BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79569_g1_i1 len=2085 path=[2063:0-2084]

Length=2085
                                                                      Score     E

ref|XP_006342711.1|  PREDICTED: galactose oxidase-like                  730   0.0      
ref|XP_009614398.1|  PREDICTED: galactose oxidase-like                  729   0.0      
ref|XP_008221311.1|  PREDICTED: galactose oxidase-like                  726   0.0      
ref|XP_004252835.1|  PREDICTED: galactose oxidase-like                  724   0.0      
ref|XP_008221409.1|  PREDICTED: galactose oxidase-like                  722   0.0      
ref|XP_009794042.1|  PREDICTED: galactose oxidase-like                  718   0.0      
gb|AET97563.1|  galactose oxidase                                       716   0.0      
ref|XP_010263908.1|  PREDICTED: galactose oxidase-like                  714   0.0      
ref|XP_009791893.1|  PREDICTED: galactose oxidase-like                  709   0.0      
ref|XP_009600286.1|  PREDICTED: galactose oxidase-like                  709   0.0      
ref|XP_010061250.1|  PREDICTED: galactose oxidase-like                  709   0.0      
ref|XP_009774595.1|  PREDICTED: galactose oxidase-like                  707   0.0      
ref|XP_010271447.1|  PREDICTED: galactose oxidase-like                  704   0.0      
ref|XP_007017716.1|  Glyoxal oxidase-related protein                    703   0.0      
ref|XP_007222145.1|  hypothetical protein PRUPE_ppa004709mg             701   0.0      
ref|XP_010061025.1|  PREDICTED: galactose oxidase-like                  702   0.0      
ref|XP_004291826.1|  PREDICTED: galactose oxidase-like                  701   0.0      
ref|XP_007225625.1|  hypothetical protein PRUPE_ppa003824mg             699   0.0      
emb|CDP07430.1|  unnamed protein product                                700   0.0      
ref|XP_011083592.1|  PREDICTED: galactose oxidase-like                  699   0.0      
ref|XP_004238617.1|  PREDICTED: galactose oxidase-like                  699   0.0      
ref|XP_008221312.1|  PREDICTED: galactose oxidase-like                  697   0.0      
ref|XP_008387970.1|  PREDICTED: galactose oxidase-like                  697   0.0      
ref|XP_009337676.1|  PREDICTED: galactose oxidase-like                  696   0.0      
ref|XP_008347351.1|  PREDICTED: galactose oxidase-like                  696   0.0      
ref|XP_009337669.1|  PREDICTED: galactose oxidase-like                  695   0.0      
ref|XP_011069718.1|  PREDICTED: galactose oxidase-like                  696   0.0      
ref|XP_009797022.1|  PREDICTED: galactose oxidase-like                  695   0.0      
ref|XP_009797023.1|  PREDICTED: galactose oxidase-like                  695   0.0      
ref|XP_007017718.1|  Glyoxal oxidase-related protein                    694   0.0      
ref|XP_004291825.1|  PREDICTED: galactose oxidase-like                  693   0.0      
ref|XP_004238618.1|  PREDICTED: galactose oxidase-like                  693   0.0      
ref|XP_010105253.1|  hypothetical protein L484_019396                   692   0.0      
ref|XP_006342233.1|  PREDICTED: galactose oxidase-like                  689   0.0      
ref|XP_009335425.1|  PREDICTED: galactose oxidase-like                  689   0.0      
ref|XP_011069751.1|  PREDICTED: galactose oxidase-like                  689   0.0      
ref|XP_006342232.1|  PREDICTED: galactose oxidase-like                  689   0.0      
ref|XP_010536366.1|  PREDICTED: galactose oxidase-like                  688   0.0      
ref|XP_004289629.1|  PREDICTED: galactose oxidase-like                  688   0.0      
gb|KDP38596.1|  hypothetical protein JCGZ_04521                         688   0.0      
ref|XP_011028961.1|  PREDICTED: galactose oxidase-like                  690   0.0      
ref|XP_009603236.1|  PREDICTED: galactose oxidase-like                  688   0.0      
ref|XP_011069750.1|  PREDICTED: galactose oxidase-like                  687   0.0      
ref|XP_011092656.1|  PREDICTED: galactose oxidase-like                  687   0.0      
ref|XP_010271448.1|  PREDICTED: galactose oxidase-like                  686   0.0      
ref|XP_008387971.1|  PREDICTED: galactose oxidase-like                  685   0.0      
ref|XP_006342231.1|  PREDICTED: galactose oxidase-like                  686   0.0      
ref|XP_009797024.1|  PREDICTED: galactose oxidase-like                  686   0.0      
ref|XP_006473606.1|  PREDICTED: galactose oxidase-like                  683   0.0      
ref|XP_002280559.1|  PREDICTED: galactose oxidase                       684   0.0      Vitis vinifera
gb|KDO84767.1|  hypothetical protein CISIN_1g009420mg                   682   0.0      
gb|EYU36763.1|  hypothetical protein MIMGU_mgv1a004035mg                683   0.0      
ref|XP_008377171.1|  PREDICTED: galactose oxidase-like                  682   0.0      
ref|XP_006435123.1|  hypothetical protein CICLE_v10003275mg             680   0.0      
ref|XP_007017717.1|  Glyoxal oxidase-related protein                    681   0.0      
ref|XP_004238325.1|  PREDICTED: galactose oxidase-like                  681   0.0      
ref|XP_006342230.1|  PREDICTED: galactose oxidase-like                  680   0.0      
ref|XP_008338258.1|  PREDICTED: galactose oxidase-like                  679   0.0      
ref|XP_004147869.1|  PREDICTED: galactose oxidase-like                  679   0.0      
ref|XP_008367966.1|  PREDICTED: galactose oxidase-like                  679   0.0      
gb|KGN60011.1|  hypothetical protein Csa_3G866440                       679   0.0      
ref|XP_009607831.1|  PREDICTED: galactose oxidase-like                  679   0.0      
ref|XP_009335433.1|  PREDICTED: galactose oxidase-like                  676   0.0      
ref|XP_008350494.1|  PREDICTED: galactose oxidase-like                  675   0.0      
ref|XP_009625411.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...    675   0.0      
ref|XP_007136064.1|  hypothetical protein PHAVU_009G014800g             675   0.0      
ref|XP_003589379.1|  Galactose oxidase                                  674   0.0      
ref|XP_003527766.1|  PREDICTED: galactose oxidase-like                  674   0.0      
ref|XP_009337677.1|  PREDICTED: galactose oxidase-like                  673   0.0      
gb|KHN45905.1|  Galactose oxidase                                       672   0.0      
ref|XP_008377179.1|  PREDICTED: galactose oxidase-like                  672   0.0      
ref|XP_002301997.2|  glyoxal oxidase-related family protein             671   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003523554.1|  PREDICTED: galactose oxidase-like                  672   0.0      
ref|XP_008350495.1|  PREDICTED: galactose oxidase-like                  672   0.0      
ref|XP_010540180.1|  PREDICTED: galactose oxidase-like                  672   0.0      
ref|XP_004499224.1|  PREDICTED: galactose oxidase-like                  672   0.0      
ref|XP_008466509.1|  PREDICTED: galactose oxidase-like                  671   0.0      
ref|XP_006416454.1|  hypothetical protein EUTSA_v10007284mg             669   0.0      
ref|XP_010536368.1|  PREDICTED: galactose oxidase-like                  668   0.0      
ref|XP_009336713.1|  PREDICTED: galactose oxidase-like                  666   0.0      
ref|NP_177692.1|  glyoxal oxidase-related protein                       666   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004238324.1|  PREDICTED: galactose oxidase-like                  665   0.0      
ref|XP_008348975.1|  PREDICTED: galactose oxidase-like                  665   0.0      
ref|XP_002510488.1|  Galactose oxidase precursor, putative              665   0.0      Ricinus communis
ref|XP_010111102.1|  hypothetical protein L484_008478                   665   0.0      
ref|XP_011074991.1|  PREDICTED: galactose oxidase-like                  664   0.0      
ref|XP_009337697.1|  PREDICTED: galactose oxidase-like                  662   0.0      
ref|XP_010471675.1|  PREDICTED: galactose oxidase-like isoform X1       661   0.0      
emb|CDY62590.1|  BnaA08g31280D                                          661   0.0      
ref|XP_010428587.1|  PREDICTED: galactose oxidase-like                  661   0.0      
gb|KFK37635.1|  hypothetical protein AALP_AA3G008700                    660   0.0      
ref|XP_009103375.1|  PREDICTED: galactose oxidase-like                  660   0.0      
ref|XP_010471676.1|  PREDICTED: galactose oxidase-like isoform X2       660   0.0      
ref|XP_006304793.1|  hypothetical protein CARUB_v10012343mg             658   0.0      
ref|XP_010533609.1|  PREDICTED: galactose oxidase-like                  658   0.0      
emb|CDY01391.1|  BnaA07g11640D                                          657   0.0      
ref|XP_002889034.1|  hypothetical protein ARALYDRAFT_895435             656   0.0      
ref|XP_010105252.1|  hypothetical protein L484_019394                   655   0.0      
ref|XP_011045139.1|  PREDICTED: galactose oxidase-like                  655   0.0      
ref|XP_009149487.1|  PREDICTED: galactose oxidase                       655   0.0      
ref|XP_009103376.1|  PREDICTED: galactose oxidase-like                  655   0.0      
ref|XP_006300296.1|  hypothetical protein CARUB_v10021300mg             654   0.0      
ref|XP_009110252.1|  PREDICTED: galactose oxidase-like                  654   0.0      
ref|XP_008444780.1|  PREDICTED: galactose oxidase-like                  654   0.0      
ref|XP_010416450.1|  PREDICTED: galactose oxidase-like isoform X1       654   0.0      
ref|XP_004500954.1|  PREDICTED: galactose oxidase-like                  652   0.0      
ref|XP_006390288.1|  hypothetical protein EUTSA_v10018361mg             651   0.0      
ref|XP_010498415.1|  PREDICTED: galactose oxidase                       650   0.0      
gb|KEH36231.1|  glyoxal oxidase amino-terminal protein                  650   0.0      
ref|XP_010536365.1|  PREDICTED: galactose oxidase-like                  648   0.0      
ref|XP_010670864.1|  PREDICTED: galactose oxidase-like                  650   0.0      
ref|XP_006383733.1|  hypothetical protein POPTR_0005s25690g             647   0.0      
gb|KGN62661.1|  hypothetical protein Csa_2G365680                       647   0.0      
ref|XP_009388162.1|  PREDICTED: galactose oxidase-like                  646   0.0      
ref|XP_010916153.1|  PREDICTED: galactose oxidase-like                  646   0.0      
gb|KEH24796.1|  glyoxal oxidase amino-terminal protein                  644   0.0      
ref|XP_004164439.1|  PREDICTED: galactose oxidase-like                  645   0.0      
ref|XP_004152661.1|  PREDICTED: galactose oxidase-like                  645   0.0      
ref|XP_004486272.1|  PREDICTED: galactose oxidase-like                  643   0.0      
emb|CDY44191.1|  BnaC05g15480D                                          650   0.0      
ref|XP_010539855.1|  PREDICTED: galactose oxidase-like                  640   0.0      
ref|XP_010459669.1|  PREDICTED: galactose oxidase-like                  638   0.0      
ref|XP_003527665.1|  PREDICTED: galactose oxidase-like                  636   0.0      
ref|XP_010477216.1|  PREDICTED: galactose oxidase-like                  636   0.0      
ref|XP_008775019.1|  PREDICTED: galactose oxidase-like                  635   0.0      
ref|XP_008466667.1|  PREDICTED: galactose oxidase-like                  639   0.0      
ref|XP_004147870.1|  PREDICTED: galactose oxidase-like                  634   0.0      
emb|CDY39045.1|  BnaA02g17340D                                          635   0.0      
gb|KGN60010.1|  hypothetical protein Csa_3G865940                       635   0.0      
ref|XP_002893079.1|  hypothetical protein ARALYDRAFT_472215             634   0.0      
ref|NP_173419.1|  glyoxal oxidase-related protein                       633   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009408991.1|  PREDICTED: galactose oxidase-like                  632   0.0      
emb|CDY29385.1|  BnaA06g14110D                                          630   0.0      
ref|XP_009106213.1|  PREDICTED: galactose oxidase isoform X2            632   0.0      
emb|CDY47509.1|  BnaAnng09070D                                          631   0.0      
ref|XP_009106212.1|  PREDICTED: galactose oxidase isoform X1            630   0.0      
ref|XP_009128116.1|  PREDICTED: galactose oxidase-like                  629   0.0      
emb|CDY13556.1|  BnaC02g23670D                                          628   0.0      
ref|XP_003544396.1|  PREDICTED: uncharacterized protein LOC100791340    627   0.0      
emb|CDX73183.1|  BnaC06g36310D                                          625   0.0      
ref|XP_010670846.1|  PREDICTED: galactose oxidase-like                  625   0.0      
ref|XP_007160695.1|  hypothetical protein PHAVU_001G009200g             625   0.0      
ref|XP_009336703.1|  PREDICTED: galactose oxidase-like                  625   0.0      
ref|XP_010670858.1|  PREDICTED: galactose oxidase-like                  623   0.0      
ref|XP_011045140.1|  PREDICTED: galactose oxidase-like                  621   0.0      
ref|XP_008813838.1|  PREDICTED: galactose oxidase-like                  619   0.0      
gb|AAG12543.1|AC007797_3  Unknown Protein                               616   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|EAY89314.1|  hypothetical protein OsI_10817                          615   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001049609.1|  Os03g0258900                                       614   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009393211.1|  PREDICTED: galactose oxidase-like                  613   0.0      
ref|XP_007136065.1|  hypothetical protein PHAVU_009G014900g             612   0.0      
ref|XP_006649773.1|  PREDICTED: galactose oxidase-like                  611   0.0      
ref|XP_010416451.1|  PREDICTED: galactose oxidase-like isoform X2       607   0.0      
gb|KHG09161.1|  galactose oxidase                                       597   0.0      
ref|XP_002468154.1|  hypothetical protein SORBIDRAFT_01g040550          599   0.0      Sorghum bicolor [broomcorn]
gb|EMT01589.1|  hypothetical protein F775_04099                         598   0.0      
ref|NP_001149941.1|  glyoxal oxidase precursor                          598   0.0      Zea mays [maize]
tpg|DAA44472.1|  TPA: glyoxal oxidase                                   597   0.0      
ref|XP_003561804.1|  PREDICTED: galactose oxidase-like                  595   0.0      
ref|XP_006838081.1|  hypothetical protein AMTR_s00225p00021580          590   0.0      
gb|KFK44113.1|  hypothetical protein AALP_AA1G217400                    588   0.0      
emb|CDY43432.1|  BnaC07g14990D                                          587   0.0      
ref|XP_009594288.1|  PREDICTED: uncharacterized protein LOC104090813    591   0.0      
ref|XP_009782130.1|  PREDICTED: galactose oxidase-like                  591   0.0      
emb|CDY43429.1|  BnaC07g14960D                                          587   0.0      
ref|XP_004984953.1|  PREDICTED: galactose oxidase-like                  589   0.0      
emb|CDY01390.1|  BnaA07g11630D                                          586   0.0      
ref|XP_004304717.1|  PREDICTED: uncharacterized protein LOC101300467    587   0.0      
ref|XP_006357288.1|  PREDICTED: galactose oxidase-like                  587   0.0      
gb|EYU38846.1|  hypothetical protein MIMGU_mgv1a027114mg                582   0.0      
emb|CDY53551.1|  BnaA09g57100D                                          584   0.0      
ref|XP_009117902.1|  PREDICTED: galactose oxidase-like                  584   0.0      
emb|CDP08591.1|  unnamed protein product                                583   0.0      
ref|XP_007030653.1|  Glyoxal oxidase-related protein                    583   0.0      
ref|XP_009619752.1|  PREDICTED: galactose oxidase-like                  583   0.0      
ref|XP_010652487.1|  PREDICTED: galactose oxidase                       581   0.0      
emb|CDX81637.1|  BnaC08g39640D                                          579   0.0      
ref|XP_010476497.1|  PREDICTED: galactose oxidase-like                  578   0.0      
ref|XP_008218222.1|  PREDICTED: galactose oxidase                       577   0.0      
ref|XP_009779182.1|  PREDICTED: galactose oxidase-like                  579   0.0      
ref|XP_006471853.1|  PREDICTED: galactose oxidase-like                  577   0.0      
ref|XP_004239377.1|  PREDICTED: galactose oxidase-like                  576   0.0      
ref|XP_008221748.1|  PREDICTED: galactose oxidase                       576   0.0      
ref|XP_010458940.1|  PREDICTED: galactose oxidase-like                  575   0.0      
ref|XP_011071032.1|  PREDICTED: galactose oxidase-like                  576   0.0      
ref|XP_010256224.1|  PREDICTED: galactose oxidase                       573   0.0      
ref|XP_010496071.1|  PREDICTED: galactose oxidase-like                  574   0.0      
ref|XP_007208189.1|  hypothetical protein PRUPE_ppa020922mg             572   0.0      
ref|XP_010242442.1|  PREDICTED: galactose oxidase                       573   0.0      
ref|XP_008389005.1|  PREDICTED: galactose oxidase                       570   0.0      
gb|EYU23055.1|  hypothetical protein MIMGU_mgv1a021812mg                566   0.0      
ref|NP_172895.2|  glyoxal oxidase-related protein                       568   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KDP25206.1|  hypothetical protein JCGZ_20362                         567   0.0      
gb|EYU22441.1|  hypothetical protein MIMGU_mgv1a024085mg                569   0.0      
ref|XP_009606830.1|  PREDICTED: galactose oxidase                       567   0.0      
ref|XP_002890054.1|  hypothetical protein ARALYDRAFT_888820             567   0.0      
ref|XP_004237211.1|  PREDICTED: galactose oxidase-like                  566   0.0      
ref|XP_006344285.1|  PREDICTED: galactose oxidase-like                  566   0.0      
ref|XP_009364601.1|  PREDICTED: galactose oxidase                       565   0.0      
ref|XP_007227672.1|  hypothetical protein PRUPE_ppa026498mg             565   0.0      
gb|KDP21232.1|  hypothetical protein JCGZ_21703                         563   0.0      
ref|XP_007039386.1|  Glyoxal oxidase-related protein                    563   0.0      
ref|XP_009801814.1|  PREDICTED: galactose oxidase                       560   0.0      
gb|KFK43688.1|  hypothetical protein AALP_AA1G160100                    560   0.0      
ref|XP_010660091.1|  PREDICTED: galactose oxidase                       559   0.0      
ref|XP_011010793.1|  PREDICTED: galactose oxidase                       559   0.0      
ref|XP_009360496.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...    560   0.0      
ref|XP_010554972.1|  PREDICTED: galactose oxidase                       558   0.0      
ref|XP_006304526.1|  hypothetical protein CARUB_v10011386mg             558   0.0      
ref|XP_002520142.1|  conserved hypothetical protein                     558   0.0      Ricinus communis
ref|XP_002518913.1|  Galactose oxidase precursor, putative              556   0.0      Ricinus communis
ref|XP_006343542.1|  PREDICTED: galactose oxidase-like                  556   0.0      
ref|XP_006378160.1|  glyoxal oxidase-related family protein             556   0.0      
ref|XP_004243010.2|  PREDICTED: galactose oxidase                       555   0.0      
ref|XP_006577272.1|  PREDICTED: galactose oxidase-like                  554   0.0      
ref|XP_006849170.1|  hypothetical protein AMTR_s00027p00175370          554   0.0      
ref|XP_006438575.1|  hypothetical protein CICLE_v10031195mg             552   0.0      
ref|XP_006417012.1|  hypothetical protein EUTSA_v10007241mg             553   0.0      
ref|XP_006483245.1|  PREDICTED: galactose oxidase-like                  553   0.0      
ref|XP_003553749.1|  PREDICTED: galactose oxidase-like                  551   0.0      
ref|XP_004494672.1|  PREDICTED: galactose oxidase-like                  551   0.0      
ref|XP_006433075.1|  hypothetical protein CICLE_v10000768mg             550   0.0      
ref|XP_006382737.1|  glyoxal oxidase-related family protein             550   0.0      
ref|XP_006849171.1|  hypothetical protein AMTR_s00027p00177380          550   0.0      
ref|XP_011073112.1|  PREDICTED: galactose oxidase                       547   0.0      
ref|XP_010674901.1|  PREDICTED: galactose oxidase                       546   0.0      
ref|XP_006389311.1|  glyoxal oxidase-related family protein             546   0.0      
gb|KFK35620.1|  hypothetical protein AALP_AA4G014800                    546   0.0      
ref|XP_007147126.1|  hypothetical protein PHAVU_006G098100g             546   0.0      
ref|XP_010532190.1|  PREDICTED: galactose oxidase                       546   0.0      
gb|EPS72896.1|  hypothetical protein M569_01859                         543   0.0      
ref|XP_007046239.1|  Glyoxal oxidase-related protein, putative          544   0.0      
ref|XP_011003791.1|  PREDICTED: galactose oxidase-like                  544   0.0      
ref|XP_003626387.1|  Galactose oxidase                                  543   0.0      
emb|CDP00283.1|  unnamed protein product                                539   0.0      
ref|XP_010523439.1|  PREDICTED: galactose oxidase-like isoform X1       541   0.0      
ref|XP_006828863.1|  hypothetical protein AMTR_s00001p00165980          540   0.0      
tpg|DAA44471.1|  TPA: hypothetical protein ZEAMMB73_122663              539   0.0      
ref|XP_008340335.1|  PREDICTED: uncharacterized protein LOC103403295    552   0.0      
ref|XP_009119411.1|  PREDICTED: galactose oxidase                       538   2e-180   
ref|XP_004489989.1|  PREDICTED: uncharacterized protein LOC101500908    539   2e-180   
ref|XP_011026783.1|  PREDICTED: galactose oxidase-like                  537   2e-180   
ref|XP_004298452.1|  PREDICTED: galactose oxidase-like                  538   3e-180   
gb|KDO82728.1|  hypothetical protein CISIN_1g048017mg                   537   4e-180   
ref|XP_010041767.1|  PREDICTED: galactose oxidase                       536   4e-180   
ref|XP_006290310.1|  hypothetical protein CARUB_v10019204mg             536   5e-180   
ref|XP_006833409.1|  hypothetical protein AMTR_s00109p00131490          537   1e-179   
emb|CDY62245.1|  BnaC01g42480D                                          535   2e-179   
ref|XP_010096335.1|  hypothetical protein L484_021082                   536   2e-179   
ref|XP_006392509.1|  hypothetical protein EUTSA_v10023396mg             534   4e-179   
ref|XP_008781649.1|  PREDICTED: uncharacterized protein LOC103701389    535   5e-179   
emb|CDY44816.1|  BnaCnng11720D                                          532   2e-178   
ref|XP_004309580.1|  PREDICTED: galactose oxidase-like                  531   5e-178   
ref|XP_010100623.1|  hypothetical protein L484_011554                   529   1e-177   
ref|XP_010516382.1|  PREDICTED: galactose oxidase-like                  530   2e-177   
ref|XP_010504696.1|  PREDICTED: galactose oxidase-like                  529   3e-177   
ref|NP_191321.1|  glyoxal oxidase-related protein                       528   6e-177   Arabidopsis thaliana [mouse-ear cress]
emb|CBI19807.3|  unnamed protein product                                525   1e-176   
ref|XP_002876427.1|  hypothetical protein ARALYDRAFT_907231             528   1e-176   
ref|XP_010930930.1|  PREDICTED: uncharacterized protein LOC105051966    523   2e-174   
ref|XP_002512263.1|  Galactose oxidase precursor, putative              520   9e-174   Ricinus communis
emb|CBI34589.3|  unnamed protein product                                520   1e-173   
ref|XP_007209012.1|  hypothetical protein PRUPE_ppa023406mg             519   1e-173   
ref|XP_002272723.2|  PREDICTED: uncharacterized protein LOC100259927    520   2e-173   Vitis vinifera
gb|KCW65018.1|  hypothetical protein EUGRSUZ_G02553                     520   3e-173   
gb|KHN04050.1|  Galactose oxidase                                       517   3e-173   
ref|XP_002299426.2|  hypothetical protein POPTR_0001s11390g             519   4e-173   Populus trichocarpa [western balsam poplar]
ref|XP_008245383.1|  PREDICTED: galactose oxidase-like                  518   8e-173   
ref|XP_009392205.1|  PREDICTED: galactose oxidase-like                  518   9e-173   
ref|NP_001150444.1|  glyoxal oxidase precursor                          518   1e-172   Zea mays [maize]
ref|XP_003519774.1|  PREDICTED: galactose oxidase-like                  518   2e-172   
ref|XP_002446737.1|  hypothetical protein SORBIDRAFT_06g021520          515   1e-171   Sorghum bicolor [broomcorn]
emb|CAN83495.1|  hypothetical protein VITISV_026965                     513   6e-171   Vitis vinifera
ref|XP_009407008.1|  PREDICTED: uncharacterized protein LOC103989784    512   1e-170   
ref|XP_010541897.1|  PREDICTED: galactose oxidase-like                  511   6e-170   
ref|XP_002973684.1|  hypothetical protein SELMODRAFT_413959             509   8e-170   
ref|XP_004298451.1|  PREDICTED: galactose oxidase-like                  510   2e-169   
ref|XP_010100201.1|  hypothetical protein L484_015346                   508   4e-169   
ref|XP_003613586.1|  hypothetical protein MTR_5g038410                  506   3e-168   
ref|XP_004978797.1|  PREDICTED: galactose oxidase-like                  505   1e-167   
ref|XP_010254463.1|  PREDICTED: galactose oxidase                       506   2e-167   
gb|EPS58061.1|  hypothetical protein M569_16755                         498   5e-167   
ref|XP_009367481.1|  PREDICTED: uncharacterized protein LOC103957109    502   4e-166   
ref|XP_009367892.1|  PREDICTED: uncharacterized protein LOC103957460    501   5e-166   
ref|XP_006439219.1|  hypothetical protein CICLE_v10024435mg             496   2e-164   
ref|XP_006477507.1|  PREDICTED: galactose oxidase-like                  496   2e-164   
ref|XP_002975736.1|  hypothetical protein SELMODRAFT_232564             492   1e-163   
ref|XP_010924630.1|  PREDICTED: uncharacterized protein LOC105047413    495   2e-163   
ref|XP_008464498.1|  PREDICTED: uncharacterized protein LOC103502362    494   2e-163   
ref|XP_002873953.1|  hypothetical protein ARALYDRAFT_488852             493   1e-162   
ref|XP_008801460.1|  PREDICTED: galactose oxidase-like                  492   4e-162   
ref|NP_001176372.1|  Os11g0169700                                       491   4e-162   
emb|CDP00282.1|  unnamed protein product                                488   2e-161   
ref|XP_008352131.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...    483   3e-161   
gb|EAY80097.1|  hypothetical protein OsI_35269                          487   2e-160   
ref|XP_002456130.1|  hypothetical protein SORBIDRAFT_03g031030          488   4e-160   
ref|XP_010904553.1|  PREDICTED: galactose oxidase-like                  484   5e-160   
ref|XP_007226541.1|  hypothetical protein PRUPE_ppa024999mg             485   1e-159   
ref|XP_010493033.1|  PREDICTED: galactose oxidase-like                  485   2e-159   
ref|XP_002449081.1|  hypothetical protein SORBIDRAFT_05g004490          484   2e-159   
ref|XP_008367509.1|  PREDICTED: uncharacterized protein LOC103431143    483   4e-159   
ref|XP_010656292.1|  PREDICTED: galactose oxidase                       485   4e-159   
gb|AAL84955.1|  AT5g19580/T20D1_100                                     484   8e-159   
ref|XP_010454240.1|  PREDICTED: galactose oxidase-like                  483   8e-159   
ref|NP_197459.1|  glyoxal oxidase-related protein                       483   9e-159   
ref|XP_006287335.1|  hypothetical protein CARUB_v10000533mg             483   2e-158   
ref|XP_004292851.1|  PREDICTED: uncharacterized protein LOC101303486    481   4e-158   
ref|XP_009381768.1|  PREDICTED: uncharacterized protein LOC103969853    480   9e-158   
ref|XP_007157402.1|  hypothetical protein PHAVU_002G066900g             478   1e-157   
gb|KDO76728.1|  hypothetical protein CISIN_1g0433692mg                  477   1e-157   
ref|XP_008220102.1|  PREDICTED: uncharacterized protein LOC103320236    479   2e-157   
ref|XP_010424026.1|  PREDICTED: galactose oxidase-like                  477   2e-157   
ref|XP_004138264.1|  PREDICTED: uncharacterized protein LOC101204692    478   4e-157   
ref|NP_001170492.1|  hypothetical protein precursor                     480   4e-157   
ref|XP_003576251.1|  PREDICTED: galactose oxidase-like                  479   1e-156   
ref|XP_010420764.1|  PREDICTED: galactose oxidase-like isoform X1       478   1e-156   
ref|XP_010107380.1|  hypothetical protein L484_003656                   478   3e-156   
ref|XP_008239597.1|  PREDICTED: uncharacterized protein LOC103338188    476   4e-156   
ref|XP_004969528.1|  PREDICTED: uncharacterized protein LOC101774211    477   8e-156   
ref|XP_001771865.1|  predicted protein                                  471   3e-155   
emb|CBI28031.3|  unnamed protein product                                484   6e-155   
ref|XP_006383732.1|  hypothetical protein POPTR_0005s25680g             469   1e-154   
ref|XP_002961909.1|  hypothetical protein SELMODRAFT_77682              471   1e-154   
ref|XP_006400518.1|  hypothetical protein EUTSA_v10012975mg             473   2e-154   
ref|XP_003516476.1|  PREDICTED: uncharacterized protein LOC100797716    471   1e-153   
emb|CDM83959.1|  unnamed protein product                                469   2e-153   
ref|XP_006857804.1|  hypothetical protein AMTR_s00061p00216590          467   3e-153   
ref|XP_004293134.1|  PREDICTED: uncharacterized protein LOC101306599    465   5e-153   
ref|XP_003569556.2|  PREDICTED: uncharacterized protein LOC100835848    467   2e-152   
ref|XP_002972585.1|  hypothetical protein SELMODRAFT_97196              465   2e-152   
ref|XP_002438138.1|  hypothetical protein SORBIDRAFT_10g008655          466   3e-152   
ref|XP_002972039.1|  hypothetical protein SELMODRAFT_441651             465   3e-152   
ref|XP_006381726.1|  hypothetical protein POPTR_0006s16390g             467   4e-152   
ref|XP_007037788.1|  Glyoxal oxidase-related protein                    465   4e-152   
ref|XP_008362947.1|  PREDICTED: galactose oxidase-like                  468   6e-152   
ref|XP_009336933.1|  PREDICTED: galactose oxidase-like                  468   6e-152   
ref|XP_004139435.1|  PREDICTED: galactose oxidase-like                  466   8e-152   
ref|XP_010535983.1|  PREDICTED: galactose oxidase-like                  464   2e-151   
ref|XP_010663077.1|  PREDICTED: uncharacterized protein LOC100253501    464   3e-151   
gb|KFK26190.1|  hypothetical protein AALP_AA8G214300                    464   4e-151   
ref|XP_010511646.1|  PREDICTED: galactose oxidase-like                  464   4e-151   
ref|XP_007203106.1|  hypothetical protein PRUPE_ppa023837mg             468   4e-151   
ref|XP_008793761.1|  PREDICTED: galactose oxidase-like                  462   9e-151   
ref|XP_008242563.1|  PREDICTED: uncharacterized protein LOC103340881    466   2e-150   
ref|XP_006848962.1|  hypothetical protein AMTR_s00166p00070030          460   3e-150   
ref|XP_008460895.1|  PREDICTED: galactose oxidase                       462   3e-150   
ref|XP_010102932.1|  hypothetical protein L484_018951                   461   3e-150   
ref|XP_007152887.1|  hypothetical protein PHAVU_004G168600g             462   4e-150   
ref|XP_007160315.1|  hypothetical protein PHAVU_002G311300g             462   4e-150   
ref|XP_009352508.1|  PREDICTED: galactose oxidase-like                  463   6e-150   
dbj|BAL41451.1|  glyoxal oxidase 2                                      464   9e-150   
ref|XP_010051583.1|  PREDICTED: galactose oxidase-like                  461   1e-149   
ref|XP_004513017.1|  PREDICTED: uncharacterized protein LOC101505637    460   1e-149   
ref|XP_010251352.1|  PREDICTED: uncharacterized protein LOC104593293    459   1e-149   
ref|XP_003516307.1|  PREDICTED: galactose oxidase-like                  458   2e-149   
ref|XP_006400519.1|  hypothetical protein EUTSA_v10012975mg             459   4e-149   
ref|XP_010688268.1|  PREDICTED: uncharacterized protein LOC104902254    457   5e-149   
emb|CDP12684.1|  unnamed protein product                                457   7e-149   
ref|XP_002281387.1|  PREDICTED: uncharacterized protein LOC100256065    457   7e-149   
ref|XP_009394071.1|  PREDICTED: uncharacterized protein LOC103979627    456   8e-149   
ref|XP_010262660.1|  PREDICTED: galactose oxidase                       456   8e-149   
ref|XP_008367891.1|  PREDICTED: galactose oxidase-like                  459   2e-148   
emb|CDY42279.1|  BnaC02g08850D                                          456   3e-148   
ref|XP_010470629.1|  PREDICTED: galactose oxidase-like isoform X1       455   9e-148   
ref|XP_009105271.1|  PREDICTED: galactose oxidase                       455   1e-147   
ref|XP_004288880.1|  PREDICTED: uncharacterized protein LOC101300395    456   1e-147   
ref|NP_176897.1|  glyoxal oxidase-related protein                       456   1e-147   
ref|XP_001778975.1|  predicted protein                                  452   1e-147   
ref|XP_003630749.1|  Galactose oxidase                                  456   1e-147   
emb|CDX96101.1|  BnaA07g26300D                                          455   1e-147   
ref|XP_004501852.1|  PREDICTED: uncharacterized protein LOC101503410    467   2e-147   
ref|XP_004503455.1|  PREDICTED: uncharacterized protein LOC101501825    455   2e-147   
emb|CDY44928.1|  BnaA02g04330D                                          454   2e-147   
ref|XP_009126377.1|  PREDICTED: galactose oxidase-like                  453   3e-147   
ref|XP_006475694.1|  PREDICTED: galactose oxidase-like                  454   3e-147   
ref|XP_002888587.1|  hypothetical protein ARALYDRAFT_475824             454   3e-147   
ref|XP_004299160.1|  PREDICTED: uncharacterized protein LOC101293298    453   3e-147   
ref|XP_010541740.1|  PREDICTED: galactose oxidase-like                  454   3e-147   
ref|XP_010532465.1|  PREDICTED: galactose oxidase-like                  454   5e-147   
ref|XP_003567916.1|  PREDICTED: galactose oxidase-like                  454   6e-147   
gb|KFK41129.1|  hypothetical protein AALP_AA2G089900                    454   8e-147   
ref|XP_002324431.2|  hypothetical protein POPTR_0018s09110g             453   9e-147   
emb|CDY01797.1|  BnaC06g28370D                                          452   1e-146   
ref|XP_004242940.2|  PREDICTED: uncharacterized protein LOC101252095    451   2e-146   
gb|KDP33710.1|  hypothetical protein JCGZ_07281                         456   2e-146   
gb|KDP29259.1|  hypothetical protein JCGZ_16648                         453   2e-146   
ref|XP_011048365.1|  PREDICTED: galactose oxidase                       451   3e-146   
ref|XP_006584818.1|  PREDICTED: uncharacterized protein LOC100808336    452   3e-146   
ref|XP_006451231.1|  hypothetical protein CICLE_v10010756mg             451   3e-146   
gb|KDO54103.1|  hypothetical protein CISIN_1g039705mg                   447   2e-145   
dbj|BAL41454.1|  glyoxal oxidase 5                                      450   3e-145   
ref|XP_011009462.1|  PREDICTED: galactose oxidase-like                  449   5e-145   
ref|XP_010026976.1|  PREDICTED: uncharacterized protein LOC104417381    447   5e-145   
gb|KEH35019.1|  glyoxal oxidase amino-terminal protein                  444   9e-145   
emb|CDY51183.1|  BnaC02g45610D                                          447   1e-144   
ref|XP_006341271.1|  PREDICTED: uncharacterized protein LOC102605018    445   2e-144   
ref|XP_007137990.1|  hypothetical protein PHAVU_009G171700g             445   2e-144   
ref|XP_011087000.1|  PREDICTED: galactose oxidase-like                  446   2e-144   
dbj|BAL41452.1|  glyoxal oxidase 3                                      448   4e-144   
ref|XP_009127543.1|  PREDICTED: galactose oxidase-like                  445   5e-144   
ref|XP_003528130.2|  PREDICTED: uncharacterized protein LOC100814200    444   5e-144   
ref|XP_008811510.1|  PREDICTED: galactose oxidase                       444   7e-144   
gb|EEC71262.1|  hypothetical protein OsI_03252                          446   7e-144   
ref|XP_009766667.1|  PREDICTED: uncharacterized protein LOC104217988    446   8e-144   
ref|XP_006391296.1|  hypothetical protein EUTSA_v10018300mg             445   1e-143   
ref|XP_006349488.1|  PREDICTED: galactose oxidase-like                  442   1e-143   
ref|XP_007209962.1|  hypothetical protein PRUPE_ppa004880mg             440   1e-143   
emb|CDP06561.1|  unnamed protein product                                442   2e-143   
ref|XP_011078293.1|  PREDICTED: uncharacterized protein LOC105162073    445   2e-143   
ref|XP_007134016.1|  hypothetical protein PHAVU_010G012100g             442   2e-143   
ref|XP_002440240.1|  hypothetical protein SORBIDRAFT_09g028310          444   2e-143   
ref|XP_011094925.1|  PREDICTED: galactose oxidase                       441   3e-143   
ref|NP_001043851.1|  Os01g0677000                                       444   4e-143   
ref|XP_010905399.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...    441   5e-143   
ref|XP_001784508.1|  predicted protein                                  442   5e-143   
ref|XP_003520957.1|  PREDICTED: uncharacterized protein LOC100776515    441   5e-143   
gb|ACG29670.1|  glyoxal oxidase                                         443   7e-143   
ref|XP_008649992.1|  PREDICTED: uncharacterized protein LOC103630723    443   9e-143   
ref|XP_004301024.1|  PREDICTED: uncharacterized protein LOC101292420    441   1e-142   
ref|XP_010535982.1|  PREDICTED: galactose oxidase-like                  440   1e-142   
ref|XP_006301879.1|  hypothetical protein CARUB_v10022352mg             447   1e-142   
ref|XP_006420316.1|  hypothetical protein CICLE_v10006853mg             441   2e-142   
gb|KDO66474.1|  hypothetical protein CISIN_1g042303mg                   439   2e-142   
gb|ACV49898.1|  glyoxal oxidase                                         439   2e-142   
ref|XP_006451227.1|  hypothetical protein CICLE_v10007862mg             440   3e-142   
ref|XP_003620657.1|  Galactose oxidase                                  441   3e-142   
gb|EYU41788.1|  hypothetical protein MIMGU_mgv1a004290mg                437   8e-142   
ref|XP_010535981.1|  PREDICTED: galactose oxidase-like                  438   9e-142   
ref|XP_004963606.1|  PREDICTED: galactose oxidase-like                  439   2e-141   
gb|EEE51720.1|  hypothetical protein OsJ_33111                          437   2e-141   
ref|XP_008442498.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...    437   2e-141   
gb|ACV49897.1|  glyoxal oxidase                                         436   2e-141   
ref|XP_004249644.1|  PREDICTED: galactose oxidase                       437   2e-141   
ref|XP_004305171.1|  PREDICTED: galactose oxidase-like                  436   3e-141   
gb|ABA42922.1|  glyoxal oxidase                                         436   3e-141   
ref|XP_001783776.1|  predicted protein                                  436   4e-141   
ref|XP_010553274.1|  PREDICTED: galactose oxidase                       436   4e-141   
ref|XP_006475693.1|  PREDICTED: galactose oxidase-like                  438   4e-141   
gb|KDP33711.1|  hypothetical protein JCGZ_07282                         439   4e-141   
ref|XP_006654771.1|  PREDICTED: uncharacterized protein LOC102716970    438   6e-141   
ref|XP_002274763.1|  PREDICTED: galactose oxidase                       436   7e-141   
ref|XP_002514260.1|  Galactose oxidase precursor, putative              438   7e-141   
gb|KDO66471.1|  hypothetical protein CISIN_1g035640mg                   437   7e-141   
gb|ACV49899.1|  glyoxal oxidase                                         434   9e-141   
ref|XP_004137754.1|  PREDICTED: galactose oxidase-like                  434   1e-140   
gb|KCW83241.1|  hypothetical protein EUGRSUZ_B00180                     433   2e-140   
ref|XP_011078295.1|  PREDICTED: uncharacterized protein LOC105162074    437   3e-140   
gb|KDP24540.1|  hypothetical protein JCGZ_25104                         434   3e-140   
gb|EPS61181.1|  glyoxal oxidase                                         433   3e-140   
gb|KHN07971.1|  E3 ubiquitin-protein ligase RGLG2                       444   4e-140   
emb|CDX67577.1|  BnaA07g16170D                                          434   4e-140   
ref|XP_009774166.1|  PREDICTED: galactose oxidase                       433   4e-140   
ref|XP_009421296.1|  PREDICTED: galactose oxidase                       434   5e-140   
ref|XP_006451228.1|  hypothetical protein CICLE_v10010177mg             435   6e-140   
ref|XP_010088559.1|  hypothetical protein L484_016951                   432   9e-140   
ref|XP_010674911.1|  PREDICTED: uncharacterized protein LOC104890981    432   9e-140   
ref|XP_007026880.1|  Glyoxal oxidase-related protein                    440   1e-139   
ref|XP_006290869.1|  hypothetical protein CARUB_v10016978mg             431   3e-139   
ref|XP_010044010.1|  PREDICTED: galactose oxidase                       431   4e-139   
ref|XP_006850437.1|  hypothetical protein AMTR_s00165p00057230          431   4e-139   
ref|XP_002970607.1|  hypothetical protein SELMODRAFT_411320             429   9e-139   
ref|XP_002970610.1|  hypothetical protein SELMODRAFT_93556              429   1e-138   
ref|XP_001776127.1|  predicted protein                                  430   1e-138   
dbj|BAL41448.1|  glyoxal oxidase 1                                      433   2e-138   
dbj|BAL41453.1|  glyoxal oxidase 4                                      432   2e-138   
ref|XP_006429215.1|  hypothetical protein CICLE_v10011448mg             429   3e-138   
emb|CDY59162.1|  BnaC06g42590D                                          428   3e-138   
emb|CDY58964.1|  BnaC09g38100D                                          429   4e-138   
ref|XP_002322929.1|  glyoxal oxidase-related family protein             428   4e-138   
ref|XP_007208466.1|  hypothetical protein PRUPE_ppa003992mg             428   5e-138   
ref|XP_002968444.1|  hypothetical protein SELMODRAFT_231119             427   6e-138   
ref|XP_008240187.1|  PREDICTED: galactose oxidase                       427   6e-138   
ref|XP_011006630.1|  PREDICTED: galactose oxidase                       427   7e-138   
gb|KDO57956.1|  hypothetical protein CISIN_1g044265mg                   426   9e-138   
ref|XP_009602919.1|  PREDICTED: galactose oxidase                       427   1e-137   
ref|XP_006480899.1|  PREDICTED: galactose oxidase-like                  427   1e-137   
ref|XP_004507195.1|  PREDICTED: galactose oxidase-like                  427   1e-137   
ref|NP_190963.1|  glyoxal oxidase-related protein                       427   1e-137   
ref|XP_001771982.1|  predicted protein                                  426   3e-137   
ref|XP_010515903.1|  PREDICTED: galactose oxidase-like                  426   3e-137   
ref|XP_009103886.1|  PREDICTED: galactose oxidase                       426   3e-137   
ref|XP_002876232.1|  hypothetical protein ARALYDRAFT_485786             426   4e-137   
ref|XP_002968445.1|  hypothetical protein SELMODRAFT_89852              426   4e-137   
ref|XP_010427056.1|  PREDICTED: galactose oxidase-like                  426   4e-137   
gb|KEH28959.1|  glyoxal oxidase amino-terminal protein                  425   5e-137   
ref|XP_001763031.1|  predicted protein                                  425   8e-137   
ref|XP_009600209.1|  PREDICTED: uncharacterized protein LOC104095723    427   8e-137   
gb|KDO52701.1|  hypothetical protein CISIN_1g048136mg                   424   2e-136   
emb|CDP03295.1|  unnamed protein product                                435   2e-136   
ref|XP_001757263.1|  predicted protein                                  422   6e-136   
gb|KFK34638.1|  hypothetical protein AALP_AA5G172000                    422   6e-136   
ref|XP_001765643.1|  predicted protein                                  422   7e-136   
ref|XP_010504181.1|  PREDICTED: galactose oxidase-like                  422   8e-136   
gb|EYU32954.1|  hypothetical protein MIMGU_mgv1a002908mg                425   1e-135   
ref|XP_001774105.1|  predicted protein                                  421   3e-135   
ref|XP_001762124.1|  predicted protein                                  420   4e-135   
ref|XP_006437613.1|  hypothetical protein CICLE_v10033514mg             422   6e-135   
gb|EAY98991.1|  hypothetical protein OsI_20949                          423   7e-135   
ref|NP_001056298.1|  Os05g0559000                                       422   9e-135   
ref|XP_008359690.1|  PREDICTED: LOW QUALITY PROTEIN: galactose ox...    419   2e-134   



>ref|XP_006342711.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=568

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/531 (66%), Positives = 414/531 (78%), Gaps = 10/531 (2%)
 Frame = +1

Query  187   GGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPP  366
             GG WNLL  +IGISAMHMQLL+ND+VV FDRT+ G SNISLPDGKC +            
Sbjct  44    GGSWNLLLSNIGISAMHMQLLNNDRVVMFDRTDFGMSNISLPDGKCRYDQNDTTLKV---  100

Query  367   DDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCN  546
               +CTAHS+EYD+ASNS RP++V +D WCSSGSV P G+LVQTGG+ +G +VVR F PC+
Sbjct  101   --DCTAHSIEYDIASNSIRPLMVQTDVWCSSGSVFPDGSLVQTGGFNDGEKVVRVFKPCS  158

Query  547   DAE----CDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSL  714
             +A     CDWEEI  GLV+ RWYST+HILPDGRQII+GGRRAFNYEF+PKS  A+  YSL
Sbjct  159   NATTNGTCDWEEIQGGLVQRRWYSTNHILPDGRQIIIGGRRAFNYEFYPKSASANNSYSL  218

Query  715   PFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPR  894
             PFL +T DP    ENNLYPFV LNVDGNLFIFANNRAIL DY  NVV+  YPEIPGG+PR
Sbjct  219   PFLVKTNDPN-KIENNLYPFVFLNVDGNLFIFANNRAILFDYTKNVVLTNYPEIPGGDPR  277

Query  895   NYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPN  1074
             NYPS+GSAVLLPLKNL+     AEVLVCGG+PK +Y +A    F GAL+TCGRI+ITDPN
Sbjct  278   NYPSTGSAVLLPLKNLQAQEIQAEVLVCGGAPKGSYTSALNGNFSGALSTCGRIIITDPN  337

Query  1075  PEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSR  1254
             P+W  E MP  R MGDMVILP GNVLIINGAT G AGW+ GR+P   PV+YRPD P  SR
Sbjct  338   PQWTMETMPLARTMGDMVILPNGNVLIINGATTGTAGWECGRDPVLKPVIYRPDNPFDSR  397

Query  1255  FELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPK  1434
             FE+QN + IPRMYHS+AVL+ DGRVLV GSNPH  Y FT V FPTELS+EAFSPSYLD  
Sbjct  398   FEIQNSSTIPRMYHSTAVLLRDGRVLVGGSNPHIYYNFTGVLFPTELSLEAFSPSYLDSI  457

Query  1435  YAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLV  1614
                LRP+I+SPASQ  + YG+ + ++FKV+G+VD++ V +TMV+P F+THSF+MNQRLLV
Sbjct  458   SEYLRPQIISPASQYAIEYGQRMPIRFKVAGRVDINLVTITMVAPGFNTHSFTMNQRLLV  517

Query  1615  LNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             L +  VK  GE  Y I+VV P++  LAP GYYLLFVVH++IPS+GIWV IQ
Sbjct  518   LVSENVKLIGENAYQINVVTPNNAKLAPPGYYLLFVVHQDIPSEGIWVKIQ  568



>ref|XP_009614398.1| PREDICTED: galactose oxidase-like [Nicotiana tomentosiformis]
Length=553

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/537 (65%), Positives = 420/537 (78%), Gaps = 18/537 (3%)
 Frame = +1

