BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79587_g1_i1 len=1105 path=[1:0-1104]

Length=1105
                                                                      Score     E

ref|XP_009773188.1|  PREDICTED: fasciclin-like arabinogalactan pr...    297   1e-95   
ref|XP_009588605.1|  PREDICTED: fasciclin-like arabinogalactan pr...    296   2e-95   
ref|XP_006348836.1|  PREDICTED: fasciclin-like arabinogalactan pr...    266   2e-83   
ref|XP_004243392.1|  PREDICTED: fasciclin-like arabinogalactan pr...    259   8e-81   
gb|EYU28950.1|  hypothetical protein MIMGU_mgv1a021394mg                250   3e-77   
gb|EYU28951.1|  hypothetical protein MIMGU_mgv1a012619mg                248   2e-76   
emb|CDP15882.1|  unnamed protein product                                234   6e-71   
ref|XP_011100234.1|  PREDICTED: fasciclin-like arabinogalactan pr...    230   1e-69   
gb|AAN60339.1|  unknown                                                 224   2e-67   Arabidopsis thaliana [mouse-ear cress]
gb|ABR68799.1|  fasciclin-like arabinogalactan protein 1                224   2e-67   Gossypium hirsutum [American cotton]
gb|ABV27475.1|  fasciclin-like arabinogalactan protein 4                222   2e-66   Gossypium hirsutum [American cotton]
ref|XP_006418194.1|  hypothetical protein EUTSA_v10008582mg             221   3e-66   
emb|CDX94756.1|  BnaC07g17650D                                          219   2e-65   
ref|XP_010522581.1|  PREDICTED: fasciclin-like arabinogalactan pr...    219   2e-65   
emb|CDY22308.1|  BnaA06g36300D                                          219   2e-65   
gb|KFK42730.1|  hypothetical protein AALP_AA1G032300                    219   2e-65   
ref|XP_009101735.1|  PREDICTED: fasciclin-like arabinogalactan pr...    218   4e-65   
ref|XP_010475017.1|  PREDICTED: fasciclin-like arabinogalactan pr...    218   5e-65   
ref|XP_010482678.1|  PREDICTED: fasciclin-like arabinogalactan pr...    218   7e-65   
ref|XP_010457404.1|  PREDICTED: fasciclin-like arabinogalactan pr...    217   1e-64   
ref|XP_002892185.1|  hypothetical protein ARALYDRAFT_470362             214   2e-63   
ref|XP_009119354.1|  PREDICTED: fasciclin-like arabinogalactan pr...    214   2e-63   
ref|XP_006304423.1|  hypothetical protein CARUB_v10011002mg             214   2e-63   
ref|XP_004287337.1|  PREDICTED: fasciclin-like arabinogalactan pr...    212   9e-63   
gb|KFK31663.1|  hypothetical protein AALP_AA6G142700                    212   1e-62   
ref|NP_563692.1|  fasciclin-like arabinogalactan protein 9              211   2e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006469071.1|  PREDICTED: fasciclin-like arabinogalactan pr...    211   2e-62   
ref|XP_009113940.1|  PREDICTED: fasciclin-like arabinogalactan pr...    211   3e-62   
gb|ABK78690.1|  unknown                                                 210   6e-62   Brassica rapa
emb|CDY18192.1|  BnaC05g02150D                                          210   8e-62   
ref|XP_002277788.1|  PREDICTED: fasciclin-like arabinogalactan pr...    210   1e-61   Vitis vinifera
emb|CAN83422.1|  hypothetical protein VITISV_000403                     209   2e-61   Vitis vinifera
gb|KDO49564.1|  hypothetical protein CISIN_1g025959mg                   207   6e-61   
ref|XP_010489025.1|  PREDICTED: fasciclin-like arabinogalactan pr...    207   6e-61   
ref|XP_008242761.1|  PREDICTED: fasciclin-like arabinogalactan pr...    207   7e-61   
ref|XP_006299820.1|  hypothetical protein CARUB_v10016021mg             207   7e-61   
ref|XP_010415601.1|  PREDICTED: fasciclin-like arabinogalactan pr...    207   1e-60   
emb|CDY13122.1|  BnaA09g16950D                                          206   2e-60   
ref|XP_006403136.1|  hypothetical protein EUTSA_v10003262mg             206   2e-60   
ref|XP_010467804.1|  PREDICTED: fasciclin-like arabinogalactan pr...    204   2e-59   
ref|XP_009368837.1|  PREDICTED: fasciclin-like arabinogalactan pr...    204   2e-59   
ref|XP_010093970.1|  hypothetical protein L484_010536                   203   3e-59   
ref|XP_006376379.1|  hypothetical protein POPTR_0013s12490g             202   6e-59   
ref|XP_002517840.1|  conserved hypothetical protein                     201   2e-58   Ricinus communis
gb|KDP24065.1|  hypothetical protein JCGZ_25722                         201   2e-58   
ref|XP_007203478.1|  hypothetical protein PRUPE_ppa022313mg             201   2e-58   
ref|XP_006281682.1|  hypothetical protein CARUB_v10027821mg             201   3e-58   
ref|XP_010245565.1|  PREDICTED: fasciclin-like arabinogalactan pr...    200   5e-58   
ref|NP_199226.1|  fasciclin-like arabinogalactan protein 13             199   9e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865383.1|  hypothetical protein ARALYDRAFT_494579             199   1e-57   
ref|NP_565475.1|  fasciclin-like arabinogalactan protein 6              199   1e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008367860.1|  PREDICTED: LOW QUALITY PROTEIN: fasciclin-li...    199   1e-57   
ref|XP_010494416.1|  PREDICTED: fasciclin-like arabinogalactan pr...    197   6e-57   
ref|XP_002884207.1|  hypothetical protein ARALYDRAFT_480881             197   1e-56   
gb|KHN36673.1|  Fasciclin-like arabinogalactan protein 6                195   3e-56   
ref|XP_006408977.1|  hypothetical protein EUTSA_v10002226mg             194   7e-56   
ref|XP_004487189.1|  PREDICTED: fasciclin-like arabinogalactan pr...    194   2e-55   
ref|XP_006446719.1|  hypothetical protein CICLE_v10016407mg             193   2e-55   
ref|NP_001238356.1|  uncharacterized protein LOC100527846 precursor     193   2e-55   
ref|XP_007043716.1|  Fasciclin-like arabinogalactan protein 9           192   2e-55   
ref|XP_007149797.1|  hypothetical protein PHAVU_005G099500g             193   2e-55   
ref|XP_010441925.1|  PREDICTED: fasciclin-like arabinogalactan pr...    193   2e-55   
gb|KEH39201.1|  fasciclin-like arabinogalactan protein                  193   2e-55   
gb|AFK41457.1|  unknown                                                 193   3e-55   
gb|AFK39439.1|  unknown                                                 191   1e-54   
ref|XP_003540384.1|  PREDICTED: uncharacterized LOC100500293            191   1e-54   
gb|AFK43105.1|  unknown                                                 191   2e-54   
gb|EPS63702.1|  hypothetical protein M569_11081                         184   1e-52   
ref|XP_011002659.1|  PREDICTED: fasciclin-like arabinogalactan pr...    185   3e-52   
ref|XP_002325592.1|  fasciclin-like arabinogalactan-protein 9           183   1e-51   Populus trichocarpa [western balsam poplar]
ref|XP_010424800.1|  PREDICTED: fasciclin-like arabinogalactan pr...    182   3e-51   
ref|XP_009402376.1|  PREDICTED: fasciclin-like arabinogalactan pr...    182   7e-51   
ref|XP_010540894.1|  PREDICTED: fasciclin-like arabinogalactan pr...    182   7e-51   
ref|XP_010490785.1|  PREDICTED: fasciclin-like arabinogalactan pr...    181   1e-50   
ref|XP_010452179.1|  PREDICTED: fasciclin-like arabinogalactan pr...    181   1e-50   
ref|XP_010689776.1|  PREDICTED: fasciclin-like arabinogalactan pr...    181   1e-50   
ref|XP_006398764.1|  hypothetical protein EUTSA_v10015384mg             181   1e-50   
ref|XP_006286413.1|  hypothetical protein CARUB_v10002835mg             181   1e-50   
ref|XP_009130731.1|  PREDICTED: fasciclin-like arabinogalactan pr...    181   1e-50   
ref|XP_010052360.1|  PREDICTED: fasciclin-like arabinogalactan pr...    181   2e-50   
gb|AAM62616.1|  arabinogalactan protein-like                            180   3e-50   Arabidopsis thaliana [mouse-ear cress]
emb|CDX80855.1|  BnaC03g01090D                                          179   4e-50   
emb|CDY44345.1|  BnaC02g03320D                                          179   5e-50   
ref|XP_009125482.1|  PREDICTED: fasciclin-like arabinogalactan pr...    179   5e-50   
emb|CDY11242.1|  BnaA03g00780D                                          179   6e-50   
ref|XP_002519547.1|  conserved hypothetical protein                     179   6e-50   Ricinus communis
ref|NP_195937.1|  fasciclin-like arabinogalactan protein 11             179   8e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010253626.1|  PREDICTED: fasciclin-like arabinogalactan pr...    178   1e-49   
ref|XP_002873077.1|  hypothetical protein ARALYDRAFT_487087             178   1e-49   
ref|XP_004241271.1|  PREDICTED: fasciclin-like arabinogalactan pr...    177   4e-49   
emb|CAI99883.1|  putative cell surface adhesion protein                 177   5e-49   Zinnia violacea [garden zinnia]
gb|KFK24763.1|  hypothetical protein AALP_AA8G021900                    176   7e-49   
ref|XP_008783124.1|  PREDICTED: fasciclin-like arabinogalactan pr...    177   8e-49   
gb|AAT37954.1|  fasciclin-like AGP 11                                   174   4e-48   Populus tremula x Populus alba [gray poplar]
ref|XP_011006038.1|  PREDICTED: fasciclin-like arabinogalactan pr...    176   4e-48   
gb|EYU18853.1|  hypothetical protein MIMGU_mgv1a026916mg                174   5e-48   
ref|XP_004243817.1|  PREDICTED: fasciclin-like arabinogalactan pr...    174   5e-48   
ref|XP_011015335.1|  PREDICTED: fasciclin-like arabinogalactan pr...    173   7e-48   
ref|XP_002285068.1|  PREDICTED: fasciclin-like arabinogalactan pr...    173   9e-48   Vitis vinifera
ref|XP_006381469.1|  fasciclin-like AGP 13 family protein               172   1e-47   
ref|XP_011089317.1|  PREDICTED: fasciclin-like arabinogalactan pr...    172   2e-47   
ref|XP_009620250.1|  PREDICTED: fasciclin-like arabinogalactan pr...    172   3e-47   
ref|XP_010232123.1|  PREDICTED: fasciclin-like arabinogalactan pr...    172   3e-47   
emb|CAN60933.1|  hypothetical protein VITISV_022591                     170   4e-47   Vitis vinifera
ref|XP_009760303.1|  PREDICTED: fasciclin-like arabinogalactan pr...    171   1e-46   
ref|XP_011048566.1|  PREDICTED: fasciclin-like arabinogalactan pr...    170   1e-46   
ref|XP_010919222.1|  PREDICTED: fasciclin-like arabinogalactan pr...    171   1e-46   
ref|XP_010558264.1|  PREDICTED: fasciclin-like arabinogalactan pr...    170   1e-46   
ref|XP_009406930.1|  PREDICTED: fasciclin-like arabinogalactan pr...    171   2e-46   
ref|XP_002323464.1|  fasciclin-like AGP 13 family protein               169   2e-46   Populus trichocarpa [western balsam poplar]
ref|XP_008798339.1|  PREDICTED: fasciclin-like arabinogalactan pr...    169   3e-46   
ref|XP_006480613.1|  PREDICTED: fasciclin-like arabinogalactan pr...    169   4e-46   
gb|KDP29103.1|  hypothetical protein JCGZ_16492                         167   1e-45   
ref|XP_002275538.1|  PREDICTED: fasciclin-like arabinogalactan pr...    167   1e-45   Vitis vinifera
gb|AAT37956.1|  fasciclin-like AGP 13                                   167   1e-45   Populus tremula x Populus alba [gray poplar]
ref|XP_009786976.1|  PREDICTED: fasciclin-like arabinogalactan pr...    167   2e-45   
ref|XP_010924403.1|  PREDICTED: fasciclin-like arabinogalactan pr...    166   4e-45   
ref|XP_010916030.1|  PREDICTED: fasciclin-like arabinogalactan pr...    166   6e-45   
ref|NP_001130967.1|  uncharacterized protein LOC100192072 precursor     166   6e-45   Zea mays [maize]
ref|XP_009612445.1|  PREDICTED: fasciclin-like arabinogalactan pr...    166   8e-45   
ref|XP_006428804.1|  hypothetical protein CICLE_v10012588mg             165   9e-45   
ref|XP_008449261.1|  PREDICTED: fasciclin-like arabinogalactan pr...    165   1e-44   
gb|AFK36413.1|  unknown                                                 165   2e-44   
ref|XP_003625615.1|  Fasciclin-like arabinogalactan protein             165   2e-44   
ref|XP_008789092.1|  PREDICTED: fasciclin-like arabinogalactan pr...    164   2e-44   
ref|XP_002458287.1|  hypothetical protein SORBIDRAFT_03g030690          164   2e-44   Sorghum bicolor [broomcorn]
ref|XP_006826651.1|  hypothetical protein AMTR_s00393p00013250          164   2e-44   
ref|XP_004493964.1|  PREDICTED: fasciclin-like arabinogalactan pr...    164   4e-44   
gb|AGN92421.1|  putative fasciclin-like arabinogalactan protein 1       162   5e-44   
ref|XP_008798234.1|  PREDICTED: fasciclin-like arabinogalactan pr...    163   6e-44   
ref|XP_009421475.1|  PREDICTED: fasciclin-like arabinogalactan pr...    163   6e-44   
ref|XP_006340150.1|  PREDICTED: fasciclin-like arabinogalactan pr...    162   8e-44   
ref|XP_004143241.1|  PREDICTED: fasciclin-like arabinogalactan pr...    162   1e-43   
ref|XP_003567900.1|  PREDICTED: fasciclin-like arabinogalactan pr...    162   2e-43   
ref|XP_010260346.1|  PREDICTED: fasciclin-like arabinogalactan pr...    162   3e-43   
gb|ABR68797.1|  arabinogalactan protein 2                               161   4e-43   Gossypium hirsutum [American cotton]
ref|XP_004969482.1|  PREDICTED: fasciclin-like arabinogalactan pr...    160   7e-43   
ref|XP_009404414.1|  PREDICTED: fasciclin-like arabinogalactan pr...    162   8e-43   
gb|EMT22225.1|  hypothetical protein F775_32785                         159   2e-42   
gb|EPS63113.1|  hypothetical protein M569_11675                         157   2e-42   
ref|XP_006365737.1|  PREDICTED: fasciclin-like arabinogalactan pr...    158   5e-42   
emb|CAN62433.1|  hypothetical protein VITISV_022135                     158   6e-42   Vitis vinifera
ref|XP_006843643.1|  hypothetical protein AMTR_s00007p00166710          158   6e-42   
ref|XP_002280829.1|  PREDICTED: fasciclin-like arabinogalactan pr...    157   7e-42   Vitis vinifera
gb|ABI95404.1|  fasciclin-like protein FLA14                            157   2e-41   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ94967.1|  predicted protein                                      157   2e-41   
ref|XP_009342757.1|  PREDICTED: fasciclin-like arabinogalactan pr...    156   2e-41   
ref|XP_010937843.1|  PREDICTED: fasciclin-like arabinogalactan pr...    155   4e-41   
ref|XP_010684113.1|  PREDICTED: fasciclin-like arabinogalactan pr...    155   5e-41   
ref|XP_008350366.1|  PREDICTED: fasciclin-like arabinogalactan pr...    155   5e-41   
gb|EPS62200.1|  hypothetical protein M569_12593                         153   5e-41   
ref|XP_008463798.1|  PREDICTED: fasciclin-like arabinogalactan pr...    155   6e-41   
ref|XP_010107552.1|  hypothetical protein L484_024406                   155   7e-41   
ref|NP_001043814.1|  Os01g0668100                                       155   1e-40   Oryza sativa Japonica Group [Japonica rice]
gb|ABV27477.1|  fasciclin-like arabinogalactan protein 6                154   1e-40   Gossypium hirsutum [American cotton]
ref|XP_008793344.1|  PREDICTED: fasciclin-like arabinogalactan pr...    154   1e-40   
gb|ACU15329.1|  unknown                                                 152   2e-40   Glycine max [soybeans]
gb|ACJ85305.1|  unknown                                                 153   2e-40   Medicago truncatula
gb|ABI95402.1|  fasciclin-like protein FLA12                            154   2e-40   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004148768.1|  PREDICTED: fasciclin-like arabinogalactan pr...    153   3e-40   
gb|AFK36056.1|  unknown                                                 152   4e-40   
ref|XP_010104108.1|  hypothetical protein L484_014391                   153   4e-40   
gb|ABI95403.1|  fasciclin-like protein FLA13                            154   4e-40   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010920871.1|  PREDICTED: fasciclin-like arabinogalactan pr...    153   5e-40   
ref|XP_002440247.1|  hypothetical protein SORBIDRAFT_09g028480          152   6e-40   Sorghum bicolor [broomcorn]
ref|XP_003606406.1|  Fasciclin-like arabinogalactan protein             152   7e-40   
ref|XP_009377418.1|  PREDICTED: fasciclin-like arabinogalactan pr...    152   8e-40   
ref|XP_006488128.1|  PREDICTED: fasciclin-like arabinogalactan pr...    152   8e-40   
gb|KDO73213.1|  hypothetical protein CISIN_1g025798mg                   152   8e-40   
gb|AAO92753.1|  arabinogalactan protein                                 152   1e-39   Gossypium hirsutum [American cotton]
ref|XP_006424604.1|  hypothetical protein CICLE_v10028988mg             152   2e-39   
ref|XP_007015428.1|  FASCICLIN-like arabinogalactan-protein 11          151   2e-39   
ref|XP_008243923.1|  PREDICTED: fasciclin-like arabinogalactan pr...    151   2e-39   
ref|NP_001174524.1|  Os05g0563550                                       151   2e-39   
ref|XP_004251119.1|  PREDICTED: fasciclin-like arabinogalactan pr...    150   3e-39   
ref|XP_004505977.1|  PREDICTED: fasciclin-like arabinogalactan pr...    150   4e-39   
gb|EMT20397.1|  hypothetical protein F775_29110                         150   5e-39   
emb|CDP07130.1|  unnamed protein product                                150   7e-39   
emb|CDY36978.1|  BnaC09g17940D                                          146   7e-39   
ref|XP_008455488.1|  PREDICTED: fasciclin-like arabinogalactan pr...    149   8e-39   
gb|ABR68796.1|  arabinogalactan protein 4                               149   8e-39   Gossypium hirsutum [American cotton]
gb|EEE64696.1|  hypothetical protein OsJ_19551                          151   9e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007204927.1|  hypothetical protein PRUPE_ppa023999mg             149   1e-38   
ref|XP_008225462.1|  PREDICTED: fasciclin-like arabinogalactan pr...    149   4e-38   
ref|XP_004304418.1|  PREDICTED: fasciclin-like arabinogalactan pr...    147   5e-38   
ref|XP_007027300.1|  FASCICLIN-like arabinogalactan-protein 11, p...    147   8e-38   
gb|ACU18940.1|  unknown                                                 146   2e-37   Glycine max [soybeans]
ref|NP_001235903.1|  uncharacterized protein LOC100500034 precursor     146   2e-37   
ref|XP_007207834.1|  hypothetical protein PRUPE_ppa023379mg             146   2e-37   
ref|XP_003540183.1|  PREDICTED: fasciclin-like arabinogalactan pr...    145   2e-37   
gb|ADE62307.1|  fasciclin-like arabinogalactan protein                  146   3e-37   
gb|ACZ67172.1|  fasciclin and related adhesion glycoprotein             145   3e-37   Populus nigra [black poplar]
ref|XP_003521385.1|  PREDICTED: fasciclin-like arabinogalactan pr...    145   3e-37   
ref|XP_002532604.1|  conserved hypothetical protein                     146   4e-37   Ricinus communis
ref|XP_010043729.1|  PREDICTED: fasciclin-like arabinogalactan pr...    145   4e-37   
ref|XP_003521389.1|  PREDICTED: fasciclin-like arabinogalactan pr...    145   4e-37   
ref|XP_007207073.1|  hypothetical protein PRUPE_ppa026177mg             145   5e-37   
gb|ACZ67174.1|  fasciclin and related adhesion glycoprotein             144   5e-37   Populus deltoides
ref|XP_011041714.1|  PREDICTED: fasciclin-like arabinogalactan pr...    144   6e-37   
gb|ACU18441.1|  unknown                                                 143   6e-37   Glycine max [soybeans]
gb|ABV27476.1|  fasciclin-like arabinogalactan protein 5                144   7e-37   Gossypium hirsutum [American cotton]
gb|ABB97042.1|  unknown                                                 144   7e-37   Brassica rapa
gb|KHN09493.1|  Fasciclin-like arabinogalactan protein 11               144   8e-37   
ref|XP_002321841.1|  fasciclin-like AGP 15 family protein               144   8e-37   Populus trichocarpa [western balsam poplar]
ref|XP_006604571.1|  PREDICTED: fasciclin-like arabinogalactan pr...    144   8e-37   
ref|XP_002866383.1|  hypothetical protein ARALYDRAFT_496195             144   8e-37   
gb|ABS50664.1|  fasciclin-like arabinogalactan protein                  144   9e-37   Eucalyptus grandis [rose gum]
ref|XP_009131912.1|  PREDICTED: fasciclin-like arabinogalactan pr...    144   9e-37   
ref|XP_009405666.1|  PREDICTED: fasciclin-like arabinogalactan pr...    144   1e-36   
ref|XP_004961219.1|  PREDICTED: fasciclin-like arabinogalactan pr...    142   1e-36   
emb|CDY67775.1|  BnaCnng56350D                                          144   1e-36   
gb|KCW85724.1|  hypothetical protein EUGRSUZ_B02486                     145   2e-36   
ref|XP_004144519.1|  PREDICTED: fasciclin-like arabinogalactan pr...    143   2e-36   
ref|XP_004163432.1|  PREDICTED: fasciclin-like arabinogalactan pr...    143   2e-36   
ref|XP_006361812.1|  PREDICTED: fasciclin-like arabinogalactan pr...    143   2e-36   
ref|XP_010520362.1|  PREDICTED: fasciclin-like arabinogalactan pr...    143   3e-36   
gb|ADE62309.1|  fasciclin-like arabinogalactan protein                  143   3e-36   
ref|XP_004487128.1|  PREDICTED: fasciclin-like arabinogalactan pr...    142   3e-36   
dbj|BAB08198.1|  unnamed protein product                                142   4e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010046692.1|  PREDICTED: fasciclin-like arabinogalactan pr...    142   4e-36   
gb|AAA74420.1|  arabinogalactan-like protein                            142   5e-36   Pinus taeda
ref|XP_007162741.1|  hypothetical protein PHAVU_001G176400g             143   5e-36   
gb|ABR17950.1|  unknown                                                 142   5e-36   Picea sitchensis
ref|XP_002317778.1|  fasciclin-like AGP 15 family protein               142   5e-36   Populus trichocarpa [western balsam poplar]
gb|AAT37950.1|  fasciclin-like AGP 7                                    142   5e-36   Populus tremula x Populus alba [gray poplar]
gb|KHG08221.1|  Fasciclin-like arabinogalactan protein 12               142   6e-36   
ref|XP_004246666.1|  PREDICTED: fasciclin-like arabinogalactan pr...    142   6e-36   
gb|EAY72628.1|  hypothetical protein OsI_00494                          142   6e-36   Oryza sativa Indica Group [Indian rice]
dbj|BAD61084.1|  putative arabinogalactan protein                       142   6e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011094679.1|  PREDICTED: fasciclin-like arabinogalactan pr...    141   7e-36   
ref|XP_009769903.1|  PREDICTED: fasciclin-like arabinogalactan pr...    141   7e-36   
ref|XP_010104104.1|  hypothetical protein L484_014387                   143   9e-36   
ref|XP_010446221.1|  PREDICTED: fasciclin-like arabinogalactan pr...    141   1e-35   
ref|XP_002280565.2|  PREDICTED: fasciclin-like arabinogalactan pr...    142   1e-35   Vitis vinifera
ref|XP_002317779.1|  fasciclin-like AGP 15 family protein               142   1e-35   Populus trichocarpa [western balsam poplar]
ref|XP_010483697.1|  PREDICTED: fasciclin-like arabinogalactan pr...    141   1e-35   
gb|ABV27478.1|  fasciclin-like arabinogalactan protein 7                141   1e-35   Gossypium hirsutum [American cotton]
gb|KHN32074.1|  Fasciclin-like arabinogalactan protein 11               140   2e-35   
ref|XP_011014336.1|  PREDICTED: fasciclin-like arabinogalactan pr...    141   2e-35   
ref|XP_011025076.1|  PREDICTED: fasciclin-like arabinogalactan pr...    142   2e-35   
ref|XP_002455162.1|  hypothetical protein SORBIDRAFT_03g005280          140   3e-35   Sorghum bicolor [broomcorn]
emb|CAN80889.1|  hypothetical protein VITISV_031811                     140   3e-35   Vitis vinifera
ref|XP_009630866.1|  PREDICTED: fasciclin-like arabinogalactan pr...    139   4e-35   
ref|XP_010104101.1|  hypothetical protein L484_014384                   140   5e-35   
gb|ABR68798.1|  arabinogalactan protein 3                               140   5e-35   Gossypium hirsutum [American cotton]
ref|XP_009389411.1|  PREDICTED: fasciclin-like arabinogalactan pr...    139   6e-35   
ref|XP_006400843.1|  hypothetical protein EUTSA_v10014491mg             139   7e-35   
ref|XP_006655019.1|  PREDICTED: fasciclin-like arabinogalactan pr...    138   7e-35   
ref|XP_008225421.1|  PREDICTED: fasciclin-like arabinogalactan pr...    140   7e-35   
ref|XP_007132234.1|  hypothetical protein PHAVU_011G077400g             139   8e-35   
dbj|BAD16216.1|  putative fasciclin-like arabinogalactan-protein        139   8e-35   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054735.1|  Os05g0163300                                       139   1e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006645522.1|  PREDICTED: fasciclin-like arabinogalactan pr...    141   1e-34   
ref|XP_010104103.1|  hypothetical protein L484_014386                   140   1e-34   
gb|AAT07658.1|  putative arabinogalactan protein                        139   2e-34   Oryza sativa Japonica Group [Japonica rice]
gb|ACJ85480.1|  unknown                                                 138   2e-34   Medicago truncatula
gb|AAT37958.1|  fasciclin-like AGP 15                                   138   2e-34   Populus tremula x Populus alba [gray poplar]
ref|XP_010104099.1|  hypothetical protein L484_014382                   139   2e-34   
gb|KDP44073.1|  hypothetical protein JCGZ_05540                         137   3e-34   
gb|AAD56235.1|AF183809_1  arabinogalactan protein Pop14A9               137   3e-34   Populus tremula x Populus alba [gray poplar]
ref|XP_010104098.1|  hypothetical protein L484_014381                   139   3e-34   
gb|EYU38532.1|  hypothetical protein MIMGU_mgv1a012755mg                137   3e-34   
ref|XP_002532608.1|  conserved hypothetical protein                     138   3e-34   Ricinus communis
ref|XP_006648571.1|  PREDICTED: fasciclin-like arabinogalactan pr...    138   3e-34   
gb|KDP44079.1|  hypothetical protein JCGZ_05546                         138   3e-34   
ref|XP_003565918.1|  PREDICTED: fasciclin-like arabinogalactan pr...    137   4e-34   
ref|XP_008225450.1|  PREDICTED: fasciclin-like arabinogalactan pr...    138   4e-34   
gb|AAM62683.1|  arabinogalactan protein-like                            137   4e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002532603.1|  conserved hypothetical protein                     137   4e-34   Ricinus communis
gb|AAK95321.1|AF410335_1  AT5g60490/muf9_140                            137   4e-34   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200857.1|  fasciclin-like arabinogalactan protein 12             137   4e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007207878.1|  hypothetical protein PRUPE_ppa021321mg             137   6e-34   
gb|KDP44077.1|  hypothetical protein JCGZ_05544                         137   6e-34   
gb|KDP44074.1|  hypothetical protein JCGZ_05541                         137   6e-34   
gb|AFK35566.1|  unknown                                                 136   6e-34   
ref|XP_004295018.1|  PREDICTED: fasciclin-like arabinogalactan pr...    136   8e-34   
ref|XP_008225441.1|  PREDICTED: fasciclin-like arabinogalactan pr...    137   8e-34   
gb|KFK27578.1|  hypothetical protein AALP_AA8G402100                    136   8e-34   
ref|XP_002463075.1|  hypothetical protein SORBIDRAFT_02g037310          136   9e-34   Sorghum bicolor [broomcorn]
ref|XP_003597212.1|  Fasciclin-like arabinogalactan protein             137   1e-33   
gb|AAT37952.1|  fasciclin-like AGP 9                                    136   1e-33   
ref|XP_002313519.2|  fasciclin-like AGP 15 family protein               136   2e-33   
ref|XP_011044381.1|  PREDICTED: fasciclin-like arabinogalactan pr...    135   2e-33   
gb|KDO73214.1|  hypothetical protein CISIN_1g042775mg                   134   2e-33   
ref|XP_007208544.1|  hypothetical protein PRUPE_ppa024648mg             136   2e-33   
ref|XP_002532605.1|  conserved hypothetical protein                     135   2e-33   
ref|XP_003539721.1|  PREDICTED: fasciclin-like arabinogalactan pr...    135   2e-33   
ref|XP_006488127.1|  PREDICTED: fasciclin-like arabinogalactan pr...    136   2e-33   
ref|XP_006279682.1|  hypothetical protein CARUB_v10026995mg             135   2e-33   
ref|XP_007152043.1|  hypothetical protein PHAVU_004G096900g             135   3e-33   
ref|XP_010101250.1|  hypothetical protein L484_000577                   135   3e-33   
ref|XP_002318877.1|  fasciclin-like AGP 15 family protein               134   3e-33   
ref|XP_006591618.1|  PREDICTED: fasciclin-like arabinogalactan pr...    136   3e-33   
emb|CDP06732.1|  unnamed protein product                                135   4e-33   
gb|KDP44072.1|  hypothetical protein JCGZ_05539                         134   4e-33   
ref|XP_011029966.1|  PREDICTED: fasciclin-like arabinogalactan pr...    134   4e-33   
ref|XP_006384898.1|  hypothetical protein POPTR_0004s22030g             134   5e-33   
gb|KDP44078.1|  hypothetical protein JCGZ_05545                         134   6e-33   
ref|XP_009338258.1|  PREDICTED: fasciclin-like arabinogalactan pr...    134   7e-33   
ref|XP_010104102.1|  hypothetical protein L484_014385                   134   8e-33   
ref|XP_002298676.2|  fasciclin-like AGP 15 family protein               133   1e-32   
gb|KHN38782.1|  Fasciclin-like arabinogalactan protein 11               134   1e-32   
ref|XP_002321998.2|  hypothetical protein POPTR_0015s01560g             133   1e-32   
emb|CDM81544.1|  unnamed protein product                                133   1e-32   
gb|AAT37953.1|  fasciclin-like AGP 10                                   133   1e-32   
gb|ABI95408.1|  fasciclin-like protein FLA18                            133   1e-32   
ref|XP_002313520.2|  fasciclin-like AGP 15 family protein               133   1e-32   
ref|XP_006424603.1|  hypothetical protein CICLE_v10029172mg             132   1e-32   
ref|XP_008363505.1|  PREDICTED: fasciclin-like arabinogalactan pr...    134   2e-32   
ref|XP_010653562.1|  PREDICTED: fasciclin-like arabinogalactan pr...    133   2e-32   
ref|XP_003539724.1|  PREDICTED: fasciclin-like arabinogalactan pr...    133   2e-32   
gb|ACU18837.1|  unknown                                                 133   2e-32   
ref|XP_002532600.1|  conserved hypothetical protein                     132   2e-32   
ref|XP_004968272.1|  PREDICTED: fasciclin-like arabinogalactan pr...    133   2e-32   
ref|XP_011003630.1|  PREDICTED: fasciclin-like arabinogalactan pr...    132   3e-32   
ref|XP_010535593.1|  PREDICTED: fasciclin-like arabinogalactan pr...    132   3e-32   
ref|XP_003539723.1|  PREDICTED: fasciclin-like arabinogalactan pr...    133   3e-32   
ref|XP_004952331.1|  PREDICTED: fasciclin-like arabinogalactan pr...    132   3e-32   
ref|XP_004485932.1|  PREDICTED: fasciclin-like arabinogalactan pr...    133   3e-32   
gb|KHN06429.1|  Fasciclin-like arabinogalactan protein 12               131   3e-32   
ref|XP_002532612.1|  conserved hypothetical protein                     131   4e-32   
ref|XP_002532611.1|  conserved hypothetical protein                     132   4e-32   
ref|NP_001240023.1|  uncharacterized protein LOC100791112 precursor     132   6e-32   
gb|KHN32073.1|  Fasciclin-like arabinogalactan protein 11               131   6e-32   
ref|XP_003539725.1|  PREDICTED: fasciclin-like arabinogalactan pr...    132   6e-32   
ref|XP_009335061.1|  PREDICTED: fasciclin-like arabinogalactan pr...    131   7e-32   
gb|KHN32072.1|  Fasciclin-like arabinogalactan protein 11               131   8e-32   
ref|XP_010032011.1|  PREDICTED: fasciclin-like arabinogalactan pr...    131   9e-32   
ref|XP_003565205.1|  PREDICTED: fasciclin-like arabinogalactan pr...    130   1e-31   
gb|AAT37957.1|  fasciclin-like AGP 14                                   130   1e-31   
emb|CAN80894.1|  hypothetical protein VITISV_031816                     130   1e-31   
ref|XP_003546043.1|  PREDICTED: fasciclin-like arabinogalactan pr...    131   1e-31   
ref|XP_010653564.1|  PREDICTED: fasciclin-like arabinogalactan pr...    130   1e-31   
gb|KDP44080.1|  hypothetical protein JCGZ_05547                         130   1e-31   
ref|XP_006488126.1|  PREDICTED: fasciclin-like arabinogalactan pr...    130   2e-31   
ref|XP_006424602.1|  hypothetical protein CICLE_v10030205mg             130   2e-31   
gb|KHN05735.1|  Fasciclin-like arabinogalactan protein 11               130   2e-31   
emb|CAN80892.1|  hypothetical protein VITISV_031814                     130   2e-31   
emb|CBI16294.3|  unnamed protein product                                132   2e-31   
gb|KDO73215.1|  hypothetical protein CISIN_1g037512mg                   130   2e-31   
ref|XP_003606125.1|  Fasciclin-like arabinogalactan protein             130   2e-31   
gb|ACU17607.1|  unknown                                                 130   2e-31   
gb|ABS50663.1|  fasciclin-like arabinogalactan protein                  130   3e-31   
emb|CAN80893.1|  hypothetical protein VITISV_031815                     129   3e-31   
ref|XP_002275816.2|  PREDICTED: fasciclin-like arabinogalactan pr...    129   3e-31   
ref|XP_010653559.1|  PREDICTED: fasciclin-like arabinogalactan pr...    129   3e-31   
ref|XP_002532610.1|  conserved hypothetical protein                     129   4e-31   
ref|XP_003606417.1|  Fasciclin-like arabinogalactan protein             130   4e-31   
ref|NP_001151382.1|  fasciclin-like arabinogalactan protein 8 pre...    129   4e-31   
ref|XP_011040874.1|  PREDICTED: fasciclin-like arabinogalactan pr...    129   4e-31   
ref|NP_001239620.1|  uncharacterized protein LOC100796929 precursor     129   4e-31   
ref|XP_007132200.1|  hypothetical protein PHAVU_011G074500g             129   5e-31   
ref|XP_010456482.1|  PREDICTED: fasciclin-like arabinogalactan pr...    129   5e-31   
ref|XP_007132230.1|  hypothetical protein PHAVU_011G077000g             129   6e-31   
ref|XP_003539114.1|  PREDICTED: fasciclin-like arabinogalactan pr...    129   6e-31   
ref|XP_008385295.1|  PREDICTED: fasciclin-like arabinogalactan pr...    129   6e-31   
ref|XP_007132231.1|  hypothetical protein PHAVU_011G077100g             129   7e-31   
gb|AES64069.2|  fasciclin domain protein                                129   7e-31   
ref|XP_011040871.1|  PREDICTED: fasciclin-like arabinogalactan pr...    128   8e-31   
ref|XP_009630865.1|  PREDICTED: fasciclin-like arabinogalactan pr...    128   8e-31   
ref|XP_010104107.1|  hypothetical protein L484_014390                   129   1e-30   
gb|AFK33714.1|  unknown                                                 128   1e-30   
ref|NP_001046645.1|  Os02g0308400                                       128   1e-30   
gb|EAY85536.1|  hypothetical protein OsI_06909                          128   1e-30   
gb|ACF85943.1|  unknown                                                 128   1e-30   
ref|XP_002275791.1|  PREDICTED: fasciclin-like arabinogalactan pr...    127   1e-30   
ref|XP_010653558.1|  PREDICTED: fasciclin-like arabinogalactan pr...    129   1e-30   
ref|XP_007206667.1|  hypothetical protein PRUPE_ppa022851mg             128   1e-30   
ref|XP_008225430.1|  PREDICTED: fasciclin-like arabinogalactan pr...    128   2e-30   
ref|XP_007132232.1|  hypothetical protein PHAVU_011G077200g             127   2e-30   
ref|XP_009338259.1|  PREDICTED: fasciclin-like arabinogalactan pr...    128   2e-30   
ref|XP_003606412.1|  Fasciclin-like arabinogalactan protein             128   2e-30   
ref|XP_007208580.1|  hypothetical protein PRUPE_ppa023283mg             128   2e-30   
gb|AAT37951.1|  fasciclin-like AGP 8                                    127   2e-30   
emb|CAN80891.1|  hypothetical protein VITISV_031813                     129   2e-30   
ref|XP_002532601.1|  conserved hypothetical protein                     127   2e-30   
gb|AFK46797.1|  unknown                                                 128   2e-30   
emb|CBI32719.3|  unnamed protein product                                128   2e-30   
ref|XP_011044383.1|  PREDICTED: fasciclin-like arabinogalactan pr...    127   3e-30   
gb|KDP44081.1|  hypothetical protein JCGZ_05548                         126   3e-30   
gb|ACJ84960.1|  unknown                                                 128   3e-30   
gb|KHN05734.1|  Fasciclin-like arabinogalactan protein 11               127   3e-30   
ref|XP_003538217.1|  PREDICTED: fasciclin-like arabinogalactan pr...    127   4e-30   
ref|XP_006647201.1|  PREDICTED: fasciclin-like arabinogalactan pr...    126   4e-30   
gb|ADE62308.1|  fasciclin-like arabinogalactan protein                  126   4e-30   
gb|KHN39526.1|  Fasciclin-like arabinogalactan protein 11               127   4e-30   
ref|XP_004246667.1|  PREDICTED: fasciclin-like arabinogalactan pr...    126   4e-30   
ref|XP_007132209.1|  hypothetical protein PHAVU_011G075300g             127   5e-30   
ref|XP_004505975.1|  PREDICTED: fasciclin-like arabinogalactan pr...    126   5e-30   
ref|XP_003532766.1|  PREDICTED: fasciclin-like arabinogalactan pr...    126   6e-30   
ref|XP_003629841.1|  Fasciclin-like arabinogalactan protein             127   7e-30   
ref|XP_003629840.1|  Fasciclin-like arabinogalactan protein             128   8e-30   
ref|XP_009769904.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   8e-30   
ref|XP_003539718.1|  PREDICTED: fasciclin-like arabinogalactan pr...    126   9e-30   
ref|XP_006591149.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   1e-29   
gb|KHN48027.1|  Fasciclin-like arabinogalactan protein 12               126   1e-29   
gb|KHN32077.1|  Fasciclin-like arabinogalactan protein 11               126   1e-29   
ref|XP_003593816.1|  Fasciclin-like arabinogalactan protein             126   1e-29   
ref|XP_003532767.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   1e-29   
ref|XP_008344850.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   1e-29   
gb|KHN48026.1|  Fasciclin-like arabinogalactan protein 11               125   1e-29   
ref|XP_010653555.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   1e-29   
ref|XP_003538218.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   1e-29   
gb|AFK41879.1|  unknown                                                 125   1e-29   
ref|XP_003538216.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   1e-29   
ref|XP_010456492.1|  PREDICTED: fasciclin-like arabinogalactan pr...    124   1e-29   
ref|XP_003593818.1|  Fasciclin-like arabinogalactan protein             127   1e-29   
gb|AER92607.1|  putative fasciclin-like AGP                             125   2e-29   
ref|XP_010653711.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   2e-29   
ref|XP_007159487.1|  hypothetical protein PHAVU_002G241600g             128   2e-29   
ref|XP_010034295.1|  PREDICTED: fasciclin-like arabinogalactan pr...    124   2e-29   
gb|AFK42841.1|  unknown                                                 125   2e-29   
gb|AAT37945.1|  fasciclin-like AGP 2                                    124   2e-29   
gb|KHN32070.1|  Fasciclin-like arabinogalactan protein 11               125   2e-29   
ref|XP_003629839.1|  Fasciclin-like arabinogalactan protein             125   2e-29   
ref|XP_003539722.2|  PREDICTED: fasciclin-like arabinogalactan pr...    125   2e-29   
ref|XP_003593817.1|  Fasciclin-like arabinogalactan protein             124   3e-29   
gb|KHN39527.1|  Fasciclin-like arabinogalactan protein 12               125   3e-29   
ref|XP_003539726.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   3e-29   
ref|XP_002319946.1|  fasciclin-like AGP 15 family protein               124   3e-29   
gb|KHN05732.1|  Beta-galactosidase 8                                    127   3e-29   
ref|XP_002532609.1|  conserved hypothetical protein                     124   3e-29   
gb|ACU23556.1|  unknown                                                 124   4e-29   
ref|XP_006376544.1|  hypothetical protein POPTR_0013s14780g             123   4e-29   
ref|XP_007159488.1|  hypothetical protein PHAVU_002G241700g             125   4e-29   
ref|XP_002442056.1|  hypothetical protein SORBIDRAFT_08g008370          124   4e-29   
gb|AFK36882.1|  unknown                                                 124   4e-29   
emb|CBI32722.3|  unnamed protein product                                122   5e-29   
ref|XP_011023709.1|  PREDICTED: fasciclin-like arabinogalactan pr...    123   5e-29   
ref|XP_011048522.1|  PREDICTED: fasciclin-like arabinogalactan pr...    123   5e-29   
gb|AAT37947.1|  fasciclin-like AGP 4                                    123   6e-29   
ref|XP_011020993.1|  PREDICTED: fasciclin-like arabinogalactan pr...    123   6e-29   
gb|AFK45477.1|  unknown                                                 124   7e-29   
ref|XP_002318983.1|  fasciclin-like AGP 15 family protein               123   7e-29   
ref|XP_006376543.1|  hypothetical protein POPTR_0013s14760g             123   7e-29   
ref|XP_011020991.1|  PREDICTED: fasciclin-like arabinogalactan pr...    123   8e-29   
ref|XP_007132237.1|  hypothetical protein PHAVU_011G077700g             123   8e-29   
ref|XP_003539728.1|  PREDICTED: fasciclin-like arabinogalactan pr...    123   9e-29   
ref|XP_011020992.1|  PREDICTED: fasciclin-like arabinogalactan pr...    123   9e-29   
ref|XP_006591575.1|  PREDICTED: fasciclin-like arabinogalactan pr...    122   1e-28   
ref|XP_003538053.1|  PREDICTED: fasciclin-like arabinogalactan pr...    123   1e-28   
ref|XP_003535643.1|  PREDICTED: fasciclin-like arabinogalactan pr...    123   1e-28   
ref|XP_002319945.2|  fasciclin-like AGP 15 family protein               122   1e-28   
gb|AAT37949.1|  fasciclin-like AGP 6                                    122   1e-28   
gb|KHN21528.1|  Fasciclin-like arabinogalactan protein 11               122   1e-28   
ref|XP_006361822.1|  PREDICTED: fasciclin-like arabinogalactan pr...    122   1e-28   
ref|XP_002440662.1|  hypothetical protein SORBIDRAFT_09g004750          122   1e-28   
gb|KHN28640.1|  Fasciclin-like arabinogalactan protein 11               122   1e-28   
ref|XP_007132216.1|  hypothetical protein PHAVU_011G076000g             123   1e-28   
gb|KHN39525.1|  Fasciclin-like arabinogalactan protein 11               123   1e-28   
ref|XP_003539213.1|  PREDICTED: fasciclin-like arabinogalactan pr...    123   1e-28   
ref|XP_011020990.1|  PREDICTED: fasciclin-like arabinogalactan pr...    122   1e-28   
ref|XP_004504276.1|  PREDICTED: fasciclin-like arabinogalactan pr...    122   2e-28   
ref|XP_004505973.1|  PREDICTED: fasciclin-like arabinogalactan pr...    122   2e-28   
gb|AAT37946.1|  fasciclin-like AGP 3                                    122   2e-28   
ref|XP_006594988.1|  PREDICTED: fasciclin-like arabinogalactan pr...    122   2e-28   
ref|XP_002275883.3|  PREDICTED: fasciclin-like arabinogalactan pr...    122   2e-28   
ref|XP_007148000.1|  hypothetical protein PHAVU_006G172100g             122   2e-28   
ref|XP_007132229.1|  hypothetical protein PHAVU_011G076900g             122   2e-28   
gb|AFK46710.1|  unknown                                                 122   3e-28   
ref|XP_007132201.1|  hypothetical protein PHAVU_011G074600g             122   3e-28   
ref|XP_010104105.1|  hypothetical protein L484_014388                   122   3e-28   
gb|KCW88820.1|  hypothetical protein EUGRSUZ_A01158                     120   3e-28   
ref|XP_006371654.1|  hypothetical protein POPTR_0019s14350g             120   4e-28   
ref|XP_004505974.1|  PREDICTED: fasciclin-like arabinogalactan pr...    122   4e-28   
ref|XP_007132199.1|  hypothetical protein PHAVU_011G074400g             121   4e-28   
gb|EMT07885.1|  hypothetical protein F775_09011                         120   4e-28   
emb|CBI32717.3|  unnamed protein product                                123   5e-28   
gb|ABI95407.1|  fasciclin-like protein FLA17                            120   5e-28   
ref|XP_007132197.1|  hypothetical protein PHAVU_011G074200g             121   5e-28   
ref|XP_011047517.1|  PREDICTED: fasciclin-like arabinogalactan pr...    120   5e-28   
ref|XP_003566509.2|  PREDICTED: fasciclin-like arabinogalactan pr...    120   5e-28   
ref|XP_002532606.1|  conserved hypothetical protein                     120   5e-28   
ref|XP_011041844.1|  PREDICTED: fasciclin-like arabinogalactan pr...    120   6e-28   
ref|XP_003547182.1|  PREDICTED: fasciclin-like arabinogalactan pr...    121   6e-28   
ref|XP_011048524.1|  PREDICTED: fasciclin-like arabinogalactan pr...    120   6e-28   
gb|EYU22635.1|  hypothetical protein MIMGU_mgv1a024657mg                118   6e-28   
ref|XP_004505972.1|  PREDICTED: fasciclin-like arabinogalactan pr...    121   7e-28   
ref|XP_006371657.1|  hypothetical protein POPTR_0019s14370g             120   7e-28   
ref|XP_011048521.1|  PREDICTED: fasciclin-like arabinogalactan pr...    120   8e-28   
ref|XP_011041845.1|  PREDICTED: fasciclin-like arabinogalactan pr...    120   9e-28   
ref|XP_010104106.1|  hypothetical protein L484_014389                   121   1e-27   
ref|XP_006655588.1|  PREDICTED: fasciclin-like arabinogalactan pr...    119   1e-27   
gb|EYU32287.1|  hypothetical protein MIMGU_mgv1a022550mg                117   1e-27   
gb|AAT37944.1|  fasciclin-like AGP 1                                    119   1e-27   
gb|ABI95406.1|  fasciclin-like protein FLA16                            119   2e-27   
ref|NP_001056328.1|  Os05g0563600                                       119   2e-27   
ref|XP_002325675.2|  fasciclin-like AGP 15 family protein               119   2e-27   
ref|XP_008664451.1|  PREDICTED: fasciclin-like arabinogalactan pr...    119   2e-27   
ref|XP_003538212.1|  PREDICTED: fasciclin-like arabinogalactan pr...    119   2e-27   
gb|AER92606.1|  putative fasciclin-like AGP                             119   2e-27   
gb|KHN38777.1|  Fasciclin-like arabinogalactan protein 11               119   2e-27   
gb|AFK38800.1|  unknown                                                 119   2e-27   
ref|XP_011021435.1|  PREDICTED: fasciclin-like arabinogalactan pr...    118   2e-27   
ref|XP_006339076.1|  PREDICTED: fasciclin-like arabinogalactan pr...    119   2e-27   
ref|XP_007132210.1|  hypothetical protein PHAVU_011G075400g             119   3e-27   
gb|ACF85666.1|  unknown                                                 118   3e-27   
ref|XP_010653563.1|  PREDICTED: fasciclin-like arabinogalactan pr...    118   3e-27   
emb|CBI32721.3|  unnamed protein product                                118   4e-27   
ref|XP_002325674.1|  fasciclin-like AGP 15 family protein               118   5e-27   



