]
Length=219

 Score =   128 bits (322),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 94/154 (61%), Gaps = 6/154 (4%)
 Frame = +2

Query  242  RNLQCTAKHLSSLGAIHASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSG  421
            + ++  ++ +  L  I AS  Q   +  + KW+ E VGDGD+ HIG   + P AFE++  
Sbjct  55   KRIKVESRSIDRLHPIRASASQ--PSGGTDKWVFEFVGDGDSSHIGQAVSPPKAFELTLD  112

Query  422  AITVGRVSEKADMVIPVPT----VSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGV  589
              TVGR+ EKAD+VIPV T    +SG HARL   E  L V+D++STNGT+ID  RL PG 
Sbjct  113  VATVGRLPEKADIVIPVATGSSKLSGIHARLERKEGILFVSDMNSTNGTYIDNTRLSPGA  172

Query  590  AAAALPGTRITFGDTHLAIFRVSKLEKVDDAPEE  691
                  G+ ITFGD +LA FR SK E +D + EE
Sbjct  173  VTVLSAGSCITFGDINLATFRFSKKEGIDSSIEE  206



>gb|ABK26653.1| unknown [Picea sitchensis]
Length=240

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 94/175 (54%), Gaps = 27/175 (15%)
 Frame = +2

Query  242  RNLQCTAKHLSSLGAIHASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSG  421
            + ++  ++ +  L  I AS  Q   +  + KW+ E VGDGD+ HIG   + P AFE++  
Sbjct  55   KRIKVESRSIDRLHPIRASASQ--PSGGTDKWVFEFVGDGDSSHIGQAVSPPKAFELTLD  112

Query  422  AITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAA  601
              TVGR+ EKAD+VIPV TVSG HARL   E  L V+D++STNGT+ID  RL PG     
Sbjct  113  VATVGRLPEKADIVIPVATVSGIHARLERKEGILFVSDMNSTNGTYIDNTRLSPGAVTVL  172

Query  602  LPGTRITF-------------------------GDTHLAIFRVSKLEKVDDAPEE  691
              G+ ITF                         GD +LA FR SK E +D + EE
Sbjct  173  SAGSCITFESKSHDMVIDCITSYSFQSLPSFILGDINLATFRFSKKEGIDSSIEE  227



>gb|ABK22834.1| unknown [Picea sitchensis]
Length=240

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 96/181 (53%), Gaps = 27/181 (15%)
 Frame = +2

Query  242  RNLQCTAKHLSSLGAIHASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSG  421
            + ++  ++ +  L  I AS  Q   +  + KW+ E VGDGD+ HIG   + P AFE++  
Sbjct  55   KRIKVESRSIDRLHPIRASASQ--PSGGTDKWVFEFVGDGDSSHIGQAVSPPKAFELTLD  112

Query  422  AITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAA  601
              TVGR+ EKAD+VIPV TVSG HARL   E  L V+D++STNGT+ID  RL PG   A 
Sbjct  113  VATVGRLPEKADIVIPVATVSGIHARLERKEGILFVSDMNSTNGTYIDNTRLSPGAVTAL  172

Query  602  LPGTRITF-------------------------GDTHLAIFRVSKLEKVDDAPEEQEDDG  706
              G+ ITF                         GD +LA FR SK + +D + E    D 
Sbjct  173  SAGSCITFESKSHDMVIDCITCYSFESLPSFILGDINLATFRFSKEKGIDSSIEGTSLDQ  232

Query  707  A  709
            A
Sbjct  233  A  233



>ref|XP_005644709.1| SMAD/FHA domain-containing protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20165.1| SMAD/FHA domain-containing protein [Coccomyxa subellipsoidea 
C-169]
Length=173

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 98/172 (57%), Gaps = 6/172 (3%)
 Frame = +2

Query  194  VFAQNSVNFLGYNCLPRNLQCTAKHLSSLGAIHASEGQITSTAVSIKWLLEPVGDGDTKH  373
            +    S++  G+   P + +   K   S G   +   + T+ AV+ K +L P GDG TKH
Sbjct  1    MLTARSISAAGFCLAPAHQRTATKFRISTGG--SKRARHTTLAVTSKLVLVPTGDGSTKH  58

Query  374  IGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNG  553
            +  P ++P   E+  G   VGR  E AD+VIP+PTVSG HA LR T   + VTDL STNG
Sbjct  59   LEEPVSLPEEIELKDGVFEVGR-EEPADVVIPIPTVSGRHALLRITGTKVQVTDLGSTNG  117

Query  554  TFIDEKRLRPGVAAAALPGTRITFGDTHLAIFR-VSKLEKVDD--APEEQED  700
            T++DE+ L    AA    G+RITFGD  LA+F  V + E V D  A  EQE+
Sbjct  118  TYLDEEELPTNRAAEVYVGSRITFGDASLAMFELVERPEDVTDVAADTEQEN  169



>ref|XP_004502004.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280133-like 
isoform X2 [Cicer arietinum]
Length=189

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 83/150 (55%), Gaps = 38/150 (25%)
 Frame = +2

Query  260  AKHLSSLGAIHAS-EGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVG  436
            AK   +LGAIHAS E    +T  + KWLL+P+GDGDT+HIG+   MPGA+EI+S  +TVG
Sbjct  63   AKQKGTLGAIHASLEAATPTTNATEKWLLKPIGDGDTRHIGFKVEMPGAYEIASSEVTVG  122

Query  437  RVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTR  616
            RV EKAD+VIPV TVSG HAR+R  +                                  
Sbjct  123  RVPEKADLVIPVATVSGVHARIRKNQ----------------------------------  148

Query  617  ITFGDTHLAIFRVSKLEKVDDAPEEQEDDG  706
               GD +LA+FRV K+E   DA   +E +G
Sbjct  149  ---GDANLAMFRVLKVEDEKDADTAEETEG  175



>ref|XP_002503308.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64566.1| predicted protein [Micromonas sp. RCC299]
Length=161

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 70/113 (62%), Gaps = 1/113 (1%)
 Frame = +2

Query  332  KWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGR-VSEKADMVIPVPTVSGAHARLRH  508
            +WLL+  G    +H+G    +PG FE+    + VGR  SE   + I VPTVSGAHA L  
Sbjct  48   RWLLKNCGPKTIEHLGEDVEIPGDFELKGPRVVVGRQASESVSLEIAVPTVSGAHAMLEV  107

Query  509  TEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLE  667
            ++D ++VTDL STNGTFI+ + L+ G+A     G+ + FGD  LA F + KL+
Sbjct  108  SDDAVMVTDLSSTNGTFIEGEELQAGIAYELKEGSEVIFGDEFLACFELLKLK  160



>gb|EMS51992.1| hypothetical protein TRIUR3_21495 [Triticum urartu]
Length=125

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = +2

Query  425  ITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAAL  604
            +TVGRV E AD+VIPV TVSG HARL   +  LVVTD+DSTNGT+++E++L PG   A  
Sbjct  1    MTVGRVPENADVVIPVATVSGVHARLEKKDGNLVVTDMDSTNGTYVNERKLVPGFPVAVQ  60

Query  605  PGTRITFGDTHLAI  646
            PG+ + FG T L +
Sbjct  61   PGSLLIFGTTPLCV  74



>ref|XP_005843548.1| hypothetical protein CHLNCDRAFT_140170 [Chlorella variabilis]
 gb|EFN51446.1| hypothetical protein CHLNCDRAFT_140170 [Chlorella variabilis]
Length=152

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 67/109 (61%), Gaps = 1/109 (1%)
 Frame = +2

Query  341  LEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDC  520
            L P GDG  +H+    A+PGA ++  G   +GR +  AD++I +PTVS  HA LR  E  
Sbjct  21   LTPTGDGTQQHLDAEVAIPGAIKLQEGLFELGR-APPADILIEIPTVSTRHATLRVGEAS  79

Query  521  LVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLE  667
            ++VTDL STNGT ID + L    AA   PG+ I FGD ++A FR+  +E
Sbjct  80   VIVTDLGSTNGTTIDGEELEATQAAELKPGSEIVFGDKYIAKFRLDVVE  128



>ref|XP_003080696.1| forkhead-associated domain-containing protein / FHA domain-containing 
protein (ISS) [Ostreococcus tauri]
 emb|CAL54864.1| Forkhead-associated (FHA) domain [Ostreococcus tauri]
Length=164

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 73/135 (54%), Gaps = 3/135 (2%)
 Frame = +2

Query  287  IHASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRV-SEKADMV  463
            + AS G + +     ++ L   GDG   H+  P   PG  EI +    +GRV SE  ++ 
Sbjct  32   VRASLGVLAANEDCGRFTLRNCGDGSQSHLDAPVPAPGDLEIVAVKSVIGRVQSEAVNLA  91

Query  464  IPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLA  643
            I VPTVSGAHA +      ++VTDL STNGTFID + L PGV    + G  + FGD  LA
Sbjct  92   IGVPTVSGAHAMIDLVNGKVMVTDLTSTNGTFIDGEELLPGVPTQLMVGGEVIFGDEFLA  151

Query  644  IFRVSKLEKVDDAPE  688
              R   +E +D+  E
Sbjct  152  --RYELVETLDEESE  164



>gb|KFM26549.1| hypothetical protein F751_2136 [Auxenochlorella protothecoides]
Length=154

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 70/125 (56%), Gaps = 5/125 (4%)
 Frame = +2

Query  314  STAVSIKWLLEPVGDGDTKHIGYP--TAMPGAFEISSGAITVGRVSEKADMVIPVPTVSG  487
            +T +S K  L P GDG   H+        PG   + SG + +GR S  AD+ + +PTVSG
Sbjct  24   ATRISAKLTLVPNGDGSKDHLKGEDDVVQPGPISLRSGTLELGR-SSNADIRLDIPTVSG  82

Query  488  AHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLE  667
             HAR++     ++VTDL STNGTF+D K L        LPG  +TFGD +LA F +   E
Sbjct  83   KHARIKVESSKILVTDLGSTNGTFVDGKELPANEEREVLPGGEVTFGDVYLAKFSLE--E  140

Query  668  KVDDA  682
              D+A
Sbjct  141  SADEA  145



>ref|XP_006384725.1| hypothetical protein POPTR_0004s20540g [Populus trichocarpa]
 gb|ERP62522.1| hypothetical protein POPTR_0004s20540g [Populus trichocarpa]
Length=124

 Score = 84.7 bits (208),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 65/108 (60%), Gaps = 8/108 (7%)
 Frame = +2

Query  392  MPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEK  571
            MP AFEI+S  ++V   S   ++  P  TVS  HAR++     LVVTDLDS NGTFIDEK
Sbjct  1    MPDAFEIAS--VSVSITSFNLNICFPHLTVSALHARIQKKGGTLVVTDLDSNNGTFIDEK  58

Query  572  RLRPGV-----AAAALPGTRITFGDTHLAIFRVSKLEKVDDAPEEQED  700
            RLRPG+         L       GDTHLA+F VSKL  V +AP + E+
Sbjct  59   RLRPGLLELLSTIICLCLRSFIAGDTHLAMFLVSKLATV-EAPSKPEE  105



>ref|XP_001692997.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP03566.1| predicted protein [Chlamydomonas reinhardtii]
Length=146

 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 74/126 (59%), Gaps = 6/126 (5%)
 Frame = +2

Query  311  TSTAVSIKWLLEPVGDGDTKHI-GYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSG  487
            T  AVS K +L+P+G G T+H+ G     PG   +  G + VGRV E  D+V+PVPTVS 
Sbjct  25   THVAVSNKLVLQPIGSGSTEHLDGEKVTPPGPVPLREGTLDVGRV-EPCDIVLPVPTVSS  83

Query  488  AHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALP-GTRITFGDTHLAIFRVSKL  664
             HA L    D ++V D++STNGT ++   ++  +    LP G  I FGD  LA F++ KL
Sbjct  84   RHAILTIEGDKVLVIDVNSTNGTMVNGAEIK-AMDYVELPIGGEIVFGDEFLAKFQLQKL  142

Query  665  EKVDDA  682
               DDA
Sbjct  143  P--DDA  146



>ref|XP_001419098.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97391.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=112

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 62/114 (54%), Gaps = 6/114 (5%)
 Frame = +2