Query  175   AVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglgg  354
             A   GGKWN+L  +IGISAMHMQLL+NDKVV FDRT+ G SNISLPDGKC          
Sbjct  29    ASAAGGKWNILMSNIGISAMHMQLLNNDKVVIFDRTDFGHSNISLPDGKC----------  78

Query  355   RKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTR  519
             R  P+D     +CTAHSVEY++ +NS RP++V +D WCSSGSV P G+LVQTGG+ +G +
Sbjct  79    RNDPNDTTLQIDCTAHSVEYNIVTNSIRPLMVQTDVWCSSGSVFPDGSLVQTGGFNDGEK  138

Query  520   VVRRFSPCN-DAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPA  696
             VVR F PCN +  CDW+EI  GL + RWY+T+HILPDGRQII+GGRRAFNYEF+PK   A
Sbjct  139   VVRVFKPCNGNNTCDWQEIQGGLAQRRWYATNHILPDGRQIIIGGRRAFNYEFYPKPASA  198

Query  697   DTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEI  876
                YSLPFL QT DP +  ENNLYPFV LN+DGNLFIFANNRAIL DY  NVVV++YP+I
Sbjct  199   YKAYSLPFLVQTNDPKI--ENNLYPFVFLNMDGNLFIFANNRAILFDYTKNVVVKSYPQI  256

Query  877   PGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRI  1056
             PGG+PR+YPS+GSAVLLPLKNL+     AEVLVCGG+PK +Y +A+   F+GAL+TCGRI
Sbjct  257   PGGDPRSYPSTGSAVLLPLKNLQTQQIQAEVLVCGGAPKGSYISAQNGKFLGALSTCGRI  316

Query  1057  VITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPD  1236
              ITDPNP+W  E MP  R MGDMVILP GNVLIINGA  G AGW+LGR+P   PV+YRPD
Sbjct  317   RITDPNPQWTIENMPLARTMGDMVILPNGNVLIINGAATGTAGWELGRDPVLKPVIYRPD  376

Query  1237  APPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSP  1416
              P GSRFE+QNP+ IPRMYHS+A L+ +GRVL+AGSNPH  Y FT V FPTELS+EAFSP
Sbjct  377   NPFGSRFEIQNPSTIPRMYHSTATLLRNGRVLIAGSNPHIYYNFTGVLFPTELSLEAFSP  436

Query  1417  SYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSM  1596
             SYLDP+   LRP+I+SPASQ  + YG+ V ++FKVSG+V+ + V VTMV+P F+THSF+ 
Sbjct  437   SYLDPESEYLRPQIISPASQYIIGYGQRVPIRFKVSGRVNRNLVTVTMVAPGFNTHSFTQ  496

Query  1597  NQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             NQRLLVL    VK  GE+ Y ++VV P+S  LAP GYYLLFVVH++IPS+GIWV IQ
Sbjct  497   NQRLLVLANENVKLVGEKAYQVNVVTPNSATLAPPGYYLLFVVHQDIPSEGIWVKIQ  553



>ref|XP_008221311.1| PREDICTED: galactose oxidase-like [Prunus mume]
Length=535

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/527 (65%), Positives = 409/527 (78%), Gaps = 17/527 (3%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GGKW LLQ +IGISAMHMQLLHND+VV FDRT+ G SN+SLPDGKC             
Sbjct  25    AGGKWQLLQQNIGISAMHMQLLHNDRVVLFDRTDFGKSNLSLPDGKC-------------  71

Query  364   PDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPC  543
               ++CTAHS EYDV +N+FRP+ +LSD WCSSGSV+P G L+QTGG+  G R VR F PC
Sbjct  72    VGNDCTAHSAEYDVTTNTFRPLTLLSDVWCSSGSVAPDGRLIQTGGFTNGERRVRIFEPC  131

Query  544   NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFL  723
                 CDW+EI  GL   RWY+TDHILPDGRQII+GGRR FNYEF+PKS   +  +SLPFL
Sbjct  132   TG--CDWKEIENGLAARRWYATDHILPDGRQIIIGGRRQFNYEFYPKSASTNKVFSLPFL  189

Query  724   AQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYP  903
              QT DP   AENNLYPFV LNVDGNLFIFANNRAIL DYV N VV+TYP+IPGG+PR+YP
Sbjct  190   VQTNDPD--AENNLYPFVFLNVDGNLFIFANNRAILFDYVKNNVVKTYPQIPGGDPRSYP  247

Query  904   SSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEW  1083
             S+GSAVLLPLKNLK  +  AEVLVCGG+P  +Y  A +  F GALNTC RI ITDPNP+W
Sbjct  248   STGSAVLLPLKNLKARSIEAEVLVCGGAPTGSYIKATKGTFTGALNTCARIKITDPNPQW  307

Query  1084  ITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFEL  1263
             + E MP  RVMGDM +LP G VL+INGA+NGAAGW+LGRNP  +PV+YRPD   GSRFE 
Sbjct  308   VLETMPQARVMGDMTLLPDGTVLLINGASNGAAGWELGRNPVLNPVVYRPDNAAGSRFEQ  367

Query  1264  QNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAA  1443
             QNP  IPRMYHS+AVL+ DGRVLV GSNPH  Y+FTNV FPTEL +EAFSP YLD KYA 
Sbjct  368   QNPTTIPRMYHSTAVLLRDGRVLVGGSNPHPNYEFTNVLFPTELRVEAFSPDYLDAKYAN  427

Query  1444  LRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNT  1623
             +RP+IVSP SQ+ ++YG+ ++++F ++G +  + V VTMV+P+F+THSFSMN R LVL +
Sbjct  428   VRPKIVSPKSQAKINYGKKLTIRFSMTGTLATNSVSVTMVAPSFTTHSFSMNHRSLVLAS  487

Query  1624  VKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
               VK+ G+  Y ++V  P SGNLAPSGYYLL+VVH++IPS GIWV I
Sbjct  488   ENVKSVGKSAYEVEVTTPASGNLAPSGYYLLYVVHQQIPSDGIWVQI  534



>ref|XP_004252835.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=570

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/531 (66%), Positives = 414/531 (78%), Gaps = 10/531 (2%)
 Frame = +1

Query  187   GGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPP  366
             GG WN+L   IGISAMHMQLL+ND+VV FDRT+ G SNISLPDGKC +            
Sbjct  46    GGSWNVLLSDIGISAMHMQLLNNDRVVMFDRTDFGMSNISLPDGKCRYDQNDTTLKV---  102

Query  367   DDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCN  546
               +CTAHSVEY+VASNS RP++V +D WCSSGSV P G+LVQTGG+ +G +VVR + PC+
Sbjct  103   --DCTAHSVEYNVASNSIRPLMVQTDVWCSSGSVFPDGSLVQTGGFNDGDKVVRVYKPCS  160

Query  547   DAE----CDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSL  714
             ++     CDWEEI  GL++ RWYST+HILPDGRQII+GGRRAFNYEF+PKS  A+  YSL
Sbjct  161   NSTTNSTCDWEEIQGGLIQRRWYSTNHILPDGRQIIIGGRRAFNYEFYPKSASANNSYSL  220

Query  715   PFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPR  894
             PFL +T DP    ENNLYPFV LNVDGNLFIFANNRAIL DY+ NVV++ YPEIPGG+PR
Sbjct  221   PFLVKTNDPN-KIENNLYPFVFLNVDGNLFIFANNRAILFDYMKNVVLKNYPEIPGGDPR  279

Query  895   NYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPN  1074
             NYPS+GSA+LLPLKNL+     AEVLVCGG+PK +Y +A    F GAL+TCGRI ITDPN
Sbjct  280   NYPSTGSAILLPLKNLQAQEIQAEVLVCGGAPKGSYTSALNGNFSGALSTCGRITITDPN  339

Query  1075  PEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSR  1254
             P+WI E MP  R MGDMVILP GNVLIINGA  G AGW+ GR+P   PV+YRPD P  SR
Sbjct  340   PQWIMETMPLARTMGDMVILPNGNVLIINGAATGTAGWECGRDPVLKPVIYRPDNPFDSR  399

Query  1255  FELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPK  1434
             FE+QNP+ IPRMYHS+AVL+ DGRVLV GSNPH  Y FT VFFPTELS+EAFSP YLD  
Sbjct  400   FEIQNPSTIPRMYHSTAVLLRDGRVLVGGSNPHIYYNFTGVFFPTELSLEAFSPPYLDSV  459

Query  1435  YAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLV  1614
                LRP+I SPASQ  + YG+ V ++FKV+G+VD++ V VTMV+P F+THSF+MNQRLLV
Sbjct  460   SEYLRPQITSPASQHAIGYGQRVPIRFKVAGRVDINLVTVTMVAPGFNTHSFTMNQRLLV  519

Query  1615  LNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             L +  VK  G+  Y I+VV P++  LAP GYYLLFVVH++IPS+GIWV IQ
Sbjct  520   LVSENVKLIGKNAYQINVVTPNNAKLAPPGYYLLFVVHQDIPSEGIWVKIQ  570



>ref|XP_008221409.1| PREDICTED: galactose oxidase-like [Prunus mume]
Length=540

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/527 (65%), Positives = 407/527 (77%), Gaps = 17/527 (3%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GGKW LLQ +IGISAMHMQLLHND+VV FDRTN G SN+SLPDGKC             
Sbjct  30    AGGKWQLLQQNIGISAMHMQLLHNDRVVLFDRTNFGNSNLSLPDGKC-------------  76

Query  364   PDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPC  543
               ++CTAHS EYDV +N+FRP+ +LSD WCSSGSV+P G L+QTGG+  G R VR F PC
Sbjct  77    VGNDCTAHSAEYDVTTNTFRPLTLLSDVWCSSGSVAPDGRLIQTGGFTNGERRVRIFEPC  136

Query  544   NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFL  723
                 CDW+EI  GL   RWY+TDHILPDGRQII+GGRR FNYEF+PKS   +  +SLPFL
Sbjct  137   TG--CDWKEIENGLAARRWYATDHILPDGRQIIIGGRRQFNYEFYPKSASTNKVFSLPFL  194

Query  724   AQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYP  903
              QT DP   AENNLYPFV LNVDGNLFIFANNRAIL DYV N VV+TYP+IPGG+PR+YP
Sbjct  195   VQTNDPD--AENNLYPFVFLNVDGNLFIFANNRAILFDYVKNNVVKTYPQIPGGDPRSYP  252

Query  904   SSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEW  1083
             S+GSAVLLPLKNLK  +  AEVLVCGG+P  +Y  A +  F GALNTC RI ITDPNP+W
Sbjct  253   STGSAVLLPLKNLKARSIEAEVLVCGGAPTGSYIKATKGTFTGALNTCARIKITDPNPQW  312

Query  1084  ITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFEL  1263
             + E MP  RVMGDM +LP G VL+INGA+NGAAGW+LGRNP  +PV+YRPD   GSRFE 
Sbjct  313   VLETMPQARVMGDMTLLPDGTVLLINGASNGAAGWELGRNPVLNPVVYRPDNAVGSRFEQ  372

Query  1264  QNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAA  1443
             QNP  IPRMYHS+AVL+ DGRVLV GSNPH  Y+FTNV FPTELS+EAF+P YLD KY  
Sbjct  373   QNPTTIPRMYHSTAVLLRDGRVLVGGSNPHPDYEFTNVLFPTELSVEAFNPDYLDAKYTN  432

Query  1444  LRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNT  1623
             +RP+IVS  SQ+ ++YG+ ++++F V G +  + V VTMV+P+F+THSFSMN R LVL +
Sbjct  433   VRPKIVSSISQAKINYGKKLTIRFSVMGTLATNSVSVTMVAPSFTTHSFSMNHRSLVLAS  492

Query  1624  VKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
               VK+ G+  Y ++V  P SGNLAPSGYYLL+VVH++IPS GIWV I
Sbjct  493   ENVKSVGKSAYEVEVTTPASGNLAPSGYYLLYVVHQQIPSDGIWVQI  539



>ref|XP_009794042.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=553

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/537 (65%), Positives = 414/537 (77%), Gaps = 18/537 (3%)
 Frame = +1

Query  175   AVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglgg  354
             A   GGKWNLL P+IGISAMHMQLL+NDKVV FDRT+ G SNISLP GKC          
Sbjct  29    ASAAGGKWNLLMPNIGISAMHMQLLNNDKVVIFDRTDFGHSNISLPYGKC----------  78

Query  355   RKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTR  519
             R  P+D     +CTAHSVEY+  +NS RP++V +D WCSSG+V P G+LVQTGG+ +G +
Sbjct  79    RNDPNDTTLQIDCTAHSVEYNTVTNSIRPLMVQTDVWCSSGAVFPDGSLVQTGGFNDGEK  138

Query  520   VVRRFSPCN-DAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPA  696
             VVR F PCN +  CDW+EI  GL + RWY+T+HILPDGRQI++GGRRAFNYEF+PK   A
Sbjct  139   VVRVFKPCNGNNTCDWQEIQGGLAQRRWYATNHILPDGRQIVIGGRRAFNYEFYPKPASA  198

Query  697   DTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEI  876
                YSLPFL QT D  L  ENNLYPFV LNVDGNLFIFANNRAIL DY  NVVV+ +P+I
Sbjct  199   YKAYSLPFLVQTND--LKIENNLYPFVFLNVDGNLFIFANNRAILFDYTKNVVVKNFPQI  256

Query  877   PGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRI  1056
             PGG+PR+YPS+GSAVLLPLKNL+     AEVLVCGG+PK +Y +A+   F+ AL TCGRI
Sbjct  257   PGGDPRSYPSTGSAVLLPLKNLQTQQIQAEVLVCGGAPKGSYISAQNGNFLAALTTCGRI  316

Query  1057  VITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPD  1236
              ITDPNP+W  E MP  R MGDM+ILP GNVLII+GA  G AGW+LGR+P   PV+YRPD
Sbjct  317   GITDPNPQWTMENMPLARTMGDMLILPNGNVLIISGAATGTAGWELGRDPVLKPVIYRPD  376

Query  1237  APPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSP  1416
              P  SRFE+QNP+ IPRMYHS+A L+ DGRVL+ GSNPH  Y FT V FPTELS+EAFSP
Sbjct  377   NPFSSRFEIQNPSTIPRMYHSTATLLRDGRVLIGGSNPHIYYNFTGVLFPTELSLEAFSP  436

Query  1417  SYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSM  1596
             SYLDP+   LRP+I+SPASQ  + YG+ V V+FKVSG+V+ + V VTMV+P F+THSF+ 
Sbjct  437   SYLDPESEYLRPQIISPASQYTIGYGQRVPVRFKVSGRVNRNLVTVTMVAPGFNTHSFTQ  496

Query  1597  NQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             NQRLLVL +  VK  GE+ Y I+VV P+S  LAP GYYLLFVVH++IPS+GIWV IQ
Sbjct  497   NQRLLVLASENVKLLGEKAYQINVVTPNSATLAPPGYYLLFVVHQDIPSEGIWVKIQ  553



>gb|AET97563.1| galactose oxidase [Ziziphus jujuba]
Length=545

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/532 (64%), Positives = 406/532 (76%), Gaps = 19/532 (4%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GG+W LLQ SIGISAMHMQLL+ND+VV FDRT+ GPSN+SLP GKC          R  
Sbjct  27    AGGQWQLLQKSIGISAMHMQLLNNDRVVIFDRTDFGPSNLSLPAGKC----------RND  76

Query  364   PDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
             P+D     +CTAHS EYDVA+N+FRP+ V +D WCSSG V+P G L+QTGGY +G R VR
Sbjct  77    PNDTVLTVDCTAHSAEYDVATNTFRPLTVQTDVWCSSGCVTPDGRLIQTGGYNDGERRVR  136

Query  529   RFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFY  708
              + PC    CDW+EI  GL   RWY+T+HILPDGRQII+GGRR FNYEF+PK+  A   Y
Sbjct  137   IYKPCTG--CDWQEIELGLAARRWYATNHILPDGRQIIIGGRRQFNYEFYPKTASASNVY  194

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
             SLPFL QT DP +  ENNLYPFV LN DGNLF+FANNRAILLDYV N V++TYPEIPGG+
Sbjct  195   SLPFLVQTNDPKI--ENNLYPFVFLNTDGNLFVFANNRAILLDYVKNKVLKTYPEIPGGD  252

Query  889   PRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITD  1068
             PR+YPS+GSAVLLPL+NLK     AEVLVCGG+PK +Y  A +  F+GAL TC RI ITD
Sbjct  253   PRSYPSTGSAVLLPLENLKANFIEAEVLVCGGAPKGSYTEAIKRNFIGALKTCARIKITD  312

Query  1069  PNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPG  1248
             PNP+W+ E MP  RVMGDM +LP GNVLIING   G AGW+LGRNP  +PV+Y+P+   G
Sbjct  313   PNPQWVVETMPTARVMGDMTLLPNGNVLIINGGAAGTAGWELGRNPVLNPVIYKPNNAVG  372

Query  1249  SRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLD  1428
             SRFE QNP+ IPRMYHS+A+L+ DGRVLV GSNPH  Y FT V FPT+LS+EAFSPSYL+
Sbjct  373   SRFESQNPSSIPRMYHSTAILLRDGRVLVGGSNPHVYYNFTGVIFPTDLSLEAFSPSYLE  432

Query  1429  PKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRL  1608
              +++ LRP IVSP SQ+ L+Y + ++V+F V+G V    V VTMVSP+F+THSFSMNQRL
Sbjct  433   AQFSNLRPRIVSPTSQTKLAYAQKLAVRFTVTGTVATKLVSVTMVSPSFTTHSFSMNQRL  492

Query  1609  LVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             LVL    V+  G+  Y + V  P SGNLAPSGYYLLFVVH+EIPS GIWV I
Sbjct  493   LVLGAESVRNLGKTTYEVQVTTPSSGNLAPSGYYLLFVVHQEIPSLGIWVQI  544



>ref|XP_010263908.1| PREDICTED: galactose oxidase-like [Nelumbo nucifera]
Length=550

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/536 (64%), Positives = 419/536 (78%), Gaps = 19/536 (4%)
 Frame = +1

Query  175   AVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglgg  354
             A  GGGKW+LLQ SIGISAMHMQLL+ND+VV FDRT+ G S + LPDGKC          
Sbjct  29    AAGGGGKWDLLQQSIGISAMHMQLLNNDRVVIFDRTDFGESKLPLPDGKC----------  78

Query  355   RKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTR  519
             R  P+D     +CTAHS EYDV S S RP++VL+D WCSSG+VSP G L+QTGG+ +G  
Sbjct  79    RNDPNDTVLTVDCTAHSAEYDVLSKSIRPLMVLTDVWCSSGAVSPDGRLIQTGGFNDGDH  138

Query  520   VVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPAD  699
              VR F+PCN   CDW+E   GL+  RWY+T+HILPDGR II+GGRR FNYEF+PKS   +
Sbjct  139   AVRIFTPCNG--CDWQENSSGLLARRWYATNHILPDGRSIIIGGRRQFNYEFYPKSSSTN  196

Query  700   TFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIP  879
               +SLPFL+QT DP +  ENNLYPFV LNVDGNLFIFANNRAILLDY  N VV+T+P++P
Sbjct  197   ILFSLPFLSQTNDPKI--ENNLYPFVHLNVDGNLFIFANNRAILLDYTKNAVVKTFPQMP  254

Query  880   GGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIV  1059
             GG+PR+YPS+GS+VLLPLKNL+  +  AEVLVCGG+PKD+Y  AK+  FV AL+TCGRI 
Sbjct  255   GGDPRSYPSTGSSVLLPLKNLQQSSVEAEVLVCGGAPKDSYVQAKKGKFVRALDTCGRIK  314

Query  1060  ITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDA  1239
             ITD +P+W  E MP  RVMGDM++LP G+VLIINGA++G AGW+LGR P   PV+YRPD 
Sbjct  315   ITDASPDWSMETMPLARVMGDMLLLPNGHVLIINGASSGTAGWELGREPELKPVIYRPDN  374

Query  1240  PPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPS  1419
             P GSRFE+QNP+  PR+YHS+A+L+ DGRVLV G+NPH  Y FT V +PT+LS+EAFSP 
Sbjct  375   PSGSRFEVQNPSSTPRLYHSTAILLRDGRVLVGGNNPHRYYNFTGVLYPTDLSLEAFSPD  434

Query  1420  YLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMN  1599
             YLD K++ LRP+I+SP SQ+ LSYG+ +SV+F VSG ++   V VTMVSP+F+THSFSMN
Sbjct  435   YLDSKFSTLRPKILSPGSQAQLSYGQRLSVRFSVSGALNDKWVSVTMVSPSFTTHSFSMN  494

Query  1600  QRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             QRLLVL+  KV       Y ++V AP+SG LAPSGYYLLFVVH+EIPS+GIWV+I+
Sbjct  495   QRLLVLDGGKVTPVSSSVYDVEVTAPNSGFLAPSGYYLLFVVHQEIPSEGIWVNIK  550



>ref|XP_009791893.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=545

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/533 (63%), Positives = 415/533 (78%), Gaps = 19/533 (4%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GGKW LL+ +IGISAMHMQLL+ND+V+ +DRT+ G SNISLP+G+C          R  
Sbjct  27    AGGKWQLLKSNIGISAMHMQLLNNDRVIMYDRTDFGASNISLPNGRC----------RNN  76

Query  364   PDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
             P+D     +CTAHSVEYDV++NS RP++V +D WCSSGSV+  G+LVQTGG+ +G R+VR
Sbjct  77    PNDLALKVDCTAHSVEYDVSTNSVRPLMVQTDVWCSSGSVNADGSLVQTGGFNDGERMVR  136

Query  529   RFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFY  708
                PCN   CDW+E+   L++ RWYST+HILPDGRQII+GGR+AFNYEF+PK+   +  +
Sbjct  137   VVKPCN--TCDWQEMGSNLIQSRWYSTNHILPDGRQIIIGGRKAFNYEFYPKTASTNNVF  194

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
             SLPFL QT +P    ENNL+PFV LNVDGNLFIFAN+RAIL DY  N VV+TYP+IPGG+
Sbjct  195   SLPFLQQTNNPR--EENNLFPFVFLNVDGNLFIFANDRAILFDYKVNKVVKTYPQIPGGD  252

Query  889   PRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITD  1068
             PRNYPSSGSAVLLPLKNL+  T  AEVLVCGG+P+ +Y  A +  F+GALNTCGRI ITD
Sbjct  253   PRNYPSSGSAVLLPLKNLRAQTVQAEVLVCGGAPRGSYPKADKGEFIGALNTCGRITITD  312

Query  1069  PNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPG  1248
             PNP+W  E MP  R MGDMVILP GNVLIINGA  G AGW + R P   PV+YRPD P G
Sbjct  313   PNPQWTVETMPLARTMGDMVILPDGNVLIINGAAAGTAGWQIARKPVLSPVIYRPDNPLG  372

Query  1249  SRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLD  1428
             SRFE+QN N IPRMYHS+AVL+ DGRVLV GSNP+  Y FT V FPTELS+EAFSPSYLD
Sbjct  373   SRFEVQNSNTIPRMYHSTAVLLRDGRVLVGGSNPNEFYNFTGVLFPTELSLEAFSPSYLD  432

Query  1429  PKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRL  1608
             P+ + LRP+I+SPAS+    YG+ V+++F VSG ++   VKVTMV+P F+THS +MNQR+
Sbjct  433   PESSNLRPQIISPASRHKTKYGKSVNIRFTVSGLLNTDLVKVTMVAPGFNTHSNTMNQRM  492

Query  1609  LVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             LVL++ KV+  G+  Y I+++ P+SG LAP GYY+LFVVH+EIPS+GIW+ IQ
Sbjct  493   LVLSSGKVRRIGKSSYQINLIFPNSGKLAPPGYYMLFVVHQEIPSEGIWIKIQ  545



>ref|XP_009600286.1| PREDICTED: galactose oxidase-like [Nicotiana tomentosiformis]
Length=554

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/533 (64%), Positives = 409/533 (77%), Gaps = 9/533 (2%)
 Frame = +1

Query  175   AVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglgg  354
             A   GG W+LL  +IGISAMHMQLL+ND+V+ +DRT+ G SNISLPDGKC +        
Sbjct  29    AYAAGGNWDLLISNIGISAMHMQLLNNDRVIIYDRTDFGASNISLPDGKCRNNSNDLALK  88

Query  355   RKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
                   +CTAHSVEYDV++NS RP++V +D WCSSGS +  G+LVQTGG+ +G  VVR F
Sbjct  89    L-----DCTAHSVEYDVSTNSVRPLMVQTDVWCSSGSATSDGSLVQTGGFNDGENVVRVF  143

Query  535   SPCND--AECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFY  708
              PCN   + CDW+EI  GL++ RWY+T+HILPDGRQII+GGR AFNYEF+PK+   +  +
Sbjct  144   RPCNGNGSTCDWKEIGGGLIQSRWYATNHILPDGRQIIIGGREAFNYEFYPKTASTNNVF  203

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
             SLPFL QT DP    ENNLYPFV LNVDGNLFIFAN+RAIL +Y+ N VV+TYP+IPGG+
Sbjct  204   SLPFLQQTNDPR--EENNLYPFVFLNVDGNLFIFANDRAILFNYMANTVVKTYPQIPGGD  261

Query  889   PRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITD  1068
             PRNYPS+GSA+LLPLKNL+  T  AEVLVCGG+ K +Y NA    F+GALNTCGRI ITD
Sbjct  262   PRNYPSTGSAILLPLKNLQAQTIQAEVLVCGGTAKGSYLNASSGNFLGALNTCGRITITD  321

Query  1069  PNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPG  1248
             PNP+WI E MP  R MGDMVILP GNVLIINGA  G AGW+LGR+P   PV+YRPD P  
Sbjct  322   PNPQWIMETMPLVRTMGDMVILPNGNVLIINGAAAGTAGWELGRSPVLSPVIYRPDNPSH  381

Query  1249  SRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLD  1428
             SRFE+QN N IPRMYHS+++L+ DGRVLV GSNPHA Y FT V +PTELS+E FSPSYLD
Sbjct  382   SRFEVQNSNTIPRMYHSTSILLRDGRVLVGGSNPHALYNFTGVLYPTELSLETFSPSYLD  441

Query  1429  PKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRL  1608
             P+ A  RP+I+SPASQ  + YG  V+++F V G V    VKVTMVSP F+THSF+MNQR+
Sbjct  442   PESANSRPQIISPASQRKVKYGGRVNIRFTVPGSVKRDLVKVTMVSPGFNTHSFTMNQRM  501

Query  1609  LVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             LVL +  V   G+  Y I+ V P+S NLAP+GYYLLFVVH+ IPS+GIWV I+
Sbjct  502   LVLFSGNVTRVGKSAYKINSVFPNSSNLAPAGYYLLFVVHQGIPSEGIWVRIR  554



>ref|XP_010061250.1| PREDICTED: galactose oxidase-like [Eucalyptus grandis]
 gb|KCW68173.1| hypothetical protein EUGRSUZ_F01844 [Eucalyptus grandis]
Length=551

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/534 (64%), Positives = 415/534 (78%), Gaps = 21/534 (4%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
             GGG+W LLQ SIG+SAMHMQLLHND VV FDRT+ G SN+SLP+GKC          R  
Sbjct  33    GGGRWQLLQRSIGVSAMHMQLLHNDVVVIFDRTDFGKSNLSLPNGKC----------RND  82

Query  364   PDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
             P D     +CTAHS+EYDVASNSFRP++V +D WCSSGSV P G L+QTGG+ +G R +R
Sbjct  83    PRDTALKIDCTAHSIEYDVASNSFRPLMVQTDVWCSSGSVMPDGRLIQTGGFNDGERRIR  142

Query  529   RFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFY  708
              F+PC  + CDW+E+  GL   RWY+T+HILP+G QIIVGGR  FNYEF+PK+G A   Y
Sbjct  143   IFNPC--SGCDWQEVENGLSARRWYATNHILPNGLQIIVGGRGQFNYEFYPKTG-APKVY  199

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
             +LPFLAQT D  +  ENNLYPFV LNVDGNLFIFANNRAIL DY +  VV+TYP +PGG+
Sbjct  200   NLPFLAQTNDANI--ENNLYPFVHLNVDGNLFIFANNRAILFDYAHGKVVKTYPAMPGGD  257

Query  889   PRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITD  1068
             PRNYPS+GS+VLLPLKNL+ P   AEVLVCGG+P+ +Y  A +  FVGAL TCGRI ITD
Sbjct  258   PRNYPSTGSSVLLPLKNLQAPVKEAEVLVCGGAPRGSYIKATKGNFVGALTTCGRIKITD  317

Query  1069  PNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPG  1248
             P P+W+ E MP PRVMGDM +LP GNVLIINGA  G AGW++GRNP F+PVLYRPD P G
Sbjct  318   PAPQWVMETMPKPRVMGDMTLLPNGNVLIINGAAVGTAGWEIGRNPVFNPVLYRPDNPTG  377

Query  1249  SRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLD  1428
             +RFELQNP+ IPRMYHS+A+L+ DGRVLV GSNPH TY FT+V FPTELS+EAFSP YLD
Sbjct  378   NRFELQNPSSIPRMYHSTAILLRDGRVLVGGSNPHVTYAFTSVLFPTELSLEAFSPPYLD  437

Query  1429  PKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRL  1608
              +Y  LRP I+SPASQ+G+ YG  + V+F V G V  S+V VTMV+P+F+THSFSMNQRL
Sbjct  438   AQYNNLRPRIISPASQAGIGYGMKLLVRFSVVGAVSASRVTVTMVAPSFTTHSFSMNQRL  497

Query  1609  LVLNTVK-VKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             LV+   + V A G+  Y ++ V P +  LAP+GYYLLFVVH+++PS+GIW+ +Q
Sbjct  498   LVIGDGRGVTAVGKSVYEVEAVTPGTRTLAPAGYYLLFVVHQDVPSEGIWIRVQ  551



>ref|XP_009774595.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=554

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/534 (63%), Positives = 413/534 (77%), Gaps = 19/534 (4%)
 Frame = +1

Query  187   GGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPP  366
             GG W+LL  +IGISAMHMQLL+ND+V+ +DRT+ G SNISLPDGKC          R  P
Sbjct  33    GGNWDLLISNIGISAMHMQLLNNDRVIMYDRTDFGASNISLPDGKC----------RNNP  82

Query  367   DD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRR  531
             +D     +CTAHSVEYDV++NS RP++V +D WCSSGS +  G+LVQTGG+ +G  VVR 
Sbjct  83    NDLALKLDCTAHSVEYDVSTNSVRPLMVQTDVWCSSGSATSDGSLVQTGGFNDGENVVRV  142

Query  532   FSPCND--AECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTF  705
             F PCN   + CDW+EI  GL++ RWY+T+HILPDGRQII+GGR AFNYEF+PK+   ++ 
Sbjct  143   FRPCNGNGSTCDWKEIGGGLIQSRWYATNHILPDGRQIIIGGREAFNYEFYPKTASTNSV  202

Query  706   YSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGG  885
             ++LPFL QT DP    ENNLYPFV LNVDGNLFIFAN+RAIL +Y+ N VV+TYP+IPGG
Sbjct  203   FNLPFLQQTNDPR--EENNLYPFVFLNVDGNLFIFANDRAILFNYMANTVVKTYPQIPGG  260

Query  886   EPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVIT  1065
             +PRNYPS+GSAVLLPLKNL+     AEVLVCGG+P+ +Y NA    F+GALNTCGRI IT
Sbjct  261   DPRNYPSTGSAVLLPLKNLQAQIIQAEVLVCGGTPRGSYLNASSGNFLGALNTCGRITIT  320

Query  1066  DPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPP  1245
             DPNP+WI E MP  R MGDMVILP GNVLI+NGA  G AGW+LGR+P   PV+YRPD P 
Sbjct  321   DPNPQWIMETMPLARTMGDMVILPNGNVLILNGAAAGTAGWELGRSPVLSPVIYRPDNPF  380

Query  1246  GSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYL  1425
              SRFE+QN N IPRMYHS+++LI DGRVLV GSNPHA Y FT V +PTELS+E FSPSYL
Sbjct  381   DSRFEVQNSNTIPRMYHSTSILIRDGRVLVGGSNPHAFYNFTGVLYPTELSLETFSPSYL  440

Query  1426  DPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQR  1605
             DP+ A  RP I++PAS+  + YG+ V+++F V G V+   V VTMV+P F+THSF+MNQR
Sbjct  441   DPESANSRPRIIAPASRHKIKYGQRVNIRFTVPGSVNRDVVNVTMVAPGFNTHSFTMNQR  500

Query  1606  LLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             +LVL +  V   G+  Y I+ V P+S NLAP+GYYLLFVVH++IPS+GIWV IQ
Sbjct  501   MLVLFSGNVTRVGKSAYKINSVFPNSSNLAPAGYYLLFVVHQDIPSEGIWVRIQ  554



>ref|XP_010271447.1| PREDICTED: galactose oxidase-like [Nelumbo nucifera]
Length=553

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/539 (63%), Positives = 411/539 (76%), Gaps = 19/539 (4%)
 Frame = +1

Query  166   AAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggg  345
             A AA  GGGKW+LL+ SIGISAMHMQLLHND+VV FDRT+ G S ++LP GKC H     
Sbjct  29    AHAAGVGGGKWDLLKHSIGISAMHMQLLHNDRVVIFDRTDFGRSMLALPHGKCRHD----  84

Query  346   lggRKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGE  510
                   P D     +CTAHS EYDV+SNS RP++V +D WCSSGSVSP G L+QTGG  +
Sbjct  85    ------PKDFVLQVDCTAHSAEYDVSSNSIRPLMVQTDVWCSSGSVSPDGRLIQTGGSND  138

Query  511   GTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSG  690
             G R VR F+PCN   CDWEE   GL+ PRWY+T+ ILPDGR II+GGR  FNYEF+PKS 
Sbjct  139   GERSVRIFAPCNG--CDWEENSSGLLVPRWYATNQILPDGRSIIIGGRNQFNYEFYPKSS  196

Query  691   PADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYP  870
               DT + LPFL+QT DP +  ENNLYPFV LNVDGNLFIFANNRAILLDY  NVVV+ +P
Sbjct  197   STDTLFDLPFLSQTNDPNV--ENNLYPFVHLNVDGNLFIFANNRAILLDYTRNVVVKRFP  254

Query  871   EIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCG  1050
             ++P G  R YPS+GS+VLLPLK LK P+  AEVL+CGG+PK +Y+ A R  FVGAL+TCG
Sbjct  255   KMPDGHARCYPSTGSSVLLPLKKLKRPSVEAEVLICGGAPKGSYFQAIRGSFVGALSTCG  314

Query  1051  RIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYR  1230
             RI ITD +P W  E MP  RVMGDM++LP G VL+INGA +G AGW+LGRNP  +PV+YR
Sbjct  315   RIKITDESPAWSMETMPLARVMGDMILLPDGQVLMINGAKSGVAGWELGRNPELYPVIYR  374

Query  1231  PDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAF  1410
             P++P GSRF +QNP  IPRMYHSSA+L+ DGRVLV GSNPH  Y FT V +PTELS+EAF
Sbjct  375   PNSPSGSRFHVQNPTTIPRMYHSSALLLRDGRVLVGGSNPHEFYNFTGVLYPTELSLEAF  434

Query  1411  SPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSF  1590
             SP YLDP  + LRPEI+SP SQ+ L YG+ ++V+F +SG++    V VTMV+P+F+THSF
Sbjct  435   SPGYLDPGVSHLRPEIISPPSQTKLKYGQSITVRFSLSGELSSKGVSVTMVAPSFTTHSF  494

Query  1591  SMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             +MNQRLL L+  +VK   +  Y + V  P+SG LAPSGYYLLFVVH E+PS+GIWVHI+
Sbjct  495   AMNQRLLELDGRQVKPVSKSVYDVQVTIPESGFLAPSGYYLLFVVHTEVPSEGIWVHIK  553



>ref|XP_007017716.1| Glyoxal oxidase-related protein [Theobroma cacao]
 gb|EOY14941.1| Glyoxal oxidase-related protein [Theobroma cacao]
Length=546

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/531 (64%), Positives = 406/531 (76%), Gaps = 20/531 (4%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G+W LLQ SIG+SAMHMQLL ND+VV FDRT+ G SN+ LP+GKC          R  P+
Sbjct  31    GRWQLLQKSIGVSAMHMQLLRNDRVVMFDRTDFGKSNLPLPNGKC----------RTDPN  80

Query  370   D-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
             D     +CTAHSVEYDV +N FR ++V +D WCSSG++ P G LVQTGG+ +G R VR F
Sbjct  81    DTALKVDCTAHSVEYDVLTNKFRALMVQTDVWCSSGAIMPDGNLVQTGGFNDGERRVRVF  140

Query  535   SPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSL  714
             SPC  + CDW+EIP GL   RWY+T+HILPDGRQI+VGGRR FNYEF PK+  A+TF +L
Sbjct  141   SPC--STCDWQEIPNGLAAKRWYATNHILPDGRQIVVGGRRQFNYEFVPKNVAANTF-NL  197

Query  715   PFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPR  894
             PFL++T D G+  ENNLYPFV LNVDGNLFIFANNRAILLDYVNN VV+TYP IPGG+PR
Sbjct  198   PFLSETNDRGV--ENNLYPFVFLNVDGNLFIFANNRAILLDYVNNKVVKTYPTIPGGDPR  255

Query  895   NYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPN  1074
             +YPS+GSAVLLPLKNLK P   AEVLVCGG+PK +Y  A R  F+ AL TC R+ ITDPN
Sbjct  256   SYPSTGSAVLLPLKNLKAPAIQAEVLVCGGAPKGSYLEALRGKFIAALKTCARMTITDPN  315

Query  1075  PEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSR  1254
             P+W+ E MP  RVM DM++LP G VLIINGA +G+AGW+LGRNP   P LY PD   GSR
Sbjct  316   PQWVMETMPMARVMSDMILLPNGKVLIINGAGSGSAGWELGRNPVLSPALYLPDNKIGSR  375

Query  1255  FELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPK  1434
             F+ Q P  IPRMYHS+AVL+ DGRVLV GSNPH  Y FT V FPTELS+EAFSP+YLD K
Sbjct  376   FQAQTPTTIPRMYHSTAVLLRDGRVLVGGSNPHTFYNFTGVLFPTELSLEAFSPAYLDAK  435

Query  1435  YAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLV  1614
             +  LRP IV+P S S + YG+ ++VQ  ++GKV  + V VTMV+P+F+THSFSMNQR+LV
Sbjct  436   FNNLRPTIVAPKSSSEIQYGKKLTVQVLITGKVAPNLVSVTMVAPSFTTHSFSMNQRVLV  495

Query  1615  LNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             L   KV A  +  Y IDV  P S NLAP+G+YLLFVVH++IPS+GIWV ++
Sbjct  496   LGNDKVTALEKSTYNIDVTTPRSANLAPAGFYLLFVVHQDIPSQGIWVKLR  546



>ref|XP_007222145.1| hypothetical protein PRUPE_ppa004709mg [Prunus persica]
 gb|EMJ23344.1| hypothetical protein PRUPE_ppa004709mg [Prunus persica]
Length=495

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/511 (65%), Positives = 395/511 (77%), Gaps = 17/511 (3%)
 Frame = +1

Query  232   MHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPDDNCTAHSVEYDVAS  411
             MHMQLLHND+VV FDRT+ G SN+SLPDGKC               ++CTAHS EYDV +
Sbjct  1     MHMQLLHNDRVVLFDRTDFGKSNLSLPDGKC-------------VGNDCTAHSAEYDVTT  47

Query  412   NSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCNDAECDWEEIPYGLVR  591
             N+FRP+ VLSD WCSSGSV+P G L+QTGG+  G R VR F PC    CDW+EI  GL  
Sbjct  48    NTFRPLTVLSDVWCSSGSVAPDGRLIQTGGFTNGERRVRIFEPCTG--CDWKEIENGLAA  105

Query  592   PRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFLAQTTDPGLGAENNLYP  771
              RWY+TDHILPDGRQII+GGRR FNYEF+PKS   +  +SLPFL QT DP   AENNLYP
Sbjct  106   RRWYATDHILPDGRQIIIGGRRQFNYEFYPKSASTNKVFSLPFLVQTNDPD--AENNLYP  163

Query  772   FVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYPSSGSAVLLPLKNLKGP  951
             FV LNVDGNLFIFANNRAIL DYV N VV+TYP+IPGG+PR+YPS+GSAVLLPLKNLK  
Sbjct  164   FVFLNVDGNLFIFANNRAILFDYVKNNVVKTYPQIPGGDPRSYPSTGSAVLLPLKNLKAR  223

Query  952   TTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEWITEEMPFPRVMGDMVI  1131
             +  AEVLVCGG+P  +Y  A +  F GALNTC RI ITDPNP+W+ E MP  RVMGDM +
Sbjct  224   SIEAEVLVCGGAPTGSYIKATKGTFTGALNTCARIKITDPNPQWVLETMPQARVMGDMTL  283

Query  1132  LPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFELQNPNKIPRMYHSSAVL  1311
             LP G VL+INGA+NGAAGW+LGRNP  +PV+YRPD   GSRFE QNP  IPRMYHS+AVL
Sbjct  284   LPDGTVLLINGASNGAAGWELGRNPVLNPVVYRPDNAAGSRFEQQNPTTIPRMYHSTAVL  343

Query  1312  ITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAALRPEIVSPASQSGLSY  1491
             + DGRVLV GSNPH  Y+FTNV FPTEL +EAF+P YLD KY  LRP+IV+P SQ+ ++Y
Sbjct  344   LRDGRVLVGGSNPHPNYEFTNVLFPTELRVEAFNPDYLDAKYGNLRPKIVTPKSQAKINY  403

Query  1492  GEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNTVKVKAAGEEEYGIDVV  1671
             G+ ++++F V+G +  + V VTMV+P+F+THSFSMN R LVL +  VK+ G+  Y ++V 
Sbjct  404   GKKLTIRFSVTGTLATNSVSVTMVAPSFTTHSFSMNHRSLVLASENVKSVGKSAYEVEVT  463

Query  1672  APDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
              P SGNLAPSGYYLL+VVH++IPS GIWV I
Sbjct  464   TPASGNLAPSGYYLLYVVHQQIPSDGIWVQI  494



>ref|XP_010061025.1| PREDICTED: galactose oxidase-like [Eucalyptus grandis]
Length=565

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/527 (64%), Positives = 397/527 (75%), Gaps = 9/527 (2%)
 Frame = +1

Query  193   KWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPDD  372
             +W LLQ +IGI AMHMQLLHND+VV +DRT+ G SN+SLPDGKC H     +       D
Sbjct  46    RWQLLQSNIGIVAMHMQLLHNDRVVIYDRTDFGKSNLSLPDGKCRHDPSEAVVV-----D  100

Query  373   NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCNDA  552
             +CTAHSVEYDVASNSFRP++V +D WCSSG+V+  GTLVQTGGY +G R VR F+PC+D 
Sbjct  101   DCTAHSVEYDVASNSFRPLMVQTDVWCSSGAVTSDGTLVQTGGYNDGERQVRTFAPCSDR  160

Query  553   ECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFLAQT  732
              CDW+EI  GL   RWY+T+ ILPDGRQI++GGRR FNYEF+PKS  A   YSLPFL QT
Sbjct  161   RCDWQEIRNGLAARRWYATNQILPDGRQIVIGGRRQFNYEFYPKSSSAPNVYSLPFLVQT  220

Query  733   TDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYPSSG  912
              DPGL  ENNLYPFV LNVDGNLFIFANNRAIL DYVN  VVRTYP +PGG+PR YPS+G
Sbjct  221   NDPGL--ENNLYPFVHLNVDGNLFIFANNRAILFDYVNQKVVRTYPTMPGGDPRCYPSTG  278

Query  913   SAVLLPLKNLKGPT--TMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEWI  1086
             S+VLLPLK    PT    AEVLVCGG+PK A+  A    F+GALNTCGRI ITDPNP+W 
Sbjct  279   SSVLLPLKTAGRPTGNVEAEVLVCGGAPKGAFKQASGGKFLGALNTCGRIKITDPNPQWA  338

Query  1087  TEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFELQ  1266
              E MP  R MGDMV+LP G+VLIING   G AGW+ GRNP  +PV+Y+PD P G RF LQ
Sbjct  339   METMPGARAMGDMVLLPNGDVLIINGVAAGTAGWEFGRNPVLNPVIYKPDGPAGGRFALQ  398

Query  1267  NPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAAL  1446
             +P+ IPR+YHS+AVL+ DGRVLV GSNPH  Y FT V FPTEL +EAF P YLDP+++  
Sbjct  399   DPSGIPRVYHSTAVLLRDGRVLVGGSNPHIFYNFTGVIFPTELRLEAFRPPYLDPEHSGS  458

Query  1447  RPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNTV  1626
             RP I+ P SQ+ + Y +  SV+F V+G V +  V VTMV+P F+THSFSMNQRLLV+ + 
Sbjct  459   RPRIIYPTSQAKIGYSQKFSVRFTVTGNVSLDAVAVTMVAPPFNTHSFSMNQRLLVIGSG  518

Query  1627  KVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
              V   G   Y    VAP S NLAP+GYYLLFVVH+ IPS+GIWV IQ
Sbjct  519   TVVKVGNSAYAAQAVAPGSHNLAPAGYYLLFVVHQGIPSEGIWVQIQ  565



>ref|XP_004291826.1| PREDICTED: galactose oxidase-like [Fragaria vesca subsp. vesca]
Length=554

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/548 (61%), Positives = 413/548 (75%), Gaps = 21/548 (4%)
 Frame = +1

Query  139   FHNRGFFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDG  318
             F +   F+   AA   GGKW LL P++GISAMHMQLL ND+VV FDRT+ G SN+SLP+G
Sbjct  23    FISTSLFSLTHAA---GGKWQLLLPNVGISAMHMQLLKNDRVVMFDRTDFGKSNLSLPNG  79

Query  319   KCHHggggglggRKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGT  483
              C          R  P+D     +CTAHS EYDVA N  RP+ V SD WCSSGSV+P+GT
Sbjct  80    VC----------RNNPNDTALKVDCTAHSAEYDVAGNKIRPLFVYSDVWCSSGSVNPSGT  129

Query  484   LVQTGGYGEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAF  663
             LVQTGG+ +G + VR + PC  A CDW+EI   L   RWY+T+HILPDGRQII+GGRR F
Sbjct  130   LVQTGGFNDGEKRVRTYDPC--ATCDWKEIENALTNRRWYATNHILPDGRQIIIGGRRQF  187

Query  664   NYEFFPKSGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYV  843
             NYEF+PKS  +   +SLPFL +T+D G   ENNLYPFV LNVDGNLFIFANNRAIL DY 
Sbjct  188   NYEFYPKSEGSMNAHSLPFLVETSD-GTAIENNLYPFVFLNVDGNLFIFANNRAILFDYA  246

Query  844   NNVVVRTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNI  1023
                +V+TYP IPGG+PR+YPS+GSAVLLPLK+ KG    AEVLVCGG+PK +Y NA+   
Sbjct  247   AGKIVKTYPTIPGGDPRSYPSTGSAVLLPLKSSKGQVVAAEVLVCGGAPKGSYVNAESGT  306

Query  1024  FVGALNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRN  1203
             FV AL TC RI ITDPNP+W+ E MP  RVMGDM +L  G+VLIINGA  G AGW+LGRN
Sbjct  307   FVEALKTCARIKITDPNPQWVMETMPLARVMGDMTLLANGDVLIINGAGQGTAGWELGRN  366

Query  1204  PAFHPVLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFF  1383
             P  +PV+Y+ D   GSRFE QNP+ IPRMYHS+A+L+ DGRVLV GSNPH  Y+F+NV F
Sbjct  367   PVLNPVVYKSDNAVGSRFEQQNPSTIPRMYHSTAILLRDGRVLVGGSNPHIRYEFSNVMF  426

Query  1384  PTELSMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMV  1563
             PTEL++EAFSPSYL+ ++A++RP I SP SQ  + YG+ ++V+F ++GK+ ++ V VTMV
Sbjct  427   PTELALEAFSPSYLESQFASIRPSIFSPLSQVTVGYGQKLAVRFSITGKIALNSVSVTMV  486

Query  1564  SPAFSTHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPS  1743
             SP+F+THSFSMNQRLLVL +  V A G  ++ + V  P +GNLAPSGYYLL+VVH++IPS
Sbjct  487   SPSFTTHSFSMNQRLLVLASENVIAVGNLKFEVQVTTPATGNLAPSGYYLLYVVHQQIPS  546

Query  1744  KGIWVHIQ  1767
             +GIWV IQ
Sbjct  547   EGIWVKIQ  554



>ref|XP_007225625.1| hypothetical protein PRUPE_ppa003824mg [Prunus persica]
 gb|EMJ26824.1| hypothetical protein PRUPE_ppa003824mg [Prunus persica]
Length=546