>ref|XP_009773188.1| PREDICTED: fasciclin-like arabinogalactan protein 9 [Nicotiana 
sylvestris]
Length=247

 Score =   297 bits (761),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 157/248 (63%), Positives = 192/248 (77%), Gaps = 14/248 (6%)
 Frame = -2

Query  936  VSFIVLSFLLVGLAEVKAQ---APAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQ  766
            +S I L FLL    +++AQ   APAP+P GP+DIFA+LKKAG Q+  FIKFLN TQVG Q
Sbjct  7    LSLIPLFFLL--FPQIQAQSPTAPAPAPTGPIDIFAILKKAG-QYNTFIKFLNETQVGMQ  63

Query  765  VNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVS  586
            +N QVN+   GMTVFAP+DNAF NLP GTLNKL+DQQK+ LIQYH++PKFYSF+DLQTVS
Sbjct  64   INNQVNNSNQGMTVFAPSDNAFTNLPGGTLNKLNDQQKVQLIQYHILPKFYSFDDLQTVS  123

Query  585  NPVRTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLD  406
            NPVRTQA G  G+ +GLNFTGQNNQVNVSSGAVET +YN +RK+PPLAVYQ+DKVL+PL 
Sbjct  124  NPVRTQATGQKGEPFGLNFTGQNNQVNVSSGAVETNIYNAIRKEPPLAVYQLDKVLIPLA  183

Query  405  FTADHPAAKAPTGSASSTP---AGKSNDGKNATAAKEPSPAPNGAGKMSLEL-GLVTGIL  238
            FT     AK P+   +  P   + KS    + T AKEPSPAPNGA K+++ + GL++G+ 
Sbjct  184  FT----DAKTPSSDNAPAPTDDSAKSGSTADKTKAKEPSPAPNGAKKINVGVFGLISGVF  239

Query  237  VFCMGLLS  214
            +FCMG LS
Sbjct  240  LFCMGALS  247



>ref|XP_009588605.1| PREDICTED: fasciclin-like arabinogalactan protein 9 [Nicotiana 
tomentosiformis]
Length=251

 Score =   296 bits (759),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 155/253 (61%), Positives = 191/253 (75%), Gaps = 9/253 (4%)
 Frame = -2

Query  951  MAKAAVSFIVLSFL---LVGLAEVKAQ---APAPSPGGPVDIFAVLKKAGGQFGIFIKFL  790
            MA+ ++  I LS +    +   +++AQ   APAP+P GP+DIFA+LKK G Q+  FIKFL
Sbjct  1    MAQRSLPLIFLSLIPLFFILFPQIQAQSPTAPAPAPTGPIDIFAILKKPG-QYNTFIKFL  59

Query  789  NTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYS  610
            N TQVG Q+N QVN+   GMTVFAP+DNAF NLP GTLNKL+DQQK+ LIQYHV+PKFYS
Sbjct  60   NETQVGMQINNQVNNSNQGMTVFAPSDNAFTNLPGGTLNKLNDQQKVQLIQYHVLPKFYS  119

Query  609  FEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQV  430
            F+DLQTVSNPVRTQA G  G+ +GLNFTGQNNQVNVSSGAVET +YN +RKDPPLAVYQ+
Sbjct  120  FDDLQTVSNPVRTQATGQKGEPFGLNFTGQNNQVNVSSGAVETNIYNAIRKDPPLAVYQL  179

Query  429  DKVLVPLDFTADHPAAKAPTGSASSTPAGKSNDGKNATAAKEPSPAPNGAGKMSL-ELGL  253
            DKVL+PL+FT D     +    A S  + KS    + T AK PSPAPNGA ++++   GL
Sbjct  180  DKVLIPLEFT-DAKTPSSDNAPAPSNDSAKSGSTADKTKAKVPSPAPNGAKRINVGAFGL  238

Query  252  VTGILVFCMGLLS  214
            V+G+ +FCMG LS
Sbjct  239  VSGVFLFCMGALS  251



>ref|XP_006348836.1| PREDICTED: fasciclin-like arabinogalactan protein 9-like [Solanum 
tuberosum]
Length=249

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 151/249 (61%), Positives = 184/249 (74%), Gaps = 18/249 (7%)
 Frame = -2

Query  930  FIVLSFLLVGLAEVKAQ---APAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVN  760
             I+LS + +     +AQ   APAP+P GP+DIFA+LKK G Q+  FIKFLN +QVGNQ+N
Sbjct  9    LILLSIIPLFFILTQAQSPTAPAPAPSGPIDIFAILKKEG-QYNTFIKFLNESQVGNQIN  67

Query  759  IQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNP  580
             QVN+   GMTV AP+DNAFNNLPSGTLN+L+DQQK+ LI  HVIPKFY+F+DLQTVSNP
Sbjct  68   NQVNNSNQGMTVLAPSDNAFNNLPSGTLNQLNDQQKVQLILNHVIPKFYTFDDLQTVSNP  127

Query  579  VRTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFT  400
            VRTQA GP G+ +GLNFTG NNQVNVSSG+V T +YN +RK+PPLAVYQ+DKVLVP +FT
Sbjct  128  VRTQATGPKGEPFGLNFTGNNNQVNVSSGSVVTNIYNAIRKNPPLAVYQLDKVLVPSEFT  187

Query  399  ADHPAAKAPTGSASSTPAGKSNDGKNA--TAAKEPSPA----PNGAGKMSLE-LGLVTGI  241
                  KAP+   +  PA K+ +G +A  T A EPSPA    PN A ++S   LGL+ G 
Sbjct  188  ----DPKAPSSDDAPAPA-KAKNGTSADKTTADEPSPASSTKPNDAKRISGGILGLICG-  241

Query  240  LVFCMGLLS  214
             VF MG LS
Sbjct  242  -VFLMGTLS  249



>ref|XP_004243392.1| PREDICTED: fasciclin-like arabinogalactan protein 9 [Solanum 
lycopersicum]
Length=247

 Score =   259 bits (661),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 169/228 (74%), Gaps = 15/228 (7%)
 Frame = -2

Query  879  APAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAF  700
            APAP+P GP+DIFA+LKK G Q+  FIKFLN +QVGNQ+N QVN+   GMTV AP+DNAF
Sbjct  29   APAPAPSGPIDIFAILKKEG-QYNTFIKFLNESQVGNQINNQVNNSNQGMTVLAPSDNAF  87

Query  699  NNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQ  520
            NNLPSGTLN+L+DQQK+ LI  HVIPKFY+F+DLQTVSNPVRTQA GP G+ +GLNFTG 
Sbjct  88   NNLPSGTLNQLNDQQKVQLILNHVIPKFYTFDDLQTVSNPVRTQATGPKGEPFGLNFTGS  147

Query  519  NNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPA-G  343
            NNQVNVSSG+V T +YN +RKDPPLAV+Q+DKVLVP  FT       AP   A + P  G
Sbjct  148  NNQVNVSSGSVVTNIYNAIRKDPPLAVFQLDKVLVPSQFTDPSSDDDAP---APTKPKNG  204

Query  342  KSNDGKNATAAKEPSPA----PNGAGKMSLE-LGLVTGILVFCMGLLS  214
             SND    T A EPSPA    PN A ++S   LGLV G  VF M  LS
Sbjct  205  TSND---KTTADEPSPASNTKPNDAKRISGGILGLVCG--VFLMATLS  247



>gb|EYU28950.1| hypothetical protein MIMGU_mgv1a021394mg [Erythranthe guttata]
Length=267

 Score =   250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 133/241 (55%), Positives = 166/241 (69%), Gaps = 20/241 (8%)
 Frame = -2

Query  879  APAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAF  700
            AP P+  GP++I A+L+KA  Q+  FI+ LN TQ  NQ+N QVN+  DGMTVFAPTDNAF
Sbjct  28   APPPTASGPINITAILEKAS-QYTTFIRLLNETQAANQINNQVNNSQDGMTVFAPTDNAF  86

Query  699  NNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQ  520
            NNLP G+LNKL++QQ++ L+ YH+ PK+YS E L TVSNPVRTQA+G D + +GLNFTGQ
Sbjct  87   NNLPPGSLNKLTNQQQVQLVLYHICPKYYSLESLLTVSNPVRTQASGQDNQVFGLNFTGQ  146

Query  519  NNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF------------TADHPAAKA  376
             NQVNVS+G VE  +YN LRKDPPLAVYQVDKVL+P++F            +        
Sbjct  147  GNQVNVSTGVVEVPIYNALRKDPPLAVYQVDKVLLPIEFFPQQSKSKAPAPSPPPSGGGG  206

Query  375  PTGSASSTPAGKSNDGKNATAAKEPS---PAP----NGAGKMSLELGLVTGILVFCMGLL  217
               +A       SN   N TAAK PS   PA     NG+G+MS+ LGLV+GI++ CMGLL
Sbjct  207  GGAAAKPPSTSTSNPSTNVTAAKAPSTNDPATNNPGNGSGEMSVGLGLVSGIILLCMGLL  266

Query  216  S  214
            S
Sbjct  267  S  267



>gb|EYU28951.1| hypothetical protein MIMGU_mgv1a012619mg [Erythranthe guttata]
Length=245

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 131/222 (59%), Positives = 163/222 (73%), Gaps = 3/222 (1%)
 Frame = -2

Query  879  APAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAF  700
            AP P+P GP++I A+L+KA  Q+  FI+ LN TQ  NQ+N QVN+  DGMTVFAPTDNAF
Sbjct  26   APPPTPAGPINITAILEKAN-QYTTFIRLLNETQAANQINNQVNNSHDGMTVFAPTDNAF  84

Query  699  NNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQ  520
            NNLP GTLNKL++QQ++ L+ YH+ PKFYS E L TVSNPVRTQA+G D + +GLNFTGQ
Sbjct  85   NNLPPGTLNKLTNQQQVQLVLYHICPKFYSLESLLTVSNPVRTQASGQDNQVFGLNFTGQ  144

Query  519  NNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGK  340
             NQVNVS+G VE  +YN LRKDPPLAVYQVDKVL+P +F+   P A +P  +     +G 
Sbjct  145  GNQVNVSTGIVEVPIYNALRKDPPLAVYQVDKVLIPKEFSEPKPPAASPPPNGDG--SGS  202

Query  339  SNDGKNATAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLLS  214
            +     A  A   S   NG+GKM++  GLV+GIL+ CMGLLS
Sbjct  203  AAKDGGAAKAPSTSSPGNGSGKMNVGFGLVSGILLLCMGLLS  244



>emb|CDP15882.1| unnamed protein product [Coffea canephora]
Length=249

 Score =   234 bits (596),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 119/223 (53%), Positives = 157/223 (70%), Gaps = 6/223 (3%)
 Frame = -2

Query  879  APAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAF  700
            APAP+P GP++   +L KAGG F   I+ L+ TQ GNQ++ Q+N+  DGMT+ APTDNAF
Sbjct  30   APAPAPEGPINTTGILDKAGG-FSTLIRLLDETQAGNQIDNQLNNSHDGMTLLAPTDNAF  88

Query  699  NNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQ  520
             NLP+G LNKLSDQQK+ LIQYHVIPK+Y+   LQTVSNPVRT+A+G DG  +GLNFTGQ
Sbjct  89   QNLPAGALNKLSDQQKVQLIQYHVIPKYYTLTSLQTVSNPVRTEASGQDGGVFGLNFTGQ  148

Query  519  --NNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPA  346
               NQVNVSSG V T +YN +R   PLA+YQ+DKV+ P++F  +   A AP  S  +  +
Sbjct  149  TNQNQVNVSSGTVNTPIYNVVRGKFPLAIYQLDKVMWPMEF--NESKASAPVSSPPTLNS  206

Query  345  GKSNDGKNATAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLL  217
             +S  G   T A+ PS   + A  M++ L L++G+ + CMG+L
Sbjct  207  TRSGSGDGNTTAETPSTKSD-AKSMTVGLSLISGLWLLCMGVL  248



>ref|XP_011100234.1| PREDICTED: fasciclin-like arabinogalactan protein 13 [Sesamum 
indicum]
Length=247

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 131/218 (60%), Positives = 160/218 (73%), Gaps = 12/218 (6%)
 Frame = -2

Query  858  GPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGT  679
            GP+++ A+L+KAG Q+  FI+ LN TQ GNQ+N QVN+  DGMT+FAPTDNAFNNLP+GT
Sbjct  39   GPINVTAILEKAG-QYNFFIRLLNETQAGNQINNQVNNSHDGMTLFAPTDNAFNNLPTGT  97

Query  678  LNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVS  499
            LN L++QQ + L+ YH+ PKFYS + L TVSNPVRT A+G DG  +GLNFTGQ NQVNVS
Sbjct  98   LNNLTNQQHVQLVLYHICPKFYSLDSLLTVSNPVRTLASGQDGGVFGLNFTGQANQVNVS  157

Query  498  SGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF-TADHPAAKAPTGSASSTPAGKSNDGKN  322
            +G VE  +YN LRKD PLAVYQVDKVL+P +F  A  PAA  P    SS+PA    DG  
Sbjct  158  TGIVEVPLYNALRKDFPLAVYQVDKVLLPEEFYKAKAPAASPPAADGSSSPAA---DG--  212

Query  321  ATAAKEPSPAP--NGAGKMSLELGLVTGILVFCMGLLS  214
               AK PS     NG+G+MS+ LGLV+GI + CM LLS
Sbjct  213  --GAKAPSTGNPGNGSGRMSVGLGLVSGIWL-CMALLS  247



>gb|AAN60339.1| unknown [Arabidopsis thaliana]
Length=247

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/230 (53%), Positives = 155/230 (67%), Gaps = 9/230 (4%)
 Frame = -2

Query  897  AEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFA  718
            A  +  AP P P GP+++ A+L+K GGQF  FI  LN TQVG+QVNIQVNS ++GMTVFA
Sbjct  23   ATAQPAAPTPEPAGPINLTAILEK-GGQFTTFIHLLNITQVGSQVNIQVNSSSEGMTVFA  81

Query  717  PTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYG  538
            PTDNAF NL  GTLN+LS   ++ LI YHV PK+YS +DL +VSNPVRTQA+G D   YG
Sbjct  82   PTDNAFQNLKPGTLNQLSPDDQVKLILYHVSPKYYSMDDLLSVSNPVRTQASGRDNGVYG  141

Query  537  LNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADH---PAAKAPTG  367
            LNFTGQ NQ+NVS+G VET++ N LR+  PLAVY VD VL+P +   +H   P A AP  
Sbjct  142  LNFTGQTNQINVSTGYVETRISNSLRQQRPLAVYVVDMVLLPGEMFGEHKLSPIAPAP--  199

Query  366  SASSTPAGKSNDGKNATAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLL  217
               S   G ++D  +   A  PS   +G+G+  + LG   G++V C+  L
Sbjct  200  --KSKSGGVTDDSGSTKKAASPSDK-SGSGEKKVGLGFGLGLIVLCLKFL  246



>gb|ABR68799.1| fasciclin-like arabinogalactan protein 1 [Gossypium hirsutum]
Length=244

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 122/240 (51%), Positives = 159/240 (66%), Gaps = 7/240 (3%)
 Frame = -2

Query  927  IVLSFLLVGLAEVKAQ-APAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQV  751
            I+LS  LV +  V AQ APAP+P GP++   +L K  GQ+  F++ L  TQVG+QV  Q+
Sbjct  10   ILLSLFLVFICGVSAQTAPAPAPSGPLNFTGILDK-NGQYTYFLQLLAQTQVGSQVQTQL  68

Query  750  NSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRT  571
             + T+G TVFAPTDNAFNNL  GT+N L  QQK+ L+ YHVIPK+YS  DLQ VSNPVRT
Sbjct  69   KTTTEGFTVFAPTDNAFNNLKPGTVNNLDPQQKVQLVLYHVIPKYYSLNDLQFVSNPVRT  128

Query  570  QANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADH  391
            QA    G+ +GLN TG NNQVNVSSG VETQ+ N L +  PLA+YQ DKVL+P +F    
Sbjct  129  QA----GQDFGLNVTGLNNQVNVSSGVVETQINNALYQKKPLAIYQADKVLLPEEFFEAK  184

Query  390  PAAKAPTGSASSTPAGKSNDGKNATAAKEPSPAPN-GAGKMSLELGLVTGILVFCMGLLS  214
              A AP+ +   +  G  ++ + +  A EP+ A N G+   ++ LG V G+ + CMG LS
Sbjct  185  SPAAAPSPATKKSSTGSKSNSRASATADEPASADNSGSAGRNMGLGFVVGLALACMGFLS  244



>gb|ABV27475.1| fasciclin-like arabinogalactan protein 4 [Gossypium hirsutum]
Length=244

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 121/240 (50%), Positives = 159/240 (66%), Gaps = 7/240 (3%)
 Frame = -2

Query  927  IVLSFLLVGLAEVKAQ-APAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQV  751
            I+LS  LV +  V AQ APAP+P GP++   +L K  GQ+  F++ L  TQVG+QV  Q+
Sbjct  10   ILLSLFLVFICGVSAQTAPAPAPSGPLNFTGILDK-NGQYTYFLQLLAQTQVGSQVQTQL  68

Query  750  NSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRT  571
             + T+G TVFAPTDNAFNNL  GT+N L  QQK+ L+ YHVIPK+YS  DLQ VSNPVRT
Sbjct  69   KTTTEGFTVFAPTDNAFNNLKPGTVNNLDPQQKVQLVLYHVIPKYYSLNDLQFVSNPVRT  128

Query  570  QANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADH  391
            QA    G+ +GLN TG NNQVNVSSG VETQ+ N L +  PLA+YQ DKVL+P +F    
Sbjct  129  QA----GEDFGLNVTGLNNQVNVSSGVVETQINNALYQKKPLAIYQADKVLLPEEFFEAK  184

Query  390  PAAKAPTGSASSTPAGKSNDGKNATAAKEPSPAPN-GAGKMSLELGLVTGILVFCMGLLS  214
              A AP+ +   +  G  ++ + +  A EP+ A N G+   ++ LG V G+ + C+G LS
Sbjct  185  SPAAAPSPATKKSSTGSKSNSRASATADEPASADNSGSTGRNMGLGFVVGLALACIGFLS  244



>ref|XP_006418194.1| hypothetical protein EUTSA_v10008582mg [Eutrema salsugineum]
 gb|ESQ36547.1| hypothetical protein EUTSA_v10008582mg [Eutrema salsugineum]
Length=248

 Score =   221 bits (564),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 117/213 (55%), Positives = 149/213 (70%), Gaps = 4/213 (2%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            +++ A+L+K GGQF  FI  LN TQVG+QVNIQVNS ++GMTVFAPTDNAF NL  GTLN
Sbjct  38   INLTAILEK-GGQFTTFIHLLNITQVGSQVNIQVNSSSEGMTVFAPTDNAFQNLKPGTLN  96

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSG  493
            KLS  +++ LI YHV PKFYS +DL +VSNPVRTQA+G D   YGLNFTGQ NQVNVS+G
Sbjct  97   KLSADEQVKLILYHVSPKFYSLDDLLSVSNPVRTQASGRDNGVYGLNFTGQANQVNVSTG  156

Query  492  AVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGKSNDGKNATA  313
             VET+V NPLR+  PLAVY VD VL+P +   +H    +P   A  +P+   +D  N+T 
Sbjct  157  YVETRVSNPLRQQRPLAVYVVDMVLLPGEMFGEHKL--SPVAPAPKSPSSGVSDDSNSTK  214

Query  312  AKEPSPA-PNGAGKMSLELGLVTGILVFCMGLL  217
                SPA  +G+ +  + LG V G++  C+  L
Sbjct  215  KAAASPADKSGSCERKVGLGFVLGLVFLCLKFL  247



>emb|CDX94756.1| BnaC07g17650D [Brassica napus]
Length=244

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/211 (56%), Positives = 150/211 (71%), Gaps = 6/211 (3%)
 Frame = -2

Query  849  DIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNK  670
            +I A+L+K GGQF  FI  LNTT+VGNQ+NIQVNS ++GMTVFAPTDNAF NL  GTLNK
Sbjct  39   NITAILEK-GGQFATFIHLLNTTRVGNQINIQVNSSSEGMTVFAPTDNAFQNLKPGTLNK  97

Query  669  LSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGA  490
            LS   ++ LI YHV PKFY+ +DL +VSNPVRTQA+G DG  YGLNFT Q NQVNVS+G 
Sbjct  98   LSYDDQVKLILYHVSPKFYTLDDLLSVSNPVRTQASGRDGAVYGLNFTSQGNQVNVSTGF  157

Query  489  VETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGKSNDGKNATAA  310
            VET+V N LRK+ PLAVY VD VL+P +   ++  + A  G  S++P   S+D + A A 
Sbjct  158  VETRVSNALRKERPLAVYVVDMVLLPEEMFGENKVSPAAPGPKSNSP-DVSDDQEKAGAP  216

Query  309  KEPSPAPNGAGKMSLELGLVTGILVFCMGLL  217
             + S    G+G+M   LGL  G++  C+ L+
Sbjct  217  SDKS----GSGEMKAGLGLALGLVFVCLKLV  243



>ref|XP_010522581.1| PREDICTED: fasciclin-like arabinogalactan protein 9 [Tarenaya 
hassleriana]
Length=247

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/216 (55%), Positives = 151/216 (70%), Gaps = 7/216 (3%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            V++ A+L+K GGQF  FI  LNTTQVGNQVNIQ+NS +DGMTVFAPTDNAF NL  GTLN
Sbjct  34   VNLTAILEK-GGQFSSFIHLLNTTQVGNQVNIQLNSSSDGMTVFAPTDNAFQNLKPGTLN  92

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSG  493
             LS + ++ LI YHV PK+Y+ +DL +VSNPVRTQA+G DG  YGLNFTGQ NQVNVS+G
Sbjct  93   HLSIEDQVRLILYHVTPKYYTLDDLLSVSNPVRTQASGRDGGVYGLNFTGQGNQVNVSTG  152

Query  492  AVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGKSNDGKNATA  313
             VET++ N LR+  PLAVY VD+VL+P +   D+    +P   A+S P   S    NAT 
Sbjct  153  VVETRINNALRQQMPLAVYVVDQVLLPDEMFGDNKNKTSP--PAASAPKSSSTGDANATG  210

Query  312  AKEPSP---APNGAGKM-SLELGLVTGILVFCMGLL  217
              + +P     +G+G+M +  LG   G++V C+ L 
Sbjct  211  EPKKTPKSSEKSGSGEMKNGRLGFALGLVVVCLKLF  246



>emb|CDY22308.1| BnaA06g36300D [Brassica napus]
Length=244

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 151/211 (72%), Gaps = 6/211 (3%)
 Frame = -2

Query  849  DIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNK  670
            +I A+L+K GGQF  FI  LNTT+VG+Q+NIQVNS ++GMTVFAPTDNAF NL  GTLNK
Sbjct  39   NITAILEK-GGQFATFIHLLNTTRVGDQINIQVNSSSEGMTVFAPTDNAFQNLKPGTLNK  97

Query  669  LSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGA  490
            LS + ++ LI YHV PKFY+ +DL +VSNPVRTQA+G DG  YGLNFT Q NQVNVS+G 
Sbjct  98   LSYEDQVKLILYHVSPKFYTLDDLLSVSNPVRTQASGRDGAVYGLNFTSQGNQVNVSTGF  157

Query  489  VETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGKSNDGKNATAA  310
            VET+V N LRK+ PLAVY VD VL+P +   ++  + A  G  S++P   S+D + A A 
Sbjct  158  VETRVSNALRKERPLAVYVVDMVLLPEEMFGENKVSPAAPGPKSNSP-DVSDDQEKAGAP  216

Query  309  KEPSPAPNGAGKMSLELGLVTGILVFCMGLL  217
             + S    G+G+M   LGL  G++  C+ L+
Sbjct  217  SDKS----GSGEMKAGLGLALGLVFLCLKLV  243



>gb|KFK42730.1| hypothetical protein AALP_AA1G032300 [Arabis alpina]
Length=247

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 148/215 (69%), Gaps = 9/215 (4%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            +++ A+L+K GGQF  FI  LN TQVG QVNIQVNS ++GMTVFAPTDNAF NL  GTLN
Sbjct  38   INLTAILEK-GGQFTTFIHLLNITQVGAQVNIQVNSSSEGMTVFAPTDNAFQNLKPGTLN  96

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSG  493
            KLS  +++ LI YHV PKFYS +DL +VSNPVRTQA+G D   YGLNFTG  NQVNVS+G
Sbjct  97   KLSSDEQVKLILYHVSPKFYSMDDLLSVSNPVRTQASGRDNGIYGLNFTGTANQVNVSTG  156

Query  492  AVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADH---PAAKAPTGSASSTPAGKSNDGKN  322
             VET+V N LR   PLAVY VD VL+P +   +H   P A AP   AS    G S+D K+
Sbjct  157  YVETRVSNALRDKRPLAVYVVDMVLLPGEMFGEHKLSPVAPAPKSPAS----GVSDDDKS  212

Query  321  ATAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLL  217
               A  PS   +G+G+M + LG   G++V C+  L
Sbjct  213  TKKAAAPSD-KSGSGEMKVGLGFGLGLVVMCLKFL  246



>ref|XP_009101735.1| PREDICTED: fasciclin-like arabinogalactan protein 13 [Brassica 
rapa]
Length=244

 Score =   218 bits (556),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 150/211 (71%), Gaps = 6/211 (3%)
 Frame = -2

Query  849  DIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNK  670
            +I A+L+K GGQF  FI  LNTT+VG+Q+NIQVNS ++GMTVFAPTDNAF NL  GTLNK
Sbjct  39   NITAILEK-GGQFATFIHLLNTTRVGDQINIQVNSSSEGMTVFAPTDNAFQNLKPGTLNK  97

Query  669  LSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGA  490
            LS   ++ LI YHV PKFY+ +DL +VSNPVRTQA+G DG  YGLNFT Q NQVNVS+G 
Sbjct  98   LSYDDQVKLILYHVSPKFYTLDDLLSVSNPVRTQASGRDGAVYGLNFTSQGNQVNVSTGF  157

Query  489  VETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGKSNDGKNATAA  310
            VET+V N LRK+ PLAVY VD VL+P +   ++  + A  G  S++P   S+D + A A 
Sbjct  158  VETRVSNALRKERPLAVYVVDMVLLPEEMFGENKVSPAAPGPKSNSP-DVSDDQEKAGAP  216

Query  309  KEPSPAPNGAGKMSLELGLVTGILVFCMGLL  217
             + S    G+G+M   LGL  G++  C+ L+
Sbjct  217  SDKS----GSGEMKAGLGLALGLVFLCLKLV  243



>ref|XP_010475017.1| PREDICTED: fasciclin-like arabinogalactan protein 9 [Camelina 
sativa]
Length=248

 Score =   218 bits (556),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 148/215 (69%), Gaps = 8/215 (4%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            +++ A+L+K GGQF  FI  LN TQ+G+QVNIQ+NS ++GMTVFAPTDNAF NL  GTLN
Sbjct  38   INLTAILEK-GGQFSTFIHLLNITQIGSQVNIQINSSSEGMTVFAPTDNAFQNLKPGTLN  96

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSG  493
            KLS  +++ LI YHV PKFYS +DL +VSNPVRTQA+G D   YGLN TGQ NQ+NVS+G
Sbjct  97   KLSSDEQVKLILYHVSPKFYSMDDLLSVSNPVRTQASGRDNGVYGLNITGQTNQINVSTG  156

Query  492  AVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADH---PAAKAPTGSASSTPAGKSNDGKN  322
             VET++ N LR+  PLAVY VD VL+P +   +H   P A AP  S SS     S+D   
Sbjct  157  YVETRISNALRQQRPLAVYVVDMVLLPGEMFGEHKLSPIAPAPKKSTSSEV---SDDTTT  213

Query  321  ATAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLL  217
              AA  PS   +G+G+  + LG   G++V C+  L
Sbjct  214  KKAAASPSE-KSGSGEKKVGLGFGLGLVVLCLKFL  247



>ref|XP_010482678.1| PREDICTED: fasciclin-like arabinogalactan protein 9 [Camelina 
sativa]
Length=247

 Score =   218 bits (555),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 148/215 (69%), Gaps = 9/215 (4%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            +++ A+L+K GGQF  FI  LN TQ+G+QVNIQ+NS ++GMTVFAPTDNAF NL  GTLN
Sbjct  38   INLTAILEK-GGQFSTFIHLLNITQIGSQVNIQLNSSSEGMTVFAPTDNAFQNLKPGTLN  96

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSG  493
            KLS  +++ LI YHV PKFYS +DL +VSNPVRTQA+G D   YGLN TGQ NQ+NVS+G
Sbjct  97   KLSSDEQVKLILYHVSPKFYSMDDLLSVSNPVRTQASGRDNGVYGLNITGQTNQINVSTG  156

Query  492  AVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADH---PAAKAPTGSASSTPAGKSNDGKN  322
             VET++ N LR+  PLAVY VD VL+P +   +H   P A AP  S    P+ + +D   
Sbjct  157  YVETRISNALRQQRPLAVYVVDMVLLPGEMFGEHKLSPIAPAPKKS----PSSEVSDDTT  212

Query  321  ATAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLL  217
              AA  PS   +G+G+  + LG   G++V CM  L
Sbjct  213  KKAAASPS-EKSGSGEKKVGLGFGLGLVVLCMKFL  246



>ref|XP_010457404.1| PREDICTED: fasciclin-like arabinogalactan protein 9 [Camelina 
sativa]
Length=248

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 148/215 (69%), Gaps = 8/215 (4%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            +++ A+L+K GGQF  FI  LN TQ+G+QVNIQ+NS ++GMTVFAPTDNAF NL  GTLN
Sbjct  38   INLTAILEK-GGQFSTFIHLLNITQIGSQVNIQLNSSSEGMTVFAPTDNAFQNLKPGTLN  96

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSG  493
            KLS  +++ LI YHV PKFYS +DL +VSNPVRTQA+G D   YGLN TGQ NQ+NVS+G
Sbjct  97   KLSSDEQVKLILYHVSPKFYSMDDLLSVSNPVRTQASGRDNGVYGLNITGQTNQINVSTG  156

Query  492  AVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADH---PAAKAPTGSASSTPAGKSNDGKN  322
             VET++ N LR+  PLAVY VD VL+P +   +H   P A AP  S SS     S+D   
Sbjct  157  YVETRISNALRQQRPLAVYVVDMVLLPGEMFGEHKLSPIAPAPKKSTSSEV---SDDTTT  213

Query  321  ATAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLL  217
              AA  PS   +G+G+  + LG   G++V C+  L
Sbjct  214  KKAAASPSE-KSGSGEKKVGLGFGLGLVVLCLKFL  247



>ref|XP_002892185.1| hypothetical protein ARALYDRAFT_470362 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68444.1| hypothetical protein ARALYDRAFT_470362 [Arabidopsis lyrata subsp. 
lyrata]
Length=247

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 148/215 (69%), Gaps = 9/215 (4%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            +++ A+L+K GGQF  FI  LN TQVG+QVNIQVNS ++GMTVFAPTDNAF NL  GTLN
Sbjct  38   INLTAILEK-GGQFTTFIHLLNITQVGSQVNIQVNSSSEGMTVFAPTDNAFQNLKPGTLN  96

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSG  493
            +L+  +++ LI YHV PKFYS +DL +VSNPVRTQA+G D   YGLNFTGQ NQ+NVS+G
Sbjct  97   QLTPDEQVKLILYHVSPKFYSMDDLLSVSNPVRTQASGRDNGVYGLNFTGQTNQINVSTG  156

Query  492  AVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADH---PAAKAPTGSASSTPAGKSNDGKN  322
             VET+V N LR+  PLAVY VD VL+P +   +H   P A AP     S   G S+D  +
Sbjct  157  YVETRVSNALRQQRPLAVYVVDMVLLPGEMFGEHKLSPIAPAP----KSKSGGVSDDSGS  212

Query  321  ATAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLL  217
               A  PS   +G+G+  + LG   G++V C+  L
Sbjct  213  TKKAASPSDK-SGSGEKKVGLGFGLGLVVLCLKFL  246



>ref|XP_009119354.1| PREDICTED: fasciclin-like arabinogalactan protein 9 [Brassica 
rapa]
 emb|CDX89859.1| BnaA10g02230D [Brassica napus]
Length=250

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/218 (54%), Positives = 146/218 (67%), Gaps = 12/218 (6%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            +++ A+L+K GGQF  FI  L  TQVG QVNIQVNS ++GMTVFAPTDNAF NL +GTLN
Sbjct  38   INLTAILEK-GGQFTTFIHLLKITQVGEQVNIQVNSSSEGMTVFAPTDNAFQNLKAGTLN  96

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSG  493
            KLS  +++ LI YHV PKFY+ +DL +VSNPVRTQA+G D   YGLNFTG+ NQVNVS+G
Sbjct  97   KLSADEQVKLILYHVSPKFYTLDDLLSVSNPVRTQASGRDNGVYGLNFTGEANQVNVSTG  156

Query  492  AVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADH------PAAKAPTGSASSTPAGKSND  331
             VET+V N LR   PLAVY VD VL+P +   +H      PA K+PT   S     KSN 
Sbjct  157  YVETRVSNALRSQRPLAVYVVDMVLLPGEMFGEHKLSPIAPAPKSPTTGVSDDDT-KSNS  215

Query  330  GKNATAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLL  217
             K A A  + S     +G+  + LG   G++V C+  L
Sbjct  216  SKKAAAPADKS----ASGERRVGLGFGFGLVVLCLKFL  249



>ref|XP_006304423.1| hypothetical protein CARUB_v10011002mg [Capsella rubella]
 gb|EOA37321.1| hypothetical protein CARUB_v10011002mg [Capsella rubella]
Length=248

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/216 (54%), Positives = 148/216 (69%), Gaps = 10/216 (5%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            +++ A+L+K GGQF  FI  LN TQ+G+QVNIQ+NS ++GMTVFAPTDNAF NL  GTLN
Sbjct  38   INLTAILEK-GGQFTTFIHLLNITQIGSQVNIQLNSSSEGMTVFAPTDNAFQNLKPGTLN  96

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSG  493
            KLS  +++ LI YHV PK+YS +DL +VSNPVRTQA+G D   YGLN TGQ NQ+NVS+G
Sbjct  97   KLSSDEQVKLILYHVSPKYYSMDDLLSVSNPVRTQASGRDNGVYGLNITGQTNQINVSTG  156

Query  492  AVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADH---PAAKAPTGSASSTPAGKSNDGKN  322
             VET++ N LR+  PLAVY VD VL+P +   +H   P A AP  S SS   G S+D   
Sbjct  157  YVETRISNALRQQRPLAVYVVDMVLLPGEMFGEHKLSPIAPAPKKSPSS---GVSDDEST  213

Query  321  ATAAKEPS-PAPNGAGKMSLELGLVTGILVFCMGLL  217
              AA  PS  + +G  K  L  GL  G++V C+  L
Sbjct  214  KKAAASPSDKSSSGEKKTGLGFGL--GLVVLCLKFL  247



>ref|XP_004287337.1| PREDICTED: fasciclin-like arabinogalactan protein 6-like [Fragaria 
vesca subsp. vesca]
Length=246

 Score =   212 bits (540),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 116/223 (52%), Positives = 157/223 (70%), Gaps = 9/223 (4%)
 Frame = -2

Query  879  APAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAF  700
            APAP+P GP++   +L KAG Q+  F++ L+ TQV  Q+  Q+NS T+G+TVFAPTDNAF
Sbjct  27   APAPAPSGPLNFTGILDKAG-QYTTFLRLLSQTQVATQIQSQLNSTTEGLTVFAPTDNAF  85

Query  699  NNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPD-GKTYGLNFTG  523
             NL +GTLN LS +Q++ L+ YHV+PK+Y+   L TVSNPVRTQ++  + G +YGLNFTG
Sbjct  86   TNLKAGTLNDLSSEQQVQLVLYHVLPKYYTLASLLTVSNPVRTQSSSQNGGGSYGLNFTG  145

Query  522  Q-NNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPA  346
               NQVNVSSGAV TQ+ N LR+  PLAVYQ+DKVL+P D  A+  A+ APT  A+ TPA
Sbjct  146  SGGNQVNVSSGAVTTQINNALRQQFPLAVYQIDKVLLPNDMFAE--ASPAPT--AAKTPA  201

Query  345  GKSNDGKNATAAKEPSPAPNGAGKMSLE--LGLVTGILVFCMG  223
            G +N  K   AA+  +   +G+ K ++   +GL  G+ +F MG
Sbjct  202  GSTNTTKGTVAAEPSTDGTSGSSKTTVGSFVGLALGLALFFMG  244



>gb|KFK31663.1| hypothetical protein AALP_AA6G142700 [Arabis alpina]
Length=250

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/216 (51%), Positives = 146/216 (68%), Gaps = 5/216 (2%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            ++I A+L+K GGQF   I+ LNTTQ+G+Q+NIQ+NS T+GMT+FAPTDNAF NL  GTLN
Sbjct  35   INITAILEK-GGQFVTLIRLLNTTQIGSQINIQINSSTEGMTIFAPTDNAFQNLKPGTLN  93

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPD-GKTYGLNFTGQNNQVNVSS  496
            KLS   ++ LI YHV PKFY+ +DL +VSNPVRTQA+G D G  YGLNFTGQ NQVNVS+
Sbjct  94   KLSSDDQVKLILYHVSPKFYTLDDLLSVSNPVRTQASGRDRGTVYGLNFTGQGNQVNVST  153

Query  495  GAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGKSND---GK  325
            G +ET+V   LR + PLAVY VD VL+P +   +      P  S  +     S+D    +
Sbjct  154  GMIETRVSTALRPERPLAVYVVDMVLLPEEMFGERKIVPVPAPSPQAKSPDVSDDVDSTR  213

Query  324  NATAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLL  217
             A A   P+   +G+G+M + LG   G+++ C+  L
Sbjct  214  KAAAPTRPTSERSGSGEMKVGLGFGLGLVMLCLKFL  249



>ref|NP_563692.1| fasciclin-like arabinogalactan protein 9 [Arabidopsis thaliana]
 sp|Q9ZWA8.1|FLA9_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 9; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAK20861.1|AF333974_1 fasciclin-like arabinogalactan-protein 9 [Arabidopsis thaliana]
 gb|AAD10681.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM65486.1| putative surface protein [Arabidopsis thaliana]
 dbj|BAE99074.1| predicted GPI-anchored protein [Arabidopsis thaliana]
 gb|ACE95181.1| At1g03870 [Arabidopsis thaliana]
 gb|AEE27627.1| fasciclin-like arabinogalactan protein 9 [Arabidopsis thaliana]
Length=247

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 147/215 (68%), Gaps = 9/215 (4%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            +++ A+L+K GGQF  FI  LN TQVG+QVNIQVNS ++GMTVFAPTDNAF NL  GTLN
Sbjct  38   INLTAILEK-GGQFTTFIHLLNITQVGSQVNIQVNSSSEGMTVFAPTDNAFQNLKPGTLN  96

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSG  493
            +LS   ++ LI YHV PK+YS +DL +VSNPVRTQA+G D   YGLNFTGQ NQ+NVS+G
Sbjct  97   QLSPDDQVKLILYHVSPKYYSMDDLLSVSNPVRTQASGRDNGVYGLNFTGQTNQINVSTG  156

Query  492  AVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADH---PAAKAPTGSASSTPAGKSNDGKN  322
             VET++ N LR+  PLAVY VD VL+P +   +H   P A AP     S   G ++D  +
Sbjct  157  YVETRISNSLRQQRPLAVYVVDMVLLPGEMFGEHKLSPIAPAP----KSKSGGVTDDSGS  212

Query  321  ATAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLL  217
               A  PS   +G+G+  + LG   G++V C+  L
Sbjct  213  TKKAASPSDK-SGSGEKKVGLGFGLGLIVLCLKFL  246



>ref|XP_006469071.1| PREDICTED: fasciclin-like arabinogalactan protein 13-like [Citrus 
sinensis]
Length=245

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/228 (52%), Positives = 152/228 (67%), Gaps = 9/228 (4%)
 Frame = -2

Query  888  KAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTD  709
            + QA AP+P GPV++  +L K  GQF  FIK L +TQV NQ+  Q+NS ++GMTVFAPTD
Sbjct  24   QIQAQAPAPAGPVNLTGILDK-NGQFTTFIKLLISTQVANQIQSQINSSSEGMTVFAPTD  82

Query  708  NAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNF  529
            NAFNNL  G LN L +Q+++ L+ YHV  KFY   DL  VSNPVRT A+G D   +GLNF
Sbjct  83   NAFNNLEKGLLNNLDNQKQVQLVLYHVTSKFYRQSDLLLVSNPVRTLASGQD--VWGLNF  140

Query  528  TGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTP  349
            TGQ NQVNVSSG VET + N LR++ PLAVYQVDKVL+P + +A    + AP      + 
Sbjct  141  TGQGNQVNVSSGVVETPINNVLRQNFPLAVYQVDKVLLPEELSAAKSPSAAPAPEGKKST  200

Query  348  AGKSNDGKNATAAKEPSPAPNGAG---KMSLELGLVTGILVFCMGLLS  214
             G +   K   AA EP+PA +  G   +++  LG V G+ + CMG+LS
Sbjct  201  EGSN---KKVPAASEPAPADDNTGAGARLNAGLGFVAGLALLCMGVLS  245



>ref|XP_009113940.1| PREDICTED: fasciclin-like arabinogalactan protein 13 [Brassica 
rapa]
Length=249

 Score =   211 bits (537),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 147/213 (69%), Gaps = 3/213 (1%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            ++I A+L+K GGQF  FI+ LNTTQ+GNQ+NIQVNS ++GMTVFAPTDNAF NL  GTLN
Sbjct  38   INITAILEK-GGQFVTFIRLLNTTQIGNQINIQVNSSSEGMTVFAPTDNAFQNLKPGTLN  96

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPD-GKTYGLNFTGQNNQVNVSS  496
            KLS   ++ LI YHV PKFY+ +DL +VSNPVRTQA G D G  YGLNFTGQ NQVNVS+
Sbjct  97   KLSPDDQVKLILYHVSPKFYTMDDLLSVSNPVRTQATGRDGGAVYGLNFTGQGNQVNVST  156

Query  495  GAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGKSNDGKNAT  316
            G +ET+V N LRK+ PLAVY VD VL+P +    H  +       S +PA   +   ++ 
Sbjct  157  GIIETRVSNALRKERPLAVYVVDMVLLPEEMFGKHKISPVAPSPKSKSPAVSDDSDDSSK  216

Query  315  AAKEPSPAPNGAGKMSLELGLVTGILVFCMGLL  217
             A  PS   +G+G+M + LG   G+++  +  +
Sbjct  217  KAAVPSEK-SGSGEMKVGLGFGLGLVMLYLKFI  248



>gb|ABK78690.1| unknown [Brassica rapa]
Length=250

 Score =   210 bits (535),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 115/218 (53%), Positives = 144/218 (66%), Gaps = 12/218 (6%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            +++ A+L+K GGQF  FI  L   QVG QVNIQVNS ++GMTVFAPTDNAF NL +GTLN
Sbjct  38   INLTAILEK-GGQFNTFIHLLKIIQVGEQVNIQVNSSSEGMTVFAPTDNAFQNLKAGTLN  96

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSG  493
            KLS  +++ LI YHV PK Y+ +DL +VSNPVRTQA+G D   YGLNFTG+ NQVNVS+G
Sbjct  97   KLSADEQVKLILYHVSPKLYTLDDLLSVSNPVRTQASGRDNGVYGLNFTGEANQVNVSTG  156

Query  492  AVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADH------PAAKAPTGSASSTPAGKSND  331
             VET+V N LR   PLAVY VD VL+P +   +H      PA K+PT   S     KSN 
Sbjct  157  YVETRVSNALRSQRPLAVYVVDMVLLPGEMFGEHKLSPIAPAPKSPTTGVSDDDT-KSNS  215

Query  330  GKNATAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLL  217
             K A A  + S     +G+  + LG   G++V C+  L
Sbjct  216  SKKAAAPADKS----ASGERRVGLGFGFGLVVLCLKFL  249



>emb|CDY18192.1| BnaC05g02150D [Brassica napus]
Length=250

 Score =   210 bits (534),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 145/219 (66%), Gaps = 14/219 (6%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            +++ A+L+K GGQF  FI  L  TQVG QVN QVNS ++GMTVFAPTDNAF NL +GTLN
Sbjct  38   INLTAILEK-GGQFTTFIHLLKITQVGEQVNTQVNSSSEGMTVFAPTDNAFQNLKAGTLN  96

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSG  493
            KLS  +++ LI YHV PKFY+ +DL +VSNPVRTQA+G D   YGLNFTG+ NQVNVS+G
Sbjct  97   KLSADEQVKLILYHVSPKFYTLDDLLSVSNPVRTQASGRDNGVYGLNFTGEANQVNVSTG  156

Query  492  AVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADH------PAAKAPTGSASSTPAGKSND  331
             VET+V N LR   PLAVY VD VL+P +   +H      PA K+PT   S       +D
Sbjct  157  YVETRVSNALRTQRPLAVYVVDMVLLPGEMFGEHKLSPIAPAPKSPTTGVS------DDD  210