Query  371  HIGYPTAMPGAFEISSGAITVGRV-SEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDST  547
            H+  P   PG   I +    +GR  SE  ++ I VPTVSGAHA +   +  ++VTDL ST
Sbjct  3    HLDAPVRAPGDLTIEATKSVIGRQRSEAVNLPIEVPTVSGAHAMIDLVDGKVMVTDLTST  62

Query  548  NGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLEKVDDAPEEQEDDGA  709
            NGTFID + L PGV    + G  + FGD  LA F     E V+ A E   DD A
Sbjct  63   NGTFIDGEELLPGVPTQLVVGGEVIFGDEFLARF-----ELVETADEGSGDDAA  111



>ref|XP_007513773.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16298.1| predicted protein [Bathycoccus prasinos]
Length=159

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 65/126 (52%), Gaps = 9/126 (7%)
 Frame = +2

Query  305  QITSTAVSIKWLLEPVGDGDTKHI-------GYPTAMPGAFEISSGAITVGRVSEKA-DM  460
            ++  T  S  ++L  VGD D  H+           A+P    ++     VGRVS  A ++
Sbjct  30   KVQKTIQSKAFILRNVGDLDRNHLEEEGNTEKQEDAIPRVLRLNGAKSVVGRVSSSAVNL  89

Query  461  VIPVPTVSGAHARLRHTEDC-LVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTH  637
             + V TVS AHA +  T D  ++VTDL STNGT+ID + L PG+      G  + FGD H
Sbjct  90   AVGVATVSSAHAMVDLTPDGKVMVTDLTSTNGTYIDGEELLPGIPQELTEGGEVIFGDEH  149

Query  638  LAIFRV  655
             A F +
Sbjct  150  CARFEL  155



>gb|ABG22342.1| FHA domain containing protein, expressed [Oryza sativa Japonica 
Group]
Length=166

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = +2

Query  332  KWLLEPVGDGDTKHIGYPTAMPGAFEISS-GAITVGRVSEKADMVIPVPT  478
            +W+LEP GDGD +HIGY  A PG F+I+S  A+TVGRV E+AD+V+ V T
Sbjct  91   RWVLEPAGDGDWRHIGYRVARPGGFQIASEAAVTVGRVPEQADIVLSVAT  140



>gb|EPS57360.1| hypothetical protein M569_17458 [Genlisea aurea]
Length=126

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 52/92 (57%), Gaps = 7/92 (8%)
 Frame = +2

Query  239  PRNLQCTAKHLSSLGAIHASEGQITSTAV------SIKWLLEPVGDGDTKHIGYPTAMPG  400
            P  L   A  L S  A+  S+ +  + A       S +W+LEPVG+GD +HIGY    PG
Sbjct  35   PGKLNSKAGKLRSFCAVKDSDSEAAAAATTATEDWSARWVLEPVGNGDFRHIGYRIPRPG  94

Query  401  AFEISSG-AITVGRVSEKADMVIPVPTVSGAH  493
            A E++S   +T+GR  EKAD V+ VPT  G +
Sbjct  95   AIELASDVVVTIGRTPEKADAVVAVPTGDGRY  126



>ref|XP_002956933.1| hypothetical protein VOLCADRAFT_107456 [Volvox carteri f. nagariensis]
 gb|EFJ42058.1| hypothetical protein VOLCADRAFT_107456 [Volvox carteri f. nagariensis]
Length=127

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 61/106 (58%), Gaps = 4/106 (4%)
 Frame = +2

Query  353  GDGDTKHI-GYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVV  529
            G+G  +H+ G    +PG   +  G + VGRV +  D+V+PVPTVS  HA L    D ++V
Sbjct  18   GNGSCEHLDGEKVELPGPVVLREGTLDVGRV-DPCDIVLPVPTVSSRHAILTVEGDKVLV  76

Query  530  TDLDSTNGTFIDEKRLRPGVAAAALP-GTRITFGDTHLAIFRVSKL  664
             D++STNGT I+   ++  +    LP G  I FGD  LA F + K+
Sbjct  77   IDVNSTNGTSINGTEIK-AMDYVELPIGGEIVFGDEFLAKFTLQKV  121



>ref|XP_003058427.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56882.1| predicted protein [Micromonas pusilla CCMP1545]
Length=191

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 67/154 (44%), Gaps = 37/154 (24%)
 Frame = +2

Query  311  TSTAVSIKWLLEPVGDGDTKHIGYPTAM--PGAFEISSGAITVGRV-SEKADMVIPVPTV  481
            ++  V   W+L+ VG     H+     +  PG   ++S  + VGR  SE   + I VPTV
Sbjct  37   SAVVVRAAWVLKNVGPKTKDHLDEDDEVVTPGDLPLTSPRMVVGRAASESVSLEIAVPTV  96

Query  482  S----------------------------------GAHARLRHTEDCLVVTDLDSTNGTF  559
            S                                  GAHA L  +ED + V DL STNGTF
Sbjct  97   SPSLAFNPDTPRRLSTPSDAFQLHPDIALYGTTVSGAHAMLEVSEDAVRVVDLSSTNGTF  156

Query  560  IDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSK  661
            ID + L+ GVA A      + FGD  LA +++ K
Sbjct  157  IDGEELQAGVAYALDENGEVVFGDEFLACYQLVK  190



>ref|WP_022350182.1| fHA domain-containing protein [Firmicutes bacterium CAG:534]
 emb|CDD48992.1| fHA domain-containing protein [Firmicutes bacterium CAG:534]
Length=413

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +2

Query  407  EISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPG  586
            ++S   +TVG++    DMV+  P+VS  HAR   T   + +TDL+STNGTF +  RL P 
Sbjct  333  DLSRLPLTVGKLPGAVDMVLEEPSVSRMHARFTKTGSAVYITDLNSTNGTFRNGMRLAPN  392

Query  587  VAAAALPGTRITFGDTHLAIFR  652
                  PG  I  G  +  I+R
Sbjct  393  ACEIIEPGDEIKIGKLNF-IYR  413



>ref|WP_036514781.1| hypothetical protein [Nitrincola sp. AK23]
 gb|EXJ09080.1| RDD family protein [Nitrincola sp. AK23]
Length=284

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 47/86 (55%), Gaps = 4/86 (5%)
 Frame = +2

Query  407  EISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDC----LVVTDLDSTNGTFIDEKR  574
            E+ +G +  GR +E    ++P  TVSG H RLR   D     L++ DLDS NGT +DE+R
Sbjct  198  ELEAGIVLGGRKTEDTTHIVPDNTVSGRHLRLRLQLDTGSTSLILEDLDSMNGTLVDEQR  257

Query  575  LRPGVAAAALPGTRITFGDTHLAIFR  652
            L+P         +RI  G + + + R
Sbjct  258  LQPHHPKRISLQSRIQIGGSEIQVSR  283



>ref|WP_014063273.1| signal peptide protein [Thermoanaerobacter wiegelii]
 ref|YP_004820605.1| FHA domain-containing protein [Thermoanaerobacter wiegelii Rt8.B1]
 gb|AEM79321.1| FHA domain containing protein [Thermoanaerobacter wiegelii Rt8.B1]
Length=134

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 47/79 (59%), Gaps = 7/79 (9%)
 Frame = +2

Query  404  FEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRP  583
            FE++    T+GR SE+ D+VI  P VS  HA +R       + DL+STNGTF++ KR++ 
Sbjct  59   FEVT----TIGR-SEECDIVIESPYVSARHAIIRKRGKRFYIQDLNSTNGTFVNGKRIK-  112

Query  584  GVAAAALPGTRITFGDTHL  640
            G+A     G  IT GD  L
Sbjct  113  GIAKIK-NGDVITLGDVEL  130



>ref|WP_029915524.1| hypothetical protein, partial [Pelobacter seleniigenes]
Length=111

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 47/90 (52%), Gaps = 5/90 (6%)
 Frame = +2

Query  380  YPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTF  559
            Y  A+   F   SG I VGR +++ D+ I    VSG HA +R   +  V+ DL STNGTF
Sbjct  8    YQGAVLETFTTDSGKIQVGR-NQQNDIQIDSLAVSGRHALIRKVMNTYVIEDLGSTNGTF  66

Query  560  IDEKRLRPGVAAAALPGTRITFGDTHLAIF  649
            ++E+++        L G  I  G  H  IF
Sbjct  67   VNERKIDK---YELLDGDEIIIG-KHSLIF  92



>ref|XP_003062638.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53457.1| predicted protein [Micromonas pusilla CCMP1545]
Length=733

 Score = 57.4 bits (137),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 59/123 (48%), Gaps = 10/123 (8%)
 Frame = +2

Query  314  STAVSIKWLLEPVGDGDTKHIGYPTAMPGAF--------EISSGAITVGRVSEKADMVIP  469
            +T  S +  L P GDG + H+   T +P +             G + VGR    +D+ + 
Sbjct  52   ATRASRELNLVPCGDGSSDHLPPGTRVPPSLAKTVVKLPRRDGGVVVVGR-ERPSDVRLN  110

Query  470  VPTVSGAHARLRHTEDCLV-VTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAI  646
            + TVSG HA      D  V VTD  S+NGT +D + L+PG       G  +T GD HLA 
Sbjct  111  IGTVSGQHASFERDADGDVYVTDRGSSNGTDVDGRTLKPGTRYKLSVGDVVTLGDPHLAR  170

Query  647  FRV  655
            F V
Sbjct  171  FEV  173



>ref|WP_022464028.1| fOG: FHA domain [Clostridium sp. CAG:277]
 emb|CDE69265.1| fOG: FHA domain [Clostridium sp. CAG:277]
Length=345

 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 47/84 (56%), Gaps = 2/84 (2%)
 Frame = +2

Query  380  YPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTF  559
            YP A+P  F ++ GA+TVGR +   D V+P   +S  HA++   ED + V D +S+NG F
Sbjct  256  YPEALPQLF-LTEGALTVGR-APGCDAVLPGSQISWHHAKIEVEEDRVFVIDTNSSNGVF  313

Query  560  IDEKRLRPGVAAAALPGTRITFGD  631
            +++KRL          G  I F D
Sbjct  314  LNKKRLIKEHPVLCRAGDIIGFAD  337



>ref|WP_033372494.1| hypothetical protein, partial [Glaciibacter superstes]
Length=97

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 40/77 (52%), Gaps = 5/77 (6%)
 Frame = +2

Query  425  ITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEK-----RLRPGV  589
            IT GR+     +  P   VS  H  +R   D +VVTDLDSTNGT +        RL PG 
Sbjct  9    ITGGRLPRLLSVASPTAAVSSTHVEIRQEGDAVVVTDLDSTNGTMVSPPGGRTTRLAPGQ  68

Query  590  AAAALPGTRITFGDTHL  640
            +   +PGT +  GD ++
Sbjct  69   SLVVVPGTTVDIGDGNI  85



>ref|WP_013565725.1| protein serine phosphatase with GAF(s) sensor(s) [Isosphaera 
pallida]
 ref|YP_004179986.1| protein serine phosphatase with GAF(s) sensor(s) [Isosphaera 
pallida ATCC 43644]
 gb|ADV63437.1| protein serine phosphatase with GAF(s) sensor(s) [Isosphaera 
pallida ATCC 43644]
Length=573

 Score = 57.0 bits (136),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 57/113 (50%), Gaps = 6/113 (5%)
 Frame = +2

Query  404  FEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTED-----CLVVTDLDSTNGTFIDE  568
             E+ +  IT+GR S+  D+V P P +S  HAR+    +       ++TDLDS+ GT +++
Sbjct  27   IELRTNTITLGRNSKYCDLVFPAPNISRRHARIDRVIEPDGRVVFMLTDLDSSLGTQLND  86

Query  569  KRLRPGVAAAALPGTRITFGDTHLAIFRVSKLEKVDDAPEEQEDDGAKGGPSS  727
            + LR G +A    G  I  GD  L     S+L+ V       E +  +G P S
Sbjct  87   RVLR-GQSAVLRDGDEIQIGDVFLLFQAESRLDPVTRTDSLTESEAWRGRPDS  138



>ref|WP_027428265.1| hypothetical protein [Lachnospiraceae bacterium AD3010]
Length=464

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 46/85 (54%), Gaps = 1/85 (1%)
 Frame = +2