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/532 (63%), Positives = 401/532 (75%), Gaps = 19/532 (4%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GGKW LLQ +IGISAMHMQLLHND+VV FDRT+ G SN+SLP+G+C          R  
Sbjct  28    AGGKWLLLQQNIGISAMHMQLLHNDRVVLFDRTDFGKSNLSLPEGQC----------RND  77

Query  364   PDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
             P+D     +CTAHS EYD  +NSFRP++V +D WCSSGSV+  G+L+QTGG+ +G R VR
Sbjct  78    PNDTVLKVDCTAHSAEYDAPTNSFRPLMVQTDVWCSSGSVAQDGSLIQTGGFNDGERRVR  137

Query  529   RFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFY  708
              F  C    CDW+E   GL   RWY+T+HILPDGRQII+GGRR FNYEF+PKS  +   +
Sbjct  138   IFQSCTG--CDWKEYDNGLAARRWYATNHILPDGRQIIIGGRRQFNYEFYPKSESSSNVH  195

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
             SLPFL QT DP +  ENNLYPFV LNVDGNLFIFANNRAIL DYV NVVV+TYP+IPGGE
Sbjct  196   SLPFLVQTNDPKV--ENNLYPFVFLNVDGNLFIFANNRAILFDYVKNVVVKTYPQIPGGE  253

Query  889   PRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITD  1068
             PR+YPS+GSAVLLPLKNL+     AEVLVCGG+PK +Y  A    FV AL TCGRI ITD
Sbjct  254   PRSYPSTGSAVLLPLKNLQAQFVEAEVLVCGGAPKGSYAKAVNGTFVEALKTCGRIKITD  313

Query  1069  PNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPG  1248
             PNP+W+ E MP  RVMGDM +LP G VLIINGA  G AGW+ GRNP  +PV+YRPD   G
Sbjct  314   PNPQWVVETMPQARVMGDMTLLPDGTVLIINGAAVGTAGWEFGRNPVLNPVIYRPDNAVG  373

Query  1249  SRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLD  1428
             SRFE QNP  IPRMYHS+AVL+ DGRVLV GSNPH  Y+FTNV FPTEL +E+F+P YLD
Sbjct  374   SRFEQQNPTTIPRMYHSTAVLLRDGRVLVGGSNPHIYYEFTNVLFPTELRLESFNPDYLD  433

Query  1429  PKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRL  1608
              K   LRP+IV+P SQ+ ++YG+ ++V+F V+G V  + V VTMV+P+F+THSFSMNQRL
Sbjct  434   AKSVNLRPKIVAPQSQAKINYGQKLAVRFSVAGTVAPNLVLVTMVAPSFTTHSFSMNQRL  493

Query  1609  LVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             LVL         +  Y + V  P SGNLAPSGYYLL+VVH++IPS+GIWV I
Sbjct  494   LVLAAESATNVAKSTYQVQVTTPGSGNLAPSGYYLLYVVHQQIPSEGIWVQI  545



>emb|CDP07430.1| unnamed protein product [Coffea canephora]
Length=561

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/536 (62%), Positives = 412/536 (77%), Gaps = 9/536 (2%)
 Frame = +1

Query  166   AAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggg  345
             A AA   GG+W LLQ SIGI++MHMQLL+NDKVV +DRT+ GPSNISL  GKC +     
Sbjct  33    AEAAATTGGQWALLQSSIGIASMHMQLLNNDKVVIYDRTDFGPSNISLASGKCRYDPQ--  90

Query  346   lggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVV  525
                 +    +CTAHSVEYDVA+NSFRP+ VL+D WCSSGS+ P GT VQTGG+ +G  VV
Sbjct  91    ---EQVLKVDCTAHSVEYDVATNSFRPLTVLTDVWCSSGSLMPDGTFVQTGGFNDGDHVV  147

Query  526   RRFSPCND-AECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADT  702
             R + PC+  + CDW+EI  GL++ RWY+T+HILPD  QII+GGRR FNYEF+PK+   + 
Sbjct  148   RLYKPCSSGSNCDWQEINNGLIQRRWYATNHILPDSSQIIIGGRRQFNYEFYPKTAATNQ  207

Query  703   FYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPG  882
              ++L FL QT DP +  ENNLYPFV LNVDGNLFIFANNRAILL+Y  N+VV+ YP++P 
Sbjct  208   VFNLRFLVQTNDPVV--ENNLYPFVFLNVDGNLFIFANNRAILLNYKKNIVVKNYPQLPD  265

Query  883   GEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVI  1062
             G PR YPS+GSAVLLPL+NL+GP   AEVLVCGG+PK AY +A++  F+GALNTCGRI I
Sbjct  266   GNPRCYPSTGSAVLLPLRNLQGPAIQAEVLVCGGAPKGAYASAQKGDFMGALNTCGRISI  325

Query  1063  TDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAP  1242
              DPNP+W+ E MP  RVMGDM++LP G+VL+INGA+ G AGW+ GRNP   PV+Y+P+  
Sbjct  326   NDPNPQWVMETMPLARVMGDMLLLPNGHVLMINGASAGTAGWEYGRNPVLSPVIYQPNKT  385

Query  1243  PGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSY  1422
              GSRFE+QNP+ IPRMYHSSA+L+ DGRVLV GSNPH  Y FT V +PTELS+EAFSPSY
Sbjct  386   IGSRFEVQNPSTIPRMYHSSAILLRDGRVLVGGSNPHMLYNFTGVLYPTELSLEAFSPSY  445

Query  1423  LDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQ  1602
             LDP  A LRP I+SP SQS + YG  + ++F VSG++  + V VTM +P+F+THSFSMNQ
Sbjct  446   LDPGVAGLRPRIISPVSQSQIGYGRQLVIRFSVSGQLKGNLVTVTMAAPSFNTHSFSMNQ  505

Query  1603  RLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLF-VVHREIPSKGIWVHIQ  1767
             RLLVL    VK AG   Y   V+ P + +LAP G+YLLF VVH++IPS+GIWVH+Q
Sbjct  506   RLLVLGGDNVKIAGNSTYQTAVLTPSTSSLAPPGFYLLFVVVHQDIPSQGIWVHLQ  561



>ref|XP_011083592.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=550

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/547 (62%), Positives = 415/547 (76%), Gaps = 27/547 (5%)
 Frame = +1

Query  145   NRGFFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKC  324
             +R   T AA      G+W+LL  +IGISAMHMQLLH D+VV FDRT+ GPSNISLPDGKC
Sbjct  25    HRNILTRAA-----DGRWDLLLSNIGISAMHMQLLHTDRVVMFDRTDFGPSNISLPDGKC  79

Query  325   HHggggglggRKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLV  489
                       R+ P+D     +CTAHSVEYDVASNS RP++VL+D WCSSG+V P GTLV
Sbjct  80    ----------RRDPNDTVLPVDCTAHSVEYDVASNSIRPLMVLTDVWCSSGAVMPDGTLV  129

Query  490   QTGGYGEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNY  669
             QTGG+ +G   +R + PC ++ CDW EI  GL + RWY+T+HILPDGRQI+VGGRR FNY
Sbjct  130   QTGGFNDGDHAIRIYEPCRNSTCDWREISRGLTQRRWYATNHILPDGRQIVVGGRRQFNY  189

Query  670   EFFPKSGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNN  849
             EF+PK+  AD  Y+LPFL QT DP +  ENNLYPFV LN DGNLFIFANNRAIL +Y+N 
Sbjct  190   EFYPKTSSADGSYNLPFLVQTNDPRI--ENNLYPFVFLNGDGNLFIFANNRAILFNYLNG  247

Query  850   VVVRTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFV  1029
              VVRTYP +PGG+PR+YPS+GSAVLLPLKN        EVLVCGG+PK AY  A    FV
Sbjct  248   SVVRTYPTMPGGDPRSYPSTGSAVLLPLKN----NAETEVLVCGGAPKGAYVRANNGDFV  303

Query  1030  GALNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPA  1209
             GALNTCGRI I D NP+W+ E MP  RVM DM++LP G VLIINGA +G AGW+LGR+P 
Sbjct  304   GALNTCGRIRINDLNPQWVMETMPMGRVMSDMLLLPNGEVLIINGAGSGTAGWELGRSPV  363

Query  1210  FHPVLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPT  1389
               PV+YRPD P GSRFE+QNP+  PRMYHS+AVL+ DGRVLV GSNPH  Y FT V FPT
Sbjct  364   LAPVIYRPDNPIGSRFEVQNPSSTPRMYHSTAVLLRDGRVLVGGSNPHTYYNFTGVLFPT  423

Query  1390  ELSMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKV-SGKVDMSQVKVTMVS  1566
             +L+++AFSP YLDPK + LRP+I+SP SQS + YG+ + ++F +  G+++ + V VTMV+
Sbjct  424   DLTLQAFSPRYLDPKLSYLRPKIISPVSQSEIRYGQQLPIRFTIPPGRLNSTSVMVTMVA  483

Query  1567  PAFSTHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSK  1746
             P+F+THSFSMNQRLLVL+   V A G+  Y + V  P SGNLAP+GYYL+FVVH++IPS+
Sbjct  484   PSFNTHSFSMNQRLLVLSHGDVTAVGKSTYQVRVGTPGSGNLAPAGYYLVFVVHQDIPSE  543

Query  1747  GIWVHIQ  1767
             GIWV I+
Sbjct  544   GIWVQIR  550



>ref|XP_004238617.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=557

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/544 (61%), Positives = 410/544 (75%), Gaps = 15/544 (3%)
 Frame = +1

Query  142   HNRGFFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGK  321
             H+R    AAA     GGKW+LL  +IGISAMHMQLL++D+VV +DRT+ G SNISLPDGK
Sbjct  25    HDRNLAYAAA-----GGKWDLLMSNIGISAMHMQLLNDDRVVIYDRTDFGMSNISLPDGK  79

Query  322   CHHggggglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGG  501
             C +              +CTAHSVEYDV++NS RP+++ ++ WCSSGS +  G+LVQTGG
Sbjct  80    CRNNNNDLALKV-----DCTAHSVEYDVSTNSVRPLMIQTNVWCSSGSATSDGSLVQTGG  134

Query  502   YGEGTRVVRRFSPC---NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYE  672
               +G  V+R + PC     + CDW EI  GL++ RWYST+HILPDG QII+GGR AFNYE
Sbjct  135   SNDGKFVIRVYRPCIIGKKSNCDWLEIENGLIQSRWYSTNHILPDGSQIIIGGRDAFNYE  194

Query  673   FFPKSGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNV  852
             FFPK+   +  ++LPFL QT DP    ENNLYPFV LNVDGNLFIF NNRAIL DY  N+
Sbjct  195   FFPKTASTNNVFNLPFLQQTNDPR--EENNLYPFVFLNVDGNLFIFTNNRAILFDYTTNM  252

Query  853   VVRTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVG  1032
             +V+TYP+IPGG+PRNYPS+GSAVLLPLKNL+  T  AEVLVCGG+P+ +Y  A R  F+G
Sbjct  253   IVKTYPQIPGGDPRNYPSTGSAVLLPLKNLEAHTIQAEVLVCGGAPRGSYLKATRGEFIG  312

Query  1033  ALNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAF  1212
             ALNTCGRI ITDPNP+W  E MP PR MGDMVILP GNVLI+NGA  G+AGW++ R P  
Sbjct  313   ALNTCGRITITDPNPQWTMETMPLPRTMGDMVILPNGNVLIVNGAAMGSAGWEIARGPVL  372

Query  1213  HPVLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTE  1392
              PV+YRPD  P SRFE+QNPN IPRMYHS+AVL+ DGRVLV GSNP+  Y FT V FPTE
Sbjct  373   SPVIYRPDNLPDSRFEVQNPNAIPRMYHSTAVLLRDGRVLVGGSNPNEFYNFTGVLFPTE  432

Query  1393  LSMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPA  1572
             LS+EAFSPSYLD + A LRP+I+SP S+    +G+ V +QF +SG V+ + +KVTM++P 
Sbjct  433   LSLEAFSPSYLDSESAHLRPQIISPVSRHKFKHGQRVDIQFSISGLVNKNSIKVTMIAPG  492

Query  1573  FSTHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGI  1752
             F+THS +MNQR+LVL    VK  G+  Y ++ + P SG+LAP GYYLLFVVH++IPS+GI
Sbjct  493   FNTHSNTMNQRMLVLTNGVVKQVGKSSYHMNCLFPKSGSLAPPGYYLLFVVHQDIPSEGI  552

Query  1753  WVHI  1764
             WV I
Sbjct  553   WVRI  556



>ref|XP_008221312.1| PREDICTED: galactose oxidase-like [Prunus mume]
Length=546

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/532 (63%), Positives = 401/532 (75%), Gaps = 19/532 (4%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GGKW LLQ +IGISAMHMQLLHND+VV FDRT+ G SN+SLP GKC          R  
Sbjct  28    AGGKWLLLQQNIGISAMHMQLLHNDRVVLFDRTDFGKSNLSLPKGKC----------RND  77

Query  364   PDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
             P+D     +CTAHS EYDV +NSFRP++V +D WCSSGSV+  G+L+QTGG+ +G R VR
Sbjct  78    PNDTVLKVDCTAHSAEYDVPTNSFRPLMVQTDVWCSSGSVAQDGSLIQTGGFNDGERRVR  137

Query  529   RFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFY  708
              F  C    CDW+E   GL   RWY+T+HILP+GRQII+GGRR FNYEF+PKS  +   +
Sbjct  138   IFQSCTG--CDWKEYDNGLAARRWYATNHILPEGRQIIIGGRRQFNYEFYPKSESSSNVH  195

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
             SLPFL QT DP +  ENNLYPFV LNVDGNLFIFANNRAIL DYV NVVV+TYP+IPGGE
Sbjct  196   SLPFLVQTNDPKV--ENNLYPFVFLNVDGNLFIFANNRAILFDYVKNVVVKTYPQIPGGE  253

Query  889   PRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITD  1068
             PR+YPS+GSAVLLPLKNL+     AEVLVCGG+PK +Y  A    FV AL TCGRI ITD
Sbjct  254   PRSYPSTGSAVLLPLKNLQARFVEAEVLVCGGAPKGSYAKAVNGTFVEALKTCGRIKITD  313

Query  1069  PNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPG  1248
             PNP+W+ E MP  RVMGDM +LP G VLIINGA  G AGW+ GRNP  +PV+Y+PD   G
Sbjct  314   PNPQWVVETMPQARVMGDMTLLPDGTVLIINGAAVGTAGWEFGRNPVLNPVIYQPDKAVG  373

Query  1249  SRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLD  1428
             SRFE QNP  IPRMYHS+AVL+ DGRVLV GSNPH  Y+FTNV FPTEL +E+F+P YLD
Sbjct  374   SRFEQQNPTTIPRMYHSAAVLLRDGRVLVGGSNPHIYYEFTNVLFPTELRLESFNPDYLD  433

Query  1429  PKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRL  1608
               Y  LRP+IV+P SQ+ +++G+ ++V+F V G V  + V VTMV+P+F+THSFSMNQRL
Sbjct  434   AMYVNLRPKIVAPQSQAKINHGQKLAVRFYVEGTVAPNLVSVTMVAPSFTTHSFSMNQRL  493

Query  1609  LVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             LVL    V    +  Y + V  P SGNLAPSGYY+L+VVH++IPS+GIWV I
Sbjct  494   LVLAAESVTNVAKSTYQVQVTTPGSGNLAPSGYYILYVVHQQIPSEGIWVQI  545



>ref|XP_008387970.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=547

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/532 (62%), Positives = 403/532 (76%), Gaps = 19/532 (4%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GGKW LLQ +IGI+AMH+QLLHND+VV +DRT+ G SN+SLPDGKC          R+ 
Sbjct  29    AGGKWVLLQQNIGITAMHLQLLHNDRVVIYDRTDFGMSNLSLPDGKC----------RED  78

Query  364   PDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
             P+D     +CTAHSVEYDV +NSFRP++V +D WCSSGS+SP G L+QTGG+ +G R VR
Sbjct  79    PNDTALKIDCTAHSVEYDVPTNSFRPLMVQTDVWCSSGSISPDGRLIQTGGFNDGERKVR  138

Query  529   RFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFY  708
              + PCN   CDW+E   GL   RWY+T+HILPDGRQII+GGRR FNYEF+PKS  +   Y
Sbjct  139   IYEPCNG--CDWKEYDNGLAARRWYATNHILPDGRQIIIGGRRQFNYEFYPKSASSSNVY  196

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
             SLPFL QT D  +  ENNLYPFV LNVDGNLFIFANNRAIL DYV N++V+TYP+IPGG+
Sbjct  197   SLPFLVQTNDAKI--ENNLYPFVFLNVDGNLFIFANNRAILFDYVKNIIVKTYPQIPGGD  254

Query  889   PRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITD  1068
             PR+YPS+GSAVLLPLKNL+     AEVL+CGG+PK ++  A +  FV AL TCGRI ITD
Sbjct  255   PRSYPSTGSAVLLPLKNLQAQLVEAEVLLCGGAPKGSHEKAVKGTFVEALKTCGRIKITD  314

Query  1069  PNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPG  1248
             PNP+W+ E MP  RVMGDM +LP G VLIINGA  G AGW+ GRNP  +PVLY+P+   G
Sbjct  315   PNPQWVVETMPQARVMGDMTLLPDGTVLIINGAALGTAGWEFGRNPVLNPVLYQPNNAVG  374

Query  1249  SRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLD  1428
             SRF  QNP  IPRMYHS+A+L+ DGRVLV GSNPH  Y+F NV FPTEL +EAF+P YLD
Sbjct  375   SRFMQQNPTTIPRMYHSTAILLRDGRVLVGGSNPHIYYEFKNVLFPTELRLEAFNPDYLD  434

Query  1429  PKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRL  1608
              KYA LRP+IV+P SQ  ++Y + ++V+F V+G +  + V VTMV+P+F+THSFSMNQR+
Sbjct  435   AKYANLRPKIVAPNSQGTITYAQKLAVRFSVTGTLATNLVSVTMVAPSFTTHSFSMNQRV  494

Query  1609  LVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             LVL    V       Y + V  P SGNLAPSGYYLL+VVH+ IPS+GIWV +
Sbjct  495   LVLAAESVTNVALSTYQVLVTTPGSGNLAPSGYYLLYVVHQSIPSEGIWVQV  546



>ref|XP_009337676.1| PREDICTED: galactose oxidase-like [Pyrus x bretschneideri]
Length=533

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/527 (62%), Positives = 397/527 (75%), Gaps = 17/527 (3%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GGKW LLQ S+GISAMHMQLL ND+VV FDRT+ G SN+SLP+G+C             
Sbjct  23    AGGKWQLLQQSVGISAMHMQLLRNDRVVMFDRTDFGKSNLSLPNGECVR-----------  71

Query  364   PDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPC  543
               ++CTAHS EYDV +N+ R + +L+D WCSSG+V+P G L+QTGGYG+G R VR F PC
Sbjct  72    --NDCTAHSAEYDVKTNTVRALSLLTDVWCSSGAVAPNGRLIQTGGYGDGERNVRVFEPC  129

Query  544   NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFL  723
                 CDW+E    L   RWY+TDHILP+GRQII+GGRR FNYEF+PK+G +   YSLPFL
Sbjct  130   TG--CDWKEFENALGARRWYATDHILPNGRQIIIGGRREFNYEFYPKTGSSSKVYSLPFL  187

Query  724   AQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYP  903
              QT D G   ENNLYPFV LNVDGNLFIFANNRAIL DY  N VV+TYP+IPGG+PR YP
Sbjct  188   VQTDDAG--EENNLYPFVFLNVDGNLFIFANNRAILFDYAKNNVVKTYPQIPGGDPRCYP  245

Query  904   SSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEW  1083
             S+GSAVLLPLKNL  P+  AEVLVCGG+PK ++  A +  FV ALNTC RI I +P P+W
Sbjct  246   STGSAVLLPLKNLAAPSVEAEVLVCGGAPKGSFVKANQGTFVEALNTCARININNPKPQW  305

Query  1084  ITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFEL  1263
             + E MP  RVMGDM++LP G VL+INGA++G AG+++GRNP  +PV+YRPD   GSRFE 
Sbjct  306   VMETMPQARVMGDMLLLPDGTVLLINGASSGTAGYEIGRNPVLNPVVYRPDNAIGSRFEQ  365

Query  1264  QNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAA  1443
             QNP  IPRMYHS+A+L+ DGRVLV GSNPH  Y+FTNV FPTEL +EAFSP YLD KY  
Sbjct  366   QNPTTIPRMYHSTAILLRDGRVLVGGSNPHEKYEFTNVLFPTELRLEAFSPDYLDAKYNN  425

Query  1444  LRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNT  1623
             LRP+IV+P SQ+ ++YG+ +S+QF V G +    V V+MV+P+F+THSFSMNQRLLVL  
Sbjct  426   LRPQIVAPISQAKINYGKKLSIQFLVKGNLATKSVSVSMVAPSFNTHSFSMNQRLLVLEA  485

Query  1624  VKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
               VK  G   Y + V  P SGNLAPSGYYLL+VVH++IPS  IWV I
Sbjct  486   ENVKKVGTTAYQVQVTTPASGNLAPSGYYLLYVVHQKIPSAAIWVQI  532



>ref|XP_008347351.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=533

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/527 (62%), Positives = 395/527 (75%), Gaps = 17/527 (3%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GGKW LLQ S+GISAMHMQLL ND+V+ FDRT+ G SN++LP+G+C             
Sbjct  23    AGGKWQLLQQSVGISAMHMQLLRNDRVIMFDRTDFGKSNLALPNGECVR-----------  71

Query  364   PDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPC  543
               ++CTAHS EYDV +N+ R + +LSD WCSSG+V+P G L+QTGG G G R VR F PC
Sbjct  72    --NDCTAHSAEYDVKTNTVRALTLLSDVWCSSGAVAPNGRLIQTGGNGAGDRRVRVFEPC  129

Query  544   NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFL  723
                 CDW+E    L   RWY+TDHILP+G+QII+GGRR FNYEF+PK+G +   YSLPFL
Sbjct  130   TG--CDWKEFANALGARRWYATDHILPNGQQIIIGGRRQFNYEFYPKTGSSSKVYSLPFL  187

Query  724   AQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYP  903
              QT D G   ENNLYPFV LNVDGNLFIFANNRAIL DY  N VV+TYP+IPGG+PR  P
Sbjct  188   VQTBDAG--EENNLYPFVFLNVDGNLFIFANNRAILFDYAKNXVVKTYPQIPGGDPRCXP  245

Query  904   SSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEW  1083
             S+GSAVLLPLKNL  P+  AEVLVCGG+PK ++  A +  FV ALNTC RI I +P P+W
Sbjct  246   STGSAVLLPLKNLAAPSVEAEVLVCGGAPKGSFVKANQGTFVEALNTCARIKINNPKPQW  305

Query  1084  ITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFEL  1263
             + E MP  RVMGDM++LP G VL+INGA++GAAGW++GRNP  +PV+YRPD   GSRFE 
Sbjct  306   VMETMPQARVMGDMLLLPDGTVLLINGASSGAAGWEIGRNPVLNPVVYRPDNAIGSRFEQ  365

Query  1264  QNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAA  1443
             QNP  IPRMYHS+A+L+ DGRVLV GSNPH  Y+FT+V FPTEL +EAFSP YLD KY  
Sbjct  366   QNPTTIPRMYHSTAILLRDGRVLVGGSNPHXKYEFTBVLFPTELRLEAFSPDYLDAKYNN  425

Query  1444  LRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNT  1623
             LRP+IV+P SQ+ ++YG+ +S+QF V G +    V V+MV+P+F+THSFSMNQRLLVL  
Sbjct  426   LRPQIVAPISQAKINYGKKLSIQFSVKGNLATQSVSVSMVAPSFNTHSFSMNQRLLVLEA  485

Query  1624  VKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
               VK  G   Y + V  P SGNLAPSGYYLL+VVH++IPS  IWV I
Sbjct  486   ENVKKVGTTAYQVQVTTPASGNLAPSGYYLLYVVHQKIPSAAIWVQI  532



>ref|XP_009337669.1| PREDICTED: galactose oxidase-like [Pyrus x bretschneideri]
Length=533

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/527 (62%), Positives = 395/527 (75%), Gaps = 17/527 (3%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GGKW LLQ S+GISAMHMQLL ND+VV FDRT+ G SN+ LP+G+C             
Sbjct  23    AGGKWQLLQQSVGISAMHMQLLRNDRVVMFDRTDFGKSNLPLPNGECVR-----------  71

Query  364   PDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPC  543
               ++CTAHS EYDV +N+ RP+ +L+D WCSSG+V+P G L+QTGG G+G R VR F PC
Sbjct  72    --NDCTAHSAEYDVKTNTVRPLTLLTDVWCSSGAVAPNGRLIQTGGNGDGERNVRVFEPC  129

Query  544   NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFL  723
                 CDW+E   GL   RWY+TDHILP+GRQII+GGRR FNYEF+PK+G +   YSLPFL
Sbjct  130   TG--CDWKEFENGLGARRWYATDHILPNGRQIIIGGRREFNYEFYPKTGSSSKVYSLPFL  187

Query  724   AQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYP  903
              QT D G   ENNLYPFV LNVDGNLFIFANNRAIL DY  N VV+TYP+IPGG+PR YP
Sbjct  188   VQTDDAG--EENNLYPFVFLNVDGNLFIFANNRAILFDYAKNNVVKTYPQIPGGDPRCYP  245

Query  904   SSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEW  1083
             S+GSAVLLPLKNL  P   AEVLVCGG+PK ++  A +  FV ALNTC RI I +P P+W
Sbjct  246   STGSAVLLPLKNLAAPAVEAEVLVCGGAPKGSFVKANQGTFVEALNTCARININNPKPQW  305

Query  1084  ITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFEL  1263
             + E MP  RVMGDM++LP G VL+INGA++G AGW++GRNP  +PV+YRPD   GSRFE 
Sbjct  306   VMETMPQARVMGDMLLLPDGTVLLINGASSGTAGWEIGRNPVLNPVVYRPDNAIGSRFEQ  365

Query  1264  QNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAA  1443
             QNP  IPRMYHS+A+L+ DGRVLV GSNPH  Y+FTNV FPTEL +EAFSP YL  KY  
Sbjct  366   QNPTTIPRMYHSTAILLRDGRVLVGGSNPHEKYEFTNVLFPTELRLEAFSPDYLGAKYNN  425

Query  1444  LRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNT  1623
             LRP+IV+P SQ+ ++YG+ +S+QF V G +    V V+MV+P+F+THSFSMNQRLLVL  
Sbjct  426   LRPQIVAPISQAKINYGKKLSIQFSVKGNLATKSVSVSMVAPSFNTHSFSMNQRLLVLEA  485

Query  1624  VKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
               VK  G   Y + V  P SGNLAPSGYYLL+VVH++IPS  IWV I
Sbjct  486   ENVKKVGTTAYQVQVTTPASGNLAPSGYYLLYVVHQKIPSAAIWVQI  532



>ref|XP_011069718.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=562

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/542 (62%), Positives = 411/542 (76%), Gaps = 23/542 (4%)
 Frame = +1

Query  175   AVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglgg  354
             A  GGGKWNLL  +IG+SAMHMQLL+ D+V+ FDRT+ GPSNISLP+ +C          
Sbjct  33    AAPGGGKWNLLLSNIGVSAMHMQLLNTDRVIIFDRTDFGPSNISLPNNQC----------  82

Query  355   RKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTR  519
             R  P+D     +CTAHSVEYDVASNS RP+ VL+D WCSSGS  P G+L+QTGG+ +G R
Sbjct  83    RNDPNDLTLKVDCTAHSVEYDVASNSIRPLNVLTDVWCSSGSAMPDGSLMQTGGFNDGDR  142

Query  520   VVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPAD  699
              VR + PC+D  CDW+E    L + RWY+T+HILPDGRQIIVGGR  F+YEF+PK   AD
Sbjct  143   NVRVYKPCSDDSCDWQEFDVALRQRRWYATNHILPDGRQIIVGGRGQFSYEFYPKKAGAD  202

Query  700   TFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIP  879
               Y+LPFL+QT DP +  ENNLYPFV LN DGNLFIFANNRAIL DYVN +VVR YP IP
Sbjct  203   QSYNLPFLSQTNDPRI--ENNLYPFVFLNTDGNLFIFANNRAILFDYVNGLVVRNYPTIP  260

Query  880   GGEPRNYPSSGSAVLLPLKNLKG-PTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRI  1056
             GG+PR+YPSSGSAVLLPL++L+G     AEVLVCGG+PK ++ +A    FVGALN+CGRI
Sbjct  261   GGDPRSYPSSGSAVLLPLRDLQGGANVTAEVLVCGGAPKGSFTSANNGNFVGALNSCGRI  320

Query  1057  VITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPD  1236
              I+DPNP+W+ E MP  RVMGDMV+LP GN+LIINGA++G AGWDLGRNP F PV+YRP+
Sbjct  321   RISDPNPQWVMETMPLARVMGDMVLLPNGNILIINGASSGTAGWDLGRNPVFTPVIYRPN  380

Query  1237  APPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSP  1416
              P G RFE QN + IPRMYHS+A+L+ DGR+LV+GSNPHA Y FT V FPT+L+MEAFSP
Sbjct  381   NPVGLRFEAQNSSSIPRMYHSTAILLRDGRILVSGSNPHAYYNFTGVVFPTDLTMEAFSP  440

Query  1417  SYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSM  1596
              YLDP+   +RP IVSPAS S + YG+ + + FK  G+++   + VTMV+P F+THSFSM
Sbjct  441   DYLDPRLIRVRPMIVSPASHSQIGYGQQLVINFKAQGRINRGFITVTMVAPPFTTHSFSM  500

Query  1597  NQRLLVLN-----TVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVH  1761
             NQRLLVL      +  V + G   Y + V+ P S  LAP GYYLLFVV+RE+PS+GIWV 
Sbjct  501   NQRLLVLTNSTGISASVTSLGGSNYQVRVMTPGSNILAPPGYYLLFVVYREVPSQGIWVQ  560

Query  1762  IQ  1767
             I+
Sbjct  561   IK  562



>ref|XP_009797022.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=551

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/537 (63%), Positives = 406/537 (76%), Gaps = 20/537 (4%)
 Frame = +1

Query  175   AVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglgg  354
             A   GGKW LL  +IGISAMH+QLL+ND+V+ +DRT+ GPSNISLPDGKC          
Sbjct  29    AYAAGGKWQLLMSNIGISAMHIQLLNNDRVIMYDRTDFGPSNISLPDGKC----------  78

Query  355   RKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTR  519
             R  P+D     +CTAHSVEYDV++NS RP++V +D WCSSGSV+  G+LVQTGG+ +G  
Sbjct  79    RNNPNDLALKVDCTAHSVEYDVSTNSVRPLMVQTDVWCSSGSVNSDGSLVQTGGFNDGEH  138

Query  520   VVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPAD  699
             +VR   PC  + CDW+E+   L++ RWYST+HILPDGRQII+GGR+AFNYEF+PK+    
Sbjct  139   MVRVVKPC--STCDWQEMGNNLIQSRWYSTNHILPDGRQIIIGGRKAFNYEFYPKTASTS  196

Query  700   TFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIP  879
               +SLPFL QT +P    ENNL+PFV LNVDGNLFIFAN+RAILLDY  N VV+T+P+IP
Sbjct  197   NVFSLPFLQQTNNPR--EENNLFPFVFLNVDGNLFIFANDRAILLDYKTNTVVKTFPQIP  254

Query  880   GGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIV  1059
             GG+PRNYPSSGSAVLLPLKNL+  T  AEVLVCGG+P+ +Y  A +  F+GALNTCGRI 
Sbjct  255   GGDPRNYPSSGSAVLLPLKNLRSQTVQAEVLVCGGAPRGSYPKADKGEFLGALNTCGRIT  314

Query  1060  ITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDA  1239
             ITDPNP+W  E MP  R MGDMVILP GNVLIINGA +G AGW + RNP   PV+YRPD 
Sbjct  315   ITDPNPQWTMETMPLARTMGDMVILPNGNVLIINGAASGTAGWQIARNPVLSPVIYRPDN  374

Query  1240  PPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPS  1419
             P  SRFE+QNPN IPRMYHS+AVL+ DGRVLV GSNP+  Y FT V FPT+LS+EAFSPS
Sbjct  375   PSDSRFEVQNPNAIPRMYHSTAVLLRDGRVLVGGSNPNELYNFTGVLFPTDLSLEAFSPS  434

Query  1420  YLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMN  1599
             YLD + A LRP I+SPAS    +YG+ V ++F  SG ++   VKVTMV+P F+THSF+MN
Sbjct  435   YLDQESANLRPRIISPASHLKYTYGQRVDIRFTASGLLNTDLVKVTMVAPGFNTHSFTMN  494

Query  1600  QRLLVL-NTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             QR+LVL  +  V+  G   Y I  V P SG  AP GYYLLFVVH++IPS+ IWV IQ
Sbjct  495   QRMLVLPRSGMVRQVGRFVYQISCVFPKSGIFAPPGYYLLFVVHQDIPSEAIWVRIQ  551



>ref|XP_009797023.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=551

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/534 (63%), Positives = 405/534 (76%), Gaps = 20/534 (4%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GGKW LL  +IGISAMH+QLL+ND+V+ +DRT+ GPSNISLPDGKC          R  
Sbjct  32    AGGKWQLLMSNIGISAMHIQLLNNDRVIMYDRTDFGPSNISLPDGKC----------RNN  81

Query  364   PDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
             P+D     +CTAHSVEYDV++NS RP++V +D WCSSGSV+  G+LVQTGG+ +G  +VR
Sbjct  82    PNDLALKVDCTAHSVEYDVSTNSVRPLMVQTDVWCSSGSVNSDGSLVQTGGFNDGEHMVR  141

Query  529   RFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFY  708
                PC  + CDW+E+   L++ RWYST+HILPDGRQII+GGR+AFNYEF+PK+   +  +
Sbjct  142   VVKPC--STCDWQEMGNNLIQSRWYSTNHILPDGRQIIIGGRKAFNYEFYPKTASTNNVF  199

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
             SLPFL QT +P    ENNL+PFV LNVDGNLFIFAN+RAILLDY  N VV+T+P+IPGG+
Sbjct  200   SLPFLQQTNNPR--EENNLFPFVFLNVDGNLFIFANDRAILLDYKTNTVVKTFPQIPGGD  257

Query  889   PRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITD  1068
             PRNYPSSGSAVLLPLKNL+  T  AEVLVCGG+P+ +Y  A +  F+GALNTCGRI ITD
Sbjct  258   PRNYPSSGSAVLLPLKNLRSQTVQAEVLVCGGAPRGSYPKADKGEFLGALNTCGRITITD  317

Query  1069  PNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPG  1248
             PNP+W  E MP  R MGDMVILP GNVLIINGA +G AGW + RNP   PV+YRPD P  
Sbjct  318   PNPQWTMETMPLARTMGDMVILPNGNVLIINGAASGTAGWQIARNPVLSPVIYRPDNPSD  377

Query  1249  SRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLD  1428
             SRFE+QNPN IPRMYHS+AVL+ DGRVLV GSNP+  Y FT V FPT+LS+EAFSPSYLD
Sbjct  378   SRFEVQNPNAIPRMYHSTAVLLRDGRVLVGGSNPNELYNFTGVLFPTDLSLEAFSPSYLD  437

Query  1429  PKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRL  1608
              + A LRP I+SPAS    +YG+ V + F  SG ++   VKVTMV+P F+THSF+MNQR+
Sbjct  438   QESANLRPRIISPASHLKYTYGQRVDILFTASGLLNRDLVKVTMVAPGFNTHSFTMNQRM  497

Query  1609  LVL-NTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             LVL  +  V+  G   Y I  V P SG  AP GYYLLFVVH++IPS+ IWV IQ
Sbjct  498   LVLPRSGMVRQVGRFVYQISCVFPKSGIFAPLGYYLLFVVHQDIPSEAIWVRIQ  551



>ref|XP_007017718.1| Glyoxal oxidase-related protein [Theobroma cacao]
 gb|EOY14943.1| Glyoxal oxidase-related protein [Theobroma cacao]
Length=546

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/526 (64%), Positives = 402/526 (76%), Gaps = 10/526 (2%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G+W LLQ SIG+SAMHMQLL ND+VV FDRT+ G SN+SLP+GKC            P D
Sbjct  31    GRWQLLQKSIGVSAMHMQLLRNDRVVMFDRTDFGKSNLSLPNGKCLSNPTNTAL---PVD  87

Query  370   DNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCND  549
               CTAHSVEY+V +N FR + V +D WCSSG++ P G LVQTGG+  GTR VR FSPC  
Sbjct  88    --CTAHSVEYNVLTNEFRALTVQTDVWCSSGAIMPDGNLVQTGGFNNGTRRVRVFSPC--  143

Query  550   AECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFLAQ  729
             + CDW+EIP GL   RWY+T+HILPDGRQIIVGGRR FNYEF PK+  A+TF +LPFL++
Sbjct  144   STCDWQEIPNGLAAKRWYATNHILPDGRQIIVGGRRQFNYEFIPKTVAANTF-NLPFLSE  202

Query  730   TTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYPSS  909
             T D G+  ENNLYPFV LNVDGNLFIFANNRAILLDYVNN VV+TYP IPGG+PR+YPS+
Sbjct  203   TNDRGV--ENNLYPFVFLNVDGNLFIFANNRAILLDYVNNKVVKTYPTIPGGDPRSYPST  260

Query  910   GSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEWIT  1089
             GSAVLLPLKNLK P   AEVLVCGG+PK +Y  A +  F+GALNTC R+ ITDPNP+W+ 
Sbjct  261   GSAVLLPLKNLKAPAIQAEVLVCGGAPKGSYLQALKGNFIGALNTCARMTITDPNPQWVM  320

Query  1090  EEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFELQN  1269
             E MP  RVM DM++LP G VLIINGA +G+AGW+LGR+P   PV+Y PD   GSRFE Q 
Sbjct  321   ETMPMARVMSDMILLPNGKVLIINGAGSGSAGWELGRDPVLSPVMYLPDHEIGSRFETQT  380

Query  1270  PNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAALR  1449
             P  IPRMYHS+ VL+ DGRVLV GSNPHA Y FT V FPTELS+EAFSP Y+D ++  LR
Sbjct  381   PTTIPRMYHSAVVLLRDGRVLVGGSNPHAFYNFTGVLFPTELSLEAFSPVYMDAEFNDLR  440

Query  1450  PEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNTVK  1629
             P IV+P S SG+   + +SVQ  ++GKVD + V VTMV+P+F+THSFSMNQR+L L    
Sbjct  441   PTIVAPKSMSGIQIRKKLSVQVVITGKVDPNLVSVTMVAPSFTTHSFSMNQRVLDLGNNN  500

Query  1630  VKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             V A G   Y I+   P S NLAP+G+YLLFVVH++IPS+GIWV ++
Sbjct  501   VTALGNSTYNIEYTTPRSYNLAPAGFYLLFVVHQDIPSQGIWVKLR  546



>ref|XP_004291825.1| PREDICTED: galactose oxidase-like [Fragaria vesca subsp. vesca]
Length=554

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/548 (61%), Positives = 412/548 (75%), Gaps = 21/548 (4%)
 Frame = +1

Query  139   FHNRGFFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDG  318
             F +   F+   AA   GGKW LL P++GISAMHMQLL ND+VV FDRT+ G SN+ LP+G
Sbjct  23    FISTSLFSLTHAA---GGKWQLLLPNVGISAMHMQLLKNDRVVMFDRTDFGKSNLPLPNG  79

Query  319   KCHHggggglggRKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGT  483
             +C          R  P+D     +CTAHS EYDVA N  RP+ V SD WCSSGSV+P+GT
Sbjct  80    RC----------RNNPNDTALKVDCTAHSAEYDVAGNKIRPLFVYSDVWCSSGSVNPSGT  129

Query  484   LVQTGGYGEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAF  663
             LVQTGG+ +G + VR + PC  A CDW+EI   L   RWY+T+H LPDGRQII+GGRR F
Sbjct  130   LVQTGGFNDGEKRVRTYDPC--ATCDWKEIENALTNRRWYATNHELPDGRQIIIGGRREF  187

Query  664   NYEFFPKSGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYV  843
             NYEF+PKSG +   +SLPFL +T+D G   ENNLYPFV LNVDGNLFIFANNRAIL DY 
Sbjct  188   NYEFYPKSGGSMNAHSLPFLVETSD-GNAIENNLYPFVFLNVDGNLFIFANNRAILFDYA  246

Query  844   NNVVVRTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNI  1023
                +V+TYP IPGG+PR+YPS+GSAVLLPLK+ KG    AEVLVCGG+PK +Y  A    
Sbjct  247   AGKIVKTYPTIPGGDPRSYPSTGSAVLLPLKSSKGQVVAAEVLVCGGAPKGSYVKAASGT  306

Query  1024  FVGALNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRN  1203
             FV AL TC RI ITDP+P+W  E MP  RVMGDM +L  G+VLIINGA +G AGW+LGRN
Sbjct  307   FVEALKTCARIKITDPSPQWGMETMPLARVMGDMTLLANGDVLIINGAGSGTAGWELGRN  366

Query  1204  PAFHPVLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFF  1383
             P  +PV+Y+PD   GSRFE QNP+ IPRMYHS+A+L+ DGRVLV GSNPH  Y+F+NV F
Sbjct  367   PVLNPVVYKPDNAVGSRFEQQNPSTIPRMYHSAAILLRDGRVLVGGSNPHIRYEFSNVLF  426

Query  1384  PTELSMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMV  1563
             PTEL++EAFSPSYL+ ++A++RP I SP SQ  + YG+ ++V+F ++GK+ ++ V VTMV
Sbjct  427   PTELALEAFSPSYLESQFASIRPSIFSPLSQVTVGYGQKLAVRFSITGKIALNSVSVTMV  486

Query  1564  SPAFSTHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPS  1743
             SP+F+THSFSMNQRLLVL +  V A G  ++ + V  P +GNLAPSGYYLL+VVH++IPS
Sbjct  487   SPSFTTHSFSMNQRLLVLASENVIAVGNLKFEVQVTTPATGNLAPSGYYLLYVVHQQIPS  546

Query  1744  KGIWVHIQ  1767
             +GIWV I+
Sbjct  547   EGIWVKIK  554



>ref|XP_004238618.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=553

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/537 (61%), Positives = 409/537 (76%), Gaps = 12/537 (2%)
 Frame = +1

Query  160   TAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggg  339
             +A AAA   GGKW+LL  +IGIS+MHMQLL+ND+V+ +DRT+ G SNISLP+GKC +   
Sbjct  27    SAYAAA---GGKWDLLMSNIGISSMHMQLLNNDRVIMYDRTDFGASNISLPNGKCRNNTN  83

Query  340   gglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTR  519
                        +CTAHSVEYDV++NS RP++V +D WCSSGS +  GTLVQTGG+ +G +
Sbjct  84    DLAL-----KIDCTAHSVEYDVSTNSIRPLMVQTDVWCSSGSATSDGTLVQTGGFNDGEK  138

Query  520   VVRRFSPCN--DAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGP  693
             VVR   PCN   + CDW EI   L++ RWY+T+H+LPDGRQII+GGR AFNYEF+PK+  
Sbjct  139   VVRVLKPCNGNKSRCDWREIESALIQSRWYATNHVLPDGRQIIIGGREAFNYEFYPKTLS  198

Query  694   ADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPE  873
              +  ++L FL QT DP    ENNLYPFV LNVDGNLFIFANNRAIL DY ++ +V+TYP+
Sbjct  199   TNNIFNLTFLQQTNDPR--EENNLYPFVFLNVDGNLFIFANNRAILFDYTSDTIVKTYPQ  256

Query  874   IPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGR  1053
             IPGG+PRNYPS+GSAVLLPLKNL+     AEVLVCGG+   ++  A+R  F+GALNTCGR
Sbjct  257   IPGGDPRNYPSTGSAVLLPLKNLEAQIIQAEVLVCGGTKNGSFLRAQRGKFLGALNTCGR  316

Query  1054  IVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRP  1233
             I ITDPNP+W+ E MP  R+M DMVILP GNVLIINGA  G AGW+LGR+P   PV+YRP
Sbjct  317   IRITDPNPQWVMETMPLARIMSDMVILPNGNVLIINGAAAGTAGWELGRSPVLSPVIYRP  376

Query  1234  DAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFS  1413
             D P  SRFE+QNP+ IPRMYHS+ +L+ DGRVLV GSNPH  Y FT V +PTELS+EAFS
Sbjct  377   DNPVNSRFEVQNPSTIPRMYHSTTILLRDGRVLVGGSNPHGLYNFTGVLYPTELSLEAFS  436

Query  1414  PSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFS  1593
             PSYLD   A LRP+I+SPAS+  + YG  V+++F V G ++ + VKVTMV+P F+THSF+
Sbjct  437   PSYLDSDSANLRPQIISPASRRKVKYGGQVNIRFIVPGPINRNLVKVTMVAPGFNTHSFT  496

Query  1594  MNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             MNQR+LVL++  V   G   Y I+ + P+S  LAP GYY+LFVVH++IPS+GIW+ I
Sbjct  497   MNQRILVLSSGNVTQVGTSTYKINSIFPNSSKLAPPGYYMLFVVHQDIPSEGIWIRI  553



>ref|XP_010105253.1| hypothetical protein L484_019396 [Morus notabilis]
 gb|EXC04188.1| hypothetical protein L484_019396 [Morus notabilis]
Length=548

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/533 (63%), Positives = 402/533 (75%), Gaps = 19/533 (4%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G+W  LQ SIG+SAMHMQLL+ D+VV FDRT+ G SN+SLPDGKC          R  P+
Sbjct  28    GRWQTLQTSIGVSAMHMQLLNTDRVVIFDRTDFGKSNLSLPDGKC----------RNDPN  77

Query  370   D-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
             D     +CTAHSVEYDV SN+FRP++V +D WCSSG+++P GTLVQTGG+ +G R VR F
Sbjct  78    DTALKIDCTAHSVEYDVVSNTFRPLMVQTDVWCSSGALTPDGTLVQTGGFNDGERRVRIF  137

Query  535   SPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKS-GPADTFYS  711
              PC+   CDW EI +GL   RWY+TDHILPDG+ I++GGRR FNYEF+PK+   A   YS
Sbjct  138   KPCSTGGCDWLEIEFGLAARRWYATDHILPDGQVIVIGGRRQFNYEFYPKTTSSAKNPYS  197

Query  712   LPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEP  891
             LPFL QT D  +  ENNLYPFV LNVDGNLFIFANNRAILLDY  N V++TYP+IPGG+P
Sbjct  198   LPFLVQTNDAKI--ENNLYPFVFLNVDGNLFIFANNRAILLDYTKNQVLKTYPQIPGGDP  255

Query  892   RNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDP  1071
             R+YPS+GSAVLLPLKNL+     AEVLVCGG+PK AY  A    FVGAL +C R+ ITDP
Sbjct  256   RSYPSTGSAVLLPLKNLQAQLIEAEVLVCGGAPKGAYVQAVNGNFVGALKSCARMKITDP  315

Query  1072  NPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGS  1251
             NP W+ E+MP  RVMGDM +LP GNVLIING   G AGW+ GR+P   P+LYRPD   GS
Sbjct  316   NPTWVMEDMPLARVMGDMTLLPNGNVLIINGGAAGTAGWEYGRDPVLSPILYRPDKLIGS  375

Query  1252  RFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDP  1431
             RFE+QNP+ IPRMYHS+A+L+ DGRVLV GSNPH  Y FT V FPT+LS+E+FSP YLD 
Sbjct  376   RFEVQNPSSIPRMYHSTAILLRDGRVLVGGSNPHIYYNFTGVLFPTDLSLESFSPQYLDA  435

Query  1432  KYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDM-SQVKVTMVSPAFSTHSFSMNQRL  1608
             +++ LRP+IVSP SQS +SY   ++V+F VSG   +   V VTMV+P+F+THSFSMNQRL
Sbjct  436   QFSNLRPKIVSPPSQSKVSYLNKLAVRFTVSGATLLPGSVAVTMVAPSFTTHSFSMNQRL  495

Query  1609  LVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             LVL+   + + G+  Y + V  P SG LAPSGYYL FVVH+EIPS GIWV IQ
Sbjct  496   LVLSAESMTSLGKSTYEVRVTTPGSGILAPSGYYLWFVVHQEIPSDGIWVQIQ  548



>ref|XP_006342233.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=553

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/534 (60%), Positives = 407/534 (76%), Gaps = 9/534 (2%)
 Frame = +1