Query  330  GKNATAAKEPSPAPNGA-GKMSLELGLVTGILVFCMGLL  217
             K+ +  K  +PA   A G+    LG   G++V C+  L
Sbjct  211  TKSNSTKKAAAPADKSASGERRAGLGFGFGLVVLCLKFL  249



>ref|XP_002277788.1| PREDICTED: fasciclin-like arabinogalactan protein 13 [Vitis vinifera]
 emb|CBI21911.3| unnamed protein product [Vitis vinifera]
Length=251

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/231 (53%), Positives = 155/231 (67%), Gaps = 15/231 (6%)
 Frame = -2

Query  888  KAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTD  709
            K  APAPSP   +++  +L K  GQF  FI+ L TTQ+G+Q+  Q+ S T+GMTVFAPTD
Sbjct  28   KPSAPAPSPS-HLNLTGILDK-NGQFKTFIRLLATTQIGDQIKNQLKSSTEGMTVFAPTD  85

Query  708  NAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNF  529
            NAF+NL  GTLN LSDQ+++ LI YHV+ KFYS E L TVSNPVRTQA G DG  +GLNF
Sbjct  86   NAFSNLKPGTLNALSDQEQVQLILYHVLSKFYSLETLLTVSNPVRTQATGQDGGIFGLNF  145

Query  528  TGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTP  349
            TG+ NQVNVS+G +ETQV N LR + PLAVYQVDKVL+PL+     P A  P  + + + 
Sbjct  146  TGEGNQVNVSTGIIETQVNNVLRGESPLAVYQVDKVLLPLELFGAKPPALPPPPAKAPSS  205

Query  348  AGKSNDGKNATA-AKEPSPA------PNGAGKMSLELGLVTGILVFCMGLL  217
            A       NAT  A+EPS +      P+G+G  ++  G   G+ + CMG L
Sbjct  206  A------TNATVIAEEPSASASEKSDPSGSGGRNVGYGFAVGLGLMCMGAL  250



>emb|CAN83422.1| hypothetical protein VITISV_000403 [Vitis vinifera]
Length=251

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 122/231 (53%), Positives = 155/231 (67%), Gaps = 15/231 (6%)
 Frame = -2

Query  888  KAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTD  709
            K  APAPSP   +++  +L K  GQF  FI+ L TTQ+G+Q+  Q+ S T+GMTVFAPTD
Sbjct  28   KPSAPAPSPS-HLNLTGILDK-NGQFKTFIRLLATTQIGDQIKNQLKSSTEGMTVFAPTD  85

Query  708  NAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNF  529
            NAF+NL  GTLN LSDQ+++ LI YHV+ KFYS E L TVSNPVRTQA G DG  +GLNF
Sbjct  86   NAFSNLKPGTLNALSDQEQVQLILYHVLSKFYSLETLLTVSNPVRTQATGQDGGIFGLNF  145

Query  528  TGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTP  349
            TG+ NQVNVS+G +ETQV N LR + PLAVYQVDKVL+PL+     P A  P  + + + 
Sbjct  146  TGEGNQVNVSTGIIETQVNNVLRGESPLAVYQVDKVLLPLELFGAKPPALPPPPAKAPSS  205

Query  348  AGKSNDGKNATA-AKEPSPA------PNGAGKMSLELGLVTGILVFCMGLL  217
            A       NAT  A+EPS +      P+G+G  ++  G   G+ + CMG L
Sbjct  206  A------XNATVIAEEPSASASEKSDPSGSGGRNVGYGXAVGLGLMCMGAL  250



>gb|KDO49564.1| hypothetical protein CISIN_1g025959mg [Citrus sinensis]
Length=245

 Score =   207 bits (528),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 117/228 (51%), Positives = 151/228 (66%), Gaps = 9/228 (4%)
 Frame = -2

Query  888  KAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTD  709
            + QA AP+P GPV++  +L K  GQF  FIK L +TQV NQ+  Q+NS ++GMTVFAPTD
Sbjct  24   QIQAQAPAPAGPVNLTGILDK-NGQFTTFIKLLISTQVANQIQSQINSSSEGMTVFAPTD  82

Query  708  NAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNF  529
            NAFNNL  G LN L +Q+++ L+ YHV  KFY   DL  VSNPVRT A+G D   +GLNF
Sbjct  83   NAFNNLEKGLLNNLDNQKQVQLVLYHVTSKFYRQSDLLLVSNPVRTLASGQD--VWGLNF  140

Query  528  TGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTP  349
            TGQ NQVNVSSG VET + + LR++ PLAVYQVDKVL+P + +A    + AP        
Sbjct  141  TGQGNQVNVSSGVVETPINSVLRQNFPLAVYQVDKVLLPEELSAAKSPSAAPAPEGKKPT  200

Query  348  AGKSNDGKNATAAKEPSPAPN---GAGKMSLELGLVTGILVFCMGLLS  214
             G +   K   AA EP+PA +     G+++  LG V G+ + CMG+LS
Sbjct  201  EGSN---KKVPAASEPAPADDKTGAGGRLNAGLGFVVGLALLCMGVLS  245



>ref|XP_010489025.1| PREDICTED: fasciclin-like arabinogalactan protein 6 [Camelina 
sativa]
Length=250

 Score =   207 bits (528),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 114/250 (46%), Positives = 160/250 (64%), Gaps = 11/250 (4%)
 Frame = -2

Query  951  MAKAAVSFIVLSFLLVGLAEVKAQAPAPSPG---GPVDIFAVLKKAGGQFGIFIKFLNTT  781
            M+ +  S++VL FL   +  +++Q  AP+P     P+++ A+L+  G QF  F++ LNTT
Sbjct  1    MSSSIYSYVVLFFLFSIVPYIQSQPIAPAPTTETSPINLTAILE-TGHQFTTFMRLLNTT  59

Query  780  QVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFED  601
            QVG QV++Q+NS   GMT+FAPTDNAFNNL  GTLN L+ QQ+I L+ YH+IPK+YS  D
Sbjct  60   QVGFQVSVQLNSSDQGMTIFAPTDNAFNNLKPGTLNGLTYQQQIQLMLYHIIPKYYSLSD  119

Query  600  LQTVSNPVRTQANGPDGKTYGLNFTG--QNNQVNVSSGAVETQVYNPLRKDPPLAVYQVD  427
            L   SNPVRTQA G +G  +GLNFTG  Q+NQVNVS+G VET++ N LR+  PL +Y VD
Sbjct  120  LLLASNPVRTQATGQEGGVFGLNFTGQAQSNQVNVSTGVVETRISNALRQQFPLGIYVVD  179

Query  426  KVLVPLDFTADHPAAKAPTGSASSTPAGKSNDGKNATAAKEPSPAPNGAGKMSLELGLVT  247
            KVL+P +          PTG+ +  P   S D  +    +E   + +   + S  LG+V 
Sbjct  180  KVLLPEELFG---TKNTPTGAPAPKPITSSPDADSPAVDEEHKSSGSSVKRTS--LGVVL  234

Query  246  GILVFCMGLL  217
            G + FC  ++
Sbjct  235  GFVWFCCSVI  244



>ref|XP_008242761.1| PREDICTED: fasciclin-like arabinogalactan protein 13 [Prunus 
mume]
Length=249

 Score =   207 bits (528),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 119/236 (50%), Positives = 154/236 (65%), Gaps = 6/236 (3%)
 Frame = -2

Query  921  LSFLLVGLAEVKAQ-APAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNS  745
             SFLL+     +AQ APAP P GP++   +L K  GQ+  FI+ L  TQV +Q+  Q+NS
Sbjct  13   FSFLLLFTPHTQAQTAPAPGPTGPLNFTGILDK-NGQYTTFIRLLIQTQVASQITNQLNS  71

Query  744  PTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQA  565
             T+G+TVFAPTDNAF +L +GTLN L  QQ++ ++ YHV+PK+Y+   L TVSNPVRTQA
Sbjct  72   STEGLTVFAPTDNAFTSLKAGTLNNLRTQQQVAVVLYHVLPKYYTLTSLLTVSNPVRTQA  131

Query  564  NGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPA  385
             G DG  YGLNFTG  NQVNVSSG VETQ+ N LR+  PLAVYQVDKVL+P D       
Sbjct  132  TGQDGGAYGLNFTGSGNQVNVSSGVVETQINNALRQQFPLAVYQVDKVLLPNDLFGAKAP  191

Query  384  AKAPTGSASSTPAGKSNDGKNATAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLL  217
            A AP  + + + +G SN+     A+   SP  + AG +    G + G++   MGLL
Sbjct  192  ASAPPPAKTHSSSGSSNETATKAAS---SPDNSDAGSIKSNAGFM-GLVFGMMGLL  243



>ref|XP_006299820.1| hypothetical protein CARUB_v10016021mg [Capsella rubella]
 gb|EOA32718.1| hypothetical protein CARUB_v10016021mg [Capsella rubella]
Length=246

 Score =   207 bits (528),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 113/246 (46%), Positives = 154/246 (63%), Gaps = 8/246 (3%)
 Frame = -2

Query  951  MAKAAVSFIVLSFLLVGLAEVKAQAPAPSP---GGPVDIFAVLKKAGGQFGIFIKFLNTT  781
            M+ +  S++VL F +  +  +++Q  AP+P     P+     + ++G QF  FI+ LNTT
Sbjct  1    MSSSIYSYVVLFFFISIVPNIQSQPIAPAPTTESSPMINLTAILESGHQFTTFIRLLNTT  60

Query  780  QVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFED  601
            QVG QV++Q+NS   GMT+FAPTDNAFNNL  GTLN L+ QQ+I L+ YH+IPK+YS  D
Sbjct  61   QVGFQVSVQLNSSDQGMTIFAPTDNAFNNLKPGTLNGLTYQQQIQLMLYHIIPKYYSLSD  120

Query  600  LQTVSNPVRTQANGPDGKTYGLNFTG--QNNQVNVSSGAVETQVYNPLRKDPPLAVYQVD  427
            L   SNP+RTQA G +G  YGLNFTG  QNNQVNVS+G VET++ N LR+  PLAVY VD
Sbjct  121  LLLASNPIRTQATGHEGGVYGLNFTGQAQNNQVNVSTGVVETRINNALRQQFPLAVYVVD  180

Query  426  KVLVPLDFTADHPAAKAPTGSASSTPAGKSNDGKNATAAKEPSPAPNGAGKMSLELGLVT  247
            KVL+P +          PTG+ S      S    ++ A  +     +G+      LG++ 
Sbjct  181  KVLLPEELFG---TKTTPTGAPSPKSTPSSTSDADSPAVDDDEHKSSGSSAKMTSLGVIL  237

Query  246  GILVFC  229
            G  +FC
Sbjct  238  GFALFC  243



>ref|XP_010415601.1| PREDICTED: fasciclin-like arabinogalactan protein 6 [Camelina 
sativa]
Length=248

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/249 (46%), Positives = 160/249 (64%), Gaps = 10/249 (4%)
 Frame = -2

Query  951  MAKAAVSFIVLSFLLVGLAEVKAQAPAPSPG---GPVDIFAVLKKAGGQFGIFIKFLNTT  781
            M+ +  S++VL FL   +  +++Q  AP+P     P+++ A+L+ +G QF  F++ LNTT
Sbjct  1    MSSSIYSYVVLFFLFSIVPYIQSQPIAPAPTTETSPINLTAILE-SGHQFTTFMRLLNTT  59

Query  780  QVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFED  601
            QVG QV++Q+NS   GMT+FAPTDNAFNNL  GTLN L+ QQ+I L+ YH+IPK+YS  D
Sbjct  60   QVGFQVSVQLNSSDQGMTIFAPTDNAFNNLKPGTLNGLTYQQQIQLMLYHIIPKYYSLSD  119

Query  600  LQTVSNPVRTQANGPDGKTYGLNFTG--QNNQVNVSSGAVETQVYNPLRKDPPLAVYQVD  427
            L   SNPVRTQA G +G  +GLNFTG  Q+NQVNVS+G VET++ N LR+  PLA+Y VD
Sbjct  120  LLLASNPVRTQATGQEGGVFGLNFTGEAQSNQVNVSTGVVETRINNALRQQFPLAIYVVD  179

Query  426  KVLVPLDFTADHPAAKAPTGSASSTPAGKSNDGKNATAAKEPSPAPNGAGKMSLELGLVT  247
            KVL+P +          PTG+ +      S D  + +   E   + +G+      LG+V 
Sbjct  180  KVLLPEELFG---TKTTPTGAPAPKSITSSPDADSPSVVDEEHKS-SGSNVKRTSLGVVL  235

Query  246  GILVFCMGL  220
            G + FC  +
Sbjct  236  GFVWFCCSV  244



>emb|CDY13122.1| BnaA09g16950D [Brassica napus]
Length=250

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/213 (51%), Positives = 144/213 (68%), Gaps = 2/213 (1%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            ++I A+L+K GGQF  FI+ LNTTQ+GNQ+NIQVNS ++GMTVFAPTDNAF NL  G LN
Sbjct  38   INITAILEK-GGQFVTFIRLLNTTQIGNQINIQVNSSSEGMTVFAPTDNAFQNLKPGALN  96

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPD-GKTYGLNFTGQNNQVNVSS  496
            KLS   ++ LI YHV PKFY+ +DL +VSNPVRTQA G D G  YGLNFTGQ NQVNVS+
Sbjct  97   KLSPDDQVKLILYHVSPKFYTMDDLLSVSNPVRTQATGRDGGAVYGLNFTGQGNQVNVST  156

Query  495  GAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGKSNDGKNAT  316
            G +ET+V N LRK+ PLAVY VD VL+P +    H  +       S +PA   +   +++
Sbjct  157  GIIETRVSNALRKERPLAVYVVDMVLLPEEMFGKHKISPVAPSPKSKSPAVSDDSSDDSS  216

Query  315  AAKEPSPAPNGAGKMSLELGLVTGILVFCMGLL  217
                     +G+G+M + LG   G+++  +  +
Sbjct  217  KKAAVPSEKSGSGEMKVGLGFGLGLVMLYLKFI  249



>ref|XP_006403136.1| hypothetical protein EUTSA_v10003262mg [Eutrema salsugineum]
 gb|ESQ44589.1| hypothetical protein EUTSA_v10003262mg [Eutrema salsugineum]
Length=254

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 143/196 (73%), Gaps = 4/196 (2%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            +++ A+L+K GGQF  F + LNTTQ+GNQ+NIQVNS ++GMTVFAPTDNAF NL  GTLN
Sbjct  42   INVTAILEK-GGQFVTFTRLLNTTQIGNQINIQVNSSSEGMTVFAPTDNAFQNLKPGTLN  100

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPD-GKTYGLNFTGQNNQVNVSS  496
            KLS   ++ LI YHV PKFY+ +DL +VSNPVRTQA+G D G  YGLNFTGQ NQVNVS+
Sbjct  101  KLSPDDQVKLILYHVSPKFYTLDDLLSVSNPVRTQASGRDAGAIYGLNFTGQGNQVNVST  160

Query  495  GAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGKSNDGKNAT  316
            G +ET+V N L K+ PLAVY VD VL+P +   +   +    G  S +P G S+D ++ +
Sbjct  161  GVIETRVSNALSKERPLAVYVVDMVLLPEEMFGERKISPVAPGPKSKSP-GVSDDSEDES  219

Query  315  AAKEPSPAP-NGAGKM  271
            + K  +P+  +G+G+M
Sbjct  220  SKKAAAPSEKSGSGEM  235



>ref|XP_010467804.1| PREDICTED: fasciclin-like arabinogalactan protein 6 [Camelina 
sativa]
Length=253

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/250 (46%), Positives = 157/250 (63%), Gaps = 11/250 (4%)
 Frame = -2

Query  951  MAKAAVSFIVLSFLLVGLAEVKAQAPAPSPG---GPVDIFAVLKKAGGQFGIFIKFLNTT  781
            M+ +  S++VL FL   +  +++Q  AP+P     P++  AVL+  G QF  F++ LNTT
Sbjct  1    MSSSIYSYVVLFFLFSIVPYIQSQPIAPAPTTETSPINFTAVLE-TGHQFTTFMRLLNTT  59

Query  780  QVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFED  601
            QVG QV++Q+NS   GMT+FA TDNAFNNL  GTLN L+ QQ+I L+ YH+IPK+YS  D
Sbjct  60   QVGFQVSVQLNSSDQGMTIFALTDNAFNNLKPGTLNGLTYQQQIQLMLYHIIPKYYSLSD  119

Query  600  LQTVSNPVRTQANGPDGKTYGLNFTG--QNNQVNVSSGAVETQVYNPLRKDPPLAVYQVD  427
            L   SNPVRTQA G +G  +GLNFTG  Q+NQVNVS+G VET++ N LR+  PLA+Y VD
Sbjct  120  LLLASNPVRTQATGQEGGVFGLNFTGQAQSNQVNVSTGVVETRINNALRQQFPLAIYVVD  179

Query  426  KVLVPLDFTADHPAAKAPTGSASSTPAGKSNDGKNATAAKEPSPAPNGAGKMSLELGLVT  247
            KVL+P +          PTG+ +      S D  +    KE   + +   + S  LG+V 
Sbjct  180  KVLLPEELFG---TKTTPTGAPAPKSITSSPDADSPAVDKEHKSSGSNVKRTS--LGVVL  234

Query  246  GILVFCMGLL  217
            G + FC   +
Sbjct  235  GFIWFCYSFI  244



>ref|XP_009368837.1| PREDICTED: fasciclin-like arabinogalactan protein 13 [Pyrus x 
bretschneideri]
Length=247

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 147/218 (67%), Gaps = 5/218 (2%)
 Frame = -2

Query  900  LAEVKAQ-APAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTV  724
            ++  +AQ APA  P GP+++  +L K  GQ+  FI+ L +TQV NQ+  Q+NS T+G+TV
Sbjct  21   ISHTQAQTAPAQGPAGPLNLTGLLDK-NGQYSTFIRLLISTQVANQITNQLNSSTEGLTV  79

Query  723  FAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKT  544
            FAPTDNAF+NL +GTLN L  QQ++ L+ YHV+PK+Y+   L TVSNPVRTQA G DG  
Sbjct  80   FAPTDNAFDNLKAGTLNNLDTQQQVSLVLYHVLPKYYTLASLLTVSNPVRTQATGQDGGA  139

Query  543  YGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGS  364
            YGLNFTG  NQVNVS+G VETQ+ N LR+  PLAVYQVDKVL+P D       A AP  S
Sbjct  140  YGLNFTGSGNQVNVSTGIVETQINNALRQQFPLAVYQVDKVLLPSDLFGAKAPASAPPPS  199

Query  363  ASSTPAGKSNDGKNATAAKEPSPAPNGAGKMSLELGLV  250
             + + +G +N+    T     SP  +GAG +   +G +
Sbjct  200  KAHSGSGSTNE---TTIKPASSPHNSGAGSIVSNVGFM  234



>ref|XP_010093970.1| hypothetical protein L484_010536 [Morus notabilis]
 gb|EXB54957.1| hypothetical protein L484_010536 [Morus notabilis]
Length=243

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 115/223 (52%), Positives = 151/223 (68%), Gaps = 7/223 (3%)
 Frame = -2

Query  882  QAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNA  703
            +APAPS  GPV++ A+L K GGQ+   ++ L+ TQV NQ+  Q+NS  +GMTVFAPTDNA
Sbjct  28   EAPAPS-SGPVNLTAILVK-GGQYTTLLRLLSETQVDNQIENQLNSSKEGMTVFAPTDNA  85

Query  702  FNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTG  523
            FNNL +GTLN LS + ++ LI YHV+PK+YS E+LQTVSNPVRTQ++       GLNFTG
Sbjct  86   FNNLKAGTLNGLSREDQVQLILYHVLPKYYSLENLQTVSNPVRTQSSND-----GLNFTG  140

Query  522  QNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAG  343
            Q +QVNVS+G VETQV N LR++ PLAVYQVD VL+P         A AP  + S+    
Sbjct  141  QGHQVNVSTGIVETQVNNALREEFPLAVYQVDAVLLPEGLFGAKAPASAPPPAKSTPADS  200

Query  342  KSNDGKNATAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLLS  214
             S+  K   AA     +   + K ++ LGLV G+++ CM +LS
Sbjct  201  ASDKAKTKAAAPSAKDSTGDSNKRNVGLGLVAGLVLVCMEVLS  243



>ref|XP_006376379.1| hypothetical protein POPTR_0013s12490g [Populus trichocarpa]
 gb|ERP54176.1| hypothetical protein POPTR_0013s12490g [Populus trichocarpa]
Length=238

 Score =   202 bits (514),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 153/222 (69%), Gaps = 10/222 (5%)
 Frame = -2

Query  879  APAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAF  700
            APAP+P GPV+  AVL K GGQF   I+ LN TQ  NQ+  Q+NS ++GMT+FAPTDNAF
Sbjct  27   APAPTPSGPVNFTAVLVK-GGQFATLIRLLNNTQTLNQIENQLNSSSEGMTIFAPTDNAF  85

Query  699  NNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQ  520
            NNL +G LN L+ Q+++ L+QYH +PKFY+  +L  VSNPV TQA+G DG  +GLNFTGQ
Sbjct  86   NNLKAGALNGLNQQEQVQLLQYHTLPKFYTMSNLLLVSNPVPTQASGQDG-VWGLNFTGQ  144

Query  519  NNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGK  340
            +NQVNVS+G VE Q+ N LR+D PLAVY VDKVL+P     +      P  ++   P+ K
Sbjct  145  SNQVNVSTGLVEVQINNALRQDSPLAVYPVDKVLLP-----EALFGVKPPTASPPAPSSK  199

Query  339  SNDGKNATAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLLS  214
            SN      AA EPS   N AG  ++ LGLV G+ + CMG+LS
Sbjct  200  SNS---TVAAAEPSTGKNSAGGRNVALGLVVGLGLVCMGILS  238



>ref|XP_002517840.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44358.1| conserved hypothetical protein [Ricinus communis]
Length=246

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 110/217 (51%), Positives = 145/217 (67%), Gaps = 6/217 (3%)
 Frame = -2

Query  858  GPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGT  679
            GP+++  +L K  GQF  FI+ L +TQV  Q+  Q+NS T+G TVFAPTDNAFNNL +GT
Sbjct  34   GPLNVTGILDK-NGQFTTFIRLLTSTQVATQLENQLNSTTEGFTVFAPTDNAFNNLKAGT  92

Query  678  LNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVS  499
            LN LS QQ++ L+  H+ PKFY+  +L  V NPVRTQA G DG  +GLNFTGQ NQVNVS
Sbjct  93   LNDLSTQQQVQLVLAHITPKFYTLSNLLLVPNPVRTQATGQDGGVFGLNFTGQANQVNVS  152

Query  498  SGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGKSNDGKNA  319
            +G VETQ+ N +R+  PLA+YQVDKVL+P +     P   +P   A ++  G S   KN 
Sbjct  153  TGIVETQINNAIRQQFPLALYQVDKVLLPEELFGVKPPTASPAPPAKTSSGGSS---KND  209

Query  318  TAAKEPSP--APNGAGKMSLELGLVTGILVFCMGLLS  214
            T A EPS     +G  + ++ LG V G+ + CMG++S
Sbjct  210  TVASEPSSDKGTSGGVRTNVALGFVIGLGLACMGVIS  246



>gb|KDP24065.1| hypothetical protein JCGZ_25722 [Jatropha curcas]
Length=249

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 146/216 (68%), Gaps = 4/216 (2%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            V++  +L K   QF  FI+ L +TQV NQ+  Q+NS T+GMT+FAPTDNAFNNL +GTLN
Sbjct  35   VNLTGILAKYS-QFTTFIRLLTSTQVANQIENQINSSTEGMTLFAPTDNAFNNLKAGTLN  93

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSG  493
             L+ QQ++ LI YHV+PKFY+  +L  VSNPVRT A G DG  +GLNFTGQ+NQVNVSSG
Sbjct  94   GLTQQQQLQLILYHVLPKFYTLSNLLLVSNPVRTLATGQDGSVFGLNFTGQSNQVNVSSG  153

Query  492  AVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGKSND---GKN  322
             VETQ+ N LR+D PLAVYQVDKVL+P +   D  +  AP  ++ ++P G  N+   G  
Sbjct  154  VVETQINNALRQDFPLAVYQVDKVLLPEELFGDKTSTAAPAPTSKTSPGGSKNNTVVGSP  213

Query  321  ATAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLLS  214
            + A   P  + N   +  +  G   G+  FCMG+L+
Sbjct  214  SLADDSPGDSSNDGKRSEVAFGFAVGLGFFCMGILA  249



>ref|XP_007203478.1| hypothetical protein PRUPE_ppa022313mg [Prunus persica]
 gb|EMJ04677.1| hypothetical protein PRUPE_ppa022313mg [Prunus persica]
Length=249

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 127/174 (73%), Gaps = 2/174 (1%)
 Frame = -2

Query  921  LSFLLVGLAEVKAQ-APAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNS  745
             SFLL+     +AQ APAP P GP++   +L K  GQ+  FI+ L  TQV +Q+  Q+NS
Sbjct  13   FSFLLLFTPTTQAQTAPAPGPAGPLNFTGILDK-NGQYTTFIRLLIQTQVASQITNQLNS  71

Query  744  PTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQA  565
             ++G+TVFAPTDNAF +L +GTLN L+ QQ++ L+ YHV+PK+Y+   L TVSNPVRTQA
Sbjct  72   SSEGLTVFAPTDNAFTSLKAGTLNTLTTQQQVALVLYHVLPKYYTITSLLTVSNPVRTQA  131

Query  564  NGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
             G DG  YGLNFTG  NQVNVSSG VETQ+ N LR+  PLAVYQVDKVL+P D 
Sbjct  132  TGQDGGAYGLNFTGSGNQVNVSSGVVETQINNALRQQFPLAVYQVDKVLLPNDL  185



>ref|XP_006281682.1| hypothetical protein CARUB_v10027821mg [Capsella rubella]
 gb|EOA14580.1| hypothetical protein CARUB_v10027821mg [Capsella rubella]
Length=254

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 143/214 (67%), Gaps = 3/214 (1%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            ++I A+L+K GGQF  FI+ LNTTQ+G+Q+NIQ+NS ++GMTV APTDNAF NL  GTLN
Sbjct  41   INITAILEK-GGQFVTFIRLLNTTQIGSQINIQINSSSEGMTVLAPTDNAFQNLKPGTLN  99

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPD-GKTYGLNFTGQNNQVNVSS  496
            KLS   ++ LI YHV PK+Y+ EDL +VSNPVRTQA+G D G  YGLNFTGQ NQVNVS+
Sbjct  100  KLSPDDQVKLILYHVSPKYYTLEDLLSVSNPVRTQASGRDVGGVYGLNFTGQGNQVNVST  159

Query  495  GAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAK-APTGSASSTPAGKSNDGKNA  319
            G VET++   LR+  PLAVY VD VL+P +   +   +  AP    S +P    +   N+
Sbjct  160  GIVETRLSTSLRQQRPLAVYVVDMVLLPEEMFGERKISPVAPPPKKSKSPDVSDDLDTNS  219

Query  318  TAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLL  217
            T    P    +G+ +M   LG   G++V  +  L
Sbjct  220  TKKAAPPTEKSGSCEMKSGLGFGLGLVVLTLKFL  253



>ref|XP_010245565.1| PREDICTED: fasciclin-like arabinogalactan protein 13 [Nelumbo 
nucifera]
Length=253

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 111/217 (51%), Positives = 148/217 (68%), Gaps = 6/217 (3%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            +++ A+L K GGQ+  FI+ L +TQV NQ+  Q+NS T G+TVFAPTDNAF+NL +GTLN
Sbjct  39   INLTAILDK-GGQYTTFIRLLGSTQVINQIENQLNSSTQGLTVFAPTDNAFSNLKAGTLN  97

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSG  493
             LS Q +  LI YHV+P++ S    QT+SNPVRTQA G +G + GLNFT   NQVNVS+G
Sbjct  98   GLSAQDQSELILYHVLPQYQSMVSFQTISNPVRTQA-GSEGGSLGLNFTSSGNQVNVSTG  156

Query  492  AVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKA--PTGSASSTPAGKSNDGKNA  319
             V TQV N LR+DPPLAVYQ+DKVL+P +       A A  P+ + S   + K++    A
Sbjct  157  LVNTQVNNALRQDPPLAVYQIDKVLLPPELFGVKSKASAPQPSKTPSDASSNKTSPATVA  216

Query  318  TAAKEPSPAPNGAGK--MSLELGLVTGILVFCMGLLS  214
            ++AK PS A   +G   +++ LGLV GI + C+G LS
Sbjct  217  SSAKGPSSADESSGSNGLTVGLGLVVGIGLMCLGFLS  253



>ref|NP_199226.1| fasciclin-like arabinogalactan protein 13 [Arabidopsis thaliana]
 sp|Q9FFH6.1|FLA13_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 13; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAB10980.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL25613.1| AT5g44130/MLN1_5 [Arabidopsis thaliana]
 gb|AAM19981.1| AT5g44130/MLN1_5 [Arabidopsis thaliana]
 gb|AAN60268.1| unknown [Arabidopsis thaliana]
 gb|AED95065.1| fasciclin-like arabinogalactan protein 13 [Arabidopsis thaliana]
Length=247

 Score =   199 bits (507),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 150/214 (70%), Gaps = 4/214 (2%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            ++I A+L+K GGQF   I+ LNTTQ+GNQ+NIQ+NS ++GMTV APTDNAF NL  GTLN
Sbjct  35   INITAILEK-GGQFVTLIRLLNTTQIGNQINIQINSSSEGMTVLAPTDNAFQNLKPGTLN  93

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPD-GKTYGLNFTGQNNQVNVSS  496
            KLS   ++ LI YHV PKFY+ EDL +VSNPVRTQA+G D G  YGLNFTGQ NQVNVS+
Sbjct  94   KLSPDDQVKLILYHVSPKFYTLEDLLSVSNPVRTQASGRDVGGVYGLNFTGQGNQVNVST  153

Query  495  GAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGKSNDGKNAT  316
            G VET++   LR++ PLAVY VD VL+P +   +   +       S +P   S+D +++ 
Sbjct  154  GVVETRLSTSLRQERPLAVYVVDMVLLPEEMFGERKISPMAPPPKSKSP-DVSDDSESSK  212

Query  315  AAKEPSPAP-NGAGKMSLELGLVTGILVFCMGLL  217
             A  PS +  +G+G+M+  LGL  G++V C+  L
Sbjct  213  KAAAPSESEKSGSGEMNTGLGLGLGLVVLCLKFL  246



>ref|XP_002865383.1| hypothetical protein ARALYDRAFT_494579 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41642.1| hypothetical protein ARALYDRAFT_494579 [Arabidopsis lyrata subsp. 
lyrata]
Length=247

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/216 (50%), Positives = 145/216 (67%), Gaps = 8/216 (4%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            ++I A+L+K GGQF   I+ LNTTQ+GNQ+NIQ+NS ++GMTV APTDNAF NL  GTLN
Sbjct  35   INITAILEK-GGQFVTLIRLLNTTQIGNQINIQINSSSEGMTVLAPTDNAFQNLKPGTLN  93

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPD-GKTYGLNFTGQNNQVNVSS  496
            KLS + ++ LI YHV PKFY+ EDL +VSNPV TQA+G D G  YGLNFTGQ NQVNVS+
Sbjct  94   KLSPEDQVKLILYHVSPKFYTLEDLLSVSNPVSTQASGRDAGGVYGLNFTGQGNQVNVST  153

Query  495  GAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADH---PAAKAPTGSASSTPAGKSNDGK  325
            G VET++   LR++ PLAVY VD VL+P +   +    P A  P   +        +  K
Sbjct  154  GIVETRLSTSLRQERPLAVYVVDMVLLPEEMFGERKISPVAPPPKSKSPDVSDDSDSSKK  213

Query  324  NATAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLL  217
             A+ ++      +G+G+M+  LG   G++V C+  L
Sbjct  214  TASPSQSEK---SGSGEMNTGLGFGLGLVVLCLKFL  246



>ref|NP_565475.1| fasciclin-like arabinogalactan protein 6 [Arabidopsis thaliana]
 sp|Q9SIL7.2|FLA6_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 6; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAK20859.1|AF333972_1 fasciclin-like arabinogalactan-protein 6 [Arabidopsis thaliana]
 gb|AAD25652.2| putative surface protein [Arabidopsis thaliana]
 gb|AEC07022.1| fasciclin-like arabinogalactan protein 6 [Arabidopsis thaliana]
Length=247

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 115/250 (46%), Positives = 158/250 (63%), Gaps = 11/250 (4%)
 Frame = -2

Query  951  MAKAAVSFIVLSFLLVGLAEVKAQAPAPSP---GGPVDIFAVLKKAGGQFGIFIKFLNTT  781
            M+ +  S++VL   L  +  +++Q  AP+P     P+++ A+L+ AG QF   I+ LNTT
Sbjct  1    MSSSLFSYVVLLIFLFTIPYIQSQPTAPAPTTEKSPINLTAILE-AGHQFTTLIQLLNTT  59

Query  780  QVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFED  601
            QVG QV++Q+NS   GMT+FAPTDNAFN L  GTLN L+ QQ+I L+ YH+IPK+YS  D
Sbjct  60   QVGFQVSVQLNSSDQGMTIFAPTDNAFNKLKPGTLNSLTYQQQIQLMLYHIIPKYYSLSD  119

Query  600  LQTVSNPVRTQANGPDGKTYGLNFTG--QNNQVNVSSGAVETQVYNPLRKDPPLAVYQVD  427
            L   SNPVRTQA G DG  +GLNFTG  Q+NQVNVS+G VET++ N LR+  PLAVY VD
Sbjct  120  LLLASNPVRTQATGQDGGVFGLNFTGQAQSNQVNVSTGVVETRINNALRQQFPLAVYVVD  179

Query  426  KVLVPLDFTADHPAAKAPTGSASSTPAGKSNDGKNATAAKEPSPAPNGAGKMSLELGLVT  247
             VL+P +          PTG+ +   +  S+D  +  A  E   A +   + S  LG+V 
Sbjct  180  SVLLPEELFG---TKTTPTGAPAPKSSTSSSDADSPAADDEHKSAGSSVKRTS--LGIVV  234

Query  246  GILVFCMGLL  217
               +FC  ++
Sbjct  235  SFALFCCSVI  244



>ref|XP_008367860.1| PREDICTED: LOW QUALITY PROTEIN: fasciclin-like arabinogalactan 
protein 9, partial [Malus domestica]
Length=244

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 142/210 (68%), Gaps = 5/210 (2%)
 Frame = -2

Query  876  PAP-SPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAF  700
            P P +P GP++   +L K  GQ+  FI+ L +TQV NQ+  Q+NS T+G+TVFAPTDNAF
Sbjct  26   PCPQAPAGPLNFTGLLDK-NGQYSTFIRLLISTQVANQITNQLNSSTEGLTVFAPTDNAF  84

Query  699  NNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQ  520
            +NL +GTLN L  QQ++ L+ YHV+PK+Y+   L TVSNPVRTQA G DG TYGLNFTG 
Sbjct  85   DNLKAGTLNSLDTQQQVALVLYHVLPKYYTLASLLTVSNPVRTQATGQDGGTYGLNFTGS  144

Query  519  NNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGK  340
             NQVNVS+G VETQ+ N LR+  PLAVYQVDKVL+P D         AP  S +++ +G 
Sbjct  145  GNQVNVSTGIVETQINNALRQQFPLAVYQVDKVLLPYDLFGAKAPXSAPPPSKANSGSGS  204

Query  339  SNDGKNATAAKEPSPAPNGAGKMSLELGLV  250
            +N+    T     SP  +GAG +   +G +
Sbjct  205  ANE---TTIKPASSPDNSGAGSVLSNVGFM  231



>ref|XP_010494416.1| PREDICTED: fasciclin-like arabinogalactan protein 13 [Camelina 
sativa]
Length=251

 Score =   197 bits (501),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 147/216 (68%), Gaps = 9/216 (4%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            ++I A+L+K GGQF  FI+ LNTTQ+G+Q+NIQ+NS ++GMTV APTDNAF NL  GTLN
Sbjct  40   INITAILEK-GGQFVTFIRLLNTTQIGSQINIQLNSSSEGMTVLAPTDNAFQNLKPGTLN  98

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPD-GKTYGLNFTGQNNQVNVSS  496
            KLS   ++ LI YHV PKFY+ EDL +VSNPVRTQA+G D G  YGLNFTGQ NQVNVS+
Sbjct  99   KLSPDDQVKLILYHVSPKFYTLEDLLSVSNPVRTQASGRDVGGVYGLNFTGQGNQVNVST  158

Query  495  GAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADH---PAAKAPTGSASSTPAGKSNDGK  325
            G VET++   LR++ PLAVY VD VL+P +   +    P A AP  S S   +  S+  K
Sbjct  159  GIVETRLSTSLRQERPLAVYVVDMVLLPEEMFGERKASPVAPAPKKSKSPDVSDDSDSSK  218

Query  324  NATAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLL  217
             A A  E S    G+G+M   LG   G++V  +  L
Sbjct  219  KAAAPTEKS----GSGEMKSGLGFGLGLVVLSLKFL  250



>ref|XP_002884207.1| hypothetical protein ARALYDRAFT_480881 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60466.1| hypothetical protein ARALYDRAFT_480881 [Arabidopsis lyrata subsp. 
lyrata]
Length=247

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 111/250 (44%), Positives = 155/250 (62%), Gaps = 11/250 (4%)
 Frame = -2

Query  951  MAKAAVSFIVLSFLLVGLAEVKAQAPAPSPG---GPVDIFAVLKKAGGQFGIFIKFLNTT  781
            M+ +  S +VL F L  +  +++Q  AP+P     P+++ A+L+  G QF   I+ LNTT
Sbjct  1    MSSSIFSSVVLFFFLFTIPYIQSQPIAPAPTTETSPINLTAILE-TGHQFTTLIRLLNTT  59

Query  780  QVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFED  601
            QVG QV++Q+NS   GMT+FAPTDNAFNNL  GTLN L+ QQ+I L+ YH+IPK+YS  D
Sbjct  60   QVGFQVSVQLNSSDQGMTIFAPTDNAFNNLKPGTLNSLTYQQQIQLMLYHIIPKYYSLSD  119

Query  600  LQTVSNPVRTQANGPDGKTYGLNFTG--QNNQVNVSSGAVETQVYNPLRKDPPLAVYQVD  427
            L   SNP+RTQA G +G  +GLNFTG  Q+NQVNVS+G VET++ N LR+  PLAVY VD
Sbjct  120  LLLASNPIRTQATGYEGGVFGLNFTGQAQSNQVNVSTGVVETRINNALRQQFPLAVYVVD  179

Query  426  KVLVPLDFTADHPAAKAPTGSASSTPAGKSNDGKNATAAKEPSPAPNGAGKMSLELGLVT  247
             VL+P +          PTG+ +  P   ++     + A +      G+      L +V 
Sbjct  180  SVLLPEELFG---TKTTPTGAPA--PKSTTSSSDADSPAGDDEHKSAGSSMKKTSLRIVL  234

Query  246  GILVFCMGLL  217
            G  +FC  ++
Sbjct  235  GFALFCCSVI  244



>gb|KHN36673.1| Fasciclin-like arabinogalactan protein 6 [Glycine soja]
Length=250

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 115/238 (48%), Positives = 153/238 (64%), Gaps = 16/238 (7%)
 Frame = -2

Query  900  LAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVF  721
            +A+ +AQAPAP+P G V++ A+L+K GGQ+   IK L  TQ   Q+  Q+ S + G T+F
Sbjct  18   MAQTQAQAPAPAPSGAVNLTAILEK-GGQYTTLIKLLKDTQQLTQIESQLKSNSQGFTLF  76

Query  720  APTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTY  541
            APTDNAF +L  G LN LSD +K+ LI +HV PK+Y+  DL TVSNPVRTQA   +G T+
Sbjct  77   APTDNAFQSLKPGALNDLSDDKKVKLILFHVTPKYYTISDLLTVSNPVRTQATEEEG-TW  135

Query  540  GLNFTGQ-NNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF-----TADHPAAK  379
            GLNFTGQ  NQVN+S+G V+TQ+ N LR+  PLAVYQVDKVL+PL+      T     A 
Sbjct  136  GLNFTGQGGNQVNISTGVVQTQLNNALREKFPLAVYQVDKVLLPLELFGTTKTTHSSEAP  195

Query  378  APTGSASSTP----AGKSNDGKNATAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLL  217
            +P GS  STP     GK+    +    K+ + A NG    ++  GLV G+ + C+  L
Sbjct  196  SPKGS-KSTPEIPSVGKAGGAPSPHGDKKDTNAANG---RNVAFGLVVGLALICIEAL  249



>ref|XP_006408977.1| hypothetical protein EUTSA_v10002226mg [Eutrema salsugineum]
 gb|ESQ50430.1| hypothetical protein EUTSA_v10002226mg [Eutrema salsugineum]
Length=248

 Score =   194 bits (494),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 113/238 (47%), Positives = 150/238 (63%), Gaps = 23/238 (10%)
 Frame = -2

Query  891  VKAQAPAPSPG---GPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVF  721
            +++Q  AP P     PV++ AVL+ +G QF  FI+ LNTTQVG QV++Q+NS   GMTVF
Sbjct  21   IQSQPIAPPPTNETSPVNLTAVLE-SGHQFTTFIRLLNTTQVGFQVSVQLNSSDQGMTVF  79

Query  720  APTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTY  541
            APTDNAFNNL  GTLN L+ Q++I LI YH+IPK+Y   DL   SNPVRTQA G +G  +
Sbjct  80   APTDNAFNNLKPGTLNSLTYQRQIQLILYHIIPKYYPLSDLLLASNPVRTQATGQEGGVF  139

Query  540  GLNFTGQN--NQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADH-------P  388
            GLNFTGQ   N+VN+S+G VET++ N LR+  PL+VY VDKVL+P +            P
Sbjct  140  GLNFTGQGQINEVNISTGVVETRITNILRQKFPLSVYVVDKVLLPEELFGTKTTTPTGAP  199

Query  387  AAKAPTGSASSTPAGKSNDGKNATAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLLS  214
            A K    S + +PA   +D K+A ++           K +  LG+V G   FC  ++S
Sbjct  200  APKTLPSSDADSPAIDEDDHKSAGSSV----------KRTSRLGIVLGCAWFCCSVMS  247



>ref|XP_004487189.1| PREDICTED: fasciclin-like arabinogalactan protein 13-like [Cicer 
arietinum]
Length=279

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 113/228 (50%), Positives = 152/228 (67%), Gaps = 16/228 (7%)
 Frame = -2

Query  882  QAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNA  703
            +APAPSP GP++I ++L+KAG Q+   I+ L  TQ   Q+  Q+NS +DG T+FAPTDNA
Sbjct  61   KAPAPSPSGPINITSILEKAG-QYTYLIRLLKETQQLIQIQSQLNSTSDGFTIFAPTDNA  119

Query  702  FNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTG  523
            F NL SG +N L+D+QK+ LI YHV PK+YS  DL TVSNPVRTQA+  +G ++GLNFT 
Sbjct  120  FQNLKSGAINDLTDEQKVKLILYHVTPKYYSLSDLLTVSNPVRTQASDSEG-SWGLNFTS  178

Query  522  QNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAG  343
            Q NQVN+SSG V T + N LR+  PLA+YQ+DKVL+PL            T S SS+P+ 
Sbjct  179  QGNQVNISSGVVTTSINNALRQQFPLAIYQLDKVLLPLQLFG--------TKSPSSSPSP  230

Query  342  KSNDGKNATAAKE-PSPAP-----NGAGKMSLELGLVTGILVFCMGLL  217
            K+++ +N T   + PSP+      NG    ++  G V G+ V CM +L
Sbjct  231  KASETRNTTVKGDAPSPSKSSLKDNGVAGKNVGFGFVVGLCVICMRVL  278



>ref|XP_006446719.1| hypothetical protein CICLE_v10016407mg [Citrus clementina]
 gb|ESR59959.1| hypothetical protein CICLE_v10016407mg [Citrus clementina]
Length=247

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/216 (51%), Positives = 142/216 (66%), Gaps = 9/216 (4%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            V++  +L K  GQF  FIK L +TQV NQ+  Q+NS ++GMTVFAPTDNAFNNL  G LN
Sbjct  38   VNLTGILDK-NGQFTTFIKLLISTQVANQIQSQINSSSEGMTVFAPTDNAFNNLEKGLLN  96

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSG  493
             L +Q+++ L+ YHV  KFY   DL  VSNPVRT A+G D   +GLNFTGQ NQVNVSSG
Sbjct  97   NLDNQKQVQLVLYHVTSKFYRQSDLLLVSNPVRTLASGQD--VWGLNFTGQGNQVNVSSG  154

Query  492  AVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGKSNDGKNATA  313
             VET + + LR++ PLAVYQVDKVL+P + +A    + AP         G +   K   A
Sbjct  155  VVETPINSVLRQNFPLAVYQVDKVLLPEELSAAKSPSAAPAPEGKKPTEGSN---KKVPA  211

Query  312  AKEPSPAPN---GAGKMSLELGLVTGILVFCMGLLS  214
            A EP+PA +     G+++  LG V G+ + CMG+LS
Sbjct  212  ASEPAPADDKTGAGGRLNAGLGFVAGLALLCMGVLS  247



>ref|NP_001238356.1| uncharacterized protein LOC100527846 precursor [Glycine max]
 gb|ACU17039.1| unknown [Glycine max]
Length=250

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 114/238 (48%), Positives = 152/238 (64%), Gaps = 16/238 (7%)
 Frame = -2

Query  900  LAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVF  721
            +A+ +AQAPAP+P G V++ A+L+K GGQ+   IK L  TQ   Q+  Q+ S + G T+F
Sbjct  18   MAQTQAQAPAPAPSGAVNLTAILEK-GGQYTTLIKLLKDTQQLTQIESQLKSNSQGFTLF  76

Query  720  APTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTY  541
            APTDNAF +L  G LN LSD +K+ LI +HV PK+Y+  DL TVSNPVRTQA   +G  +
Sbjct  77   APTDNAFQSLKPGALNDLSDDKKVKLILFHVTPKYYTISDLLTVSNPVRTQATEEEG-AW  135

Query  540  GLNFTGQ-NNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF-----TADHPAAK  379
            GLNFTGQ  NQVN+S+G V+TQ+ N LR+  PLAVYQVDKVL+PL+      T     A 
Sbjct  136  GLNFTGQGGNQVNISTGVVQTQLNNALREKFPLAVYQVDKVLLPLELFGTTKTTHSSEAP  195

Query  378  APTGSASSTP----AGKSNDGKNATAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLL  217
            +P GS  STP     GK+    +    K+ + A NG    ++  GLV G+ + C+  L
Sbjct  196  SPKGS-KSTPEIPSVGKAGGAPSPHGDKKDTNAANG---RNVAFGLVVGLALICIEAL  249



>ref|XP_007043716.1| Fasciclin-like arabinogalactan protein 9 [Theobroma cacao]
 gb|EOX99547.1| Fasciclin-like arabinogalactan protein 9 [Theobroma cacao]
Length=208

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 140/198 (71%), Gaps = 5/198 (3%)
 Frame = -2