Query  404  FEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRP  583
            + I      +G++  KAD V+P P VS  HA +R  E    ++DL+STNGT ++E+ L+ 
Sbjct  381  YRIERTPYMIGKMRNKADAVLPDPRVSRIHACIREEEGRYYLSDLNSTNGTAVNERVLKG  440

Query  584  GVAAAALPGTRITFGDTHLAIFRVS  658
               A    G  + F D  L  FR++
Sbjct  441  SETAELFDGDTVRFADVTLT-FRLA  464



>gb|ETX02374.1| hypothetical protein ETSY2_35690 [Candidatus Entotheonella sp. 
TSY2]
Length=118

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 45/80 (56%), Gaps = 2/80 (3%)
 Frame = +2

Query  425  ITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAAL  604
            +++GR S+  D+VI     S  HAR+    D   + DL S+NGTF+ EK+L PG+ +   
Sbjct  22   MSIGRNSDN-DIVISDSRASRYHARVTRRGDDFFLEDLSSSNGTFVGEKQLSPGIRSDLT  80

Query  605  PGTRITFGDTHLAIFRVSKL  664
             G  I  G T L IFR+ + 
Sbjct  81   DGDEIRIGSTRL-IFRLYRF  99



>ref|WP_022025104.1| forkhead-associated domain-containing protein [Clostridium sp. 
CAG:75]
 emb|CCZ52376.1| forkhead-associated domain-containing protein [Clostridium sp. 
CAG:75]
Length=141

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = +2

Query  389  AMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDE  568
             +P    +    + +GR+ +  D+ IP+  +S  HA L   +D + + D DS NGTF++ 
Sbjct  56   CVPAVISLLKSEVHIGRL-QTEDVCIPIDYISREHAVLYIDDDQIQIEDCDSANGTFLNG  114

Query  569  KRLRPGVAAAALPGTRITFGD  631
            ++L P V     PG  I+F D
Sbjct  115  EQLMPHVRTTCNPGDLISFAD  135



>gb|ELT87041.1| hypothetical protein CAPTEDRAFT_113758 [Capitella teleta]
Length=105

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 44/86 (51%), Gaps = 5/86 (6%)
 Frame = +2

Query  377  GYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHA--RLRHTEDCLVVTDLDSTN  550
            GY     G F+++    TVG+  E  D+VIP   V   HA       EDC V+ DL++  
Sbjct  3    GYLKNQEGIFQLAPKVTTVGK--EGCDLVIPTHGVDYQHAVIEFSQQEDCFVLQDLNTAQ  60

Query  551  GTFIDEKRLRPGVAAAALPGTRITFG  628
            GT++++ R++      A PG  I FG
Sbjct  61   GTYVNDCRVQNAAVRLA-PGDIIRFG  85



>ref|WP_022303141.1| putative uncharacterized protein [Firmicutes bacterium CAG:227]
 emb|CDC94394.1| putative uncharacterized protein [Firmicutes bacterium CAG:227]
Length=467

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 55/117 (47%), Gaps = 14/117 (12%)
 Frame = +2

Query  338  LLEPVGDGDTKHIGYPTAMPGAFE--------ISSGAITVGRVSEKADMVIPVPTVSGAH  493
            LL+P     T     P+A    FE        ++   + +G+  E A++ + +PTVS  H
Sbjct  352  LLQPDTSAQT-----PSASLTVFENGQPLTVFLTEEFLLIGKHPELANLCLSIPTVSRLH  406

Query  494  ARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKL  664
            AR+R    C  + DL+S NGTFI+ K L P          +I   +  L IF  S++
Sbjct  407  ARIRKDAACFFIMDLNSKNGTFINGKPLSPQEEYQLCDNDKIQISEVEL-IFHDSQI  462



>ref|WP_012995733.1| MULTISPECIES: signal peptide protein [Thermoanaerobacter]
 ref|YP_003477575.1| FHA domain-containing protein [Thermoanaerobacter italicus Ab9]
 ref|YP_003677462.1| FHA domain-containing protein [Thermoanaerobacter mathranii subsp. 
mathranii str. A3]
 gb|ADD03013.1| FHA domain containing protein [Thermoanaerobacter italicus Ab9]
 gb|ADH61451.1| FHA domain containing protein [Thermoanaerobacter mathranii subsp. 
mathranii str. A3]
Length=134

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 7/79 (9%)
 Frame = +2

Query  404  FEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRP  583
            FE++    T+GR SE+ D+VI  P VS  HA +R       + DL+STNGTFI+ KR++ 
Sbjct  59   FEVT----TIGR-SEECDIVIESPYVSARHAIIRKRGRRFYIQDLNSTNGTFINGKRVK-  112

Query  584  GVAAAALPGTRITFGDTHL  640
            G+A        IT GD  L
Sbjct  113  GIAKIK-NNDVITLGDVEL  130



>ref|WP_029689419.1| signal peptide protein [Thermoanaerobacter sp. A7A]
Length=134

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 46/79 (58%), Gaps = 7/79 (9%)
 Frame = +2

Query  404  FEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRP  583
            FE++    T+GR SE+ D+VI  P VS  HA +R       + DL+STNGTF++ KR++ 
Sbjct  59   FEVT----TIGR-SEECDIVIESPYVSARHAIIRKRGKRFYIQDLNSTNGTFVNGKRIK-  112

Query  584  GVAAAALPGTRITFGDTHL  640
            G+A        IT GD  L
Sbjct  113  GIAKIR-NNDVITLGDVEL  130



>ref|WP_012269067.1| MULTISPECIES: signal peptide protein [Thermoanaerobacter]
 ref|YP_001664571.1| FHA domain-containing protein [Thermoanaerobacter pseudethanolicus 
ATCC 33223]
 ref|YP_004185570.1| Forkhead-associated protein [Thermoanaerobacter brockii subsp. 
finnii Ako-1]
 gb|ABY94235.1| FHA domain containing protein [Thermoanaerobacter pseudethanolicus 
ATCC 33223]
 gb|ADV79187.1| Forkhead-associated protein [Thermoanaerobacter brockii subsp. 
finnii Ako-1]
Length=134

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 7/79 (9%)
 Frame = +2

Query  404  FEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRP  583
            FE++    T+GR SE+ D+VI  P VS  HA +R       + DL+STNGTFI+ KR++ 
Sbjct  59   FEVT----TIGR-SEECDIVIESPYVSARHAIIRKRGKRFYIQDLNSTNGTFINGKRIK-  112

Query  584  GVAAAALPGTRITFGDTHL  640
            G+A        IT GD  L
Sbjct  113  GIAKIR-NNDVITLGDVDL  130



>gb|KHO63099.1| signal peptide protein [Thermoanaerobacter sp. YS13]
Length=134

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 46/79 (58%), Gaps = 7/79 (9%)
 Frame = +2

Query  404  FEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRP  583
            FE++    T+GR SE+ D+VI  P VS  HA +R       + DL+STNGTF++ KR++ 
Sbjct  59   FEVT----TIGR-SEECDIVIESPYVSARHAIIRKRGKRFYIQDLNSTNGTFVNGKRIK-  112

Query  584  GVAAAALPGTRITFGDTHL  640
            G+A        IT GD  L
Sbjct  113  GIAKIR-NNDVITLGDVEL  130



>ref|WP_006569482.1| signal peptide protein [Thermoanaerobacter siderophilus]
 gb|EIV99593.1| FHA domain-containing protein [Thermoanaerobacter siderophilus 
SR4]
Length=134

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 46/79 (58%), Gaps = 7/79 (9%)
 Frame = +2

Query  404  FEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRP  583
            FE++    T+GR SE+ D+VI  P VS  HA +R       + DL+STNGTF++ KR++ 
Sbjct  59   FEVT----TIGR-SEECDIVIESPYVSARHAIIRKRGKRFYIQDLNSTNGTFVNGKRIK-  112

Query  584  GVAAAALPGTRITFGDTHL  640
            G+A        IT GD  L
Sbjct  113  GIAKIR-NNDVITLGDVEL  130



>ref|WP_022154966.1| fHA domain-containing protein [Firmicutes bacterium CAG:65]
 emb|CDA99911.1| fHA domain-containing protein [Firmicutes bacterium CAG:65]
Length=378

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +2

Query  410  ISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGV  589
            +   A T+G+   +AD+V+   ++S  HAR+   ED   + D++STNGTF +  R++P  
Sbjct  299  LDQEAYTIGKKRGEADLVLEDLSISRLHARIVKEEDGYYLEDMNSTNGTFKNGLRMQPYE  358

Query  590  AAAALPGTRITFGDTHLAIFR  652
                  G  ITFG   L I+R
Sbjct  359  KRKLEEGDEITFGKRTL-IYR  378



>ref|WP_003869421.1| MULTISPECIES: signal peptide protein [Thermoanaerobacter]
 ref|YP_001662689.1| FHA domain-containing protein [Thermoanaerobacter sp. X514]
 ref|YP_003904721.1| FHA domain containing protein [Thermoanaerobacter sp. X513]
 gb|ABY92353.1| FHA domain containing protein [Thermoanaerobacter sp. X514]
 gb|EFK83918.1| FHA domain containing protein [Thermoanaerobacter sp. X561]
 gb|ADN55430.1| FHA domain containing protein [Thermoanaerobacter sp. X513]
 gb|EGD52668.1| FHA domain containing protein [Thermoanaerobacter ethanolicus 
JW 200]
 gb|EMT39139.1| FHA domain containing protein [Thermoanaerobacter thermohydrosulfuricus 
WC1]
 gb|AIS52949.1| FHA domain-containing protein [Thermoanaerobacter kivui]
Length=134

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 44/79 (56%), Gaps = 7/79 (9%)
 Frame = +2

Query  404  FEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRP  583
            FE++    T+GR SE+ D+VI  P VS  HA +R       + DL+STNGTF++ KR++ 
Sbjct  59   FEVT----TIGR-SEECDIVIESPYVSARHAIIRKRGKRFYIQDLNSTNGTFVNGKRIKR  113

Query  584  GVAAAALPGTRITFGDTHL  640
               A       IT GD  L
Sbjct  114  --IAKITNNDVITLGDVEL  130



>gb|ETI81903.1| FHA protein [Varibaculum cambriense DORA_20]
Length=76

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 45/79 (57%), Gaps = 4/79 (5%)
 Frame = +2

Query  431  VGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPG  610
            +GR SE AD+V+  P VS  H  LR T   ++ TDL STNG++++  R+    AA  L G
Sbjct  2    IGRGSE-ADIVVHDPGVSRRHLELRITPQGVIATDLGSTNGSYVEGHRIS---AATLLDG  57

Query  611  TRITFGDTHLAIFRVSKLE  667
              +T G THL  +  S  E
Sbjct  58   NELTIGRTHLLFWTSSADE  76



>ref|WP_016293272.1| hypothetical protein [Lachnospiraceae bacterium 28-4]
 gb|EOS29086.1| hypothetical protein C807_03610 [Lachnospiraceae bacterium 28-4]
Length=445

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 38/67 (57%), Gaps = 0/67 (0%)
 Frame = +2

Query  428  TVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALP  607
            T+G+++   D+VI   T+S  HAR    ED + VTD++STNGTF +  RL P        
Sbjct  372  TIGKMAGNVDIVIKDSTISRIHARFTRQEDGIYVTDMNSTNGTFKNGLRLEPNETVRIEC  431

Query  608  GTRITFG  628
            G  + FG
Sbjct  432  GDELRFG  438



>ref|WP_003866600.1| signal peptide protein [Thermoanaerobacter ethanolicus]
 gb|EEU63496.1| FHA domain containing protein [Thermoanaerobacter ethanolicus 
CCSD1]
Length=134

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 44/79 (56%), Gaps = 7/79 (9%)
 Frame = +2

Query  404  FEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRP  583
            FE++    T+GR SE+ D+VI  P VS  HA +R       + DL+STNGTF++ KR++ 
Sbjct  59   FEVT----TIGR-SEECDIVIESPYVSARHAIIRKRGKRFYIQDLNSTNGTFVNGKRIKR  113

Query  584  GVAAAALPGTRITFGDTHL  640
               A       IT GD  L
Sbjct  114  --IAKITNNDVITLGDVEL  130



>ref|XP_005646300.1| FAD/NAD(P)-binding domain-containing protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21756.1| FAD/NAD(P)-binding domain-containing protein [Coccomyxa subellipsoidea 
C-169]
Length=626