Query  169   AAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHgggggl  348
             +A   GGG+W+LL  +IGIS+MHMQLL+ND+VV +DRT+ G SNISLP+GKC +      
Sbjct  27    SAYAAGGGRWDLLMSNIGISSMHMQLLNNDRVVMYDRTDFGASNISLPNGKCRNNTNDLT  86

Query  349   ggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
                     +CTAHSVEYDV++NS RP++V +D WCSSGS +  GTLVQTGG+ +G  VVR
Sbjct  87    LKV-----DCTAHSVEYDVSTNSVRPLMVQTDVWCSSGSATSDGTLVQTGGFNDGENVVR  141

Query  529   RFSPCN--DAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADT  702
                PCN   + CDW+EI   L++ RWY+T+H+LPDGRQII+GGR AFNYEF+PK+   + 
Sbjct  142   VLKPCNGNKSTCDWKEIEGALIQSRWYATNHVLPDGRQIIIGGREAFNYEFYPKTLSTNN  201

Query  703   FYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPG  882
              ++L FL QT D  L  ENNLYPFV LNVDGNLFIFANNRAIL DY  +++V+TYP+IPG
Sbjct  202   IFNLTFLQQTND--LREENNLYPFVFLNVDGNLFIFANNRAILFDYTRDIIVKTYPQIPG  259

Query  883   GEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVI  1062
             G+PRNYPS+GSAVLLPLKNL+     AEVLVCGG+   ++  A+R  F+GALNTCGRI I
Sbjct  260   GDPRNYPSTGSAVLLPLKNLEAQIIQAEVLVCGGTKNGSFLRAQRGNFLGALNTCGRITI  319

Query  1063  TDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAP  1242
             TDPNP+WI E MP  R+MGDMVILP GNVLIINGAT G AGW+LGRNP   PV+YRPD P
Sbjct  320   TDPNPQWIMETMPLARIMGDMVILPNGNVLIINGATAGTAGWELGRNPVLSPVIYRPDNP  379

Query  1243  PGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSY  1422
               SRF++QN + IPRMYHS+ VL+ DGRVLV+GSNPH  Y FT V +PTELS+EAFSPSY
Sbjct  380   VNSRFDVQNSSTIPRMYHSTTVLLRDGRVLVSGSNPHGLYNFTGVLYPTELSLEAFSPSY  439

Query  1423  LDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQ  1602
             LD +   LRP +VSP+S+  + YG  V+++F + G ++ + VKVTMV+P F+THSF+MNQ
Sbjct  440   LDSESVNLRPRVVSPSSRRKVKYGGQVNIRFIIPGPINRNLVKVTMVAPGFNTHSFTMNQ  499

Query  1603  RLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             R+L L++  V   G   + I+ + P+S  LAP GYY+LFVVH++IPS+GIW+ I
Sbjct  500   RILELSSGNVTQVGTSTFKINSIFPNSSKLAPPGYYMLFVVHQDIPSEGIWIRI  553



>ref|XP_009335425.1| PREDICTED: galactose oxidase-like [Pyrus x bretschneideri]
Length=547

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/530 (62%), Positives = 398/530 (75%), Gaps = 19/530 (4%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             GKW LLQ +IGI+AMHMQLLHND+VV +DRT+ G SN+SLPDGKC          R+ P+
Sbjct  31    GKWVLLQQNIGITAMHMQLLHNDRVVIYDRTDFGMSNLSLPDGKC----------REDPN  80

Query  370   D-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
             D     +CTAHSVEYDV +NSFRP++V +D WCSSGS+SP G L+QTGG+ +G R VR +
Sbjct  81    DTALKIDCTAHSVEYDVPTNSFRPLMVQTDVWCSSGSISPDGRLIQTGGFNDGERKVRIY  140

Query  535   SPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSL  714
              PC    CDW+E   G    RWY+T+HILPDGRQII+GGRR FNYEF+PKS  +   YSL
Sbjct  141   QPCTG--CDWKEYDNGXXXRRWYATNHILPDGRQIIIGGRRQFNYEFYPKSASSSNVYSL  198

Query  715   PFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPR  894
             PFL QT D  +  ENNLYPFV LNVDGNLFIFANNRAIL +YV N++V+TYP+IPGG+PR
Sbjct  199   PFLVQTNDAKI--ENNLYPFVFLNVDGNLFIFANNRAILFNYVKNIIVKTYPKIPGGDPR  256

Query  895   NYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPN  1074
             +YPS+GSAVLLPLKNL+     AEVL+CGG+PK +Y  A +  FV AL TCGRI ITDPN
Sbjct  257   SYPSTGSAVLLPLKNLQAQLVEAEVLICGGAPKGSYEKAVKGTFVEALKTCGRIKITDPN  316

Query  1075  PEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSR  1254
             P+W+ E MP  RVMGDM +LP G VLIINGA  G AGW+ GRNP  +P LY+P+   GSR
Sbjct  317   PQWVVETMPQARVMGDMTLLPDGTVLIINGAALGTAGWEFGRNPVLNPALYQPNNAVGSR  376

Query  1255  FELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPK  1434
             F  QNP  IPRMYHS+A+L+ DGRVLV GSNPH  Y+F NV FPTEL +EAF+P YLD K
Sbjct  377   FVQQNPTTIPRMYHSTAILLRDGRVLVGGSNPHIYYEFKNVLFPTELRLEAFNPDYLDAK  436

Query  1435  YAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLV  1614
             YA LRP+IV+P SQ  ++Y + ++V+F V+G V  + V VTMV+P+F+THSFSMNQR+LV
Sbjct  437   YANLRPKIVAPKSQGTITYAQKLAVRFSVTGTVATNLVSVTMVAPSFTTHSFSMNQRVLV  496

Query  1615  LNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             L    V       Y   V  P SG+LAPSGYYLL+VVH+ IPS+GIWV I
Sbjct  497   LAAESVTNVALSTYQALVTTPGSGHLAPSGYYLLYVVHQSIPSEGIWVQI  546



>ref|XP_011069751.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=560

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/542 (62%), Positives = 403/542 (74%), Gaps = 23/542 (4%)
 Frame = +1

Query  175   AVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglgg  354
             A  GGGKWNLL   IG+SAMHMQLL+ D+VV FDRT+ GPSNISLP+  C          
Sbjct  31    AAPGGGKWNLLLSDIGVSAMHMQLLNTDRVVIFDRTDFGPSNISLPNNHC----------  80

Query  355   RKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTR  519
             R  P+D     +CTAHSVEYDVASNS RP+ VL+D WCSSGSV P G+L+QTGG+ +G R
Sbjct  81    RNDPNDLMLKVDCTAHSVEYDVASNSIRPLNVLTDVWCSSGSVMPDGSLMQTGGFNDGDR  140

Query  520   VVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPAD  699
              VR + PC D  CDW+E    L + RWY+T+HILPDGRQIIVGGR  F+YEF+PK   AD
Sbjct  141   NVRVYKPCGDNSCDWQEFDAVLRQRRWYATNHILPDGRQIIVGGRGQFSYEFYPKKAGAD  200

Query  700   TFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIP  879
               Y+LPFL+QT DP +  ENNLYPFV LNVDGNLFIFANNRAIL DY N VVVR YP IP
Sbjct  201   QSYNLPFLSQTNDPRI--ENNLYPFVFLNVDGNLFIFANNRAILFDYTNGVVVRNYPTIP  258

Query  880   GGEPRNYPSSGSAVLLPLKNLK-GPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRI  1056
             GG+PR+YPSSGSAVLLPL++L+ G    AEVLVCGG+PK ++ +A    FVGALN+CGRI
Sbjct  259   GGDPRSYPSSGSAVLLPLRDLQAGSNVTAEVLVCGGAPKGSFTSANNGKFVGALNSCGRI  318

Query  1057  VITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPD  1236
              ITDPNP+W+ E MP  RVMGDMV+LP GNVLIINGA+ G AGWDLGR+P   P++YRP+
Sbjct  319   RITDPNPQWVMETMPLARVMGDMVLLPNGNVLIINGASTGTAGWDLGRDPVLTPLIYRPN  378

Query  1237  APPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSP  1416
              P G RFE QN   IPRMYHS+A+L+ DGR+LV+GSNPHA Y FT V FPT+L+ME FSP
Sbjct  379   NPVGLRFEAQNSTSIPRMYHSTAILLRDGRILVSGSNPHAYYNFTGVLFPTDLTMETFSP  438

Query  1417  SYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSM  1596
              YLDP+   +RP IVSPAS S + YG+ + + F   G+++   + VTMV+P F+THSFSM
Sbjct  439   DYLDPRLVRVRPRIVSPASHSQIEYGQQLVINFTAQGRINRGFITVTMVAPPFTTHSFSM  498

Query  1597  NQRLLVLN-----TVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVH  1761
             NQRLLVL      +  V   G   Y + V+ P S  LAP GYYLLFVV+RE+PS+GIW+ 
Sbjct  499   NQRLLVLTNRTGISASVTPLGRSNYQVRVMTPGSNILAPPGYYLLFVVYREVPSQGIWIQ  558

Query  1762  IQ  1767
             I+
Sbjct  559   IK  560



>ref|XP_006342232.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=553

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/529 (62%), Positives = 399/529 (75%), Gaps = 11/529 (2%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GGKW+LL P+IGISAMHMQLL+ND+V+ +DRT+ G SNI LPDGKC +           
Sbjct  33    AGGKWDLLMPNIGISAMHMQLLNNDRVIMYDRTDFGASNIPLPDGKCRNNPKELALKV--  90

Query  364   PDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPC  543
                +CTAHSVEYDV++NS RP++V +D WCSSGS +  G+LVQTGG+ +G  +VR F+PC
Sbjct  91    ---DCTAHSVEYDVSTNSIRPLMVQTDVWCSSGSATSDGSLVQTGGFNDGKLMVRTFNPC  147

Query  544   NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFL  723
             N   CDW+E+  GLV+ RWYST+HILPDG QII+GGR AFNYEFFPK+   +  +SLPFL
Sbjct  148   N--TCDWQEMGDGLVQSRWYSTNHILPDGSQIIIGGRDAFNYEFFPKTASTNNVFSLPFL  205

Query  724   AQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYP  903
              QT  P    ENNLYPFV LNVDGNLFIF N+RAILLDY  N +V+TYP+IPGG+PRNYP
Sbjct  206   QQTNVPR--EENNLYPFVFLNVDGNLFIFTNDRAILLDYTTNTIVKTYPQIPGGDPRNYP  263

Query  904   SSGSAVLLPLKNLKGPTTM--AEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNP  1077
             S+GSAVLLPLKNL+  T    AEVLVCGG+PK +Y  A +  FVGALNTCGRI ITDPNP
Sbjct  264   STGSAVLLPLKNLRSQTVFVQAEVLVCGGAPKGSYLRATKGDFVGALNTCGRITITDPNP  323

Query  1078  EWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRF  1257
             +W  E MP PR MGDMVILP GNVLI+NGA  G AGW + RNP   PV+YRPD P  SRF
Sbjct  324   QWTMETMPLPRTMGDMVILPNGNVLIVNGAATGTAGWQIARNPVLSPVIYRPDNPSDSRF  383

Query  1258  ELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKY  1437
             E+Q PN IPRMYHS+AVL+ DGRVLV GSNP+  Y FT V FPTELS+EAFSPSYLD ++
Sbjct  384   EVQTPNAIPRMYHSTAVLLRDGRVLVGGSNPNELYNFTGVVFPTELSLEAFSPSYLDAEF  443

Query  1438  AALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVL  1617
             A LRP+I+SP S    +YG+ V ++F   G ++   +KVT+V+P F+THS +MNQR+LVL
Sbjct  444   ANLRPQIISPDSHLKFTYGQRVDIRFTALGLLNRDSIKVTIVAPGFNTHSNTMNQRMLVL  503

Query  1618  NTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
                 V+  G   Y +  V P+SG LAP GYYLLFVVH++IPS+ IWV +
Sbjct  504   PRGIVRQVGRFVYEVSCVFPNSGKLAPPGYYLLFVVHQDIPSEAIWVRV  552



>ref|XP_010536366.1| PREDICTED: galactose oxidase-like [Tarenaya hassleriana]
Length=551

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/538 (63%), Positives = 402/538 (75%), Gaps = 20/538 (4%)
 Frame = +1

Query  172   AAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglg  351
             A+  GGG+W LLQ SIGISAMHMQLL ND+VV FDRT+ GPSNISLP GKC         
Sbjct  26    ASAAGGGRWQLLQSSIGISAMHMQLLRNDRVVIFDRTDFGPSNISLPAGKCIDS------  79

Query  352   gRKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGT  516
                 PDD     +CTAHSVEYDV SN FR + V SD WCSSGSV P GTLVQTGG  +G 
Sbjct  80    ----PDDPVSKVDCTAHSVEYDVTSNRFRTLTVQSDTWCSSGSVIPNGTLVQTGGDKDGE  135

Query  517   RVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPA  696
             R VR FSPC    CDW EI  GL   RWY+T+HILPDGRQII+GGRR +N+E++PK+  A
Sbjct  136   RRVRLFSPCGSNGCDWSEIDDGLAVRRWYATNHILPDGRQIIIGGRRQWNFEYYPKTAEA  195

Query  697   DTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEI  876
                YSLPFL QT D   G+ENNLYP V LNVDGNLF+FANNRAILLDY  N+V+RTYP +
Sbjct  196   PNVYSLPFLVQTND--RGSENNLYPNVFLNVDGNLFVFANNRAILLDYSKNIVIRTYPTV  253

Query  877   PGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNA-KRNIFVGALNTCGR  1053
             PGG+PR+YPS+GSAVLLPLKNL+     AEVLVCGG+P+ A+  A K   FV AL+TC R
Sbjct  254   PGGDPRSYPSTGSAVLLPLKNLEASNVEAEVLVCGGAPRGAFEQALKERTFVKALDTCAR  313

Query  1054  IVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRP  1233
             I ITD NP+W+ E MP  RVMGDM++LP GNVL+ING ++G AGW+LGR P   P LYRP
Sbjct  314   IKITDQNPKWVMETMPQARVMGDMILLPNGNVLLINGGSSGTAGWELGREPVLSPDLYRP  373

Query  1234  DAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFS  1413
             D P GSRFE QNPN IPRMYHS+A+L+ DGRVLV GSNPH  Y FTNV F TELS+EAFS
Sbjct  374   DNPFGSRFETQNPNSIPRMYHSTAILLRDGRVLVGGSNPHTYYNFTNVLFRTELSLEAFS  433

Query  1414  PSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFS  1593
             PSYLD + + LRP+I+SP SQS + Y   + + F +S  V  + VKVTMV P+F+THSFS
Sbjct  434   PSYLDSESSNLRPKIISPKSQSRIKYNTQLKLVFTISEAV-TNPVKVTMVYPSFNTHSFS  492

Query  1594  MNQRLLVLNTVKVKAAGEE-EYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             MNQRLL+L+ V    +GE   Y ++V  P S NLAPSGYY++FVV+++IPS GIWVH+
Sbjct  493   MNQRLLILDNVMFTRSGESATYEVEVKTPRSANLAPSGYYMMFVVNQDIPSDGIWVHL  550



>ref|XP_004289629.1| PREDICTED: galactose oxidase-like [Fragaria vesca subsp. vesca]
Length=547

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/531 (61%), Positives = 406/531 (76%), Gaps = 18/531 (3%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             GKW LL  ++GISAMHMQLLHND+VV FDRT+ G SN+SLP+G C          R  P+
Sbjct  30    GKWELLTKNVGISAMHMQLLHNDRVVMFDRTDFGASNLSLPNGVC----------RNNPN  79

Query  370   D-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
             D     +CTAHS EYDVASN+ RP+ V +D WCSSG+V+P G+LVQTGGY +G ++VR F
Sbjct  80    DTTLKVDCTAHSAEYDVASNTVRPLFVFTDTWCSSGAVNPNGSLVQTGGYNDGEKMVRVF  139

Query  535   SPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSL  714
             +PC  A CDWEEI   L   RWY+TDHILPDGRQII+GGR  F+YEF+PKS  + T  +L
Sbjct  140   TPC--ATCDWEEIGNVLANWRWYATDHILPDGRQIIIGGRGQFSYEFYPKSEGSMTSLNL  197

Query  715   PFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPR  894
             PFL +T+D G   ENNLYPFV LNVDGNLFIFANNRAIL DYV +  V+TYP IPGGEPR
Sbjct  198   PFLQETSD-GAAIENNLYPFVFLNVDGNLFIFANNRAILFDYVASKTVKTYPTIPGGEPR  256

Query  895   NYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPN  1074
             +YPS+GSAVLLPLK+  G    AEVLVCGG+P  AY  A +  ++ +L +C RI ITDPN
Sbjct  257   SYPSTGSAVLLPLKSTNGQAAEAEVLVCGGAPFGAYTKALKKTYMDSLKSCARIKITDPN  316

Query  1075  PEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSR  1254
             PEW+ E+MP  R+MGDM +LP G+VLIINGA  G AGW+LGR+P   PV+Y+PD   GSR
Sbjct  317   PEWVMEDMPLARIMGDMTLLPNGDVLIINGAAQGTAGWELGRHPVRTPVVYKPDNATGSR  376

Query  1255  FELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPK  1434
             FELQNP+ I RMYHS+AVL+ DGRVLV GSNPH  Y F+NV FPT+LS+EAFSP+YLD K
Sbjct  377   FELQNPSAISRMYHSTAVLLRDGRVLVGGSNPHERYVFSNVLFPTDLSLEAFSPNYLDSK  436

Query  1435  YAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLV  1614
             +A++RP  +SP+SQ+ + YGE ++V F ++G + +  V VTMVSP+F+THSFSMNQRL++
Sbjct  437   FASVRPTTLSPSSQAEVGYGEKLTVSFSITGTIALDTVSVTMVSPSFTTHSFSMNQRLVI  496

Query  1615  LNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             L +  V+A G   + ++V  P SGNLAPSGY+LL+VVH++IPS GIWV I+
Sbjct  497   LASETVRALGNLTFQVEVTTPASGNLAPSGYFLLYVVHQQIPSAGIWVKIR  547



>gb|KDP38596.1| hypothetical protein JCGZ_04521 [Jatropha curcas]
Length=550

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/532 (62%), Positives = 403/532 (76%), Gaps = 18/532 (3%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
             GGG+W LLQ SIGI+AMHMQLL+ND+VV FDRT+ G SN+SLP+G+C          R  
Sbjct  31    GGGRWQLLQKSIGITAMHMQLLNNDRVVIFDRTDFGISNLSLPEGQC----------RDD  80

Query  364   PDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
             P++     +CTAHS EYD  +N FRP+ VL++ WCSSG+V+P G L+QTGG+ +G R VR
Sbjct  81    PNELVIKTDCTAHSAEYDALTNKFRPLRVLTNVWCSSGAVTPDGRLIQTGGFNDGERQVR  140

Query  529   RFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFY  708
              FSPC+   CDW+E+  GL   RWY+T+HILP+G Q+I+GGRR F+YEF+PK+G AD  Y
Sbjct  141   VFSPCSSTNCDWQEVGNGLKARRWYATNHILPEGNQVIIGGRRQFSYEFYPKTGAAD-LY  199

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
             SLPFL QT D  +  ENNLYPFV LNVDGNLFIFANNRAIL DY    VV+TYPEIPGG+
Sbjct  200   SLPFLVQTDDRNI--ENNLYPFVFLNVDGNLFIFANNRAILFDYKLGKVVKTYPEIPGGD  257

Query  889   PRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITD  1068
             PR+YPS+GSAVLLPLK L+     AEVLVCGG+PK +Y  AK+  FV AL+TCGRI ITD
Sbjct  258   PRSYPSTGSAVLLPLKKLQATNIEAEVLVCGGAPKGSYVQAKKGNFVKALDTCGRIKITD  317

Query  1069  PNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPG  1248
             PNP+W  E MP  RVMGDM++LP GNVLIINGA+ G AGW+ GRNP  +PVLY PD   G
Sbjct  318   PNPKWTMENMPHSRVMGDMILLPNGNVLIINGASAGTAGWEFGRNPVLNPVLYNPDKAIG  377

Query  1249  SRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLD  1428
             SRFE  NP  IPRMYHS+A+L+ DGRVLV GSNPH  Y FT V FPTELS+EAF P YLD
Sbjct  378   SRFESLNPTTIPRMYHSTAILLRDGRVLVGGSNPHIYYNFTGVLFPTELSLEAFYPPYLD  437

Query  1429  PKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRL  1608
              +   LR  IVSPAS++ + Y + + V+FKV+G++D + V VTM++P+F+THSFSMNQRL
Sbjct  438   SQNNNLRLTIVSPASKAKIGYAQKLLVRFKVAGRLDTNTVSVTMIAPSFTTHSFSMNQRL  497

Query  1609  LVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             LVL   KV   G   Y ++V AP S N+AP GYYLL+VVH++IPS+GIWV I
Sbjct  498   LVLENEKVTNVGTATYNVEVTAPRSPNIAPPGYYLLYVVHQDIPSEGIWVQI  549



>ref|XP_011028961.1| PREDICTED: galactose oxidase-like [Populus euphratica]
Length=598

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/530 (63%), Positives = 403/530 (76%), Gaps = 10/530 (2%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
             GGG+W LLQ SIGI+AMHMQLL ND+VV +DRT+ G SN+SLPDGKC +     +     
Sbjct  77    GGGQWQLLQNSIGITAMHMQLLSNDRVVIYDRTDFGRSNLSLPDGKCRNDSSELVIKY--  134

Query  364   PDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPC  543
                +C+AHSVEYDV +N FRP++V SD WCSSG+V P G+L+QTGG+ +G R VR FSPC
Sbjct  135   ---DCSAHSVEYDVLANRFRPLMVQSDVWCSSGAVVPDGSLIQTGGFNDGERKVRIFSPC  191

Query  544   NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFL  723
             N A+CDWEE+  GL   RWY+T HILPDGRQII+GGRR FNYEF+PKS  A   YSL FL
Sbjct  192   NGADCDWEEVGDGLKAKRWYATSHILPDGRQIIIGGRRQFNYEFYPKSS-APNVYSLRFL  250

Query  724   AQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYP  903
              +T D G+  ENNLYP V LN DGNLFIFANNRAIL D+  N VV+TYP IPGG+PR+YP
Sbjct  251   METNDRGI--ENNLYPSVFLNGDGNLFIFANNRAILFDHKTNKVVKTYPAIPGGDPRSYP  308

Query  904   SSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEW  1083
             S+GSAVLLPLKNL+  T  AEVLVCGG+PK ++   ++  FV AL+TC RI I DPNP W
Sbjct  309   STGSAVLLPLKNLQASTIEAEVLVCGGAPKGSFARVEKGNFVQALDTCARIKINDPNPRW  368

Query  1084  ITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFEL  1263
             + E MP  RVMGDM +LP GNVLIINGA  G AGW+ GR+P  +PVLYRPD   GSRFEL
Sbjct  369   VMETMPTARVMGDMTLLPNGNVLIINGAGAGTAGWENGRDPVLNPVLYRPDDASGSRFEL  428

Query  1264  QNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAA  1443
             QNP+ IPRMYHS+A+L+ DGR LV GSNPH  Y+FT V FPTELS+EAFSP YLDPK+  
Sbjct  429   QNPSTIPRMYHSTAILLRDGRGLVGGSNPHIGYEFTGVLFPTELSLEAFSPPYLDPKFDD  488

Query  1444  LRPEIVSPASQSG--LSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVL  1617
             LRP+IVS ++  G  + YG+ + V+FKV+ K+ +  V VTMV+PAF+THSFSMN RLLVL
Sbjct  489   LRPKIVSSSASKGKNIGYGQKLLVRFKVTSKIVIDMVSVTMVAPAFNTHSFSMNHRLLVL  548

Query  1618  NTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
                KV   G   Y I V+ P  G+LAPSG+Y+L+VVH+EIPS+G+WV IQ
Sbjct  549   GNEKVTDVGASTYDIQVMTPPPGDLAPSGHYMLYVVHQEIPSEGLWVKIQ  598



>ref|XP_009603236.1| PREDICTED: galactose oxidase-like [Nicotiana tomentosiformis]
Length=564

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/537 (62%), Positives = 405/537 (75%), Gaps = 20/537 (4%)
 Frame = +1

Query  175   AVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglgg  354
             A   GGKW LL  +IGISAMH+QLL+ND+V+ +DRT+ G SNISLP+GKC          
Sbjct  42    AYAAGGKWQLLMSNIGISAMHIQLLNNDRVIMYDRTDFGASNISLPNGKC----------  91

Query  355   RKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTR  519
             R  P+D     +CTAHSVEYDV++NS RP++V +D WCSSGSV+  G+LVQTGG+ +G R
Sbjct  92    RNNPNDLALKVDCTAHSVEYDVSTNSVRPLMVQTDVWCSSGSVNSDGSLVQTGGFNDGER  151

Query  520   VVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPAD  699
             +VR   PC  + CDW+E+   L++ RWYST+HILPDGRQII+GGR+AFNYEF+PK+   +
Sbjct  152   MVRVVKPC--STCDWQEMGSNLIQSRWYSTNHILPDGRQIIIGGRKAFNYEFYPKTASTN  209

Query  700   TFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIP  879
               ++LPFL QT +P    ENNL+PFV LNVDGNLFIFAN+RAIL DY  N VV+TYP+IP
Sbjct  210   NVFNLPFLQQTNNPR--EENNLFPFVFLNVDGNLFIFANDRAILFDYKTNKVVKTYPQIP  267

Query  880   GGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIV  1059
             GG+PRNYPSSGSAVLLPLKNL+  T  AEVLVCGG+P+ +Y  A +  F+GALNTCGRI 
Sbjct  268   GGDPRNYPSSGSAVLLPLKNLRSQTVQAEVLVCGGAPRGSYPKADKGEFLGALNTCGRIT  327

Query  1060  ITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDA  1239
             ITDPNP+W  E MP  R MGDMVILP GNVLIINGA +G AGW + RNP   PV+YRPD 
Sbjct  328   ITDPNPQWTIETMPLARTMGDMVILPNGNVLIINGAASGTAGWQIARNPVLSPVIYRPDN  387

Query  1240  PPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPS  1419
             P  SRFE+QNPN IPRMYHS+AVL+ DGRVLV GSNP+  Y FT V FPT+LS+EAFSPS
Sbjct  388   PSDSRFEVQNPNVIPRMYHSTAVLLRDGRVLVGGSNPNELYNFTGVLFPTDLSLEAFSPS  447

Query  1420  YLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMN  1599
             YLDP+ A LRP I+SPAS    +YG+ V ++F  S  ++   VKVTMV+P F+THSF+MN
Sbjct  448   YLDPESANLRPRIISPASHLKFTYGQRVDIRFTASRLLNRDLVKVTMVAPGFNTHSFTMN  507

Query  1600  QRLLVL-NTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             QR+LVL  +  V+  G   Y I  V P S   AP GYYLLFVVH++IPS+ IWV IQ
Sbjct  508   QRMLVLPRSGIVRQVGRFVYQISCVFPKSAIFAPPGYYLLFVVHQDIPSEAIWVRIQ  564



>ref|XP_011069750.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=562

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/542 (61%), Positives = 406/542 (75%), Gaps = 23/542 (4%)
 Frame = +1

Query  175   AVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglgg  354
             A  GGGKWNLL  +IG+SAMHMQLL+ D+V+ FDRT+ GPSNISLP+ +C          
Sbjct  33    AAPGGGKWNLLLSNIGVSAMHMQLLNTDRVIIFDRTDFGPSNISLPNNQC----------  82

Query  355   RKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTR  519
             R  P+D     +CTAHSVEYDVASNS RP+ VL+D WCSSGS  P G+L+QTGG+ +G R
Sbjct  83    RNDPNDLTLKVDCTAHSVEYDVASNSIRPLNVLTDVWCSSGSAMPDGSLMQTGGFNDGDR  142

Query  520   VVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPAD  699
              VR + PC+D  CDW+E    L + RWY+T+HILPDGRQIIVGGR  F+YEF+PK   AD
Sbjct  143   NVRVYKPCSDDSCDWQEFDVALRQRRWYATNHILPDGRQIIVGGRGQFSYEFYPKKAGAD  202

Query  700   TFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIP  879
               Y+LPFL+QT DP +  ENNLYPFV LN DGNLFIFANNRAIL DYVN +VVR YP IP
Sbjct  203   QSYNLPFLSQTNDPRI--ENNLYPFVFLNTDGNLFIFANNRAILFDYVNGLVVRNYPTIP  260

Query  880   GGEPRNYPSSGSAVLLPLKNLKG-PTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRI  1056
             GG+PR+YPSSGSAVLLPL++L+G     AEVLVCGG+PK ++ +A    FVGALNTCGRI
Sbjct  261   GGDPRSYPSSGSAVLLPLRDLQGGANVTAEVLVCGGAPKGSFTSANNGNFVGALNTCGRI  320

Query  1057  VITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPD  1236
              I+DPNP+W  E MP  RVMGDMV+LP GN+LIINGA++G AGWD GRNP   PV+YRP+
Sbjct  321   RISDPNPQWAMETMPLARVMGDMVLLPNGNILIINGASSGTAGWDFGRNPVLTPVIYRPN  380

Query  1237  APPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSP  1416
              P G RFE QN + IPRMYHS+A+L+ DGR+LV+GSNPHA Y FT V FPT+L++EAFSP
Sbjct  381   NPVGLRFEAQNSSSIPRMYHSTAILLRDGRILVSGSNPHAYYNFTGVVFPTDLTIEAFSP  440

Query  1417  SYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSM  1596
              YLD +   +RP IVSPAS S + YG+ + + FK  G+++   + VTMV+P F+THSFSM
Sbjct  441   DYLDSRLIRVRPMIVSPASHSQIGYGQQLVINFKAQGRINRGFITVTMVAPPFTTHSFSM  500

Query  1597  NQRLLVLN-----TVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVH  1761
             NQRLLVL      +  V + G   Y + V  P S  LAP GYYLLFVV+RE+PS+GIWV 
Sbjct  501   NQRLLVLTNSTGISASVTSLGGSNYQVRVRTPSSNILAPPGYYLLFVVYREVPSQGIWVQ  560

Query  1762  IQ  1767
             I+
Sbjct  561   IK  562



>ref|XP_011092656.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=562

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/542 (62%), Positives = 407/542 (75%), Gaps = 23/542 (4%)
 Frame = +1

Query  175   AVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglgg  354
             A  GGGKWNL+  +IG+SAMHMQLL+ D+VV FDRT+ GPSNISLP+ +C          
Sbjct  33    AAPGGGKWNLVLSNIGVSAMHMQLLNTDRVVIFDRTDFGPSNISLPNNQC----------  82

Query  355   RKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTR  519
             R  P+D     +CTAHSVEYDVASNS RP+ VL+D WCSSGS  P G+L+QTGG+ +G R
Sbjct  83    RNDPNDLTLKVDCTAHSVEYDVASNSIRPLNVLTDVWCSSGSAMPDGSLMQTGGFNDGDR  142

Query  520   VVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPAD  699
              VR + PC+D  CDW+E    L + RWY+T+HILPDGRQIIVGGR  F YEF+PK   AD
Sbjct  143   NVRVYKPCSDDSCDWQEFDVALRQRRWYATNHILPDGRQIIVGGRGQFGYEFYPKKTGAD  202

Query  700   TFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIP  879
               Y+LPFL+QT DP +  ENNLYPFV LN DGNLFIFANNRAIL DYVN +VVR YP IP
Sbjct  203   QSYNLPFLSQTNDPRI--ENNLYPFVFLNTDGNLFIFANNRAILFDYVNGLVVRNYPTIP  260

Query  880   GGEPRNYPSSGSAVLLPLKNLKG-PTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRI  1056
             GG+PR+YPSSGSAVLLPL++L+G     AEVLVCGG+PK ++ +A    FVGALNTC RI
Sbjct  261   GGDPRSYPSSGSAVLLPLRDLQGGANVTAEVLVCGGAPKGSFTSANNGNFVGALNTCWRI  320

Query  1057  VITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPD  1236
              I+DPNP+W+ E MP  RVMGDMV+LP GN+LIINGA++G AGWDLGRNP   PV+YRP+
Sbjct  321   RISDPNPQWVMETMPLARVMGDMVLLPNGNILIINGASSGTAGWDLGRNPVLTPVIYRPN  380

Query  1237  APPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSP  1416
              P G RFE QN + IPRMYHS+A+L+ DGR+LV+GSNPHA Y FT V FPT+L+MEAFSP
Sbjct  381   NPVGLRFEAQNSSTIPRMYHSTAILLRDGRILVSGSNPHAYYNFTGVVFPTDLTMEAFSP  440

Query  1417  SYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSM  1596
              YLDP    +RP IVSPAS S + YG+ + + FK  G+++   + VTMV+P F+THSFSM
Sbjct  441   DYLDPHLIRVRPMIVSPASHSQIGYGQQLVINFKAQGRINRGFITVTMVAPPFTTHSFSM  500

Query  1597  NQRLLVLN-----TVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVH  1761
             NQRLLVL      +  V + G   Y + V+ P S  LAP GYYLLFVV+RE+PS+GIWV 
Sbjct  501   NQRLLVLTNSTGISASVISLGGSNYQVRVMTPGSNILAPPGYYLLFVVYREVPSQGIWVQ  560

Query  1762  IQ  1767
             I+
Sbjct  561   IK  562



>ref|XP_010271448.1| PREDICTED: galactose oxidase-like [Nelumbo nucifera]
Length=549

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/532 (62%), Positives = 400/532 (75%), Gaps = 19/532 (4%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
             G G W LLQ SIGISAMHMQLL+ND+VV FDRT+ G S ++LP GKC          R  
Sbjct  31    GRGSWELLQKSIGISAMHMQLLYNDRVVIFDRTDFGKSELALPQGKC----------RTD  80

Query  364   PDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
             P D     +CTAHS EYDV++NSFRP++V +D WCSSG V+P G L+QTGG+ +G R VR
Sbjct  81    PSDTVLTVDCTAHSAEYDVSTNSFRPLMVQTDVWCSSGVVAPDGRLIQTGGFNDGERSVR  140

Query  529   RFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFY  708
              F+PCN   CDWEE   GL+  RWY+T+HILPDGR I++GGRR FNYEF+PKS   +  +
Sbjct  141   MFTPCNG--CDWEENRSGLLARRWYATNHILPDGRSIVIGGRREFNYEFYPKSPSTNKLF  198

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
             SLPFL +T DPG+  ENNLYPFV LNVDGNLFIF+NNRAILLDY  N VV+T+P+IPGG+
Sbjct  199   SLPFLWETNDPGI--ENNLYPFVHLNVDGNLFIFSNNRAILLDYNRNKVVKTFPQIPGGD  256

Query  889   PRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITD  1068
             PR YPS+GS+VLLPLK+ + P   AEVLVCGG+ K +Y  AKR  FV ALNTCGRI ITD
Sbjct  257   PRCYPSTGSSVLLPLKHTQRPYIEAEVLVCGGALKGSYAQAKRGNFVKALNTCGRIKITD  316

Query  1069  PNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPG  1248
             P P W  E MP PRVMGDM ILP G++LIINGA +G  GW++GR+P + PVLY+PD P G
Sbjct  317   PKPAWFMETMPLPRVMGDMTILPNGHILIINGAASGTGGWEMGRDPVYSPVLYKPDYPSG  376

Query  1249  SRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLD  1428
             SRFE+QNP KIPRMYHS+A+L+ DGRVLV G+NPH  Y FT V +PT+LS+EAFSP YLD
Sbjct  377   SRFEVQNPTKIPRMYHSTAILLRDGRVLVGGNNPHVFYNFTGVLYPTDLSLEAFSPGYLD  436

Query  1429  PKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRL  1608
             P    +RP I+ P SQ  L YG+ + V+  V G  D S+V +TMV+P+F+THSFSMNQRL
Sbjct  437   PGLLNVRPRIIYPLSQVKLKYGQRLRVRISVPGAFDSSRVSITMVAPSFTTHSFSMNQRL  496

Query  1609  LVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             LVL+  +V       Y ++ + P SG L+PSGYYLLFVVH+E+PSKGIW+ I
Sbjct  497   LVLDAARVTPVSGPVYDVETLMPKSGLLSPSGYYLLFVVHQEVPSKGIWIQI  548



>ref|XP_008387971.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=533

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/527 (62%), Positives = 390/527 (74%), Gaps = 17/527 (3%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GGKW LLQ S+GISAMHMQLLHND+VV FDRT+ GPSN+SLP+G C             
Sbjct  23    AGGKWQLLQQSVGISAMHMQLLHNDRVVMFDRTDFGPSNLSLPNGAC-------------  69

Query  364   PDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPC  543
              +++CTAHS EYDV +N+ RP+ VLSD WCSSG+V+P G L+QTGG G G R VR F PC
Sbjct  70    VNNDCTAHSAEYDVKTNTVRPLTVLSDVWCSSGAVAPDGRLIQTGGNGAGERRVRIFEPC  129

Query  544   NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFL  723
                 CDW+EI   L   RWY+TDHILP+GRQII+GGR  FNYEF+PK+  +   YSLPFL
Sbjct  130   TG--CDWKEIENALNARRWYATDHILPNGRQIIIGGRGQFNYEFYPKTKSSSNLYSLPFL  187

Query  724   AQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYP  903
              QT   G G ENNLYPFV LNVDGNLFIFANNRAIL +Y    VV+TYP+I GG+PR YP
Sbjct  188   TQTN--GAGEENNLYPFVFLNVDGNLFIFANNRAILFNYAKKQVVQTYPQISGGDPRCYP  245

Query  904   SSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEW  1083
             SSGSAVLLPLKNLK P+  AEVLVCGG+PK ++    +  FV AL TC RI I +PNP+W
Sbjct  246   SSGSAVLLPLKNLKAPSVEAEVLVCGGAPKGSFAKVNQGTFVEALKTCARIEINNPNPQW  305

Query  1084  ITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFEL  1263
             + E MP  +VMGDM++LP G VL+INGA++G AGW+ GRNP  +PV+YRPD   GSRFE 
Sbjct  306   VVETMPQAKVMGDMLLLPDGTVLLINGASSGTAGWENGRNPVLNPVVYRPDNSIGSRFEQ  365

Query  1264  QNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAA  1443
             QNP  IPRMYHS+A+L+ DGRVLV GSNPH  Y+FTNV FPTEL +EAFSP YLD KY  
Sbjct  366   QNPTTIPRMYHSTAILLRDGRVLVGGSNPHDKYEFTNVLFPTELRLEAFSPDYLDAKYNN  425

Query  1444  LRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNT  1623
             LRP+I +P SQ+ ++YG+ +S+QF V G +    V V+M +P+F+THSFSMNQRLLVL  
Sbjct  426   LRPKINAPKSQAKINYGKKLSIQFSVKGNLVTKSVSVSMAAPSFNTHSFSMNQRLLVLEA  485

Query  1624  VKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
               +   G   Y + V  P S NLAPSGYYLL+VVH+EIPS  IWV I
Sbjct  486   ENIIKGGTTTYEVQVTTPASRNLAPSGYYLLYVVHQEIPSAAIWVQI  532



>ref|XP_006342231.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=556

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/537 (61%), Positives = 404/537 (75%), Gaps = 13/537 (2%)
 Frame = +1

Query  163   AAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHgggg  342
             A AAA   GGKW+LL  +IGISAMHMQLL++D+VV +DRT+ G SNISLP+GKC +    
Sbjct  29    AYAAA---GGKWDLLMSNIGISAMHMQLLNDDRVVMYDRTDFGMSNISLPNGKCRNNNND  85

Query  343   glggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRV  522
                       +CTAHS+EYDV++NS RP+++ ++ WCSSGS +  G+LVQTGG  +G  V
Sbjct  86    LALKV-----DCTAHSIEYDVSTNSVRPLMIQTNVWCSSGSATSDGSLVQTGGSNDGKFV  140

Query  523   VRRFSPC---NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGP  693
             +R + PC     + CDW+E+  GL++ RWYST+HILPDGRQII+GGR AFNYEF PK   
Sbjct  141   IRVYKPCITGKRSNCDWQEMGNGLIQSRWYSTNHILPDGRQIIIGGRDAFNYEFHPKIPS  200

Query  694   ADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPE  873
              +  +SLPFL QT DP    ENNLYPFV LNVD NLFIF NNRAIL DY  N +V+TYP+
Sbjct  201   TNNVFSLPFLQQTNDPR--EENNLYPFVFLNVDANLFIFTNNRAILFDYTKNTIVKTYPQ  258

Query  874   IPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGR  1053
             IP G+PRNYPS+GSAVLLPLKNL+  T  AEVLVCGG+P+ +Y  A R  FVGALNTCGR
Sbjct  259   IPDGDPRNYPSTGSAVLLPLKNLEAQTIQAEVLVCGGAPRGSYLKATRGEFVGALNTCGR  318

Query  1054  IVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRP  1233
             I ITDPNP+W  E M  PR MGDMVILP GNVLI+NGA  G AGW + R+P   PV+YRP
Sbjct  319   ITITDPNPQWTIETMLLPRTMGDMVILPNGNVLIVNGAATGTAGWGIARSPVLSPVIYRP  378

Query  1234  DAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFS  1413
             D    SRFE+QNPN IPRMYHS+AVL+ DGRVLV GSNP+  Y FT V FPTELS+EAFS
Sbjct  379   DNLLDSRFEIQNPNAIPRMYHSTAVLLRDGRVLVGGSNPNELYNFTGVLFPTELSLEAFS  438

Query  1414  PSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFS  1593
             PSYLD + A LRP+I+SP S+   +YG+ V++QF +SG ++ + +KVTMV+P F+THS +
Sbjct  439   PSYLDSESANLRPQIISPVSRHKFNYGQRVNIQFSISGLLNKNSIKVTMVAPGFNTHSNT  498

Query  1594  MNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             MNQR+LVL+   VK  G+  Y +  + P SG+LAP GYYLLFVVH++IPS+GIWV I
Sbjct  499   MNQRMLVLSNGVVKQVGKSSYQMSCLFPKSGSLAPPGYYLLFVVHQDIPSEGIWVRI  555



>ref|XP_009797024.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=558

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/538 (62%), Positives = 411/538 (76%), Gaps = 12/538 (2%)
 Frame = +1

Query  163   AAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHgggg  342
             +A AAV  GG W LL   IGISAMHMQLL+ND+VV FDRT+ G SNI+LP+GKC +    
Sbjct  30    SANAAV--GGTWELLMSDIGISAMHMQLLNNDRVVMFDRTDFGASNIALPNGKCRNNSND  87

Query  343   glggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRV  522
                       +CTAHSVE+DV +NS RP++V ++ WCSSGS +  G+LVQTGG+ +G  V
Sbjct  88    LALIV-----DCTAHSVEFDVTTNSVRPLMVQTNVWCSSGSATSDGSLVQTGGFNDGINV  142

Query  523   VRRFSPC---NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGP  693
             VR F PC     + CDW+E+  GL++ RWY+T+H+LPDGRQII+GGR AFNYEF+PK+  
Sbjct  143   VRVFKPCITGKRSTCDWQEMGNGLIQSRWYATNHMLPDGRQIIIGGRAAFNYEFYPKTAS  202

Query  694   ADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPE  873
              +  +SLPFL QT DP    ENNLYPFV LNVDGNLFIFAN+RAIL DY +N VV+TYP+
Sbjct  203   TNNVFSLPFLEQTNDPM--EENNLYPFVFLNVDGNLFIFANDRAILFDYKSNTVVKTYPQ  260

Query  874   IPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGR  1053
             IPGG+PRNYPS+GSAVLLPLKNL+  T  AE LVCGG+P+ +Y  A    F+GALNTCGR
Sbjct  261   IPGGDPRNYPSTGSAVLLPLKNLQEQTIQAEFLVCGGTPRGSYLKATTGDFLGALNTCGR  320

Query  1054  IVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRP  1233
             I ITDP+P+W  E MP  R MGDM+ILP GNVLI+NGA  GAAGW+LGR+P   PV+YRP
Sbjct  321   ITITDPDPQWTMETMPLARTMGDMIILPNGNVLILNGAAAGAAGWELGRDPVLCPVIYRP  380

Query  1234  DAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFS  1413
             D P  SRFE+QNPN IPRMYHS+AVL+ DGRVLV GSNP+  Y FT V FPTELS+EAFS
Sbjct  381   DNPLDSRFEVQNPNTIPRMYHSTAVLLRDGRVLVGGSNPNEFYNFTGVLFPTELSLEAFS  440

Query  1414  PSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFS  1593
             PSYLDPK A LRP+I+SP S+    YG+ V++QF VSG ++   +KVTMV+P F+THSF+
Sbjct  441   PSYLDPKSANLRPQIISPTSRHKFKYGQRVNIQFTVSGLLNRDLIKVTMVAPGFNTHSFT  500

Query  1594  MNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             MNQR+LVL++  V+  G+  Y + +V P SG LAP GYY+LFVVH++IPS+GIWV I 
Sbjct  501   MNQRMLVLSSGDVRLIGKFVYQVSLVFPKSGKLAPPGYYMLFVVHQDIPSEGIWVRIH  558



>ref|XP_006473606.1| PREDICTED: galactose oxidase-like [Citrus sinensis]
Length=535

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/528 (65%), Positives = 403/528 (76%), Gaps = 17/528 (3%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GG W LLQ SIGIS+MHMQLL+ND+VV FDR++ GPSN+SLP GKC             
Sbjct  25    AGGGWQLLQKSIGISSMHMQLLNNDRVVMFDRSDFGPSNLSLPPGKCLKT----------  74

Query  364   PDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPC  543
                +CTAHSVEY+V +N FRP+ V S+ WCSSG+V P G L+QTGG+ +G + +R F PC
Sbjct  75    ---DCTAHSVEYNVLTNEFRPLFVQSNVWCSSGAVRPDGVLIQTGGFNDGEKKIRSFVPC  131

Query  544   NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFL  723
             ND  CDW+EI  GL   RWY+TDHILPDGR II+GGRR FNYEF+PK+G A   YSLPFL
Sbjct  132   NDESCDWKEID-GLGARRWYATDHILPDGRIIIIGGRRQFNYEFYPKNG-APNVYSLPFL  189

Query  724   AQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYP  903
              QT DP +  ENNLYPFV LNVDG LFIFANNRAIL DYVNN VV+ YP IPGG+PR+YP
Sbjct  190   VQTNDPRV--ENNLYPFVFLNVDGFLFIFANNRAILFDYVNNKVVKQYPAIPGGDPRSYP  247

Query  904   SSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEW  1083
             SSGSAVLLPLKNL  P+  AEVLVCGG+PK AY  A++ +FV ALNTC RI ITDP P W
Sbjct  248   SSGSAVLLPLKNLLAPSVAAEVLVCGGAPKGAYEQAEKGVFVAALNTCARIKITDPTPTW  307

Query  1084  ITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFEL  1263
             + E MP PRVMGDM +LP GNVL+INGA  G AGW+LGR+P   PV+YRPD  PGSRF+L
Sbjct  308   VLETMPQPRVMGDMTLLPNGNVLLINGAGKGTAGWELGRDPVLAPVVYRPDNIPGSRFDL  367

Query  1264  QNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAA  1443
             QNP+ IPRMYHS+AVL+ DGRVLV GSNPHA Y FT V FPTELS+EAFSP YLD  +A 
Sbjct  368   QNPSTIPRMYHSTAVLLRDGRVLVGGSNPHAYYNFTGVLFPTELSLEAFSPYYLDAPFAN  427

Query  1444  LRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNT  1623
             LRP IV P SQ  L Y +   V+F  SG V +++V VTMV+P+F+THSFSMNQRLLVL +
Sbjct  428   LRPTIVLPESQFTLKYKQKFRVRFSASGPVALNKVTVTMVAPSFNTHSFSMNQRLLVLAS  487

Query  1624  VKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
               V   G   Y I V +P SGNLAPSGYYLLFVVH+++PS+GIWVH+Q
Sbjct  488   DTVTKLGNSGYEIVVNSPGSGNLAPSGYYLLFVVHQDVPSEGIWVHVQ  535



>ref|XP_002280559.1| PREDICTED: galactose oxidase [Vitis vinifera]
Length=553

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/533 (61%), Positives = 400/533 (75%), Gaps = 20/533 (4%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GG+W LL  +IGI+AMHMQLLHND+VV FDRT+ G SN+SLPDGKC          R  
Sbjct  36    AGGEWQLLLKNIGITAMHMQLLHNDRVVIFDRTDFGKSNLSLPDGKC----------RND  85

Query  364   PDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
             P+D     +CTAHSVEYDVA+NS R ++V +D WCSSG+V   G L+QTGG+ +G RVVR
Sbjct  86    PNDTVLPIDCTAHSVEYDVATNSIRALMVQTDVWCSSGAVMANGNLIQTGGFNDGDRVVR  145