Query  951  MAKAAVSFIVLS----FLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNT  784
            MA A VS I L+    FLL     +   APA +P GP++   +L+K  GQ+  F++ L  
Sbjct  1    MASATVSSIPLTLSALFLLFTSTALAQTAPAAAPPGPLNFTGILEK-NGQYTYFLRLLAK  59

Query  783  TQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFE  604
            +QVG+Q+  Q+NS T+G TV APTDNAFNNL +GT+N L +Q+K+ L+ +HV+PK+YS  
Sbjct  60   SQVGSQIQNQLNSTTEGFTVLAPTDNAFNNLKAGTINSLDEQKKVQLVLFHVLPKYYSLN  119

Query  603  DLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDK  424
            DLQ VSNPVRTQA G DG  YGLNFTGQNNQVNVS+G VETQ+ N L +  PLA+YQVDK
Sbjct  120  DLQFVSNPVRTQATGQDGGVYGLNFTGQNNQVNVSTGVVETQINNALTQQKPLAIYQVDK  179

Query  423  VLVPLDFTADHPAAKAPT  370
            VL+P +F      A+AP+
Sbjct  180  VLLPAEFFEVKSPAEAPS  197



>ref|XP_007149797.1| hypothetical protein PHAVU_005G099500g [Phaseolus vulgaris]
 gb|ESW21791.1| hypothetical protein PHAVU_005G099500g [Phaseolus vulgaris]
Length=247

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 117/224 (52%), Positives = 148/224 (66%), Gaps = 19/224 (8%)
 Frame = -2

Query  858  GPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGT  679
            G VD+ A+L+K GGQ+   I+ LN +Q   Q+  Q+ S + G T+FAPTDNAF NL SG 
Sbjct  34   GAVDLVAILQK-GGQYTTLIRLLNDSQQLIQIQSQLKSNSQGFTLFAPTDNAFQNLKSGA  92

Query  678  LNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVS  499
            LN LSD+QK+ LI YHV PK+YS  DL TVSNPVRTQA+G DG ++GLNFTGQ NQVNVS
Sbjct  93   LNHLSDEQKVQLILYHVTPKYYSLADLLTVSNPVRTQASGSDG-SWGLNFTGQGNQVNVS  151

Query  498  SGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTAD----HPAAKAPTGSASSTPAGKSND  331
            SG VETQV N LR+  PLAVYQVDKVL+P +   +     P+ K+P  S  +T  GK   
Sbjct  152  SGVVETQVNNALRQQFPLAVYQVDKVLLPEELFGEKSPAAPSPKSPKSSPETTTVGK---  208

Query  330  GKNATAAKEPSPA-----PNGAGKMSLELGLVTGILVFCMGLLS  214
                 A   PSP+      NGA + ++  G++ G+ + CMG LS
Sbjct  209  -----AGGAPSPSGEGQKDNGAAERNMGFGVILGVGLICMGALS  247



>ref|XP_010441925.1| PREDICTED: fasciclin-like arabinogalactan protein 13 [Camelina 
sativa]
Length=251

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 114/216 (53%), Positives = 145/216 (67%), Gaps = 9/216 (4%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            ++I A+L+K GGQF  FI+ LNTTQ+G+Q+NIQ+NS ++GMTV APTDNAF NL  GTLN
Sbjct  40   INITAILEK-GGQFVTFIRLLNTTQIGSQINIQLNSSSEGMTVLAPTDNAFQNLKPGTLN  98

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPD-GKTYGLNFTGQNNQVNVSS  496
            KLS   ++ LI YHV PK+Y+ EDL +VSNPVRTQA+G D G  YGLNFTGQ NQV VS+
Sbjct  99   KLSPDDQVKLILYHVSPKYYTLEDLLSVSNPVRTQASGRDVGGVYGLNFTGQGNQVKVST  158

Query  495  GAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADH---PAAKAPTGSASSTPAGKSNDGK  325
            G VET++   LR++ PLAVY VD VL+P +   +    P A AP  S S   +  S+  K
Sbjct  159  GVVETRLSTSLRQERPLAVYVVDMVLLPEEMFGERKTSPVAPAPKKSKSPDVSDDSDSSK  218

Query  324  NATAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLL  217
             A A  E S    G+G M   LG   G++V  +  L
Sbjct  219  KAAAPTEKS----GSGDMKSGLGFGLGLVVLSLKFL  250



>gb|KEH39201.1| fasciclin-like arabinogalactan protein [Medicago truncatula]
Length=249

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/242 (46%), Positives = 157/242 (65%), Gaps = 4/242 (2%)
 Frame = -2

Query  936  VSFIVLSFLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNI  757
            ++ I+L+ +     +++AQAPAP+P GP++I  + +KAG Q+   I+ LN TQ   Q+  
Sbjct  9    LALILLTLIPFLTPQIQAQAPAPAPSGPINITTIFEKAG-QYNFLIRLLNETQQLTQIQT  67

Query  756  QVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPV  577
            Q+NS ++G T+FAPTDNAF NLPSG +N LSDQQK+ LI YHV PK+YS  D  TVSNPV
Sbjct  68   QLNSTSEGFTIFAPTDNAFQNLPSGAINDLSDQQKVQLILYHVTPKYYSLSDFLTVSNPV  127

Query  576  RTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTA  397
            RTQA+G +G  +GL+FT Q NQVNVS+G V   + N LR+  PLAVYQ+DKVL+P +   
Sbjct  128  RTQASGKEGN-WGLHFTSQGNQVNVSTGVVTVPINNALRQQFPLAVYQLDKVLLPSELFG  186

Query  396  DHPAAKAPTGSASSTPAG--KSNDGKNATAAKEPSPAPNGAGKMSLELGLVTGILVFCMG  223
                + +P   +S TP+    S+D +    +   S   + A   ++  G V G+ + CMG
Sbjct  187  AKSPSSSPAPKSSKTPSKTPSSSDVEGDAPSPASSKKDDSAAGRNVGFGFVAGLGLICMG  246

Query  222  LL  217
            +L
Sbjct  247  VL  248



>gb|AFK41457.1| unknown [Medicago truncatula]
Length=249

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 110/242 (45%), Positives = 156/242 (64%), Gaps = 4/242 (2%)
 Frame = -2

Query  936  VSFIVLSFLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNI  757
            ++ I+L+ +     +++AQAPAP+P GP++I  + +KAG Q+   I+ LN TQ   Q+  
Sbjct  9    LALILLTLIPFLTPQIQAQAPAPAPSGPINITTIFEKAG-QYNFLIRLLNETQQLTQIQT  67

Query  756  QVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPV  577
            Q+NS ++G T+FAPTDNAF NLPSG +N LSDQQK+ LI YHV PK+YS  D  TVSNPV
Sbjct  68   QLNSTSEGFTIFAPTDNAFQNLPSGAINDLSDQQKVQLILYHVTPKYYSLSDFLTVSNPV  127

Query  576  RTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTA  397
            RTQA+G +G  +GL+FT Q NQVNVS+G V   + N LR+  PLAVYQ+DKVL+P +   
Sbjct  128  RTQASGKEGN-WGLHFTSQGNQVNVSTGVVTVPINNALRQQFPLAVYQLDKVLLPFELFG  186

Query  396  DHPAAKAPTGSASSTPAG--KSNDGKNATAAKEPSPAPNGAGKMSLELGLVTGILVFCMG  223
                + +P   +S TP+    S+D +    +   S   + A   ++  G V G+ + CMG
Sbjct  187  AKSPSSSPAPKSSKTPSKTPSSSDVEGDAPSPASSKKDDSAAGRNVGFGFVAGLGLICMG  246

Query  222  LL  217
            + 
Sbjct  247  VF  248



>gb|AFK39439.1| unknown [Medicago truncatula]
Length=249

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 110/242 (45%), Positives = 156/242 (64%), Gaps = 4/242 (2%)
 Frame = -2

Query  936  VSFIVLSFLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNI  757
            ++ I+L+ +     +++AQAPAP+P GP++I  + +KAG Q+   I+ LN TQ   Q+  
Sbjct  9    LALILLTLIPFLTPQIQAQAPAPAPSGPINITTIFEKAG-QYNFLIRLLNETQQLTQIQT  67

Query  756  QVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPV  577
            Q+NS ++G T+FAPTDNAF NLPS  +N LSDQQK+ LI YHV PK+YS  D  TVSNPV
Sbjct  68   QLNSTSEGFTIFAPTDNAFQNLPSEAINDLSDQQKVQLILYHVTPKYYSLSDFLTVSNPV  127

Query  576  RTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTA  397
            RTQA+G +G  +GL+FT Q NQVNVS+G V   + N LR+  PLAVYQ+DKVL+P +   
Sbjct  128  RTQASGKEGN-WGLHFTSQGNQVNVSTGVVTVPINNALRQQFPLAVYQLDKVLLPSELFG  186

Query  396  DHPAAKAPTGSASSTPAG--KSNDGKNATAAKEPSPAPNGAGKMSLELGLVTGILVFCMG  223
                + +P   +S TP+    S+D +    +   S   + A   ++  G V G+ + CMG
Sbjct  187  AKSPSSSPAPKSSKTPSKTPSSSDVERDAPSPASSKKDDSAAGRNVGFGFVAGLGLICMG  246

Query  222  LL  217
            +L
Sbjct  247  VL  248



>ref|XP_003540384.1| PREDICTED: uncharacterized LOC100500293 [Glycine max]
 gb|KHN27918.1| Fasciclin-like arabinogalactan protein 9 [Glycine soja]
Length=250

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 144/221 (65%), Gaps = 10/221 (5%)
 Frame = -2

Query  858  GPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGT  679
            G V++ A+L+K GGQ+   +K L  TQ   Q+  Q+ S + G T+FAPTDNAF +L  G 
Sbjct  34   GAVNLTAILEK-GGQYTTLMKLLKDTQQLTQIESQLKSNSQGFTLFAPTDNAFQSLKPGA  92

Query  678  LNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQ-NNQVNV  502
            LNKLSD QK+ LI +HV PK+Y+  DL TVSNPVRTQA   +G T+GLNFTGQ  NQVN+
Sbjct  93   LNKLSDDQKVKLILFHVTPKYYTISDLLTVSNPVRTQATEKEG-TWGLNFTGQGGNQVNI  151

Query  501  SSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF-----TADHPAAKAPTGSASSTPAGKS  337
            S+G V+TQ+ NPLR+  PLAVYQVDKVL+PL+      T    AA +P GS  STP   S
Sbjct  152  STGVVQTQLNNPLREKFPLAVYQVDKVLLPLELFGTTKTRASSAAPSPKGS-KSTPEIPS  210

Query  336  NDGKNATAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLLS  214
              GK  +A  +     N A  M++  GLV G+   CMG LS
Sbjct  211  -VGKAGSAPSDSPKDTNAANGMNVGFGLVLGLGFICMGALS  250



>gb|AFK43105.1| unknown [Lotus japonicus]
Length=248

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 123/247 (50%), Positives = 170/247 (69%), Gaps = 11/247 (4%)
 Frame = -2

Query  936  VSFIVLSFLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNI  757
            ++ I+L+FL +  ++++AQAPAP+P GPV++ A+L+KAG Q+   I+ L  +Q   Q+  
Sbjct  7    LALILLTFLSLFASKIQAQAPAPAPSGPVNLTAILEKAG-QYTTLIRLLKESQQLTQIES  65

Query  756  QVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPV  577
            Q+NS T G T+FAPTDNAF NL SG +N L+D QK+ LI YHV PK+YS  DLQTVSNPV
Sbjct  66   QLNSTTQGFTLFAPTDNAFQNLKSGAINDLTDDQKVKLILYHVTPKYYSLSDLQTVSNPV  125

Query  576  RTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLD-FT  400
            RTQA+  +G ++GLNF GQ NQVNV++G V T + N LR+  PLA+YQVD+VL+PL+ F 
Sbjct  126  RTQASEKEG-SWGLNFKGQGNQVNVTTGVVTTSINNDLRQQFPLAIYQVDRVLLPLELFG  184

Query  399  ADHPAAKAPTGSASSTPAGKS-NDGKNATAAKEPSPAP----NGAGKMSLELGLVTGILV  235
            A  P++     S+ +TP+ ++ + GK   A   PSPA     NG    ++ LGLV G+  
Sbjct  185  AKSPSSAPSPKSSETTPSDETPSSGKKGGA---PSPAASQKDNGVAGRNVGLGLVLGLGF  241

Query  234  FCMGLLS  214
             CMG LS
Sbjct  242  ICMGALS  248



>gb|EPS63702.1| hypothetical protein M569_11081, partial [Genlisea aurea]
Length=180

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 116/150 (77%), Gaps = 1/150 (1%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            VDI  +L KAG Q+  FI+ LN TQ+ NQ++ Q  +  DGMTVFA TD+AF NLP+GTLN
Sbjct  32   VDIIGILHKAG-QYAFFIRLLNQTQIANQIDNQAETSADGMTVFAATDDAFRNLPAGTLN  90

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSG  493
             LS Q++I L+QYH+ PKFY+ ++LQTVSNPVRT+A+G DG+ +GLNF+   NQVN+S+G
Sbjct  91   NLSFQRQIQLLQYHICPKFYTLDELQTVSNPVRTEASGQDGQVFGLNFSADANQVNLSTG  150

Query  492  AVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
             V+  + N +  + PLAV++VDKVL+PL+F
Sbjct  151  VVQVSINNAVEDNFPLAVFEVDKVLLPLEF  180



>ref|XP_011002659.1| PREDICTED: fasciclin-like arabinogalactan protein 13 [Populus 
euphratica]
Length=245

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 148/214 (69%), Gaps = 6/214 (3%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            V+  AVL K GGQF  FI  LN TQ  NQ+  Q+NS ++GMT+FAPTDNAFNNL SG LN
Sbjct  37   VNFTAVLVK-GGQFVTFISLLNKTQTFNQIENQINSSSEGMTIFAPTDNAFNNLKSGALN  95

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSG  493
             L+ QQ++ L+QYH++PKFYS  +L  VSNPV TQA+G +G  +GLNF+G++NQVNVS+G
Sbjct  96   DLNQQQQVQLLQYHMLPKFYSLSNLLLVSNPVPTQASGQEG-VWGLNFSGKSNQVNVSTG  154

Query  492  AVETQVYNPLRKDPPLAVYQVDKVLVPLD-FTADHPAAKAPTGSASSTPAGKSNDGKNAT  316
             VE Q+ N LR+D PLAVY VDKVL+P + F    P+A  P  +   +  GKSN    + 
Sbjct  155  LVEVQLNNALRQDFPLAVYPVDKVLLPEELFGVKPPSASPPAPATKGSSPGKSNS---SD  211

Query  315  AAKEPSPAPNGAGKMSLELGLVTGILVFCMGLLS  214
             A EPSP  N AG  ++ LGL+ G+    MG+LS
Sbjct  212  TAAEPSPGKNSAGGRNVALGLIFGLGFVSMGILS  245



>ref|XP_002325592.1| fasciclin-like arabinogalactan-protein 9 [Populus trichocarpa]
 gb|EEE99973.1| fasciclin-like arabinogalactan-protein 9 [Populus trichocarpa]
Length=245

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 148/215 (69%), Gaps = 4/215 (2%)
 Frame = -2

Query  858  GPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGT  679
            GPV+  AVL K GGQF  FI  LN TQ  NQ+  Q+NS ++GMT+FAPTDNAF+NL SG 
Sbjct  35   GPVNFTAVLVK-GGQFVTFISLLNKTQTFNQIENQINSSSEGMTIFAPTDNAFSNLKSGA  93

Query  678  LNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVS  499
            LN LS QQ++ L+QYH++PKFYS  +L  VSNPV TQA+G +G  +GLNFTGQ+NQVNVS
Sbjct  94   LNGLSQQQQVQLLQYHMLPKFYSLSNLLLVSNPVPTQASGQEG-VWGLNFTGQSNQVNVS  152

Query  498  SGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGKSNDGKNA  319
            +G VE QV N LR+D PLAVY VDKVL+P +     P + +P   A +T    S    ++
Sbjct  153  TGLVEVQVNNALRQDFPLAVYPVDKVLLPDELFGVKPPSASPP--APATKGSSSGKSNSS  210

Query  318  TAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLLS  214
              A EPSP  N AG  ++ LGL+ G+    MG+LS
Sbjct  211  DTAAEPSPGKNSAGGRNVALGLIFGLGFVSMGILS  245



>ref|XP_010424800.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Camelina 
sativa]
Length=243

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 128/182 (70%), Gaps = 4/182 (2%)
 Frame = -2

Query  948  AKAAVSFIVLSFLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGN  769
            ++  +S  +  F LV       QAPAP+P GP +I A+L+KAG QF +FI+ L +TQ  +
Sbjct  4    SRTLISSNLFIFFLVMATTTNGQAPAPTPSGPTNITAILEKAG-QFTLFIRLLKSTQASD  62

Query  768  QVNIQVNSPT-DGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQT  592
            Q+N Q+NS + +G+TVFAPTDNAFN+L SGTLN LSDQQK+ L+Q+HV+P   +    QT
Sbjct  63   QINTQLNSSSSNGLTVFAPTDNAFNSLKSGTLNSLSDQQKVQLVQFHVLPTLLTMPQFQT  122

Query  591  VSNPVRTQA-NGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLV  415
            VSNP+RTQA +G +GK + LN T   NQVN+++G V   V N +  D  LAVYQVD+VL+
Sbjct  123  VSNPIRTQAGDGQNGK-FPLNITSSGNQVNITTGVVSATVANSVYSDKQLAVYQVDQVLL  181

Query  414  PL  409
            PL
Sbjct  182  PL  183



>ref|XP_009402376.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Musa acuminata 
subsp. malaccensis]
Length=265

 Score =   182 bits (462),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 106/239 (44%), Positives = 144/239 (60%), Gaps = 16/239 (7%)
 Frame = -2

Query  954  RMAKAAVSFIVLSFLLVGLA-EVKAQ-APAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTT  781
            R   A  +F+     L GLA E  AQ A +P+P GP +I A+++KAG Q+G  I+ L +T
Sbjct  20   RFGCAVTAFL----FLAGLAGETFAQSATSPAPAGPTNITAIMEKAG-QYGTLIRLLKST  74

Query  780  QVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFED  601
            QVG+Q+N Q+N+   G+T+FAPTDNAF++LPSGTLN L+DQQK+ LIQ+H++P   S   
Sbjct  75   QVGDQINNQLNNSNTGLTIFAPTDNAFSSLPSGTLNSLTDQQKVALIQFHILPTVISASQ  134

Query  600  LQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKV  421
             QTVSNPVRTQA       Y LN T    QVN+S+G V+  + N +  D  LAVYQVD+V
Sbjct  135  FQTVSNPVRTQAGDASNGRYPLNVTTMGTQVNLSTGVVDATIANTIYSDSKLAVYQVDQV  194

Query  420  LVPLDF---------TADHPAAKAPTGSASSTPAGKSNDGKNATAAKEPSPAPNGAGKM  271
            L+PL+           A   A K      +  P+  S D  +A+A    S + +G G M
Sbjct  195  LLPLEIFGPPAPAAAPAPAEAKKQKPSPVAEGPSTPSTDATDASAGVNLSRSASGGGVM  253



>ref|XP_010540894.1| PREDICTED: fasciclin-like arabinogalactan protein 6 [Tarenaya 
hassleriana]
Length=260

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 106/221 (48%), Positives = 139/221 (63%), Gaps = 9/221 (4%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            +++ A+L+K G ++  FI  LN TQV  QV+IQ+NS   G+TVFAPT+N F NL  GTLN
Sbjct  41   INLTAILEK-GSEYSTFIHLLNATQVSVQVSIQLNSSNQGVTVFAPTNNGFTNLKPGTLN  99

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSG  493
             LS+QQ+I L+ YH+IPK+YS  DL +VSNPVRT A G D   + LNFTGQ+NQVN+S+G
Sbjct  100  GLSNQQQIQLMLYHIIPKYYSMSDLISVSNPVRTLATGQDSGDFRLNFTGQSNQVNISTG  159

Query  492  AVETQVYNPLRKDPPLAVYQVDKVLVPLD-FTADHPAAKAPTGS-------ASSTPAGKS  337
             V   V N LR+  PLAVY +++VL+P D F +  P  KAP+ S        S +    S
Sbjct  160  VVLAHVNNALRQHFPLAVYMMEQVLLPQDMFGSPPPETKAPSASPTAPAPEKSPSDHADS  219

Query  336  NDGKNATAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLLS  214
             D     AA E   + +G    +   GLV G+  FC GLLS
Sbjct  220  PDSDEPPAASEEPESGSGGRGTTTGFGLVLGLAWFCFGLLS  260



>ref|XP_010490785.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Camelina 
sativa]
Length=246

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 130/182 (71%), Gaps = 5/182 (3%)
 Frame = -2

Query  948  AKAAVSFIVLSFLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGN  769
            ++  +S  +  F LV +A    QAPAP+P GP +I A+L+KAG QF +FI+ L +TQ  +
Sbjct  4    SRTLISSNLFIFFLV-MATTNGQAPAPTPSGPTNITAILEKAG-QFTLFIRLLKSTQASD  61

Query  768  QVNIQVNSPT-DGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQT  592
            Q+N Q+NS + +G+TVFAPTDNAFN+L SGTLN LSDQQK+ L+Q+HV+P   +    QT
Sbjct  62   QINTQLNSSSSNGLTVFAPTDNAFNSLKSGTLNSLSDQQKVQLVQFHVLPTLLTMPQFQT  121

Query  591  VSNPVRTQA-NGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLV  415
            VSNP+RTQA +G +GK + LN T   NQVN+++G V   V N +  D  LAVYQVD+VL+
Sbjct  122  VSNPLRTQAGDGQNGK-FPLNITSSGNQVNITTGVVSATVANSVYSDKQLAVYQVDQVLL  180

Query  414  PL  409
            PL
Sbjct  181  PL  182



>ref|XP_010452179.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Camelina 
sativa]
Length=247

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 127/182 (70%), Gaps = 4/182 (2%)
 Frame = -2

Query  948  AKAAVSFIVLSFLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGN  769
            ++  +S  +  F LV       QAPAP+P GP +I A+L+KAG QF +FI+ L +TQ  +
Sbjct  4    SRTLISSNLFIFFLVMATTTNGQAPAPTPSGPTNITAILEKAG-QFTMFIRLLKSTQASD  62

Query  768  QVNIQVNSPT-DGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQT  592
            Q+N Q+NS + +G+TVFAPTDNAFN+L SGTLN LSDQQK+ L+Q+HV+P   +    QT
Sbjct  63   QINTQLNSSSSNGLTVFAPTDNAFNSLKSGTLNSLSDQQKVQLVQFHVLPTLLTMPQFQT  122

Query  591  VSNPVRTQA-NGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLV  415
            VSNP+RTQA +G  GK + LN T   NQVN+++G V   V N +  D  LAVYQVD+VL+
Sbjct  123  VSNPLRTQAGDGQKGK-FPLNITSSGNQVNITTGVVSATVANSVYSDKQLAVYQVDQVLL  181

Query  414  PL  409
            PL
Sbjct  182  PL  183



>ref|XP_010689776.1| PREDICTED: fasciclin-like arabinogalactan protein 13 [Beta vulgaris 
subsp. vulgaris]
Length=252

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 136/216 (63%), Gaps = 5/216 (2%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            +++ A+L+KA  Q+  F++ L +TQV NQ+  QVN+ T+GMTVFAPTDNAF NL  GTLN
Sbjct  37   LNLTAILEKAS-QYTTFMRLLASTQVDNQIANQVNTSTEGMTVFAPTDNAFQNLKPGTLN  95

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTG-QNNQVNVSS  496
             LS Q+++ L+ YHV+PKFY+FE+ +TVSNPVRTQA G DG+ +GLN     N QVNVS+
Sbjct  96   GLSVQEQVQLVLYHVLPKFYNFENFETVSNPVRTQATGQDGEPFGLNIVSIGNRQVNVST  155

Query  495  GAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSA---SSTPAGKSNDGK  325
            G V  Q+ N LR+  PLAVYQVD VL+P +         AP  SA     + +    DG 
Sbjct  156  GIVTVQLNNALRERFPLAVYQVDMVLLPKELFGAKSPKSAPKSSAPKSDDSKSDDKADGP  215

Query  324  NATAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLL  217
               A+ +      G G  SL +  V G+ +   GLL
Sbjct  216  ATAASADAEERNAGYGLRSLGMKFVAGVGILTAGLL  251



>ref|XP_006398764.1| hypothetical protein EUTSA_v10015384mg [Eutrema salsugineum]
 gb|ESQ40217.1| hypothetical protein EUTSA_v10015384mg [Eutrema salsugineum]
Length=243

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 124/171 (73%), Gaps = 5/171 (3%)
 Frame = -2

Query  915  FLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTD  736
            F LV +A    QAPAP+P GP +I AVL+KAG QF +FI+ L +TQ  +Q+N Q+NS + 
Sbjct  15   FFLV-MATTNGQAPAPAPSGPTNITAVLEKAG-QFTMFIRLLKSTQAADQINTQINSSSS  72

Query  735  -GMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQA-N  562
             G+TVFAPTDNAF++L SGTLN LSDQQK+ L+Q+HV+P   +    QTVSNP+RTQA +
Sbjct  73   QGLTVFAPTDNAFSSLKSGTLNSLSDQQKVQLVQFHVLPTLLTMPQFQTVSNPLRTQAGD  132

Query  561  GPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPL  409
            G +GK + LN T   NQVN+++G V   V N +  D  LAVYQVD+VL+PL
Sbjct  133  GQNGK-FPLNITSSGNQVNITTGVVSATVANSVYSDKQLAVYQVDQVLLPL  182



>ref|XP_006286413.1| hypothetical protein CARUB_v10002835mg [Capsella rubella]
 gb|EOA19311.1| hypothetical protein CARUB_v10002835mg [Capsella rubella]
Length=246

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 130/182 (71%), Gaps = 5/182 (3%)
 Frame = -2

Query  948  AKAAVSFIVLSFLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGN  769
            ++  +S  +  F LV +A    QAPAP+P GP +I A+L+KAG QF +FI+ L +TQ  +
Sbjct  4    SRTLISSNLFIFFLV-MATTNGQAPAPTPSGPTNITAILEKAG-QFTLFIRLLKSTQASD  61

Query  768  QVNIQVNSPT-DGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQT  592
            Q+N Q+NS + +G+TVFAPTDNAFN+L SGTLN LSDQQK+ L+Q+HV+P   +    QT
Sbjct  62   QINTQLNSSSSNGLTVFAPTDNAFNSLKSGTLNSLSDQQKVQLVQFHVLPTLLTMPQFQT  121

Query  591  VSNPVRTQA-NGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLV  415
            VSNP+RTQA +G +GK + LN T   NQVN+++G V   V N +  D  LAVYQVD+VL+
Sbjct  122  VSNPLRTQAGDGQNGK-FPLNITSSGNQVNITTGVVSATVANSVYSDKQLAVYQVDQVLL  180

Query  414  PL  409
            PL
Sbjct  181  PL  182



>ref|XP_009130731.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Brassica 
rapa]
Length=243

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 130/183 (71%), Gaps = 5/183 (3%)
 Frame = -2

Query  951  MAKAAVSFIVLSFLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVG  772
            +++  +SF +  F LV +A    QAPAP+P GP +I AVL+KAG Q+ +FI+ L +TQ  
Sbjct  3    ISRTFMSFNLFIFFLV-IATTNGQAPAPTPSGPTNITAVLEKAG-QYTMFIRLLKSTQAA  60

Query  771  NQVNIQVNSPTD-GMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQ  595
            +Q+N Q+NS +  G+TVFAPTDNAF++L SGTLN LSDQQK+ L+Q+HV+P   +    Q
Sbjct  61   DQINTQLNSSSSQGLTVFAPTDNAFSSLKSGTLNSLSDQQKVQLVQFHVLPTLLTMPQFQ  120

Query  594  TVSNPVRTQA-NGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVL  418
            TVSNP+RTQA +G  GK + LN T   NQVN+++G V   V N +  D  LAVYQVD+VL
Sbjct  121  TVSNPLRTQAGDGQSGK-FPLNITSSGNQVNITTGVVSATVANSVYSDKQLAVYQVDQVL  179

Query  417  VPL  409
            +PL
Sbjct  180  LPL  182



>ref|XP_010052360.1| PREDICTED: fasciclin-like arabinogalactan protein 13 [Eucalyptus 
grandis]
 gb|KCW89588.1| hypothetical protein EUGRSUZ_A01871 [Eucalyptus grandis]
Length=249

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 104/213 (49%), Positives = 139/213 (65%), Gaps = 10/213 (5%)
 Frame = -2

Query  849  DIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNK  670
            ++  +L K  GQ+  FI+ L TTQV NQ+  Q+N+ T+G+TVFAPTDNAFNNL +GT+N 
Sbjct  46   NLTGILDK-NGQYTSFIRLLTTTQVANQIENQLNTSTEGLTVFAPTDNAFNNLKAGTIND  104

Query  669  LSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGA  490
            LS++Q++ L+  HV PK+YS    Q+VSNPVRTQ     G   GLNF+ Q NQVNVS+G 
Sbjct  105  LSNEQQVQLVLNHVAPKYYSLLSFQSVSNPVRTQ-----GNFAGLNFSSQGNQVNVSTGM  159

Query  489  VETQVYNPLRKDPPLAVYQVDKVLVPLD-FTADHPAAKAPTGSASSTPAGKSNDGKNATA  313
            VET + N L +  PLAVYQVDKVL+P + F A  PA+  P    SS+ +  +   K  +A
Sbjct  160  VETPINNALYQQSPLAVYQVDKVLLPPELFEAPAPASSTPAAPKSSSSSNSTTSAKAPSA  219

Query  312  AKEPSPAPNGAGKMSLELGLVTGILVFCMGLLS  214
                S A   +GK ++ LG V G+ + CMG LS
Sbjct  220  ENSNSGA---SGKSNMWLGFVVGVGMMCMGFLS  249



>gb|AAM62616.1| arabinogalactan protein-like [Arabidopsis thaliana]
Length=246

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 124/171 (73%), Gaps = 5/171 (3%)
 Frame = -2

Query  915  FLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPT-  739
            F LV LA    QAPAP P GP +I A+L+KAG QF +FI+ L +TQ  +Q+N Q+NS + 
Sbjct  15   FFLV-LATTYGQAPAPGPSGPTNITAILEKAG-QFTLFIRLLKSTQASDQINTQLNSSSS  72

Query  738  DGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQA-N  562
            +G+TVFAPTDNAFN+L SGTLN LSDQQK+ L+Q+HV+P   +    QTVSNP+RTQA +
Sbjct  73   NGLTVFAPTDNAFNSLKSGTLNSLSDQQKVQLVQFHVLPTLITMPQFQTVSNPLRTQAGD  132

Query  561  GPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPL  409
            G +GK + LN T   NQVN+++G V   V N +  D  LAVYQVD+VL+PL
Sbjct  133  GQNGK-FPLNITSSGNQVNITTGVVSATVANSVYSDKQLAVYQVDQVLLPL  182



>emb|CDX80855.1| BnaC03g01090D [Brassica napus]
Length=243

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 131/183 (72%), Gaps = 5/183 (3%)
 Frame = -2

Query  951  MAKAAVSFIVLSFLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVG  772
            +++  +SF +  F LV +A    QAPAP+P GP +I AVL+KAG Q+ +FI+ L +TQ  
Sbjct  3    ISRTFMSFNLFIFFLV-IATTNGQAPAPTPSGPTNITAVLEKAG-QYTMFIRLLKSTQAA  60

Query  771  NQVNIQVNSPTD-GMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQ  595
            +Q+N Q+NS +  G+TVFAPTDNAF++L SGTLN LSDQQK+ L+Q+HV+P   +    Q
Sbjct  61   DQINTQLNSSSSQGLTVFAPTDNAFSSLKSGTLNSLSDQQKVQLVQFHVLPTLLTMPQFQ  120

Query  594  TVSNPVRTQA-NGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVL  418
            TVSNP+RTQA +G +GK + LN T   NQVN+++G V   V N +  D  +AVYQVD+VL
Sbjct  121  TVSNPLRTQAGDGQNGK-FPLNITSSGNQVNITTGVVSATVANSVYSDKQIAVYQVDQVL  179

Query  417  VPL  409
            +PL
Sbjct  180  LPL  182



>emb|CDY44345.1| BnaC02g03320D [Brassica napus]
Length=243

 Score =   179 bits (454),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 140/209 (67%), Gaps = 8/209 (4%)
 Frame = -2

Query  915  FLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTD  736
            F LV +A    QAPAP+P GP +I AVL+KAG Q+ +FI+ L +TQ  +Q+N Q+NS + 
Sbjct  15   FFLV-MATTNGQAPAPTPSGPTNITAVLEKAG-QYTMFIRLLKSTQAADQINTQLNSSSS  72

Query  735  -GMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQA-N  562
             G+TVFAPTDNAF++L SGTLN LSDQQK+ L+Q+HV+P   +    QTVSNP+RTQA +
Sbjct  73   QGLTVFAPTDNAFSSLKSGTLNSLSDQQKVQLVQFHVLPTLLTMPQFQTVSNPLRTQAGD  132

Query  561  GPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLD-FTADHPA  385
            G +GK + LN T   NQVN+++G V   V N +  D  LAVYQVD+VL+PL  F +    
Sbjct  133  GQNGK-FPLNITSSGNQVNITTGVVSATVANSVYSDKQLAVYQVDQVLLPLAMFGSSSAP  191

Query  384  AKAPT--GSASSTPAGKSNDGKNATAAKE  304
            A AP   G  S   A   +DG ++T + +
Sbjct  192  APAPEKGGLVSKGSAPSGDDGGDSTDSSD  220



>ref|XP_009125482.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Brassica 
rapa]
 emb|CDY62902.1| BnaAnng18460D [Brassica napus]
Length=243

 Score =   179 bits (454),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 140/209 (67%), Gaps = 8/209 (4%)
 Frame = -2

Query  915  FLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTD  736
            F LV +A    QAPAP+P GP +I AVL+KAG Q+ +FI+ L +TQ  +Q+N Q+NS + 
Sbjct  15   FFLV-MATTNGQAPAPTPSGPTNITAVLEKAG-QYTMFIRLLKSTQAADQINTQLNSSSS  72

Query  735  -GMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQA-N  562
             G+TVFAPTDNAF++L SGTLN LSDQQK+ L+Q+HV+P   +    QTVSNP+RTQA +
Sbjct  73   QGLTVFAPTDNAFSSLKSGTLNSLSDQQKVQLVQFHVLPTLLTMPQFQTVSNPLRTQAGD  132

Query  561  GPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLD-FTADHPA  385
            G +GK + LN T   NQVN+++G V   V N +  D  LAVYQVD+VL+PL  F +    
Sbjct  133  GQNGK-FPLNITSSGNQVNITTGVVSATVANSVYSDKQLAVYQVDQVLLPLAMFGSSSAP  191

Query  384  AKAPT--GSASSTPAGKSNDGKNATAAKE  304
            A AP   G  S   A   +DG ++T + +
Sbjct  192  APAPEKGGLVSKGSAPSGDDGGDSTDSSD  220



>emb|CDY11242.1| BnaA03g00780D [Brassica napus]
Length=243

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 130/183 (71%), Gaps = 5/183 (3%)
 Frame = -2

Query  951  MAKAAVSFIVLSFLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVG  772
            +++  +SF +  F LV +A    QAPAP+P GP +I AVL+KAG Q+ +FI+ L +TQ  
Sbjct  3    ISRTFMSFNLFIFFLV-IATTNGQAPAPTPSGPTNITAVLEKAG-QYTMFIRLLKSTQAA  60

Query  771  NQVNIQVNSPTD-GMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQ  595
            +Q+N Q+NS +  G+TVFAPTDNAF++L SGTLN LSDQQK+ L+Q+HV+P   +    Q
Sbjct  61   DQINTQLNSSSSQGLTVFAPTDNAFSSLKSGTLNSLSDQQKVQLVQFHVLPTLLTMPQFQ  120

Query  594  TVSNPVRTQA-NGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVL  418
            TVSNP+RTQA +G +GK + LN T   NQ N+++G V   V N +  D  LAVYQVD+VL
Sbjct  121  TVSNPLRTQAGDGQNGK-FPLNITSSGNQANITTGVVSATVANSVYSDKQLAVYQVDQVL  179

Query  417  VPL  409
            +PL
Sbjct  180  LPL  182



>ref|XP_002519547.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42961.1| conserved hypothetical protein [Ricinus communis]
Length=241

 Score =   179 bits (453),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 118/176 (67%), Gaps = 1/176 (1%)
 Frame = -2

Query  930  FIVLSFLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQV  751
            F+ L F+ +  +   AQ P+PSP GP +I A+L+KAG QF  FIK + +TQ  +Q+N Q+
Sbjct  10   FLFLMFVFLCCSTSSAQTPSPSPSGPTNITAILEKAG-QFTTFIKLMMSTQEASQINTQL  68

Query  750  NSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRT  571
            N+   G+TVFAP DNAF NL +GTLN L+DQ+K+ L+Q+H++P F S    QTVSNP+RT
Sbjct  69   NNSNQGLTVFAPPDNAFANLKAGTLNSLTDQEKVQLMQFHILPTFISMSQFQTVSNPLRT  128

Query  570  QANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
            QA       + LN T   NQVNV++G     V N +  D  LAVYQVDKVL+PLD 
Sbjct  129  QAGNSANGEFPLNVTTSGNQVNVTTGVDTATVANTIYTDGSLAVYQVDKVLLPLDL  184



>ref|NP_195937.1| fasciclin-like arabinogalactan protein 11 [Arabidopsis thaliana]
 sp|Q8LEJ6.2|FLA11_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 11; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAK25893.1|AF360183_1 putative arabinogalactan protein [Arabidopsis thaliana]
 emb|CAB86084.1| arabinogalactan protein-like [Arabidopsis thaliana]
 dbj|BAB08377.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK64076.1| putative arabinogalactan protein [Arabidopsis thaliana]
 gb|AED90563.1| fasciclin-like arabinogalactan protein 11 [Arabidopsis thaliana]
Length=246

 Score =   179 bits (453),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 124/171 (73%), Gaps = 5/171 (3%)
 Frame = -2

Query  915  FLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPT-  739
            F LV +A    QAPAP P GP +I A+L+KAG QF +FI+ L +TQ  +Q+N Q+NS + 
Sbjct  15   FFLV-IATTYGQAPAPGPSGPTNITAILEKAG-QFTLFIRLLKSTQASDQINTQLNSSSS  72

Query  738  DGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQA-N  562
            +G+TVFAPTDNAFN+L SGTLN LSDQQK+ L+Q+HV+P   +    QTVSNP+RTQA +
Sbjct  73   NGLTVFAPTDNAFNSLKSGTLNSLSDQQKVQLVQFHVLPTLITMPQFQTVSNPLRTQAGD  132

Query  561  GPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPL  409
            G +GK + LN T   NQVN+++G V   V N +  D  LAVYQVD+VL+PL
Sbjct  133  GQNGK-FPLNITSSGNQVNITTGVVSATVANSVYSDKQLAVYQVDQVLLPL  182



>ref|XP_010253626.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Nelumbo 
nucifera]
Length=243

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 117/169 (69%), Gaps = 1/169 (1%)
 Frame = -2

Query  909  LVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGM  730
            L+      AQAPAP P GP +I A+L+KAG QF   I+ L +TQ+ +Q+N Q+N+   G+
Sbjct  16   LLKCTTTLAQAPAPGPSGPTNITAILEKAG-QFTTLIRLLKSTQMADQINQQLNNSNQGI  74

Query  729  TVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDG  550
            T+FAPTDNAF+NL SGTLN L+DQQK+ L+Q+HV+P F S    QTVSNP+RTQA   + 
Sbjct  75   TLFAPTDNAFSNLKSGTLNSLTDQQKVQLVQFHVLPSFISVSQFQTVSNPLRTQAGNSNN  134

Query  549  KTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
              + LN T   NQVN+++G V T V N +  D  LAVYQVD+VL+PL  
Sbjct  135  GQFPLNVTTTGNQVNITTGVVNTTVANTIYTDNQLAVYQVDQVLLPLQL  183



>ref|XP_002873077.1| hypothetical protein ARALYDRAFT_487087 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49336.1| hypothetical protein ARALYDRAFT_487087 [Arabidopsis lyrata subsp. 
lyrata]
Length=246

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 126/175 (72%), Gaps = 6/175 (3%)
 Frame = -2

Query  927  IVLSFLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVN  748
            + + FL+V  A    QAPAP P GP +I A+L+KAG QF +FI+ L +TQ  +Q+N Q+N
Sbjct  12   LFIFFLIV--ATTNGQAPAPGPSGPTNITAILEKAG-QFTLFIRLLKSTQASDQINTQLN  68

Query  747  SPT-DGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRT  571
            S + +G+TVFAPTDNAFN+L SGTLN LSDQQK+ L+Q+HV+P   +    QTVSNP+RT
Sbjct  69   SSSSNGLTVFAPTDNAFNSLKSGTLNSLSDQQKVQLVQFHVLPTLITMPQFQTVSNPLRT  128

Query  570  QA-NGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPL  409
            QA +G +GK + LN T   NQVN+++G V   V N +  D  LAVYQVD+VL+PL
Sbjct  129  QAGDGQNGK-FPLNITSSGNQVNITTGVVSATVANSVYSDKQLAVYQVDQVLLPL  182



>ref|XP_004241271.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Solanum 
lycopersicum]
Length=249

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 112/253 (44%), Positives = 144/253 (57%), Gaps = 14/253 (6%)
 Frame = -2

Query  951  MAKAAVSFIVLSFLLVGLAEVKAQAPA--PSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQ  778
            M+    S  +L+  L        Q PA  P+P GP +I  +L+KAG QF  FI+ L TTQ
Sbjct  2    MSHLVFSLSLLAIFLHSCTFTLGQNPASAPAPSGPTNITKILEKAG-QFTTFIRLLGTTQ  60

Query  777  VGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDL  598
             G+Q+N Q+N+   GMTVFAPTDNAF++L +GTLN LS Q+++ L+Q+HV+P F S    
Sbjct  61   AGDQINTQLNNSKQGMTVFAPTDNAFSSLKAGTLNSLSSQEQVQLVQFHVLPSFISVSQF  120

Query  597  QTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVL  418
            QTVSNP+RTQA       + LN T   NQVNVS+G V+  V N +  D  LAVYQVDKVL
Sbjct  121  QTVSNPLRTQAGDTSPGDFPLNVTTSGNQVNVSTGIVDATVGNTIYTDGELAVYQVDKVL  180

Query  417  VPLDFTADHPAAKAPTGSASSTPAGKSNDGKNATAAKEPS------PA-PNGAGKMSLEL  259
             PL   A    A AP  + + T    SN  K + AA  PS      PA  +GA  ++   
Sbjct  181  QPLSIFASPSPATAPEPATTET----SNLKKKSPAALSPSSGSDDTPADKSGADSVNNVA  236

Query  258  GLVTGILVFCMGL  220
             L  G   F   L
Sbjct  237  ALAIGAFCFAFWL  249



>emb|CAI99883.1| putative cell surface adhesion protein [Zinnia violacea]
Length=252

 Score =   177 bits (448),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 114/163 (70%), Gaps = 1/163 (1%)
 Frame = -2

Query  891  VKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPT  712
            V AQAPAP P GP +I  +L+KAG QF   I+ +  TQ+G+Q+N Q+N+   GMTVFAPT
Sbjct  29   VVAQAPAPGPSGPTNITKILEKAG-QFTTLIRLMKATQLGDQINTQLNNSNQGMTVFAPT  87

Query  711  DNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLN  532
            DNAF++L  GTLN LSDQ K+ L+Q+HV+P + +   LQTVSNP+RTQA       + LN
Sbjct  88   DNAFSSLKPGTLNSLSDQDKVSLLQFHVVPTYLTTSQLQTVSNPLRTQAGDTASNKFPLN  147

Query  531  FTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
             T   NQVNVS+G V+T V N +  D  LAVYQVDKVL+P+  
Sbjct  148  VTAAGNQVNVSTGVVDTPVSNSIYTDGTLAVYQVDKVLLPMSL  190



>gb|KFK24763.1| hypothetical protein AALP_AA8G021900 [Arabis alpina]
Length=247

 Score =   176 bits (447),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 125/188 (66%), Gaps = 6/188 (3%)
 Frame = -2

Query  933  SFIV--LSFLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVN  760
            SFI   L    + +A    QAPAP+P GP +I AVL+KAG Q+ +FI+ L +TQ  +Q+N
Sbjct  6    SFIFSNLFVFFIVMATTNGQAPAPTPSGPTNITAVLEKAG-QYTLFIRLLKSTQASDQIN  64

Query  759  IQVNSPTD-GMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSN  583
             Q+NS +  G+TVFAPTDNAF++L SGTLN LSDQQK+ L+Q+HV+P   +    QTVSN
Sbjct  65   TQLNSSSSQGLTVFAPTDNAFSSLKSGTLNSLSDQQKVQLVQFHVLPTLLTMPQFQTVSN  124

Query  582  PVRTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
            P+RTQA       + LN T   NQVN+++G V   V N +  D  LAVYQVD+VL+PL  
Sbjct  125  PLRTQAGDGQNGQFPLNITSSGNQVNITTGVVSATVANSVYSDKQLAVYQVDQVLLPLAL  184

Query  402  --TADHPA  385
              T+  PA
Sbjct  185  FGTSSAPA  192



>ref|XP_008783124.1| PREDICTED: fasciclin-like arabinogalactan protein 6 [Phoenix 
dactylifera]
Length=287

 Score =   177 bits (449),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 98/219 (45%), Positives = 135/219 (62%), Gaps = 22/219 (10%)
 Frame = -2

Query  915  FLLVGLAEVKAQAPAP-SPG---GPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVN  748
            FLL+    V AQA AP +PG   GP+ + A+L+K+G Q+   ++ L  TQVG QV  Q+N
Sbjct  52   FLLITAPHVLAQAKAPVAPGPTAGPLSLTAILEKSG-QYTTLLRLLKVTQVGEQVQSQLN  110

Query  747  SPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQ  568
            +  DG+T+FAPTDNAF++L SG LN L+ Q+++ L+ YHV+P++YS    QT SNPVRTQ
Sbjct  111  NSYDGLTIFAPTDNAFSSLKSGALNSLNPQEQVSLVLYHVLPRYYSLTTFQTASNPVRTQ  170

Query  567  ANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF-----  403
            A+G +G  Y +N T  +NQ NVS+G  ET + N L  + PLAVY +DKVL+P D      
Sbjct  171  ASGSNGAVYTVNVTTSSNQANVSTGVDETPISNALYSEFPLAVYSIDKVLLPYDLFGPKP  230

Query  402  --------TADHPAAKA----PTGSASSTPAGKSNDGKN  322
                       H  A A    PT  A +TP+  S  G++
Sbjct  231  PAPAPAPVPKKHKKAPASASGPTSEAETTPSAASLKGRS  269



>gb|AAT37954.1| fasciclin-like AGP 11 [Populus tremula x Populus alba]
Length=238

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 127/201 (63%), Gaps = 14/201 (7%)
 Frame = -2

Query  930  FIVLSFLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQV  751
            F+    L +  +   AQ P+P+P GP +I A+L KAG QF   I+ L +TQ  +Q+N Q+
Sbjct  10   FVPFLMLFLYSSTAFAQTPSPAPSGPTNITAILAKAG-QFTTLIRLLKSTQEADQINTQL  68