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 55/99 (56%), Gaps = 7/99 (7%)
 Frame = +2

Query  371  HIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTE-DCLVVTDLDST  547
             I YP A   A EI +  + +G  ++ AD+ +  P V+ AHARLR++E     V DL S 
Sbjct  499  RIAYPEA---ALEICTAGVLIGSGAD-ADVKLDSPVVAEAHARLRNSEAGGYTVEDLASP  554

Query  548  NGTFIDEKRLRPGVAAAALPGTRITFG--DTHLAIFRVS  658
            +GT+++ +RL+P   A   PG  + FG  +T    +R+ 
Sbjct  555  SGTWLNGRRLQPRQPAQLCPGDELCFGCRETEAVRYRIK  593



>gb|KFM26740.1| PsbD mRNA maturation factor Nac2, chloroplastic [Auxenochlorella 
protothecoides]
Length=494

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 49/93 (53%), Gaps = 14/93 (15%)
 Frame = +2

Query  389  AMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLR--------HTEDCLVVTDLDS  544
            A PG F +  GA+  G     AD+V+  PTVSG+HARL           E  LVV DL S
Sbjct  107  ATPGPFVL--GAVIDG----DADVVVLDPTVSGSHARLEVLTRGAGPDAEAQLVVADLSS  160

Query  545  TNGTFIDEKRLRPGVAAAALPGTRITFGDTHLA  643
            TNGT+++  RLRP       PG  ++  D  ++
Sbjct  161  TNGTYVNGARLRPWTETVLHPGDVLSLADPRVS  193



>ref|XP_005844735.1| hypothetical protein CHLNCDRAFT_138731 [Chlorella variabilis]
 gb|EFN52633.1| hypothetical protein CHLNCDRAFT_138731 [Chlorella variabilis]
Length=705

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 59/124 (48%), Gaps = 14/124 (11%)
 Frame = +2

Query  335  WLLEPVGDGDTK-----HIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHAR  499
            W+L PV DG +      H+ +  A   +  IS   +TVG      DMV+  PTVS  HAR
Sbjct  560  WVLTPVTDGSSASPEALHLEFEAAKHQSPVISREGVTVG-TGAGCDMVLTAPTVSEQHAR  618

Query  500  LRHTEDCLV-VTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFG-------DTHLAIFRV  655
            L   E     VTDLDS  GT+++ +RL   V     P   ++FG       D  + +F  
Sbjct  619  LHQCEAGDYHVTDLDSQLGTWVNSRRLPARVPQRLRPDDVVSFGAPGQGSLDFKVCMFHN  678

Query  656  SKLE  667
            S LE
Sbjct  679  SLLE  682



>ref|WP_027295314.1| hypothetical protein [Robinsoniella sp. KNHs210]
Length=546

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/139 (26%), Positives = 57/139 (41%), Gaps = 10/139 (7%)
 Frame = +2

Query  245  NLQCTAKHLSSLGAIHASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMP---GAFEIS  415
            N+Q   +     G     E QI  T +         GD + K + + +  P   G   + 
Sbjct  415  NMQLRNQTKIEEGYQAEKEEQIGQTTI-------LCGDEELKKLCFISMEPHLRGNILLY  467

Query  416  SGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAA  595
               + +G++  K D+ I +P VS  HA++   E    V DL+S NGTF++ +RL      
Sbjct  468  DKTLYIGKMKSKVDVRIDLPVVSRVHAKIWQEEGSFYVMDLNSMNGTFLNGERLEANEKR  527

Query  596  AALPGTRITFGDTHLAIFR  652
               P   + F      I R
Sbjct  528  EIRPSDEVAFASASYYIGR  546



>ref|WP_022588813.1| signal peptide protein [Caldanaerobacter subterraneus]
 gb|ERM90929.1| signal peptide protein [Caldanaerobacter subterraneus subsp. 
yonseiensis KB-1]
Length=132

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 46/79 (58%), Gaps = 8/79 (10%)
 Frame = +2

Query  404  FEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRP  583
            FE++S    +GR S++ D+VI  P VS  HA ++   +   + DL+STNGTF++ KR+R 
Sbjct  58   FEVTS----IGR-SDECDIVIESPYVSARHALIKKRGNKFYIEDLNSTNGTFVNGKRVR-  111

Query  584  GVAAAALPGTRITFGDTHL  640
               A    G  IT GD  L
Sbjct  112  --IARIKNGDVITLGDVDL  128



>ref|WP_014148586.1| hypothetical protein [Methylomicrobium alcaliphilum]
 ref|YP_004917388.1| hypothetical protein MEALZ_2110 [Methylomicrobium alcaliphilum 
20Z]
 emb|CCE23796.1| exported protein of unknown function [Methylomicrobium alcaliphilum 
20Z]
Length=448

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 42/76 (55%), Gaps = 2/76 (3%)
 Frame = +2

Query  431  VGRVSEKADMVIPVPTVSGAHARLR-HTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALP  607
            +GR   +   VI    VS  HA+LR H    L+V DLDSTNG F+D  +L   V A   P
Sbjct  371  LGRDPNQVSFVIEQTDVSRCHAQLRWHERRGLLVMDLDSTNGVFVDHAKLANRVWATIKP  430

Query  608  GTRITFGDTHLAIFRV  655
            G R+ FG   + ++R+
Sbjct  431  GQRLIFGSEQV-VYRI  445



>ref|WP_034232404.1| hypothetical protein [Lachnospiraceae bacterium AC2029]
Length=492

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 1/65 (2%)
 Frame = +2

Query  410  ISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGV  589
            +S G   +GR  E+ +  IP P +S  HARL    D + + DL STNGT+++  RL PG 
Sbjct  413  VSEGYCRIGRSEEENEYCIPAPAISRNHARLECVGDVVTLRDLGSTNGTYLNHMRL-PGE  471

Query  590  AAAAL  604
            A A L
Sbjct  472  AVAEL  476



>ref|WP_038110302.1| signal peptide protein, partial [Varibaculum cambriense]
Length=83

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 45/79 (57%), Gaps = 4/79 (5%)
 Frame = +2

Query  431  VGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPG  610
            +GR SE AD+V+  P VS  H  LR T   ++ TDL STNG++++  R+    AA  L G
Sbjct  9    IGRGSE-ADIVVHDPGVSRRHLELRITPQGVIATDLGSTNGSYVEGHRIS---AATLLDG  64

Query  611  TRITFGDTHLAIFRVSKLE  667
              +T G THL  +  S  E
Sbjct  65   NELTIGRTHLLFWTSSADE  83



>ref|WP_022305566.1| fHA domain protein [Roseburia sp. CAG:380]
 emb|CDC92339.1| fHA domain protein [Roseburia sp. CAG:380]
Length=367

 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 43/82 (52%), Gaps = 1/82 (1%)
 Frame = +2

Query  386  TAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFID  565
            + +P   E+    + VGR  E +D+VIP   VS  HARL   ED + +TDL S NG F++
Sbjct  279  SYVPERVELDREMLVVGRGLE-SDVVIPAAQVSWQHARLETGEDGIYLTDLSSVNGVFLN  337

Query  566  EKRLRPGVAAAALPGTRITFGD  631
             KRL          G  ++F D
Sbjct  338  RKRLIKEHPVLCRVGDIVSFAD  359



>ref|WP_026505130.1| hypothetical protein [Butyrivibrio sp. NC3005]
Length=594

 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = +2

Query  425  ITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLV-VTDLDSTNGTFIDEKRLRPGVAAAA  601
            +T+G+++   D  +   T+S  HAR+   ED  V V DL+STNGTF +  RL+P  A+  
Sbjct  519  MTIGKMAGGVDTCLNNQTISRIHARIFRDEDNNVCVQDLNSTNGTFHNGLRLKPQQASVL  578

Query  602  LPGTRITFGD  631
            +PG  I F D
Sbjct  579  VPGDEICFAD  588



>ref|WP_036940127.1| hypothetical protein [Pseudobacteroides cellulosolvens]
Length=360

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 49/90 (54%), Gaps = 1/90 (1%)
 Frame = +2

Query  314  STAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAH  493
             + +++  ++E + D +T       A P    IS     VGR+SE +D VIP   +  AH
Sbjct  248  KSEINVYPVMERIFDNETDDTD-SKANPDIVTISKNNFIVGRISELSDYVIPSKFIGRAH  306

Query  494  ARLRHTEDCLVVTDLDSTNGTFIDEKRLRP  583
            +++   +    + DL S NGT+++E++L+P
Sbjct  307  SQISIEQGRYFIKDLGSVNGTYLNEEKLKP  336



>ref|WP_022500420.1| fHA domain-containing protein [Firmicutes bacterium CAG:95]
 emb|CDF07369.1| fHA domain-containing protein [Firmicutes bacterium CAG:95]
Length=193

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 52/110 (47%), Gaps = 5/110 (5%)
 Frame = +2

Query  323  VSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARL  502
            V I W    + + D K  G   +      +    ITVG+++   D+V+   +VS  HAR+
Sbjct  89   VFIPW----IENSDNKLYGIGKSNKYHIPLQKLPITVGKMAGAVDLVLNDQSVSRLHARI  144

Query  503  RHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFR  652
                +   +TDL+STNGTF +  RL P  +    PG  I  G     I+R
Sbjct  145  SRDGNRFFITDLNSTNGTFRNGMRLEPNASEIIEPGDEIGIGKLKF-IYR  193



>ref|WP_025280909.1| hypothetical protein [Halorhodospira halochloris]
 gb|AHK80606.1| hypothetical protein M911_04375 [Halorhodospira halochloris str. 
A]
Length=237

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 45/72 (63%), Gaps = 6/72 (8%)
 Frame = +2

Query  374  IGYPTAMP-GAFEISSGAITVGRVSEKADMVIPVP--TVSGAHARLRHTEDCLVVTDLDS  544
            + Y    P G F +S G  T+GR   K D +I +   TVSG HARLR   + +++ DLDS
Sbjct  5    LAYKNRQPQGEFPLSEGTTTIGR---KPDNLICLQDRTVSGHHARLRLYREEVILQDLDS  61

Query  545  TNGTFIDEKRLR  580
            TNGT+++ +R++
Sbjct  62   TNGTYVNRERIQ  73



>ref|WP_032120338.1| signal peptide protein [Clostridium sp. CL-2]
Length=150

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 45/82 (55%), Gaps = 3/82 (4%)
 Frame = +2

Query  419  GAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAA  598
            G +T+GR+ + + +++  P VSG HAR+    + L + DL+STNG +++E+++   +   
Sbjct  72   GDVTIGRMDDNS-IILSEPFVSGHHARVYAKNNTLYIEDLNSTNGIYVNEEKVEGKIKLT  130

Query  599  ALPGTRITFGDTHLAIFRVSKL  664
               G  I  G     + R  KL
Sbjct  131  T--GDEIKIGSAIFTVLRADKL  150



>ref|XP_007512359.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16959.1| predicted protein [Bathycoccus prasinos]
Length=390

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 52/109 (48%), Gaps = 14/109 (13%)
 Frame = +2

Query  263  KHLSSLGAIHASEGQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRV  442
            + +SS  A    E   TSTA   KW L P      K +G      G          +GR 
Sbjct  212  ERVSSKAAAALMEATDTSTA---KWTLTPDSSTTKKRLGKINLKNG------DVFIIGR-  261

Query  443  SEKA---DMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLR  580
             EK    D+ +P+P VSG H +L    + L VTDL STNGT++D  +LR
Sbjct  262  -EKGNGVDVSVPLPCVSGVHCQLEMERNKLYVTDLGSTNGTYVDGFQLR  309



>gb|ESA33559.1| fha domain-containing protein [Leptolyngbya sp. Heron Island 
J]
Length=190

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/95 (31%), Positives = 50/95 (53%), Gaps = 3/95 (3%)
 Frame = +2

Query  386  TAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDC-LVVTDLDSTNGTFI  562
            T     F    G  T+GR   ++D+ +P   +S  HA L++++D   +++DL+STNGT++
Sbjct  78   TGKSKGFYSKDGLWTIGRDPRQSDIAVPDKRLSRCHAALQYSQDQGFILSDLESTNGTYV  137