Query  529   RFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFY  708
              F PC  + CDWEE+P+GL   RWY+T+HILPD RQI++GGRR FNYEF+PK+G A   Y
Sbjct  146   IFKPC--SSCDWEEVPFGLAARRWYATNHILPDDRQIVIGGRRQFNYEFYPKTGAASNAY  203

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
             SLPFLAQT D G+  ENNLYPFV L+ DGNLFIF+NNRAIL DY  NVVV+T+P IPGG+
Sbjct  204   SLPFLAQTNDRGI--ENNLYPFVYLHTDGNLFIFSNNRAILFDYAKNVVVKTFPTIPGGD  261

Query  889   PRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITD  1068
             PR YPS+GSAV+LPL NL+  +   EVLVCGG+P  +Y  A +  FVGAL TC RI ITD
Sbjct  262   PRCYPSTGSAVMLPL-NLQASSIEVEVLVCGGAPTGSYTQASKGNFVGALKTCARIKITD  320

Query  1069  PNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPG  1248
              +P+W+ E MP  RVMGDM +LP G+VLIINGA+ G AGW+ GR+P   PVLY+PD P G
Sbjct  321   SSPQWVMETMPLARVMGDMTLLPNGDVLIINGASAGTAGWENGRDPVLKPVLYKPDKPTG  380

Query  1249  SRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLD  1428
             SRFE+ NP  IPRMYHS+A+L+ DGRVLV GSNPH  YKFT V +PTEL +EAFSP YLD
Sbjct  381   SRFEVMNPTTIPRMYHSTAILLRDGRVLVGGSNPHIYYKFTGVLYPTELRLEAFSPEYLD  440

Query  1429  PKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRL  1608
               +  LRP I+SP SQ+ + YG+ ++V+F V+G +D   V VTM++P+F+THS SMNQRL
Sbjct  441   SGFKNLRPTIISPTSQAKIGYGKDLTVRFSVTGTLDPDTVSVTMLAPSFTTHSLSMNQRL  500

Query  1609  LVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             LVL +  VK A +  + I V  P S  LAPSGYY+LFVVH+ IPS+GIWV IQ
Sbjct  501   LVLGSGNVKNAEKSTFAIAVTTPASAILAPSGYYVLFVVHQGIPSEGIWVQIQ  553



>gb|KDO84767.1| hypothetical protein CISIN_1g009420mg [Citrus sinensis]
Length=535

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/528 (65%), Positives = 402/528 (76%), Gaps = 17/528 (3%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GG W LLQ SIGIS+MHMQLL+ND+VV FDR++ GPSN+SLP GKC             
Sbjct  25    AGGGWQLLQKSIGISSMHMQLLNNDRVVMFDRSDFGPSNLSLPPGKCLKT----------  74

Query  364   PDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPC  543
                +CTAHSVEY V +N FRP+ V S+ WCSSG+V P G L+QTGG+ +G + +R F PC
Sbjct  75    ---DCTAHSVEYSVLTNEFRPLFVQSNVWCSSGAVRPDGVLIQTGGFNDGEKKIRSFVPC  131

Query  544   NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFL  723
             ND  CDW+EI  GL   RWY+TDHILPDGR II+GGRR FNYEF+PK+G A   YSLPFL
Sbjct  132   NDESCDWKEID-GLGARRWYATDHILPDGRIIIIGGRRQFNYEFYPKNG-APNVYSLPFL  189

Query  724   AQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYP  903
              QT DP +  ENNLYPFV LNVDG LFIFANNRAIL DYVNN VV+ YP IPGG+PR+YP
Sbjct  190   VQTNDPRV--ENNLYPFVFLNVDGFLFIFANNRAILFDYVNNKVVKQYPAIPGGDPRSYP  247

Query  904   SSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEW  1083
             SSGSAVLLPLKNL  P+  AEVLVCGG+PK AY  A++ +FV ALNTC RI ITDP P W
Sbjct  248   SSGSAVLLPLKNLLAPSVAAEVLVCGGAPKGAYEQAEKGVFVAALNTCARIKITDPTPTW  307

Query  1084  ITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFEL  1263
             + E MP PRVMGDM +LP GNVL+INGA  G AGW+LGR+P   PV+YRPD  PGSRF+L
Sbjct  308   VLETMPQPRVMGDMTLLPNGNVLLINGAGKGTAGWELGRDPVLAPVVYRPDNIPGSRFDL  367

Query  1264  QNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAA  1443
             QNP+ IPRMYHS+AVL+ DGRVLV GSNPHA Y FT V FPTELS+EAFSP YLD  +A 
Sbjct  368   QNPSTIPRMYHSTAVLLRDGRVLVGGSNPHAYYNFTGVLFPTELSLEAFSPYYLDAPFAN  427

Query  1444  LRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNT  1623
             LRP IV P SQ  L Y +   V+F  SG V +++V VTMV+P+F+THSFSMNQRLLVL +
Sbjct  428   LRPTIVLPESQFTLKYKQKFRVRFSASGPVALNKVTVTMVAPSFNTHSFSMNQRLLVLAS  487

Query  1624  VKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
               V   G   Y I V +P SGNLAPSGYYLLFVVH+++PS+GIWVH+Q
Sbjct  488   DTVTKLGNSGYEIVVNSPGSGNLAPSGYYLLFVVHQDVPSEGIWVHVQ  535



>gb|EYU36763.1| hypothetical protein MIMGU_mgv1a004035mg [Erythranthe guttata]
Length=548

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/546 (63%), Positives = 418/546 (77%), Gaps = 27/546 (5%)
 Frame = +1

Query  154   FFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHg  333
             F   A+AA   GGKW++L  +IG+SAMH+QLL+ND+VV FDRT+ G SNISLP GKC   
Sbjct  22    FLPRASAA---GGKWDVLLSNIGVSAMHIQLLNNDRVVIFDRTDFGSSNISLPAGKC---  75

Query  334   gggglggRKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTG  498
                    R  P+D     +CTAHSVEYDV SN+ RP+ V +D WCSSG+V+P G+LVQTG
Sbjct  76    -------RNDPNDTYSTVDCTAHSVEYDVVSNTVRPLTVQTDTWCSSGAVAPDGSLVQTG  128

Query  499   GYGEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFF  678
             GY +G   VR F PCND+ CDW+EI  GL++ RWY+T+HILPDG+QII+GGRR F +EF+
Sbjct  129   GYNDGDHAVRTFRPCNDSSCDWQEINPGLIKRRWYATNHILPDGKQIIIGGRRQFGFEFY  188

Query  679   PKSGPAD-TFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVV  855
             PK+ PAD   Y+L FL QT DP +  ENNLYPFV LN DGNLFIFANNRAIL +Y N VV
Sbjct  189   PKTSPADYKSYNLSFLVQTYDPLI--ENNLYPFVFLNTDGNLFIFANNRAILFNYSNRVV  246

Query  856   VRTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGA  1035
             V+TYP IPGG+PR+YPSSGSAVLLPLKN  G    AEVLVCGG+PKD+Y NA   IF+ A
Sbjct  247   VKTYPIIPGGDPRSYPSSGSAVLLPLKNNSG----AEVLVCGGAPKDSYVNATNGIFLPA  302

Query  1036  LNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFH  1215
             L+TCGRI I DPNP+W+ E MP PRVMGDMV+LP GNVLIINGA +G AGW+ GR+P   
Sbjct  303   LDTCGRIRINDPNPQWVVETMPGPRVMGDMVLLPNGNVLIINGARSGTAGWEYGRDPVLS  362

Query  1216  PVLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTEL  1395
             PV+YRPD    SRFE+QN +  PRMYHS+AVL+ DGRVLV G+NPHA Y FT V FPT+L
Sbjct  363   PVIYRPDKSIWSRFEVQNSSTTPRMYHSTAVLLRDGRVLVGGNNPHAYYNFTGVLFPTDL  422

Query  1396  SMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKV-SGKVDMSQVKVTMVSPA  1572
             ++EAFSPSYLD K+A+ RP IV+P S S + YG+ +++ F V SG++  S VKVTMV+P+
Sbjct  423   TLEAFSPSYLDSKFASSRPVIVTPVSPSVIGYGQELTIGFAVASGRIIGSLVKVTMVAPS  482

Query  1573  FSTHSFSMNQRLLVLNTVKVKAAGEE-EYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKG  1749
             F+THSFSMNQRLLVL+   V  + +   Y I V+ P SG LAPSGYYLLFVV++EIPS+G
Sbjct  483   FTTHSFSMNQRLLVLSGGNVTTSFDNTTYQIRVITPGSGILAPSGYYLLFVVYQEIPSEG  542

Query  1750  IWVHIQ  1767
             IWV I+
Sbjct  543   IWVQIK  548



>ref|XP_008377171.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=533

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/527 (61%), Positives = 389/527 (74%), Gaps = 17/527 (3%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GGKW LLQ  +GISAMHMQLL ND+V  FDRT+ G SN+ LP+G+C             
Sbjct  23    AGGKWQLLQQXVGISAMHMQLLRNDRVXMFDRTDFGKSNLXLPNGECVR-----------  71

Query  364   PDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPC  543
               ++CTAHS EYDV +N+ R + +LSD WCSSG+V+P G L+QTGG G G R VR F PC
Sbjct  72    --NDCTAHSAEYDVKTNTVRALTLLSDVWCSSGAVAPNGRLIQTGGNGAGDRRVRVFEPC  129

Query  544   NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFL  723
                 CDW+E    L   RWY+TDHILP+G+QII+GGR  FNYE +PK+G +   YSLPFL
Sbjct  130   TG--CDWKEFANALGARRWYATDHILPNGQQIIIGGRXQFNYEXYPKTGSSSKVYSLPFL  187

Query  724   AQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYP  903
              QT D G   ENNLYPFV LNVDGNLFIFANNRAIL DY  N VV+TYP+IPGG+PR  P
Sbjct  188   VQTBDAG--EENNLYPFVFLNVDGNLFIFANNRAILFDYAKNXVVKTYPQIPGGDPRCXP  245

Query  904   SSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEW  1083
             S+GSAVLLPLKNL  P+  AEVLVCGG+PK ++  A +  FV ALNTC RI I +P P+W
Sbjct  246   STGSAVLLPLKNLAAPSVEAEVLVCGGAPKGSFVKANQGTFVEALNTCARIKINNPKPQW  305

Query  1084  ITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFEL  1263
             + E MP  RVMGDM++LP G VL+INGA++GAAGW++GRNP  +PV+YRPD   GSRFE 
Sbjct  306   VMETMPQARVMGDMLLLPDGTVLLINGASSGAAGWEIGRNPVLNPVVYRPDNAIGSRFEQ  365

Query  1264  QNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAA  1443
             QNP  IPRMYHS+A+L+ DGRVLV GSNPH  Y+FT+V FPTEL +EAFSP YLD KY  
Sbjct  366   QNPTTIPRMYHSTAILLRDGRVLVGGSNPHXKYEFTBVLFPTELRLEAFSPDYLDAKYNN  425

Query  1444  LRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNT  1623
             LRP+IV+P SQ+ ++YG+ +S+QF V G +    V V+MV+P+F+ HSFSMNQRLLVL  
Sbjct  426   LRPQIVAPISQAKINYGKKLSIQFSVKGNLATXSVSVSMVAPSFNXHSFSMNQRLLVLXA  485

Query  1624  VKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
               VK  G   Y + V  P SGNLAPSGYYLL+VVH++IPS  IWV I
Sbjct  486   ENVKKVGTTAYQVQVTTPASGNLAPSGYYLLYVVHQKIPSAAIWVQI  532



>ref|XP_006435123.1| hypothetical protein CICLE_v10003275mg [Citrus clementina]
 gb|ESR48363.1| hypothetical protein CICLE_v10003275mg [Citrus clementina]
Length=521

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/528 (65%), Positives = 402/528 (76%), Gaps = 17/528 (3%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GG W LLQ SIGIS+MHMQLL+ND+VV FDR++ GPSN+SLP GKC             
Sbjct  11    AGGGWQLLQKSIGISSMHMQLLNNDRVVMFDRSDFGPSNLSLPPGKCLKT----------  60

Query  364   PDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPC  543
                +CTAHSVEY V +N FRP+ V S+ WCSSG+V P G L+QTGG+ +G + +R F PC
Sbjct  61    ---DCTAHSVEYSVLTNEFRPLFVQSNVWCSSGAVRPDGVLIQTGGFNDGEKKIRSFVPC  117

Query  544   NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFL  723
             ND  CDW+EI  GL   RWY+TDHILPDGR II+GGRR FNYEF+PK+G A   YSLPFL
Sbjct  118   NDESCDWKEID-GLGARRWYATDHILPDGRIIIIGGRRQFNYEFYPKNG-APNVYSLPFL  175

Query  724   AQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYP  903
              QT DP +  ENNLYPFV LNVDG LFIFANNRAIL DYVNN VV+ YP +PGG+PR+YP
Sbjct  176   VQTNDPRV--ENNLYPFVFLNVDGFLFIFANNRAILFDYVNNKVVKQYPAMPGGDPRSYP  233

Query  904   SSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEW  1083
             SSGSAVLLPLKNL  P+  AEVLVCGG+PK AY  A++ +F+ ALNTC RI ITDP P W
Sbjct  234   SSGSAVLLPLKNLLAPSVAAEVLVCGGAPKGAYEQAEKGVFIAALNTCARIKITDPTPTW  293

Query  1084  ITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFEL  1263
             + E MP PRVMGDM +LP GNVL+INGA  G AGW+LGR+P   PV+YRPD  PGSRF+L
Sbjct  294   VLETMPQPRVMGDMTLLPNGNVLLINGAGKGTAGWELGRDPVLAPVVYRPDNIPGSRFDL  353

Query  1264  QNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAA  1443
             QNP+ IPRMYHS+AVL+ DGRVLV GSNPHA Y FT V FPTELS+EAFSP YLD  +A 
Sbjct  354   QNPSTIPRMYHSTAVLLRDGRVLVGGSNPHAYYNFTGVLFPTELSLEAFSPYYLDAPFAN  413

Query  1444  LRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNT  1623
             LRP IV P SQ  L Y +   V+F  SG V +++V VTMV+P+F+THSFSMNQRLLVL +
Sbjct  414   LRPTIVLPESQFTLKYKQKFRVRFSASGPVALNKVTVTMVAPSFNTHSFSMNQRLLVLAS  473

Query  1624  VKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
               V   G   Y I V +P SGNLAPSGYYLLFVVH+++PS+GIWVH+Q
Sbjct  474   DTVTKLGNSGYEIVVNSPGSGNLAPSGYYLLFVVHQDVPSEGIWVHVQ  521



>ref|XP_007017717.1| Glyoxal oxidase-related protein [Theobroma cacao]
 gb|EOY14942.1| Glyoxal oxidase-related protein [Theobroma cacao]
Length=546

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/526 (62%), Positives = 398/526 (76%), Gaps = 10/526 (2%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G+W LLQ SIG+SAMHMQLL ND+VV FDRT+ G SN+SLP+GKC            P D
Sbjct  31    GRWQLLQKSIGVSAMHMQLLRNDRVVMFDRTDFGKSNLSLPNGKC---LTNSSNTALPAD  87

Query  370   DNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCND  549
               CTAHSVEY+V +N FR ++V +D WCSSG++ P G LVQTGG+  G R VR FSPC  
Sbjct  88    --CTAHSVEYNVLTNEFRALMVQTDVWCSSGAIMPDGNLVQTGGFNNGERRVRVFSPC--  143

Query  550   AECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFLAQ  729
             + CDW+EIP  L   RWY+++HILPDGRQIIVGGR  FNYEF PK+  A+TF +LPFL++
Sbjct  144   STCDWQEIPNRLAAKRWYASNHILPDGRQIIVGGRGQFNYEFIPKTFAANTF-NLPFLSE  202

Query  730   TTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYPSS  909
             T D G+  ENNLYPFV LNVDGNLFIFANNRAILLDYVNN VV+TYP IPGG PR+YPS+
Sbjct  203   TNDRGV--ENNLYPFVFLNVDGNLFIFANNRAILLDYVNNKVVKTYPTIPGGNPRSYPST  260

Query  910   GSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEWIT  1089
             GSAVLLPLKNLK     AEV VCGG+PK +Y  A +  F+GALNTC R+ ITDPNP+W+ 
Sbjct  261   GSAVLLPLKNLKASAIQAEVFVCGGAPKGSYVQALKGNFIGALNTCARMTITDPNPQWVM  320

Query  1090  EEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFELQN  1269
             E MP  RVM DM++LP G VLIINGA +G+AGW+LGR+P   PV+Y PD   GSRFE Q 
Sbjct  321   ETMPMARVMSDMILLPNGKVLIINGAGSGSAGWELGRDPVLSPVMYLPDNEIGSRFETQT  380

Query  1270  PNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAALR  1449
             P  IPRMYHS+ VL+ DGRVLV GSNPHA Y FT V FPTELS+EAFSP+Y+D ++  LR
Sbjct  381   PTTIPRMYHSAVVLLRDGRVLVGGSNPHAFYNFTGVLFPTELSLEAFSPAYMDSEFNDLR  440

Query  1450  PEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNTVK  1629
             P IV+P S  G+   + +SVQ +++GKVD + V VTMV+P+F+THSFSMNQR+L L    
Sbjct  441   PTIVAPKSMFGIQIRKKLSVQVQITGKVDPNLVSVTMVAPSFTTHSFSMNQRVLDLGNDN  500

Query  1630  VKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             V A+G   Y I+   P S NLAP+G+YLLFVVH++IPS+ IWV ++
Sbjct  501   VTASGNSTYNIEYTTPRSYNLAPAGFYLLFVVHQDIPSQAIWVKLR  546



>ref|XP_004238325.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=547

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/527 (61%), Positives = 396/527 (75%), Gaps = 9/527 (2%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GGKW+LL  +IGISAMHMQLL+ND+V+ +DRT+ G SNISLPDGKC +           
Sbjct  29    AGGKWDLLMSNIGISAMHMQLLNNDRVIMYDRTDFGASNISLPDGKCRNNPKELALKI--  86

Query  364   PDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPC  543
                +CTAHSVEYDV++NS RP++V ++ WCSSGS +  G+LVQTGG+ +G  +VR F+PC
Sbjct  87    ---DCTAHSVEYDVSTNSIRPLMVQTNVWCSSGSATSDGSLVQTGGFNDGKLMVRTFNPC  143

Query  544   NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFL  723
             N   CDW+E+  GL + RWYST+HILPDG QII+GGR AFNYEFFP++      ++LPFL
Sbjct  144   N--TCDWQEMGDGLGQSRWYSTNHILPDGSQIIIGGRDAFNYEFFPQTASTSNVFNLPFL  201

Query  724   AQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYP  903
              +T  P    ENNLYPFV LNVDGNLFIF N+RAILLDY  N +V+TYP+IPGG+PRNYP
Sbjct  202   RETNVPR--EENNLYPFVFLNVDGNLFIFTNDRAILLDYTTNTIVKTYPQIPGGDPRNYP  259

Query  904   SSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEW  1083
             S+GSAVLLPLKNL+     AEVLVCGG+PK +Y  A +  FVGALNTCGRI ITDPNP+W
Sbjct  260   STGSAVLLPLKNLRSQKVQAEVLVCGGAPKGSYLRATKGDFVGALNTCGRITITDPNPQW  319

Query  1084  ITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFEL  1263
               E MP PR MGDMVILP GNVLI+NGA  G AGW + RNP F PV+YR D P  SRFE+
Sbjct  320   TMETMPLPRTMGDMVILPNGNVLIVNGAATGTAGWQIARNPVFSPVIYRTDNPSDSRFEV  379

Query  1264  QNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAA  1443
             Q PN IPRMYHS+AVL+ DGRVLV GSNP+  Y FT V FPT+LS+EAFSPSYLD ++A 
Sbjct  380   QTPNAIPRMYHSTAVLLRDGRVLVGGSNPNELYNFTGVVFPTDLSLEAFSPSYLDVEFAN  439

Query  1444  LRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNT  1623
             LRP+I+SP S    +YG+ V ++F   G ++   +KVTMV+P F+THS +MNQR+LVL  
Sbjct  440   LRPQIISPDSHLKFTYGQRVDIRFTALGLLNRDLIKVTMVAPGFNTHSNTMNQRMLVLPR  499

Query  1624  VKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
               V+  G   Y +  V P SG+LAP GYYLLFVVH++IPS+ IWV +
Sbjct  500   GIVRQVGRFVYEVSCVFPKSGSLAPPGYYLLFVVHQDIPSEAIWVRV  546



>ref|XP_006342230.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=553

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/538 (62%), Positives = 408/538 (76%), Gaps = 21/538 (4%)
 Frame = +1

Query  175   AVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglgg  354
             A   GGKW+LL  +IGISAMHMQLL+ND+V+ +DRT+ G SNISLP+GKC          
Sbjct  30    AYAAGGKWDLLMSNIGISAMHMQLLNNDRVIMYDRTDFGASNISLPNGKC----------  79

Query  355   RKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTR  519
             R  P D     +CTAHSVEYDV++NS RP++V +D WCSSGS +  GTLVQTGG+ +G  
Sbjct  80    RNNPKDLALKVDCTAHSVEYDVSTNSIRPLMVQTDVWCSSGSATSDGTLVQTGGFNDGRN  139

Query  520   VVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPAD  699
             +VR F PC  + CDW+EI  GL++ RWYS + ILPDGRQII+GGR AFNYEF+PK+   +
Sbjct  140   MVRTFKPC--STCDWQEIGTGLIQGRWYSANQILPDGRQIIIGGRDAFNYEFYPKTASTN  197

Query  700   TFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIP  879
               +SLPF+ QT  P    ENNLYPFV LNVDGNLFIFANNRAILLDY  N +V+TYP+IP
Sbjct  198   KVFSLPFIQQTNVPK--EENNLYPFVFLNVDGNLFIFANNRAILLDYTTNTIVKTYPQIP  255

Query  880   GGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKR-NIFVGALNTCGRI  1056
             GG+PRNYPS+GSAVLLPLKNL+  T  AEVLVCGG+P  +Y  A R N FVGALNTCGRI
Sbjct  256   GGDPRNYPSTGSAVLLPLKNLQAQTIQAEVLVCGGAPIGSYLKAARANTFVGALNTCGRI  315

Query  1057  VITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPD  1236
              ITDPNP+W  E MP  R MGDMVILP GN+LI+NGA  G AGW + RNP   PV+YRPD
Sbjct  316   TITDPNPQWTMETMPLARTMGDMVILPNGNILIVNGAAAGTAGWGIARNPVLSPVIYRPD  375

Query  1237  APPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSP  1416
              P GSRFE+QNPN IPRMYHS+ VL+ DGRVLV GSNP+  Y FT V FPT+LS+EAFSP
Sbjct  376   NPFGSRFEVQNPNAIPRMYHSTTVLLRDGRVLVGGSNPNELYNFTRVLFPTDLSLEAFSP  435

Query  1417  SYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGK-VDMSQVKVTMVSPAFSTHSFS  1593
             SYLD     LRP+I+SPAS   + YG+ V+++F +SG  ++ + +KVTMV+P F+THS +
Sbjct  436   SYLDSNSTNLRPQIISPASHKTIKYGQRVNIRFTLSGSLLNTNLIKVTMVAPGFNTHSNT  495

Query  1594  MNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             MNQR+LVL++ K+K  G   Y I  + P+SG LAP GYY+LFVV+++IPS+GIW+ IQ
Sbjct  496   MNQRMLVLSSEKIKKTGIFTYQISSIFPNSGKLAPPGYYMLFVVNQDIPSEGIWIKIQ  553



>ref|XP_008338258.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=540

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/527 (61%), Positives = 390/527 (74%), Gaps = 17/527 (3%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GGKW LLQ ++GISAMHMQLL+ND+V+ FDRT+ G SN+SLP+G C             
Sbjct  30    AGGKWQLLQQNVGISAMHMQLLYNDRVIMFDRTDFGKSNLSLPNGTCVR-----------  78

Query  364   PDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPC  543
               ++CTAHS EYDV +N+ RP+ V SD WCSSGSV+P G L+QTGGY  G R VR F PC
Sbjct  79    --NDCTAHSAEYDVTTNTVRPLTVQSDIWCSSGSVAPNGNLIQTGGYDIGERRVRVFKPC  136

Query  544   NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFL  723
                 CDW+E    L   RWY+TDHILPDGRQII+GGR  FNYEF+PK+  +   YSLPFL
Sbjct  137   TG--CDWKEYENTLGVSRWYATDHILPDGRQIIIGGRXQFNYEFYPKTESSSNVYSLPFL  194

Query  724   AQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYP  903
              QT DP    ENNLYP+V LNVDGNLFIFANNRAILLDYV N VV+ YP+IPGG+PR+YP
Sbjct  195   VQTNDPN--EENNLYPYVFLNVDGNLFIFANNRAILLDYVMNKVVKXYPQIPGGDPRSYP  252

Query  904   SSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEW  1083
             S+GSAVLLPL+NL  P+  AEVLVCGG+PK +Y  A +  FV ALNTCGRI I DP P+W
Sbjct  253   STGSAVLLPLRNLTAPSIEAEVLVCGGAPKGSYXQAIKGTFVEALNTCGRIKINDPKPQW  312

Query  1084  ITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFEL  1263
             + E MP  RVM DM++LP G V+IINGA+ G AGW+LG+NP   P++YRPD   GSRFE 
Sbjct  313   VVETMPQARVMSDMLLLPDGTVVIINGASFGTAGWELGQNPVLEPLVYRPDNAVGSRFEK  372

Query  1264  QNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAA  1443
             QNP  IPRMYHS+AVL+ DGRVLV GSNPH  Y+  +  FPTEL +EAFS  YLD KY+ 
Sbjct  373   QNPAPIPRMYHSTAVLLRDGRVLVGGSNPHDKYELADELFPTELRLEAFSXDYLDAKYSK  432

Query  1444  LRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNT  1623
             LRP IV P SQ+ +SYG+ + ++F + G +  + V VT+V+P+F+THSFSMNQRLLVL  
Sbjct  433   LRPRIVDPKSQAKISYGKKLFIRFSLXGSIATNLVMVTIVAPSFNTHSFSMNQRLLVLAA  492

Query  1624  VKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
               VK  G   Y + V  P SGNLAPSGYYLL+VVH++IPS+GIWV I
Sbjct  493   ETVKKVGTMTYQVQVTTPGSGNLAPSGYYLLYVVHQQIPSEGIWVQI  539



>ref|XP_004147869.1| PREDICTED: galactose oxidase-like [Cucumis sativus]
 ref|XP_004170844.1| PREDICTED: galactose oxidase-like [Cucumis sativus]
Length=548

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/546 (60%), Positives = 404/546 (74%), Gaps = 18/546 (3%)
 Frame = +1

Query  139   FHNRGFFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDG  318
             F N   F++ +     GG W LLQ S+GISAMHMQLL ND+VV +DRT+ GPSN+SLP G
Sbjct  13    FTNLLLFSSLSPTTAAGGSWMLLQRSVGISAMHMQLLQNDRVVMYDRTDFGPSNLSLPGG  72

Query  319   KCHHggggglggRKPPDD---NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLV  489
             KC          R P      +CTAHS+EY+V +N+FRP++VLSD WCSSGSV P GTLV
Sbjct  73    KC---------LRDPKAKIKVDCTAHSIEYNVITNTFRPLMVLSDVWCSSGSVLPDGTLV  123

Query  490   QTGGYGEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNY  669
             QTGG+  G R VR+F PC  + CDWEEIP  L   RWY+T+HILPDGRQII GGRR +NY
Sbjct  124   QTGGFNSGERRVRKFRPC--STCDWEEIPLALSARRWYATNHILPDGRQIIFGGRRQYNY  181

Query  670   EFFPKSGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNN  849
             EF+PK       + L FLA+T D G+  ENNLYP+V L  DGNLFIFANNRAIL DY  N
Sbjct  182   EFYPKDEATQNVFDLRFLAETNDNGI--ENNLYPYVFLQPDGNLFIFANNRAILFDYTKN  239

Query  850   VVVRTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRN-IF  1026
              VV+T+P IP GEPRNYPS+GSAV+LPL N+       EVLVCGG+PK +Y  A  + IF
Sbjct  240   KVVKTFPAIPDGEPRNYPSTGSAVMLPL-NVDAKFIEVEVLVCGGAPKGSYDKANSHGIF  298

Query  1027  VGALNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNP  1206
             V AL TC RI ITD NP+W+ E MP PRVM DM++LP GNVL+ING + GAAGW++GR P
Sbjct  299   VEALRTCARIKITDQNPQWVMETMPQPRVMVDMLLLPNGNVLLINGGSAGAAGWEIGRKP  358

Query  1207  AFHPVLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFP  1386
             A +PVLY  + P G RFELQNP  IPRMYHS+A+L+ DGRVLV GSNPH++Y FT V FP
Sbjct  359   ALNPVLYHTNNPVGKRFELQNPTTIPRMYHSTAILLRDGRVLVGGSNPHSSYNFTGVLFP  418

Query  1387  TELSMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVS  1566
             TEL +EAFSPSYLDP++A LRP I  PAS   L +G+ + V F V GKVD +++ VT++S
Sbjct  419   TELRLEAFSPSYLDPEFAYLRPAIQFPASSVKLRHGQALKVGFTVPGKVDSTRLSVTILS  478

Query  1567  PAFSTHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSK  1746
             P+F+THSFSMNQRLL+L+T K +  G ++Y ++V  P SGN+APSGYY+L++VH+EIPS 
Sbjct  479   PSFNTHSFSMNQRLLILSTTKYRLRGNKKYEVEVTIPGSGNVAPSGYYILYLVHKEIPSI  538

Query  1747  GIWVHI  1764
             GIWV +
Sbjct  539   GIWVQL  544



>ref|XP_008367966.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=540

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/527 (61%), Positives = 390/527 (74%), Gaps = 17/527 (3%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GGKW LLQ ++GISAMHMQLL+ND+V+ FDRT+ G SN+SLP+G C             
Sbjct  30    AGGKWQLLQQNVGISAMHMQLLYNDRVIMFDRTDFGKSNLSLPNGTCVR-----------  78

Query  364   PDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPC  543
               ++CTAHS EYDV +N+ RP+ V SD WCSSGSV+P G L+QTGGY  G R VR F PC
Sbjct  79    --NDCTAHSAEYDVTTNTVRPLTVQSDIWCSSGSVAPNGNLIQTGGYDIGERRVRVFKPC  136

Query  544   NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFL  723
                 CDW+E    L   RWY+TDHILPDGRQII+GGR  FNYEF+PK+  +   YSLPFL
Sbjct  137   TG--CDWKEYENTLGVSRWYATDHILPDGRQIIIGGRGQFNYEFYPKTESSSNVYSLPFL  194

Query  724   AQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYP  903
              QT DP    ENNLYP+V LNVDGNLFIFANNRAILLDYV N VV+ YP+IPGG+PR+YP
Sbjct  195   VQTNDPN--EENNLYPYVFLNVDGNLFIFANNRAILLDYVMNKVVKIYPQIPGGDPRSYP  252

Query  904   SSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEW  1083
             S+GSAVLLPL+NL  P+  AEVLVCGG+PK +Y  A +  FV ALNTCGRI I DP P+W
Sbjct  253   STGSAVLLPLRNLTAPSIEAEVLVCGGAPKGSYVQAIKGTFVEALNTCGRIKINDPKPQW  312

Query  1084  ITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFEL  1263
             + E MP  RVM DM++LP G V+IINGA+ G AGW+LG+NP   P++YRPD   GSRFE 
Sbjct  313   VVETMPQARVMSDMLLLPDGTVVIINGASFGTAGWELGQNPVLEPLVYRPDNAVGSRFEK  372

Query  1264  QNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAA  1443
             QNP  IPRMYHS+AVL+ DGRVLV GSNPH  Y+  +  FPTEL +EAFS  YLD KY+ 
Sbjct  373   QNPAPIPRMYHSTAVLLRDGRVLVGGSNPHDKYELADELFPTELRLEAFSXDYLDAKYSK  432

Query  1444  LRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNT  1623
             LRP IV P SQ+ +SYG+ + ++F + G +  + V VT+V+P+F+THSFSMNQRLLVL  
Sbjct  433   LRPRIVDPKSQAKISYGKKLFIRFSLXGSIATNLVMVTIVAPSFNTHSFSMNQRLLVLAA  492

Query  1624  VKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
               VK  G   Y + V  P SGNLAPSGYYLL+VVH++IPS+GIWV I
Sbjct  493   ETVKKVGTMTYQVQVTTPGSGNLAPSGYYLLYVVHQQIPSEGIWVQI  539



>gb|KGN60011.1| hypothetical protein Csa_3G866440 [Cucumis sativus]
Length=560

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/546 (60%), Positives = 404/546 (74%), Gaps = 18/546 (3%)
 Frame = +1

Query  139   FHNRGFFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDG  318
             F N   F++ +     GG W LLQ S+GISAMHMQLL ND+VV +DRT+ GPSN+SLP G
Sbjct  25    FTNLLLFSSLSPTTAAGGSWMLLQRSVGISAMHMQLLQNDRVVMYDRTDFGPSNLSLPGG  84

Query  319   KCHHggggglggRKPPDD---NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLV  489
             KC          R P      +CTAHS+EY+V +N+FRP++VLSD WCSSGSV P GTLV
Sbjct  85    KC---------LRDPKAKIKVDCTAHSIEYNVITNTFRPLMVLSDVWCSSGSVLPDGTLV  135

Query  490   QTGGYGEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNY  669
             QTGG+  G R VR+F PC  + CDWEEIP  L   RWY+T+HILPDGRQII GGRR +NY
Sbjct  136   QTGGFNSGERRVRKFRPC--STCDWEEIPLALSARRWYATNHILPDGRQIIFGGRRQYNY  193

Query  670   EFFPKSGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNN  849
             EF+PK       + L FLA+T D G+  ENNLYP+V L  DGNLFIFANNRAIL DY  N
Sbjct  194   EFYPKDEATQNVFDLRFLAETNDNGI--ENNLYPYVFLQPDGNLFIFANNRAILFDYTKN  251

Query  850   VVVRTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRN-IF  1026
              VV+T+P IP GEPRNYPS+GSAV+LPL N+       EVLVCGG+PK +Y  A  + IF
Sbjct  252   KVVKTFPAIPDGEPRNYPSTGSAVMLPL-NVDAKFIEVEVLVCGGAPKGSYDKANSHGIF  310

Query  1027  VGALNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNP  1206
             V AL TC RI ITD NP+W+ E MP PRVM DM++LP GNVL+ING + GAAGW++GR P
Sbjct  311   VEALRTCARIKITDQNPQWVMETMPQPRVMVDMLLLPNGNVLLINGGSAGAAGWEIGRKP  370

Query  1207  AFHPVLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFP  1386
             A +PVLY  + P G RFELQNP  IPRMYHS+A+L+ DGRVLV GSNPH++Y FT V FP
Sbjct  371   ALNPVLYHTNNPVGKRFELQNPTTIPRMYHSTAILLRDGRVLVGGSNPHSSYNFTGVLFP  430

Query  1387  TELSMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVS  1566
             TEL +EAFSPSYLDP++A LRP I  PAS   L +G+ + V F V GKVD +++ VT++S
Sbjct  431   TELRLEAFSPSYLDPEFAYLRPAIQFPASSVKLRHGQALKVGFTVPGKVDSTRLSVTILS  490

Query  1567  PAFSTHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSK  1746
             P+F+THSFSMNQRLL+L+T K +  G ++Y ++V  P SGN+APSGYY+L++VH+EIPS 
Sbjct  491   PSFNTHSFSMNQRLLILSTTKYRLRGNKKYEVEVTIPGSGNVAPSGYYILYLVHKEIPSI  550

Query  1747  GIWVHI  1764
             GIWV +
Sbjct  551   GIWVQL  556



>ref|XP_009607831.1| PREDICTED: galactose oxidase-like [Nicotiana tomentosiformis]
Length=558

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/538 (61%), Positives = 406/538 (75%), Gaps = 12/538 (2%)
 Frame = +1

Query  163   AAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHgggg  342
             +A AAV  GG W LL   IGISAMHMQLL+ND+VV FDRT+ G SNI+LP+GKC +    
Sbjct  30    SANAAV--GGTWELLMSDIGISAMHMQLLNNDRVVMFDRTDFGASNIALPNGKCRNNSND  87

Query  343   glggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRV  522
                       +CTAHSVE+D+ +NS RP++V ++ WCSSGS +  G+LVQTGG+ +G  V
Sbjct  88    LALIV-----DCTAHSVEFDITTNSVRPLMVQTNVWCSSGSATSDGSLVQTGGFNDGVNV  142

Query  523   VRRFSPC---NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGP  693
             VR F PC     + CDW+E+  GL++ RWY+T+H+LPDGRQII+GGR AFNYEF+PK+  
Sbjct  143   VRVFKPCITGKRSTCDWQEMGNGLIQSRWYATNHMLPDGRQIIIGGRAAFNYEFYPKTAS  202

Query  694   ADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPE  873
              +  +SLPFL QT DP    ENNLYPFV LNVDGNLFIFAN+RAIL DY  N VV+TYP+
Sbjct  203   TNNVFSLPFLEQTNDPM--EENNLYPFVFLNVDGNLFIFANDRAILFDYTTNTVVKTYPQ  260

Query  874   IPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGR  1053
             IPG +PRNYPS+GSAVLLPLKNL+  T  AE LVCGG+P+ +Y  A    F+GALNTCGR
Sbjct  261   IPGSDPRNYPSTGSAVLLPLKNLQAQTIQAEFLVCGGTPRGSYLKATTGDFLGALNTCGR  320

Query  1054  IVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRP  1233
             I ITDP+P+W  E MP  R MGDMVILP GNVLI+NGA  GAAGW+LGR+P   PV+YRP
Sbjct  321   ITITDPDPQWTMETMPLARTMGDMVILPNGNVLILNGAAAGAAGWELGRDPVLCPVIYRP  380

Query  1234  DAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFS  1413
             D P  SRFE+QNPN IPRMYHS+ VL+ DGRVLV GSNP+  Y FT V FPTELS+EAFS
Sbjct  381   DNPLDSRFEVQNPNIIPRMYHSTTVLLRDGRVLVGGSNPNEFYNFTGVLFPTELSLEAFS  440

Query  1414  PSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFS  1593
             PSYLD + A LRP+I+S  S+    YG+ V++QF VSG V+   +KVTMV+P F+THSF+
Sbjct  441   PSYLDSESANLRPQIISSTSRHKFKYGQGVNIQFTVSGLVNRDLIKVTMVAPGFNTHSFT  500

Query  1594  MNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             MNQR+LVL++  V+  G+  Y + +V P SG LAP GYY+LFVVH++IPS+GIWV I 
Sbjct  501   MNQRMLVLSSGDVRLIGKFVYQVSLVFPKSGKLAPPGYYMLFVVHQDIPSEGIWVRIH  558



>ref|XP_009335433.1| PREDICTED: galactose oxidase-like [Pyrus x bretschneideri]
Length=533

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/528 (61%), Positives = 391/528 (74%), Gaps = 17/528 (3%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GGKW LLQ S+GISAMHMQLLHND+V+ FDRT+ GPSN+SLP+G C             
Sbjct  23    AGGKWQLLQQSVGISAMHMQLLHNDRVIMFDRTDFGPSNLSLPNGAC-------------  69

Query  364   PDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPC  543
              +++CTAHS EYDV +N+ RP+ VLSD WCSSG+V+P G L+QTGG G G R VR F PC
Sbjct  70    VNNDCTAHSAEYDVKTNTVRPLTVLSDVWCSSGAVAPDGRLIQTGGNGAGERRVRIFEPC  129

Query  544   NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFL  723
                 CDW+EI   L   RWY+TDHILP+GRQII+GGR  FNYEF+PK+  +   YSLPFL
Sbjct  130   TG--CDWKEIENALNARRWYATDHILPNGRQIIIGGRGQFNYEFYPKTKSSSNLYSLPFL  187

Query  724   AQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYP  903
              QT D G   ENNLYPFV LN+DGNLFIFANNRAIL +Y    VV+TYP+IPGG+PR YP
Sbjct  188   TQTNDAG--EENNLYPFVFLNMDGNLFIFANNRAILFNYAKKQVVQTYPQIPGGDPRCYP  245

Query  904   SSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEW  1083
             S+GSAVLLPLKNLK P+  AEVLVCGG+PK ++    +  FV AL TC RI I +PN +W
Sbjct  246   STGSAVLLPLKNLKAPSVEAEVLVCGGAPKGSFAKVNQGTFVEALKTCARIEINNPNAQW  305

Query  1084  ITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFEL  1263
             + E MP  RVMGDM++LP G VL+INGA++G AGW+ GRNP  +P++YRPD   GSRFE 
Sbjct  306   VVETMPQARVMGDMLLLPDGTVLLINGASSGTAGWENGRNPVLNPIVYRPDNAIGSRFEQ  365

Query  1264  QNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAA  1443
             QNP  IPRMYHS+A+L+ DGRVL+ GSNPH  Y+FTNV FPTEL +EAFSP YLD  Y  
Sbjct  366   QNPTTIPRMYHSTAILLRDGRVLIGGSNPHDKYEFTNVLFPTELRLEAFSPDYLDATYNN  425

Query  1444  LRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNT  1623
             LRP IV+P SQ+ ++YG+ +S+QF V G +    V V+MV+P+F+THSFSMNQRLLVL  
Sbjct  426   LRPTIVAPNSQAKINYGKKLSIQFSVKGNLVSKSVSVSMVAPSFNTHSFSMNQRLLVLGA  485

Query  1624  VKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
               +   G   Y + V  P S NLAPSGYYLL+VVH++IPS  IWV IQ
Sbjct  486   ENIIKGGTTTYEVQVTTPASRNLAPSGYYLLYVVHQQIPSAAIWVQIQ  533



>ref|XP_008350494.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=537

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/540 (61%), Positives = 400/540 (74%), Gaps = 22/540 (4%)
 Frame = +1

Query  148   RGFFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCH  327
              GF     AA   GG W LL  +IG+SAMHMQL  ND++V FDRT+ G SN+SLP+G C 
Sbjct  18    HGFSRTTHAA---GGNWQLLA-TIGVSAMHMQLFKNDRIVLFDRTDFGKSNLSLPNGNC-  72

Query  328   HggggglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYG  507
                          +++CTAHS E+ V + +FRP+ VLSD WCSSGS++P G L+Q+GG+ 
Sbjct  73    ------------VNNDCTAHSAEFVVQTKAFRPLTVLSDVWCSSGSMAPNGNLIQSGGFN  120

Query  508   EGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKS  687
              G R VR F PC    CDW EI  GL   RWY+T+H LPDGRQII+GG + FNYEF+PK+
Sbjct  121   SGERRVRVFQPCTG--CDWTEIVDGLAVRRWYATNHALPDGRQIIIGGTKQFNYEFYPKT  178

Query  688   GPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTY  867
                   YSLPFL+QT DPG   ENNLYPFV LN DGNLFIFANNRAILLDY+ NVVV+TY
Sbjct  179   ESTSNAYSLPFLSQTNDPG--EENNLYPFVFLNPDGNLFIFANNRAILLDYMKNVVVKTY  236

Query  868   PEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTC  1047
             P+IPGG+PR YPSSGSAVLLPLKNL  P+  AEVLVCGG+PK ++  A ++IFV ALNTC
Sbjct  237   PQIPGGDPRCYPSSGSAVLLPLKNLTAPSVEAEVLVCGGAPKGSFAQANKDIFVEALNTC  296

Query  1048  GRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLY  1227
              RI ITDPNP+WI E MP  RVMGDM++LP   VL+INGA++G AGW++GRNP  +PV+Y
Sbjct  297   ARIKITDPNPQWIVETMPQARVMGDMILLPDSTVLLINGASSGVAGWEIGRNPVLNPVVY  356

Query  1228  RPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKF-TNVFFPTELSME  1404
             RPD   GSRFE QNP  IPRMYHSSA+L+ DGRV+V GSNPH  Y+F +NV FPTE  +E
Sbjct  357   RPDNAVGSRFEQQNPTTIPRMYHSSALLVRDGRVVVGGSNPHDKYQFGSNVLFPTEFRLE  416

Query  1405  AFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTH  1584
             AFSP YLD KYA LRP I++P +Q+ + YG  +++QF ++G + M+ V VTMV+P FSTH
Sbjct  417   AFSPEYLDAKYADLRPTILTPLNQAKIHYGIKLTIQFSLTGTLAMNSVSVTMVAPPFSTH  476

Query  1585  SFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             SFSMNQRLLVL    V+  G   Y   V  P SGNLAPSGYY+L+VVH++IPS+GI+V I
Sbjct  477   SFSMNQRLLVLGAENVQQVGPTTYQAQVTTPPSGNLAPSGYYILYVVHQQIPSEGIFVQI  536



>ref|XP_009625411.1| PREDICTED: LOW QUALITY PROTEIN: galactose oxidase-like [Nicotiana 
tomentosiformis]
Length=550

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/533 (62%), Positives = 405/533 (76%), Gaps = 19/533 (4%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GG+W LL  +IGISAMHMQLL+ND+V+ +DRT+ G SNISLP+GKC          R  
Sbjct  32    AGGQWQLLMSNIGISAMHMQLLNNDRVIMYDRTDFGASNISLPNGKC----------RNN  81

Query  364   PDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
             P+D     +CTAHSVEYDV++NS RP++V +D WCSSGSV   G+LVQTGG+ +G R+VR
Sbjct  82    PNDLALKVDCTAHSVEYDVSTNSVRPLMVQTDVWCSSGSVDSDGSLVQTGGFNDGERMVR  141

Query  529   RFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFY  708
                PC  + CDW+E+   L++ RWYST+HILPDGRQII+GGR+AFNYEF+PK+   +  +
Sbjct  142   VVKPC--STCDWQEMGSNLIQSRWYSTNHILPDGRQIIIGGRKAFNYEFYPKTASTNNVF  199

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
             SLPFL QT +P    ENNL+PFV  NVDGNLFIFAN+RAIL DY  N VV+TYP+IPGG+
Sbjct  200   SLPFLQQTNNPR--EENNLFPFVFXNVDGNLFIFANDRAILFDYKANKVVKTYPQIPGGD  257

Query  889   PRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITD  1068
             PRNYPSS SAVLLPLKNL+     AEVLVCGG+P+ +Y  A +  F+GALNTCGRI ITD
Sbjct  258   PRNYPSSDSAVLLPLKNLRTQKVQAEVLVCGGAPRGSYPKADKGEFIGALNTCGRITITD  317

Query  1069  PNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPG  1248
             PNP+W  E MP  R MGDMVILP GNVLIINGA  G AGW +   P   PV+YRPD P G
Sbjct  318   PNPQWTMETMPLARTMGDMVILPNGNVLIINGAAAGTAGWQIAGKPVLSPVIYRPDNPLG  377

Query  1249  SRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLD  1428
             SRFE+QN N IPR+YHS+A+L+ DGRVL  GSNP+  Y FT V FPT+LS+EAFSPSYLD
Sbjct  378   SRFEVQNSNVIPRIYHSTAILLRDGRVLTGGSNPNEFYNFTGVLFPTDLSLEAFSPSYLD  437

Query  1429  PKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRL  1608
             P+ A LR +I+S AS+    YG+ VS++F VSG ++   VKVTMV+P F+THS +MNQR+
Sbjct  438   PESANLRSQIISLASRHKTKYGQSVSIRFTVSGLLNTDLVKVTMVAPGFNTHSNTMNQRM  497

Query  1609  LVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             LVL++ KV+  G+  Y I+++ P SG LAP GYY+LFVVH++IPSKGIWV IQ
Sbjct  498   LVLSSGKVRRIGKSTYHINLIFPSSGKLAPPGYYMLFVVHQDIPSKGIWVKIQ  550



>ref|XP_007136064.1| hypothetical protein PHAVU_009G014800g [Phaseolus vulgaris]
 gb|ESW08058.1| hypothetical protein PHAVU_009G014800g [Phaseolus vulgaris]
Length=568

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/531 (62%), Positives = 393/531 (74%), Gaps = 10/531 (2%)
 Frame = +1

Query  175   AVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglgg  354
             A  G G+W+LLQ SIGI  MHMQLLHND+VV  DRT+ G SN+SLP+G+C +     +  
Sbjct  26    AEAGNGQWHLLQESIGIVGMHMQLLHNDRVVILDRTDFGFSNLSLPNGRCRNNPNEMVV-  84

Query  355   RKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
                   +CTAHS+EYDVA N FR + V ++ WCSSGSVSP GTLVQTGG+ +G R VR  
Sbjct  85    ----KTDCTAHSIEYDVAVNKFRSLFVQTNVWCSSGSVSPDGTLVQTGGFNDGDRAVRAL  140