Query  750  NSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRT  571
            N+   G+TVFAPTDN+F NL +GTLN LSDQQK+ L+Q+H++P F S  + QTVSNP+RT
Sbjct  69   NNSNQGLTVFAPTDNSFANLKAGTLNSLSDQQKVQLVQFHILPNFLSMSNFQTVSNPLRT  128

Query  570  QA-NGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTAD  394
            QA N  DG+ + LN T   NQVN+++G     V N +  D  L VYQVD+VL+PLD    
Sbjct  129  QAGNSADGE-FPLNVTTSGNQVNITTGVDTATVANTIYTDGQLVVYQVDQVLLPLDLFGT  187

Query  393  HPA-----------AKAPTGS  364
             PA           AKAP GS
Sbjct  188  APAPAPSKPEKDVPAKAPAGS  208



>ref|XP_011006038.1| PREDICTED: fasciclin-like arabinogalactan protein 13 [Populus 
euphratica]
Length=311

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 114/153 (75%), Gaps = 2/153 (1%)
 Frame = -2

Query  879  APAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAF  700
            APAP P GPV+  AVL K GGQF   I+ LN TQ  NQ+  Q+NS ++GMT+FAPTDNAF
Sbjct  28   APAPMPSGPVNFTAVLVK-GGQFTTLIRLLNKTQTFNQIENQLNSSSEGMTIFAPTDNAF  86

Query  699  NNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQ  520
            NNL +G LN L+ Q+++ L+QYH +PKFY+  +L  VSNPV TQA+G DG  +GLNFTGQ
Sbjct  87   NNLKAGALNGLNQQEQVQLLQYHTLPKFYTTSNLLLVSNPVPTQASGQDG-VWGLNFTGQ  145

Query  519  NNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKV  421
            +NQVNVS+G VE Q+ N LR+D PLA    ++V
Sbjct  146  SNQVNVSTGLVEVQINNALRQDFPLAPAHSNEV  178


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = -2

Query  879  APAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAP  715
            APAP P GPV+  AVL K GGQF   I+ LN TQ  NQ+  Q+NS ++GMT+FAP
Sbjct  230  APAPMPSGPVNFTAVLVK-GGQFATLIRLLNKTQTFNQIENQLNSSSEGMTIFAP  283



>gb|EYU18853.1| hypothetical protein MIMGU_mgv1a026916mg [Erythranthe guttata]
Length=236

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 115/174 (66%), Gaps = 1/174 (1%)
 Frame = -2

Query  924  VLSFLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNS  745
            +L  L      V AQ PAP+P GP +I  +L+KAG Q+   I+    TQ+ +Q+N Q+N+
Sbjct  1    MLLCLFQCATTVVAQTPAPAPAGPTNITKILEKAG-QYTTLIRLCKITQICDQINTQLNN  59

Query  744  PTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQA  565
               G+TVFAPTDNAF+NLP+GTLN L+DQQK+ L+Q+H++P F S    QTVSNP+RTQA
Sbjct  60   SNQGLTVFAPTDNAFSNLPAGTLNSLTDQQKVSLVQFHILPAFLSMSQFQTVSNPLRTQA  119

Query  564  NGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
                   + LN T   +QVNVS+G  +  V N +  D  LAVYQVDKVL+PL  
Sbjct  120  GDSAAGAFPLNVTTSGSQVNVSTGVNDATVANTVYSDNQLAVYQVDKVLLPLSL  173



>ref|XP_004243817.1| PREDICTED: fasciclin-like arabinogalactan protein 9 [Solanum 
lycopersicum]
Length=250

 Score =   174 bits (441),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 107/228 (47%), Positives = 143/228 (63%), Gaps = 27/228 (12%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            VD++ +L+  GG++  FIKFL  T+VG+++N + NS +DG+TV APTDNAF NL    +N
Sbjct  35   VDVYHILE-GGGEYNTFIKFLKETKVGDRINYKANS-SDGVTVLAPTDNAFKNL----IN  88

Query  672  KLSDQQKIL--LIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVS  499
             +SD +  L  LI YHVI KFY F++LQTV NPV T A G D +  GLNFTG+ NQ+NVS
Sbjct  89   SISDDEHKLQQLINYHVISKFYEFDELQTVHNPVETLATGEDNEPLGLNFTGKKNQLNVS  148

Query  498  SGAVETQVYNP---LRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGKSN--  334
            SG V T VY     +  DPPLAVY++DKVLVP +F       K+P+ + +  PA   N  
Sbjct  149  SGYVVTNVYEKAISISTDPPLAVYKLDKVLVPSEFI----DPKSPSSNDAPAPAKAKNGT  204

Query  333  -DGKNATAAKEPSP------APNGAGKMSLELGLVTGI-LVFCMGLLS  214
             D    TA  +PSP       PN A +++  +G++  I  VF MG LS
Sbjct  205  SDDDEITADDKPSPITAAATKPNDAKRIN--VGILCLISCVFLMGQLS  250



>ref|XP_011015335.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Populus 
euphratica]
Length=238

 Score =   173 bits (439),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 122/186 (66%), Gaps = 14/186 (8%)
 Frame = -2

Query  885  AQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDN  706
            AQ P+P+P GP +I A+L KAG QF   I+ L +TQ  +Q+N Q+N+   G+TVFAPTDN
Sbjct  25   AQTPSPAPSGPTNITAILAKAG-QFTTLIRLLKSTQEADQINTQLNNSNQGLTVFAPTDN  83

Query  705  AFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQA-NGPDGKTYGLNF  529
            +F NL +GTLN LSDQQK+ L+Q+H++P F S  + QTVSNP+RTQA N  DG+ + LN 
Sbjct  84   SFANLKAGTLNSLSDQQKVQLVQFHILPNFLSMSNFQTVSNPLRTQAGNSADGE-FPLNV  142

Query  528  TGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPA-----------A  382
            T   NQVN+++G     V N +  D  L VYQVD+VL+PLD     PA           A
Sbjct  143  TTSGNQVNITTGVDTATVANTIYTDGQLVVYQVDQVLLPLDLFGTAPAPAPSKPEKDVPA  202

Query  381  KAPTGS  364
            KAP GS
Sbjct  203  KAPAGS  208



>ref|XP_002285068.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Vitis vinifera]
Length=244

 Score =   173 bits (439),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 114/161 (71%), Gaps = 3/161 (2%)
 Frame = -2

Query  885  AQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDN  706
            +QAPAPS  GP +I  +L+KAG Q+ I I+ +  TQV +Q+N Q+N+   G+TVFAPTDN
Sbjct  26   SQAPAPS--GPTNITQILEKAG-QYTILIRLMKGTQVADQINTQLNNSNQGLTVFAPTDN  82

Query  705  AFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFT  526
            AF+ L +GTLN L+DQQK+ LIQ+HV+P F S    QTVSNP+RTQA   +   + LN T
Sbjct  83   AFSTLKAGTLNSLTDQQKVQLIQFHVVPNFLSISQFQTVSNPLRTQAGNSNNGEFPLNVT  142

Query  525  GQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
               NQVNVS+G V+  V N +  D  LAVYQVDKVL+PLD 
Sbjct  143  TSGNQVNVSTGIVDATVANTVYTDNQLAVYQVDKVLLPLDI  183



>ref|XP_006381469.1| fasciclin-like AGP 13 family protein [Populus trichocarpa]
 gb|ERP59266.1| fasciclin-like AGP 13 family protein [Populus trichocarpa]
Length=227

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 119/174 (68%), Gaps = 4/174 (2%)
 Frame = -2

Query  921  LSFLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSP  742
            L F L G   V AQ P+P+P GP +I A+L+KAG QF   I+ + +TQ  +Q+N Q+N+ 
Sbjct  13   LMFFLYGSTTV-AQTPSPAPSGPTNITAILEKAG-QFTTLIRLMKSTQEADQINTQLNNS  70

Query  741  TDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQA-  565
              G+TVFAP DNAF NL +GTLN LSDQQK+ L+Q+H+IP F+S    QTVSNP+RTQA 
Sbjct  71   NQGLTVFAPPDNAFTNLKAGTLNSLSDQQKVQLVQFHIIPNFFSMSSFQTVSNPLRTQAG  130

Query  564  NGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
            N  DG+ + LN T   NQVN+++G     V N +  D  L VYQVD+VL+PLD 
Sbjct  131  NSADGE-FPLNVTTSGNQVNITTGVNTATVANTIFTDGQLVVYQVDQVLLPLDL  183



>ref|XP_011089317.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Sesamum 
indicum]
Length=248

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 111/159 (70%), Gaps = 1/159 (1%)
 Frame = -2

Query  885  AQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDN  706
            AQ PAP P GP +I  +L+KAG QF   I+    TQVG+Q+N Q+N+   G+T+FAPTDN
Sbjct  26   AQTPAPGPSGPTNITKILEKAG-QFTTLIRLFQITQVGDQINTQLNNSNQGLTLFAPTDN  84

Query  705  AFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFT  526
            AF++L +GTLN LSDQQK+ L+Q+H++P F S    QTVSNP+RTQA       Y LN T
Sbjct  85   AFSSLQAGTLNSLSDQQKVSLVQFHILPTFLSMSQFQTVSNPLRTQAGDSAAGEYPLNVT  144

Query  525  GQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPL  409
              +NQVN+S+G  +  V N +  D  LAVYQVDKVL+PL
Sbjct  145  TASNQVNISTGVDDATVANTIYTDGQLAVYQVDKVLLPL  183



>ref|XP_009620250.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Nicotiana 
tomentosiformis]
Length=248

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 114/166 (69%), Gaps = 1/166 (1%)
 Frame = -2

Query  900  LAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVF  721
            L  V+  A AP+P GP +I  +L+KAG QF  FI+ L TTQ G+Q+N Q+N+   GMTVF
Sbjct  21   LTLVQTSAAAPAPSGPTNITKILEKAG-QFTTFIRLLKTTQAGDQINTQLNNSNQGMTVF  79

Query  720  APTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTY  541
            APTDNAF++L +GTLN LS QQ++ L+Q+H++P F S    QTVSNP+RTQA       +
Sbjct  80   APTDNAFSSLKAGTLNSLSSQQQVSLVQFHLLPNFISISQFQTVSNPLRTQAGDTGPGDF  139

Query  540  GLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
             LN T   NQVNVS+G V+  V N +  D  LAVYQVDKVL PL+ 
Sbjct  140  PLNVTTLGNQVNVSTGIVDATVANTIYTDGELAVYQVDKVLQPLNI  185



>ref|XP_010232123.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Brachypodium 
distachyon]
Length=250

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 127/199 (64%), Gaps = 16/199 (8%)
 Frame = -2

Query  885  AQAPAP--SPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSP--TDGMTVFA  718
            AQAPAP  +P GP ++ A+L K GGQ+  FI+ +  TQ   Q+N Q+N+    +G TVFA
Sbjct  25   AQAPAPDATPSGPPNVTAILVK-GGQYTTFIRLMKETQQDTQLNSQLNNSFNGNGYTVFA  83

Query  717  PTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYG  538
            PTDNAFNNL  GTLN L+ QQ++ L+Q HV+P+FYS E  QT SNPVRTQA+G DG  + 
Sbjct  84   PTDNAFNNLKPGTLNSLTQQQQVALVQGHVLPQFYSMESFQTASNPVRTQASGQDGP-FT  142

Query  537  LNFTGQ-NNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF---------TADHP  388
            LN T   NNQVNVSSG  E  V N L    PLAVY VDKVL+PL+F          A   
Sbjct  143  LNITATANNQVNVSSGVSEVTVNNALSDKKPLAVYSVDKVLLPLEFFGAKAPAAAPAASK  202

Query  387  AAKAPTGSASSTPAGKSND  331
              K   G A+S PAG  ++
Sbjct  203  DGKTKKGEAASGPAGSDDE  221



>emb|CAN60933.1| hypothetical protein VITISV_022591 [Vitis vinifera]
Length=214

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 110/157 (70%), Gaps = 1/157 (1%)
 Frame = -2

Query  873  APSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNN  694
            AP+P GP +I  +L+KAG Q+ I I+ +  TQV +Q+N Q+ +   G+TVFAPTDNAF+ 
Sbjct  12   APAPSGPTNITQILEKAG-QYTILIRLMKGTQVADQINTQLXNSNQGLTVFAPTDNAFST  70

Query  693  LPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNN  514
            L +GTLN L+DQQK+ LIQ+HV+P F S    QTVSNP+RTQA   +   + LN T   N
Sbjct  71   LKAGTLNSLTDQQKVQLIQFHVVPNFLSISQFQTVSNPLRTQAGNSNNGEFPLNVTTSGN  130

Query  513  QVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
            QVNVS+G V+  V N +  D  LAVYQVDKVL+PLD 
Sbjct  131  QVNVSTGIVDATVANTVYTDNQLAVYQVDKVLLPLDI  167



>ref|XP_009760303.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Nicotiana 
sylvestris]
Length=250

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 114/168 (68%), Gaps = 3/168 (2%)
 Frame = -2

Query  900  LAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVF  721
            LA+  A  PAPS  GP +I  +L+KAG QF  FI+ L TTQ G+Q+N Q+N+   GMTVF
Sbjct  23   LAQTSATVPAPS--GPTNITKILEKAG-QFTTFIRLLKTTQAGDQINTQLNNSKQGMTVF  79

Query  720  APTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTY  541
            APTDNAF++L +GTLN LS QQ++ L+Q+H++P F S    QTVSNP+RTQA       +
Sbjct  80   APTDNAFSSLKAGTLNSLSSQQQVSLVQFHLLPNFISISQFQTVSNPLRTQAGDTSPGDF  139

Query  540  GLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTA  397
             LN T   NQVNVS+G V+  V N +  D  LAVYQVDKVL PL   A
Sbjct  140  PLNVTTLGNQVNVSTGIVDATVANTIYTDGELAVYQVDKVLQPLSIFA  187



>ref|XP_011048566.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Populus 
euphratica]
Length=239

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 118/174 (68%), Gaps = 4/174 (2%)
 Frame = -2

Query  921  LSFLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSP  742
            L F L     V AQ P+P+P GP +I A+L+KAG QF   I+ + +TQV +Q+N Q+N+ 
Sbjct  13   LMFFLYSSTTV-AQTPSPAPSGPTNITAILEKAG-QFTTLIRLMKSTQVADQINTQLNNS  70

Query  741  TDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQA-  565
              G+TVFAP DNAF NL +G LN LSDQQK+ L+Q+H+IP F S  + QTVSNP+RTQA 
Sbjct  71   NQGLTVFAPPDNAFTNLKAGALNSLSDQQKVQLVQFHIIPNFLSMSNFQTVSNPLRTQAG  130

Query  564  NGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
            N  DG+ + LN T   NQVN+++G     V N +  D  L VYQVD+VL+PLD 
Sbjct  131  NSADGE-FPLNVTTSGNQVNITTGVNTATVANTIFTDGQLVVYQVDQVLLPLDL  183



>ref|XP_010919222.1| PREDICTED: fasciclin-like arabinogalactan protein 9 [Elaeis guineensis]
Length=253

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 119/168 (71%), Gaps = 5/168 (3%)
 Frame = -2

Query  900  LAEVKAQ--APAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMT  727
            L   +AQ  AP P+P  P+++ AVL+K GGQ+   I+ L TTQV  QVN Q+N+  +G+T
Sbjct  17   LVRARAQPVAPGPTPA-PLNLTAVLEK-GGQYTTLIRLLRTTQVEQQVNSQLNNSFNGLT  74

Query  726  VFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGK  547
            VFAPTDNAFN+L +GTLN LS Q+++ L+ +HV+P+FYS    +T SNPV+TQA+  +G 
Sbjct  75   VFAPTDNAFNSLKAGTLNGLSQQEQVALVLFHVLPRFYSLSSFETTSNPVQTQASSNNG-  133

Query  546  TYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
             Y +N T   +QVN+S+G V T V N LR D PLAVY +DKVL+P D 
Sbjct  134  VYTVNITSTTSQVNISTGVVSTPVTNTLRSDFPLAVYSIDKVLLPYDL  181



>ref|XP_010558264.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Tarenaya 
hassleriana]
Length=243

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 117/157 (75%), Gaps = 4/157 (3%)
 Frame = -2

Query  873  APSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTD-GMTVFAPTDNAFN  697
            AP+P GP +I AVL+KAG QF  F++ L +TQ  +Q+N Q+NS ++ G+TVFAPTDNAFN
Sbjct  22   APTPSGPTNITAVLEKAG-QFTTFMRLLKSTQAADQINTQLNSSSNQGLTVFAPTDNAFN  80

Query  696  NLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQA-NGPDGKTYGLNFTGQ  520
            +L SGTLN LSDQQK+ L+Q+HV+P   +    QTVSNP+RTQA +G +GK + LN T  
Sbjct  81   SLKSGTLNSLSDQQKVQLVQFHVLPTLLTMSQFQTVSNPLRTQAGDGQNGK-FPLNITSS  139

Query  519  NNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPL  409
             NQVN+++G V+  V N +  D  L+VYQVD+VL+PL
Sbjct  140  GNQVNITTGVVQATVANTIYSDKQLSVYQVDQVLLPL  176



>ref|XP_009406930.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Musa acuminata 
subsp. malaccensis]
Length=267

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 137/215 (64%), Gaps = 11/215 (5%)
 Frame = -2

Query  927  IVLSFLLVGLAEVKAQ-APAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQV  751
            I L FL+  +    AQ A +P+P GP +I AVL+KAG +FG FI+ L +T VG+Q+N Q+
Sbjct  31   ITLLFLVQFIVVTSAQLAESPAPAGPPNITAVLEKAG-EFGTFIRLLKSTHVGDQINNQL  89

Query  750  NSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRT  571
            N+  +G+T+FAPTD+AF++LPSGT+N L+DQQ++ LIQ+H +P   S    QT+SNPVRT
Sbjct  90   NNSVNGITIFAPTDSAFSSLPSGTMNSLTDQQQVALIQFHELPYIVSISQFQTISNPVRT  149

Query  570  QANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF----  403
            QA   +   Y LN T   N VN+++G V T + + +  D  LAVY++D+VL+PL+     
Sbjct  150  QAGDVNNGRYPLNVTTIGNSVNITTGIVNTSIASTVYSDSQLAVYKLDQVLLPLEIFGPP  209

Query  402  ----TADHPAAKAPTGSASSTPAGKSNDGKNATAA  310
                      +K    S + +P+G S D   ATAA
Sbjct  210  APAAAPAPNKSKKKESSIAESPSGTS-DSSGATAA  243



>ref|XP_002323464.1| fasciclin-like AGP 13 family protein [Populus trichocarpa]
 gb|ABK92660.1| unknown [Populus trichocarpa]
 gb|EEF05225.1| fasciclin-like AGP 13 family protein [Populus trichocarpa]
Length=239

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 114/162 (70%), Gaps = 3/162 (2%)
 Frame = -2

Query  885  AQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDN  706
            AQ P+P+P GP +I A+L KAG QF   I+ L +TQ  +Q+N Q+N+   G+TVFAPTDN
Sbjct  24   AQTPSPAPSGPTNITAILAKAG-QFTTLIRLLKSTQEADQINTQLNNSNQGLTVFAPTDN  82

Query  705  AFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQA-NGPDGKTYGLNF  529
            +F NL +GTLN LSDQQK+ L+Q+H++P F S  + QTVSNP+RTQA N  DG+ + LN 
Sbjct  83   SFANLKAGTLNSLSDQQKVQLVQFHILPNFLSMSNFQTVSNPLRTQAGNSADGE-FPLNV  141

Query  528  TGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
            T   NQVN+++G     V N +  D  L VYQVD+VL+PLD 
Sbjct  142  TTSGNQVNITTGVNTATVANTIYTDGQLVVYQVDQVLLPLDL  183



>ref|XP_008798339.1| PREDICTED: fasciclin-like arabinogalactan protein 9 [Phoenix 
dactylifera]
Length=246

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 133/204 (65%), Gaps = 10/204 (5%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            V++ AVL+K GGQ+ IFI+ L  TQV  Q+N Q+N+  +G+TVFAPTDNAFN+L SGTLN
Sbjct  39   VNLTAVLEK-GGQYNIFIRLLRATQVEQQINSQLNNSFNGLTVFAPTDNAFNSLQSGTLN  97

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSG  493
             LS Q+++ L+ YHV+P++YS    QT SNPVRTQA+G +G  Y LN T   +Q N+S+G
Sbjct  98   SLSQQEQVALVLYHVLPRYYSLSMFQTTSNPVRTQASGSNG-VYTLNVTSTTSQANISTG  156

Query  492  AVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGKSNDGKNATA  313
             V+  V N L+ D PLAVY V+KVL+P D     P A A   +      GK+ DG +A A
Sbjct  157  VVDAPVTNTLKSDFPLAVYSVEKVLLPYDLFGAKPPAPALAPAKD--KPGKA-DGPSAEA  213

Query  312  AKEPSPA----PNGAGKMSLELGL  253
               PS A      GAG+ S  +GL
Sbjct  214  ESNPSAAVSLKRRGAGR-SFVVGL  236



>ref|XP_006480613.1| PREDICTED: fasciclin-like arabinogalactan protein 11-like [Citrus 
sinensis]
 gb|KDO44237.1| hypothetical protein CISIN_1g026047mg [Citrus sinensis]
Length=244

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 127/213 (60%), Gaps = 1/213 (0%)
 Frame = -2

Query  930  FIVLSFLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQV  751
            F +L   L+   +  AQ PA +  GP +I A+L+K GGQF  FI+ L  TQ  +Q+N Q+
Sbjct  9    FFLLLVSLLHCIKTSAQVPAAALSGPPNITAILEK-GGQFTSFIRLLENTQQDDQINTQL  67

Query  750  NSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRT  571
            N+   G+TVFAPTDNAF NL SGT+N LSDQQK+ L+Q+H++P   S    QT SNP+RT
Sbjct  68   NNSNQGLTVFAPTDNAFANLKSGTINSLSDQQKVQLVQFHILPTSMSTSQFQTASNPLRT  127

Query  570  QANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADH  391
            QA   +   + LN T   NQVN+++G  E  V N +     LAVYQVD+VL+PLD     
Sbjct  128  QAGNSNDGEFPLNVTTSGNQVNLTTGVNEATVANTVFSGSNLAVYQVDQVLLPLDLFGSQ  187

Query  390  PAAKAPTGSASSTPAGKSNDGKNATAAKEPSPA  292
              A AP+      P   +  G +  A+ + S A
Sbjct  188  APAPAPSTPEKDVPVAATPKGSSTDASVDTSRA  220



>gb|KDP29103.1| hypothetical protein JCGZ_16492 [Jatropha curcas]
Length=241

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 116/176 (66%), Gaps = 2/176 (1%)
 Frame = -2

Query  930  FIVLSFLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQV  751
            F+ L F+L   A   AQ P+P+P GP +I A+L+KAG QF  FIK + +TQ  +Q+N Q+
Sbjct  10   FLFLIFILYSSASY-AQNPSPAPSGPTNITAILEKAG-QFTTFIKLMKSTQEADQINTQL  67

Query  750  NSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRT  571
            N+   G+TVFAP DNAF NL  GTLN L+DQ K+ L+Q+H++P F +    QTVSNP+RT
Sbjct  68   NNSNQGLTVFAPPDNAFANLKPGTLNSLTDQGKVQLVQFHILPSFIAMSQFQTVSNPLRT  127

Query  570  QANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
            QA       + LN T   NQVNV++G     V N +  D  LAVYQVD+VL+PLD 
Sbjct  128  QAGNSANGEFPLNVTTSGNQVNVTTGVDTATVANTIYTDGSLAVYQVDQVLLPLDL  183



>ref|XP_002275538.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Vitis vinifera]
 emb|CAN68230.1| hypothetical protein VITISV_008024 [Vitis vinifera]
 emb|CBI32715.3| unnamed protein product [Vitis vinifera]
Length=239

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 99/229 (43%), Positives = 143/229 (62%), Gaps = 7/229 (3%)
 Frame = -2

Query  951  MAKAAVSFIVLSFLLVGL-AEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQV  775
            M K  +S ++L F L    A  ++ APAP+P GP++I +VLKK+G ++  FI+ L +TQ+
Sbjct  1    MLKQPLSTLLLIFFLHCTPASGQSSAPAPAPSGPINIVSVLKKSG-KYTTFIRLLKSTQI  59

Query  774  GNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQ  595
             +Q+N Q+N    G+TVFAPTD+AF+NL  G LN L+DQQK  L+Q+HV+P F S    Q
Sbjct  60   DDQINSQLNDLNQGLTVFAPTDSAFSNLKPGMLNSLTDQQKFQLVQFHVVPSFLSIPQFQ  119

Query  594  TVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLV  415
            TVSNP+RTQA G   + + LN T   NQVN+++G V T + N L  D  LAVY++D+VL+
Sbjct  120  TVSNPLRTQAGGGTAQ-FPLNITMSGNQVNMTTGRVNTSLTNTLYTDGQLAVYEIDQVLL  178

Query  414  PLD-FTADHPAAKAPTGSASSTPAGKSNDGKNATAAKEPSPAPNGAGKM  271
                F    PA    T   S  P+G +    +++ AK+    P+ A K+
Sbjct  179  AEGLFRPPAPAPPPKTSDPSDAPSGSNGASDDSSDAKD---RPHSAQKL  224



>gb|AAT37956.1| fasciclin-like AGP 13 [Populus tremula x Populus alba]
Length=239

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 126/210 (60%), Gaps = 19/210 (9%)
 Frame = -2

Query  921  LSFLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSP  742
            L F L     V AQ P+P+P GP +I A+L+KAG QF   I+ + +TQ  +Q+N Q+N+ 
Sbjct  13   LMFFLYSSTTV-AQTPSPAPSGPTNITAILEKAG-QFTTLIRLMKSTQEADQINTQLNNS  70

Query  741  TDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQA-  565
              G+TVFAP DNAF NL +G LN LSDQQK+ L+Q+H+IP F S    QTVSNP+RTQA 
Sbjct  71   NQGLTVFAPPDNAFANLKAGALNSLSDQQKVQLVQFHIIPNFLSMSSFQTVSNPLRTQAG  130

Query  564  NGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF------  403
            N  DG+ + LN T   NQVN+++G     V N +  D  L VYQVD+VL+PLD       
Sbjct  131  NSADGE-FPLNVTTSGNQVNITTGVNTATVANTIFTDGQLVVYQVDQVLLPLDLFGTAAA  189

Query  402  --------TADHPAAKAPTGSASSTPAGKS  337
                      D P AKAP GS     A  S
Sbjct  190  PAPAPSKPDKDVP-AKAPAGSKEDASADAS  218



>ref|XP_009786976.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Nicotiana 
sylvestris]
Length=247

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 108/157 (69%), Gaps = 1/157 (1%)
 Frame = -2

Query  879  APAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAF  700
            A AP+P GP +I  +L+KAG QF   I+ +  TQVG+Q+N Q+N+   GMTVFAPTDNAF
Sbjct  27   ATAPAPSGPTNITKILEKAG-QFTTLIRLMKVTQVGDQINTQLNNSNQGMTVFAPTDNAF  85

Query  699  NNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQ  520
            +NL SGT+N LS QQ++ L+Q+HV+P F S    QTVSNP+RTQA       + LN T  
Sbjct  86   SNLKSGTINSLSAQQQVQLVQFHVLPNFISMTQFQTVSNPLRTQAGDASPGEFPLNVTTS  145

Query  519  NNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPL  409
             NQVNVS+G  +  V N +  D  LAVYQVDKVL PL
Sbjct  146  GNQVNVSTGVDDATVANTIYTDGQLAVYQVDKVLQPL  182



>ref|XP_010924403.1| PREDICTED: fasciclin-like arabinogalactan protein 9 [Elaeis guineensis]
Length=245

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 107/149 (72%), Gaps = 1/149 (1%)
 Frame = -2

Query  849  DIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNK  670
            ++ AVL+K GGQ+   I+ L  TQV  Q+N Q+N+  +G+TVFAPTDNAFN L +GTLN 
Sbjct  39   NLTAVLEK-GGQYNTLIRLLRATQVEQQINSQLNNSFNGLTVFAPTDNAFNTLKAGTLNS  97

Query  669  LSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGA  490
            LS QQ++ L+ YHV+P++YS    QT SNPVRTQA+G +G  Y +N T   +Q NVS+G 
Sbjct  98   LSQQQQVALVLYHVLPRYYSLSTFQTTSNPVRTQASGSNGGVYTINVTSTPSQANVSTGV  157

Query  489  VETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
            V+T + N L+ D PLAVY VD+VL+P + 
Sbjct  158  VDTPISNTLKSDFPLAVYSVDRVLLPYEL  186



>ref|XP_010916030.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Elaeis 
guineensis]
Length=254

 Score =   166 bits (420),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 123/176 (70%), Gaps = 6/176 (3%)
 Frame = -2

Query  918  SFLLVGLAEVKAQAPAP-SPG---GPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQV  751
            +FLLV    + AQA  P +PG   GP+++ A+L+K GGQ+   ++ L  TQVG QV  Q+
Sbjct  17   AFLLVTAPHLLAQAKTPVAPGPTAGPLNVTAILEK-GGQYTTLLRLLKETQVGEQVQSQL  75

Query  750  NSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRT  571
            N+  DG+T+FAPTDNAF++L SGTLN L+ Q+++ L+ YHV+P+FYS    QT SNPVRT
Sbjct  76   NNSYDGLTIFAPTDNAFSSLKSGTLNGLNPQEQVSLVLYHVLPRFYSLTTFQTTSNPVRT  135

Query  570  QANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
            QA+G +G  Y +N T  +NQVNVS+G  +  + + L  D PLAVY +DKVL+P D 
Sbjct  136  QASGNNG-VYMINVTTSSNQVNVSTGVDDAPINDDLYSDFPLAVYSIDKVLLPYDL  190



>ref|NP_001130967.1| uncharacterized protein LOC100192072 precursor [Zea mays]
 gb|ACF79374.1| unknown [Zea mays]
 tpg|DAA58200.1| TPA: hypothetical protein ZEAMMB73_687790 [Zea mays]
Length=249

 Score =   166 bits (420),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 127/201 (63%), Gaps = 8/201 (4%)
 Frame = -2

Query  867  SPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPT----DGMTVFAPTDNAF  700
            +P GP ++ A+L+K GGQF +F++ +  TQ   Q+N Q+NS       G TVFAPTDNAF
Sbjct  31   TPSGPPNVTAILEK-GGQFTMFMRLMKETQQDTQLNSQLNSSYASSGGGYTVFAPTDNAF  89

Query  699  NNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQ  520
            NNL  GTLN L+ QQ++ L+Q HV+P+FYS +  QT SNPVRTQA+G DG  Y LN T  
Sbjct  90   NNLKPGTLNSLTQQQQVALVQGHVLPQFYSMDSFQTASNPVRTQASGRDGP-YTLNITAT  148

Query  519  -NNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAG  343
             NNQVNVSSG  E  + N L    PLAVY VDKVL+PL+       A AP  S      G
Sbjct  149  ANNQVNVSSGVAEVTINNALSAVKPLAVYSVDKVLLPLELFGAKAPAAAPAASQGKPKKG  208

Query  342  KSNDGKNATAAKEPSPAPNGA  280
             S+D  + +A  + + AP GA
Sbjct  209  GSSDAPSGSAGSDDA-APTGA  228



>ref|XP_009612445.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Nicotiana 
tomentosiformis]
Length=248

 Score =   166 bits (419),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 108/157 (69%), Gaps = 1/157 (1%)
 Frame = -2

Query  879  APAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAF  700
            A AP+P GP +I  +L+KAG QF   I+ +  TQVG+Q+N Q+N+   GMTVFAPTDNAF
Sbjct  27   AIAPAPSGPTNITKILEKAG-QFTTLIRLMKVTQVGDQINTQLNNSNQGMTVFAPTDNAF  85

Query  699  NNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQ  520
            +NL SGT+N LS QQ++ L+Q+HV+P F S    QTVSNP+RTQA       + LN T  
Sbjct  86   SNLKSGTINSLSAQQQVQLVQFHVLPNFISMTQFQTVSNPLRTQAGDASPGDFPLNVTTS  145

Query  519  NNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPL  409
             NQVNVS+G  +  V N +  D  LA+YQVDKVL PL
Sbjct  146  GNQVNVSTGVDDATVANTIYTDGQLALYQVDKVLQPL  182



>ref|XP_006428804.1| hypothetical protein CICLE_v10012588mg [Citrus clementina]
 gb|ESR42044.1| hypothetical protein CICLE_v10012588mg [Citrus clementina]
Length=244

 Score =   165 bits (418),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 122/201 (61%), Gaps = 1/201 (0%)
 Frame = -2

Query  894  EVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAP  715
            +  AQ PA +  GP +I A+L+K GGQF  FI+ L  TQ  +Q+N Q+N+   G+TVFAP
Sbjct  21   KTSAQVPAAALSGPPNITAILEK-GGQFTSFIRLLENTQQDDQINTQLNNSNQGLTVFAP  79

Query  714  TDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGL  535
            TDNAF NL SGT+N LSDQQK+ L+Q+H++P   S    QT SNP+RTQA   +   + L
Sbjct  80   TDNAFANLKSGTINSLSDQQKVQLVQFHILPTSMSTSQFQTASNPLRTQAGNSNDGEFPL  139

Query  534  NFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASS  355
            N T   NQVN+++G  E  V N +     LAVYQVD+VL+PLD       A AP+     
Sbjct  140  NVTTSGNQVNLTTGVNEATVANTVFSGSNLAVYQVDQVLLPLDLFGSQAPAPAPSTPEKD  199

Query  354  TPAGKSNDGKNATAAKEPSPA  292
             P   +  G +  A+ + S A
Sbjct  200  VPVAATPKGSSTDASVDTSRA  220



>ref|XP_008449261.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Cucumis 
melo]
Length=248

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 100/223 (45%), Positives = 133/223 (60%), Gaps = 14/223 (6%)
 Frame = -2

Query  936  VSFIVLSFLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNI  757
            +SF ++S L       ++  P P P GP +I A+L+K GGQF  FIK L +TQ  +Q+N 
Sbjct  8    ISFFLISLLFSESVSAQSTQP-PGPSGPTNISAILEK-GGQFSTFIKLLKSTQQSDQINN  65

Query  756  QVNSPTDG--MTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSN  583
            Q+N+   G  +TVFAP DNAF+NL  GTLN LSDQQK+ L+QYHV+P F S    QTVSN
Sbjct  66   QLNNSNQGQGLTVFAPPDNAFSNLKPGTLNSLSDQQKVQLVQYHVVPTFISMSQFQTVSN  125

Query  582  PVRTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
            P+RTQA   +   + LN T   +QVN+++G  +  V N +  D  LAVYQVDKVL+P+D 
Sbjct  126  PLRTQAGNSNAGQFPLNVTTSGSQVNLTTGVDDAVVANTIYTDGQLAVYQVDKVLLPVDL  185

Query  402  --------TADHPAAKAPTGSASSTPAGKSNDGKNATAAKEPS  298
                     A     KA +GS +  PAG S D  +      P+
Sbjct  186  FGTVAAPAPAPSKPVKAVSGSDA--PAGASKDTSSDDTGAAPA  226



>gb|AFK36413.1| unknown [Medicago truncatula]
 gb|AES81833.2| fasciclin-like arabinogalactan protein [Medicago truncatula]
Length=256

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 117/171 (68%), Gaps = 3/171 (2%)
 Frame = -2

Query  915  FLLVGLAEVKAQAPA--PSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSP  742
            F++V L +  +  PA  P+P GP++I  VL+KAG QF  FIK L  TQV +++N Q+N+ 
Sbjct  16   FIIVTLFQRISAQPAISPAPSGPLNITKVLEKAG-QFTTFIKLLKATQVSDRINSQLNNS  74

Query  741  TDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQAN  562
              G+T+FAPTDNAF++L SGTLN +S Q ++ L+Q+H++P  Y+    QT SNP+ TQA 
Sbjct  75   NQGLTIFAPTDNAFSSLKSGTLNSISTQNQLQLLQFHILPTLYTISQFQTASNPLHTQAG  134

Query  561  GPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPL  409
              D   Y LN T   NQVNV++G ++T V N +  D  LAVYQVD+VL+P+
Sbjct  135  NSDDGEYPLNVTTSGNQVNVTTGVIDTTVSNTIYSDNQLAVYQVDQVLLPM  185



>ref|XP_003625615.1| Fasciclin-like arabinogalactan protein [Medicago truncatula]
Length=258

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 117/171 (68%), Gaps = 3/171 (2%)
 Frame = -2

Query  915  FLLVGLAEVKAQAPA--PSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSP  742
            F++V L +  +  PA  P+P GP++I  VL+KAG QF  FIK L  TQV +++N Q+N+ 
Sbjct  16   FIIVTLFQRISAQPAISPAPSGPLNITKVLEKAG-QFTTFIKLLKATQVSDRINSQLNNS  74

Query  741  TDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQAN  562
              G+T+FAPTDNAF++L SGTLN +S Q ++ L+Q+H++P  Y+    QT SNP+ TQA 
Sbjct  75   NQGLTIFAPTDNAFSSLKSGTLNSISTQNQLQLLQFHILPTLYTISQFQTASNPLHTQAG  134

Query  561  GPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPL  409
              D   Y LN T   NQVNV++G ++T V N +  D  LAVYQVD+VL+P+
Sbjct  135  NSDDGEYPLNVTTSGNQVNVTTGVIDTTVSNTIYSDNQLAVYQVDQVLLPM  185



>ref|XP_008789092.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Phoenix 
dactylifera]
Length=241

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 104/229 (45%), Positives = 138/229 (60%), Gaps = 10/229 (4%)
 Frame = -2

Query  951  MAKAAVSFIVLSFLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVG  772
            M    +  I L FLL     +   A AP+P GP +I  +L+KAG QF  F++ L +TQVG
Sbjct  1    MEHITIYAITLPFLLFMTQTLAQPAAAPAPPGPTNITKILEKAG-QFTTFMRLLKSTQVG  59

Query  771  NQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQT  592
            +Q+N Q+N+   G+TVFAP+DNAF++L +G LN L+DQQK+ LIQ+HV+P F S    QT
Sbjct  60   DQINQQLNNSNSGLTVFAPSDNAFSSLSAGILNSLTDQQKVALIQFHVLPSFISTTQFQT  119

Query  591  VSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVP  412
            VSNP+RTQA   +   + LN T   N VN+++G V T V N +  D  LAVYQVD+VL+P
Sbjct  120  VSNPLRTQAGDVNNGQFPLNVTTTGNTVNITTGIVNTTVSNTIYSDNQLAVYQVDQVLLP  179

Query  411  LDFTADHPAAKAPTGSASSTPAGKSNDGKNATAAKEPSPAPNGAGKMSL  265
            LD    H  A AP     S P  K    K A  A+ PS     +  +SL
Sbjct  180  LDIFGPHAPAPAP-----SIPKKK----KAAPIAEGPSSTSKDSAAVSL  219



>ref|XP_002458287.1| hypothetical protein SORBIDRAFT_03g030690 [Sorghum bicolor]
 gb|EES03407.1| hypothetical protein SORBIDRAFT_03g030690 [Sorghum bicolor]
Length=248

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 116/168 (69%), Gaps = 9/168 (5%)
 Frame = -2

Query  885  AQAPAP--SPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSP----TDGMTV  724
            AQAP P  +P GP ++ AVL+K GGQ+ +F++ +  TQ   Q+N Q+NS       G TV
Sbjct  24   AQAPGPAATPSGPPNVTAVLEK-GGQYTMFMRLMKETQQDTQLNSQLNSSFASNGGGYTV  82

Query  723  FAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKT  544
            FAPTDNAFN+L  GTLN L+ QQ++ L+Q HV+P+FYS +  QT SNPVRTQA+G DG  
Sbjct  83   FAPTDNAFNSLKPGTLNSLTQQQQVALVQGHVLPQFYSMDSFQTASNPVRTQASGRDGP-  141

Query  543  YGLNFTG-QNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
            Y LN T   NNQ+NVS+G VE  V N L    PLAVY VDKVL+PL+ 
Sbjct  142  YTLNVTSTTNNQLNVSTGVVEVTVNNALSAVKPLAVYSVDKVLLPLEL  189



>ref|XP_006826651.1| hypothetical protein AMTR_s00393p00013250 [Amborella trichopoda]
 gb|ERM93888.1| hypothetical protein AMTR_s00393p00013250 [Amborella trichopoda]
Length=237

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 115/176 (65%), Gaps = 3/176 (2%)
 Frame = -2

Query  858  GPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGT  679
             P ++  +L +AG QF + I+ L +TQV NQ+   +N+   G+T+FAPTDNAFN+LP GT
Sbjct  25   APPNVTGILSRAG-QFTVLIRLLQSTQVANQITNTLNNSNQGLTLFAPTDNAFNSLPPGT  83

Query  678  LNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFT--GQNNQVN  505
            LN LS Q ++ LI YHV+P+FYS +  QT+SNPVRTQA+G  G  Y LN T    + QVN
Sbjct  84   LNSLSQQDQVTLILYHVLPQFYSLQGFQTLSNPVRTQASGMGGGQYTLNVTTVASSMQVN  143

Query  504  VSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGKS  337
            V++G V T + N +    PLAVY+VDKVL+PLD     P   AP  + + T   K+
Sbjct  144  VTTGLVTTPIANSINVTSPLAVYEVDKVLLPLDMFGVKPPTGAPQAAETPTAGAKT  199



>ref|XP_004493964.1| PREDICTED: fasciclin-like arabinogalactan protein 11-like [Cicer 
arietinum]
Length=253

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 87/203 (43%), Positives = 128/203 (63%), Gaps = 7/203 (3%)
 Frame = -2

Query  933  SFIVLSFLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQ  754
            +FI+   L   ++   A +PAPS  GP +I  +L+KAG QF  F+K L  TQV ++++ Q
Sbjct  14   TFIITMTLFQTISAQTASSPAPS--GPTNITKILEKAG-QFTTFMKLLKATQVSDRIDSQ  70

Query  753  VNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVR  574
            +N+   G+T+FAPTDNAF++L SGTLN +S Q ++ L+Q+H++P  Y+    QT SNP+ 
Sbjct  71   LNNSNQGLTIFAPTDNAFSSLKSGTLNSISTQNQLQLLQFHILPTLYTISQFQTASNPLH  130

Query  573  TQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTAD  394
            TQA   D   Y LN T   NQVNV++G ++T V N +  D  LAVYQVDKVL+P+     
Sbjct  131  TQAGNSDDGEYPLNVTTSGNQVNVTTGVIDTTVSNTIYSDNQLAVYQVDKVLLPMALF--  188

Query  393  HPAAKAPTGSASSTPAGKSNDGK  325
               + APT + +  PA   ++ +
Sbjct  189  --GSVAPTAAPTEAPAPSKSEKR  209



>gb|AGN92421.1| putative fasciclin-like arabinogalactan protein 1, partial [Centaurium 
erythraea]
Length=224

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 108/159 (68%), Gaps = 1/159 (1%)
 Frame = -2

Query  879  APAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAF  700
            A +P P GP +I  +L+KAG QF  FI+ +  TQV  Q++ Q+N+   G+TVFAPTD+AF
Sbjct  7    AASPXPSGPTNITKILEKAG-QFTTFIRLMKLTQVATQIDGQLNNSNSGLTVFAPTDSAF  65

Query  699  NNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQ  520
            + L +GTLN L+DQQK+ L+Q+H++P F S    QTVSNP+RTQA G +   + LN T  
Sbjct  66   SALQAGTLNSLTDQQKVALVQFHIVPSFLSMSQFQTVSNPLRTQAGGTNNGEFPLNVTTX  125

Query  519  NNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
             NQVNVS+G   T V   +  D  LA+YQVDKVL+PL  
Sbjct  126  GNQVNVSTGVDTTTVSGSVYSDNQLAIYQVDKVLLPLSM  164



>ref|XP_008798234.1| PREDICTED: fasciclin-like arabinogalactan protein 9 [Phoenix 
dactylifera]
Length=254

 Score =   163 bits (413),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 98/229 (43%), Positives = 140/229 (61%), Gaps = 11/229 (5%)
 Frame = -2

Query  936  VSFIVLSFLLVGLAEVKAQ--APAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQV  763
            ++ I+ + L +     +AQ  AP P+P  P+++ AVL+K GGQ+ + I+ L  TQV  Q+
Sbjct  9    IALIIATLLALTAPGARAQPVAPGPTPA-PLNLTAVLEK-GGQYNMLIRLLRGTQVEQQI  66

Query  762  NIQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSN  583
            N Q+N+  +G+TVFAPTDNAF++L +GTLN L+ QQ++ L+ YHV+ ++YS    QT SN
Sbjct  67   NSQLNNSFNGLTVFAPTDNAFSSLEAGTLNSLNQQQQVALVLYHVLSRYYSLSSFQTTSN  126

Query  582  PVRTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
            PV+TQA+G +G  Y LN T   +QVN+S+G V+T + N L    PLAVY V+KVL+P   
Sbjct  127  PVQTQASGSNG-VYTLNITSTTSQVNISTGVVDTLITNTLTSYFPLAVYSVEKVLLPYGL  185

Query  402  TADHPAAKAPT------GSASSTPAGKSNDGKNATAAKEPSPAPNGAGK  274
                P A AP       G   +TP     DG +A     PS A    G+
Sbjct  186  FGAKPPATAPAPAKEKPGKNDNTPTAPKADGPSADVGSSPSSAVGLKGR  234



>ref|XP_009421475.1| PREDICTED: fasciclin-like arabinogalactan protein 13 [Musa acuminata 
subsp. malaccensis]
Length=249

 Score =   163 bits (413),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 103/256 (40%), Positives = 151/256 (59%), Gaps = 19/256 (7%)
 Frame = -2

Query  951  MAKAAVSFIVLSFLLVGLAEVKAQA-----PAPSPGGPVDIFAVLKKAGGQFGIFIKFLN  787
            MA + +   + +FLL+  + +  QA     P P P  P+++  +L+K GGQ+G F++ L 
Sbjct  1    MASSPMLIGLTTFLLLTASALFDQAESKVAPGPKPA-PLNLTGILEK-GGQYGTFLRLLR  58

Query  786  TTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSF  607
             TQVG Q+  Q+N+  +G+T+F PTDNAF+NL +GTLN L+ Q+++ L+ YHV+P++YS 
Sbjct  59   ETQVGEQIESQLNNSFNGLTIFVPTDNAFSNLKAGTLNSLTTQEQVSLVLYHVLPRYYSP  118

Query  606  EDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVD  427
               +T SNPV TQA+G  G  Y +N T  +NQVNVS+G  ET +   L  + PLAV+ VD
Sbjct  119  TTFETTSNPVNTQASGRSG-VYTVNITSTSNQVNVSTGVNETPINTNLYLEFPLAVFSVD  177

Query  426  KVLVPLDF------TADHPAAKAPTGSASSTPAGKSNDGKNATAAKEPSPAPNGAGKMSL  265
            KVL+P +        +    A  P     S PA    DG +A+A   PS A       S+
Sbjct  178  KVLLPAELFGAKPPASSPSPAATPVKPKKSAPAA---DGPSASADTAPSAATRKG--RSV  232