Query  563  DEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLE  667
            + K+L+     A   G RI  G +    F  S  +
Sbjct  138  NGKKLQR--VYALRDGDRIRIGSSLFHFFSCSSCD  170



>ref|WP_012639099.1| FHA-domain containing protein [Thioalkalivibrio sulfidiphilus]
 ref|YP_002514611.1| FHA-domain containing protein [Thioalkalivibrio sulfidiphilus 
HL-EbGr7]
 gb|ACL73624.1| FHA-domain containing protein [Thioalkalivibrio sulfidiphilus 
HL-EbGr7]
Length=251

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 57/111 (51%), Gaps = 10/111 (9%)
 Frame = +2

Query  371  HIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTN  550
            HI +  ++    E++ G   +GR  E  D+V+P  TVSG HAR+ H     V+ DL STN
Sbjct  5    HIHHKDSLIAVHELAPGTTRIGR-KEDNDIVLPDRTVSGHHARIHHAYGLAVLEDLGSTN  63

Query  551  GTFIDEKRLRPGVAAAALP-GTRITFGDTHLAIFRVSKLEKV-DDAPEEQE  697
            G+ ++ KR    V   AL  G  I  G+  L   R    E+V  D PE Q+
Sbjct  64   GSSVNGKR----VTRRALENGDIIVIGNCQL---RFETDEQVGTDEPETQD  107



>ref|WP_035837634.1| hypothetical protein, partial [Cryobacterium roopkundense]
Length=90

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 35/59 (59%), Gaps = 5/59 (8%)
 Frame = +2

Query  479  VSGAHARLRHTEDCLVVTDLDSTNGTFI-----DEKRLRPGVAAAALPGTRITFGDTHL  640
            VSG H  +R   D +VVTD+ STNGT +       +RLR G + A  PGTR+  GD ++
Sbjct  27   VSGTHLEIRQDGDSVVVTDVGSTNGTLVLPPRGRRQRLRAGQSLAVRPGTRVDIGDGNI  85



>ref|WP_036054502.1| hypothetical protein, partial [Leptolyngbya sp. Heron Island 
J]
Length=152

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 48/89 (54%), Gaps = 3/89 (3%)
 Frame = +2

Query  386  TAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDC-LVVTDLDSTNGTFI  562
            T     F    G  T+GR   ++D+ +P   +S  HA L++++D   +++DL+STNGT++
Sbjct  66   TGKSKGFYSKDGLWTIGRDPRQSDIAVPDKRLSRCHAALQYSQDQGFILSDLESTNGTYV  125

Query  563  DEKRLRPGVAAAALPGTRITFGDTHLAIF  649
            + K+L+     A   G RI  G +    F
Sbjct  126  NGKKLQR--VYALRDGDRIRIGSSLFHFF  152



>ref|WP_031460416.1| transcriptional regulator [Chloroflexus sp. MS-G]
Length=224

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 33/51 (65%), Gaps = 1/51 (2%)
 Frame = +2

Query  425  ITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRL  577
            ITVGR     D++I  P  S  HAR   TE+   V DLDSTNGTF++++RL
Sbjct  28   ITVGR-DRSNDIIIDHPLASRRHARFEQTEEGFFVRDLDSTNGTFLNQERL  77



>ref|WP_022118583.1| putative uncharacterized protein [Firmicutes bacterium CAG:56]
 emb|CDA63209.1| putative uncharacterized protein [Firmicutes bacterium CAG:56]
Length=161

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 41/76 (54%), Gaps = 1/76 (1%)
 Frame = +2

Query  431  VGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPG  610
            +G+   +AD+ I    +S  HA++   E+   + DLDSTNGT+I+ KRL          G
Sbjct  87   IGKGGRQADVCIDRDVISRVHAKILRREEEYFLMDLDSTNGTYINGKRLGGDGMEKLQQG  146

Query  611  TRITFGDTHLAIFRVS  658
             RI+F D    IF++ 
Sbjct  147  DRISFADLEY-IFQLQ  161



>ref|XP_002503779.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65037.1| predicted protein [Micromonas sp. RCC299]
Length=689

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 57/114 (50%), Gaps = 10/114 (9%)
 Frame = +2

Query  341  LEPVGDGDTKHIGYPTAMPGAFEISS--------GAITVGRVSEKADMVIPVPTVSGAHA  496
            L P GDG   H+   T +PG+   +          ++ VGR  + AD+ + + TVS  HA
Sbjct  59   LVPCGDGTKDHLPKGTRVPGSLAKTQIRLPSRAGNSVVVGR-EKPADVSLGIGTVSAQHA  117

Query  497  RLRHTEDCLV-VTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRV  655
            +    ED  V VTD+ S+NGT +D + +  G       G  +T GD HLA + V
Sbjct  118  KFEAGEDGEVYVTDMGSSNGTDVDGRPVPRGQMFKLSVGDIVTLGDPHLARYEV  171



>ref|WP_038040214.1| signal peptide protein [Thermomicrobiales bacterium KI4]
Length=258

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 67/150 (45%), Gaps = 11/150 (7%)
 Frame = +2

Query  212  VNFLGYNCLPR-NLQCTAKHLSSLGAIHASEGQITSTAVSIKWLLEPVGDGDTKH---IG  379
            V  +G + +PR N+Q  A          A E +   T V     LE  G+   K    IG
Sbjct  102  VRIVGDSNIPRRNIQVEASIAQLPDYDPAVEAEWQQTQVFRA--LEETGNVPPKFLRIIG  159

Query  380  YPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTF  559
             P      F I     T+GR  +  D+++ VP VS  HARL + +D   + DL+STNGT 
Sbjct  160  GPLPE-QTFLIRQKVTTIGRAPDN-DVILEVPEVSRHHARLEYHQDHYEIVDLNSTNGTM  217

Query  560  IDEKRLRPGVAAAALPGTRITFGDTHLAIF  649
            ++    RP   +    G R+T G   L I 
Sbjct  218  VNG---RPVTRSPITDGDRLTLGTVSLQIL  244



>ref|WP_022211499.1| fHA domain-containing protein [Clostridium sp. CAG:265]
 emb|CDB74206.1| fHA domain-containing protein [Clostridium sp. CAG:265]
Length=150

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 61/120 (51%), Gaps = 11/120 (9%)
 Frame = +2

Query  302  GQITSTAVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTV  481
            G+  S   + K+ +E V  G ++ +       G+  +    +T+GR  E   +V+  P  
Sbjct  38   GKKKSNPAARKYAVEVVNPGASEDLE-----EGSVILVRTELTIGR-REDNLIVLSEPFA  91

Query  482  SGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSK  661
            SG HA+L    + L + DL+STNG +++E+R++  V   A  G  I  G    AIF+V K
Sbjct  92   SGYHAKLYVKNNNLYIQDLNSTNGVYVNEERIKDKVKLTA--GDEIKIGS---AIFKVLK  146



>ref|WP_031158523.1| signal peptide protein [Streptosporangium roseum]
Length=181

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 47/88 (53%), Gaps = 8/88 (9%)
 Frame = +2

Query  389  AMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDE  568
            A+PG    S     VGR S   D+V+   TVS  HA LR  EDC +V DL S NGT +++
Sbjct  96   ALPGD---SRTRYVVGRGS-ACDLVLADLTVSRVHAELRRDEDCWIVVDLGSLNGTRLND  151

Query  569  KRLRPGVAAAAL-PGTRITFGDTHLAIF  649
             RL   V  A + PG  ++FGD    + 
Sbjct  152  WRL---VGPAKVRPGDVLSFGDCMFLVI  176



>ref|WP_016310066.1| hypothetical protein [Enterorhabdus caecimuris]
 gb|EOS50253.1| hypothetical protein C811_01878 [Enterorhabdus caecimuris B7]
Length=285

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 48/81 (59%), Gaps = 5/81 (6%)
 Frame = +2

Query  401  AFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTED-CLVVTDLDSTNGTFIDEKRL  577
            AF +   A T+GR S K D+VIP   VS  HA +R  E    ++TDL STNGTF++ +++
Sbjct  204  AFTLPGDAETIGRES-KNDIVIPDINVSRVHAEIRQDESGAWILTDLGSTNGTFVNGRQI  262

Query  578  RPGVAAAALPGTRITFGDTHL  640
            +   +AA     RI  G T+L
Sbjct  263  K---SAALSDADRIIVGTTNL  280



>ref|WP_022864685.1| signal peptide protein [Varibaculum cambriense]
Length=231

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 45/79 (57%), Gaps = 4/79 (5%)
 Frame = +2

Query  431  VGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALPG  610
            +GR SE AD+V+  P VS  H  LR T   ++ TDL STNG++++  R+    AA  L G
Sbjct  157  IGRGSE-ADIVVHDPGVSRRHLELRITPQGVIATDLGSTNGSYVEGHRIS---AATLLDG  212

Query  611  TRITFGDTHLAIFRVSKLE  667
              +T G THL  +  S  E
Sbjct  213  NELTIGRTHLLFWTSSADE  231



>ref|WP_022806647.1| MULTISPECIES: hypothetical protein [unclassified Calescamantes]
Length=281

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 44/73 (60%), Gaps = 5/73 (7%)
 Frame = +2

Query  431  VGRVSEKADMVIPVPTVSGAHARLRHTED-CLVVTDLDSTNGTFIDEKRLRPGVAAAALP  607
            +GR +E  DMVIP  ++S  HA +   E+  L + DL+STNGTF++ K++   V A  LP
Sbjct  50   IGRSNE-VDMVIPEKSISRKHAFIEVKEEGTLTIKDLNSTNGTFVNGKKI---VLAKILP  105

Query  608  GTRITFGDTHLAI  646
            G  IT G   + +
Sbjct  106  GDLITLGRVEMRL  118



>ref|WP_029665269.1| hypothetical protein [Candidatus Calescibacterium nevadense]
Length=281

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 44/73 (60%), Gaps = 5/73 (7%)
 Frame = +2

Query  431  VGRVSEKADMVIPVPTVSGAHARLRHTED-CLVVTDLDSTNGTFIDEKRLRPGVAAAALP  607
            +GR +E  DMVIP  ++S  HA +   E+  L + DL+STNGTF++ K++   V A  LP
Sbjct  50   IGRSNE-VDMVIPEKSISRKHAFIEVKEEGTLTIKDLNSTNGTFVNGKKI---VLAKILP  105

Query  608  GTRITFGDTHLAI  646
            G  IT G   + +
Sbjct  106  GDLITLGRVEMRL  118



>ref|WP_004623272.1| FHA domain-containing protein [[Clostridium] termitidis]
 gb|EMS73942.1| FHA domain-containing protein [ [[Clostridium] termitidis CT1112]
Length=513

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 66/169 (39%), Gaps = 28/169 (17%)
 Frame = +2

Query  188  ATVFAQNSVNFLGYNCLPR-NLQCTAKHLSSLGAIHASEGQITSTAVSIKWLLEPVGDGD  364
            A VF++    +LG   +PR  +   +K  SS   I   +G               V  G+
Sbjct  356  AGVFSEKE--YLGKESIPRAEMDTVSKQESSKDKIPEPQG---------------VYSGE  398

Query  365  TKHIGYPTAMPGAF----------EISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTE  514
            T+ I  P    GA+          E    +I VGR+    D V+    V   HA +   E
Sbjct  399  TEIIRKPGINAGAYLKETQGEAVIEFDKSSILVGRMEGLVDAVVNSSAVGKIHAEILSEE  458

Query  515  DCLVVTDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSK  661
                + D +S NGTF+++KRL P      L    + F +     F  +K
Sbjct  459  GIYYLVDCNSRNGTFVNDKRLVPNTRNKVLNNDLVRFANKEYQFFASAK  507



>ref|WP_022804813.1| hypothetical protein [Calescamantes bacterium JGI 0000106-G12]
Length=281

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 44/73 (60%), Gaps = 5/73 (7%)
 Frame = +2

Query  431  VGRVSEKADMVIPVPTVSGAHARLRHTED-CLVVTDLDSTNGTFIDEKRLRPGVAAAALP  607
            +GR +E  DMVIP  ++S  HA +   E+  L + DL+STNGTF++ K++   V A  LP
Sbjct  50   IGRSNE-VDMVIPEKSISRKHAFIEVKEEGTLTIKDLNSTNGTFVNGKKI---VLAKILP  105