Query  535   SPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKS-GPADTFYS  711
             +PC    CDW E+  GL   RWY+T+HILPDGRQII+GGRR FNYEF+PK+   A   YS
Sbjct  141   TPCR--TCDWREVDNGLSARRWYATNHILPDGRQIIIGGRRQFNYEFYPKTQSTAKNTYS  198

Query  712   LPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEP  891
             LPFL QT D    AENNLYPFV LNVDGNLFIFANNRAIL DY  N VV TYP+IPGG+P
Sbjct  199   LPFLVQTNDAS--AENNLYPFVFLNVDGNLFIFANNRAILFDYNKNSVVTTYPQIPGGDP  256

Query  892   RNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDP  1071
             R YPS+GSAVLLPLKNL+     AEVL+CGG+P+ A+ ++    F GAL TC RI ITDP
Sbjct  257   RCYPSTGSAVLLPLKNLRESKVEAEVLICGGAPRGAFTDSLSGRFTGALKTCARIKITDP  316

Query  1072  NPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGS  1251
              P W+ E MP  RVM DMV+LP G+VLI+NGA+ G AGW+LGRNP  +P LY+P    GS
Sbjct  317   KPSWVMETMPGGRVMSDMVLLPNGDVLIVNGASVGTAGWELGRNPVLNPFLYKPSNRIGS  376

Query  1252  RFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDP  1431
             RFELQNP+ IPRMYHSSAVL+ DGRVLVAGSNPH  Y FTNV FPTEL +EAFSP+YL+P
Sbjct  377   RFELQNPSSIPRMYHSSAVLLRDGRVLVAGSNPHTYYNFTNVMFPTELRLEAFSPAYLEP  436

Query  1432  KYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLL  1611
              ++ +RP IVSP+SQ+ + YGE + V F+V   ++   V VTM++P F+THSFSMNQRLL
Sbjct  437   GFSNVRPTIVSPSSQTKVKYGETLKVGFEVIASLNNDSVSVTMLAPPFATHSFSMNQRLL  496

Query  1612  VLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             VL    +   GE  Y ++V AP S  LAP G+YLLFVVHREIPS GIWV +
Sbjct  497   VLEPQNLSKVGESTYEVEVTAPGSSVLAPPGFYLLFVVHREIPSHGIWVRM  547



>ref|XP_003589379.1| Galactose oxidase [Medicago truncatula]
 gb|AES59630.1| glyoxal oxidase amino-terminal protein [Medicago truncatula]
Length=543

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/527 (61%), Positives = 396/527 (75%), Gaps = 12/527 (2%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
             G G+W +LQ SIGI AMHMQLLHND++V FDRT+ G S + LP+GKC H           
Sbjct  28    GNGQWQVLQKSIGIVAMHMQLLHNDRIVIFDRTDFGLSKLPLPNGKCRHDPRETTV----  83

Query  364   PDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPC  543
                +CTAHSVEY++ SN+FRP+ V +D WCSSGSV+P GTLVQTGGY +G R +R F  C
Sbjct  84    -KTDCTAHSVEYNIKSNTFRPLFVQTDVWCSSGSVNPKGTLVQTGGYNDGDRTIRMFDTC  142

Query  544   NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFL  723
             N+  CDW+E   GL   RWY+T+HILPDGRQII+GGR+ FNYEF+PK+      Y LPFL
Sbjct  143   NN--CDWQEFDGGLAARRWYATNHILPDGRQIIIGGRKQFNYEFYPKNNIG--VYRLPFL  198

Query  724   AQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYP  903
              QT D G  AENNLYPFV+LNVDGNLFIFANNRAIL DY  NVVVRT+P+IPGG+PR+YP
Sbjct  199   EQTNDAG--AENNLYPFVILNVDGNLFIFANNRAILFDYTKNVVVRTFPQIPGGDPRSYP  256

Query  904   SSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEW  1083
             SSGS VLLPLKNL+     AEVL+CGG+PK +Y  A +  F+GALNTC RI ITDPNP W
Sbjct  257   SSGSGVLLPLKNLQSKFIEAEVLICGGAPKGSYQKASKREFLGALNTCARIKITDPNPTW  316

Query  1084  ITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFEL  1263
             + E MP  RVMGDMV+LP G+VLIINGA +G AGW+ GR+P  +PVLY+ + P G+RFEL
Sbjct  317   VVETMPRARVMGDMVMLPNGDVLIINGAGSGTAGWEYGRDPVLNPVLYKTNNPIGARFEL  376

Query  1264  QNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAA  1443
             QNP+  PRMYHS+A+L+ DGRVLV GSNPH  Y F NV FPTELS+EAFSPSYL+P++A 
Sbjct  377   QNPSHTPRMYHSTAILVRDGRVLVGGSNPHIGYNFNNVLFPTELSIEAFSPSYLEPRFAN  436

Query  1444  LRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNT  1623
             +RP IV+  S+    +G+ + ++F+V   +D + V VTM++P F+THSFSMNQRLLVL +
Sbjct  437   VRPRIVASTSELQ-KHGQKLGLRFQVKAALDKNLVYVTMLAPPFNTHSFSMNQRLLVLES  495

Query  1624  VKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
              KV       Y + V  P S  LAP G+YLLFVVH+EIPS+GIW+ I
Sbjct  496   NKVNIVEGTTYDVQVTMPGSPILAPPGFYLLFVVHKEIPSEGIWIQI  542



>ref|XP_003527766.1| PREDICTED: galactose oxidase-like [Glycine max]
Length=558

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/533 (62%), Positives = 397/533 (74%), Gaps = 11/533 (2%)
 Frame = +1

Query  169   AAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHgggggl  348
             AA     G+W LL  +IGI AMHMQLLHND+V+ FDRT+ G SN++LPDG+C +     +
Sbjct  35    AAEAAAKGQWQLLHKNIGIVAMHMQLLHNDRVIIFDRTDFGLSNLTLPDGRCRNNPNEMV  94

Query  349   ggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
                     +CTAHSVEYDV +N+FR + V ++ WCSS S SP GTLVQTGG+ +G R VR
Sbjct  95    V-----KTDCTAHSVEYDVVANTFRALFVQTNVWCSSASASPDGTLVQTGGFNDGDRAVR  149

Query  529   RFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFY  708
              F+PC    CDW+EI  GL   RWY+T+HILPDGRQII+GGRR FNYEF+PK+   +T Y
Sbjct  150   TFTPCR--TCDWKEIDDGLAARRWYATNHILPDGRQIIIGGRRQFNYEFYPKTQAKNT-Y  206

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
             SLPFL QT D    AENNLYPFV LNVDGNLFIF+NNRAIL DY  N VVRTYP+IPGG+
Sbjct  207   SLPFLVQTNDAN--AENNLYPFVFLNVDGNLFIFSNNRAILFDYNKNSVVRTYPQIPGGD  264

Query  889   PRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITD  1068
             PR YPS+GSAVLLPLKNL+ P   AEVL+CGG+P+ AY NA    FV AL TC RI ITD
Sbjct  265   PRCYPSTGSAVLLPLKNLRAPKVEAEVLICGGAPRGAYQNALSGKFVPALETCARIKITD  324

Query  1069  PNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPG  1248
             PNP+W  E MP  RVM DMV+LP G+VLI+NGA  G AGW+LGRNP   P LY+P+   G
Sbjct  325   PNPKWDMETMPGARVMSDMVLLPNGDVLIVNGAAVGTAGWELGRNPLLSPFLYKPNNRVG  384

Query  1249  SRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLD  1428
             SRFE+Q  + IPRMYHSSAVL+ DGRVLVAGSNPH  YKFTNV FPTEL +EAFSP YL+
Sbjct  385   SRFEVQTSSDIPRMYHSSAVLLRDGRVLVAGSNPHIYYKFTNVLFPTELRLEAFSPWYLE  444

Query  1429  PKYAALRPEIVSPASQSGLSYGEVVSVQFKV-SGKVDMSQVKVTMVSPAFSTHSFSMNQR  1605
             P ++++RP IV PASQ+ L YG+ + ++F+V S  +    V VTM+SP F+THSFSMNQR
Sbjct  445   PGFSSVRPTIVFPASQTKLKYGQTLRLRFEVMSATLVGDSVSVTMLSPPFNTHSFSMNQR  504

Query  1606  LLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             +LVL    +   GE  Y ++V AP S  LAP G+YLLF+VH+EIPS+GIWV +
Sbjct  505   MLVLEPHDLSKVGESTYEVEVTAPVSAVLAPPGFYLLFLVHQEIPSQGIWVQM  557



>ref|XP_009337677.1| PREDICTED: galactose oxidase-like [Pyrus x bretschneideri]
Length=536

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/541 (61%), Positives = 401/541 (74%), Gaps = 23/541 (4%)
 Frame = +1

Query  145   NRGFFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKC  324
             N    TA AA    GGKW +L+ ++GISAMHMQL  ND++V FDRT+ G SN+SLP+G C
Sbjct  17    NFSVLTAHAA----GGKWQVLK-NVGISAMHMQLFKNDRIVLFDRTDFGKSNLSLPNGNC  71

Query  325   HHggggglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGY  504
                           +++CTAHS E+ V +N+ RP+ VLSD WCSSGS+   G L+QTGG 
Sbjct  72    -------------VNNDCTAHSAEFVVQTNAVRPLTVLSDVWCSSGSMDAYGNLIQTGGN  118

Query  505   GEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPK  684
               G R VR F+PC    CDW+EI  GL   RWY+T+HILPDGR+II+GGR  FNYEF+PK
Sbjct  119   NIGERRVRVFTPCTG--CDWKEIVDGLAARRWYATNHILPDGREIIIGGRGQFNYEFYPK  176

Query  685   SGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRT  864
             +      YSLPFL+QT DPG   ENNLYPFV LN DGNLF+FANNRAILLDYV NVVV+T
Sbjct  177   TASTSNVYSLPFLSQTNDPG--QENNLYPFVFLNPDGNLFVFANNRAILLDYVKNVVVKT  234

Query  865   YPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNT  1044
             YP+IPGG+PR+YPS+GSAVLLPLKNL  P+  AEVLVCGG+PK ++  A +  FV ALNT
Sbjct  235   YPQIPGGDPRSYPSTGSAVLLPLKNLMAPSVEAEVLVCGGAPKGSFVQANKGTFVEALNT  294

Query  1045  CGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVL  1224
             C RI ITDPNP+WI E MP  RVMGDM++LP   VL+INGA++G AGW++GRNP F+PV+
Sbjct  295   CARIKITDPNPQWIVETMPQARVMGDMLLLPDSTVLLINGASSGVAGWEIGRNPVFNPVV  354

Query  1225  YRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTN-VFFPTELSM  1401
             YRPD   GSRFE QNP  IPRMYHSSA+L+ DGRV+V GSNPH  Y+F N V FPTEL +
Sbjct  355   YRPDNAVGSRFEQQNPTTIPRMYHSSALLVRDGRVIVGGSNPHEKYQFGNDVLFPTELRL  414

Query  1402  EAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFST  1581
             EAFSP YLD KYA LRP I++P +Q+ + YG  +++QF ++G    + V VTMV+P FST
Sbjct  415   EAFSPEYLDAKYANLRPTILAPGNQAKIHYGIKLAIQFSLTGTFAKNSVSVTMVAPPFST  474

Query  1582  HSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVH  1761
             HSFSMNQRLLVL    V+  G   Y + V  P S NLAPSGYY+LFVVH++IPS+GI+V 
Sbjct  475   HSFSMNQRLLVLGAENVQQVGPTTYQVQVTTPPSKNLAPSGYYILFVVHQQIPSEGIFVK  534

Query  1762  I  1764
             I
Sbjct  535   I  535



>gb|KHN45905.1| Galactose oxidase [Glycine soja]
Length=530

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/530 (61%), Positives = 394/530 (74%), Gaps = 13/530 (2%)
 Frame = +1

Query  175   AVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglgg  354
             A    G+W LL  +IGI AMHMQLLHND+V+ FDRT+ G SN++LPDG+C +     +  
Sbjct  13    AAEAKGQWQLLHKNIGIVAMHMQLLHNDRVIIFDRTDFGLSNLTLPDGRCRNNPNELVVK  72

Query  355   RKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
             R     +CTAHS+EYDVA+N+FR + V ++ WCSSGSVSP GTLVQTGG+ +G R VR F
Sbjct  73    R-----DCTAHSIEYDVAANTFRALFVQTNVWCSSGSVSPDGTLVQTGGFNDGYRAVRTF  127

Query  535   SPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSL  714
             +PC    CDW E+ +GL   RWY+T+HILPDGRQII+GGRR FNYEF+PK+   +T YSL
Sbjct  128   TPCRS--CDWAEVQHGLAAQRWYATNHILPDGRQIIIGGRRQFNYEFYPKTQAKNT-YSL  184

Query  715   PFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPR  894
             PFLAQT D    AENNLYPFV LNVDGNLFIFANNRAIL DY  N VVRTYP+IPGG+PR
Sbjct  185   PFLAQTNDAN--AENNLYPFVFLNVDGNLFIFANNRAILFDYNKNSVVRTYPQIPGGDPR  242

Query  895   NYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPN  1074
              YPS+GSAVLLPL+    P   AEVL+CGG+P+ A+ N     FVGAL TC RI ITDP 
Sbjct  243   CYPSTGSAVLLPLRE---PNVEAEVLICGGAPRGAFRNTLSGKFVGALRTCARIKITDPK  299

Query  1075  PEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSR  1254
               W+ E MP  RVM DMV+LP G+VLI+NGA  G AGW+LGRNP  +P LY+P+   G R
Sbjct  300   ANWVMETMPSARVMSDMVLLPNGDVLIVNGAAVGTAGWELGRNPVLNPFLYKPNKRVGMR  359

Query  1255  FELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPK  1434
             FE+QNP+ IPRMYHS AVL+ DGRVL+AGSNPH  Y FT V FPTEL +EAFSP YL+P 
Sbjct  360   FEVQNPSHIPRMYHSGAVLLRDGRVLLAGSNPHTYYNFTKVLFPTELRLEAFSPWYLEPG  419

Query  1435  YAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLV  1614
             ++ +RP IVSPASQ+ L YG+ + ++FKVS  +    V VTM++P F+THSFSMNQRLLV
Sbjct  420   FSNVRPAIVSPASQTKLKYGQTLRLRFKVSATLVGDSVSVTMLAPPFNTHSFSMNQRLLV  479

Query  1615  LNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             L    +   GE  + ++V AP S  LAP G+YLLFVVH+E+PS GIWV +
Sbjct  480   LKPHHLSGVGESTHEVEVTAPASAVLAPPGFYLLFVVHQEVPSHGIWVQM  529



>ref|XP_008377179.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=537

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/543 (61%), Positives = 402/543 (74%), Gaps = 24/543 (4%)
 Frame = +1

Query  139   FHNRGFFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDG  318
             FH  GF   A AA   GG W +L  +IG+SAMHMQLL ND++V FDRT+ G SN+SLP+G
Sbjct  17    FH--GFSRTAHAA---GGNWQVLA-TIGVSAMHMQLLKNDRIVLFDRTDFGTSNLSLPNG  70

Query  319   KCHHggggglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTG  498
              C              +++CTAHS E+ V + +FRP+ VLSD WCSSGS++P G L+QTG
Sbjct  71    NC-------------VNNDCTAHSAEFVVQTKAFRPLTVLSDVWCSSGSMAPNGNLIQTG  117

Query  499   GYGEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFF  678
             G+  G R VR F PC    CDW E+  GL   RWY+T+H+LPDGR+II+GGR  FNYEF+
Sbjct  118   GFNSGERRVRVFQPCTG--CDWTEVVDGLAVRRWYATNHVLPDGREIIIGGRGQFNYEFY  175

Query  679   PKSGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVV  858
             PK+      YSLPFL+QT D G   ENNLYPFV LN DGNLFIFANNRAILLDY+ NV+V
Sbjct  176   PKTDSTSNVYSLPFLSQTNDAG--QENNLYPFVFLNPDGNLFIFANNRAILLDYLKNVIV  233

Query  859   RTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGAL  1038
             +TYP+IPGG+PR YPSSGSAVLLPLKNL  P+  AEVLVCGG+PK ++  A +  FV AL
Sbjct  234   KTYPQIPGGDPRCYPSSGSAVLLPLKNLTAPSVEAEVLVCGGAPKGSFVQANKGTFVDAL  293

Query  1039  NTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHP  1218
             NTC RI ITDPNP+WI E MP  RVMGDM++LP   VL+INGA++G AGW++GRNP  +P
Sbjct  294   NTCARIKITDPNPQWIVETMPQARVMGDMLLLPDSTVLLINGASSGVAGWEIGRNPVLNP  353

Query  1219  VLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKF-TNVFFPTEL  1395
             V+YRPD   GSRFE QNP  IPRMYHSSA+L+ DGRV+V GSNPH  Y+F +NV FPTE 
Sbjct  354   VVYRPDNAFGSRFEQQNPTTIPRMYHSSALLVRDGRVIVGGSNPHDKYQFGSNVLFPTEF  413

Query  1396  SMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAF  1575
              +EAFSP YLD KYA LRP I++P +Q+ + YG  ++VQF ++G + M+ V VTMV+P F
Sbjct  414   RLEAFSPEYLDAKYADLRPTIINPLNQAKIHYGRKLTVQFSLTGTLAMNSVLVTMVAPPF  473

Query  1576  STHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIW  1755
             STHSFSMNQRLLVL    V+  G   Y   V  P S NLAPSGYY+L+VVH++IPS+GI+
Sbjct  474   STHSFSMNQRLLVLGAENVQKVGPTTYQAQVTTPPSVNLAPSGYYILYVVHQQIPSEGIF  533

Query  1756  VHI  1764
             VHI
Sbjct  534   VHI  536



>ref|XP_002301997.2| glyoxal oxidase-related family protein [Populus trichocarpa]
 gb|EEE81270.2| glyoxal oxidase-related family protein [Populus trichocarpa]
Length=506

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/513 (64%), Positives = 388/513 (76%), Gaps = 10/513 (2%)
 Frame = +1

Query  232   MHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPDDNCTAHSVEYDVAS  411
             MHMQLL ND+VV +DRT+ G SN+SLPDGKC +     +        +CTAHSVEYDV +
Sbjct  1     MHMQLLSNDRVVIYDRTDFGRSNLSLPDGKCRNDSSELVIKY-----DCTAHSVEYDVLA  55

Query  412   NSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCNDAECDWEEIPYGLVR  591
             N FRP++V SD WCSSG+V P G L+QTGG+ +G R VR FSPCN A+CDWEE+  GL  
Sbjct  56    NRFRPLMVQSDVWCSSGAVVPDGRLIQTGGFNDGERKVRIFSPCNGADCDWEEVGDGLKA  115

Query  592   PRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFLAQTTDPGLGAENNLYP  771
              RWY+T HILPDGRQII+GGRR FNYEF+PKS  A   YSLPFL +T D G+  ENNLYP
Sbjct  116   KRWYATSHILPDGRQIIIGGRRQFNYEFYPKSS-APNVYSLPFLMETNDRGI--ENNLYP  172

Query  772   FVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYPSSGSAVLLPLKNLKGP  951
             FV LN DGNLFIFANNRAIL D+  N VV+TYP IPGG+PR+YPS+GSAVLLPLKNL+  
Sbjct  173   FVFLNGDGNLFIFANNRAILFDHKTNKVVKTYPAIPGGDPRSYPSTGSAVLLPLKNLQAS  232

Query  952   TTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEWITEEMPFPRVMGDMVI  1131
             T  AEVLVCGG+PK ++   +   FV AL+TC RI I DPNP W+ E MP  RVMGDM +
Sbjct  233   TIEAEVLVCGGAPKGSFAKVENGTFVQALDTCARIKINDPNPRWVMETMPTARVMGDMTL  292

Query  1132  LPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFELQNPNKIPRMYHSSAVL  1311
             LP GNVLIINGA  G AGW+ GR+P  +PVLYRPD   GSRFELQNP+ IPRMYHS+A+L
Sbjct  293   LPNGNVLIINGAGAGTAGWEKGRDPVLNPVLYRPDDASGSRFELQNPSTIPRMYHSTAIL  352

Query  1312  ITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAALRPEIVSPASQSG--L  1485
             + DGRVLV GSNPH  Y+FT V FPTELS+EAFSPSYLDP +  LRP IVS ++  G  +
Sbjct  353   LRDGRVLVGGSNPHIGYEFTGVLFPTELSLEAFSPSYLDPNFDDLRPTIVSSSASEGKNI  412

Query  1486  SYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNTVKVKAAGEEEYGID  1665
              YG+ + V+FKV+ K+    V VTMV+PAF+THSFSMN RLLVL   KV   G   Y I 
Sbjct  413   GYGQKLLVRFKVTSKIVTDMVSVTMVAPAFNTHSFSMNHRLLVLGNEKVTVVGTSIYDIQ  472

Query  1666  VVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             V+ P SG+LAPSG+Y+L+VVH+EIPS+G+WV I
Sbjct  473   VMTPPSGDLAPSGHYMLYVVHQEIPSEGLWVKI  505



>ref|XP_003523554.1| PREDICTED: galactose oxidase-like [Glycine max]
Length=530

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/530 (61%), Positives = 394/530 (74%), Gaps = 13/530 (2%)
 Frame = +1

Query  175   AVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglgg  354
             A    G+W LL  +IGI AMHMQLLHND+V+ FDRT+ G SN++LPDG+C +     +  
Sbjct  13    AAEAKGQWQLLHKNIGIVAMHMQLLHNDRVIIFDRTDFGLSNLTLPDGRCRNNPNELVVK  72

Query  355   RKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
             R     +CTAHS+EYDVA+N+FR + V ++ WCSSGSVSP GTLVQTGG+ +G R VR F
Sbjct  73    R-----DCTAHSIEYDVAANTFRALFVQTNVWCSSGSVSPDGTLVQTGGFNDGYRAVRTF  127

Query  535   SPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSL  714
             +PC    CDW E+ +GL   RWY+T+HILPDGRQII+GGRR FNYEF+PK+   +T YSL
Sbjct  128   TPCRS--CDWAEVQHGLAAQRWYATNHILPDGRQIIIGGRRQFNYEFYPKTQAKNT-YSL  184

Query  715   PFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPR  894
             PFLAQT D    AENNLYPFV LNVDGNLFIFANNRAIL DY  N VVRTYP+IPGG+PR
Sbjct  185   PFLAQTNDAN--AENNLYPFVFLNVDGNLFIFANNRAILFDYNKNSVVRTYPQIPGGDPR  242

Query  895   NYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPN  1074
              YPS+GSAVLLPL+    P   AEVL+CGG+P+ A+ N     FVGAL TC RI ITDP 
Sbjct  243   CYPSTGSAVLLPLRE---PNVEAEVLICGGAPRGAFRNTLSGKFVGALRTCARIKITDPK  299

Query  1075  PEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSR  1254
               W+ E MP  RVM DMV+LP G+VLI+NGA  G AGW+LGRNP  +P LY+P+   G R
Sbjct  300   ANWVMETMPGARVMSDMVLLPNGDVLIVNGAAVGTAGWELGRNPVLNPFLYKPNKRVGMR  359

Query  1255  FELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPK  1434
             FE+QNP+ IPRMYHS AVL+ DGRVL+AGSNPH  Y FT V FPTEL +EAFSP YL+P 
Sbjct  360   FEVQNPSHIPRMYHSGAVLLRDGRVLLAGSNPHTYYNFTKVLFPTELRLEAFSPWYLEPG  419

Query  1435  YAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLV  1614
             ++ +RP IVSPASQ+ L YG+ + ++FKVS  +    V VTM++P F+THSFSMNQRLLV
Sbjct  420   FSNVRPAIVSPASQTKLKYGQTLRLRFKVSATLVGDSVSVTMLAPPFNTHSFSMNQRLLV  479

Query  1615  LNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             L    +   GE  + ++V AP S  LAP G+YLLFVVH+E+PS GIWV +
Sbjct  480   LKPHHLSGVGESTHEVEVTAPASAVLAPPGFYLLFVVHQEVPSHGIWVQM  529



>ref|XP_008350495.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=536

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/541 (60%), Positives = 399/541 (74%), Gaps = 23/541 (4%)
 Frame = +1

Query  145   NRGFFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKC  324
             N    TA AA    GGKW +L+ ++GISAMHMQL  ND++V FDRT+ G SN+SL +G C
Sbjct  17    NFSVLTAHAA----GGKWQVLK-NVGISAMHMQLFKNDRIVMFDRTDFGKSNLSLANGNC  71

Query  325   HHggggglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGY  504
                           +++CTAHS E+ V +N+ RP+ VLSD WCSSGS+   G L+QTGG+
Sbjct  72    -------------VNNDCTAHSAEFVVQTNALRPLTVLSDVWCSSGSMDAYGNLIQTGGF  118

Query  505   GEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPK  684
               G R VR F+PC    CDW+E   GL   RWY+T+H+LPDGR+II+GGR  FNYEF PK
Sbjct  119   NSGERRVRVFTPCTG--CDWKETVDGLAVRRWYATNHMLPDGREIIIGGRGQFNYEFSPK  176

Query  685   SGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRT  864
             +      YSLPFL+QT DPG   ENNLYPFV LN DGNLFIFANNRAILLDYV N VV+T
Sbjct  177   TESTSNVYSLPFLSQTNDPG--QENNLYPFVFLNPDGNLFIFANNRAILLDYVKNAVVKT  234

Query  865   YPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNT  1044
             YP+IPGG+PR+YPS+GSAVLLPLKNL  P   AEVLVCGG+PK ++  A + +FV ALNT
Sbjct  235   YPQIPGGDPRSYPSTGSAVLLPLKNLTAPAVEAEVLVCGGAPKGSFSQANKGVFVEALNT  294

Query  1045  CGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVL  1224
             C RI ITDPNP+WI E MP  RVMGDM++LP   VLIINGA++GAAGW++GRNP  +PV+
Sbjct  295   CARIKITDPNPQWIVETMPQARVMGDMILLPDSTVLIINGASSGAAGWEIGRNPVLNPVV  354

Query  1225  YRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKF-TNVFFPTELSM  1401
             Y+PD   GSRFE QNP  IPRMYHSSA+L+ DGRV+V GSNPH  Y+F +NV FPTEL +
Sbjct  355   YQPDNAIGSRFEQQNPTTIPRMYHSSALLVRDGRVIVGGSNPHDKYQFGSNVLFPTELRL  414

Query  1402  EAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFST  1581
             EAFSP YLD KYA LRP I++P +Q+ + YG  ++VQF ++G+  M+ V VTMV+P FST
Sbjct  415   EAFSPEYLDAKYADLRPTIIAPRNQAKIRYGRKLTVQFSLAGRFAMNSVSVTMVAPPFST  474

Query  1582  HSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVH  1761
             HSFSMNQRLLVL        G   Y   V  P SGNLAPSGYY+L+VVH++IPS+GI+V 
Sbjct  475   HSFSMNQRLLVLGAENTHQVGPTTYEAQVTTPPSGNLAPSGYYILYVVHQQIPSEGIFVK  534

Query  1762  I  1764
             I
Sbjct  535   I  535



>ref|XP_010540180.1| PREDICTED: galactose oxidase-like [Tarenaya hassleriana]
Length=565

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/553 (61%), Positives = 403/553 (73%), Gaps = 31/553 (6%)
 Frame = +1

Query  160   TAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggg  339
             T   A   GGG+W LL  S+GISAMHMQLL ND+V+ FDRT+ GPSNISLP G C     
Sbjct  27    TCHVATAAGGGRWQLLLRSVGISAMHMQLLRNDRVIMFDRTDFGPSNISLPGGNC-----  81

Query  340   gglggRKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGY  504
                  R  P+D     +CTAHSVE+DV SN  RP+ V S+ WCSSGSV P GTLVQTGG 
Sbjct  82    -----RSNPNDRVSKVDCTAHSVEFDVISNGIRPLTVQSNTWCSSGSVMPDGTLVQTGGD  136

Query  505   GEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPK  684
              +G R  R FSPC   +CDW+E+  GL   RWY+++HILPDG QIIVGGR  FN+EF+PK
Sbjct  137   LDGERRARLFSPCFSNDCDWKELENGLALRRWYASNHILPDGSQIIVGGRGQFNFEFYPK  196

Query  685   SGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRT  864
             +   +  Y+LPFLAQT D   G+ENNLYPFV LNVDGNLF+FANNRAILLDY  N VV+T
Sbjct  197   TKDPNV-YNLPFLAQTND--RGSENNLYPFVFLNVDGNLFVFANNRAILLDYNKNTVVKT  253

Query  865   YPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNA-KRNIFVGALN  1041
             YP IPGG+PR+YPS+GSAVLLPLKNL+     AEVLVCGG+P+ AY  A +RN F+ ALN
Sbjct  254   YPAIPGGDPRSYPSTGSAVLLPLKNLEAIDVEAEVLVCGGAPRGAYEQAWRRNNFIKALN  313

Query  1042  TCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPV  1221
             TC RI ITDPNP+W+ E MP  RVMGDM +LP G+VLIING  +G A W+LGR+P F P 
Sbjct  314   TCARIRITDPNPQWVVESMPQARVMGDMTLLPNGDVLIINGGASGTAAWELGRDPIFAPD  373

Query  1222  LYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSM  1401
             LYRPD P GSRFE QNPN IPRMYHS+AVL+ DGRVLV GSNPHA Y FT V FPTELS+
Sbjct  374   LYRPDNPVGSRFETQNPNTIPRMYHSTAVLLRDGRVLVGGSNPHAFYNFTGVLFPTELSL  433

Query  1402  EAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFST  1581
             EAF PSYLD +++ LRP I SP SQ  + Y   + ++F VSG+V  S VKVTMV P+F+T
Sbjct  434   EAFLPSYLDQQFSNLRPMITSPKSQVKIKYNMKLKLKFTVSGEVK-SPVKVTMVFPSFTT  492

Query  1582  HSFSMNQRLLVLNTVKV-----------KAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVH  1728
             HSFSMNQR+LVL+ +K            K      Y ++V  P S N+AP GYY++FVV+
Sbjct  493   HSFSMNQRVLVLDNIKTPKIWDFFNFLRKGKSTSTYEVEVKTPRSANIAPPGYYMMFVVN  552

Query  1729  REIPSKGIWVHIQ  1767
             ++IPS+GIWV +Q
Sbjct  553   QDIPSEGIWVQLQ  565



>ref|XP_004499224.1| PREDICTED: galactose oxidase-like [Cicer arietinum]
Length=549

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/530 (61%), Positives = 400/530 (75%), Gaps = 12/530 (2%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
             G G+W  LQ +IGI AMHMQLLHND++V FDRT+ G SN+SLP+GKC H           
Sbjct  28    GNGQWQQLQKNIGIVAMHMQLLHNDRIVIFDRTDFGLSNLSLPNGKCRHDPKETTV----  83

Query  364   PDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPC  543
                +CTAHSVEYDV SN+FR + V +D WCSSG+V+P G L+QTGG+ +G R VR ++PC
Sbjct  84    -KTDCTAHSVEYDVKSNTFRALFVQTDVWCSSGTVNPNGILIQTGGFNDGDRAVRIYNPC  142

Query  544   NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADT-FYSLPF  720
             +D  CDW+E   GL   RWY+TDHILPDGRQII+GGR+ FNYEF+PK+   D   Y+LPF
Sbjct  143   DD--CDWQEFDGGLTARRWYATDHILPDGRQIIIGGRKQFNYEFYPKNHEVDKKVYNLPF  200

Query  721   LAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNY  900
             L +T D G   ENNLYPFV LNVDGNLF+FANNRAILLDY  N VVRT+P++PGGEPR+Y
Sbjct  201   LDETNDRG--EENNLYPFVFLNVDGNLFVFANNRAILLDYTKNAVVRTFPQVPGGEPRSY  258

Query  901   PSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPE  1080
             PS+GS VLLPLKNL+     AEVL+CGG+PK ++  A +N F+ ALNTC RI ITDPNP+
Sbjct  259   PSTGSGVLLPLKNLQSKAVEAEVLICGGAPKGSFQLATKNKFLKALNTCVRIKITDPNPK  318

Query  1081  WITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFE  1260
             W+ E MP  RVM DMV+LP GNVLIINGA +G AGW+ GR+P  +PVLY+ D P GSRFE
Sbjct  319   WVMETMPGSRVMSDMVMLPNGNVLIINGAGSGTAGWEFGRDPVLNPVLYKTDNPIGSRFE  378

Query  1261  LQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYA  1440
             LQNP++ PRMYHSSAVL+ DGRVLV GSNP+  Y F NV FPTELS+EAFSPSYL+P++A
Sbjct  379   LQNPSETPRMYHSSAVLVRDGRVLVGGSNPYIGYNFINVLFPTELSIEAFSPSYLEPRFA  438

Query  1441  ALRPEIVS--PASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLV  1614
              +RP+I+S    SQ+ L YG+ + ++F+V   +D + + VT+++P F+THSFSMNQRLLV
Sbjct  439   NVRPKIMSHISESQTKLRYGQKLVLRFQVKTTLDRNLLYVTLLAPPFNTHSFSMNQRLLV  498

Query  1615  LNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             L   KV       Y I V  P S  LAP G+Y+LFVVH+EIPS+GIW+ +
Sbjct  499   LEPNKVNNVAGTTYEIVVTIPGSTILAPPGFYMLFVVHKEIPSEGIWIQM  548



>ref|XP_008466509.1| PREDICTED: galactose oxidase-like [Cucumis melo]
Length=555

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/545 (60%), Positives = 398/545 (73%), Gaps = 17/545 (3%)
 Frame = +1

Query  139   FHNRGFFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDG  318
             F N   F+        GG W LLQ ++GISAMHMQLL ND+VV +DRT+ GPSN+SLP G
Sbjct  24    FANLLLFSGLPPTAAAGGSWRLLQRNVGISAMHMQLLQNDRVVMYDRTDFGPSNLSLPGG  83

Query  319   KCHHggggglggRKPPDD---NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLV  489
             KC          R P      +CTAHS+EY+V +N+FRP++VLSD WCSSGSVSP GTLV
Sbjct  84    KC---------LRDPTAKIKVDCTAHSIEYNVITNTFRPLMVLSDVWCSSGSVSPDGTLV  134

Query  490   QTGGYGEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNY  669
             QTGG+  G R VR F PC  + CDW+EIP  L   RWY+T+HILPDGRQII+GGRR FNY
Sbjct  135   QTGGFNSGERRVRTFKPC--STCDWKEIPLALSARRWYATNHILPDGRQIIIGGRRQFNY  192

Query  670   EFFPKSGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNN  849
             EF+PK       + L FLA+T D  +G ENNLYPFV L  DGNLFIFANNRAIL DY  N
Sbjct  193   EFYPKDRATQNVFDLRFLAETND--IGIENNLYPFVFLQPDGNLFIFANNRAILFDYTKN  250

Query  850   VVVRTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFV  1029
              VVR +P IP G+ RNYPS+GSAV+LPLK +       EVLVCGG+P  +Y  A   IFV
Sbjct  251   GVVRKFPAIPDGQHRNYPSTGSAVMLPLK-VDAKFIEVEVLVCGGAPIGSYDRANHGIFV  309

Query  1030  GALNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPA  1209
              AL TC RI ITD NP+W+ E MP PRVM DM++LP GNVL+ING + GAAGW++GR P 
Sbjct  310   DALRTCARIKITDRNPQWVMETMPQPRVMVDMLLLPNGNVLLINGGSAGAAGWEIGRKPV  369

Query  1210  FHPVLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPT  1389
              +PV+Y  + P G RFELQNP  IPRMYHS+A+L+ DGRVLV GSNPHA Y FT V +PT
Sbjct  370   LNPVIYHTNNPVGKRFELQNPTTIPRMYHSTAILLRDGRVLVGGSNPHAGYNFTGVLYPT  429

Query  1390  ELSMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSP  1569
             EL +EAFSPSYLDP++A LRP I  PAS + L +G+ + V F V GKVD +++ VT++SP
Sbjct  430   ELRLEAFSPSYLDPEFAYLRPAIQFPASSAKLRHGQALKVGFTVPGKVDSTKLSVTILSP  489

Query  1570  AFSTHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKG  1749
             +F+THSFSMNQRLL+L+T K +  G ++Y ++V  P SGN+APSGYY+L++VH+EIPS G
Sbjct  490   SFNTHSFSMNQRLLILSTGKYRLRGNKKYEVEVTIPGSGNVAPSGYYILYLVHKEIPSVG  549

Query  1750  IWVHI  1764
             IWV I
Sbjct  550   IWVQI  554



>ref|XP_006416454.1| hypothetical protein EUTSA_v10007284mg [Eutrema salsugineum]
 gb|ESQ34807.1| hypothetical protein EUTSA_v10007284mg [Eutrema salsugineum]
Length=547

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/534 (62%), Positives = 401/534 (75%), Gaps = 20/534 (4%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GGKWNLL P++GISAMHMQLL ND+VV FDRTN GPSNISLP+G C          R  
Sbjct  28    AGGKWNLLLPNVGISAMHMQLLRNDRVVMFDRTNFGPSNISLPNGNC----------RNN  77

Query  364   PDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
             P+D     +CTAHS+EYDVASN+ RP+ V S+ WCSSGSV P G LVQTGG  +G    R
Sbjct  78    PNDAVSKIDCTAHSIEYDVASNTVRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKAR  137

Query  529   RFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFY  708
              F+PCN+  CDW EI  GL R RWYS++HILPDG+QIIVGG R FNYEF+PK+   +   
Sbjct  138   TFTPCNNDRCDWAEINNGLARRRWYSSNHILPDGKQIIVGGTRQFNYEFYPKTTSPNVI-  196

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
             +LPFLA+T D   G ENNLYP+V LN DGNLFIFANNRAILLDY  N VV+T+P IPGG+
Sbjct  197   ALPFLAETND--RGQENNLYPYVFLNTDGNLFIFANNRAILLDYTKNTVVKTFPAIPGGD  254

Query  889   PRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITD  1068
             PR+YPS+GSAVLLPLKNL+     AEVLVCGG+PK ++  A+RN FV AL+TC RI I D
Sbjct  255   PRSYPSTGSAVLLPLKNLEAVKIDAEVLVCGGAPKGSFILARRNTFVRALDTCARIKIND  314

Query  1069  PNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPG  1248
              NP+W  E+MP  RVMGDM +LP G+VL+ING ++G+A W+LGR P F P LY P+ P  
Sbjct  315   ENPQWTVEKMPRARVMGDMTLLPNGDVLLINGGSSGSAAWELGREPVFVPDLYHPENPVN  374

Query  1249  SRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLD  1428
             SRFE  NP+KIPRMYHS+AVL+ DGRVLV GSNPHA Y FT V FPTELS+EAFSP YL+
Sbjct  375   SRFESLNPSKIPRMYHSAAVLLRDGRVLVGGSNPHAFYNFTGVLFPTELSLEAFSPVYLE  434

Query  1429  PKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRL  1608
             P++A LRP+I++P SQS + Y   + ++FKV+G+V    VKVTMV P+F+THSFSMNQRL
Sbjct  435   PEFANLRPKIMAPKSQSSIKYRMNLKLKFKVAGEVK-GPVKVTMVFPSFTTHSFSMNQRL  493

Query  1609  LVLNTVKVKAAGEE-EYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             LVL+ VK    G+   Y + V  P S  +AP GYY++FVV++ IPS+GIWV +Q
Sbjct  494   LVLDNVKFTRNGKSTNYEVLVRTPRSAIIAPPGYYMMFVVNQNIPSEGIWVRLQ  547



>ref|XP_010536368.1| PREDICTED: galactose oxidase-like [Tarenaya hassleriana]
Length=557

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/530 (61%), Positives = 397/530 (75%), Gaps = 12/530 (2%)
 Frame = +1

Query  187   GGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPP  366
             GG W LLQ ++GISAMHMQLLHND+V+ FDRT+ GPSNISLP GKC +         +  
Sbjct  37    GGSWQLLQLNVGISAMHMQLLHNDRVITFDRTDFGPSNISLPSGKCRNNQND-----RVS  91

Query  367   DDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCN  546
               +CTAHSVEYDV  N  RP+ V S+ WCSSGSV+P GTLVQTGG  +G R  R F PC 
Sbjct  92    KLDCTAHSVEYDVLGNGIRPLTVQSNTWCSSGSVTPDGTLVQTGGDLDGERRARLFFPCK  151

Query  547   DAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFLA  726
               +CDW EI  GL   RWY+++HILPDGRQIIVGGR  FN+EF+PK+   +  Y+LPFLA
Sbjct  152   TNKCDWSEIDNGLALRRWYASNHILPDGRQIIVGGRGQFNFEFYPKTKDPNV-YNLPFLA  210

Query  727   QTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYPS  906
             QT D   G+ENNLYP+V LNVDGN+FIFANNRAILLDY  N++V+TYP IPGG+PR+YPS
Sbjct  211   QTND--RGSENNLYPYVFLNVDGNIFIFANNRAILLDYTKNIIVKTYPTIPGGDPRSYPS  268

Query  907   SGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNA-KRNIFVGALNTCGRIVITDPNPEW  1083
             +GSAV LPLKNL+     AEVLVCGG+P+ AY  A +RN FV ALNTC RI ITDPNP W
Sbjct  269   TGSAVFLPLKNLEAANVEAEVLVCGGAPRGAYEQAWRRNNFVKALNTCARIKITDPNPNW  328

Query  1084  ITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFEL  1263
             + E MP  RVMGDM +LP GNVL++NG  +G A W+LGR P   P LY P+ P GSRFE 
Sbjct  329   VMETMPQARVMGDMTLLPNGNVLLVNGGASGTAAWELGREPVLAPDLYLPENPVGSRFET  388

Query  1264  QNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAA  1443
             QNP+ IPRMYHS+AVL+ DGRVLV GSNPHA Y FT V FPTELS+E+FSPSYL+ + + 
Sbjct  389   QNPSTIPRMYHSTAVLLRDGRVLVGGSNPHAFYNFTGVLFPTELSLESFSPSYLNQEMSG  448

Query  1444  LRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNT  1623
             LRP+I SP SQ  + Y   V ++F V  +V+ + +KVTMV P+F+THSFSMNQRLLVL+ 
Sbjct  449   LRPKITSPKSQFKMKYNTKVKLRFSVQSEVE-NPMKVTMVFPSFTTHSFSMNQRLLVLDN  507

Query  1624  VKV--KAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             VK   K+  +  Y ++V  P S NLAP GYY++FVV++++PS+GIWV +Q
Sbjct  508   VKFTRKSKAKTVYEVEVKTPRSANLAPPGYYMMFVVNQDVPSEGIWVRLQ  557



>ref|XP_009336713.1| PREDICTED: galactose oxidase-like [Pyrus x bretschneideri]
Length=537

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/540 (60%), Positives = 396/540 (73%), Gaps = 22/540 (4%)
 Frame = +1

Query  148   RGFFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCH  327
              GF     AA   GG W LL  +IG+SAMHMQL  ND++V FD T+ G SN+SLPDG C 
Sbjct  18    HGFSRTTHAA---GGNWQLLA-TIGVSAMHMQLFKNDRIVLFDNTDFGKSNLSLPDGNC-  72

Query  328   HggggglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYG  507
                          +++CTAHS E+ V + +FRP+ VLSD WCSSGS++P G L+Q+GG+ 
Sbjct  73    ------------VNNDCTAHSAEFVVQTKAFRPLTVLSDVWCSSGSMAPNGNLIQSGGFN  120

Query  508   EGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKS  687
              G R VR F PC    CDW EI  GL   RWY+T+H+LPDGRQII+GG + FNYEF+PK+
Sbjct  121   SGERRVRVFQPCTG--CDWTEIVDGLAVRRWYATNHVLPDGRQIIIGGTKQFNYEFYPKT  178

Query  688   GPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTY  867
                   Y+LPFL+QT DPG   ENNLYPFV LN DG LFIFANNRAILLDY+ NVVV+TY
Sbjct  179   ESTSNAYNLPFLSQTNDPG--EENNLYPFVFLNPDGYLFIFANNRAILLDYMKNVVVKTY  236

Query  868   PEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTC  1047
             P+I GG+PR YPSSGSAVLLPLKNL  P+  AEV VCGG+PK ++  A + IFV ALNTC
Sbjct  237   PQIQGGDPRCYPSSGSAVLLPLKNLTAPSVEAEVFVCGGAPKGSFAQANKGIFVEALNTC  296

Query  1048  GRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLY  1227
              RI ITDPNP+WI E MP  RVMGDM++LP   VL+INGA++G AGW++GRNP  +PV+Y
Sbjct  297   ARIKITDPNPQWIVETMPQARVMGDMILLPDSTVLLINGASSGVAGWEIGRNPVLNPVVY  356

Query  1228  RPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKF-TNVFFPTELSME  1404
             RPD   GSRFE QNP  IPRMYHSSA+L+ DGRV+V GSNPH  Y+F +NV FPTE  +E
Sbjct  357   RPDNAVGSRFEQQNPTTIPRMYHSSALLVRDGRVVVGGSNPHDKYQFGSNVLFPTEFRLE  416

Query  1405  AFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTH  1584
             AFSP YLD KYA LRP I++P +Q+ + YG  +++QF ++G + M+ V VTMV+P FSTH
Sbjct  417   AFSPEYLDAKYADLRPTILTPLNQAKIRYGIKLTIQFSLTGTLAMNSVSVTMVAPPFSTH  476

Query  1585  SFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             SFSMNQRLLVL    V+  G   Y   V  P SGNLAPSGYY+L+VVH++IPS+GI+V I
Sbjct  477   SFSMNQRLLVLGAENVQKVGPTTYQAQVTTPPSGNLAPSGYYILYVVHQQIPSEGIFVQI  536



>ref|NP_177692.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
 gb|AAF87115.1|AC006434_11 F10A5.18 [Arabidopsis thaliana]
 gb|AEE35738.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
Length=547

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/544 (61%), Positives = 401/544 (74%), Gaps = 25/544 (5%)
 Frame = +1

Query  154   FFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHg  333
             F  +   A    G W LL P++GISAMH QLLHND+V+ +DRTN GPSNISLP+G C   
Sbjct  23    FLLSCHVASGDEGTWELLLPNVGISAMHSQLLHNDRVIMYDRTNFGPSNISLPNGAC---  79

Query  334   gggglggRKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTG  498
                    R  P D     +CTAHSVEYDVA N  RP+ V S+ WCSSG V+P GTL+QTG
Sbjct  80    -------RSSPGDAVSKTDCTAHSVEYDVALNRIRPLTVQSNTWCSSGGVTPDGTLLQTG  132

Query  499   GYGEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFF  678
             G  +G R VR   PC+D  CDW E+  GL   RWY+T+HILPDGRQII+GGR  FNYEFF
Sbjct  133   GDLDGERKVRLMDPCDDNSCDWIEVDNGLAARRWYATNHILPDGRQIIIGGRGQFNYEFF  192

Query  679   PKSGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVV  858
             PK+  A  FYS+PFL++T DPG   ENNLYPFV LN DGNLFIFANNRAILLDY  N VV
Sbjct  193   PKTN-APNFYSIPFLSETNDPG--DENNLYPFVFLNTDGNLFIFANNRAILLDYSTNTVV  249

Query  859   RTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGAL  1038
             RTYPEIPGG+PR+YPS+GSAVLLP+KNL     + EVLVCGG+PK +Y  + RN FV AL
Sbjct  250   RTYPEIPGGDPRSYPSTGSAVLLPIKNL-----VLEVLVCGGAPKGSYNLSWRNTFVKAL  304

Query  1039  NTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHP  1218
             +TC RI I D NP+WI E+MP  RVMGDM++LP GNVL+ING ++G A W+LGR P  HP
Sbjct  305   DTCARININDVNPQWIVEKMPRARVMGDMMLLPDGNVLLINGGSSGTAAWELGREPVLHP  364

Query  1219  VLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELS  1398
              LY PD P GSRFE+QNP+ IPRMYHS A L+ DGR+LV GSNPHA Y FT V FPTEL 
Sbjct  365   DLYHPDKPVGSRFEVQNPSTIPRMYHSIATLLRDGRILVGGSNPHAFYNFTGVLFPTELR  424

Query  1399  MEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFS  1578
             +EAFSPSYLD KY++LRP IV P  Q+ ++YG V+ ++F VSG+V  S VKVTM+ P+F+
Sbjct  425   LEAFSPSYLDTKYSSLRPSIVDPRPQTTVNYGRVLRLRFIVSGRVK-SPVKVTMLFPSFT  483

Query  1579  THSFSMNQRLLVLN-TVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIW  1755
             THSFSM+QRLLVL+  +  K    + Y + V  P S  LAP GYY++FVV+++IPS+G+W
Sbjct  484   THSFSMHQRLLVLDHVISFKLGISKIYEVRVRTPSSAILAPPGYYMVFVVNQDIPSEGLW  543