Query  264  ELGLVTGILVFCMGLL  217
            E  L+ GI + C+G L
Sbjct  233  ERVLLLGIGLACVGSL  248



>ref|XP_006340150.1| PREDICTED: fasciclin-like arabinogalactan protein 11-like [Solanum 
tuberosum]
Length=238

 Score =   162 bits (411),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 96/218 (44%), Positives = 133/218 (61%), Gaps = 6/218 (3%)
 Frame = -2

Query  867  SPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLP  688
            +P GP +I  +L+KAG QF   I+ +  +QV +Q+N Q+N+   GMTVFAPTDNAF++L 
Sbjct  23   TPSGPTNITQILEKAG-QFTTLIRLMKVSQVSDQINTQLNNSNQGMTVFAPTDNAFSSLK  81

Query  687  SGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQV  508
            SGT+N LS QQ++ L+Q+HV+P F S    QT+SNP+RTQA       + LN T   NQV
Sbjct  82   SGTINSLSAQQQVQLVQFHVLPNFISMSQFQTISNPLRTQAGDATPGDFPLNVTTSGNQV  141

Query  507  NVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGKSNDG  328
            NVS+G  +  V N +  D  LAVYQVDKVL P+   A   +       A+  P GKS  G
Sbjct  142  NVSTGVDDATVSNTIYTDGQLAVYQVDKVLQPMSIFAAP-SPAVAPAPATLKPKGKSPAG  200

Query  327  KNATAAKEPSPAPN-GAGKMSLELGLVTGILVFCMGLL  217
             + T+  + SPA N G  ++++     T +LVF + L 
Sbjct  201  LSPTSGNDDSPADNSGVERIAMH---GTAVLVFGISLF  235



>ref|XP_004143241.1| PREDICTED: fasciclin-like arabinogalactan protein 11-like [Cucumis 
sativus]
 ref|XP_004156302.1| PREDICTED: fasciclin-like arabinogalactan protein 11-like [Cucumis 
sativus]
 gb|KGN48139.1| hypothetical protein Csa_6G445040 [Cucumis sativus]
Length=248

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 143/244 (59%), Gaps = 23/244 (9%)
 Frame = -2

Query  921  LSFLLVGL---AEVKAQAPAPSPG--GPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNI  757
            +SF L+ L     + AQ+  P PG  GP +I A+L+KAG QF    K L +TQ  +Q+N 
Sbjct  8    ISFFLISLLFSKSISAQSTQP-PGFSGPTNISAILEKAG-QFSTMNKLLKSTQQSDQINN  65

Query  756  QVNSPTDG--MTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSN  583
            Q+N+   G  +TVFAP DNAF+NL  GTLN LSDQQK+ L+QYHV+P F S    QTVSN
Sbjct  66   QLNNSNQGQGLTVFAPPDNAFSNLKPGTLNSLSDQQKVQLVQYHVVPTFISMSQFQTVSN  125

Query  582  PVRTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
            P+RTQA   +   + LN T   +QVN+++G V+  V N +  D  LAVYQVDKVL+P+D 
Sbjct  126  PLRTQAGNSNAGQFPLNVTTSGSQVNLTTGVVDAVVANTIYTDGQLAVYQVDKVLLPVDL  185

Query  402  --------TADHPAAKAPTGSASSTPAGKSNDGKNATAAKEPSPAPNGAGKMSLELGLVT  247
                     A     KA +G  +  PAG S D    T++ +   AP  + + +   G V 
Sbjct  186  FGTVAAPAPAPSKPVKAVSG--ADAPAGASKD----TSSDDSGAAPAMSYRFAAAFGAVV  239

Query  246  GILV  235
            G +V
Sbjct  240  GFVV  243



>ref|XP_003567900.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Brachypodium 
distachyon]
Length=245

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 120/191 (63%), Gaps = 19/191 (10%)
 Frame = -2

Query  849  DIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNK  670
            ++ AVL KAG Q+  F++ + +TQ   Q+N Q+N    G TVFAPTDNAF++L +GTLN 
Sbjct  39   NVTAVLDKAG-QYTKFMRLMKSTQQDTQLNSQLNGSDTGFTVFAPTDNAFDSLKAGTLNS  97

Query  669  LSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNN-QVNVSSG  493
            LS Q+++ L+Q H++P F+S E  +T SNPVRTQA+G DG  Y +N T  +N QVNVS+G
Sbjct  98   LSQQEQVSLVQAHIVPAFFSMESFETASNPVRTQASGADGP-YTVNVTATSNGQVNVSTG  156

Query  492  AVETQVYNPLRKDPPLAVYQVDKVLVPLDFTA-------------DHPA---AKAPTGSA  361
             V T V   LRK+ PLAVY VDKVL+P D                  PA   AKAP G  
Sbjct  157  LVSTMVGTALRKEKPLAVYSVDKVLLPYDLFGPKPPASAPPAPGKKAPAKGGAKAPAGEE  216

Query  360  SSTPAGKSNDG  328
             S PA K++ G
Sbjct  217  DSAPASKASGG  227



>ref|XP_010260346.1| PREDICTED: fasciclin-like arabinogalactan protein 13 [Nelumbo 
nucifera]
Length=282

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 127/188 (68%), Gaps = 8/188 (4%)
 Frame = -2

Query  957  PRMAKAA-VSFIVLSF---LLVGLAEVKAQAPAPSPG-GPVDIFAVLKKAGGQFGIFIKF  793
            P MA AA +S I+L+    L +   +V  QA       GPV++ A+L+K GGQ+  FI+ 
Sbjct  28   PPMASAAPLSLILLALVPCLFLITPQVDGQAAPAPAAAGPVNLTAILEK-GGQYTKFIRL  86

Query  792  LNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFY  613
            L +T V +Q+  Q+N+ T G+TVFAPTDNA ++L +GTLN LS Q +  L+ YHV+P++ 
Sbjct  87   LASTHVIDQIENQLNTSTQGLTVFAPTDNAIDSLSAGTLNGLSQQDQSALVLYHVLPQYQ  146

Query  612  SFEDLQTVSNPVRTQANGPDGKTYGLNFTG-QNNQVNVSSGAVETQVYNPLRKDPPLAVY  436
            S    QT+SNPVRTQA G  G +  LNFT   NNQVNVS+G V+TQ  N LR  PPLAVY
Sbjct  147  SLTSFQTISNPVRTQAGGQSG-SLTLNFTSIANNQVNVSTGMVQTQFSNALRDSPPLAVY  205

Query  435  QVDKVLVP  412
            QVDKVL+P
Sbjct  206  QVDKVLLP  213



>gb|ABR68797.1| arabinogalactan protein 2 [Gossypium hirsutum]
 gb|ABV27472.1| fasciclin-like arabinogalactan protein 1 [Gossypium hirsutum]
Length=243

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 123/187 (66%), Gaps = 3/187 (2%)
 Frame = -2

Query  960  RPRMAKAAVSFIVLSFLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTT  781
            R +     ++ ++L  L       ++ A AP+P GP ++  +L+KAG QF +FI+ L +T
Sbjct  2    RQQYVFTTLTLLILFSLSCSTTLAQSPALAPAPSGPTNVTKILEKAG-QFTLFIRLLKST  60

Query  780  QVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFED  601
            QV NQ+  Q+N+  +GMTVFAPTDNAF++L SGTLN L+D+QK+ L+Q+H++P + +   
Sbjct  61   QVANQLLGQLNNSNNGMTVFAPTDNAFSSLKSGTLNSLTDEQKVQLVQFHIVPTYLTSSQ  120

Query  600  LQTVSNPVRTQA-NGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDK  424
             QT+SNP+RTQA +  DGK + LN T   N VN+++G   T V   +  D  LAVYQ+D+
Sbjct  121  FQTISNPLRTQAGDSGDGK-FPLNVTTSGNSVNITTGLTNTSVSGTIYTDGQLAVYQIDQ  179

Query  423  VLVPLDF  403
            VL PL  
Sbjct  180  VLQPLQI  186



>ref|XP_004969482.1| PREDICTED: fasciclin-like arabinogalactan protein 11-like [Setaria 
italica]
Length=249

 Score =   160 bits (406),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 101/216 (47%), Positives = 132/216 (61%), Gaps = 9/216 (4%)
 Frame = -2

Query  849  DIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSP----TDGMTVFAPTDNAFNNLPSG  682
            ++ A+L+K GGQ+  F++ +  TQ   Q+N Q+NS       G TVFAPTDNAFNNL  G
Sbjct  37   NVTAILEK-GGQYTTFMRLMKETQQDTQLNSQLNSSFGNGGSGYTVFAPTDNAFNNLKPG  95

Query  681  TLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQ-NNQVN  505
            TLN L+ QQ++ L+Q HV+P+FYS +  QT SNPVRTQA+G DG  Y LN T   NNQVN
Sbjct  96   TLNSLTQQQQVSLVQGHVLPQFYSMDSFQTASNPVRTQASGRDGP-YTLNITSDTNNQVN  154

Query  504  VSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGKSNDGK  325
            VSSG V+ ++ N L  + PLAVY VDKVL+P++       A APT S      G S+D  
Sbjct  155  VSSGVVDVRISNALYSNKPLAVYSVDKVLLPMELFGAKAPAAAPTASEGKPKKGGSSDAA  214

Query  324  NATAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLL  217
            +  A  + S AP GA   +  +G     L   +G L
Sbjct  215  SGPAGSDDS-APTGAAS-ARAVGWSVAGLAAVLGYL  248



>ref|XP_009404414.1| PREDICTED: fasciclin-like arabinogalactan protein 6 [Musa acuminata 
subsp. malaccensis]
Length=313

 Score =   162 bits (410),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 112/157 (71%), Gaps = 3/157 (2%)
 Frame = -2

Query  885  AQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDN  706
            A AP P P  P+++  +L+K GGQ+G F++ L  TQVG Q+  Q+N+  +G+T+FAPTDN
Sbjct  92   AVAPGPKPA-PLNLTGILEK-GGQYGTFLRLLKETQVGEQIESQLNNSFNGLTIFAPTDN  149

Query  705  AFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFT  526
            AFNNL  GTLN L+ Q+++ L+ YHV+P++Y+    +T SNPV TQA+G +G  Y +N T
Sbjct  150  AFNNLKPGTLNSLTTQEQVSLVLYHVLPRYYTLSTFETTSNPVNTQASGSNG-VYTINIT  208

Query  525  GQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLV  415
              +NQVNVS+G  ET V N L  D PLAVY VDKVL+
Sbjct  209  SSSNQVNVSTGVNETPVNNNLHLDFPLAVYSVDKVLL  245



>gb|EMT22225.1| hypothetical protein F775_32785 [Aegilops tauschii]
Length=245

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 99/226 (44%), Positives = 132/226 (58%), Gaps = 16/226 (7%)
 Frame = -2

Query  888  KAQAPAPS--PGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSP--TDGMTVF  721
            +AQAP PS  P GP ++ A+L K GGQ+  F++ +  TQ   Q+N Q+N+    +G TVF
Sbjct  22   QAQAPGPSAKPAGPPNVTAILVK-GGQYTTFMRLMKETQQDTQLNSQLNNSFNGNGYTVF  80

Query  720  APTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTY  541
            APTDNAFNNL  GTLN L+ QQ++ L+Q H++P++Y+ E  QT SNPVRTQA+G + +  
Sbjct  81   APTDNAFNNLKPGTLNSLTQQQQVSLVQAHILPQYYTMESFQTASNPVRTQASG-EKEPI  139

Query  540  GLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF---------TADHP  388
             +N    NNQVNV++G VE  V N L    PLAVY +DKVL+P             A   
Sbjct  140  TVNIVASNNQVNVTTGLVEVAVNNALSAVKPLAVYSLDKVLLPEALFGAKAPAPAPAASK  199

Query  387  AAKAPTGSASSTPAGKSNDGKNATAAKEPSPAPNGAGKMSLELGLV  250
              K   G A+S PAG S+D    T A        G   M+  LG +
Sbjct  200  GGKTKKGEAASGPAG-SDDEATPTGAAGARAVSWGVAGMAALLGYL  244



>gb|EPS63113.1| hypothetical protein M569_11675, partial [Genlisea aurea]
Length=167

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 112/159 (70%), Gaps = 5/159 (3%)
 Frame = -2

Query  879  APAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAF  700
            APAP+P   V++ A+L+KAG QFG+ I+ L TT+VG+Q++ Q+ +   G+T+FAP+D AF
Sbjct  1    APAPAP---VNVTAILEKAG-QFGVLIRLLQTTKVGDQIDTQLGNSNQGLTIFAPSDGAF  56

Query  699  NNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQ  520
             NL  GTLN  +DQQK+ LIQ+HV+P ++S    QT S+P+RTQA G  G ++ LN T  
Sbjct  57   ANLKPGTLNSFTDQQKVELIQFHVLPSYFSASQFQTASDPLRTQAGGSQG-SFPLNVTAT  115

Query  519  NNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
             NQVN+++G     V N +  D  LAVYQVD+VL+PL F
Sbjct  116  GNQVNITTGVTNATVANTIYDDGNLAVYQVDQVLLPLSF  154



>ref|XP_006365737.1| PREDICTED: fasciclin-like arabinogalactan protein 11-like [Solanum 
tuberosum]
Length=249

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 103/227 (45%), Positives = 132/227 (58%), Gaps = 23/227 (10%)
 Frame = -2

Query  951  MAKAAVSFIVLSFLLVGLAEVKAQAPA--PSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQ  778
            M+    S  +L+ LL        Q PA  P+P GP +I  +L+KAG QF  FI+ L TTQ
Sbjct  2    MSYFVFSLSLLAILLHSCTLTLGQNPASAPAPSGPTNITKILEKAG-QFTTFIRLLRTTQ  60

Query  777  VGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDL  598
             G+Q+N Q+N+   GMTVFAPTDNAF++L +GTLN LS QQ++ L+Q+HV+P F S    
Sbjct  61   AGDQINTQLNNSKQGMTVFAPTDNAFSSLKAGTLNSLSSQQQVQLVQFHVLPSFISVSQF  120

Query  597  QTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVL  418
            QTVSNP+RTQA       + LN T   NQVNVS+G V+  V N +  D  LAVYQVDKVL
Sbjct  121  QTVSNPLRTQAGDTSPGDFPLNVTTSGNQVNVSTGIVDATVGNTIYTDGELAVYQVDKVL  180

Query  417  VPL--------------------DFTADHPAAKAPTGSASSTPAGKS  337
             PL                    +     PAA +P+  +  TPA KS
Sbjct  181  QPLSIFASPSPATAPAPATPETSNLKKKSPAALSPSSGSDDTPADKS  227



>emb|CAN62433.1| hypothetical protein VITISV_022135 [Vitis vinifera]
Length=247

 Score =   158 bits (399),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 119/183 (65%), Gaps = 3/183 (2%)
 Frame = -2

Query  951  MAKAAVSFIVLSFLLVGLAEVKAQAPAPSPGGP--VDIFAVLKKAGGQFGIFIKFLNTTQ  778
            M K  VS ++L  L +       Q+ AP+P      +I A+L+KAG Q+  FI+ L +TQ
Sbjct  1    MMKQLVSPVLLLILFLHCTRTSGQSSAPAPAPAGPTNITAILEKAG-QYTTFIRLLKSTQ  59

Query  777  VGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDL  598
            + +++NIQ+N+   G+T+FAPTDNAF+NL +GTLN  +DQQK  L+Q+HV+  F S    
Sbjct  60   MDDRINIQLNNSNQGLTIFAPTDNAFSNLKAGTLNSFTDQQKAQLVQFHVVSSFLSTSQF  119

Query  597  QTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVL  418
            QTVSNPV TQA G +   + LN T   NQVN++SG   T V N +  D  LAVYQ+D+VL
Sbjct  120  QTVSNPVSTQAGGSNSGDFSLNITTSGNQVNMTSGLTNTSVANTVYTDGQLAVYQIDQVL  179

Query  417  VPL  409
            +P+
Sbjct  180  LPM  182



>ref|XP_006843643.1| hypothetical protein AMTR_s00007p00166710 [Amborella trichopoda]
 gb|ERN05318.1| hypothetical protein AMTR_s00007p00166710 [Amborella trichopoda]
Length=245

 Score =   158 bits (399),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 111/157 (71%), Gaps = 2/157 (1%)
 Frame = -2

Query  879  APAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAF  700
            A AP+P GP +I AVL+KAG Q+ + I+ +  TQV +Q+N Q+N+   G+T+FAPTDNAF
Sbjct  26   ASAPAPTGPTNITAVLEKAG-QYTMLIRLMKATQVADQMNQQLNNSAQGLTIFAPTDNAF  84

Query  699  NNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQ  520
            ++L  GTLN L+DQQK+ LIQ+H+IP F S    QTV+NP+RTQA G     + LN T  
Sbjct  85   SSLKPGTLNSLTDQQKVSLIQFHIIPSFISVPQFQTVTNPLRTQA-GSGEDQFPLNVTTS  143

Query  519  NNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPL  409
             NQVNVS+G  +  V N +  D  LAVYQVDKVL+P+
Sbjct  144  GNQVNVSTGINDAPVANTVYTDGQLAVYQVDKVLLPI  180



>ref|XP_002280829.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Vitis vinifera]
Length=247

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 119/183 (65%), Gaps = 3/183 (2%)
 Frame = -2

Query  951  MAKAAVSFIVLSFLLVGLAEVKAQAPAPSPGGP--VDIFAVLKKAGGQFGIFIKFLNTTQ  778
            M K  VS ++L  L +       Q+ AP+P      +I A+L+KAG Q+  FI+ L +TQ
Sbjct  1    MMKQLVSPVLLLILFLQCTRTSGQSSAPAPAPAGPTNITAILEKAG-QYTTFIRLLKSTQ  59

Query  777  VGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDL  598
            + +++NIQ+N+   G+T+FAPTDNAF+NL +GTLN  +DQQK  L+Q+HV+  F S    
Sbjct  60   MDDRINIQLNNSNQGLTIFAPTDNAFSNLKAGTLNSFTDQQKAQLVQFHVVSSFLSTSQF  119

Query  597  QTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVL  418
            QTVSNPV TQA G +   + LN T   NQVN++SG   T V N +  D  LAVYQ+D+VL
Sbjct  120  QTVSNPVSTQAGGSNSGDFSLNITTSGNQVNMTSGLTNTSVANTVYTDGQLAVYQIDQVL  179

Query  417  VPL  409
            +P+
Sbjct  180  LPM  182



>gb|ABI95404.1| fasciclin-like protein FLA14 [Triticum aestivum]
 emb|CDM83630.1| unnamed protein product [Triticum aestivum]
Length=245

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 112/163 (69%), Gaps = 6/163 (4%)
 Frame = -2

Query  888  KAQAPAPS--PGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSP--TDGMTVF  721
            +AQAP PS  P GP ++ A+L K GGQ+  F++ +  TQ   Q+N Q+N+    +G TVF
Sbjct  22   QAQAPGPSATPAGPPNVTAILVK-GGQYTTFMRLMKETQQDTQLNSQLNNSFNGNGYTVF  80

Query  720  APTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTY  541
            APTDNAFNNL  GTLN L+ QQ++ L+Q H++P++Y+ E  QT SNPVRTQA+G + +  
Sbjct  81   APTDNAFNNLKPGTLNSLTQQQQVSLVQAHILPQYYTMESFQTASNPVRTQASG-EKEPI  139

Query  540  GLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVP  412
             +N    NNQVNV++G VE  V N L    PLAVY VDKVL+P
Sbjct  140  TVNIVATNNQVNVTTGLVEVAVNNALSAVKPLAVYSVDKVLLP  182



>dbj|BAJ94967.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=272

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/193 (47%), Positives = 117/193 (61%), Gaps = 14/193 (7%)
 Frame = -2

Query  849  DIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNK  670
            ++ AVL+KAG Q+  FI+ + +TQ   Q+N Q N    G TVFAPTDNA N+L  GTLN 
Sbjct  56   NVTAVLEKAG-QYTKFIRLMASTQQDTQLNAQANESDTGFTVFAPTDNALNSLKPGTLNS  114

Query  669  LSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQ-VNVSSG  493
            LS Q ++ L+Q H++P FYS E  +T SNPVRTQA+G DG    +N T  +N  VNVS+G
Sbjct  115  LSQQDQVTLVQAHIVPTFYSMESFETASNPVRTQASGTDGPCT-VNVTATSNSAVNVSTG  173

Query  492  AVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGKSNDGKNATA  313
             V T V   LR   PLAVY VDKVL+P+D     P A AP              GK  ++
Sbjct  174  IVHTTVGTALRATRPLAVYSVDKVLLPMDLFGPKPPASAPLAP-----------GKKPSS  222

Query  312  AKEPSPAPNGAGK  274
            AK  + AP+G+ +
Sbjct  223  AKGAAKAPSGSDE  235



>ref|XP_009342757.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Pyrus x 
bretschneideri]
Length=246

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 105/147 (71%), Gaps = 1/147 (1%)
 Frame = -2

Query  849  DIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNK  670
            ++ AVL+KAG QF   IK L +T++ +Q+N Q+++   GMT+FAPTDNAF++L +GTLN 
Sbjct  36   NVTAVLEKAG-QFTTLIKLLKSTKMADQINTQLSTSNQGMTIFAPTDNAFSSLKAGTLNS  94

Query  669  LSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGA  490
            +S+QQK+ L+Q+HV+P FYS    QTVSNP+ TQA   D   + LN T   NQVN+++G 
Sbjct  95   ISEQQKLQLVQFHVLPSFYSAAQFQTVSNPLHTQAGNTDDGQFPLNVTTSGNQVNITTGV  154

Query  489  VETQVYNPLRKDPPLAVYQVDKVLVPL  409
            V   V N +  D  LAVYQVD+VL+PL
Sbjct  155  VNASVANTIFTDSQLAVYQVDQVLLPL  181



>ref|XP_010937843.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Elaeis 
guineensis]
Length=243

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 103/149 (69%), Gaps = 1/149 (1%)
 Frame = -2

Query  849  DIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNK  670
            +I  +L+KAG QF   I+ L +TQVG+Q+N Q+N    G+TVFAPTDNAF++L SGTLN 
Sbjct  35   NITKILEKAG-QFTTLIRLLKSTQVGDQINNQLNDSNSGLTVFAPTDNAFSSLSSGTLNS  93

Query  669  LSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGA  490
            L+DQQK+ LIQ+HV+P F S    QTVSNP+RTQA       + LN T   N VN+++G 
Sbjct  94   LTDQQKVALIQFHVLPSFISMSQFQTVSNPLRTQAGDVTNGQFPLNVTTAGNTVNITTGI  153

Query  489  VETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
              T V N +  D  LAVYQVD+VL+PL+ 
Sbjct  154  DNTTVSNTIYSDNQLAVYQVDQVLLPLEI  182



>ref|XP_010684113.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Beta vulgaris 
subsp. vulgaris]
Length=247

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 105/149 (70%), Gaps = 1/149 (1%)
 Frame = -2

Query  849  DIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNK  670
            ++ A+L KAG QF +FI+ L +TQ  +Q+N Q+N+   G+T+FAP DN+F+NL SG LN 
Sbjct  39   NVTAILSKAG-QFTMFIRLLQSTQEADQINNQLNNSNSGLTIFAPPDNSFSNLKSGLLNS  97

Query  669  LSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGA  490
            LSDQQK+ L+Q+HV+P + S  + QT SNP+RTQA   +   Y LN T   NQVN+++G 
Sbjct  98   LSDQQKVQLVQFHVLPNYISQSEFQTASNPLRTQAGNSNDGEYPLNITTSGNQVNITTGV  157

Query  489  VETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
            V T V N L  D  LAVYQVD+VL+PL F
Sbjct  158  VNTTVSNSLYSDGQLAVYQVDQVLLPLAF  186



>ref|XP_008350366.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Malus domestica]
Length=246

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 105/148 (71%), Gaps = 1/148 (1%)
 Frame = -2

Query  849  DIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNK  670
            ++ AVL+KAG QF   IK L +T++ +Q+N Q+++   GMT+FAPTDNAF++L +GTLN 
Sbjct  36   NVTAVLEKAG-QFTTLIKLLKSTKMADQINTQLSTSNQGMTLFAPTDNAFSSLKAGTLNS  94

Query  669  LSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGA  490
            +S+QQK+ L+Q+HV+P FYS    QTVSNP+ TQA   D   + LN T   NQVN+++G 
Sbjct  95   ISEQQKLQLVQFHVLPSFYSAAQFQTVSNPLHTQAGNTDDGQFPLNVTTSGNQVNITTGV  154

Query  489  VETQVYNPLRKDPPLAVYQVDKVLVPLD  406
            V   V N +  D  LAVYQVD+VL+PL 
Sbjct  155  VNAAVANTIFTDSQLAVYQVDQVLLPLS  182



>gb|EPS62200.1| hypothetical protein M569_12593, partial [Genlisea aurea]
Length=165

 Score =   153 bits (386),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 105/164 (64%), Gaps = 1/164 (1%)
 Frame = -2

Query  864  PGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPS  685
            P GP ++  +L+KAG QF   ++    TQ+G+Q+N Q+N+   G+T+FAPTD AF+ L +
Sbjct  1    PAGPTNVTGILEKAG-QFTTLVRLFRITQIGDQINTQLNNSNQGVTIFAPTDAAFSALSA  59

Query  684  GTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVN  505
            GTLN LSDQQK+ LIQ+HV+P F S    QTVSNP+RTQA       + LN T   NQVN
Sbjct  60   GTLNSLSDQQKVSLIQFHVLPSFVSIPQFQTVSNPLRTQAGDTAAGEFPLNVTAVGNQVN  119

Query  504  VSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAP  373
            +S+G     + N +  D  LAVYQ+DKVL+P        +A AP
Sbjct  120  ISTGVDSASIGNTIYTDGQLAVYQIDKVLLPDSLFGTPSSAPAP  163



>ref|XP_008463798.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Cucumis 
melo]
Length=243

 Score =   155 bits (392),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 94/235 (40%), Positives = 134/235 (57%), Gaps = 4/235 (2%)
 Frame = -2

Query  927  IVLSFLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVN  748
            I+L F  +  +  ++ A AP P  P++I  +L+K GGQF + I+ L +TQV NQ+N Q+N
Sbjct  10   ILLIFFFIDCSYGQSPAEAPGPPPPMNISKILEK-GGQFNVLIRLLKSTQVANQINTQLN  68

Query  747  SPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQ  568
                 +T+FAPTDNAF+NL SGTLN L+DQ+K+ L+Q+H+IP F S  + QT+SNPVRTQ
Sbjct  69   DSNSELTIFAPTDNAFSNLQSGTLNSLNDQEKVELLQFHMIPTFLSLSNFQTISNPVRTQ  128

Query  567  ANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLD-FTADH  391
            A   D   + LN T   N VN+SSG V T +   +  D  LA+YQ+D VL P+  F    
Sbjct  129  AG--DAYEFPLNVTTSGNSVNISSGLVNTSISGTVYTDNQLAIYQIDSVLKPIGVFQPRP  186

Query  390  PAAKAPTGSASSTPAGKSNDGKNATAAKEPSPAPNGAGKMSLELGLVTGILVFCM  226
            P        +     G S   K++      +    G    S E  +V GI++  +
Sbjct  187  PPPAPAPEKSKKKAKGISESPKDSDDDNSSAVPLAGISSFSTEAAVVVGIMLVWI  241



>ref|XP_010107552.1| hypothetical protein L484_024406 [Morus notabilis]
 gb|EXC16234.1| hypothetical protein L484_024406 [Morus notabilis]
Length=269

 Score =   155 bits (393),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 111/167 (66%), Gaps = 8/167 (5%)
 Frame = -2

Query  882  QAPAPSPGG-----PVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSP-TDGMTVF  721
            Q+PA SP G     P D+ AVLKKAG QF  FIK +  TQV +Q+N  ++   + G+TVF
Sbjct  34   QSPAASPVGAAASSPEDVIAVLKKAG-QFTTFIKLMKGTQVSDQINSHLSGGGSQGITVF  92

Query  720  APTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTY  541
            APTD AF+ L +GTLN LS +Q+I L+QYHV+P +Y+    QTVSNP+ TQA   D   Y
Sbjct  93   APTDGAFSGLKTGTLNSLSSEQQIRLVQYHVLPAYYTLSQFQTVSNPLHTQAGNSDNGQY  152

Query  540  GLNF-TGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
             LN  T  +NQVN+++G V   V N +  D  LAV+QVDKVL+P+D 
Sbjct  153  PLNVTTSTSNQVNITTGVVNATVSNTVYTDGQLAVFQVDKVLLPIDI  199



>ref|NP_001043814.1| Os01g0668100 [Oryza sativa Japonica Group]
 dbj|BAD73656.1| arabinogalactan protein-like [Oryza sativa Japonica Group]
 dbj|BAD73684.1| arabinogalactan protein-like [Oryza sativa Japonica Group]
 dbj|BAF05728.1| Os01g0668100 [Oryza sativa Japonica Group]
 gb|EAY75309.1| hypothetical protein OsI_03200 [Oryza sativa Indica Group]
 dbj|BAG97310.1| unnamed protein product [Oryza sativa Japonica Group]
Length=247

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 105/152 (69%), Gaps = 5/152 (3%)
 Frame = -2

Query  849  DIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSP--TDGMTVFAPTDNAFNNLPSGTL  676
            ++ AVL+K GGQ+  FI+ +  TQ   Q+N Q+N+    +G TVFAPTDNAFNNL  GTL
Sbjct  37   NVTAVLEK-GGQYTTFIRLMKETQQDTQLNSQLNNSFNGNGYTVFAPTDNAFNNLKPGTL  95

Query  675  NKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTG-QNNQVNVS  499
            N L+ QQ++ L+Q HV+P+FYS +  QT SNPVRTQA+G DG  Y LN T   NN VNVS
Sbjct  96   NSLTQQQQVALVQGHVLPQFYSMDSFQTASNPVRTQASGTDGP-YTLNITSTTNNNVNVS  154

Query  498  SGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
            +G VE  V N L    PLAVY VDKVL+P + 
Sbjct  155  TGVVEVTVTNALSAVKPLAVYSVDKVLLPFEL  186



>gb|ABV27477.1| fasciclin-like arabinogalactan protein 6 [Gossypium hirsutum]
Length=241

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 106/158 (67%), Gaps = 2/158 (1%)
 Frame = -2

Query  873  APSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSP--TDGMTVFAPTDNAF  700
            AP+P   VD    + + GGQF  FIK L  TQV +Q+N Q+++P   DG+TVFAP+DNAF
Sbjct  23   APAPPLKVDNITSILEKGGQFTTFIKLLKATQVADQLNNQLSTPDPNDGITVFAPSDNAF  82

Query  699  NNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQ  520
            + L  GTLN LSDQ+K+ L+Q+H++P   S    QT SNP+RTQA    G  + LN T +
Sbjct  83   SGLKPGTLNSLSDQEKLQLVQFHILPTLMSTSQFQTASNPLRTQAGDVKGGKFPLNVTAE  142

Query  519  NNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLD  406
             NQVNV++G V   V N +  D  +AVYQVDKVL+PL+
Sbjct  143  GNQVNVTTGVVNATVENSVFSDRRIAVYQVDKVLLPLE  180



>ref|XP_008793344.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Phoenix 
dactylifera]
Length=246

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 106/149 (71%), Gaps = 1/149 (1%)
 Frame = -2

Query  849  DIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNK  670
            +I  +L+KAG QF  FI+ + +T+V +Q+N Q+N+   G+TVFAP DNAF++L +GTLN 
Sbjct  38   NITKILEKAG-QFTTFIRLIKSTKVSDQINNQLNNSDSGLTVFAPPDNAFSSLSAGTLNS  96

Query  669  LSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGA  490
            L+DQQK+ L+Q+HV+P F S  + QTVSNP+RTQA   +   + LN T   N VN+++G 
Sbjct  97   LTDQQKVELLQFHVLPSFISMTEFQTVSNPLRTQAGDANNGRFALNVTTVGNGVNITTGI  156

Query  489  VETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
            V T V N +  D  LAVYQV+KVL+PLD 
Sbjct  157  VNTTVSNTIYSDNQLAVYQVEKVLLPLDI  185



>gb|ACU15329.1| unknown [Glycine max]
Length=172

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 102/141 (72%), Gaps = 3/141 (2%)
 Frame = -2

Query  858  GPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGT  679
            G V++ A+L+K GGQ+   +K L  TQ   Q+  Q+ S + G T+FAPTDNAF +L  G 
Sbjct  34   GAVNLTAILEK-GGQYTTLMKLLKDTQQLTQIESQLKSNSQGFTLFAPTDNAFQSLKPGA  92

Query  678  LNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQ-NNQVNV  502
            LNKLSD QK+ LI +HV PK+Y+  DL TVSNPVRTQA   +G T+GLNFTGQ  NQVN+
Sbjct  93   LNKLSDDQKVKLILFHVTPKYYTISDLLTVSNPVRTQATEKEG-TWGLNFTGQGGNQVNI  151

Query  501  SSGAVETQVYNPLRKDPPLAV  439
            S+G V+TQ+ NPLR+  PLAV
Sbjct  152  STGVVQTQLNNPLREKFPLAV  172



>gb|ACJ85305.1| unknown [Medicago truncatula]
Length=221

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 115/187 (61%), Gaps = 6/187 (3%)
 Frame = -2

Query  951  MAKAAVSFIVLSFLLVGLAEVKAQ-APAPSPG---GPVDIFAVLKKAGGQFGIFIKFLNT  784
            M    +SF +L  +        AQ +PAP+P     P DI  +LKKAGG F   I+ L T
Sbjct  4    MKHPFLSFTLLLIVFFSSTTTLAQKSPAPAPSTDTAPTDIIRILKKAGG-FTTLIRLLQT  62

Query  783  TQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFE  604
            TQV  Q+N Q+ +   G+T+FAP DN+F++L  G LN LSD+QK  LIQ+H++P F S  
Sbjct  63   TQVSTQINSQLLNSNGGLTLFAPNDNSFSSLKPGFLNSLSDEQKNKLIQFHLLPTFVSMS  122

Query  603  DLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDK  424
            +  T+SNPVRTQA G D    GLN T   NQVN+++G V   V   +  D  LAVYQVDK
Sbjct  123  NFDTLSNPVRTQA-GDDPYRLGLNVTSSGNQVNMTTGIVNVTVGGTVYTDHQLAVYQVDK  181

Query  423  VLVPLDF  403
            VL+P DF
Sbjct  182  VLLPRDF  188



>gb|ABI95402.1| fasciclin-like protein FLA12 [Triticum aestivum]
Length=276

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 101/150 (67%), Gaps = 3/150 (2%)
 Frame = -2

Query  849  DIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNK  670
            ++ AVL+KAG Q+  FI+ + +TQ   Q+N Q N    G TVFAPTDNAFN+L  GTLN 
Sbjct  53   NVTAVLEKAG-QYTKFIRLMASTQQDTQLNAQANDSDTGFTVFAPTDNAFNSLKPGTLNS  111

Query  669  LSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQ-VNVSSG  493
            LS Q ++ L+Q H++P FYS E  +T SNPVRTQA+G DG    +N T  +N  VNVS+G
Sbjct  112  LSQQDQVTLVQAHIVPTFYSMESFETASNPVRTQASGTDGPCT-VNVTATSNSAVNVSTG  170

Query  492  AVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
             V T V   LR   PLAVY VDKVL+P+D 
Sbjct  171  IVHTTVGTALRATRPLAVYSVDKVLLPMDL  200



>ref|XP_004148768.1| PREDICTED: fasciclin-like arabinogalactan protein 11-like [Cucumis 
sativus]
 gb|KGN64742.1| Arabinogalactan protein 2 [Cucumis sativus]
Length=243

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 118/182 (65%), Gaps = 4/182 (2%)
 Frame = -2

Query  951  MAKAAVSFIVL-SFLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQV  775
            MA +  S ++L  F  +  +  ++ A AP P  P++I  +L+K GGQF + I+ L  TQV
Sbjct  1    MANSLFSLVILLIFFFLDCSYGQSPAEAPGPPPPMNITKILEK-GGQFNVLIRLLKNTQV  59

Query  774  GNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQ  595
             NQ+N Q+N     +T+FAPTDNAF+NL SGTLN L+DQ+K+ L+Q+H+IP F S  + Q
Sbjct  60   ANQINTQLNDSNSELTLFAPTDNAFSNLQSGTLNSLNDQEKVELLQFHMIPTFLSLSNFQ  119

Query  594  TVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLV  415
            T+SNPVRTQA   D   + LN T   N VNVSSG V T +   +  D  LA+YQ+D VL 
Sbjct  120  TISNPVRTQAG--DAYEFPLNVTTSGNSVNVSSGLVNTSISGTVYTDNQLAIYQIDSVLK  177

Query  414  PL  409
            P+
Sbjct  178  PI  179



>gb|AFK36056.1| unknown [Medicago truncatula]
Length=230

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 115/187 (61%), Gaps = 6/187 (3%)
 Frame = -2

Query  951  MAKAAVSFIVLSFLLVGLAEVKAQ-APAPSPG---GPVDIFAVLKKAGGQFGIFIKFLNT  784
            M    +SF +L  +        AQ +PAP+P     P DI  +LKKAGG F   I+ L T
Sbjct  4    MKHPFLSFTLLLIVFFSSTTTLAQKSPAPAPSTDTAPTDIIRILKKAGG-FTTLIRLLQT  62

Query  783  TQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFE  604
            TQV  Q+N Q+ +   G+T+FAP DN+F++L  G LN LSD+QK  LIQ+H++P F S  
Sbjct  63   TQVSTQINSQLLNSNGGLTLFAPNDNSFSSLKPGFLNSLSDEQKNKLIQFHLLPTFVSMS  122

Query  603  DLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDK  424
            +  T+SNPVRTQA G D    GLN T   NQVN+++G V   V   +  D  LAVYQVDK
Sbjct  123  NFDTLSNPVRTQA-GDDPYRLGLNVTSSGNQVNMTTGIVNVTVGGTVYTDHQLAVYQVDK  181

Query  423  VLVPLDF  403
            VL+P DF
Sbjct  182  VLLPRDF  188



>ref|XP_010104108.1| hypothetical protein L484_014391 [Morus notabilis]
 gb|EXB98549.1| hypothetical protein L484_014391 [Morus notabilis]
Length=250

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 92/219 (42%), Positives = 134/219 (61%), Gaps = 7/219 (3%)
 Frame = -2

Query  873  APSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNN  694
            +P P    DI+ +L KAG QF + ++ L +TQVG+Q+N Q++S    +T+FAP DNAF++
Sbjct  34   SPGPAPSTDIYKILIKAG-QFTVLLRLLRSTQVGDQINNQLSSTNSELTLFAPPDNAFSS  92

Query  693  LPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNN  514
            L +GTLN+LSDQQK+ L+Q+H++P F S  + QT+SNPV+TQA   D   Y LN T   +
Sbjct  93   LKTGTLNQLSDQQKVQLVQFHLVPAFISISNFQTLSNPVQTQA--ADTYEYPLNITTNGS  150

Query  513  QVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGKSN  334
            QVN+++G V T +   +  D  LAVYQVDKVL PL   A  P   AP  +   +      
Sbjct  151  QVNITTGVVNTTITGTVYSDNQLAVYQVDKVLQPLGIFAPRPPPPAPAPAPPKSKKKAET  210

Query  333  DGKNATAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLL  217
            D  +  A+ + S A  G G + + +G+V   + F + LL
Sbjct  211  DTDSPAASVDASDAI-GRGGVRITIGMV---MSFAVSLL  245



>gb|ABI95403.1| fasciclin-like protein FLA13 [Triticum aestivum]
Length=267

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 101/150 (67%), Gaps = 3/150 (2%)
 Frame = -2

Query  849  DIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNK  670
            ++ AVL+KAG Q+  FI+ + +TQ   Q+N Q N    G TVFAPTDNAFN+L  GTLN 
Sbjct  53   NVTAVLEKAG-QYTKFIRLMASTQQDTQLNAQANDSDTGFTVFAPTDNAFNSLKPGTLNS  111

Query  669  LSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQ-VNVSSG  493
            LS Q ++ L+Q H++P FYS E  +T SNPVRTQA+G DG    +N T  +N  VNVS+G
Sbjct  112  LSQQDQVTLVQAHIVPTFYSMESFETASNPVRTQASGTDGPCT-VNVTATSNSAVNVSTG  170

Query  492  AVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
             V T V   LR   PLAVY VDKVL+P+D 
Sbjct  171  IVHTTVGTALRATRPLAVYSVDKVLLPMDL  200



>ref|XP_010920871.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Elaeis 
guineensis]
Length=245

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 103/148 (70%), Gaps = 1/148 (1%)
 Frame = -2

Query  849  DIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNK  670
            +I  +L+KAG QF  FI+ L +T+V +Q+N Q+N+   G+TVFAP DNAF++L SGTLN 
Sbjct  36   NITKILEKAG-QFTTFIRLLKSTKVDDQINNQLNNSNTGLTVFAPPDNAFSSLASGTLNS  94

Query  669  LSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGA  490
            L+DQQK+ LIQ+HV+P F S    QTVSNP+RT A       + LN T   N VN+++G 
Sbjct  95   LTDQQKVELIQFHVLPSFISMSQFQTVSNPLRTNAGDAYNGRFPLNVTTIGNGVNITTGI  154

Query  489  VETQVYNPLRKDPPLAVYQVDKVLVPLD  406
            V T V N +  D  LAVYQVDKVL+PLD
Sbjct  155  VNTTVSNSIYSDNQLAVYQVDKVLLPLD  182



>ref|XP_002440247.1| hypothetical protein SORBIDRAFT_09g028480 [Sorghum bicolor]
 gb|EES18677.1| hypothetical protein SORBIDRAFT_09g028480 [Sorghum bicolor]
Length=245

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 107/151 (71%), Gaps = 4/151 (3%)
 Frame = -2

Query  849  DIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVN-SPTDGMTVFAPTDNAFNNLPSGTLN  673
            ++ A+L+K GGQ+  FI+ + +TQ   Q+N Q+N S   G TVFAPTDNAF +L  GTLN
Sbjct  32   NVTAILEK-GGQYTTFIRLMKSTQQDTQLNSQLNNSFGSGYTVFAPTDNAFASLKPGTLN  90

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTG-QNNQVNVSS  496
            KLS Q+++ L+Q+HV+P+FYS +  +T SNPVRTQA+G DG  Y LN T   N+QVNVS+
Sbjct  91   KLSQQEQVSLVQFHVLPQFYSLDSFETASNPVRTQASGSDGP-YTLNITADSNSQVNVST  149

Query  495  GAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
            G V T++   LR   PLAVY VD VL+P D 
Sbjct  150  GVVATRLGTALRATQPLAVYSVDTVLLPNDL  180



>ref|XP_003606406.1| Fasciclin-like arabinogalactan protein [Medicago truncatula]
 gb|AES88603.1| fasciclin-like arabinogalactan protein [Medicago truncatula]
Length=250

 Score =   152 bits (385),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 115/187 (61%), Gaps = 6/187 (3%)
 Frame = -2

Query  951  MAKAAVSFIVLSFLLVGLAEVKAQ-APAPSPG---GPVDIFAVLKKAGGQFGIFIKFLNT  784
            M    +SF +L  +        AQ +PAP+P     P DI  +LKKAGG F   I+ L T
Sbjct  4    MKHPFLSFTLLLIVFFSSTTTLAQKSPAPAPSTDTAPTDIIRILKKAGG-FTTLIRLLQT  62

Query  783  TQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFE  604
            TQV  Q+N Q+ +   G+T+FAP DN+F++L  G LN LSD+QK  LIQ+H++P F S  
Sbjct  63   TQVSTQINSQLLNSNGGLTLFAPNDNSFSSLKPGFLNSLSDEQKNKLIQFHLLPTFVSMS  122

Query  603  DLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDK  424
            +  T+SNPVRTQA G D    GLN T   NQVN+++G V   V   +  D  LAVYQVDK
Sbjct  123  NFDTLSNPVRTQA-GDDPYRLGLNVTSSGNQVNMTTGIVNVTVGGTVYTDHQLAVYQVDK  181

Query  423  VLVPLDF  403
            VL+P DF
Sbjct  182  VLLPRDF  188



>ref|XP_009377418.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Pyrus x 
bretschneideri]
Length=241

 Score =   152 bits (384),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 92/215 (43%), Positives = 131/215 (61%), Gaps = 21/215 (10%)
 Frame = -2

Query  930  FIVLSFLLVGL-----AEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQ  766
            F++L F L        A  +  APAPS     ++ AVL+KAG QF   IK L +T++ +Q
Sbjct  7    FVLLVFFLYSFSSNICARPRGAAPAPSA---TNVTAVLEKAG-QFTTLIKLLKSTKMDDQ  62

Query  765  VNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVS  586
            +N Q+++   G+T+FAPTDNAF++L +GTLN +S+QQK+ L+Q+H++P FYS    QTVS
Sbjct  63   INTQLSTSNQGITIFAPTDNAFSSLKAGTLNSISEQQKLQLVQFHILPSFYSAAQFQTVS  122

Query  585  NPVRTQA-NGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPL  409
            NP+ TQA N P      LN T   N VN+++G V   V N +  D  LAVY+VD+VL+PL
Sbjct  123  NPLHTQAGNSP------LNVTTSGNLVNITTGVVNATVANTIFTDSQLAVYEVDQVLLPL  176

Query  408  DFTADHPAAKAPTGSASS-----TPAGKSNDGKNA  319
                    A AP+ S +      +P+G S+ G  A
Sbjct  177  SIFGPAAPAPAPSKSETKVKGADSPSGSSDRGSTA  211



>ref|XP_006488128.1| PREDICTED: fasciclin-like arabinogalactan protein 12-like [Citrus 
sinensis]
Length=248

 Score =   152 bits (384),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 112/178 (63%), Gaps = 4/178 (2%)
 Frame = -2

Query  927  IVLSFLLVGLAEVKAQAPAPSPGGP---VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNI  757
            +VL FLL     V AQ  A    GP    ++  VL+KAG QF +FI+ L  T V +Q++ 
Sbjct  12   LVLLFLLHCTNTVLAQPAAAPAPGPPGPTNVTKVLEKAG-QFTLFIRLLKATSVADQIDH  70

Query  756  QVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPV  577
            Q+N   +GMT+FAPTDNAF++L SGTLN L+DQ+K+ LIQ+HVIP + S    QTVSNP+
Sbjct  71   QLNDTNNGMTLFAPTDNAFSSLSSGTLNSLNDQEKVALIQFHVIPTYVSLSQFQTVSNPL  130

Query  576  RTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
            RT A       Y LN T   N VN+SSG   T V   +  D  LAVYQVDKVL+P D 
Sbjct  131  RTNAGDSSRFEYPLNVTTFGNSVNISSGITNTSVSGTVYTDGQLAVYQVDKVLLPWDL  188



>gb|KDO73213.1| hypothetical protein CISIN_1g025798mg [Citrus sinensis]
Length=248

 Score =   152 bits (384),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 112/178 (63%), Gaps = 4/178 (2%)
 Frame = -2

Query  927  IVLSFLLVGLAEVKAQAPAPSPGGP---VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNI  757
            +VL FLL     V AQ  A    GP    ++  VL+KAG QF +FI+ L  T V +Q++ 
Sbjct  12   LVLLFLLHCTNTVVAQPAAAPAPGPPGPTNVTKVLEKAG-QFTLFIRLLKATSVADQIDH  70