Query  608  GTRITFGDTHLAI  646
            G  IT G   + +
Sbjct  106  GDLITLGRVEMRL  118



>ref|WP_011186044.1| hypothetical protein [Leifsonia xyli]
 ref|YP_062153.1| hypothetical protein Lxx12015 [Leifsonia xyli subsp. xyli str. 
CTCB07]
 gb|AAT89048.1| conserved hypothetical protein [Leifsonia xyli subsp. xyli str. 
CTCB07]
Length=130

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 41/72 (57%), Gaps = 9/72 (13%)
 Frame = +2

Query  452  ADMVIPVPT----VSGAHARLRHTEDCLVVTDLDSTNGTFI-----DEKRLRPGVAAAAL  604
            A  ++PVP+    VSG H R+  + D  VVTDL STNGT +        +LRPG +A  L
Sbjct  42   APRLLPVPSPTQEVSGTHLRIEQSGDAAVVTDLRSTNGTVVLRPGAQAVQLRPGESAVVL  101

Query  605  PGTRITFGDTHL  640
             GT +  GD ++
Sbjct  102  AGTVVEIGDGNI  113



>ref|WP_026524471.1| hypothetical protein [Butyrivibrio sp. MB2005]
Length=442

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = +2

Query  410  ISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGV  589
            +SS  I +G++S  AD VI  PTVS  HA++    D +++ DL+S NGTFI+  +L P  
Sbjct  363  LSSLPIVIGKLSSCADAVIKDPTVSRIHAKIFSFGDEIMIQDLNSKNGTFINGTQLLPNE  422

Query  590  AAAALPGTRITFG  628
                     I FG
Sbjct  423  KRTIEVDDEIVFG  435



>ref|WP_011026104.1| signal peptide protein [Caldanaerobacter subterraneus]
 ref|NP_623544.1| FHA-domain-containing protein [Caldanaerobacter subterraneus 
subsp. tengcongensis MB4]
 gb|AAM25148.1| FHA-domain-containing proteins [Caldanaerobacter subterraneus 
subsp. tengcongensis MB4]
Length=132

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 45/79 (57%), Gaps = 8/79 (10%)
 Frame = +2

Query  404  FEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRP  583
            FE++S    +GR S++ D+VI  P VS  HA ++       + DL+STNGTF++ KR++ 
Sbjct  58   FEVTS----IGR-SDECDIVIESPYVSARHALIKKRGKRFYIEDLNSTNGTFVNGKRVK-  111

Query  584  GVAAAALPGTRITFGDTHL  640
               A    G  IT GD  L
Sbjct  112  --VARIKNGDIITLGDVDL  128



>ref|WP_014433629.1| hypothetical protein [Caldilinea aerophila]
 ref|YP_005442294.1| hypothetical protein CLDAP_23570 [Caldilinea aerophila DSM 14535 
= NBRC 104270]
 dbj|BAM00397.1| hypothetical protein CLDAP_23570 [Caldilinea aerophila DSM 14535 
= NBRC 104270]
Length=213

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 38/78 (49%), Gaps = 1/78 (1%)
 Frame = +2

Query  407  EISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPG  586
            E+S    TVGR +E A + +  P  S  HA +   E    V DL S NG FID KRL PG
Sbjct  20   ELSQEVTTVGRAAE-AGVRLEDPYASRRHAEILRLEQGYQVRDLHSKNGVFIDGKRLEPG  78

Query  587  VAAAALPGTRITFGDTHL  640
             +A    G  + F  T  
Sbjct  79   GSAWLTDGAEVQFASTRF  96



>ref|WP_011563025.1| FHA domain-containing protein [Rubrobacter xylanophilus]
 ref|YP_642819.1| FHA domain-containing protein [Rubrobacter xylanophilus DSM 9941]
 gb|ABG03007.1| FHA domain containing protein [Rubrobacter xylanophilus DSM 9941]
Length=280

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 50/90 (56%), Gaps = 6/90 (7%)
 Frame = +2

Query  419  GAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAA  598
            G  TVGR S++ D+V+P P VS  HAR+   E+  V+ DL STNGT +D     P     
Sbjct  189  GPWTVGR-SQENDIVLPDPNVSRRHARILRAENGFVIEDLGSTNGTLLDGA---PIDRER  244

Query  599  ALPGTRITFGDTHLAIFRVSKLEKVDDAPE  688
               G  +TFG T  A F V ++E  ++ P+
Sbjct  245  IESGDELTFGQT-TARF-VRRIEAPEETPQ  272



>ref|WP_026670308.1| hypothetical protein [Butyrivibrio sp. AE3006]
Length=442

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = +2

Query  410  ISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGV  589
            +SS  I +G++S  AD VI  PTVS  HA++    D +++ DL+S NGTFI+  +L P  
Sbjct  363  LSSLPIVIGKLSSCADAVIKDPTVSRIHAKIFSFGDEIMIKDLNSKNGTFINGTQLLPNE  422

Query  590  AAAALPGTRITFG  628
                     I FG
Sbjct  423  KRTIEVDDEIVFG  435



>ref|XP_003081796.1| unnamed protein product [Ostreococcus tauri]
Length=610

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 62/127 (49%), Gaps = 16/127 (13%)
 Frame = +2

Query  362  DTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARL----RHTEDCLVV  529
            +TK I  P   PG+  I      VGR +     ++PV TVSG HA L       E  + V
Sbjct  2    ETKVIRLPNE-PGSRMI------VGR-ARGTGFMLPVRTVSGKHAELSLGANEDEGRVFV  53

Query  530  TDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLEKVDDAPEEQEDDGA  709
             DL S  GT I+ + LR G      PG  +TFGD HLA +    + K+   P  ++DD +
Sbjct  54   KDLGSKFGTSINGRALRRGETYEIFPGDFVTFGDEHLARYEAVAVVKI--IP--RKDDNS  109

Query  710  KGGPSSS  730
            K  P+ S
Sbjct  110  KPKPNDS  116



>gb|ETW93183.1| hypothetical protein ETSY1_40330 [Candidatus Entotheonella sp. 
TSY1]
Length=97

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 43/80 (54%), Gaps = 2/80 (3%)
 Frame = +2

Query  425  ITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAAL  604
            +++GR S+  D++I     S  HAR+    D   + DL S+NGTF+ +K+L P +     
Sbjct  1    MSIGRNSDN-DIIISDSRASRYHARVTRRGDAFFLEDLSSSNGTFVGDKQLSPDIRCELT  59

Query  605  PGTRITFGDTHLAIFRVSKL  664
             G  I  G T L IFR+ + 
Sbjct  60   DGDEIRIGSTRL-IFRLYRF  78



>ref|WP_026910202.1| signal peptide protein [Patulibacter minatonensis]
Length=161

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 46/80 (58%), Gaps = 6/80 (8%)
 Frame = +2

Query  404  FEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRP  583
            +++  GA+ +GR   + ++ I  P  SG HARL      ++V DL+STNGTF++E+   P
Sbjct  82   YDVGPGAV-IGR-GAQVEIQIEDPYASGKHARLVRQAGVVIVEDLNSTNGTFLNEE---P  136

Query  584  GVAAAALP-GTRITFGDTHL  640
             V A  L  G RI  GDT  
Sbjct  137  LVGAQPLQLGDRIRIGDTEF  156



>ref|WP_034464183.1| hypothetical protein, partial [Butyrivibrio fibrisolvens]
Length=78

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 37/69 (54%), Gaps = 0/69 (0%)
 Frame = +2

Query  425  ITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAAL  604
            +T+G++    D VIP  T+S  HARL      + + DL STNGT+ +  RL+       +
Sbjct  4    LTIGKMEGCVDFVIPHKTISRIHARLFRENGNMFLIDLGSTNGTYHNGCRLQAQKPVRIV  63

Query  605  PGTRITFGD  631
            PG  + F D
Sbjct  64   PGDEVRFSD  72



>emb|CEF99501.1| Plastid lipid-associated protein/fibrillin conserved domain [Ostreococcus 
tauri]
Length=678

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 62/127 (49%), Gaps = 16/127 (13%)
 Frame = +2

Query  362  DTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARL----RHTEDCLVV  529
            +TK I  P   PG+  I      VGR +     ++PV TVSG HA L       E  + V
Sbjct  70   ETKVIRLPNE-PGSRMI------VGR-ARGTGFMLPVRTVSGKHAELSLGANEDEGRVFV  121

Query  530  TDLDSTNGTFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLEKVDDAPEEQEDDGA  709
             DL S  GT I+ + LR G      PG  +TFGD HLA +    + K+   P  ++DD +
Sbjct  122  KDLGSKFGTSINGRALRRGETYEIFPGDFVTFGDEHLARYEAVAVVKI--IP--RKDDNS  177

Query  710  KGGPSSS  730
            K  P+ S
Sbjct  178  KPKPNDS  184



>ref|WP_006722190.1| hypothetical protein [Collinsella stercoris]
 gb|EEA89268.1| FHA domain protein [Collinsella stercoris DSM 13279]
Length=104

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  404  FEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRL  577
            +E++S   TVGR    AD+V+  P VS  HA+L  T     + DL+STNGT ++ +R+
Sbjct  25   YELTSARATVGRERSMADVVLRDPNVSRRHAQLTFTGSDWSIEDLNSTNGTLVNNRRI  82



>ref|WP_016230504.1| hypothetical protein [Lachnospiraceae bacterium 10-1]
 gb|EOS72432.1| hypothetical protein C819_04296 [Lachnospiraceae bacterium 10-1]
Length=370

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 38/68 (56%), Gaps = 0/68 (0%)
 Frame = +2

Query  425  ITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAAL  604
            +TVG+++   DMVI   ++S  H +     + + +TDL+STNGTF +  RL P  +    
Sbjct  296  LTVGKLAGAVDMVINENSISRMHVKFSRNGNKIFITDLNSTNGTFRNGIRLSPNASEIIE  355

Query  605  PGTRITFG  628
            PG  I  G
Sbjct  356  PGDEIRLG  363



>ref|WP_010075084.1| signal peptide protein [Clostridium cellulovorans]
 ref|YP_003841913.1| FHA domain-containing protein [Clostridium cellulovorans 743B]
 gb|ADL50149.1| FHA domain containing protein [Clostridium cellulovorans 743B]
Length=149

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 47/84 (56%), Gaps = 3/84 (4%)
 Frame = +2

Query  398  GAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRL  577
            G+  + SG I +GR  +  D+++    VSG HAR+    D  ++ DL STNGTF++ +RL
Sbjct  68   GSVIMISGQIVIGR-KDNNDLILSSQYVSGTHARVFLQNDKYLIEDLQSTNGTFLNGERL  126

Query  578  RPGVAAAALPGTRITFGDTHLAIF  649
              G A  ++ G  ++ G+    + 
Sbjct  127  -EGKAQLSI-GDTVSIGEAEFKVI  148



>ref|WP_021937959.1| fOG: FHA domain [Coprococcus sp. CAG:782]
 emb|CCY54037.1| fOG: FHA domain [Coprococcus sp. CAG:782]
Length=515

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 37/72 (51%), Gaps = 0/72 (0%)
 Frame = +2

Query  425  ITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAAL  604
            ITVGR   K D VI    VS  HA L    D + V DL STNGT I+   L PG A    
Sbjct  440  ITVGRSVSKCDHVIHDDGVSRRHAELIWRGDWIEVIDLGSTNGTKINGNELTPGEAVCIK  499

Query  605  PGTRITFGDTHL  640
             G  ++FGDT  
Sbjct  500  VGDVVSFGDTRF  511



>ref|WP_037321164.1| phosphopeptide-binding protein [Amycolatopsis orientalis]
Length=812

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 57/116 (49%), Gaps = 7/116 (6%)
 Frame = +2

Query  374  IGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNG  553
            I  P   P   E+S G +T+GR S KA + +    VS  H  +R   D   +TDLDS NG
Sbjct  486  IDVPGQPPVKHELSYGLVTLGR-SRKAALRLTDSRVSRLHCEIRWDGDTAWLTDLDSANG  544

Query  554  TFIDEKRLRPGVAAAALPGTRITFGDTHLAIFRVSKLEKVDDAPEEQEDDGAKGGP  721
            TF++ +R+   + A       +  GD+ + +  V++ E+    PE  E  GA   P
Sbjct  545  TFLNGRRV---LNAVLTHRDVVRLGDSTVTLISVTQEERW---PEADESTGAAASP  594