Query  1756  VHIQ  1767
             V +Q
Sbjct  544   VRLQ  547



>ref|XP_004238324.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=545

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/535 (61%), Positives = 403/535 (75%), Gaps = 24/535 (4%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GGKW+LL  +IGISAMHMQLL+ND+V+ +DRT+ G SNISLP+GKC          R  
Sbjct  28    AGGKWDLLMSNIGISAMHMQLLNNDRVIIYDRTDFGASNISLPNGKC----------RNN  77

Query  364   PDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
             P D     +CTAHSVEYDV++NS RP++V +D WCSSGS +  GTLVQTGG+ +G  +VR
Sbjct  78    PKDLALKIDCTAHSVEYDVSTNSVRPLMVQTDVWCSSGSATADGTLVQTGGFNDGRNMVR  137

Query  529   RFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFY  708
              F PC  + CDW+EI  GL++ RWYST+HILPDG QII+GGR  FNYEFFPK+   +  +
Sbjct  138   TFKPC--STCDWQEIGNGLIQSRWYSTNHILPDGSQIIIGGRDTFNYEFFPKTASTNKVF  195

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
             +LPF+ QT  P    ENNLYPFV LNVDGNLFIFANNRAILLD+  N +V+TYP+IPGG+
Sbjct  196   NLPFIQQTNVPK--EENNLYPFVFLNVDGNLFIFANNRAILLDHTTNTIVKTYPQIPGGD  253

Query  889   PRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKR-NIFVGALNTCGRIVIT  1065
             PRNYPS+GSAVLLPLK     T  AEVLVCGG+P  +Y  A R N FVGALNTCGRI IT
Sbjct  254   PRNYPSTGSAVLLPLKT---QTIQAEVLVCGGAPIGSYLKAARANTFVGALNTCGRITIT  310

Query  1066  DPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPP  1245
             DPNP+W  E MP  R MGDMVILP GNVLI+NGA  G AGW + RNP   PV+YRPD P 
Sbjct  311   DPNPQWTMETMPLARTMGDMVILPNGNVLIVNGAAAGTAGWGIARNPVLSPVIYRPDNPS  370

Query  1246  GSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYL  1425
             GSRFE+QNPN  PRMYHS+AVL+ DGRVLV GSNP+  Y FT V FPT+LS+EAFSPSYL
Sbjct  371   GSRFEVQNPNATPRMYHSTAVLLRDGRVLVGGSNPNELYNFTRVLFPTDLSLEAFSPSYL  430

Query  1426  DPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGK-VDMSQVKVTMVSPAFSTHSFSMNQ  1602
             +   A LRP+I+SP S   + YG+ ++++F +SG  V+ + +KVTMV+P F+THS +MNQ
Sbjct  431   ESNSANLRPQIISPGSHKKIKYGQRLNIRFTLSGSLVNTNLIKVTMVAPGFNTHSNTMNQ  490

Query  1603  RLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             R+L+L+  KVK  G   Y +  + P+SG LAP GYYLLFVV+++IPS+GIW+ IQ
Sbjct  491   RMLLLSNEKVKKIGILTYQVSSIFPNSGKLAPPGYYLLFVVNQDIPSEGIWIKIQ  545



>ref|XP_008348975.1| PREDICTED: galactose oxidase-like [Malus domestica]
Length=536

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/528 (61%), Positives = 394/528 (75%), Gaps = 19/528 (4%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GGKW +L+ ++GISAMHMQL  ND++V FDRT+ G SN+SLP+G C             
Sbjct  26    AGGKWQVLK-NVGISAMHMQLFKNDRIVLFDRTDFGKSNLSLPNGNC-------------  71

Query  364   PDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPC  543
               ++CTAHS E+ V +N+ RP+ VLSD WCSSGS+   G L+QTGG   G R VR F+PC
Sbjct  72    VXNDCTAHSAEFVVQTNAVRPLTVLSDVWCSSGSMDAYGNLIQTGGNNIGERRVRVFTPC  131

Query  544   NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFL  723
                 CDW+EI  GL   RWY+T+HILPDGR+II+GGR  FNYEF+PK+      YSLPFL
Sbjct  132   TG--CDWKEIVDGLAARRWYATNHILPDGREIIIGGRGQFNYEFYPKTASTSNVYSLPFL  189

Query  724   AQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYP  903
             +QT DPG   ENNLYPFV LN DGNLF+FANNRAILLDYV NVVV+TYP+IPGG+PR+YP
Sbjct  190   SQTNDPG--QENNLYPFVFLNPDGNLFVFANNRAILLDYVKNVVVKTYPQIPGGDPRSYP  247

Query  904   SSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEW  1083
             S+GSAVLLPLKNL  P+  AEVLVCGG+PK ++  A +  FV ALNTC RI ITDPN +W
Sbjct  248   STGSAVLLPLKNLMAPSVEAEVLVCGGAPKGSFVQANKGTFVEALNTCARIKITDPNAQW  307

Query  1084  ITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFEL  1263
             I E MP  RVMGDM++L    VL+INGA++G AGW++GRNP F+PV+YRPD   GSRFE 
Sbjct  308   IVETMPQARVMGDMLLLXDSTVLLINGASSGVAGWEIGRNPVFNPVVYRPDNAVGSRFEQ  367

Query  1264  QNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKF-TNVFFPTELSMEAFSPSYLDPKYA  1440
             QNP  IPRMYHSSA+L+ DGRV+V GSNPH  Y+F ++V FPTEL +EAFSP YLD KYA
Sbjct  368   QNPTTIPRMYHSSALLVRDGRVIVGGSNPHDKYQFGSDVLFPTELRLEAFSPEYLDAKYA  427

Query  1441  ALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLN  1620
              LRP I++P +Q+ + YG  ++VQF ++G    + V VTMV+P FSTHSFSMNQRLLVL 
Sbjct  428   NLRPTIIAPGNQAKIHYGIKLAVQFSLTGTFTKNSVSVTMVAPPFSTHSFSMNQRLLVLA  487

Query  1621  TVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
                V+  G   Y + V  P S NLAPSGYY+L+VVH++IPS+GI+V I
Sbjct  488   AENVQQVGPTTYQVQVTTPPSKNLAPSGYYILYVVHQQIPSEGIFVKI  535



>ref|XP_002510488.1| Galactose oxidase precursor, putative [Ricinus communis]
 gb|EEF52675.1| Galactose oxidase precursor, putative [Ricinus communis]
Length=547

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/534 (60%), Positives = 398/534 (75%), Gaps = 21/534 (4%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GG+W LLQ +IGI+AMHMQLL+ND+VV FDRT+ G SN+SLP+GKC          RK 
Sbjct  29    AGGRWQLLQENIGITAMHMQLLNNDRVVIFDRTDFGLSNLSLPNGKC----------RKD  78

Query  364   PDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
             P +     +CTAHSVEYDV SN  R ++V ++ WCSSG+V P G+L+QTGG+ +G R VR
Sbjct  79    PTELVLKTDCTAHSVEYDVLSNQIRALMVQTNVWCSSGAVMPDGSLIQTGGFNDGERKVR  138

Query  529   RFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFY  708
              F PC  + CDW E+  GL   RWY+T+HILPDG+QII+GGRR FNYEF+PKS   D  Y
Sbjct  139   TFDPC--SSCDWVELGDGLKARRWYATNHILPDGKQIIIGGRRQFNYEFYPKSAAPDV-Y  195

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
             SL FL +T D  +  ENNLYPFV LNVDGNLFIFANNRAI+ DY    VV+TYP IPGG+
Sbjct  196   SLRFLVETNDRNI--ENNLYPFVFLNVDGNLFIFANNRAIMFDYKVAKVVKTYPTIPGGD  253

Query  889   PRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITD  1068
             PR+YPS+GSAV+LPLKN +     AEVLVCGG+PK +Y  A +  FV AL+TCGR+ ITD
Sbjct  254   PRSYPSTGSAVMLPLKNSQAENIEAEVLVCGGAPKGSYTEAMKGNFVKALDTCGRMKITD  313

Query  1069  PNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPG  1248
              NP+W  E MP  RVMGDM+ LP GNV+I+NG   G AGW+ GRNP  +PVLY+PD   G
Sbjct  314   ANPQWTIETMPEARVMGDMIFLPNGNVIIVNGGGAGTAGWEYGRNPVLNPVLYKPDNAIG  373

Query  1249  SRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFT-NVFFPTELSMEAFSPSYL  1425
             SRFE QNP+ IPRMYHS+A+L+ DGRVLV GSNPH  Y F+ +VFFPTEL +EAFSP+YL
Sbjct  374   SRFESQNPSTIPRMYHSTAILLRDGRVLVGGSNPHINYNFSKDVFFPTELRLEAFSPAYL  433

Query  1426  DPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQR  1605
             D     LRP I+SPAS+S L Y + ++V+FKV+G++  + V VTMV+P+F+THSFSMNQR
Sbjct  434   DTANNNLRPTIISPASKSRLGYAQKLAVRFKVTGRLTENTVSVTMVAPSFTTHSFSMNQR  493

Query  1606  LLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             LLVL+  KV   G   Y + V AP S NLAP G+YLLFVVH +IPS+GIWV ++
Sbjct  494   LLVLDNEKVTDVGTGTYDVQVTAPRSTNLAPPGFYLLFVVHEDIPSEGIWVQVR  547



>ref|XP_010111102.1| hypothetical protein L484_008478 [Morus notabilis]
 gb|EXC30148.1| hypothetical protein L484_008478 [Morus notabilis]
Length=544

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/535 (59%), Positives = 399/535 (75%), Gaps = 13/535 (2%)
 Frame = +1

Query  160   TAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggg  339
             TAAA     GG+W LLQ SIGI+AMHMQLL+ND+VV FDRT+ G S +SLPDGKC +   
Sbjct  22    TAAA-----GGRWQLLQKSIGITAMHMQLLNNDRVVIFDRTDFGRSQLSLPDGKCRNDRF  76

Query  340   gglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTR  519
                        +CTAHS EYDV SN+FR + V +D WCSSG+V   GTL+QTGGY +G R
Sbjct  77    DTALKV-----DCTAHSAEYDVTSNTFRALTVQTDVWCSSGAVIADGTLIQTGGYNDGER  131

Query  520   VVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPAD  699
              VR F PC+   CDW+EI  GL   RWY+T+HILPDGRQII+GGRR FNYE++PK    +
Sbjct  132   RVRVFKPCDGRTCDWQEIDLGLSAKRWYATNHILPDGRQIIIGGRRQFNYEYYPKDTDKN  191

Query  700   TFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIP  879
               ++LPFL++T D  +  ENNLYPFV LN DGNLF+FANNRAIL +Y +N VV+TYP+IP
Sbjct  192   V-HNLPFLSETNDKRI--ENNLYPFVFLNTDGNLFVFANNRAILWNYASNQVVKTYPQIP  248

Query  880   GGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIV  1059
             GG+PR+YPS+GSAVLLPLKN++     AEVLVCGG+PK AY  A R  FV AL TC RI 
Sbjct  249   GGDPRSYPSTGSAVLLPLKNIQARNVKAEVLVCGGAPKGAYVQAARKKFVEALKTCARIK  308

Query  1060  ITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDA  1239
             ITDPNP W+ E MP  RVMGDM +LP G+VLIINGA +G AGW+   +P  +PVLYRPD 
Sbjct  309   ITDPNPNWVVENMPRARVMGDMALLPNGHVLIINGAGSGTAGWENAIDPVLNPVLYRPDN  368

Query  1240  PPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPS  1419
               GSRFE++NP K PRMYHS+A+L+ DGR+LV GSNPHA Y FT V FPT LS+EAFSP+
Sbjct  369   KAGSRFEVENPTKTPRMYHSAAMLLRDGRILVGGSNPHAGYNFTGVTFPTTLSLEAFSPN  428

Query  1420  YLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMN  1599
             YL  +++ +RP I+ P S + + Y + + V+F++ G V  + V VT+VSP+F+THSFSMN
Sbjct  429   YLGEEFSNVRPRILLPTSHTKVKYAQKLFVRFRIGGNVAQNLVSVTLVSPSFTTHSFSMN  488

Query  1600  QRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             QRLLVL + ++++ G++ Y ++V  P S  LAP+GYYLLFV H+EIPS+G+WV +
Sbjct  489   QRLLVLPSGQIRSLGKKTYDVEVAMPRSAILAPAGYYLLFVNHQEIPSEGVWVQL  543



>ref|XP_011074991.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=544

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/548 (60%), Positives = 400/548 (73%), Gaps = 27/548 (5%)
 Frame = +1

Query  145   NRGFFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKC  324
             +R   T AA+     G+W+ L  +IGISAMHMQLL+ D+VV FDRT+ G SNISLP G C
Sbjct  17    HRNVLTRAAS-----GRWDFLLSNIGISAMHMQLLYTDRVVIFDRTDFGVSNISLPAGNC  71

Query  325   HHggggglggRKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLV  489
                       R  P D     +CTAHSVEYDVA+NS RP++VL+D WCSSG+V P GTLV
Sbjct  72    ----------RNDPSDTALVNDCTAHSVEYDVATNSIRPLMVLTDTWCSSGAVMPDGTLV  121

Query  490   QTGGYGEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNY  669
             QTGGY +G   VR + PC +  CDW EI  GL + RWY+T+HILPDGR I++GGRR  NY
Sbjct  122   QTGGYNDGDHAVRLYKPCTNNSCDWREINPGLTQRRWYATNHILPDGRAIVIGGRRQHNY  181

Query  670   EFFPKSGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNN  849
             EF+PK+ P DT Y L FL +T DP +  ENNLYPFV LNVDGNLFIFANNRAIL DYV  
Sbjct  182   EFYPKTSPGDTSYKLDFLVETKDPKI--ENNLYPFVFLNVDGNLFIFANNRAILFDYVKG  239

Query  850   VVVRTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFV  1029
              VVRTYP IPGG+PR+YPS+GSAVLLPL +  G    AEVLVCGG+P  AY +A    FV
Sbjct  240   TVVRTYPTIPGGDPRSYPSTGSAVLLPLTDNAGS---AEVLVCGGAPNGAYLSAMNGSFV  296

Query  1030  GALNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPA  1209
              AL+TC RI I +PNPEWI E MP PRVMGDMV+LP GNVLIINGA +GAAGW+LGRNP 
Sbjct  297   TALDTCARIRINEPNPEWILETMPMPRVMGDMVLLPNGNVLIINGAGSGAAGWELGRNPV  356

Query  1210  FHPVLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPT  1389
               PV+YRP+ P GSRFE+Q+ + IPRMYHS+A+L+ DGRVLV GSNPH  Y FT V FPT
Sbjct  357   LAPVIYRPNNPFGSRFEVQSSSTIPRMYHSTALLLRDGRVLVGGSNPHTHYNFTGVLFPT  416

Query  1390  ELSMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDM-SQVKVTMVS  1566
             +L++EAF PSYLDP +  L P IVSP +Q+ + Y + ++V F     ++  + + VTMV+
Sbjct  417   DLTLEAFCPSYLDPNFKNLGPRIVSPTAQTKIGYNQQLTVLFTFPDNLNRDASIMVTMVA  476

Query  1567  PAFSTHSFSMNQRLLVLNTVKVKAA-GEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPS  1743
             PAF+THS SMNQRL+VL+   V AA G   Y I V+ P SGN+A  G+YLLFVVH+++PS
Sbjct  477   PAFTTHSCSMNQRLIVLSGGNVTAADGRSTYQIRVMTPSSGNIAQPGFYLLFVVHQDVPS  536

Query  1744  KGIWVHIQ  1767
             +GIWV I 
Sbjct  537   EGIWVQIS  544



>ref|XP_009337697.1| PREDICTED: galactose oxidase-like, partial [Pyrus x bretschneideri]
Length=500

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/516 (62%), Positives = 387/516 (75%), Gaps = 18/516 (3%)
 Frame = +1

Query  220   GISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPDDNCTAHSVEY  399
             GISAMHMQL  ND++V FDRT+ G SN+SLP+G C              +++CTAHS E+
Sbjct  1     GISAMHMQLFKNDRIVLFDRTDFGKSNLSLPNGNC-------------VNNDCTAHSAEF  47

Query  400   DVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCNDAECDWEEIPY  579
              V +N+ RP+ VLSD WCSSGS+   G L+QTGG   G R VR F+PC    CDW+EI  
Sbjct  48    VVQTNAVRPLTVLSDVWCSSGSMDAYGNLIQTGGNNIGERRVRVFTPCTG--CDWKEIVD  105

Query  580   GLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFLAQTTDPGLGAEN  759
             GL   RWY+T+HILPDGR+II+GGR  FNYEF+PK+      YSLPFL+QT DPG   EN
Sbjct  106   GLAARRWYATNHILPDGREIIIGGRGQFNYEFYPKTASTSNVYSLPFLSQTNDPG--QEN  163

Query  760   NLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYPSSGSAVLLPLKN  939
             NLYPFV LN DGNLF+FANNRAILLDYV NVVV+TYP+IPGG+PR+YPS+GSAVLLPLKN
Sbjct  164   NLYPFVFLNPDGNLFVFANNRAILLDYVKNVVVKTYPQIPGGDPRSYPSTGSAVLLPLKN  223

Query  940   LKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEWITEEMPFPRVMG  1119
             L  P+  AEVLVCGG+PK ++  A +  FV ALNTC RI ITDPNP+WI E MP  RVMG
Sbjct  224   LMAPSVEAEVLVCGGAPKGSFVQANKGTFVEALNTCARIKITDPNPQWIVETMPQARVMG  283

Query  1120  DMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFELQNPNKIPRMYHS  1299
             DM++LP   VL+INGA++G AGW++GRNP F+PV+YRPD   GSRFE QNP  IPRMYHS
Sbjct  284   DMLLLPDSTVLLINGASSGVAGWEIGRNPVFNPVVYRPDNAVGSRFEQQNPTTIPRMYHS  343

Query  1300  SAVLITDGRVLVAGSNPHATYKFTN-VFFPTELSMEAFSPSYLDPKYAALRPEIVSPASQ  1476
             SA+L+ DGRV+V GSNPH  Y+F N V FPTEL +EAFSP YLD KYA LRP I++P +Q
Sbjct  344   SALLVRDGRVIVGGSNPHEKYQFGNDVLFPTELRLEAFSPEYLDAKYANLRPTILAPGNQ  403

Query  1477  SGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNTVKVKAAGEEEY  1656
             + + YG  +++QF ++G    + V VTMV+P FSTHSFSMNQRLLVL    V+  G   Y
Sbjct  404   AKIHYGIKLAIQFSLTGTFAKNSVSVTMVAPPFSTHSFSMNQRLLVLGAENVQQVGPTTY  463

Query  1657  GIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
              + V  P S NLAPSGYY+LFVVH++IPS+GI+V I
Sbjct  464   QVQVTTPPSKNLAPSGYYILFVVHQQIPSEGIFVKI  499



>ref|XP_010471675.1| PREDICTED: galactose oxidase-like isoform X1 [Camelina sativa]
Length=548

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/546 (60%), Positives = 405/546 (74%), Gaps = 27/546 (5%)
 Frame = +1

Query  154   FFTAAAAAVRG-GGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHH  330
             FF  +     G GG W LL P++GISAMH QLLHND+V+ +DRTN GPSNISLP+G C  
Sbjct  22    FFLLSCHLTSGAGGTWRLLLPNVGISAMHSQLLHNDRVIMYDRTNFGPSNISLPNGAC--  79

Query  331   ggggglggRKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQT  495
                     RK P+D     +CTAHSVEY+VA NS RP+ V S+ WCSSG V+P GTL+QT
Sbjct  80    --------RKSPNDAVSKTDCTAHSVEYNVALNSIRPLTVQSNTWCSSGGVTPDGTLLQT  131

Query  496   GGYGEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEF  675
             GG  +G R  R F+PC+D  CDW E+  GL   RWY+++H+LPDGRQII+GGR  FNYEF
Sbjct  132   GGSRDGERKTRLFAPCDDDSCDWTEVDNGLAASRWYASNHVLPDGRQIIIGGRDQFNYEF  191

Query  676   FPKSGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVV  855
             FPK+  A   Y LPFLAQTTDPG   ENNLYP+V LN DGNLFIFANNRAILL+Y  N V
Sbjct  192   FPKTN-APNLYELPFLAQTTDPG--QENNLYPYVFLNTDGNLFIFANNRAILLNYATNTV  248

Query  856   VRTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNA-KRNIFVG  1032
             V+TYPEIPGG+PR+YPS+GSAVLLP+KNL     + EVLVCGG+PK +Y  A +R  F+ 
Sbjct  249   VKTYPEIPGGDPRSYPSTGSAVLLPIKNL-----VLEVLVCGGAPKGSYILASQRKTFIK  303

Query  1033  ALNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAF  1212
             AL+TC RI I D NP+W  E+MP  RVMGDM +LP G+VL+ING ++G A WDLGR P F
Sbjct  304   ALDTCARININDENPQWAVEKMPRARVMGDMTLLPDGHVLLINGGSSGTAAWDLGREPVF  363

Query  1213  HPVLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTE  1392
             +P +Y PD P GSRFE QN N IPRMYHS+A L+ DGRV+V GSNPHA Y FT V FPTE
Sbjct  364   NPDIYHPDRPVGSRFEPQNANAIPRMYHSTATLLRDGRVIVGGSNPHAYYNFTGVLFPTE  423

Query  1393  LSMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPA  1572
             LS+EAFSPSYL+ KY++LRP I+ P  Q+ ++YG+++ ++F V G+V  + VKVTMV P+
Sbjct  424   LSLEAFSPSYLESKYSSLRPVIMDPMPQTTINYGQILRLRFTVQGRVK-TPVKVTMVYPS  482

Query  1573  FSTHSFSMNQRLLVLNTVKVKAAGEEE-YGIDVVAPDSGNLAPSGYYLLFVVHREIPSKG  1749
             F+THSFSM+QRLLVL+ V     G    Y + V  P S NLAP GYY++FVV+++IPS+G
Sbjct  483   FNTHSFSMSQRLLVLDHVLFLRIGLSRIYEVSVRTPSSVNLAPPGYYMVFVVNQDIPSEG  542

Query  1750  IWVHIQ  1767
             +WV ++
Sbjct  543   VWVRLE  548



>emb|CDY62590.1| BnaA08g31280D [Brassica napus]
Length=547

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/538 (60%), Positives = 400/538 (74%), Gaps = 20/538 (4%)
 Frame = +1

Query  172   AAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglg  351
              ++  GGKW LL  ++GISAMHMQLL ND+VV FDRTN GPSNISLP+G C         
Sbjct  24    VSLAAGGKWTLLLSNVGISAMHMQLLRNDRVVMFDRTNFGPSNISLPNGNC---------  74

Query  352   gRKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGT  516
              R  P D     +CTAHS+EYDVASN+ RP+ V S+ WCSSGSV P G LVQTGG  +G 
Sbjct  75    -RNNPQDAVSKIDCTAHSIEYDVASNTVRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGE  133

Query  517   RVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPA  696
                R FSPCN+ +CDW EI  GL + RWYS++HILPDG+QI++GG+  FNYEF+PK+   
Sbjct  134   LKARIFSPCNNNKCDWVEINNGLTKRRWYSSNHILPDGKQIVIGGQGQFNYEFYPKTTSP  193

Query  697   DTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEI  876
             +   +LPFLA+T D   G ENNLYP+V LN DGNLFIFANNRAILLDYV N VV+TYP I
Sbjct  194   NVI-ALPFLAETND--RGQENNLYPYVFLNTDGNLFIFANNRAILLDYVKNTVVKTYPAI  250

Query  877   PGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNA-KRNIFVGALNTCGR  1053
             PGG+PR+YPS+GSAVLLPLKNL+     AEVLVCGG+PK +Y  A +RN FV AL+TC R
Sbjct  251   PGGDPRSYPSTGSAVLLPLKNLEAVKIDAEVLVCGGAPKGSYILAFRRNTFVKALDTCAR  310

Query  1054  IVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRP  1233
             I I D NP+W  E+MP  RVMGDM +LP G+VLI+NG ++G+A W+LGR P F P LY P
Sbjct  311   IKINDENPQWTVEKMPRARVMGDMTLLPNGDVLIVNGGSSGSAAWELGREPVFVPDLYHP  370

Query  1234  DAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFS  1413
             + P  SRFE  NP+ IPRMYHS+A+L+ DGRVLV GSNPH  Y FT V FPTELS+EAFS
Sbjct  371   ENPVNSRFESLNPSTIPRMYHSTAILLRDGRVLVGGSNPHGFYNFTGVLFPTELSLEAFS  430

Query  1414  PSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFS  1593
             P YL+P++A LRP+IVSP SQ+ ++Y + + ++FKV G+V    VKVTMV P+F+THSFS
Sbjct  431   PVYLEPEFAKLRPKIVSPKSQTTITYRKTMKLKFKVVGEVK-GPVKVTMVFPSFTTHSFS  489

Query  1594  MNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             MNQRLLVL+ VK K +    Y + V  P S  +AP GYY++FVV+  IPS+GIWV ++
Sbjct  490   MNQRLLVLDNVKFKRSKSTNYEVQVRTPRSAFVAPPGYYMMFVVNDNIPSEGIWVRLR  547



>ref|XP_010428587.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=548

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/547 (59%), Positives = 405/547 (74%), Gaps = 30/547 (5%)
 Frame = +1

Query  154   FFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHg  333
             FF +       GG W LL P++GISAMH QLLHND+V+ +DRTN GPSNISLP G C   
Sbjct  23    FFLSCHLTSGAGGTWKLLLPNVGISAMHSQLLHNDRVIMYDRTNFGPSNISLPHGAC---  79

Query  334   gggglggRKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTG  498
                    R+ P+D     +CTAHS+EY+VA NS RP+ V S+ WCSSG V+P GTL+QTG
Sbjct  80    -------RQSPNDAVSKTDCTAHSIEYNVALNSIRPLTVQSNTWCSSGGVTPDGTLLQTG  132

Query  499   GYGEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFF  678
             G  +G R  R F+PC+D  CDW E+  GL   RWY+++H+LPDGRQII+GGR  FNYEFF
Sbjct  133   GSRDGERKTRLFAPCDDDSCDWTEVDNGLATARWYASNHVLPDGRQIIIGGRDQFNYEFF  192

Query  679   PKSGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVV  858
             PK+  A   Y+LPFL QTTDPG   ENNLYP+V LN DGNLFIFANNRAILL+Y  N VV
Sbjct  193   PKTN-APNLYALPFLTQTTDPG--QENNLYPYVFLNTDGNLFIFANNRAILLNYATNTVV  249

Query  859   RTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAY---YNAKRNIFV  1029
             +TYPEIPGG+PR+YPS+GSAVLLP+KNL     + EVLVCGG+PK +Y   +N+K   F+
Sbjct  250   KTYPEIPGGDPRSYPSTGSAVLLPIKNL-----VLEVLVCGGAPKGSYLLAFNSK--TFI  302

Query  1030  GALNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPA  1209
              AL+TC RI I DPNP+W  E+MP  RVMGDM +LP G+VL+ING ++G A W+LGR P 
Sbjct  303   KALDTCARININDPNPQWAVEKMPRARVMGDMTLLPDGHVLLINGGSSGTAAWELGREPV  362

Query  1210  FHPVLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPT  1389
             F+P +Y PD P GSRFE QNPN IPRMYHS+A L+ DGRV+V GSNPHA Y FT V FPT
Sbjct  363   FNPDIYHPDRPVGSRFEPQNPNAIPRMYHSTATLLRDGRVIVGGSNPHAYYNFTGVLFPT  422

Query  1390  ELSMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSP  1569
             ELS+EAFSPSYL+ KY++LRP I+ P  Q+ ++YG+++ ++F V G+V  + VKV MV P
Sbjct  423   ELSLEAFSPSYLESKYSSLRPVIMDPMPQTTINYGQILRLRFTVQGRVK-TPVKVNMVYP  481

Query  1570  AFSTHSFSMNQRLLVLNTVKVKAAG-EEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSK  1746
             +F+THSFSMNQRLLVL+ V     G    Y + V  P S NLAP GYY++FVV+++IPS+
Sbjct  482   SFNTHSFSMNQRLLVLDHVLFSRIGFSSTYEVRVRTPSSVNLAPPGYYMVFVVNQDIPSE  541

Query  1747  GIWVHIQ  1767
             G+WV ++
Sbjct  542   GVWVRLE  548



>gb|KFK37635.1| hypothetical protein AALP_AA3G008700 [Arabis alpina]
Length=548

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/539 (59%), Positives = 403/539 (75%), Gaps = 10/539 (2%)
 Frame = +1

Query  154   FFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHg  333
             F  +   A  GGG W LL P++GISAMH QLLHND V+ +DR+N GPSNISLP+G C + 
Sbjct  19    FLISCHMAYGGGGTWKLLLPNVGISAMHSQLLHNDHVIMYDRSNFGPSNISLPNGTCLNS  78

Query  334   gggglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEG  513
                 +  R     +CTAHS+EYDVASN  RP+ V S+ WCSSG ++P GTL+QTGG  EG
Sbjct  79    PNDIVSKR-----DCTAHSIEYDVASNQIRPLTVRSNTWCSSGGLTPDGTLLQTGGDKEG  133

Query  514   TRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGP  693
              R  R FSPC+D  CDW E+  GL   RWY+++H+LPDGRQII+GGR  F+YEF+PK+  
Sbjct  134   ERKARLFSPCDDNTCDWSEVDNGLATRRWYASNHVLPDGRQIIIGGRAQFSYEFYPKTN-  192

Query  694   ADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPE  873
             A   +SLPFL QT DP    ENNLYP V LN DGNLFIFANNRAILLDY  N+VV+TYPE
Sbjct  193   APYLFSLPFLTQTDDPH--DENNLYPSVFLNRDGNLFIFANNRAILLDYKKNMVVKTYPE  250

Query  874   IPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGR  1053
             IPGG+PR+YPS+GS+VLLP+KNL+      EVLVCGG+PK ++    RN  V AL+TC R
Sbjct  251   IPGGDPRSYPSTGSSVLLPIKNLEDEMVQLEVLVCGGAPKGSFQLTSRNTHVKALDTCAR  310

Query  1054  IVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRP  1233
             I I D NP+W+ E+MP  RVMGDM++LP G+VL+ING  +G AGW+ GR P  +P LYRP
Sbjct  311   IKINDANPQWLVEKMPRARVMGDMILLPDGHVLLINGGGSGTAGWERGREPVLNPDLYRP  370

Query  1234  DAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFS  1413
             + P GSRF  QNP  IPRMYHS+A+L+ DGR+LV GSNPH  YKFTNV FPTELS+EAFS
Sbjct  371   NKPVGSRFVTQNPTTIPRMYHSTAILLRDGRILVGGSNPHEFYKFTNVLFPTELSLEAFS  430

Query  1414  PSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFS  1593
             PSYL+ K+++ RP IV+  SQS ++YG++++++F V+G+V  S VKVTMV P+F+THSFS
Sbjct  431   PSYLESKHSSHRPRIVNLTSQSTINYGQILTLRFDVTGRVK-SPVKVTMVFPSFNTHSFS  489

Query  1594  MNQRLLVLNTV-KVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             M+QRLL+L+ V  V+  G   Y + V  P S NLAP GYY++FVV++ IPS+G+WV +Q
Sbjct  490   MHQRLLILDHVFAVRRLGISSYEVKVKTPRSVNLAPPGYYMVFVVNQGIPSEGVWVRLQ  548



>ref|XP_009103375.1| PREDICTED: galactose oxidase-like [Brassica rapa]
Length=556

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/543 (60%), Positives = 398/543 (73%), Gaps = 29/543 (5%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GGKW+LL  ++GISAMHMQLL ND+VV FDRTN GPSNISLP+G C          R  
Sbjct  28    AGGKWDLLLSNVGISAMHMQLLPNDRVVMFDRTNFGPSNISLPNGNC----------RNN  77

Query  364   PDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
             P D     +CTAHS+EY V SN+ RP+ V S+ WCSSGS+ P G LVQTGG  +G    R
Sbjct  78    PQDAVSKIDCTAHSIEYKVESNTIRPLTVQSNTWCSSGSLRPDGVLVQTGGDRDGELKAR  137

Query  529   RFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFY  708
              F+PC+D ECDW EI  GL R RWYS++HILPDG+QII+GG+R FNYEFFPK+   +   
Sbjct  138   TFTPCSDEECDWVEINKGLARRRWYSSNHILPDGKQIIIGGQRQFNYEFFPKTTSPNVI-  196

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
              LPFLA+T D   G ENNLYP+V LN DGNLFIFANNRAILLDYVNN VV+TYP IPGG+
Sbjct  197   DLPFLAETND--RGEENNLYPYVFLNTDGNLFIFANNRAILLDYVNNKVVKTYPAIPGGD  254

Query  889   PRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNA-KRNIFVGALNTCGRIVIT  1065
             PR+YPS+GSAVLLPLKNL+     AEVLVCGG+PK ++  A ++  FV AL+TC RI I 
Sbjct  255   PRSYPSTGSAVLLPLKNLEADKIDAEVLVCGGAPKGSFILAFRKRTFVKALDTCARIKIN  314

Query  1066  DPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPP  1245
             D NP+W+ E+MP  RVMGDM +LP G+VL+ING + G+A W+LGR P F P +Y P+ P 
Sbjct  315   DENPQWMVEKMPRARVMGDMTLLPNGDVLLINGGSAGSAAWELGREPVFVPDMYHPENPV  374

Query  1246  GSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYL  1425
              SRFE  NPN IPRMYHS+A+L+ DGRVLV GSNPH  Y FT V FPTELS+EAFSP+YL
Sbjct  375   NSRFESLNPNTIPRMYHSTAILLRDGRVLVGGSNPHGFYNFTGVLFPTELSLEAFSPAYL  434

Query  1426  DPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQR  1605
             +P++A  RP+I SP SQS ++YG  + V+FKVSGK+    VKVTMV P+F+THSFSMNQR
Sbjct  435   EPEFAKFRPKITSPKSQSTITYGTNLKVKFKVSGKIK-GPVKVTMVFPSFTTHSFSMNQR  493

Query  1606  LLVLNTVKVKAAG---------EEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWV  1758
             LLVL+ VKVK             + Y + V  P S  +AP GYY++F+V+  +PS+GIWV
Sbjct  494   LLVLDNVKVKRTSSVFGALFGKSKHYEVQVRTPRSAIIAPPGYYMMFLVNENVPSEGIWV  553

Query  1759  HIQ  1767
              +Q
Sbjct  554   RLQ  556



>ref|XP_010471676.1| PREDICTED: galactose oxidase-like isoform X2 [Camelina sativa]
Length=548

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/546 (60%), Positives = 405/546 (74%), Gaps = 27/546 (5%)
 Frame = +1

Query  154   FFTAAAAAVRG-GGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHH  330
             FF  +     G GG W LL P++GISAMH QLLHND+V+ +DRTN GPSNISLP+G C  
Sbjct  22    FFLLSCHLTSGAGGTWRLLLPNVGISAMHSQLLHNDRVIMYDRTNFGPSNISLPNGAC--  79

Query  331   ggggglggRKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQT  495
                     RK P+D     +CTAHSVEY+VA NS RP+ V S+ WCSSG V+P GTL+QT
Sbjct  80    --------RKSPNDAVSKTDCTAHSVEYNVALNSIRPLTVQSNTWCSSGGVTPDGTLLQT  131

Query  496   GGYGEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEF  675
             GG  +G R  R F+PC+D  CDW E+  GL   RWY+++H+LPDGRQII+GGR  FNYEF
Sbjct  132   GGSRDGERKTRLFAPCDDDSCDWTEVDNGLAASRWYASNHVLPDGRQIIIGGRDQFNYEF  191

Query  676   FPKSGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVV  855
             FPK+  A   Y LPFLAQTTDPG   ENNLYP+V LN DGNLFIFANNRAILL+Y  N V
Sbjct  192   FPKTN-APNLYELPFLAQTTDPG--QENNLYPYVFLNTDGNLFIFANNRAILLNYATNTV  248

Query  856   VRTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNA-KRNIFVG  1032
             V+TYPEIPGG+PR+YPS+GSAVLLP+KNL     + EVLVCGG+PK +Y  A +R  F+ 
Sbjct  249   VKTYPEIPGGDPRSYPSTGSAVLLPIKNL-----VLEVLVCGGAPKGSYILASQRKTFIK  303

Query  1033  ALNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAF  1212
             AL+TC RI I D NP+W  E+MP  RVMGDM +LP G+VL+ING ++G A W+LGR P F
Sbjct  304   ALDTCARININDENPQWAVEKMPRARVMGDMTLLPDGHVLLINGGSSGTAAWELGREPVF  363

Query  1213  HPVLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTE  1392
             +P +Y PD P GSRFE QN N IPRMYHS+A L+ DGRV+V GSNPHA Y FT V FPTE
Sbjct  364   NPDIYHPDRPVGSRFEPQNANAIPRMYHSTATLLRDGRVIVGGSNPHAYYNFTGVLFPTE  423

Query  1393  LSMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPA  1572
             LS+EAFSPSYL+ KY++LRP I+ P  Q+ ++YG+++ ++F V G+V  + VKVTMV P+
Sbjct  424   LSLEAFSPSYLESKYSSLRPVIMDPMPQTTINYGQILRLRFTVQGRVK-TPVKVTMVYPS  482

Query  1573  FSTHSFSMNQRLLVLNTVKVKAAGEEE-YGIDVVAPDSGNLAPSGYYLLFVVHREIPSKG  1749
             F+THSFSM+QRLLVL+ V     G    Y + V  P S NLAP GYY++FVV+++IPS+G
Sbjct  483   FNTHSFSMSQRLLVLDHVLFLRIGLSRIYEVSVRTPSSVNLAPPGYYMVFVVNQDIPSEG  542

Query  1750  IWVHIQ  1767
             +WV ++
Sbjct  543   VWVRLE  548



>ref|XP_006304793.1| hypothetical protein CARUB_v10012343mg [Capsella rubella]
 gb|EOA37691.1| hypothetical protein CARUB_v10012343mg [Capsella rubella]
Length=549

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/535 (60%), Positives = 393/535 (73%), Gaps = 21/535 (4%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GG WN+L P++GISAMHMQLLHND+VV FDRTN GPSNISLP+G C          R  
Sbjct  29    AGGSWNVLLPNVGISAMHMQLLHNDRVVMFDRTNFGPSNISLPNGNC----------RNN  78

Query  364   PDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
             P+D     +CTAHS+EYDVA N+ RP+ V S+ WCSSGSV P G L+QTGG  +G    R
Sbjct  79    PNDAVSKIDCTAHSIEYDVAMNTVRPLTVQSNTWCSSGSVRPDGVLIQTGGDRDGALKAR  138

Query  529   RFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFY  708
              F+PCND +CDW EI  GL + RWYS++ +LPDG+QI++GG+  FNYEFFPK+   +   
Sbjct  139   TFTPCNDNKCDWVEIDNGLSKRRWYSSNQLLPDGKQIVIGGQGQFNYEFFPKTTSPNVV-  197

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
              LPFLA+T D   G ENNLYPFV +N DGNLFIFANNRA+LLDYV N VV+T+P IPGG+
Sbjct  198   DLPFLAETND--RGQENNLYPFVFMNTDGNLFIFANNRAMLLDYVKNKVVKTFPAIPGGD  255

Query  889   PRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNA-KRNIFVGALNTCGRIVIT  1065
             PR+YPS+GSAVLLPLKNL+     AEVLVCGG+PK +Y  A +R  FV AL+TC RI I 
Sbjct  256   PRSYPSTGSAVLLPLKNLEAAKIEAEVLVCGGAPKGSYLQAFRRKTFVKALDTCARIKIN  315

Query  1066  DPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPP  1245
             D +P+W  E MP  RVMGDM +LP G+VLI+NG  +G+A W+LGR P   P LY P+ P 
Sbjct  316   DADPQWTVETMPHARVMGDMTLLPNGDVLIVNGGASGSAAWELGREPVLAPDLYHPENPV  375

Query  1246  GSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYL  1425
               RFE  NP  IPRMYHS+AVL+ DGRVLV GSNPHA Y+FT V FPTEL +EAFSP+YL
Sbjct  376   NKRFESLNPTTIPRMYHSAAVLVRDGRVLVGGSNPHAFYEFTGVLFPTELRLEAFSPAYL  435

Query  1426  DPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQR  1605
             +PK+A LRP+I +P SQS + YG  + ++F V G+V   QVKVTMVSP+F+THSFSMNQR
Sbjct  436   EPKFATLRPKIQTPKSQSRIKYGTNLKLKFTVIGEVK-GQVKVTMVSPSFTTHSFSMNQR  494

Query  1606  LLVLNTVKVKAAGEE-EYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             LLVL+ VK    G    Y + V  P S  +AP GYY++FVV++ IPS+G+WV +Q
Sbjct  495   LLVLDNVKFTRKGRSTTYEVQVRTPKSAIIAPPGYYMMFVVNQNIPSEGVWVRLQ  549



>ref|XP_010533609.1| PREDICTED: galactose oxidase-like [Tarenaya hassleriana]
Length=559

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/536 (61%), Positives = 397/536 (74%), Gaps = 24/536 (4%)
 Frame = +1

Query  187   GGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPP  366
             GG+W LL+ SIGISAMH QLL ND+VV FD T+ GPSNISL  GKC H           P
Sbjct  37    GGRWQLLRRSIGISAMHTQLLRNDRVVMFDLTDFGPSNISLSGGKCRHS----------P  86

Query  367   DD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRR  531
             +D     +CTAHSVEYDV SN  RP+ + S+ WCSSGSV+P GTL+QTGG+G+G R VR 
Sbjct  87    NDGASKVDCTAHSVEYDVVSNRVRPLTIRSNTWCSSGSVAPDGTLIQTGGFGDGERRVRM  146

Query  532   FSPCNDAE-CDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFY  708
             FSPC   + CDW+EI  GLV  RWY+++H+L DGRQIIVGGR  F++EF+PK+   +  Y
Sbjct  147   FSPCRKNKYCDWKEIENGLVVRRWYASNHVLSDGRQIIVGGRGQFSFEFYPKTKDPNV-Y  205

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
             SLPFLAQT D  LG ENNLYPFV LNVDGN+FIFANNRAILLD+ NN VV+TYP IPGG+
Sbjct  206   SLPFLAQTND--LGTENNLYPFVFLNVDGNVFIFANNRAILLDHGNNTVVKTYPTIPGGD  263

Query  889   PRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITD  1068
             PR+YPS+GSAVLLPLKNL+     AEVLVCGG+ + AY  A +N FV ALNTC RI ITD
Sbjct  264   PRSYPSTGSAVLLPLKNLEALNVEAEVLVCGGATRGAYELALKNTFVKALNTCARIKITD  323

Query  1069  PNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPG  1248
             PNP+W  E MP  RVMGDM +LP G+VL+ING  +G A W+ GR P F P LYRPD P G
Sbjct  324   PNPKWEIETMPRERVMGDMTLLPNGHVLLINGGYSGTAAWECGREPVFAPDLYRPDNPLG  383

Query  1249  SRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLD  1428
              R E Q    IPRMYHS+AVL+ DGRVLV GSNPH  Y FT V FPT+LS+EAFSPSYLD
Sbjct  384   FRSESQKQTSIPRMYHSTAVLLRDGRVLVGGSNPHRYYNFTGVLFPTDLSLEAFSPSYLD  443

Query  1429  PKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRL  1608
              +++ LRP+I++P SQS + Y   + ++F VS +V  S VKVTMV P+F+THSFSMNQR+
Sbjct  444   QEFSNLRPKIIAPKSQSKIKYDTKLKLRFTVSDEVK-SPVKVTMVYPSFATHSFSMNQRV  502

Query  1609  LVLNTVKV----KAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             L L+ VK     K A +  YG++V  P S N+AP GYY++FVV++ IPSKG+WV +
Sbjct  503   LFLDNVKFTTRSKTARKTTYGVEVKTPRSANVAPPGYYMMFVVNQHIPSKGVWVRL  558



>emb|CDY01391.1| BnaA07g11640D [Brassica napus]
Length=556

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/543 (60%), Positives = 399/543 (73%), Gaps = 29/543 (5%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GGKW+LL  ++GISAMHMQLL ND+VV FDRTN GPSNISLP+G C          R+ 
Sbjct  28    AGGKWDLLLSNVGISAMHMQLLSNDRVVMFDRTNFGPSNISLPNGNC----------RRN  77

Query  364   PDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
             P D     +CTAHS+EYDVASN  RP+ V S+ WCSSGSV P G LVQTGG  +G    R
Sbjct  78    PQDPVSKMDCTAHSIEYDVASNKVRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKAR  137

Query  529   RFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFY  708
              FSPC+D +CDW EI  GL + RWYS++HILPDG+QI++GGR  FNYEFFPK+   +   
Sbjct  138   TFSPCDDNQCDWVEINNGLAKRRWYSSNHILPDGKQIVIGGRGQFNYEFFPKTTSPNVI-  196

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
             +LPFLA+T+D G   ENNLYP+V LN DG LFIFANNRAILLDYV N VV+TYP IPGG+
Sbjct  197   ALPFLAETSDKG--EENNLYPYVFLNTDGRLFIFANNRAILLDYVKNTVVKTYPAIPGGD  254

Query  889   PRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRN-IFVGALNTCGRIVIT  1065
             PR+YPS+GSAVLLPLKNL+     AEVLVCGG+PK ++  A R   FV AL+TC RI I 
Sbjct  255   PRSYPSTGSAVLLPLKNLEADKIDAEVLVCGGAPKGSFILASRKRTFVKALDTCARIKIN  314

Query  1066  DPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPP  1245
             D NP+W+ E+MP  RVMGDM +LP G+VL+ING + G+A W+LGR P F P LY P+ P 
Sbjct  315   DENPQWMVEKMPRARVMGDMTLLPNGDVLLINGGSAGSAAWELGREPVFVPDLYHPENPV  374

Query  1246  GSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYL  1425
              SRFE  NPN IPRMYHS+A+++ DGRVLV GSNPHA Y FT V FPTELS+EAFSP+YL
Sbjct  375   NSRFESLNPNTIPRMYHSTAIILRDGRVLVGGSNPHAFYNFTGVLFPTELSLEAFSPAYL  434

Query  1426  DPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQR  1605
             +P++A LRP+I SP SQS ++YG  + V+F+V+G+V    VKVTMV P+F++HSFSMNQR
Sbjct  435   EPEFAKLRPKITSPKSQSTITYGMNLKVEFEVAGEVK-GPVKVTMVFPSFTSHSFSMNQR  493

Query  1606  LLVLNTVKVKAAG---------EEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWV  1758
             LLVL+ V VK               + + V  P S  +AP GYY++FVV++ IPS+GIWV
Sbjct  494   LLVLDNVSVKRTSSVFGVLFGTSTNFEVQVRTPRSAIIAPPGYYMMFVVNQNIPSEGIWV  553

Query  1759  HIQ  1767
              +Q
Sbjct  554   RLQ  556



>ref|XP_002889034.1| hypothetical protein ARALYDRAFT_895435 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65293.1| hypothetical protein ARALYDRAFT_895435 [Arabidopsis lyrata subsp. 
lyrata]
Length=547

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/545 (60%), Positives = 402/545 (74%), Gaps = 27/545 (5%)
 Frame = +1

Query  154   FFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHg  333
             F  +   A    G W LL P++GISAMH QLLHND+V+ +DRTN GPSNISLP+G C   
Sbjct  23    FLLSCHVASGDEGTWELLLPNVGISAMHSQLLHNDRVIMYDRTNFGPSNISLPNGAC---  79

Query  334   gggglggRKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTG  498
                    R  P D     +CTAHSVEYDVA N  RP+ V S+ WCSSG V+P GTL QTG
Sbjct  80    -------RSSPGDAVSNIDCTAHSVEYDVALNRIRPLTVQSNTWCSSGGVTPDGTLQQTG  132

Query  499   GYGEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFF  678
             G  +G R VR F+PC+D  CDW E+  GL   RWY+T+H+LPDGRQII+GGR  FN+EFF
Sbjct  133   GDKDGERKVRLFAPCDDNICDWTEVDNGLAARRWYATNHVLPDGRQIIIGGRGQFNFEFF  192

Query  679   PKSGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVV  858
             PK+  A   YSLPFL++T DP    ENNLYP+V LN DGNLFIFANNRAILLDY  N VV
Sbjct  193   PKTN-APNLYSLPFLSETNDPD---ENNLYPYVFLNTDGNLFIFANNRAILLDYSRNTVV  248

Query  859   RTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAY-YNAKRNIFVGA  1035
             +TYPEIPGG+PR+YPS+GSAVLLP+KNL     + EVLVCGG+PK +Y  + +RN FV A
Sbjct  249   KTYPEIPGGDPRSYPSTGSAVLLPIKNL-----VLEVLVCGGAPKGSYDLSQRRNTFVKA  303