Query  756  QVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPV  577
            Q+N   +GMT+FAPTDNAF++L SGTLN L+DQ+K+ LIQ+HVIP + S    QTVSNP+
Sbjct  71   QLNDTNNGMTLFAPTDNAFSSLSSGTLNSLNDQEKVALIQFHVIPTYVSLSQFQTVSNPL  130

Query  576  RTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
            RT A       Y LN T   N VN+SSG   T V   +  D  LAVYQVDKVL+P D 
Sbjct  131  RTNAGDSSRFEYPLNVTTFGNSVNISSGITNTSVSGTVYTDGQLAVYQVDKVLLPWDL  188



>gb|AAO92753.1| arabinogalactan protein [Gossypium hirsutum]
Length=243

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 123/185 (66%), Gaps = 3/185 (2%)
 Frame = -2

Query  960  RPRMAKAAVSFIVLSFLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTT  781
            R +     ++ ++L  L       +A A AP+P GP ++  +L+KAG QF +FI+ L +T
Sbjct  2    RQQYVFTTLTLLILFSLSCSTTLAQAPALAPAPSGPTNVTKILEKAG-QFTLFIRLLKST  60

Query  780  QVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFED  601
            QV NQ+  Q+N+  +GMTVFAPTDNAF++L SGTLN L+D+QK+ L+Q+H++P + +   
Sbjct  61   QVANQLLGQLNNSNNGMTVFAPTDNAFSSLKSGTLNSLTDEQKVELVQFHIVPTYLTSSQ  120

Query  600  LQTVSNPVRTQA-NGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDK  424
             QT+SNP+RTQA +  DGK + LN T   N VN+++G   T V   +  D  LAVYQ+D+
Sbjct  121  FQTISNPLRTQAGDSGDGK-FPLNITTSGNSVNITTGLTNTSVSGTIYTDGQLAVYQIDQ  179

Query  423  VLVPL  409
            VL PL
Sbjct  180  VLQPL  184



>ref|XP_006424604.1| hypothetical protein CICLE_v10028988mg [Citrus clementina]
 gb|ESR37844.1| hypothetical protein CICLE_v10028988mg [Citrus clementina]
Length=287

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 112/177 (63%), Gaps = 4/177 (2%)
 Frame = -2

Query  927  IVLSFLLVGLAEVKAQAPAPSPGGP---VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNI  757
            +VL FLL     V AQ  A    GP    ++  VL+KAG QF +FI+ L  T V +Q++ 
Sbjct  51   LVLLFLLHCTNTVLAQPAAAPAPGPPGPTNVTKVLEKAG-QFTLFIRLLKATSVADQIDH  109

Query  756  QVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPV  577
            Q+N   +GMT+FAPTDNAF++L SGTLN L+DQ+K+ LIQ+HVIP + S    QTVSNP+
Sbjct  110  QLNDTNNGMTLFAPTDNAFSSLSSGTLNSLNDQEKVALIQFHVIPTYVSLSQFQTVSNPL  169

Query  576  RTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLD  406
            RT A       Y LN T   N VN+SSG   T V   +  D  LAVYQVDKVL+P D
Sbjct  170  RTNAGDSSRFEYPLNVTTFGNSVNISSGITNTSVSGTVYTDGQLAVYQVDKVLLPWD  226



>ref|XP_007015428.1| FASCICLIN-like arabinogalactan-protein 11 [Theobroma cacao]
 gb|EOY33047.1| FASCICLIN-like arabinogalactan-protein 11 [Theobroma cacao]
Length=249

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 106/151 (70%), Gaps = 3/151 (2%)
 Frame = -2

Query  858  GPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGT  679
            GP ++  +L+KAG QF +FI+ L  T V NQ+  Q+N+  +GMT+FAPTDNAF++L SGT
Sbjct  41   GPTNVTKILEKAG-QFTLFIRLLKATAVANQLLGQLNNTNNGMTIFAPTDNAFSSLKSGT  99

Query  678  LNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQA-NGPDGKTYGLNFTGQNNQVNV  502
            LN LSD+QK+ L+Q+H+IP + S    QT+SNP+RTQA +  DGK + LN T   N VN+
Sbjct  100  LNSLSDEQKVELVQFHIIPTYLSSTQFQTISNPLRTQAGDSADGK-FPLNVTTSGNSVNI  158

Query  501  SSGAVETQVYNPLRKDPPLAVYQVDKVLVPL  409
            ++G   T V   +  D  LAVYQVDKVL PL
Sbjct  159  TTGLTNTSVSGTIYTDGQLAVYQVDKVLQPL  189



>ref|XP_008243923.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Prunus 
mume]
Length=245

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 106/149 (71%), Gaps = 1/149 (1%)
 Frame = -2

Query  849  DIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNK  670
            ++ AVL+KAG QF   IK L +T++ +Q++ Q+++   G+T+FAPTDNAF++L SGTLN 
Sbjct  36   NVTAVLEKAG-QFTTLIKLLKSTRMADQIDTQLSTSNQGITLFAPTDNAFSSLKSGTLNS  94

Query  669  LSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGA  490
            +S+QQK+ L+Q+HV+P FYS    QTVSNP+ TQA   +   + LN T   NQVN+++G 
Sbjct  95   ISEQQKLALMQFHVLPNFYSVSQFQTVSNPLHTQAGNSNDGQFPLNVTTAGNQVNITTGV  154

Query  489  VETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
            V   V N +  D  LAVY+VD+VL+PL+ 
Sbjct  155  VNATVANTIFTDNQLAVYEVDQVLLPLNI  183



>ref|NP_001174524.1| Os05g0563550 [Oryza sativa Japonica Group]
 gb|AAT77395.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAY99025.1| hypothetical protein OsI_20983 [Oryza sativa Indica Group]
 dbj|BAH93252.1| Os05g0563550 [Oryza sativa Japonica Group]
Length=251

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 104/148 (70%), Gaps = 3/148 (2%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            +++ A+L+K GG +  FI+ + +TQ   Q+N Q+N  + G TVFAPTD AF++L  GTLN
Sbjct  42   LNVTAILEK-GGSYTTFIRLMKSTQQDTQLNSQLNGTSTGFTVFAPTDGAFSSLKPGTLN  100

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQN-NQVNVSS  496
             LS Q ++ L+Q H++PKFYS +   T SNPVRTQA+G DG  Y LN T  + NQVNVS+
Sbjct  101  SLSAQDQVSLVQAHIVPKFYSMDAFDTASNPVRTQASGGDGP-YTLNITATSTNQVNVST  159

Query  495  GAVETQVYNPLRKDPPLAVYQVDKVLVP  412
            G V+T +   LR D PLAVY VDKVL+P
Sbjct  160  GVVDTTLGTALRADQPLAVYSVDKVLLP  187



>ref|XP_004251119.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Solanum 
lycopersicum]
Length=242

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 94/218 (43%), Positives = 131/218 (60%), Gaps = 5/218 (2%)
 Frame = -2

Query  864  PGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPT--DGMTVFAPTDNAFNNL  691
            P GP +I  +L+KAG QF   I+ +  +QV +Q+N Q+N+    +GMT+FAPTDNAF++L
Sbjct  25   PSGPTNITQILEKAG-QFTTLIRLMKVSQVSDQINTQLNNSNQGNGMTIFAPTDNAFSSL  83

Query  690  PSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQ  511
             SGT+N LS QQ++ L+Q+HV+P F S    QT+SNP+RTQA       + LN T   NQ
Sbjct  84   KSGTINTLSAQQQVQLVQFHVLPNFISMSQFQTISNPLRTQAGDSTPGDFPLNVTTSGNQ  143

Query  510  VNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGKSND  331
            VNVS+G  +  + N +  D  LAVYQVDKVL P+   A    A APT +    P  KS  
Sbjct  144  VNVSTGVDDATIANTIYTDGQLAVYQVDKVLQPMSIFAAPAPAMAPTPATLK-PKSKSPA  202

Query  330  GKNATAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLL  217
            G N T+  +  PA + +G   + +   T +L F + L 
Sbjct  203  GLNPTSGNDDLPAADDSGVERIAMHGTT-VLFFGISLF  239



>ref|XP_004505977.1| PREDICTED: fasciclin-like arabinogalactan protein 12-like [Cicer 
arietinum]
 ref|XP_004517220.1| PREDICTED: fasciclin-like arabinogalactan protein 12-like [Cicer 
arietinum]
Length=255

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 107/170 (63%), Gaps = 2/170 (1%)
 Frame = -2

Query  912  LLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDG  733
            +LV  +     AP P+   P DI  +L+KAGG F   I+ L TT+V  Q+N Q+ +   G
Sbjct  24   ILVQKSSAATPAPEPAESAPTDIIRILRKAGG-FATLIRLLQTTKVSTQINSQLLTSNGG  82

Query  732  MTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPD  553
            +T+FAP DNAF++L  G LN LSD+QK  LIQ+H++P F S  +  T+SNPVRTQA G D
Sbjct  83   LTMFAPNDNAFSSLKPGFLNSLSDEQKNKLIQFHLLPTFVSVSNFDTLSNPVRTQA-GDD  141

Query  552  GKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
                 LN T   NQVN+++G V   +   +  D  LAVYQVDKVL+P DF
Sbjct  142  PYRLALNVTSSGNQVNITTGIVNVTLGGTVYTDHQLAVYQVDKVLLPRDF  191



>gb|EMT20397.1| hypothetical protein F775_29110 [Aegilops tauschii]
Length=267

 Score =   150 bits (380),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 104/165 (63%), Gaps = 3/165 (2%)
 Frame = -2

Query  894  EVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAP  715
            E  A    P      ++ AVL+KAG Q+  FI+ + +TQ   Q+N Q N    G TVFAP
Sbjct  39   EAPAAGTTPKASAAPNVTAVLEKAG-QYTKFIRLMASTQQDTQLNAQANDSDTGFTVFAP  97

Query  714  TDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGL  535
            TD+AFN+L  GTLN LS Q ++ L+Q H++P FYS E  +T SNPVRTQA+G DG    +
Sbjct  98   TDSAFNSLKPGTLNSLSQQDQVTLVQAHIVPTFYSMESFETASNPVRTQASGTDGPCT-V  156

Query  534  NFTGQNNQ-VNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
            N T  +N  VNVS+G V T V   LR   PLAVY VD+VL+P+D 
Sbjct  157  NVTATSNSAVNVSTGIVHTTVGAALRATRPLAVYSVDQVLLPMDL  201



>emb|CDP07130.1| unnamed protein product [Coffea canephora]
Length=244

 Score =   150 bits (378),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 102/147 (69%), Gaps = 2/147 (1%)
 Frame = -2

Query  849  DIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNK  670
            +I  +L+KAG QF   I+ +  TQ+ +Q+N Q+N   +G+T+FAP D+AF++L SGTLN 
Sbjct  38   NITKILEKAG-QFTTLIRLMRITQISDQINGQLNDTNNGITIFAPADSAFSSLKSGTLNS  96

Query  669  LSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGA  490
            L+DQQK+ LIQ+H+IP F S    QTVSNPVRTQA G     + LN T   +QVNVS+G 
Sbjct  97   LTDQQKVQLIQFHIIPSFISATQFQTVSNPVRTQA-GDSSARFPLNVTTSGSQVNVSTGV  155

Query  489  VETQVYNPLRKDPPLAVYQVDKVLVPL  409
             +  V N +  D  LAVYQVDKVL+PL
Sbjct  156  DDATVANTIYTDNQLAVYQVDKVLLPL  182



>emb|CDY36978.1| BnaC09g17940D [Brassica napus]
Length=147

 Score =   146 bits (369),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 88/111 (79%), Gaps = 2/111 (2%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            ++I A+L+K GGQF  FI+ LNTTQ+G Q+NIQVNS ++GMTVFAPTDNAF NL  GTLN
Sbjct  38   INITAILEK-GGQFVTFIRLLNTTQIGKQINIQVNSSSEGMTVFAPTDNAFQNLKPGTLN  96

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPD-GKTYGLNFTG  523
            KLS   ++ LI YHV PKFY+ +DL +VSNPVRTQA G D G  YGLNFTG
Sbjct  97   KLSPDDQVKLILYHVSPKFYTMDDLLSVSNPVRTQATGRDGGAVYGLNFTG  147



>ref|XP_008455488.1| PREDICTED: fasciclin-like arabinogalactan protein 6 [Cucumis 
melo]
Length=247

 Score =   149 bits (377),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 96/222 (43%), Positives = 132/222 (59%), Gaps = 19/222 (9%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTT----QVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPS  685
            +++  +L + GGQF  FI+ LN +    Q+ NQ+N   NS  +G+T+ APTDN FN L S
Sbjct  36   INLTGILSQ-GGQFSTFIRLLNQSRLIIQLDNQLN---NSQGEGLTILAPTDNGFNALES  91

Query  684  GTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQ--NNQ  511
            G LN L DQQK  L+ YHV+PKFY+  +LQT+SNPVRTQA       +GLNFTGQ  +NQ
Sbjct  92   GALNSLDDQQKSQLLLYHVLPKFYTLTELQTISNPVRTQAG-----DWGLNFTGQANSNQ  146

Query  510  VNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGKSND  331
            VNVS+G V   + N LR+  PL+V+ VDKVL+P     +H AA  P   A         D
Sbjct  147  VNVSTGVVTVPINNKLREQSPLSVFVVDKVLLPEALFGNHTAAPPPKAPAPGADKAPV-D  205

Query  330  GK---NATAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLLS  214
            G+    + AAK P+     A +  + LGL+    +  + ++S
Sbjct  206  GETPPKSDAAKPPANDKGAAARNGVGLGLILSFGLIVISVVS  247



>gb|ABR68796.1| arabinogalactan protein 4 [Gossypium hirsutum]
 gb|AGS08232.1| fasciclin-like arabinogalactan protein 5 [Gossypium barbadense]
Length=239

 Score =   149 bits (377),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 82/212 (39%), Positives = 125/212 (59%), Gaps = 1/212 (0%)
 Frame = -2

Query  939  AVSFIVLSFLLVGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVN  760
            A+SF++ S L       +A A +P+P GP D+  +L+KAG Q+ +F++ L +TQV +++ 
Sbjct  13   AISFLLFSQLHCSTTSAQAPAQSPAPPGPPDVAKILQKAG-QYSVFVRLLKSTQVSDRLI  71

Query  759  IQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNP  580
             ++    DG T+FAPTD AF+ L SG LN L+D+Q++ L+ +HV+P +  F   QTVSNP
Sbjct  72   GELKDTDDGKTIFAPTDKAFSALKSGALNSLNDEQRVQLVLFHVVPDYIPFSQFQTVSNP  131

Query  579  VRTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFT  400
            +RTQA       + LN T   N V + +G ++T V   +  D  LAVY+VD+VL PL   
Sbjct  132  MRTQAGDSGDGEFPLNVTTSGNTVVLKTGLMKTSVSGTIYTDGQLAVYRVDQVLQPLQVF  191

Query  399  ADHPAAKAPTGSASSTPAGKSNDGKNATAAKE  304
            A   +A AP    S   A    + K ++ A +
Sbjct  192  AARSSALAPAPGMSRKAADVDGNSKASSLAMQ  223



>gb|EEE64696.1| hypothetical protein OsJ_19551 [Oryza sativa Japonica Group]
Length=312

 Score =   151 bits (382),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 104/148 (70%), Gaps = 3/148 (2%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            +++ A+L+K GG +  FI+ + +TQ   Q+N Q+N  + G TVFAPTD AF++L  GTLN
Sbjct  42   LNVTAILEK-GGSYTTFIRLMKSTQQDTQLNSQLNGTSTGFTVFAPTDGAFSSLKPGTLN  100

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQN-NQVNVSS  496
             LS Q ++ L+Q H++PKFYS +   T SNPVRTQA+G DG  Y LN T  + NQVNVS+
Sbjct  101  SLSAQDQVSLVQAHIVPKFYSMDAFDTASNPVRTQASGGDGP-YTLNITATSTNQVNVST  159

Query  495  GAVETQVYNPLRKDPPLAVYQVDKVLVP  412
            G V+T +   LR D PLAVY VDKVL+P
Sbjct  160  GVVDTTLGTALRADQPLAVYSVDKVLLP  187



>ref|XP_007204927.1| hypothetical protein PRUPE_ppa023999mg [Prunus persica]
 gb|EMJ06126.1| hypothetical protein PRUPE_ppa023999mg [Prunus persica]
Length=245

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 106/149 (71%), Gaps = 1/149 (1%)
 Frame = -2

Query  849  DIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNK  670
            ++ A+L+KAG QF   IK L +T++ +Q++ Q+++   G+T+FAPTDNAF++L SGTLN 
Sbjct  36   NVTAILEKAG-QFTTLIKLLKSTRMADQIDTQLSTSNQGITLFAPTDNAFSSLKSGTLNS  94

Query  669  LSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGA  490
            +S+QQK+ L+Q+HV+P F+S    QTVSNP+ TQA   +   + LN T   NQVN+++G 
Sbjct  95   ISEQQKLALMQFHVLPNFFSVSQFQTVSNPLHTQAGNSNDGQFPLNVTTAGNQVNITTGV  154

Query  489  VETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
            V   V N +  D  LAVY+VD+VL+PL+ 
Sbjct  155  VNATVANTIFTDNQLAVYEVDQVLLPLNI  183



>ref|XP_008225462.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Prunus 
mume]
Length=278

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 105/156 (67%), Gaps = 3/156 (2%)
 Frame = -2

Query  879  APAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAF  700
            A AP+  GP +I  +L+KAGG F IFI+ L +TQV NQ+  Q+N+    +TV APTDN F
Sbjct  60   ADAPASLGPTNITKILEKAGG-FNIFIRLLKSTQVDNQLYSQLNNSNSELTVLAPTDNGF  118

Query  699  NNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQ  520
            + L +G+LN LSD+QK+ L+Q+H+IP F + ++ QT+SNPVRTQA   DG  Y LN T  
Sbjct  119  SQLKTGSLNSLSDEQKVQLLQFHLIPDFLTVQNFQTLSNPVRTQAG--DGFEYPLNITTS  176

Query  519  NNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVP  412
               VN+S+G V T +   +  D  LA+YQVD VL P
Sbjct  177  GRAVNISTGLVNTSISGTVYSDGQLAIYQVDSVLKP  212



>ref|XP_004304418.1| PREDICTED: fasciclin-like arabinogalactan protein 12-like [Fragaria 
vesca subsp. vesca]
Length=246

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 109/162 (67%), Gaps = 4/162 (2%)
 Frame = -2

Query  891  VKAQAPA--PSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFA  718
            V AQ+PA  P+P G  ++ AVL+KAG QF   IK L +T+  +Q+N Q+++   G+T+FA
Sbjct  22   VSAQSPAVAPAPSG-TNVTAVLEKAG-QFTTLIKLLKSTKTADQINTQLSTSNQGITIFA  79

Query  717  PTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYG  538
            PTDNAF +L +GTLN +++QQK+ L+Q+H++P +YS    QT +NP+ TQA   D   + 
Sbjct  80   PTDNAFASLKAGTLNSITEQQKLQLLQFHILPTYYSTSQFQTATNPLHTQAGNSDDGQFP  139

Query  537  LNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVP  412
            LN T    QVN+++G     V N +  D  LAVYQVD+VL+P
Sbjct  140  LNVTTSGTQVNITTGVDTASVSNTIFTDNQLAVYQVDQVLLP  181



>ref|XP_007027300.1| FASCICLIN-like arabinogalactan-protein 11, putative [Theobroma 
cacao]
 gb|EOY07802.1| FASCICLIN-like arabinogalactan-protein 11, putative [Theobroma 
cacao]
Length=247

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 109/159 (69%), Gaps = 4/159 (3%)
 Frame = -2

Query  879  APAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSP--TDGMTVFAPTDN  706
            APAP P    +I ++L+K GGQF  FI+ L  TQV +Q+N Q+++P   DG+T+FAP+DN
Sbjct  26   APAP-PIRTDNITSILEK-GGQFTTFIRLLKATQVADQLNNQLSTPDPNDGLTIFAPSDN  83

Query  705  AFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFT  526
            AF++L  GTLN LSD++K+ L+Q+H++P   S    QT SNP+RTQA       + LN T
Sbjct  84   AFSSLNPGTLNTLSDREKLQLVQFHILPTLMSTTQFQTASNPLRTQAGDVKSGRFPLNVT  143

Query  525  GQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPL  409
               NQVN+++G V T V N +  D  +AVYQVD+VL+PL
Sbjct  144  ASGNQVNITTGVVNTTVANTVFSDRRIAVYQVDQVLLPL  182



>gb|ACU18940.1| unknown [Glycine max]
Length=240

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 105/159 (66%), Gaps = 3/159 (2%)
 Frame = -2

Query  876  PAPSPGG-PVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAF  700
            PAPSP   P DI  +LKKAGG F   I+ L TTQV  QVN Q+ +  +G+TVFAP DNAF
Sbjct  26   PAPSPSSTPTDIIRILKKAGG-FTTLIRLLTTTQVSTQVNAQLLNSNNGLTVFAPNDNAF  84

Query  699  NNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQ  520
             +L  G LN L+DQQK  LIQ+HV+P F S  +  T+SNPVRTQA G D     LN T  
Sbjct  85   QSLKPGFLNSLNDQQKNELIQFHVLPTFVSISNFDTLSNPVRTQA-GDDPDRLALNITSS  143

Query  519  NNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
             NQVN+++G V T V   +  D  LA+YQVDKVL+P DF
Sbjct  144  GNQVNLTTGVVNTTVGGSVYSDHQLAIYQVDKVLLPRDF  182



>ref|NP_001235903.1| uncharacterized protein LOC100500034 precursor [Glycine max]
 gb|ACU14668.1| unknown [Glycine max]
 gb|KHN21527.1| Fasciclin-like arabinogalactan protein 11 [Glycine soja]
Length=245

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 105/159 (66%), Gaps = 3/159 (2%)
 Frame = -2

Query  876  PAPSPG-GPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAF  700
            PAPSP   P DI  +LKKAGG F   I+ L TTQV  Q+N Q+ +  +G+TVFAP DNAF
Sbjct  28   PAPSPSSAPTDIIRILKKAGG-FTTLIRLLTTTQVSTQINAQLLNSNNGLTVFAPNDNAF  86

Query  699  NNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQ  520
             +L  G LN L+DQQK  LIQ+HV+P F S  +  T+SNPVRTQA G D     LN T  
Sbjct  87   QSLKPGFLNSLNDQQKNELIQFHVLPTFVSISNFDTLSNPVRTQA-GDDPDRLALNITSS  145

Query  519  NNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
             NQVN+++G V T V   +  D  LA+YQVDKVL+P DF
Sbjct  146  GNQVNLTTGVVNTTVGGSVYSDHQLAIYQVDKVLLPRDF  184



>ref|XP_007207834.1| hypothetical protein PRUPE_ppa023379mg [Prunus persica]
 gb|EMJ09033.1| hypothetical protein PRUPE_ppa023379mg [Prunus persica]
Length=276

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 105/156 (67%), Gaps = 3/156 (2%)
 Frame = -2

Query  879  APAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAF  700
            A AP+  GP +I  +L+KAGG F IFI+ L +TQV NQ+  Q+N+    +T+ APTDN F
Sbjct  58   ADAPASLGPTNITKILEKAGG-FNIFIRLLKSTQVDNQLYSQLNNSNSELTILAPTDNGF  116

Query  699  NNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQ  520
            + L +G+LN LSD+QK+ L+Q+H+IP F + ++ QT+SNPVRTQA   DG  Y LN T  
Sbjct  117  SQLKTGSLNSLSDEQKVQLLQFHLIPDFLTVQNFQTLSNPVRTQAG--DGFEYPLNITTS  174

Query  519  NNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVP  412
               VN+++G V T +   +  D  LA+YQVD VL P
Sbjct  175  GRAVNITTGLVNTSISGTVYSDGQLAIYQVDSVLKP  210



>ref|XP_003540183.1| PREDICTED: fasciclin-like arabinogalactan protein 12-like [Glycine 
max]
 gb|KHN11210.1| Fasciclin-like arabinogalactan protein 11 [Glycine soja]
Length=240

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 105/159 (66%), Gaps = 3/159 (2%)
 Frame = -2

Query  876  PAPSPGG-PVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAF  700
            PAPSP   P DI  +LKKAGG F   I+ L TTQV  Q+N Q+ +  +G+TVFAP DNAF
Sbjct  26   PAPSPSSTPTDIIRILKKAGG-FTTLIRLLTTTQVSTQINAQLLNSNNGLTVFAPNDNAF  84

Query  699  NNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQ  520
             +L  G LN L+DQQK  LIQ+HV+P F S  +  T+SNPVRTQA G D     LN T  
Sbjct  85   QSLKPGFLNSLNDQQKNELIQFHVLPTFVSISNFDTLSNPVRTQA-GDDPDRLALNITSS  143

Query  519  NNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
             NQVN+++G V T V   +  D  LA+YQVDKVL+P DF
Sbjct  144  GNQVNLTTGVVNTTVGGSVYSDHQLAIYQVDKVLLPRDF  182



>gb|ADE62307.1| fasciclin-like arabinogalactan protein [Eucalyptus nitens]
Length=265

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 101/156 (65%), Gaps = 1/156 (1%)
 Frame = -2

Query  870  PSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNL  691
            P+P GP DI  VLKKA  QF + +K +  T V  Q+N Q+N+  +G+T+FAP DNAF++L
Sbjct  52   PAPAGPTDITKVLKKAS-QFTVLLKLMRATSVDKQINAQLNNSNNGLTIFAPNDNAFSSL  110

Query  690  PSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQ  511
             SGTLN+LS +Q++ L+Q+HV+P + +    QTVSNP+RTQA G     + L  T   + 
Sbjct  111  KSGTLNQLSSEQQVELVQFHVVPTYLAVPQFQTVSNPLRTQAGGSGKFEFPLTLTTSGSS  170

Query  510  VNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
            VN+S+G     V   +  D  LAVY VDKVL+P+  
Sbjct  171  VNISTGVTNATVDQTVYNDGQLAVYMVDKVLLPMSI  206



>gb|ACZ67172.1| fasciclin and related adhesion glycoprotein, partial [Populus 
nigra]
Length=233

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 103/151 (68%), Gaps = 3/151 (2%)
 Frame = -2

Query  858  GPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGT  679
            GP ++  VL+K GGQF +FI+ L  TQ    +N Q+N+  + +T+FAP+DNAF++L SGT
Sbjct  28   GPTNVTKVLEK-GGQFSVFIRLLKATQEDVTLNGQLNNTNNAITIFAPSDNAFSSLKSGT  86

Query  678  LNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVS  499
            LN LSDQ+K  L+Q+H+IP+F S    QTVSNP+ TQA G  G+   LN T   N VN++
Sbjct  87   LNSLSDQEKAELVQFHIIPQFLSSSQFQTVSNPLTTQA-GSGGR-LELNVTTTGNSVNIT  144

Query  498  SGAVETQVYNPLRKDPPLAVYQVDKVLVPLD  406
            +G   T V   +  D  LAVYQVDKVL+PLD
Sbjct  145  TGLTNTSVSGTIYTDNQLAVYQVDKVLLPLD  175



>ref|XP_003521385.1| PREDICTED: fasciclin-like arabinogalactan protein 11-like [Glycine 
max]
Length=248

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 108/155 (70%), Gaps = 1/155 (1%)
 Frame = -2

Query  873  APSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNN  694
            AP+P GP +I  VL+KAG QF  FIK L  +Q+ +++N Q+N+   G+TVFAPTDNAF++
Sbjct  25   APAPAGPTNITQVLEKAG-QFTTFIKLLKASQIADRINSQLNNSNQGLTVFAPTDNAFSS  83

Query  693  LPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNN  514
            L +GTLN ++ Q ++ LIQ+H++P  Y+    QT SNP+ TQA   D   Y LN T   N
Sbjct  84   LKAGTLNSINSQDQMQLIQFHILPTLYTISQFQTASNPLHTQAGNSDDGEYPLNVTTSGN  143

Query  513  QVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPL  409
            QVNV++G V+T V N +  D  LAVYQVDKVL+P+
Sbjct  144  QVNVTTGVVDTTVSNTIYSDNQLAVYQVDKVLLPM  178



>ref|XP_002532604.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29770.1| conserved hypothetical protein [Ricinus communis]
Length=271

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 103/162 (64%), Gaps = 4/162 (2%)
 Frame = -2

Query  885  AQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDN  706
               P     GP+++  VL+KAG  F  F++ + TTQ   Q+  Q+N  +DG+T+FAPTD 
Sbjct  55   VMVPVQPSKGPLNVVKVLQKAG-HFTFFVRLIKTTQEDIQLFSQLNDSSDGVTIFAPTDG  113

Query  705  AFNNL-PSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNF  529
            AF+ +  SGTLN LSDQQKI L+QYH+IP+F S    QTVSNP++T A    G  +GLN 
Sbjct  114  AFSTIIKSGTLNSLSDQQKIELVQYHIIPRFLSTSQFQTVSNPLKTLAGSGSG--FGLNV  171

Query  528  TGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
            T   + VNVSSG   T V   +  D  + +YQVDKVL+PLD 
Sbjct  172  TTSESLVNVSSGLTRTYVSGIVYTDAKVGIYQVDKVLLPLDL  213



>ref|XP_010043729.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Eucalyptus 
grandis]
 gb|ABS50662.1| fasciclin-like arabinogalactan protein [Eucalyptus grandis]
Length=265

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 101/156 (65%), Gaps = 1/156 (1%)
 Frame = -2

Query  870  PSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNL  691
            P+P GP DI  VLKKA  QF + +K +  T V  Q+N Q+N+  +G+T+FAP DNAF++L
Sbjct  52   PAPAGPTDITKVLKKAS-QFTVLLKLMRATSVDKQINAQLNNSNNGLTIFAPNDNAFSSL  110

Query  690  PSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQ  511
             SGTLN+LS +Q++ L+Q+HV+P + +    QTVSNP+RTQA G     + L  T   + 
Sbjct  111  KSGTLNQLSSEQQVELVQFHVVPTYLAVPQFQTVSNPLRTQAGGSGKFEFPLTLTTSGSS  170

Query  510  VNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
            VN+S+G     V   +  D  LAVY VDKVL+P+  
Sbjct  171  VNISTGVTNATVDQTVYNDGQLAVYMVDKVLLPMSI  206



>ref|XP_003521389.1| PREDICTED: fasciclin-like arabinogalactan protein 11-like [Glycine 
max]
 gb|KHN09494.1| Fasciclin-like arabinogalactan protein 11 [Glycine soja]
Length=244

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 118/175 (67%), Gaps = 3/175 (2%)
 Frame = -2

Query  924  VLSFLL-VGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVN  748
            ++ FLL + +  + AQ PA +P GP +I  VL+KAG QF  FIK L  +Q+ +++N Q+N
Sbjct  4    LIHFLLFLFIQTISAQTPA-APAGPTNITQVLEKAG-QFTTFIKLLKASQIADRINSQLN  61

Query  747  SPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQ  568
            +   G+TVFAPTDNAF++L +GTLN ++ Q ++ LIQ+H++P  Y+    QT SNP+ TQ
Sbjct  62   NSNQGLTVFAPTDNAFSSLKAGTLNSINSQDQMQLIQFHILPTLYTISQFQTASNPLHTQ  121

Query  567  ANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
            A   D   Y LN T   NQVNV++G V+T V N +  D  L+VYQVDKVL+P+  
Sbjct  122  AGNSDDGEYPLNVTTSGNQVNVTTGVVDTTVSNTIYSDTQLSVYQVDKVLLPMKL  176



>ref|XP_007207073.1| hypothetical protein PRUPE_ppa026177mg [Prunus persica]
 gb|EMJ08272.1| hypothetical protein PRUPE_ppa026177mg [Prunus persica]
Length=276

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 103/149 (69%), Gaps = 3/149 (2%)
 Frame = -2

Query  858  GPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGT  679
            GP +I  +L+KAGG + +FI+ L +TQV NQ+  Q+N+    +TVFAPTD+AF+NL +GT
Sbjct  65   GPTNITKILEKAGG-YKVFIRLLKSTQVDNQLYRQLNNSNSQLTVFAPTDDAFSNLGTGT  123

Query  678  LNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVS  499
            LN LSD+QK  L+Q+H+IP F + ++ QT+SNPVRTQA    G  Y LN T   N VN+S
Sbjct  124  LNSLSDEQKGQLVQFHLIPDFLTIQNFQTISNPVRTQAGS--GLDYPLNITTSGNSVNIS  181

Query  498  SGAVETQVYNPLRKDPPLAVYQVDKVLVP  412
            SG V T +   +  D  +A+YQVD VL P
Sbjct  182  SGLVNTSISGTVYSDNQIAIYQVDSVLQP  210



>gb|ACZ67174.1| fasciclin and related adhesion glycoprotein [Populus deltoides]
Length=240

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 103/151 (68%), Gaps = 3/151 (2%)
 Frame = -2

Query  858  GPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGT  679
            GP ++  VL+K GGQF +FI+ L  TQ    +N Q+N+  + +T+FAP+DNAF++L SGT
Sbjct  35   GPTNVTKVLEK-GGQFSVFIRLLKATQEDVTLNGQLNNTNNAITIFAPSDNAFSSLKSGT  93

Query  678  LNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVS  499
            LN LSDQ+K  L+Q+H+IP+F S    QTVSNP+ TQA G  G+   LN T   N VN++
Sbjct  94   LNSLSDQEKAELVQFHIIPQFLSSSQFQTVSNPLTTQA-GSGGR-LELNVTTTGNSVNIT  151

Query  498  SGAVETQVYNPLRKDPPLAVYQVDKVLVPLD  406
            +G   T V   +  D  LAVYQVDKVL+PLD
Sbjct  152  TGLTNTSVSGTIYTDNQLAVYQVDKVLLPLD  182



>ref|XP_011041714.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Populus 
euphratica]
Length=240

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 103/151 (68%), Gaps = 3/151 (2%)
 Frame = -2

Query  858  GPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGT  679
            GP ++  VL+K GGQF +FI+ L  TQ    +N Q+N+  + +T+FAP+DNAF++L SGT
Sbjct  35   GPTNVTKVLEK-GGQFSVFIRLLKATQEDVTLNGQLNNTNNAITIFAPSDNAFSSLKSGT  93

Query  678  LNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVS  499
            LN LSDQ+K  L+Q+H+IP+F S    QTVSNP+ TQA G  G+   LN T   N VN++
Sbjct  94   LNSLSDQEKAELVQFHIIPQFLSSSQFQTVSNPLTTQA-GSGGR-LELNITTTGNSVNIT  151

Query  498  SGAVETQVYNPLRKDPPLAVYQVDKVLVPLD  406
            +G   T V   +  D  LAVYQVDKVL+PLD
Sbjct  152  TGLTNTSVSGTIYTDNQLAVYQVDKVLLPLD  182



>gb|ACU18441.1| unknown [Glycine max]
Length=208

 Score =   143 bits (361),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 113/168 (67%), Gaps = 2/168 (1%)
 Frame = -2

Query  906  VGLAEVKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMT  727
            + +  + AQ  AP+P GP +I  VL+KAG QF  FIK L  +Q+ +++N Q+N+   G+T
Sbjct  15   IFIQTISAQV-APAPAGPTNITQVLEKAG-QFTTFIKLLKASQIADRINSQLNNSNQGLT  72

Query  726  VFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGK  547
            VFAPTDNAF++L +GTLN ++ Q ++ LIQ+H++P  Y+    QT SNP+ TQA   D  
Sbjct  73   VFAPTDNAFSSLKAGTLNSINSQDQMQLIQFHILPTLYTISQFQTASNPLHTQAGNSDDG  132

Query  546  TYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
             Y LN T   NQVNV++G V+T V N +  D  LAVYQVDKVL+P+  
Sbjct  133  EYPLNVTTSGNQVNVTTGVVDTTVSNTIYSDNQLAVYQVDKVLLPMKL  180



>gb|ABV27476.1| fasciclin-like arabinogalactan protein 5 [Gossypium hirsutum]
Length=239

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 83/214 (39%), Positives = 124/214 (58%), Gaps = 5/214 (2%)
 Frame = -2

Query  939  AVSFIVLSFLLVGLAEVKAQAPA--PSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQ  766
            A+SF++  F  +  +   AQAPA  P+P GP D+  +L+KAG Q+ +F++ L +TQV ++
Sbjct  13   AISFLL--FFQLHCSTTSAQAPAQSPAPPGPPDVTKILQKAG-QYSVFVRLLKSTQVSDR  69

Query  765  VNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVS  586
            +  ++    DG T+FAPTD AF+ L SG LN L+D+Q++ L+ +HVIP +      QTVS
Sbjct  70   LIGELKDTDDGKTIFAPTDKAFSALKSGALNSLNDEQRVQLVLFHVIPSYIPLSQFQTVS  129

Query  585  NPVRTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLD  406
            NP+RTQA       + LN     N V + +G  +T V + +  D  LAVY+VD+VL PL 
Sbjct  130  NPMRTQAGDSGDGEFPLNVPSSGNTVVLKTGLTKTSVSDTIYTDGQLAVYRVDQVLQPLQ  189

Query  405  FTADHPAAKAPTGSASSTPAGKSNDGKNATAAKE  304
              A   +A AP    S   A      K ++ A +
Sbjct  190  VFAARSSALAPAPGMSRKAADVDGKSKASSLAMQ  223



>gb|ABB97042.1| unknown [Brassica rapa]
Length=248

 Score =   144 bits (364),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 104/149 (70%), Gaps = 1/149 (1%)
 Frame = -2

Query  858  GPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGT  679
            GP ++  +L+KAG QF +FI+ L +T V NQ+  Q+N+  +G+T+FAP+D++F++L +GT
Sbjct  35   GPTNVTKILEKAG-QFTVFIRLLKSTGVANQLYGQLNNSDNGITIFAPSDSSFSSLKAGT  93

Query  678  LNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVS  499
            LN LSD+Q++ L+Q+HVIP + S  + QT+SNP+RTQA       + LN T   N VN++
Sbjct  94   LNSLSDEQQVELVQFHVIPSYVSSSNFQTISNPLRTQAGDSAEGHFPLNITTSGNTVNIT  153

Query  498  SGAVETQVYNPLRKDPPLAVYQVDKVLVP  412
            SG   T V   +  D  LAVYQVDKVL+P
Sbjct  154  SGVTNTTVSGSVYSDGQLAVYQVDKVLLP  182



>gb|KHN09493.1| Fasciclin-like arabinogalactan protein 11 [Glycine soja]
Length=248

 Score =   144 bits (364),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 107/155 (69%), Gaps = 1/155 (1%)
 Frame = -2

Query  873  APSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNN  694
            AP+P GP +I  VL+KAG QF  FIK L  +Q+ +++N Q+N+   G+TVFAPTDNAF++
Sbjct  25   APAPAGPTNITQVLEKAG-QFTTFIKLLKASQIADRINSQLNNSNQGLTVFAPTDNAFSS  83

Query  693  LPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNN  514
            L +GTLN ++ Q ++ LIQ+H +P  Y+    QT SNP+ TQA   D   Y LN T   N
Sbjct  84   LKAGTLNSINSQDQMQLIQFHTLPTLYTISQFQTASNPLHTQAGNSDDGEYPLNVTTSGN  143

Query  513  QVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPL  409
            QVNV++G V+T V N +  D  LAVYQVDKVL+P+
Sbjct  144  QVNVTTGVVDTTVSNTIYSDNQLAVYQVDKVLLPM  178



>ref|XP_002321841.1| fasciclin-like AGP 15 family protein [Populus trichocarpa]
 gb|ABK92565.1| unknown [Populus trichocarpa]
 gb|EEF05968.1| fasciclin-like AGP 15 family protein [Populus trichocarpa]
 gb|ACZ67173.1| fasciclin and related adhesion glycoprotein [Populus balsamifera]
Length=240

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 103/151 (68%), Gaps = 3/151 (2%)
 Frame = -2

Query  858  GPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGT  679
            GP ++  VL+K GGQF +FI+ L  TQ    +N Q+N+  + +T+FAP+DNAF++L SGT
Sbjct  35   GPTNVTKVLEK-GGQFSVFIRLLKATQEDVTLNGQLNNTNNAITIFAPSDNAFSSLKSGT  93

Query  678  LNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVS  499
            LN LSDQ+K  L+Q+H+IP+F S    QTVSNP+ TQA G  G+   LN T   N VN++
Sbjct  94   LNSLSDQEKAELVQFHIIPQFLSSSQFQTVSNPLTTQA-GSGGR-LELNVTTTGNSVNIT  151

Query  498  SGAVETQVYNPLRKDPPLAVYQVDKVLVPLD  406
            +G   T V   +  D  LAVYQVDKVL+PLD
Sbjct  152  TGLTNTSVSGTIYTDNQLAVYQVDKVLLPLD  182



>ref|XP_006604571.1| PREDICTED: fasciclin-like arabinogalactan protein 11-like [Glycine 
max]
 gb|KHN02347.1| Fasciclin-like arabinogalactan protein 11 [Glycine soja]
Length=249

 Score =   144 bits (364),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 108/157 (69%), Gaps = 1/157 (1%)
 Frame = -2

Query  873  APSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNN  694
            AP+P GP +I  VL+KAG QF  FIK L  +Q+ +++N Q+N+   G+TVFAPTDNAF++
Sbjct  25   APAPAGPTNITQVLEKAG-QFTTFIKLLKASQIADRINSQLNNSNQGLTVFAPTDNAFSS  83

Query  693  LPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNN  514
            L +GTLN ++ Q ++ LIQ+H++P  Y+    QT SNP+ TQA   D   Y LN T   N
Sbjct  84   LKAGTLNSINSQDQMQLIQFHILPTLYTISQFQTASNPLHTQAGNSDDGEYPLNVTTSGN  143

Query  513  QVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
            QVNV++G V+T V N +  D  LAVYQVDKVL+P+  
Sbjct  144  QVNVTTGVVDTTVSNTIYSDNQLAVYQVDKVLLPMKL  180



>ref|XP_002866383.1| hypothetical protein ARALYDRAFT_496195 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42642.1| hypothetical protein ARALYDRAFT_496195 [Arabidopsis lyrata subsp. 
lyrata]
Length=249

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 107/156 (69%), Gaps = 1/156 (1%)
 Frame = -2

Query  879  APAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAF  700
            A AP+P GP ++  +L+KAG QF +FI+ L +T V NQ+  Q+ +  +G+T+FAP+D++F
Sbjct  29   AVAPTPPGPTNVTKILEKAG-QFTVFIRLLKSTGVANQLYGQLKNSDNGITIFAPSDSSF  87

Query  699  NNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQ  520
            + L +GTLN L+D+Q++ LIQ+HVIP + S  + QT+SNP+RTQA       + LN T  
Sbjct  88   SGLKAGTLNSLTDEQQVELIQFHVIPSYVSSSNFQTISNPLRTQAGDSADGHFPLNVTTS  147

Query  519  NNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVP  412
             N VN+++G   T V   +  D  LAVYQVDKVL+P
Sbjct  148  GNTVNITTGVTNTTVSGNVYSDGQLAVYQVDKVLLP  183



>gb|ABS50664.1| fasciclin-like arabinogalactan protein [Eucalyptus grandis]
Length=251

 Score =   144 bits (363),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 102/152 (67%), Gaps = 3/152 (2%)
 Frame = -2

Query  858  GPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNS--PTDGMTVFAPTDNAFNNLPS  685
             P ++ A+L+KAG QF  FI+ L ++ VG+Q++ Q+++     G T+FAPTDNAF NL S
Sbjct  37   SPTNVTAILEKAG-QFTTFIRLLKSSLVGDQLSSQLSNQKSNQGFTIFAPTDNAFANLKS  95

Query  684  GTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVN  505
            GTLN LSDQ+K  L+Q+H+IP   S     T+SNP+RTQA   D   + LN T   NQVN
Sbjct  96   GTLNMLSDQEKTQLVQFHIIPSVISLTQFSTISNPLRTQAGNTDNGQFPLNVTTSGNQVN  155

Query  504  VSSGAVETQVYNPLRKDPPLAVYQVDKVLVPL  409
            V++G V   V N +  +  LA+YQVD+VL+PL
Sbjct  156  VTTGVVAASVDNAITSNSKLAIYQVDQVLLPL  187



>ref|XP_009131912.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Brassica 
rapa]
Length=248

 Score =   144 bits (363),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 104/149 (70%), Gaps = 1/149 (1%)
 Frame = -2

Query  858  GPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGT  679
            GP ++  +L+KAG QF +FI+ L +T V NQ+  Q+N+  +G+T+FAP+D++F++L +GT
Sbjct  35   GPTNVTKILEKAG-QFTVFIRLLKSTGVANQLYGQLNNSDNGITIFAPSDSSFSSLKAGT  93

Query  678  LNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVS  499
            LN LSD+Q++ L+Q+HVIP + S  + QT+SNP+RTQA       + LN T   N VN++
Sbjct  94   LNSLSDEQQVELVQFHVIPSYVSSSNFQTISNPLRTQAGDSAEGHFPLNITTSGNTVNIT  153

Query  498  SGAVETQVYNPLRKDPPLAVYQVDKVLVP  412
            SG   T V   +  D  LAVYQVDKVL+P
Sbjct  154  SGVTNTTVSGSVYSDGQLAVYQVDKVLLP  182



>ref|XP_009405666.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Musa acuminata 
subsp. malaccensis]
Length=253

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 106/153 (69%), Gaps = 3/153 (2%)
 Frame = -2

Query  858  GPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGT  679
            GP+++ A+L K GG F  FI+ L  T+V  Q+N Q+N+  +G+TVFAPTDNAF  L +GT
Sbjct  36   GPLNLTAILVK-GGNFNSFIRLLQQTRVDEQLNSQLNNSFNGLTVFAPTDNAFGGLKAGT  94

Query  678  LNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNF-TGQNNQVNV  502
            LN L+ Q+++ L+ YHV+P++YS    QT SNP+ TQA+G  G  + LN  T  +NQ NV
Sbjct  95   LNSLNQQEQVELVLYHVLPRYYSLTIFQTASNPLPTQASGKTG-VFKLNVTTTTSNQANV  153

Query  501  SSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
            S+G VET +  PL  + PLAVY V+KVL+P + 
Sbjct  154  STGVVETAINTPLYSEFPLAVYPVEKVLLPYEI  186



>ref|XP_004961219.1| PREDICTED: fasciclin-like arabinogalactan protein 11-like [Setaria 
italica]
Length=194

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 104/167 (62%), Gaps = 20/167 (12%)
 Frame = -2

Query  792  LNTTQVGNQVNIQVN-SPTDGMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKF  616
            + +TQ   Q+N Q+N S   G TVFAPTDNAF +L  GTLNKLS Q+++ L+QYH++P+F
Sbjct  1    MKSTQQDTQLNSQLNNSFGSGYTVFAPTDNAFTSLKPGTLNKLSQQEQVSLVQYHILPQF  60

Query  615  YSFEDLQTVSNPVRTQANGPDGKTYGLNFTG-QNNQVNVSSGAVETQVYNPLRKDPPLAV  439
            YS +  +T SNPVRTQA+G DG  Y LN T   NNQVNVS+G V T+V   LR   PLAV
Sbjct  61   YSLDSFETASNPVRTQASGSDGP-YTLNITADSNNQVNVSTGLVATRVGTALRDTQPLAV  119