>ref|WP_028460015.1| transcriptional regulator [Chloroflexus sp. Y-396-1]
Length=221

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 33/51 (65%), Gaps = 1/51 (2%)
 Frame = +2

Query  425  ITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRL  577
            ITVGR     D++I  P  S  HAR   TE+   V DLDSTNGTF++++RL
Sbjct  28   ITVGRDGSN-DIIIDHPLASRRHARFEQTEEGFFVRDLDSTNGTFLNQERL  77



>ref|WP_012615434.1| transcriptional regulator [Chloroflexus aggregans]
 ref|YP_002461504.1| putative winged helix family two component transcriptional regulator 
[Chloroflexus aggregans DSM 9485]
 gb|ACL23068.1| putative two component transcriptional regulator, winged helix 
family [Chloroflexus aggregans DSM 9485]
Length=219

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 42/75 (56%), Gaps = 11/75 (15%)
 Frame = +2

Query  353  GDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVT  532
            G+GD + I +   +          ITVGR +   D++I  P  S  HAR   TE+   V 
Sbjct  15   GNGDYREIVWDRPI----------ITVGRDAAN-DIIIDHPLASRRHARFEQTEEGFFVR  63

Query  533  DLDSTNGTFIDEKRL  577
            DLDSTNGTF++++R+
Sbjct  64   DLDSTNGTFLNQERV  78



>ref|WP_034926892.1| hypothetical protein, partial [Erysipelotrichaceae bacterium 
NK3D112]
Length=78

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 27/76 (36%), Positives = 42/76 (55%), Gaps = 2/76 (3%)
 Frame = +2

Query  431  VGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAALP-  607
            +GR     ++VI  P VS  HAR+   ED L + D+   NGT+++  +L P + +A L  
Sbjct  2    IGREQTSCNLVISEPAVSRRHARIYVNEDGLFIEDVSEHNGTYLNGTKL-PSLGSAPLKE  60

Query  608  GTRITFGDTHLAIFRV  655
            G RI+ G   + + RV
Sbjct  61   GDRISLGRAEIVVNRV  76



>ref|WP_034427613.1| hypothetical protein, partial [Candidatus Entotheonella sp. TSY1]
Length=80

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 42/77 (55%), Gaps = 2/77 (3%)
 Frame = +2

Query  425  ITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAAL  604
            +++GR S+  D++I     S  HAR+    D   + DL S+NGTF+ +K+L P +     
Sbjct  6    MSIGRNSDN-DIIISDSRASRYHARVTRRGDAFFLEDLSSSNGTFVGDKQLSPDIRCELT  64

Query  605  PGTRITFGDTHLAIFRV  655
             G  I  G T L IFR+
Sbjct  65   DGDEIRIGSTRL-IFRL  80



>ref|WP_022067065.1| fOG: FHA domain [Blautia sp. CAG:257]
 emb|CDA06440.1| fOG: FHA domain [Blautia sp. CAG:257]
Length=466

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  431  VGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLR  580
            VG+++  +D VIP+PTVS  HAR+R  ED   + DL+S NGT ++ + L+
Sbjct  393  VGKLANASDAVIPMPTVSRMHARIRKREDEYYLADLNSRNGTAVNGRMLK  442



>gb|ABA95711.2| FHA domain containing protein, expressed [Oryza sativa Japonica 
Group]
Length=120

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  332  KWLLEPVGDGDTKHIGYPTAMPGAFEISS  418
            +W+LEP GDGD +HIGY  A PG F+I+S
Sbjct  88   RWVLEPAGDGDWRHIGYRVARPGGFQIAS  116



>ref|XP_009610655.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Nicotiana tomentosiformis]
Length=664

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 64/138 (46%), Gaps = 9/138 (7%)
 Frame = +2

Query  320  AVSIKWLLEPVGDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHAR  499
            A   +WLL P G+G+        +       + G+++   +  K+ +VIP+P VS  HAR
Sbjct  527  ATDAEWLLLPAGNGNAAVEALVLSRDEDMPCTIGSVSHTNIPGKS-LVIPLPQVSEMHAR  585

Query  500  LRHTEDCLVVTDLDSTNGTFIDE---KRLR--PGVAAAALPGTRITFGDTHLAIFRVSKL  664
            + +      VTDL S +GT+I +   +R R  P       P   I FG    A FRV  +
Sbjct  586  ISYKGGAFFVTDLRSEHGTWITDNEGRRYRASPNFPTRFHPSDIIEFGSDKKAAFRVKVM  645

Query  665  E---KVDDAPEEQEDDGA  709
            +   K     EE++  GA
Sbjct  646  KFPPKTAAKKEERQAVGA  663



>ref|WP_021844532.1| putative uncharacterized protein [Blautia hydrogenotrophica CAG:147]
 emb|CCX60127.1| putative uncharacterized protein [Blautia hydrogenotrophica CAG:147]
Length=129

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 42/78 (54%), Gaps = 5/78 (6%)
 Frame = +2

Query  431  VGRVSEKADMVIPVPTVSGAHARLRHTEDCL-VVTDLDSTNGTFIDEKRLRPGVAAAALP  607
            +GR S   D VIP   VS  H  L    D L ++ DL STNGTFI+  RL+        P
Sbjct  50   IGR-SRTCDFVIPAIRVSRQHCLLTRMPDGLFIIEDLSSTNGTFINGIRLK--EPTPLYP  106

Query  608  GTRITFGDTHLAIFRVSK  661
            G +I+  DTHL  F+V +
Sbjct  107  GDQISLADTHLT-FQVDQ  123



>ref|WP_005945281.1| hypothetical protein [Blautia hydrogenotrophica]
 gb|EEG50785.1| FHA domain protein [Blautia hydrogenotrophica DSM 10507]
Length=121

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 42/78 (54%), Gaps = 5/78 (6%)
 Frame = +2

Query  431  VGRVSEKADMVIPVPTVSGAHARLRHTEDCL-VVTDLDSTNGTFIDEKRLRPGVAAAALP  607
            +GR S   D VIP   VS  H  L    D L ++ DL STNGTFI+  RL+        P
Sbjct  42   IGR-SRTCDFVIPAIRVSRQHCLLTRMPDGLFIIEDLSSTNGTFINGIRLK--EPTPLYP  98

Query  608  GTRITFGDTHLAIFRVSK  661
            G +I+  DTHL  F+V +
Sbjct  99   GDQISLADTHLT-FQVDQ  115



>ref|WP_020074870.1| hypothetical protein [Cryocola sp. 340MFSha3.1]
Length=402

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 51/103 (50%), Gaps = 16/103 (16%)
 Frame = +2

Query  359  GDTKHIGYPTAM---PGAFEISSGAITVGRVSEKADMVIPVPT--VSGAHARLRHTEDCL  523
            GDT  +  P  +   P    + SG        E   + +P P+  VS  H R+  + D +
Sbjct  295  GDTIALDVPVLIGRRPAPQRVDSGV-------EPRLITVPSPSQEVSSTHVRIEQSGDAV  347

Query  524  VVTDLDSTNGTFID----EKRLRPGVAAAALPGTRITFGDTHL  640
            VVTDL STNGT +      +RLRPG ++  L G R+  GD ++
Sbjct  348  VVTDLRSTNGTVVTGPTGARRLRPGESSVVLAGARVEIGDGNI  390



>ref|WP_028027626.1| hypothetical protein [Enterorhabdus mucosicola]
Length=288

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 47/81 (58%), Gaps = 5/81 (6%)
 Frame = +2

Query  401  AFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTED-CLVVTDLDSTNGTFIDEKRL  577
            AF +   A T+GR S K D+VIP   VS  HA +R  E    ++TDL STNGTF++ +++
Sbjct  207  AFTLPGDAETIGRES-KNDIVIPDINVSRVHAEIRQDESGAWILTDLGSTNGTFVNGRQI  265

Query  578  RPGVAAAALPGTRITFGDTHL  640
            +   + A     RI  G T+L
Sbjct  266  K---STALQDADRIIVGTTNL  283



>gb|KFE61034.1| sigma-54 dependent transcriptional regulator, Fis family protein 
[Hyalangium minutum]
Length=454

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 43/79 (54%), Gaps = 4/79 (5%)
 Frame = +2

Query  404  FEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRP  583
            + +S   + +G+  E  D+VI  PTVS  H  +R   D  +V DLDSTNGTF+D  ++R 
Sbjct  43   YPLSGEELRIGKAPEN-DIVIDHPTVSRNHLVVRRYGDRFLVQDLDSTNGTFLDGAQVR-  100

Query  584  GVAAAALPGTRITFGDTHL  640
               A   PG  +  GD  L
Sbjct  101  --EAYLRPGALLEVGDVRL  117



>ref|WP_012801540.1| FHA domain-containing protein [Kytococcus sedentarius]
 ref|YP_003147886.1| FHA domain-containing protein [Kytococcus sedentarius DSM 20547]
 gb|ACV05121.1| FHA domain-containing protein [Kytococcus sedentarius DSM 20547]
Length=163

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 48/84 (57%), Gaps = 3/84 (4%)
 Frame = +2

Query  401  AFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLR  580
            +  +++  + +GR  E A + +   ++SGAHAR+       V+ DL STNGT++D++RLR
Sbjct  83   SLSLTTSPVVIGRNPE-ASLSVDDDSMSGAHARVSPDAHGWVIEDLGSTNGTWVDDERLR  141

Query  581  PGVAAAALPGTRITFGDTHLAIFR  652
              V   A  GTRI  G T +   R
Sbjct  142  GVVPLVA--GTRIRVGQTLIEARR  163



>ref|WP_029947102.1| hypothetical protein, partial [Leifsonia aquatica]
Length=394

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 38/66 (58%), Gaps = 5/66 (8%)
 Frame = +2

Query  458  MVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEK-----RLRPGVAAAALPGTRIT  622
            ++ P   VSG H R+  + D +VVTDL STNGT +        RLRPG +  AL GT + 
Sbjct  324  VISPTQEVSGTHVRIEQSGDAVVVTDLRSTNGTRVVGADGTGFRLRPGASTVALAGTTVE  383

Query  623  FGDTHL  640
             GD ++
Sbjct  384  IGDGNI  389



>ref|WP_027892600.1| hypothetical protein [Meiothermus chliarophilus]
Length=299

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +2

Query  407  EISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPG  586
            ++++ ++T+GRV +   +V+P+P VS  HA LR T    V+ DL STNGT++   RL   
Sbjct  21   DLTADSLTIGRVPDNG-LVLPIPPVSRHHAELRLTAQGPVIIDLGSTNGTYVGGVRLVAH  79

Query  587  VAAAALPGTRITFG  628
                 +PG  +  G
Sbjct  80   QEFPLIPGIPVQIG  93



>gb|AHI05308.1| large Ala/Glu-rich protein [Bdellovibrio bacteriovorus W]
Length=793

 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 56/94 (60%), Gaps = 2/94 (2%)
 Frame = +2

Query  407  EISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPG  586
            E+++ + +VGR S   D+ +    +S  H  +    + L++ D +S+NGTF++++++ PG
Sbjct  19   EVTADSFSVGR-SVDCDISLSDNQISRVHLTVSCQGNELLIEDRNSSNGTFVNDEKITPG  77

Query  587  VAAAALPGTRITFGDTHLAIFRVSKLEKV-DDAP  685
            VA    P  RI  G++  ++F   K+E V ++AP
Sbjct  78   VAIVVSPADRIQLGNSEYSLFIELKIEPVIEEAP  111



>ref|WP_031077583.1| peptide-binding protein [Streptomyces sp. NRRL WC-3742]
Length=181

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 7/82 (9%)
 Frame = +2

Query  407  EISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPG  586
            +  +G +T+GR+   A + +  P+VS  HA LRH     V+ DL STNGT+++ +R    
Sbjct  102  QAGAGQLTIGRIPGSA-LRLHHPSVSRHHAELRHESVGWVLYDLGSTNGTYVNGRR----  156

Query  587  VAAAAL--PGTRITFGDTHLAI  646
            +A A L  PG ++ FG+    +
Sbjct  157  IAGAVLVRPGDQVRFGNLEFRL  178



>gb|AEV81059.2| Oxoglutarate dehydrogenase inhibitor [Actinoplanes sp. SE50/110]
Length=256