Query  438  YQVDKVLVPLDF-----------------TADHPAAKAPTGSASSTP  349
            Y VDKVL+P D                  +     A+AP GSA S P
Sbjct  120  YSVDKVLLPNDLFGVKPPSSAPPAPNKKPSKGGSVAEAPAGSADSAP  166



>emb|CDY67775.1| BnaCnng56350D [Brassica napus]
Length=248

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 104/149 (70%), Gaps = 1/149 (1%)
 Frame = -2

Query  858  GPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGT  679
            GP ++  +L+KAG QF IFI+ L +T V NQ+  Q+N+  +G+T+FAP+D++F++L +GT
Sbjct  35   GPTNVTKILEKAG-QFTIFIRLLKSTGVANQLYGQLNNSDNGITIFAPSDSSFSSLKAGT  93

Query  678  LNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVS  499
            LN LSD+Q++ L+Q+HV+P + S  + QT+SNP+RTQA       + LN T   N VN++
Sbjct  94   LNSLSDEQQVELVQFHVVPSYVSSSNFQTISNPLRTQAGDSADGHFPLNITTSGNTVNIT  153

Query  498  SGAVETQVYNPLRKDPPLAVYQVDKVLVP  412
            SG   T V   +  D  LAVYQVDKVL+P
Sbjct  154  SGVTNTTVSGSVYSDGQLAVYQVDKVLLP  182



>gb|KCW85724.1| hypothetical protein EUGRSUZ_B02486 [Eucalyptus grandis]
Length=314

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 101/156 (65%), Gaps = 1/156 (1%)
 Frame = -2

Query  870  PSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNL  691
            P+P GP DI  VLKKA  QF + +K +  T V  Q+N Q+N+  +G+T+FAP DNAF++L
Sbjct  101  PAPAGPTDITKVLKKAS-QFTVLLKLMRATSVDKQINAQLNNSNNGLTIFAPNDNAFSSL  159

Query  690  PSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQ  511
             SGTLN+LS +Q++ L+Q+HV+P + +    QTVSNP+RTQA G     + L  T   + 
Sbjct  160  KSGTLNQLSSEQQVELVQFHVVPTYLAVPQFQTVSNPLRTQAGGSGKFEFPLTLTTSGSS  219

Query  510  VNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
            VN+S+G     V   +  D  LAVY VDKVL+P+  
Sbjct  220  VNISTGVTNATVDQTVYNDGQLAVYMVDKVLLPMSI  255



>ref|XP_004144519.1| PREDICTED: fasciclin-like arabinogalactan protein 6-like [Cucumis 
sativus]
 gb|KGN43478.1| hypothetical protein Csa_7G039260 [Cucumis sativus]
Length=245

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 93/222 (42%), Positives = 132/222 (59%), Gaps = 20/222 (9%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLN----TTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPS  685
            +++  +L + GGQF  FI+ LN     TQ+ NQ+N   NS   G+T+ APTDN FN+L  
Sbjct  35   INLTGILSE-GGQFSTFIRLLNESRLITQLDNQLN---NSQGGGLTILAPTDNGFNSLRP  90

Query  684  GTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQ--NNQ  511
            G LN L DQQK  L+ YHV+PKFY+  +LQTVSNPVRTQA       +GLNFTGQ  +NQ
Sbjct  91   GALNALDDQQKSQLLLYHVLPKFYTLIELQTVSNPVRTQAG-----DWGLNFTGQANSNQ  145

Query  510  VNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGKSND  331
            VNVS+G +   + N LR+  PL+++ VD+VL+P     +H AA     +  +  A    D
Sbjct  146  VNVSTGIITAPINNKLREQSPLSIFVVDQVLLPDALFGNHTAAPPKAPAPGTDKAPV--D  203

Query  330  GKN---ATAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLLS  214
            G+    + AAK P+   +   K  + LGL+    +  + ++S
Sbjct  204  GETPPKSDAAKPPANDKSAVTKNGVGLGLILSFGLIVISVVS  245



>ref|XP_004163432.1| PREDICTED: fasciclin-like arabinogalactan protein 6-like [Cucumis 
sativus]
Length=245

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 93/222 (42%), Positives = 132/222 (59%), Gaps = 20/222 (9%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLN----TTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPS  685
            +++  +L + GGQF  FI+ LN     TQ+ NQ+N   NS   G+T+ APTDN FN+L  
Sbjct  35   INLTGILSE-GGQFSTFIRLLNESRLITQLDNQLN---NSQGGGLTILAPTDNGFNSLRP  90

Query  684  GTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQ--NNQ  511
            G LN L DQQK  L+ YHV+PKFY+  +LQTVSNPVRTQA       +GLNFTGQ  +NQ
Sbjct  91   GALNALDDQQKSQLLLYHVLPKFYTLIELQTVSNPVRTQAG-----DWGLNFTGQANSNQ  145

Query  510  VNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGKSND  331
            VNVS+G +   + N LR+  PL+++ VD+VL+P     +H AA     +  +  A    D
Sbjct  146  VNVSTGIITVPINNKLREQSPLSIFVVDQVLLPDALFGNHTAAPPKAPAPGTDKAPV--D  203

Query  330  GKN---ATAAKEPSPAPNGAGKMSLELGLVTGILVFCMGLLS  214
            G+    + AAK P+   +   K  + LGL+    +  + ++S
Sbjct  204  GETPPKSDAAKPPANDKSAVTKNGVGLGLILSFGLIVISVVS  245



>ref|XP_006361812.1| PREDICTED: fasciclin-like arabinogalactan protein 12-like [Solanum 
tuberosum]
Length=239

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 111/185 (60%), Gaps = 1/185 (1%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            +++  +L+KAG Q   FI+ L  TQ  N++  Q+N+  +G+T+F PTDNAF N+ +GTLN
Sbjct  33   LNVTKILEKAG-QCSTFIRLLQNTQQLNEITSQLNNSNNGITMFVPTDNAFLNMKAGTLN  91

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSG  493
              +DQQK  LIQ+H++P +YS    QT SNP+RTQA G   + + +N T   + VN+++G
Sbjct  92   SFTDQQKAELIQFHILPTYYSLTQFQTASNPLRTQAGGTTDREFPINITTIGSSVNITTG  151

Query  492  AVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGKSNDGKNATA  313
             V T + N +  D  LA+YQVD VL+PL F      A APT       AG S+      A
Sbjct  152  IVNTSISNTIYTDNQLAIYQVDNVLLPLQFFVPPAPAPAPTPITRKKKAGSSDSSSKQDA  211

Query  312  AKEPS  298
            +   S
Sbjct  212  SSATS  216



>ref|XP_010520362.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Tarenaya 
hassleriana]
Length=248

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 107/158 (68%), Gaps = 1/158 (1%)
 Frame = -2

Query  885  AQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDN  706
            +QA AP+P GP ++  +L+KAG QF +FI+ L  T V +Q+  Q+N+  +G+T+FAP+D+
Sbjct  27   SQAMAPAPPGPTNVTKILEKAG-QFTVFIRLLKATGVASQLYGQLNNSDNGITIFAPSDS  85

Query  705  AFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFT  526
            AF+ L SGTLN L+D+Q+  L+Q+HVIP F S  + QTVSNP+RTQA       + LN T
Sbjct  86   AFSALKSGTLNSLTDEQQTELVQFHVIPTFISSSNFQTVSNPLRTQAGDSADGHFPLNVT  145

Query  525  GQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVP  412
               + VN++SG   T V   +  D  LA+YQ+D+VL P
Sbjct  146  TNGSSVNLTSGLTNTSVSGNVYSDAQLAIYQIDQVLRP  183



>gb|ADE62309.1| fasciclin-like arabinogalactan protein [Eucalyptus nitens]
Length=248

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 102/152 (67%), Gaps = 3/152 (2%)
 Frame = -2

Query  858  GPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNS--PTDGMTVFAPTDNAFNNLPS  685
             P ++ A+L+KAG QF  FI+ L ++ VG+Q++ Q+++     G T+FAPTDNAF +L S
Sbjct  37   SPTNVTAILEKAG-QFTTFIRLLKSSLVGDQLSSQLSNQKSNQGFTIFAPTDNAFASLKS  95

Query  684  GTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVN  505
            GTLN LSDQ+K  L+Q+H+IP   S     T+SNP+RTQA   D   + LN T   NQVN
Sbjct  96   GTLNMLSDQEKTQLVQFHIIPSVISLTQFSTISNPLRTQAGNTDNGQFPLNVTTSGNQVN  155

Query  504  VSSGAVETQVYNPLRKDPPLAVYQVDKVLVPL  409
            V++G V   V N +  +  LA+YQVD+VL+PL
Sbjct  156  VTTGVVAASVDNAITSNSKLAIYQVDQVLLPL  187



>ref|XP_004487128.1| PREDICTED: fasciclin-like arabinogalactan protein 12-like [Cicer 
arietinum]
Length=248

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 98/149 (66%), Gaps = 2/149 (1%)
 Frame = -2

Query  849  DIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNK  670
            DI  +LKKAGG F   I+ L TTQV  Q+N Q+ +  +G+T+FAP DN+F+ L  G LN 
Sbjct  42   DIIRILKKAGG-FTTLIRLLQTTQVATQINAQLLNSNNGLTLFAPNDNSFSTLKPGFLNS  100

Query  669  LSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGA  490
            L+DQQK  LIQ+H +P F S  +  T+SNPVRTQA G D K   LN T   NQVN+++G 
Sbjct  101  LNDQQKNELIQFHELPTFVSISNFDTLSNPVRTQA-GDDPKRLALNITSSGNQVNLTTGV  159

Query  489  VETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
            V   V   +  D  LA+YQVDKVL+P DF
Sbjct  160  VNATVGGSVFSDHQLAIYQVDKVLLPRDF  188



>dbj|BAB08198.1| unnamed protein product [Oryza sativa Japonica Group]
Length=255

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 93/147 (63%), Gaps = 1/147 (1%)
 Frame = -2

Query  849  DIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNK  670
            +I  VL KAG QF   I+ + +T    Q++ Q+NS  +G+TVFAPTDNAF +LPSGTLN 
Sbjct  40   NITGVLAKAG-QFNTLIRLMRSTGAAEQIDNQLNSSRNGLTVFAPTDNAFTSLPSGTLNS  98

Query  669  LSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGA  490
            LSDQQK  L+QYHV+          TVSNP+RTQA       Y LN T +  QVN+S+G 
Sbjct  99   LSDQQKNSLVQYHVLSTLIPMSQFDTVSNPLRTQAGSNSPGQYPLNVTAEGQQVNISTGV  158

Query  489  VETQVYNPLRKDPPLAVYQVDKVLVPL  409
            V   V N L     L VYQVDKVL+P+
Sbjct  159  VNATVGNALYTGDNLVVYQVDKVLLPM  185



>ref|XP_010046692.1| PREDICTED: fasciclin-like arabinogalactan protein 11 [Eucalyptus 
grandis]
Length=251

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 102/152 (67%), Gaps = 3/152 (2%)
 Frame = -2

Query  858  GPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNS--PTDGMTVFAPTDNAFNNLPS  685
             P ++ A+L+KAG QF  FI+ L ++ VG+Q++ Q+++     G T+FAPTDNAF +L S
Sbjct  37   SPTNVTAILEKAG-QFTTFIRLLKSSLVGDQLSSQLSNQKSNQGFTIFAPTDNAFASLKS  95

Query  684  GTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVN  505
            GTLN LSDQ+K  L+Q+H+IP   S     T+SNP+RTQA   D   + LN T   NQVN
Sbjct  96   GTLNMLSDQEKTQLVQFHIIPSVISLTQFSTISNPLRTQAGNTDNGQFPLNVTTSGNQVN  155

Query  504  VSSGAVETQVYNPLRKDPPLAVYQVDKVLVPL  409
            V++G V   V N +  +  LA+YQVD+VL+PL
Sbjct  156  VTTGVVAASVDNAITSNSKLAIYQVDQVLLPL  187



>gb|AAA74420.1| arabinogalactan-like protein [Pinus taeda]
Length=264

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 100/147 (68%), Gaps = 2/147 (1%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            +++  +L KAG QF  F+  L +TQVG Q+  Q+N+   G+T+FAP+D AF  L  G LN
Sbjct  52   LNLSGILDKAG-QFNTFLSLLKSTQVGMQLQSQLNNSQQGITIFAPSDAAFAALKPGALN  110

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSG  493
             ++DQ KI L+QYH +P +Y+F   QTVSNPVRT A+G +G  +G+N T   N VNVS+G
Sbjct  111  SITDQDKIALLQYHALPSYYTFSQFQTVSNPVRTMASG-NGGPFGVNVTAFGNSVNVSTG  169

Query  492  AVETQVYNPLRKDPPLAVYQVDKVLVP  412
             V T V + +    P+AVYQVDKVL+P
Sbjct  170  LVNTPVNSAVYSQSPVAVYQVDKVLLP  196



>ref|XP_007162741.1| hypothetical protein PHAVU_001G176400g [Phaseolus vulgaris]
 gb|ESW34735.1| hypothetical protein PHAVU_001G176400g [Phaseolus vulgaris]
Length=295

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 122/210 (58%), Gaps = 17/210 (8%)
 Frame = -2

Query  891  VKAQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPT  712
            + AQ  AP+P GP +I  VL+KAG QF  FIK L  TQ  +++N Q+N+   G+TVFAPT
Sbjct  71   ISAQV-APAPAGPTNITQVLEKAG-QFTTFIKLLKATQTADRLNSQLNNSNQGLTVFAPT  128

Query  711  DNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLN  532
            DNAF +L +GTLN ++ Q ++ L+Q+H++P  Y+    QT SNP+ TQA   D   Y LN
Sbjct  129  DNAFTSLKAGTLNSINSQDQMQLVQFHILPTLYTISQFQTASNPLHTQAGNSDDGEYPLN  188

Query  531  FTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF--------------TAD  394
             T   NQVNV++G V+T V N +  D  LAVYQVDKVL+P+                   
Sbjct  189  VTTSGNQVNVTTGVVDTTVSNTIFSDNQLAVYQVDKVLLPMALFGSTAPAAAPAEAPAPT  248

Query  393  HPAAKAPTGSASSTPAGKSNDGKNATAAKE  304
             P      G+A S P+G S D   A + K 
Sbjct  249  KPEKNVRAGAADS-PSGSSADASGAVSLKR  277



>gb|ABR17950.1| unknown [Picea sitchensis]
Length=260

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 99/142 (70%), Gaps = 2/142 (1%)
 Frame = -2

Query  837  VLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQ  658
            +L KAG QF IF+  L +TQVG Q+  Q+N+   G+T+FAP+D AF  L  GTLN ++DQ
Sbjct  53   ILDKAG-QFNIFLSLLKSTQVGMQLQSQLNNSQQGVTIFAPSDAAFAALKPGTLNAITDQ  111

Query  657  QKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQ  478
             KI L+QYH +P +Y+F   QTVSNPVRT A+G +G  +G+N T   N VN+S+G V T 
Sbjct  112  DKIALLQYHALPSYYTFGQFQTVSNPVRTMASG-NGGPFGVNVTAVGNSVNISTGLVNTP  170

Query  477  VYNPLRKDPPLAVYQVDKVLVP  412
            V + +    P+AVYQVDKVL+P
Sbjct  171  VNSAVYSQNPVAVYQVDKVLLP  192



>ref|XP_002317778.1| fasciclin-like AGP 15 family protein [Populus trichocarpa]
 gb|EEE95998.1| fasciclin-like AGP 15 family protein [Populus trichocarpa]
Length=269

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 100/162 (62%), Gaps = 4/162 (2%)
 Frame = -2

Query  885  AQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDN  706
               P     GPV++  +L+KAGG F +FI+ + +TQ   QV  Q+N   DG+T+FAPTD 
Sbjct  55   VMVPVQVSKGPVNVIKILQKAGG-FAVFIRLIKSTQEDIQVFSQLNDSRDGVTIFAPTDG  113

Query  705  AFNNL-PSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNF  529
            AF+ +  SG LN LSD QKI L+Q+H+IPK  +  + QTVSNP+ T A    G  + LN 
Sbjct  114  AFSAIIKSGVLNSLSDHQKIELVQFHIIPKILTTANFQTVSNPITTLAGS--GSRFALNV  171

Query  528  TGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
                N VNV+SG   T V   +  D  LAVYQVDKVL+PLD 
Sbjct  172  ITTENMVNVTSGLTNTSVSAIVYTDSQLAVYQVDKVLLPLDI  213



>gb|AAT37950.1| fasciclin-like AGP 7 [Populus tremula x Populus alba]
Length=269

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 100/161 (62%), Gaps = 4/161 (2%)
 Frame = -2

Query  885  AQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDN  706
               P     GPV++  +L+KAGG F +FI+ + +TQ   QV  Q+N   DG+T+FAPTD 
Sbjct  55   VMVPVQVSKGPVNVIKILQKAGG-FAVFIRLIKSTQEDIQVFSQLNDSRDGVTIFAPTDG  113

Query  705  AFNNL-PSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNF  529
            AF+ +  SG LN LSD QKI L+Q+H+IPK  +  + QTVSNP+ T A    G  + LN 
Sbjct  114  AFSAIIKSGVLNSLSDHQKIELVQFHIIPKVLTTANFQTVSNPITTLAGS--GSRFALNV  171

Query  528  TGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLD  406
                N VNV+SG   T V   +  D  LAVYQVDKVL+PLD
Sbjct  172  ITTENMVNVTSGLTNTSVSAIVYTDSQLAVYQVDKVLLPLD  212



>gb|KHG08221.1| Fasciclin-like arabinogalactan protein 12 [Gossypium arboreum]
Length=266

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 102/144 (71%), Gaps = 3/144 (2%)
 Frame = -2

Query  837  VLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQ  658
            +L+KAG QF  FI+ +  TQV NQ+  Q+N+  +G+T+FAPTD+AF++L SGTLN LSD+
Sbjct  58   ILEKAG-QFSTFIRLMKATQVANQLLGQLNNTNNGITIFAPTDSAFSSLKSGTLNSLSDE  116

Query  657  QKILLIQYHVIPKFYSFEDLQTVSNPVRTQA-NGPDGKTYGLNFTGQNNQVNVSSGAVET  481
            QK+ LIQ+H+IP + S    QT+SNP+RTQA +  DGK + LN T   + VN++SG   T
Sbjct  117  QKVELIQFHIIPTYLSSAQFQTISNPLRTQAGDSGDGK-FPLNVTSTGDTVNITSGLTNT  175

Query  480  QVYNPLRKDPPLAVYQVDKVLVPL  409
             V   +  D  LAVYQ+D+VL PL
Sbjct  176  SVSGTVYTDGQLAVYQIDRVLQPL  199



>ref|XP_004246666.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Solanum 
lycopersicum]
Length=239

 Score =   142 bits (357),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 110/185 (59%), Gaps = 1/185 (1%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            +++  +L+KAG Q   FI+ L  TQ  N++  Q+N+  +G+T+F PTDNAF N+ +GTLN
Sbjct  33   LNVTKILEKAG-QCSTFIRLLQNTQQLNEITSQLNNSNNGITMFVPTDNAFLNMKAGTLN  91

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSG  493
              +DQQK  LIQ+H++P +YS    QT SNP+RTQA G   + + +N T   + VN+++G
Sbjct  92   SFNDQQKAELIQFHILPTYYSLTQFQTASNPLRTQAGGTTDREFPINITTTGSSVNITTG  151

Query  492  AVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGKSNDGKNATA  313
             V   + N +  D  LA+YQVD VL+PL F      A APT       AG S+      A
Sbjct  152  IVNASISNTIYTDNQLAIYQVDNVLLPLQFFVPPAPAPAPTPITRKRKAGSSDSSSKQDA  211

Query  312  AKEPS  298
            +   S
Sbjct  212  SSATS  216



>gb|EAY72628.1| hypothetical protein OsI_00494 [Oryza sativa Indica Group]
Length=269

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 93/147 (63%), Gaps = 1/147 (1%)
 Frame = -2

Query  849  DIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNK  670
            +I  VL KAG QF   I+ + +T    Q++ Q+NS  +G+TVFAPTDNAF +LPSGTLN 
Sbjct  54   NITGVLAKAG-QFNTLIRLMRSTGAAEQIDNQLNSSRNGLTVFAPTDNAFTSLPSGTLNS  112

Query  669  LSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGA  490
            LSDQQK  L+QYHV+          TVSNP+RTQA       Y LN T +  QVN+S+G 
Sbjct  113  LSDQQKNSLVQYHVLSTLIPMSQFDTVSNPLRTQAGSNSPGQYPLNVTAEGQQVNISTGV  172

Query  489  VETQVYNPLRKDPPLAVYQVDKVLVPL  409
            V   V N L     L VYQVDKVL+P+
Sbjct  173  VNATVGNALYTGDNLVVYQVDKVLLPM  199



>dbj|BAD61084.1| putative arabinogalactan protein [Oryza sativa Japonica Group]
Length=269

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 93/147 (63%), Gaps = 1/147 (1%)
 Frame = -2

Query  849  DIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNK  670
            +I  VL KAG QF   I+ + +T    Q++ Q+NS  +G+TVFAPTDNAF +LPSGTLN 
Sbjct  54   NITGVLAKAG-QFNTLIRLMRSTGAAEQIDNQLNSSRNGLTVFAPTDNAFTSLPSGTLNS  112

Query  669  LSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGA  490
            LSDQQK  L+QYHV+          TVSNP+RTQA       Y LN T +  QVN+S+G 
Sbjct  113  LSDQQKNSLVQYHVLSTLIPMSQFDTVSNPLRTQAGSNSPGQYPLNVTAEGQQVNISTGV  172

Query  489  VETQVYNPLRKDPPLAVYQVDKVLVPL  409
            V   V N L     L VYQVDKVL+P+
Sbjct  173  VNATVGNALYTGDNLVVYQVDKVLLPM  199



>ref|XP_011094679.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Sesamum 
indicum]
Length=241

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 110/184 (60%), Gaps = 15/184 (8%)
 Frame = -2

Query  849  DIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNK  670
            ++ A+L+KAG QF  FI+ L  T+V +Q+   +N+   G+T+ APTD +F+NL  GTLN 
Sbjct  36   NVTAILEKAG-QFTTFIRLLQNTKVADQITAALNNSNQGLTILAPTDGSFSNLKPGTLNS  94

Query  669  LSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGA  490
             +D+QK+ LIQ+H++P F+S    Q  SNP+RTQA G  G ++ LN T   N VN+++G 
Sbjct  95   FTDEQKVELIQFHILPSFFSPSQFQAASNPLRTQAGGSQG-SFPLNVTATGNSVNITTGV  153

Query  489  VETQVYNPLRKDPPLAVYQVDKVLVPLDF-------------TADHPAAKAPTGSASSTP  349
                V N +  D  LAVYQVD+VL+PL F                  +A AP+GS  ST 
Sbjct  154  TNATVGNAIYTDGQLAVYQVDQVLLPLSFFMTPAPAPAPQKPKKAARSADAPSGSDVSTT  213

Query  348  AGKS  337
            A  S
Sbjct  214  ADSS  217



>ref|XP_009769903.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Nicotiana 
sylvestris]
Length=239

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 109/179 (61%), Gaps = 11/179 (6%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            +++  +L KAG Q   FI+ L  TQ  N++  Q+N+  +G+T+F PTDNAF ++ +GTLN
Sbjct  33   LNVTKILDKAG-QCSTFIRLLQNTQQLNEITSQLNNSNNGITMFVPTDNAFLSMKAGTLN  91

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSG  493
              +DQQK  LIQ+H++P +YS    QT SNP+RTQA G   + + +N T   + VN+++G
Sbjct  92   SFTDQQKAELIQFHILPTYYSLTQFQTASNPLRTQAGGTSNREFPINITTTGSSVNITTG  151

Query  492  AVETQVYNPLRKDPPLAVYQVDKVLVPLDF----------TADHPAAKAPTGSASSTPA  346
             V   V N +  D  LA+YQVD+VL+PL F          T   P  KA +  +S+ PA
Sbjct  152  IVNASVSNTIYTDNQLAIYQVDQVLLPLKFFVPPAPAPAPTPIKPKKKAGSADSSTEPA  210



>ref|XP_010104104.1| hypothetical protein L484_014387 [Morus notabilis]
 gb|EXB98545.1| hypothetical protein L484_014387 [Morus notabilis]
Length=310

 Score =   143 bits (360),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 112/176 (64%), Gaps = 4/176 (2%)
 Frame = -2

Query  861  GGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSG  682
             GP D+  VL+KAG  F +FI+ L +T V  Q+  Q+N  ++ +T+FAPT+ AF+ L  G
Sbjct  88   AGPTDVSKVLEKAGS-FSVFIRLLKSTSVSIQIENQLNV-SNTLTIFAPTNGAFSALKPG  145

Query  681  TLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNV  502
            TLN LS +QK+ L+QYH++P   S ++ QT+SNPVRTQA+  +   Y LN T + N VN+
Sbjct  146  TLNSLSTEQKVQLVQYHILPTLVSLQNFQTLSNPVRTQAS--NTFDYPLNITVEGNYVNI  203

Query  501  SSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGKSN  334
            S+G V T +   + +D  LA+Y+VDKVL+PL   A  P   AP  +    P  ++N
Sbjct  204  STGIVNTTIAGTVYEDSQLAIYKVDKVLLPLGIFAPRPKPLAPAPTPLLKPKKETN  259



>ref|XP_010446221.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Camelina 
sativa]
Length=248

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 104/149 (70%), Gaps = 1/149 (1%)
 Frame = -2

Query  858  GPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGT  679
            GP ++  +L+KAG QF +FI+ L +T V NQ+  Q+N+  +G+T+FAP+D++F++L +GT
Sbjct  38   GPTNVTKILEKAG-QFTVFIRLLKSTGVANQLLGQLNNSDNGITIFAPSDSSFSSLKAGT  96

Query  678  LNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVS  499
            LN L+D+Q++ LIQ+HVIP + S  + QT+SNP+RTQA       + LN T   N VN++
Sbjct  97   LNSLNDEQQVELIQFHVIPSYVSSSNFQTISNPLRTQAGDSAEGHFPLNITTSGNTVNIT  156

Query  498  SGAVETQVYNPLRKDPPLAVYQVDKVLVP  412
            +G   T V   +  D  LAVYQVDKVL+P
Sbjct  157  TGVTNTTVSGNVYSDGQLAVYQVDKVLLP  185



>ref|XP_002280565.2| PREDICTED: fasciclin-like arabinogalactan protein 11 [Vitis vinifera]
Length=281

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 91/233 (39%), Positives = 132/233 (57%), Gaps = 22/233 (9%)
 Frame = -2

Query  960  RPRMAKAAVS-FIVLSFLLVGLAEVKAQAPA--PSPGGPVDIFAVLKKAGGQFGIFIKFL  790
            + RM K  +S F++L        +   Q+PA  P+P GP DI A+L+KAG ++  FI  L
Sbjct  36   KKRMMKQLLSPFLILLIFFHLCTKTSGQSPASAPAPSGPPDITALLRKAG-KYTTFIGLL  94

Query  789  NTTQVGNQVNIQVNSPTD-GMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFY  613
             +TQ+  Q+N ++   +D G T+FAPTD AF+NL  GTLN  +DQQK  L Q+HV+P + 
Sbjct  95   KSTQMDVQINSELQKKSDPGFTIFAPTDTAFSNLKPGTLNSFTDQQKAALTQFHVVPSYL  154

Query  612  SFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQ  433
            S    QTVSNP+RT+A G D   + LN T    QV++++G V T V + +  D  LAVY+
Sbjct  155  SNSQFQTVSNPLRTEAGG-DTVEFPLNITTNGTQVSMTTGLVNTTVDDTVYIDGQLAVYE  213

Query  432  VDKVLVPLDFTAD-----------HPAAKAPTGSASSTPAGKSNDGKNATAAK  307
            + +VL+                   P++ AP+GS SS     S D  +AT  +
Sbjct  214  IGEVLLAQGILRPPAPPPLPPKNASPSSNAPSGSISS-----SGDFSDATCLR  261



>ref|XP_002317779.1| fasciclin-like AGP 15 family protein [Populus trichocarpa]
 gb|EEE95999.1| fasciclin-like AGP 15 family protein [Populus trichocarpa]
Length=269

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 100/162 (62%), Gaps = 4/162 (2%)
 Frame = -2

Query  885  AQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDN  706
               P     GPV++  +L+KAGG F +FI+ + +TQ   QV  Q+N   DG+T+FAPTD 
Sbjct  55   VMVPVQVSKGPVNVIKILQKAGG-FAVFIRLIKSTQEDIQVFSQLNDSRDGVTIFAPTDG  113

Query  705  AFNNL-PSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNF  529
            AF+ +  SG LN LSD QKI L+Q+H+IP+  +  + QTVSNP+ T A    G  + LN 
Sbjct  114  AFSAIIKSGVLNSLSDHQKIELVQFHIIPRILTTANFQTVSNPITTLAGS--GSRFALNV  171

Query  528  TGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
                N VNV+SG   T V   +  D  LA+YQVDKVL+PLD 
Sbjct  172  ITTENMVNVTSGLTNTSVSAIVYTDSQLAIYQVDKVLLPLDI  213



>ref|XP_010483697.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Camelina 
sativa]
Length=250

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 104/149 (70%), Gaps = 1/149 (1%)
 Frame = -2

Query  858  GPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGT  679
            GP ++  +L+KAG QF +FI+ L +T V NQ+  Q+N+  +G+T+FAP+D++F++L +GT
Sbjct  37   GPTNVTKILEKAG-QFTVFIRLLKSTGVANQLLGQLNNSDNGITIFAPSDSSFSSLKAGT  95

Query  678  LNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVS  499
            LN L+D+Q++ LIQ+HVIP + S  + QT+SNP+RTQA       + LN T   N VN++
Sbjct  96   LNSLNDEQQVELIQFHVIPSYVSSSNFQTISNPLRTQAGDSAEGHFPLNITTSGNTVNIT  155

Query  498  SGAVETQVYNPLRKDPPLAVYQVDKVLVP  412
            +G   T +   +  D  LAVYQVDKVL+P
Sbjct  156  TGVTNTTISGNVYSDGQLAVYQVDKVLLP  184



>gb|ABV27478.1| fasciclin-like arabinogalactan protein 7 [Gossypium hirsutum]
Length=262

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 102/144 (71%), Gaps = 3/144 (2%)
 Frame = -2

Query  837  VLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQ  658
            +L+KAG QF  FI+ +  TQV NQ+  Q+N+  +G+T+FAPTD+AF++L SGTLN LSD+
Sbjct  58   ILEKAG-QFSTFIRLMKATQVANQLLGQLNNTNNGITIFAPTDSAFSSLKSGTLNSLSDE  116

Query  657  QKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGP-DGKTYGLNFTGQNNQVNVSSGAVET  481
            QK+ LIQ+H+IP + S    QT+SNP+RTQA+   DGK + LN T   + VN++SG   T
Sbjct  117  QKVELIQFHIIPTYLSSAQFQTISNPLRTQASDSGDGK-FPLNVTSTGDTVNITSGLTNT  175

Query  480  QVYNPLRKDPPLAVYQVDKVLVPL  409
             V   +  D  LAVYQ+D+VL PL
Sbjct  176  SVSGTVYTDGQLAVYQIDRVLQPL  199



>gb|KHN32074.1| Fasciclin-like arabinogalactan protein 11 [Glycine soja]
Length=239

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 107/168 (64%), Gaps = 4/168 (2%)
 Frame = -2

Query  900  LAEVKAQAPAPSPGGP-VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTV  724
            L  + + + AP P  P  DI  +LKKAGG F   I+ L  TQV NQ+N Q+ + + G+T+
Sbjct  15   LIVLFSHSTAPVPSAPPTDIIRILKKAGG-FTTLIRLLQATQVSNQINSQLLTTSGGLTL  73

Query  723  FAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKT  544
            FAP DNAF++L  G LN L+DQQK  LIQ+H++P + S  +  T+SNPVRTQA G +   
Sbjct  74   FAPNDNAFSSLKPGFLNSLNDQQKNELIQFHLLPTYVSVSNFDTLSNPVRTQA-GENPDR  132

Query  543  YGLNFTGQ-NNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
              LN T    NQVN+++G V   +   +  D  LAVYQVDKVL+P DF
Sbjct  133  LALNITSSGGNQVNMTTGVVNVTLGGTVYTDHQLAVYQVDKVLLPRDF  180



>ref|XP_011014336.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Populus 
euphratica]
Length=273

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 100/161 (62%), Gaps = 4/161 (2%)
 Frame = -2

Query  885  AQAPAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDN  706
               P     GPV++  +L+KAGG F +FI+ + +TQ   Q+  Q+N   DG+T+FAPTD 
Sbjct  55   VMVPVQVSKGPVNVIKILQKAGG-FAVFIRIIKSTQEDIQIFSQLNDSRDGVTIFAPTDG  113

Query  705  AFNNL-PSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNF  529
            AF+ +  SG LN LSD QKI L+Q+H+IP+  +  + QTVSNP+ T A    G  + LN 
Sbjct  114  AFSAIIKSGVLNSLSDHQKIELVQFHIIPRVLTTANFQTVSNPITTLAGS--GSRFALNV  171

Query  528  TGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLD  406
                N VNV+SG   T V   +  D  LA+YQVDKVL+PLD
Sbjct  172  ITTENMVNVTSGLTNTSVSAIVYTDSQLAIYQVDKVLLPLD  212



>ref|XP_011025076.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Populus 
euphratica]
Length=289

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 100/159 (63%), Gaps = 4/159 (3%)
 Frame = -2

Query  876  PAPSPGGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFN  697
            P     GPV++  +L+KAGG F +FI+ + +TQ   Q+  Q+N   DG+T+FAPTD AF+
Sbjct  78   PVQVSKGPVNVIKILQKAGG-FAVFIRIIKSTQEDIQIFSQLNDSRDGVTIFAPTDGAFS  136

Query  696  NL-PSGTLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQ  520
             +  SG LN LSD QKI L+Q+H+IP+  +  + QTVSNP+ T A    G  + LN    
Sbjct  137  AIIKSGVLNSLSDHQKIELVQFHIIPRVLTTANFQTVSNPITTLAGS--GSRFALNVITT  194

Query  519  NNQVNVSSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
             N VNV+SG   T V   +  D  LA+YQVDKVL+PLD 
Sbjct  195  ENMVNVTSGLTNTSVSAIVYTDSQLAIYQVDKVLLPLDI  233



>ref|XP_002455162.1| hypothetical protein SORBIDRAFT_03g005280 [Sorghum bicolor]
 gb|EES00282.1| hypothetical protein SORBIDRAFT_03g005280 [Sorghum bicolor]
Length=267

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 95/146 (65%), Gaps = 1/146 (1%)
 Frame = -2

Query  849  DIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNK  670
            +I  VL K GGQF  FI+ L +T V +Q++ QV++  +G+TVFAPTDNAF +LP+GTLN 
Sbjct  51   NITGVLAK-GGQFNTFIRLLKSTGVASQIDNQVSNGGNGITVFAPTDNAFTSLPAGTLNS  109

Query  669  LSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGA  490
            LSDQ K  L+QYHV+          TVSNP+RTQA       Y LN T +  QVN+++G 
Sbjct  110  LSDQDKNALVQYHVVSTAIPMSQFDTVSNPLRTQAGSASPGEYPLNVTSEGQQVNITTGV  169

Query  489  VETQVYNPLRKDPPLAVYQVDKVLVP  412
            V   V N L  +  L VYQVDKVL+P
Sbjct  170  VNATVANSLYSEDSLVVYQVDKVLLP  195



>emb|CAN80889.1| hypothetical protein VITISV_031811 [Vitis vinifera]
Length=243

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 91/230 (40%), Positives = 130/230 (57%), Gaps = 22/230 (10%)
 Frame = -2

Query  951  MAKAAVS-FIVLSFLLVGLAEVKAQAPA--PSPGGPVDIFAVLKKAGGQFGIFIKFLNTT  781
            M K  +S F++L        +   Q+PA  P+P GP DI AVL+KAG ++  FI  L +T
Sbjct  1    MMKQLLSPFLILLIFFHLCTKTSGQSPASAPAPSGPPDITAVLRKAG-KYTTFIGLLKST  59

Query  780  QVGNQVNIQVNSPTD-GMTVFAPTDNAFNNLPSGTLNKLSDQQKILLIQYHVIPKFYSFE  604
            Q+  Q+N ++   +D G T+FAPTD AF+NL  GTLN  +DQQK  L Q+HV+P + S  
Sbjct  60   QMDVQINSELQKKSDPGFTIFAPTDTAFSNLKPGTLNSFTDQQKAALTQFHVVPSYLSNS  119

Query  603  DLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSGAVETQVYNPLRKDPPLAVYQVDK  424
              QTVSNP+RT+A G D   + LN T    QV++++G V T V + +  D  LAVY++ +
Sbjct  120  QFQTVSNPLRTEAGG-DTVEFPLNITTNGTQVSMTTGLVNTTVDDTVYIDGQLAVYEIGE  178

Query  423  VLVPLDFTAD-----------HPAAKAPTGSASSTPAGKSNDGKNATAAK  307
            VL+                   P++ AP+GS SS     S D  +AT  +
Sbjct  179  VLLAQGILRPPAPPPLPPKNASPSSNAPSGSISS-----SGDFSDATCLR  223



>ref|XP_009630866.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Nicotiana 
tomentosiformis]
Length=239

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 80/213 (38%), Positives = 118/213 (55%), Gaps = 9/213 (4%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            +++  +L KAG Q   FI+ L  TQ  N++  Q+N+  +G+T+F PTDNAF ++ +GTLN
Sbjct  33   LNVTKILDKAG-QCSTFIRLLQNTQQLNEITSQLNNSNNGITMFVPTDNAFLSMKAGTLN  91

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSG  493
              +DQQK  LIQ+H++P +YS    QT SNP+RTQA G   + + +N T   + VN+++G
Sbjct  92   SFTDQQKAELIQFHILPTYYSLTQFQTASNPLRTQAGGTSNREFPINITTTGSSVNITTG  151

Query  492  AVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGKSNDGKNATA  313
             V   V + +  D  LA+YQVD+VL+PL F        APT       AG ++       
Sbjct  152  IVNASVSSTIYTDNQLAIYQVDQVLLPLKFFVPPAPPPAPTPIKPKKKAGSADSSSEPAV  211

Query  312  AKEPSPAPNGAGKMSLELGLVTGILVFCMGLLS  214
            +   S  PN   K        TG+L F   + S
Sbjct  212  SSGTSLVPNMIYK--------TGLLFFFSAVFS  236



>ref|XP_010104101.1| hypothetical protein L484_014384 [Morus notabilis]
 gb|EXB98542.1| hypothetical protein L484_014384 [Morus notabilis]
Length=278

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 107/163 (66%), Gaps = 4/163 (2%)
 Frame = -2

Query  861  GGPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSG  682
             GP D+  VL+KAGG F +FI+ L +T V  Q+  Q+N  ++ +T+FAPT+ AF+ L  G
Sbjct  68   AGPTDVSKVLEKAGG-FSVFIRLLKSTSVSIQIENQLNV-SNTLTIFAPTNGAFSALKPG  125

Query  681  TLNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNV  502
            TLN LS +QK+ L+QYH++P   S ++ QT+SNPVRTQA+  +   + LN T + N VN+
Sbjct  126  TLNSLSTEQKVQLVQYHILPSSVSLQNFQTLSNPVRTQAS--NTYDFPLNITVEGNWVNI  183

Query  501  SSGAVETQVYNPLRKDPPLAVYQVDKVLVPLDFTADHPAAKAP  373
            S+G V T +   + +D  LA+Y+VDKVL+PL   A  P    P
Sbjct  184  STGIVNTTISATVYEDNQLAIYKVDKVLLPLGIFAPRPKPLVP  226



>gb|ABR68798.1| arabinogalactan protein 3 [Gossypium hirsutum]
Length=264

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 102/144 (71%), Gaps = 3/144 (2%)
 Frame = -2

Query  837  VLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLNKLSDQ  658
            +L+KAG QF  FI+ +  TQV NQ+  Q+N+  +G+T+FAP+D+AF++L SGTLN LSD+
Sbjct  60   ILEKAG-QFSTFIRLMKATQVANQLLGQLNNTNNGITIFAPSDSAFSSLKSGTLNSLSDE  118

Query  657  QKILLIQYHVIPKFYSFEDLQTVSNPVRTQA-NGPDGKTYGLNFTGQNNQVNVSSGAVET  481
            QK+ LIQ+H+IP + S    QT+SNP+RTQA +  DGK + LN T   + VN++SG   T
Sbjct  119  QKVELIQFHIIPTYLSSAQFQTISNPLRTQAGDSGDGK-FPLNVTSSGDTVNITSGLTNT  177

Query  480  QVYNPLRKDPPLAVYQVDKVLVPL  409
             V   +  D  LAVYQ+D+VL PL
Sbjct  178  SVSGTVYTDGQLAVYQIDRVLQPL  201



>ref|XP_009389411.1| PREDICTED: fasciclin-like arabinogalactan protein 9 [Musa acuminata 
subsp. malaccensis]
Length=243

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 89/217 (41%), Positives = 127/217 (59%), Gaps = 16/217 (7%)
 Frame = -2

Query  852  VDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTLN  673
            ++I A+L   G  +  FI  L  TQV  Q+N ++N   +  T+FAPTD AF +L SGTLN
Sbjct  37   LNITAILVN-GTNYNTFIHLLRETQVDIQINEELNDLANAFTIFAPTDAAFKSLKSGTLN  95

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNN-QVNVSS  496
             L  Q ++ L+ YH++P++YS +  +T SNPVRTQA+G  G  Y +N T  +N QVN+S+
Sbjct  96   TLVQQDQVGLVLYHILPRYYSLDMFETASNPVRTQASGNHGA-YTINVTTDSNMQVNIST  154

Query  495  GAVETQVYNPLRKDP-PLAVYQVDKVLVPLDFTADHPAAKAPTGSASSTPAGKSNDGKNA  319
            G V T++   +  D   LAVY +DKVL+P D     P A  P+ +   +P+G      N+
Sbjct  155  GIVHTRIAKKIFDDSQQLAVYSLDKVLLPYDLFGPKPPASVPSTAGGKSPSG------NS  208

Query  318  TAAKEPSPAPNGAGKMSLELG---LVTGILVFCMGLL  217
            TAA+E +   +GAG     +G   LV G LV   G L
Sbjct  209  TAAEEGT---SGAGLHGRGVGWSLLVGGGLVAIAGYL  242



>ref|XP_006400843.1| hypothetical protein EUTSA_v10014491mg [Eutrema salsugineum]
 gb|ESQ42296.1| hypothetical protein EUTSA_v10014491mg [Eutrema salsugineum]
Length=250

 Score =   139 bits (350),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 103/149 (69%), Gaps = 1/149 (1%)
 Frame = -2

Query  858  GPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGT  679
            GP ++  +L+KAG QF IFI+ L +T V +Q+  Q+N+  +G+T+FAP+D++F+ L +GT
Sbjct  37   GPTNVTKILEKAG-QFTIFIRLLKSTGVASQLYGQLNNSENGITIFAPSDSSFSGLKAGT  95

Query  678  LNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVS  499
            LN L+D+Q++ L+Q+HVIP + S  + QT+SNP+RTQA       + LN T   N VN++
Sbjct  96   LNSLTDEQQVELVQFHVIPSYVSSSNFQTISNPLRTQAGDSADGHFPLNITTSGNTVNIT  155

Query  498  SGAVETQVYNPLRKDPPLAVYQVDKVLVP  412
            SG   T V   +  D  LAVYQVD+VL+P
Sbjct  156  SGVTNTTVSGNVYSDGQLAVYQVDQVLLP  184



>ref|XP_006655019.1| PREDICTED: fasciclin-like arabinogalactan protein 11-like [Oryza 
brachyantha]
Length=212

 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 96/147 (65%), Gaps = 3/147 (2%)
 Frame = -2

Query  846  IFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVN--SPTDGMTVFAPTDNAFNNLPSGTLN  673
            I AVL KAG QF  F++ L++TQ G Q+N Q+   + + G+TVFAP DNAF  LP+GTLN
Sbjct  41   ITAVLTKAG-QFTKFLQLLSSTQAGEQINNQIKGKASSGGLTVFAPPDNAFTALPTGTLN  99

Query  672  KLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVSSG  493
            KLSDQQK  L+Q+HV+ +        TVSNP+RTQA       Y LN T + ++VN+S+G
Sbjct  100  KLSDQQKTSLVQFHVVSQLLPMAQFDTVSNPLRTQAGETAAGKYPLNVTAEGSRVNISTG  159

Query  492  AVETQVYNPLRKDPPLAVYQVDKVLVP  412
             V   V N L     L VYQVDKVL+P
Sbjct  160  VVNATVDNTLYSGDRLVVYQVDKVLLP  186



>ref|XP_008225421.1| PREDICTED: fasciclin-like arabinogalactan protein 12 [Prunus 
mume]
Length=289

 Score =   140 bits (353),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 103/149 (69%), Gaps = 3/149 (2%)
 Frame = -2

Query  858  GPVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGT  679
            GP +I  +L+KAGG + +FI+ + +TQV NQ+  Q+N+    +TVFAPTD+AF++L +G+
Sbjct  66   GPTNITKILEKAGG-YKVFIRLIKSTQVDNQLYRQLNNSNSQLTVFAPTDDAFSSLGTGS  124

Query  678  LNKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQNNQVNVS  499
            LN LSD+QK  L+Q+H+IP F + ++ QT+SNPVRTQA    G  Y LN T   N VN+S
Sbjct  125  LNSLSDEQKGQLVQFHLIPDFLTIQNFQTISNPVRTQAG--SGLEYPLNITTSGNSVNIS  182

Query  498  SGAVETQVYNPLRKDPPLAVYQVDKVLVP  412
            +G V T +   +  D  +A+YQVD VL P
Sbjct  183  TGLVNTSISGTVYSDNQIAIYQVDSVLQP  211



>ref|XP_007132234.1| hypothetical protein PHAVU_011G077400g [Phaseolus vulgaris]
 gb|ESW04228.1| hypothetical protein PHAVU_011G077400g [Phaseolus vulgaris]
Length=263

 Score =   139 bits (351),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 99/152 (65%), Gaps = 3/152 (2%)
 Frame = -2

Query  855  PVDIFAVLKKAGGQFGIFIKFLNTTQVGNQVNIQVNSPTDGMTVFAPTDNAFNNLPSGTL  676
            P DI  +LKKAGG F   I+ L  TQV NQ+N Q+ +   G+T+FAP DNAF++L  G L
Sbjct  56   PTDIIRILKKAGG-FTTLIRLLQATQVSNQINSQLLTTNGGLTLFAPNDNAFSSLKPGFL  114

Query  675  NKLSDQQKILLIQYHVIPKFYSFEDLQTVSNPVRTQANGPDGKTYGLNFTGQ-NNQVNVS  499
            N L+DQQK  LIQ+H++P F S  +  T+SNPVRTQA G +     LN T    NQVN++
Sbjct  115  NSLNDQQKNELIQFHLLPTFVSVSNFDTLSNPVRTQA-GENPDRLALNITSSGGNQVNMT  173

Query  498  SGAVETQVYNPLRKDPPLAVYQVDKVLVPLDF  403
            +G V   +   +  D  LAVYQVDKVL+P DF
Sbjct  174  TGIVNVTLGGTVYTDHQLAVYQVDKVLLPRDF  205



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2629592296512