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 56/103 (54%), Gaps = 19/103 (18%)
 Frame = +2

Query  353  GDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVT  532
            GDG T    YP  M        G+  +GR  ++A++ +P   +S  HARL +  + +V+T
Sbjct  171  GDGRT----YPLQM--------GSTVIGR-GDQANLRLPDVGISRRHARLDYDGNQVVLT  217

Query  533  DLDSTNGTFIDEKRLRPGVAAAAL-PGTRITFGDTHLAIFRVS  658
            DL STNGT ++ +R    V+A AL PG  I  G T L  FRV 
Sbjct  218  DLGSTNGTMVNGQR----VSAVALNPGDMIQLGTTTLT-FRVD  255



>gb|KDP90614.1| hypothetical protein W824_14115 [Clavibacter cf. michiganensis 
LMG 26808]
Length=375

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 35/60 (58%), Gaps = 5/60 (8%)
 Frame = +2

Query  467  PVPTVSGAHARLRHTEDCLVVTDLDSTNGTFI-----DEKRLRPGVAAAALPGTRITFGD  631
            P+  +SG H  LR     +VVTDLDSTNGT +     +   LRPG +   +PGTRI  GD
Sbjct  306  PLGEISGTHLGLRQDAGVIVVTDLDSTNGTVVLAPGAEHLALRPGESLVVVPGTRIDIGD  365



>ref|WP_030440921.1| signal peptide protein [Actinoplanes subtropicus]
Length=262

 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 56/103 (54%), Gaps = 19/103 (18%)
 Frame = +2

Query  353  GDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVT  532
            GDG T    YP  M        G+  +GR  ++A++ +P   +S  HARL +  + +V+T
Sbjct  177  GDGRT----YPLQM--------GSTVIGR-GDQANLRLPDVGISRRHARLDYDGNQVVLT  223

Query  533  DLDSTNGTFIDEKRLRPGVAAAAL-PGTRITFGDTHLAIFRVS  658
            DL STNGT ++ +R    V+A AL PG  I  G T L  FRV 
Sbjct  224  DLGSTNGTMVNGQR----VSAVALNPGDMIQLGTTTLT-FRVD  261



>ref|WP_022213982.1| fOG: FHA domain [Blautia sp. CAG:237]
 emb|CDB78553.1| fOG: FHA domain [Blautia sp. CAG:237]
Length=454

 Score = 50.8 bits (120),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  431  VGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLR  580
            +G++   AD VIP PTVS  HAR+R  E+   + DL+S NGT ++ + LR
Sbjct  381  IGKMENAADAVIPRPTVSRVHARIRKDEEEYFLADLNSRNGTSVNGRMLR  430



>ref|WP_019464818.1| hypothetical protein [Dyella japonica]
 gb|AIF48790.1| forkhead-associated protein [Dyella japonica A8]
Length=165

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 49/92 (53%), Gaps = 5/92 (5%)
 Frame = +2

Query  377  GYPTAMPG-AFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNG  553
            G  T + G  F + +G  T+GR  +  D+V+  P+VS AHA + + +   VV +  STNG
Sbjct  45   GMSTGLEGHRFSLRAGRQTIGRRDDN-DIVVNEPSVSSAHAWIINQQGHYVVMNTLSTNG  103

Query  554  TFIDEKRLRPGVAAAALPGTRITFGDTHLAIF  649
            TF++++R+     A+   G R+ FG       
Sbjct  104  TFVNDQRVHE---ASIKHGDRVRFGQVEFVFL  132



>ref|WP_034454388.1| hypothetical protein, partial [Butyrivibrio fibrisolvens]
Length=78

 Score = 47.4 bits (111),  Expect = 0.001, Method: Composition-based stats.
 Identities = 24/69 (35%), Positives = 37/69 (54%), Gaps = 0/69 (0%)
 Frame = +2

Query  425  ITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAAL  604
            +T+G++    D +IP  T+S  HARL      + + DL STNGT+ +  RL+       +
Sbjct  4    LTIGKMEGCVDFMIPHKTISRIHARLFRENGNMFLIDLGSTNGTYHNGCRLQAQKPVRIV  63

Query  605  PGTRITFGD  631
            PG  + F D
Sbjct  64   PGDEVRFSD  72



>emb|CBJ48848.1| Chain A, Crystal Structure Of The Brct Repeat Region From The 
Mediator Of Dna Damage Checkpoint Protein 1, Mdc1 pdb|2ADO|B 
Chain B, Crystal Structure Of The Brct Repeat Region From 
The Mediator Of Dna [Ectocarpus siliculosus]
Length=1629

 Score = 51.2 bits (121),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 47/88 (53%), Gaps = 16/88 (18%)
 Frame = +2

Query  407  EISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTE------DCLVVTDLDSTNGTFI--  562
            EI  G  TVGR +E  D+ +  P+VSGAHA +   E        L V DL STNGT+I  
Sbjct  39   EIKDGETTVGR-NEDQDITVADPSVSGAHAVIEVLEVPGGGGKRLTVKDLRSTNGTYIID  97

Query  563  ----DEKRLRPGVAAAALP--GTRITFG  628
                D+KRL P   A  LP  G RI FG
Sbjct  98   TETGDKKRLAP-KKATMLPEEGCRIQFG  124



>gb|KFE70542.1| serine/threonine protein kinase [Hyalangium minutum]
Length=542

 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 46/89 (52%), Gaps = 1/89 (1%)
 Frame = +2

Query  404  FEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRP  583
            +  +S  + +GR ++  D+ IP P VS  HA +R  +  + V DL STNG  +  KR+  
Sbjct  21   YVFTSSPVRIGR-NQLNDIPIPRPFVSLFHALVRFDKGSISVVDLGSTNGVVVAGKRIEK  79

Query  584  GVAAAALPGTRITFGDTHLAIFRVSKLEK  670
             V A   PG ++T G       R +K +K
Sbjct  80   NVPAQIKPGMQVTIGSVAFEFSRDAKAQK  108



>ref|WP_015489875.1| hypothetical protein containing putative FHA domain [Clavibacter 
michiganensis]
 ref|YP_007685437.1| hypothetical protein containing putative FHA domain [Clavibacter 
michiganensis subsp. nebraskensis NCPPB 2581]
 emb|CCE75097.1| hypothetical protein containing putative FHA domain [Clavibacter 
michiganensis subsp. nebraskensis NCPPB 2581]
Length=375

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 35/60 (58%), Gaps = 5/60 (8%)
 Frame = +2

Query  467  PVPTVSGAHARLRHTEDCLVVTDLDSTNGTFI-----DEKRLRPGVAAAALPGTRITFGD  631
            P+  +SG H  LR     +VVTDLDSTNGT +     +   LRPG +   +PGTRI  GD
Sbjct  306  PLGEISGTHLGLRQDSGVVVVTDLDSTNGTVVLVPGAERLALRPGESLVVVPGTRIDIGD  365



>ref|WP_012037861.1| hypothetical protein [Clavibacter michiganensis]
 ref|YP_001221916.1| hypothetical protein CMM_1175 [Clavibacter michiganensis subsp. 
michiganensis NCPPB 382]
 emb|CAN01219.1| hypothetical protein containing putative FHA domain [Clavibacter 
michiganensis subsp. michiganensis NCPPB 382]
Length=396

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 35/60 (58%), Gaps = 5/60 (8%)
 Frame = +2

Query  467  PVPTVSGAHARLRHTEDCLVVTDLDSTNGTFI-----DEKRLRPGVAAAALPGTRITFGD  631
            P+  +SG H  LR     +VVTDLDSTNGT +     +   LRPG +   +PGTRI  GD
Sbjct  327  PLGEISGTHLGLRQDAGVIVVTDLDSTNGTVVLAPGAEHLALRPGESLVVVPGTRIDIGD  386



>ref|WP_014440161.1| signal peptide protein [Actinoplanes missouriensis]
 ref|YP_005459777.1| hypothetical protein AMIS_410 [Actinoplanes missouriensis 431]
 dbj|BAL85261.1| hypothetical protein AMIS_410 [Actinoplanes missouriensis 431]
Length=261

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 56/103 (54%), Gaps = 19/103 (18%)
 Frame = +2

Query  353  GDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVT  532
            GDG T    YP  M        G+  +GR  ++A++ +P   +S  HARL +  + +V+T
Sbjct  176  GDGRT----YPLQM--------GSTVIGR-GDQANLRLPDVGISRRHARLDYDGNQVVLT  222

Query  533  DLDSTNGTFIDEKRLRPGVAAAAL-PGTRITFGDTHLAIFRVS  658
            DL STNGT ++ +R    V+A AL PG  I  G T L  FRV 
Sbjct  223  DLGSTNGTMVNGQR----VSAVALNPGDMIQLGTTTLT-FRVD  260



>ref|WP_018190852.1| hypothetical protein [Leifsonia sp. 109]
Length=422

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 51/103 (50%), Gaps = 16/103 (16%)
 Frame = +2

Query  359  GDTKHIGYPTAM---PGAFEISSGAITVGRVSEKADMVIPVPT--VSGAHARLRHTEDCL  523
            GDT  +  P  +   P    + SG        E   + +P P+  VS  H R+  + D +
Sbjct  315  GDTIALDVPVLIGRRPAPQRVDSGV-------EPRLVTVPSPSQEVSSTHVRIEQSGDAV  367

Query  524  VVTDLDSTNGTFID----EKRLRPGVAAAALPGTRITFGDTHL  640
            VVTDL STNGT +      +RLRPG ++  L G R+  GD ++
Sbjct  368  VVTDLRSTNGTVVTGPTGAQRLRPGESSVVLAGARVEIGDGNI  410



>gb|KHD76364.1| signal peptide protein [Actinoplanes utahensis]
Length=260

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 56/103 (54%), Gaps = 19/103 (18%)
 Frame = +2

Query  353  GDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVT  532
            GDG T    YP  M        G+  +GR  ++A++ +P   +S  HARL +  + +V+T
Sbjct  175  GDGRT----YPLQM--------GSTVIGR-GDQANLRLPDVGISRRHARLDYDGNQVVLT  221

Query  533  DLDSTNGTFIDEKRLRPGVAAAAL-PGTRITFGDTHLAIFRVS  658
            DL STNGT ++ +R    V+A AL PG  I  G T L  FRV 
Sbjct  222  DLGSTNGTMVNGQR----VSAVALNPGDMIQLGTTTLT-FRVD  259



>ref|WP_014687139.1| signal peptide protein [Actinoplanes sp. SE50/110]
 ref|YP_006263127.1| Oxoglutarate dehydrogenase inhibitor [Actinoplanes sp. SE50/110]
Length=265

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 56/103 (54%), Gaps = 19/103 (18%)
 Frame = +2

Query  353  GDGDTKHIGYPTAMPGAFEISSGAITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVT  532
            GDG T    YP  M        G+  +GR  ++A++ +P   +S  HARL +  + +V+T
Sbjct  180  GDGRT----YPLQM--------GSTVIGR-GDQANLRLPDVGISRRHARLDYDGNQVVLT  226

Query  533  DLDSTNGTFIDEKRLRPGVAAAAL-PGTRITFGDTHLAIFRVS  658
            DL STNGT ++ +R    V+A AL PG  I  G T L  FRV 
Sbjct  227  DLGSTNGTMVNGQR----VSAVALNPGDMIQLGTTTLT-FRVD  264



>ref|WP_038288502.1| signal peptide protein [[Clostridium] straminisolvens]
 dbj|GAE88445.1| FHA domain protein [ [[Clostridium] straminisolvens JCM 21531]
Length=149

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 43/79 (54%), Gaps = 3/79 (4%)
 Frame = +2

Query  422  AITVGRVSEKADMVIPVPTVSGAHARLRHTEDCLVVTDLDSTNGTFIDEKRLRPGVAAAA  601
            ++T+GR ++K D+VI  P +SG HA +   +  + + D+ S NGTF++  RL  G   + 
Sbjct  71   SVTIGR-NDKNDIVIKDPFISGIHAYIMVEDQSIRIKDMGSKNGTFVNGTRLNEGEIVSL  129

Query  602  LPGTRITFGDTHLAIFRVS  658
              G  I  G  H+    VS
Sbjct  130  KDGDNIKIG--HVKFLFVS  146



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1838885864684