Query  1036  LNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFH  1215
             L+TC RI I D NP+WI E+MP  RVMGDM++LP GNVL+ING  +G A W+LGR P F+
Sbjct  304   LDTCARININDVNPQWIVEKMPRARVMGDMMLLPDGNVLLINGGGSGTAAWELGREPVFN  363

Query  1216  PVLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTEL  1395
             P +Y PD P G RFE QNP+KIPRMYHS+A L+ DGRVLV GSNPHA Y FT V FPTEL
Sbjct  364   PDIYHPDKPVGLRFEAQNPSKIPRMYHSTATLLRDGRVLVGGSNPHAFYNFTGVLFPTEL  423

Query  1396  SMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAF  1575
              +EAFSPSYLDPKY+++RP IV P SQS ++YG ++ +++ V+G+V  S VKVTM+ P+F
Sbjct  424   RLEAFSPSYLDPKYSSIRPSIVDPRSQSTINYGRILRLRYTVTGRVK-SPVKVTMLFPSF  482

Query  1576  STHSFSMNQRLLVLN-TVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGI  1752
             +THSFSM+QRLLVL+  +  +      Y + V  P S  LAP GYY++FVV+++IPS+G+
Sbjct  483   TTHSFSMHQRLLVLDHVISFRLGISRIYEVRVRTPSSPILAPPGYYMVFVVNQDIPSEGL  542

Query  1753  WVHIQ  1767
             WV +Q
Sbjct  543   WVRLQ  547



>ref|XP_010105252.1| hypothetical protein L484_019394 [Morus notabilis]
 gb|EXC04187.1| hypothetical protein L484_019394 [Morus notabilis]
Length=544

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/535 (59%), Positives = 392/535 (73%), Gaps = 13/535 (2%)
 Frame = +1

Query  160   TAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggg  339
             TAAA     GG+W LLQ SIGI AMHMQLL+ND+VV FDRT+ G S +SLPDGKC +   
Sbjct  22    TAAA-----GGRWQLLQKSIGIPAMHMQLLNNDRVVIFDRTDFGRSQLSLPDGKCRNDRF  76

Query  340   gglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTR  519
                        +CTAHS EYDV SN+FR + V +D WCSSG+V   GTL+QTGGY +G R
Sbjct  77    DTAL-----KVDCTAHSAEYDVTSNTFRALTVQTDVWCSSGAVMADGTLIQTGGYNDGER  131

Query  520   VVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPAD  699
              VR F PC+   CDW+EI  GL   RWY+T+HILP GRQII+GGRR FNYE++PK    +
Sbjct  132   RVRVFKPCDGRTCDWQEIDLGLSAKRWYATNHILPGGRQIIIGGRRQFNYEYYPKDTDKN  191

Query  700   TFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIP  879
               ++LPFL++T D G+  ENNLYPFV LN DGNLF+FANNRAIL +Y  N VV+ YP+IP
Sbjct  192   V-HNLPFLSETNDKGI--ENNLYPFVFLNTDGNLFVFANNRAILWNYARNQVVKRYPQIP  248

Query  880   GGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIV  1059
             GG+PR+YPS+GSAVLLPLKN++     AEVLVCGG+PK AY  A R  FV AL TC RI 
Sbjct  249   GGDPRSYPSTGSAVLLPLKNIQARNVEAEVLVCGGAPKGAYVQAARKKFVEALKTCARIK  308

Query  1060  ITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDA  1239
             ITDP P W+ E MP  RVMGDM +LP G+VLIINGA +G AGW+   +P  +PVLYRPD 
Sbjct  309   ITDPKPNWVVENMPRARVMGDMALLPNGHVLIINGAGSGTAGWENAIDPVLNPVLYRPDN  368

Query  1240  PPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPS  1419
               GSRFE +NP   PRMYHS+AVL+ DGR+LV GSNPH  Y FT V FPT LS+EAFSP+
Sbjct  369   KAGSRFEDENPTTTPRMYHSTAVLLRDGRILVGGSNPHVGYNFTGVTFPTTLSLEAFSPN  428

Query  1420  YLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMN  1599
             YL+ K++ +RP I+ P S + + Y + + V+F++ G V  + V VT+VSP+F+THSFSMN
Sbjct  429   YLEAKFSNVRPRILLPTSHTKVKYAQKLFVRFRIGGNVAQNLVSVTLVSPSFTTHSFSMN  488

Query  1600  QRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             QRLLVL   ++++ G++ Y ++V  P S  LAP+GYYLLFV H+EIPS+G+WV +
Sbjct  489   QRLLVLPRGQIRSLGKKTYHVEVAMPRSAILAPAGYYLLFVNHQEIPSEGVWVQL  543



>ref|XP_011045139.1| PREDICTED: galactose oxidase-like [Populus euphratica]
Length=549

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/529 (60%), Positives = 388/529 (73%), Gaps = 11/529 (2%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
             GGG+W LLQ SIGI AMHMQLL+ND VV +DRT+ G SN+SLP GKC       +     
Sbjct  29    GGGRWQLLQKSIGIVAMHMQLLNNDHVVIYDRTDFGRSNLSLPGGKCRDDSSEIVVKH--  86

Query  364   PDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPC  543
                +CTAHSV+YDV +N FRP++V +D WCSSG+V P G+L+QTGG+ +G R VR F PC
Sbjct  87    ---DCTAHSVDYDVLANKFRPLMVQTDVWCSSGAVFPDGSLIQTGGFSDGERKVRTFYPC  143

Query  544   NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFL  723
                +CDW E   GL   RWY+T+HILPDG+QII+GGRR FNYEF+PK+   +  YSLPFL
Sbjct  144   K-GDCDWVETGNGLKAKRWYATNHILPDGKQIIIGGRRQFNYEFYPKTSSPNV-YSLPFL  201

Query  724   AQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYP  903
              QT D G+  ENNLYPFV LN DGNLFIFANNRAIL DY    VV+TYP IPGG+PR+YP
Sbjct  202   LQTNDRGI--ENNLYPFVFLNSDGNLFIFANNRAILFDYKTGKVVKTYPAIPGGDPRSYP  259

Query  904   SSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEW  1083
             S+GSAVLLPLKNL   T  AEVLVCGG+PK ++    +  FV AL+TCGRI I DPNP+W
Sbjct  260   STGSAVLLPLKNLDAATIAAEVLVCGGAPKGSFEKVAKGNFVKALDTCGRIKINDPNPQW  319

Query  1084  ITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFEL  1263
             + E MP  RVMGDM +LP G VLIINGA  G AGW+ GRNP  +P+LY P+   GSRFE 
Sbjct  320   VMETMPHARVMGDMTLLPNGVVLIINGAGAGTAGWESGRNPVLNPILYWPNGAAGSRFES  379

Query  1264  QNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAA  1443
              NPN IPR+YHS+A+L+ DGRVLV GSNPH  Y+F  V FP+ELS+EAFSP YLD ++  
Sbjct  380   LNPNTIPRVYHSTAILLRDGRVLVGGSNPHIGYEFKGVLFPSELSLEAFSPPYLDAQHNY  439

Query  1444  LRPEIVSPASQSG--LSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVL  1617
             +RP I+S  +  G  + YG+ + V+FKV+GK+   ++ VTMV+PAF+THSFSMN RLLVL
Sbjct  440   VRPTILSSTASKGKYIGYGQKLLVRFKVTGKLMADKISVTMVAPAFNTHSFSMNHRLLVL  499

Query  1618  NTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
                KV + G   Y + V  P SG LAPSG+Y+L+VVH+ IPS GIWV I
Sbjct  500   GNTKVTSVGTSTYDVQVTTPRSGYLAPSGHYILYVVHQYIPSTGIWVKI  548



>ref|XP_009149487.1| PREDICTED: galactose oxidase [Brassica rapa]
Length=549

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/535 (61%), Positives = 397/535 (74%), Gaps = 21/535 (4%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GG+W LL P++GISAMHMQLL ND+VV FDRTN GPSNISLP+G C          R  
Sbjct  29    AGGRWKLLLPNVGISAMHMQLLRNDRVVMFDRTNFGPSNISLPNGNC----------RNN  78

Query  364   PDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
             P D     +CTAHS+EYDVASN+ RP+ V S+ WCSSGSV P G LVQTGG  +G    R
Sbjct  79    PQDPVSKIDCTAHSIEYDVASNTIRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKAR  138

Query  529   RFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFY  708
              F+PCN+ +CDW EI  GL + RWYS++HILPDG+QI++GG+  FNYEFFPK+   +   
Sbjct  139   IFTPCNNKKCDWIEINNGLTKRRWYSSNHILPDGKQIVIGGQGQFNYEFFPKTTSPNVI-  197

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
             +LPFLA+T D   G ENNLYP+V LN DGNLFIFANNRAILLDY+ N VV+TYP IPGG+
Sbjct  198   ALPFLAETND--RGEENNLYPYVFLNNDGNLFIFANNRAILLDYIKNTVVKTYPAIPGGD  255

Query  889   PRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNA-KRNIFVGALNTCGRIVIT  1065
             PR+YPS+GSAVLLPLKNL+     AEVLVCGG+PK +Y  A +R  FV AL+TC RI I 
Sbjct  256   PRSYPSTGSAVLLPLKNLEAVKIDAEVLVCGGAPKGSYLLAFRRKTFVKALDTCARIKIN  315

Query  1066  DPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPP  1245
             D NP+W  E+MP  RVMGDM +LP G+VLIING  +G+A W+LGR P   P +Y P  P 
Sbjct  316   DENPQWTVEKMPRARVMGDMTLLPNGDVLIINGGASGSAAWELGREPVLVPDVYHPCNPV  375

Query  1246  GSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYL  1425
              SRFE  NP  IPRMYHS+AVL+ DGRVLV GSNPHA Y FTNV FPTELS+EAFSP+YL
Sbjct  376   NSRFESLNPTTIPRMYHSTAVLLRDGRVLVGGSNPHAFYNFTNVLFPTELSLEAFSPAYL  435

Query  1426  DPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQR  1605
             +P++A  RP+I SP SQ  ++Y   + ++FKV+G+V    VKVTMV P+F+THSFSMNQR
Sbjct  436   EPEFAKFRPKIQSPKSQVMITYRMDLKLKFKVAGEVK-GPVKVTMVFPSFTTHSFSMNQR  494

Query  1606  LLVLNTVKVKAAGEE-EYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             LLVL+ V  K +G+   Y + V  P S N+AP GYY++FVV++ IPS+GIWV +Q
Sbjct  495   LLVLDNVTFKRSGKSTNYEVQVKTPRSVNIAPPGYYMMFVVNQNIPSEGIWVRLQ  549



>ref|XP_009103376.1| PREDICTED: galactose oxidase-like [Brassica rapa]
Length=556

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/543 (60%), Positives = 398/543 (73%), Gaps = 29/543 (5%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GGKW+LL  ++GISAMHMQLL ND+VV FDRTN GPSNISLP+G C          R+ 
Sbjct  28    AGGKWDLLLSNVGISAMHMQLLSNDRVVMFDRTNFGPSNISLPNGNC----------RRN  77

Query  364   PDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
             P D     +CTAHS+EYDVASN  RP+ V S+ WCSSGSV P G LVQTGG  +G    R
Sbjct  78    PQDPVSKMDCTAHSIEYDVASNKVRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKAR  137

Query  529   RFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFY  708
              FSPC+D +CDW EI  GL + RWYS++HILPDG+QI++GGR  FNYEFFPK+   +   
Sbjct  138   TFSPCDDNQCDWVEINNGLAKRRWYSSNHILPDGKQIVIGGRGQFNYEFFPKTTSPNVI-  196

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
             +LPFLA+T+D G   ENNLYP+V LN DG LFIFANNRAILLDYV N VV+TYP IPGG+
Sbjct  197   ALPFLAETSDKG--EENNLYPYVFLNTDGRLFIFANNRAILLDYVKNTVVKTYPAIPGGD  254

Query  889   PRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRN-IFVGALNTCGRIVIT  1065
             PR+YPS+GSAVLLPLKNL+     AEVLVCGG+PK ++  A R   FV AL+TC RI I 
Sbjct  255   PRSYPSTGSAVLLPLKNLEADKIDAEVLVCGGAPKGSFILASRKRTFVKALDTCARIKIN  314

Query  1066  DPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPP  1245
             D NP+W+ E+MP  RVMGDM +LP G+VL+ING + G+A W LGR P F P +Y P+ P 
Sbjct  315   DENPQWMVEKMPRARVMGDMTLLPNGDVLLINGGSAGSAAWGLGREPVFVPDMYHPENPV  374

Query  1246  GSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYL  1425
              SRFE  NPN IPRMYHS+A+++ DGRVLV GSNPHA Y FT V FPTELS+EAFSP+YL
Sbjct  375   NSRFESLNPNTIPRMYHSTAIILRDGRVLVGGSNPHAFYNFTGVLFPTELSLEAFSPAYL  434

Query  1426  DPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQR  1605
             +P++A LRP+I SP SQS ++YG  + V+F+V+G+V    VKVTMV P+F++HSFSMNQR
Sbjct  435   EPEFAKLRPKITSPKSQSTITYGMNLKVEFEVAGEVK-GPVKVTMVFPSFTSHSFSMNQR  493

Query  1606  LLVLNTVKVKAAG---------EEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWV  1758
             LLVL+ V VK               + + V  P S  +AP GYY++FVV++ IPS+GIWV
Sbjct  494   LLVLDNVSVKRTSSVFGVLFGTSRNFEVQVRTPRSAIIAPPGYYMMFVVNQNIPSEGIWV  553

Query  1759  HIQ  1767
              +Q
Sbjct  554   RLQ  556



>ref|XP_006300296.1| hypothetical protein CARUB_v10021300mg [Capsella rubella]
 gb|EOA33194.1| hypothetical protein CARUB_v10021300mg [Capsella rubella]
Length=547

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/544 (59%), Positives = 400/544 (74%), Gaps = 25/544 (5%)
 Frame = +1

Query  154   FFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHg  333
             F  +   A   GG W LL  ++GISAMH QLLHND+V+ +DRTN GPSNISLP+G C   
Sbjct  23    FLLSCHLASGAGGSWKLLLSNVGISAMHSQLLHNDRVIMYDRTNFGPSNISLPNGAC---  79

Query  334   gggglggRKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTG  498
                    R  P+D     +CTAHSVEYDVA NS RP+ V S+ WCSSG V+P GTL+QTG
Sbjct  80    -------RNSPNDIVSKTDCTAHSVEYDVALNSIRPLTVQSNTWCSSGGVTPDGTLLQTG  132

Query  499   GYGEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFF  678
             G  +G R  R F+PC+D  CDW EI  GL   RWY+++H+LPDGRQIIVGG+  FN+EFF
Sbjct  133   GDRDGERKTRLFAPCDDGSCDWTEIDKGLNARRWYASNHVLPDGRQIIVGGQGQFNFEFF  192

Query  679   PKSGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVV  858
             PK+  A   YSLPFL+QT D   G ENNLYP+V LN DGNLFIFANNRAILL+Y  N VV
Sbjct  193   PKTN-APNLYSLPFLSQTND--RGEENNLYPYVFLNTDGNLFIFANNRAILLNYATNTVV  249

Query  859   RTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAY-YNAKRNIFVGA  1035
             +TYPEIP G+PR+YPS+GSAVLLP+KNL     + EVLVCGG+PK +Y  + ++  FV A
Sbjct  250   KTYPEIPEGDPRSYPSTGSAVLLPIKNL-----VLEVLVCGGAPKGSYNLSFRKKTFVKA  304

Query  1036  LNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFH  1215
             L+TC RI I D NP+W+ E+MP  RVMGDM +LP G+VL+ING ++G A W+LGR PAF+
Sbjct  305   LDTCARININDANPQWLVEKMPRARVMGDMTLLPDGHVLLINGGSSGTAAWELGREPAFN  364

Query  1216  PVLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTEL  1395
             P LY PD P GSRFE+QN N IPRMYHS A L+ DGRVLV GSNPHA Y FT V FPTEL
Sbjct  365   PDLYHPDKPVGSRFEVQNANAIPRMYHSIATLLRDGRVLVGGSNPHAFYNFTGVLFPTEL  424

Query  1396  SMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAF  1575
             S+EAFSPSYL+ +Y++LRP I+ P  Q+ ++Y  ++ ++F VSG+V  S VKVTMV P+F
Sbjct  425   SLEAFSPSYLESQYSSLRPRIIDPMPQTTINYSRILRLRFTVSGRVK-SPVKVTMVYPSF  483

Query  1576  STHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIW  1755
             +THSFSMNQRLLVL+ V     G   Y + V  P S  LAP GYY++FVV+++IPS+G+W
Sbjct  484   TTHSFSMNQRLLVLDHVFSFRRGFRTYEVIVRTPSSAELAPPGYYMVFVVNQDIPSEGVW  543

Query  1756  VHIQ  1767
             + +Q
Sbjct  544   LRLQ  547



>ref|XP_009110252.1| PREDICTED: galactose oxidase-like [Brassica rapa]
Length=547

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/537 (60%), Positives = 396/537 (74%), Gaps = 20/537 (4%)
 Frame = +1

Query  175   AVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglgg  354
             ++  GGKW LL  ++GISAMHMQLL ND+VV FDRTN GPSNISLP+G C          
Sbjct  25    SLAAGGKWTLLLSNVGISAMHMQLLRNDRVVMFDRTNFGPSNISLPNGNC----------  74

Query  355   RKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTR  519
             R  P D     +CTAHS+EYDVASN+ RP+ V S+ WCSSGSV P G LVQTGG  +G  
Sbjct  75    RNNPQDAVSKIDCTAHSIEYDVASNTVRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGEL  134

Query  520   VVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPAD  699
               R FSPCN+  CDW EI   + + RWYS++HILPDG+QI++GG+  FNYEF+PK+   +
Sbjct  135   KARIFSPCNNNRCDWVEINNAVAKRRWYSSNHILPDGKQIVIGGQGQFNYEFYPKTTSPN  194

Query  700   TFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIP  879
                +LPFLA+T D   G ENNLYP+V LN DGNLFIFANNRAILLDYV N VV+TYP IP
Sbjct  195   VI-ALPFLAETND--RGQENNLYPYVFLNTDGNLFIFANNRAILLDYVKNTVVKTYPAIP  251

Query  880   GGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNA-KRNIFVGALNTCGRI  1056
             GG+PR+YPS+GSAVLLPLKNL+     AEVLVCGG+PK +Y  A +RN FV AL+TC RI
Sbjct  252   GGDPRSYPSTGSAVLLPLKNLEAVKIDAEVLVCGGAPKGSYILAFRRNTFVKALDTCARI  311

Query  1057  VITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPD  1236
              I D NP+W  E+MP  RVMGDM +LP G+VLI+NG  +G+A W+LGR P F P LY P+
Sbjct  312   KINDENPQWTVEKMPRARVMGDMTLLPNGDVLIVNGGASGSAAWELGREPVFVPDLYHPE  371

Query  1237  APPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSP  1416
              P  SRFE  NP+ IPRMYHS+A+L+ DGRVL  GSNPH  Y FT V FPTELS+EAFSP
Sbjct  372   NPVNSRFESLNPSTIPRMYHSTAILLRDGRVLGGGSNPHGFYNFTGVLFPTELSLEAFSP  431

Query  1417  SYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSM  1596
              YL+P++A LRP+IVSP SQ+ ++Y + + ++FKV G+V    VKVTMV P+F+THSFSM
Sbjct  432   VYLEPEFAKLRPKIVSPKSQTTITYRKTMKLKFKVVGEVK-GPVKVTMVFPSFTTHSFSM  490

Query  1597  NQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             NQRLLVL+ VK K +    Y + V  P S  +AP GYY++FVV+  IPS+GIWV ++
Sbjct  491   NQRLLVLDNVKFKRSKSTNYEVQVRTPRSAFIAPPGYYMMFVVNDNIPSEGIWVRLR  547



>ref|XP_008444780.1| PREDICTED: galactose oxidase-like [Cucumis melo]
Length=563

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/532 (60%), Positives = 395/532 (74%), Gaps = 19/532 (4%)
 Frame = +1

Query  187   GGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPP  366
             GG W+LLQ +IG+  MHMQLLHND+VV FDRT+ G SN+S PDGKC          R  P
Sbjct  44    GGGWHLLQENIGVLPMHMQLLHNDRVVIFDRTDFGASNLSFPDGKC----------RTDP  93

Query  367   DD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRR  531
             +D     +CTAHS+EYD+ASNSFRP++V +D WCS+G+    G LVQTGG+ +G R VR 
Sbjct  94    NDVALKLDCTAHSLEYDIASNSFRPLMVQTDVWCSAGAAMSDGALVQTGGFNDGDRRVRI  153

Query  532   FSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYS  711
             F P  +   DWEEIP+ L   RWY T+ ILPDGRQI++GGRR F+YEF PK+  A   YS
Sbjct  154   FKPYPNGS-DWEEIPFALAVRRWYPTNQILPDGRQIVIGGRRQFSYEFVPKTNGATKAYS  212

Query  712   LPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEP  891
              PFL +T DP +  ENNLYPFV LNVDGNLF+FANNR+IL DY  N V++ +P IPGG+P
Sbjct  213   FPFLVETNDPMI--ENNLYPFVFLNVDGNLFVFANNRSILFDYARNKVLKIFPAIPGGDP  270

Query  892   RNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDP  1071
             R YPS+GSA LLPL+NL+  T  AEVLVCGG+PK A+  A   IFVGALNTC +I ITDP
Sbjct  271   RCYPSTGSAALLPLRNLQAATIEAEVLVCGGAPKGAFDKAVNRIFVGALNTCAKIKITDP  330

Query  1072  NPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGS  1251
              PEW+ E MP  RVMGDMV+LP GNVLIINGA +G AGWD  R+P  +PVLYRP+  PGS
Sbjct  331   KPEWVMETMPMGRVMGDMVLLPNGNVLIINGAGSGTAGWDNARDPVLNPVLYRPNDSPGS  390

Query  1252  RFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDP  1431
             RF L NP+ IPR+YHS+AVL+ DGRVLV GSNP+  Y FT V FPTEL +EAFSP YLDP
Sbjct  391   RFRLLNPSPIPRLYHSTAVLLRDGRVLVGGSNPNVYYNFTGVPFPTELRLEAFSPPYLDP  450

Query  1432  KYAALRPEIVSPASQSGLSYGEVVSVQFKVSG-KVDMSQVKVTMVSPAFSTHSFSMNQRL  1608
             ++  LRP+I+SP+SQ+ +S+ + ++V+F V+G  V ++ V+VTMV+P F+THSFSM+QRL
Sbjct  451   EFENLRPKILSPSSQTTVSHAQQLAVRFTVTGNNVTLNAVEVTMVAPPFNTHSFSMSQRL  510

Query  1609  LVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             LV+    V   G   + + V  P SG +APSGYYLLFVVHREIPS GIW+ +
Sbjct  511   LVIGGENVTDMGNATWDVHVSIPKSGTIAPSGYYLLFVVHREIPSNGIWIRL  562



>ref|XP_010416450.1| PREDICTED: galactose oxidase-like isoform X1 [Camelina sativa]
Length=548

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/546 (59%), Positives = 402/546 (74%), Gaps = 27/546 (5%)
 Frame = +1

Query  154   FFTAAAAAVRG-GGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHH  330
             FF  +     G GG W LL P++GISAMH QLLHND+V+ +DRTN GPSNISLP G C  
Sbjct  22    FFLLSCHLTSGAGGTWKLLLPNVGISAMHSQLLHNDRVIMYDRTNFGPSNISLPHGAC--  79

Query  331   ggggglggRKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQT  495
                     R+ P+D     +CTAHSVEY+VA NS RP+ V S+ WCSSG V+P GTL+QT
Sbjct  80    --------RQSPNDAISKTDCTAHSVEYNVALNSIRPLTVQSNTWCSSGGVTPDGTLLQT  131

Query  496   GGYGEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEF  675
             GG  +G    R F+PC+D  CDW E+  GL   RWY+++H+LPDGRQII+GGR  FNYEF
Sbjct  132   GGSRDGELKTRLFAPCDDDSCDWTEVDNGLAAARWYASNHVLPDGRQIIIGGRDQFNYEF  191

Query  676   FPKSGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVV  855
             FPK+  A   Y+LPFL QTTDPG   ENNLYP+V LN DGNLFIFANNRAILL+Y  N V
Sbjct  192   FPKTN-APNLYALPFLTQTTDPG--QENNLYPYVFLNTDGNLFIFANNRAILLNYATNTV  248

Query  856   VRTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNA-KRNIFVG  1032
             V+TYPEIPGG+PR+YPS+GSAVLLP+KNL     + EVLVCGG+PK +Y  A K   F+ 
Sbjct  249   VKTYPEIPGGDPRSYPSTGSAVLLPIKNL-----VLEVLVCGGAPKGSYIFAFKSKTFIK  303

Query  1033  ALNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAF  1212
             AL+TC RI I DPNP+W  E+MP  RVMGDM +LP G+VL+ING ++G A W+LGR P F
Sbjct  304   ALDTCARININDPNPQWAVEKMPRARVMGDMTLLPDGHVLLINGGSSGTAAWELGREPVF  363

Query  1213  HPVLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTE  1392
             +P +Y PD P GSRFE QN N IPRMYHS+A L+ DGRV+V GSNPHA Y FT V FPTE
Sbjct  364   NPDIYYPDRPVGSRFEPQNANAIPRMYHSTATLLRDGRVIVGGSNPHAYYNFTGVLFPTE  423

Query  1393  LSMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPA  1572
             LS+EAFSPSYL+ KY++LRP I+ P  Q+ ++YG+++ ++F V G++  + VKVTMV P+
Sbjct  424   LSLEAFSPSYLESKYSSLRPVIMDPMPQTTINYGQILRLRFTVQGRMK-TPVKVTMVYPS  482

Query  1573  FSTHSFSMNQRLLVLNTVKVKAAGEEE-YGIDVVAPDSGNLAPSGYYLLFVVHREIPSKG  1749
             F+THSFSM+QRLLVL+ V     G    Y + V  P S NLAP GYY++FVV++ IPS+G
Sbjct  483   FNTHSFSMSQRLLVLDHVLFLRIGLSRIYEVSVRTPSSVNLAPPGYYMVFVVNQNIPSEG  542

Query  1750  IWVHIQ  1767
             +WV +Q
Sbjct  543   VWVRLQ  548



>ref|XP_004500954.1| PREDICTED: galactose oxidase-like [Cicer arietinum]
Length=555

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/536 (60%), Positives = 393/536 (73%), Gaps = 15/536 (3%)
 Frame = +1

Query  175   AVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglgg  354
             A  G G+W LLQ +IGI  MHMQLLHND+VV FDRT+ G SN+SLP+G+C          
Sbjct  28    AESGSGQWQLLQKNIGIVGMHMQLLHNDRVVIFDRTDFGLSNLSLPNGRCR-----INPQ  82

Query  355   RKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
              +    +CTAHS+EYDV SNSFRP+ V ++ WCSSGSVSP G L+QTGG+ +G R VR F
Sbjct  83    EQVVKTDCTAHSLEYDVVSNSFRPLFVQTNVWCSSGSVSPDGKLIQTGGFNDGDRTVRIF  142

Query  535   SPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPK-SGPADTFYS  711
             +PC  + CDW+E    L   RWYST+H LPDGRQII+GGRR FNYEF+PK    A   YS
Sbjct  143   NPC--SSCDWQEFNASLAARRWYSTNHNLPDGRQIIIGGRRQFNYEFYPKKESTAKNTYS  200

Query  712   LPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEP  891
             LPFL QT D G  AENNLYPFV LNVDGNLFIFANNRAIL DY +N VV+TYP IPGG+P
Sbjct  201   LPFLVQTNDAG--AENNLYPFVFLNVDGNLFIFANNRAILFDYNSNNVVKTYPVIPGGDP  258

Query  892   RNYPSSGSAVLLPLKNL-KGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITD  1068
             R+YPS+GSAVLLPL NL K P+  AEV++CGG+P+ ++       F+GALNTC RI ITD
Sbjct  259   RSYPSTGSAVLLPLSNLQKYPSVEAEVMICGGAPRGSFQKTLNGTFIGALNTCARIKITD  318

Query  1069  PNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPG  1248
             PNP W+ E MP  RVM DM++LP GNVL+INGA  G+AGW+ GRNP  +P LY+P+   G
Sbjct  319   PNPNWVIETMPGGRVMSDMLLLPNGNVLLINGAAMGSAGWESGRNPVLNPFLYKPNERVG  378

Query  1249  SRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKF-TNVFFPTELSMEAFSPSYL  1425
             SRF+LQ P+ IPRMYHS+AVL+ DGRVLV GSNPH  YKF  NV FPTEL +EAFSPSYL
Sbjct  379   SRFQLQKPSGIPRMYHSTAVLVRDGRVLVGGSNPHIDYKFNNNVLFPTELRLEAFSPSYL  438

Query  1426  DPKYAALRPEIVSPA--SQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMN  1599
             +     +RP++V PA  SQ+ L YG+ + V+F+V   +  + V VTM++P F+THSFSMN
Sbjct  439   EAGLDDVRPKMVFPAPQSQTKLKYGQKLKVRFQVKATLVRNSVSVTMIAPPFNTHSFSMN  498

Query  1600  QRLLVLN-TVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             QRLLVL   ++    GE  Y I+V  P S  LAP  YYLLFVVH+E+PS+G+WV +
Sbjct  499   QRLLVLEMKLQNNTVGESTYEIEVTTPGSAILAPPAYYLLFVVHQEVPSQGVWVQL  554



>ref|XP_006390288.1| hypothetical protein EUTSA_v10018361mg [Eutrema salsugineum]
 gb|ESQ27574.1| hypothetical protein EUTSA_v10018361mg [Eutrema salsugineum]
Length=552

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/529 (60%), Positives = 393/529 (74%), Gaps = 10/529 (2%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GG W LL  ++GISAMH QLL ND+V+ FDRTN GPSNISLP+G CH      +  +  
Sbjct  33    AGGTWQLLLSNVGISAMHSQLLINDRVIIFDRTNFGPSNISLPNGACHDSPNDAVSKQ--  90

Query  364   PDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPC  543
                +CTAHS+EYDVA N  RP+ V S+ WCSSG V P GTL+QTGG  +G R  R FSPC
Sbjct  91    ---DCTAHSIEYDVALNRIRPLTVQSNTWCSSGGVLPDGTLLQTGGDKDGERKARLFSPC  147

Query  544   NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFL  723
              D  CDW E+  GL   RWY+++HILPDGRQII+GGR  FN+EFFPK+  A   YSLPFL
Sbjct  148   QDNSCDWTEVDNGLAARRWYASNHILPDGRQIIIGGRGQFNFEFFPKTN-APNLYSLPFL  206

Query  724   AQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYP  903
             +QT D   G ENNLYP+V LN DGN+FIFANNRAILLDY  N V +TYPEIPGG+PR+YP
Sbjct  207   SQTND--RGDENNLYPYVFLNSDGNMFIFANNRAILLDYSKNNVFKTYPEIPGGDPRSYP  264

Query  904   SSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAY-YNAKRNIFVGALNTCGRIVITDPNPE  1080
             S+GSAVLLP+KNL+      EVLVCGG+PK ++  + +RN FV AL+TC RI I D NP+
Sbjct  265   STGSAVLLPVKNLEATVVDLEVLVCGGAPKGSFDLSLRRNTFVKALDTCARIKINDANPQ  324

Query  1081  WITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFE  1260
             WI E+MP  RVMGDM +LP G+VL+ING ++G AGW+LGR P  +P LY PD P GSRFE
Sbjct  325   WIVEKMPRARVMGDMTLLPDGHVLLINGGSSGTAGWELGREPVLNPDLYHPDKPVGSRFE  384

Query  1261  LQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYA  1440
             + NP+ IPRMYHS+A L+ DGRVLV GSNPHA Y FT V FPTEL +EAFSPSYL+ +Y 
Sbjct  385   VLNPSTIPRMYHSTAGLLRDGRVLVGGSNPHAFYNFTGVLFPTELRLEAFSPSYLETQYR  444

Query  1441  ALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLN  1620
             ++RP IVSP  QS ++YG ++ ++F+V G+V  S VKVTMV P+F+THSFSMNQRLLVL+
Sbjct  445   SIRPRIVSPTLQSTINYGGILRLRFRVMGRVK-SPVKVTMVFPSFTTHSFSMNQRLLVLD  503

Query  1621  TVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
                    G   + + V  P S NLAP G+Y++FVV+++IPS+GIWV +Q
Sbjct  504   HFGSSRMGLWTHEVRVKIPRSANLAPPGFYMVFVVNQDIPSEGIWVRLQ  552



>ref|XP_010498415.1| PREDICTED: galactose oxidase [Camelina sativa]
Length=549

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/535 (60%), Positives = 393/535 (73%), Gaps = 21/535 (4%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GG WN+L P++GISAMHMQLL ND+VV FDRTN GPSNISLP+G C          R  
Sbjct  29    AGGSWNVLLPNVGISAMHMQLLRNDRVVMFDRTNFGPSNISLPNGNC----------RDN  78

Query  364   PDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
             P+D     +CTAHS+EYDVA N+ RP+ V S+ WCSSGSV+P G LVQTGG  +G    R
Sbjct  79    PNDAVSRIDCTAHSIEYDVAMNTVRPLTVQSNTWCSSGSVTPDGVLVQTGGDRDGALKAR  138

Query  529   RFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFY  708
              FSPCN+ +CDW EI  GL++ RWYS++H+LPDG+QI++GG+  FNYEFFPK+   +   
Sbjct  139   TFSPCNNDQCDWVEIDNGLLKRRWYSSNHLLPDGKQIVIGGQGQFNYEFFPKTTSPNVV-  197

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
             +LPFLA+T D   G ENNLYP+V +N DGNLFIFANNRAILLDYV N VV+T+P IPGG+
Sbjct  198   ALPFLAETND--RGQENNLYPYVFMNTDGNLFIFANNRAILLDYVKNKVVKTFPAIPGGD  255

Query  889   PRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNA-KRNIFVGALNTCGRIVIT  1065
             PR+YPS+GSAVLLPLKNL+     AEVLVCGG+PK +Y  A +R  FV AL+TC RI I 
Sbjct  256   PRSYPSTGSAVLLPLKNLEAAKIEAEVLVCGGAPKGSYTLAFRRKTFVKALDTCARIKIN  315

Query  1066  DPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPP  1245
             D NP+W  E MP  RVMGDM +LP G+VLIING  +G+A W+LGR P   P +Y P+ P 
Sbjct  316   DANPQWTVETMPHARVMGDMTLLPNGDVLIINGGASGSAAWELGREPVLAPDVYHPENPV  375

Query  1246  GSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYL  1425
              +RFE  NP+ IPRMYHS+AVL+ DGRVLV GSNPHA Y+FT V FPTEL +EAFSP YL
Sbjct  376   NTRFETMNPSTIPRMYHSAAVLLRDGRVLVGGSNPHAFYEFTGVLFPTELRLEAFSPVYL  435

Query  1426  DPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQR  1605
             +P++A LRP I SP SQS + YG  + V+F V G+V    VKVTMV P+F+THSFSMNQR
Sbjct  436   EPQFATLRPRIQSPKSQSRIKYGLNLKVKFSVIGEV-TGPVKVTMVFPSFTTHSFSMNQR  494

Query  1606  LLVLNTVKVKAAGEE-EYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             LLVL+ VK    G    Y + V  P S  +A  GYY++FVV++ IPS+G+WV +Q
Sbjct  495   LLVLDNVKFTRKGRSTTYEVQVRTPKSAIIAQPGYYMMFVVNQNIPSEGVWVRLQ  549



>gb|KEH36231.1| glyoxal oxidase amino-terminal protein [Medicago truncatula]
Length=555

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/537 (59%), Positives = 397/537 (74%), Gaps = 17/537 (3%)
 Frame = +1

Query  175   AVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglgg  354
             A+  GG+W LLQ +IGI AMHMQLLHND+V+ FDRT+ G SN+SLP+G+C          
Sbjct  28    AIAAGGQWQLLQNNIGIVAMHMQLLHNDRVIIFDRTDFGFSNLSLPNGRCR-----VNPQ  82

Query  355   RKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
              +   ++CTAHS+EYDV SN+FRP+ + ++ WCSSGSV+P GTL+QTGG+ +G R VR F
Sbjct  83    EQAVKNDCTAHSLEYDVFSNTFRPLFIQTNIWCSSGSVNPNGTLIQTGGFNDGDRSVRTF  142

Query  535   SPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKS-GPADTFYS  711
             +PC    CDW+E    L   RWY+T+H LPDGRQII+GGRR FNYEF+PK    A   YS
Sbjct  143   NPC--PNCDWQEFNASLSARRWYATNHKLPDGRQIIIGGRRQFNYEFYPKKDATAKNTYS  200

Query  712   LPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEP  891
             LPFL QT D    AENNLYPFV LNVDGNLFIFANNRAIL DY +N VV+TYP IPGG+P
Sbjct  201   LPFLVQTNDAS--AENNLYPFVFLNVDGNLFIFANNRAILFDYNSNKVVKTYPTIPGGDP  258

Query  892   RNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDP  1071
             R+YPSSGSA LLPL+NL+ P   AEV++CGG+PK +Y    +  F+GALNTCGR+ ITDP
Sbjct  259   RSYPSSGSAALLPLRNLQNPLVEAEVMICGGAPKGSYEKTLQGSFIGALNTCGRLKITDP  318

Query  1072  NPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGS  1251
             NP W+ E MP  RVM DM++LP G+VL+INGA  G+AGW+ GRNP  +P LY+P++  GS
Sbjct  319   NPSWVMETMPGGRVMSDMILLPNGDVLLINGAAVGSAGWESGRNPVLNPFLYKPNSLVGS  378

Query  1252  RFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDP  1431
             RF+LQ P+ IPRMYHS+AVL+ DGRVLVAGSNPH  Y FT + FPTEL +EAFSPSYL+ 
Sbjct  379   RFQLQKPSDIPRMYHSTAVLLRDGRVLVAGSNPHVNYNFTRL-FPTELRLEAFSPSYLEL  437

Query  1432  KYAALRPEIVSPA--SQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQR  1605
              +  +RP +V PA  SQ+ L Y + + V+F+V   +  + V VTM +P+F+THSFSMNQR
Sbjct  438   GFNDVRPIMVFPAPQSQTKLKYAQKLKVRFQVKATLMKNMVSVTMYAPSFNTHSFSMNQR  497

Query  1606  LLVLNTV----KVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             LLVL+ +     V       Y ++V  P+S  LAP GYYLLFVVH+E+PS+G+WV +
Sbjct  498   LLVLDELSSSKNVVGESTSTYQVEVAIPNSPILAPPGYYLLFVVHQEVPSQGVWVQL  554



>ref|XP_010536365.1| PREDICTED: galactose oxidase-like [Tarenaya hassleriana]
Length=539

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/549 (60%), Positives = 399/549 (73%), Gaps = 25/549 (5%)
 Frame = +1

Query  154   FFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHg  333
               T   A V G G+W LL+ + GISAMH+QLL ND+VV FDRTN GPSNISLPDGKC   
Sbjct  1     MLTCHVAYVAGDGRWELLRGNAGISAMHIQLLRNDRVVMFDRTNWGPSNISLPDGKC---  57

Query  334   gggglggRKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTG  498
                    R  P+D     +CTAHSVEYDV +N  RP+ V+S+ +CSSGSV P GTLVQTG
Sbjct  58    -------RNNPNDRVSKMDCTAHSVEYDVVANRVRPLTVMSNPFCSSGSVRPDGTLVQTG  110

Query  499   GYGEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFF  678
             G  +G R+VR FS C    CDW EI  GL   RWY++DHILPDGRQ+IVGGR  FN+EFF
Sbjct  111   GDEDGDRMVRLFSACEMDGCDWTEIKSGLAVRRWYASDHILPDGRQVIVGGREQFNFEFF  170

Query  679   PKSGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVV  858
             PK+      YSLPFL++T D G  +ENNLYPF+ LNVDGNLF+FANNRAILLDY  NVVV
Sbjct  171   PKTKDPKV-YSLPFLSETNDNG--SENNLYPFIFLNVDGNLFVFANNRAILLDYGKNVVV  227

Query  859   RTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRN-IFVGA  1035
             +TYP IPGG+PR+YPSSGSAVL+PLKN++     A+VLVCGG+PK AY  A RN  FV A
Sbjct  228   KTYPMIPGGDPRSYPSSGSAVLIPLKNIEASNVEADVLVCGGAPKGAYQLAWRNNTFVEA  287

Query  1036  LNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFH  1215
             LNTC RI ITDPNP+W  E MP  RVMGDM++LP GNVLIING   G A +  G++P F 
Sbjct  288   LNTCARIKITDPNPQWTLETMPHARVMGDMILLPNGNVLIINGCAKGTASYQAGQDPVFA  347

Query  1216  PVLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTEL  1395
             PVLYRPD P GSRFE  NPN  PRMYHS+AVL+ DGRVLV GSNP+  Y FT V FPTEL
Sbjct  348   PVLYRPDNPIGSRFETLNPNTTPRMYHSTAVLLRDGRVLVGGSNPNPFYNFTGVLFPTEL  407

Query  1396  SMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAF  1575
             S++AFSPSYLDP ++  RP+I+SP SQS + Y   + ++F  +  V+ + V+VTMV P+F
Sbjct  408   SLQAFSPSYLDPGFSGTRPKIISPDSQSKIEYNSRLKLRFAANDVVNNATVRVTMVFPSF  467

Query  1576  STHSFSMNQRLLVLNTVK---VKAAGEEE---YGIDVVAPDSGNLAPSGYYLLFVVHREI  1737
             +THSFSMNQRLL L+ +    +K  G  +   Y + +  P + N+AP GYY++F+V+ EI
Sbjct  468   TTHSFSMNQRLLFLDIMDFTPLKTVGNGKSLIYEVVMKTPRTTNIAPPGYYMMFLVNGEI  527

Query  1738  PSKGIWVHI  1764
             PS+GIWV +
Sbjct  528   PSEGIWVQL  536



>ref|XP_010670864.1| PREDICTED: galactose oxidase-like [Beta vulgaris subsp. vulgaris]
Length=617

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/535 (60%), Positives = 397/535 (74%), Gaps = 23/535 (4%)
 Frame = +1

Query  193   KWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPDD  372
             +W LLQ SIG+SAMHMQLL+ND+V+  DRT+ GPSNISL +GKC          RK P D
Sbjct  96    QWQLLQKSIGVSAMHMQLLNNDRVIILDRTDFGPSNISLSNGKC----------RKDPYD  145

Query  373   -----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFS  537
                  +CTAHSVEYD  SN+FRP++VL+D WCSSG+    GTLVQTGGY +G RV R F 
Sbjct  146   LAMTTDCTAHSVEYDSLSNTFRPLMVLTDTWCSSGATLANGTLVQTGGYNDGARVARTFQ  205

Query  538   PCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSG-PADTFYSL  714
             P  +A CDW E+P  L+  RWY+TDH LPDGR I+VGGRRAFNYEF+PK+   +   Y L
Sbjct  206   PSCEA-CDWVEMPNKLLIRRWYATDHALPDGRLIVVGGRRAFNYEFYPKTTFSSSKLYKL  264

Query  715   PFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPR  894
             PFLAQT D  +  ENNLYPFV LNVDGNLFIFANNRAILLDY NN+VVRTYP IPGG+PR
Sbjct  265   PFLAQTNDAKM--ENNLYPFVFLNVDGNLFIFANNRAILLDYTNNLVVRTYPTIPGGDPR  322

Query  895   NYPSSGSAVLLPLKNLK-GPTTMA-EVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITD  1068
             +YPSSGSAVLLPL+NL+ G   M  EVL+CGG+P  +Y  A+   F+ ALNTC RI I  
Sbjct  323   SYPSSGSAVLLPLRNLEMGLLNMVVEVLICGGAPSGSYLKARSGQFLPALNTCARININS  382

Query  1069  PNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPG  1248
              N  W+ E MP  RVMGDM++LP G++L+INGA +G AGW+LGR+P   PV+Y P+   G
Sbjct  383   RNSTWVMETMPMARVMGDMIVLPNGDILLINGAGSGTAGWELGRDPVLEPVIYHPNNALG  442

Query  1249  SRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLD  1428
             SRFE QN ++IPRMYHSSA+++ DGRVLV GSNPH   +FT+V +PTELS+EAFSP YL+
Sbjct  443   SRFETQNSSQIPRMYHSSAIVMRDGRVLVGGSNPHMVNRFTHVLYPTELSLEAFSPPYLN  502

Query  1429  PKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRL  1608
             P    LRP I++P S S + Y +V+ V+F V G +D + + VTM+ P F+THSFSM+QRL
Sbjct  503   PNKTVLRPIIITPDSGSKVQYAQVLEVKFLVFGLIDQASIMVTMLRPPFNTHSFSMSQRL  562

Query  1609  LVL-NTVK-VKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             LVL NT++   + G  ++ ++V  P+S N++P GYYLLFVVH+ IPS GIWV I+
Sbjct  563   LVLTNTMQSATSIGPNQFQVNVTTPESTNISPPGYYLLFVVHQGIPSTGIWVQIK  617



>ref|XP_006383733.1| hypothetical protein POPTR_0005s25690g [Populus trichocarpa]
 gb|ERP61530.1| hypothetical protein POPTR_0005s25690g [Populus trichocarpa]
Length=557

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/534 (61%), Positives = 390/534 (73%), Gaps = 16/534 (3%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
             G G+W LLQ +IGI AMHMQLL+ND+VV +DRT+ G SNISLP GKC +     +     
Sbjct  31    GRGRWQLLQKNIGIVAMHMQLLNNDRVVIYDRTDYGKSNISLPHGKCRNDSWELVIKY--  88

Query  364   PDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPC  543
                +CTAHSVEYDV +N FRP++V ++ WCSSG+V P G+L+QTGG+ +G R VR F PC
Sbjct  89    ---DCTAHSVEYDVLANKFRPLMVQTNVWCSSGAVVPDGSLIQTGGFNDGQRKVRTFYPC  145

Query  544   NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFL  723
             N  +CDW E   GL   RWY+T+HILPDG+QII+GGRR FNYEF+PK+   D  YSLPFL
Sbjct  146   N-GDCDWVETGDGLKARRWYATNHILPDGKQIIIGGRRQFNYEFYPKTSSPDV-YSLPFL  203

Query  724   AQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYP  903
              QT D   G+ENNLYPFV LN DGNLFIFANNRAIL DY    VV+TYP IPGG+PR+YP
Sbjct  204   LQTND--RGSENNLYPFVFLNSDGNLFIFANNRAILFDYKTGKVVKTYPAIPGGDPRSYP  261

Query  904   SSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNI-----FVGALNTCGRIVITD  1068
             S+GSAVLLPLKNL   T  AEVLVCGG+PK ++  A +       F+ AL+TCGRI I +
Sbjct  262   STGSAVLLPLKNLDAATIEAEVLVCGGAPKGSFEMATKRKSAERKFLKALDTCGRIKINE  321

Query  1069  PNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPG  1248
             P+P+W+ E MP  RVMGDM +LP G VLIINGA +G AGW+ GR+PA +PVLY PD   G
Sbjct  322   PSPQWVMETMPCARVMGDMTLLPNGVVLIINGAGDGTAGWENGRSPALNPVLYWPDGAAG  381

Query  1249  SRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLD  1428
             SRFE  NP+ IPRMYHS+A+L+ DGRVLV GSNPH+ Y+FT V FPTELS+EAFSP YLD
Sbjct  382   SRFEPLNPSTIPRMYHSAAILLRDGRVLVGGSNPHSGYEFTRVLFPTELSLEAFSPPYLD  441

Query  1429  PKYAALRPEIVSPASQSG--LSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQ  1602
              K   LRP+IVS  +  G  + YG+ + V+FKV GK+    V VTMV+PAF+THSFSMN 
Sbjct  442   SKNKYLRPKIVSSTASKGKYIGYGQKLWVRFKVIGKLKADMVSVTMVAPAFNTHSFSMNH  501

Query  1603  RLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             RLL L   KV       Y I V  P SG LAPSGYY+L+VVH+ IPS GIWV +
Sbjct  502   RLLALRNEKVTYVRTSIYDIQVTTPSSGYLAPSGYYILYVVHQYIPSIGIWVKL  555



>gb|KGN62661.1| hypothetical protein Csa_2G365680 [Cucumis sativus]
Length=561

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/551 (58%), Positives = 397/551 (72%), Gaps = 20/551 (4%)
 Frame = +1

Query  133   QTFHNRGF-FTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISL  309
             QT     F F  + +     G+WNLLQ  IG+  MHMQLLH+D+VV FDRT+ G SN+  
Sbjct  23    QTLQFADFLFLVSQSQPIDSGRWNLLQEDIGVLPMHMQLLHSDRVVIFDRTDFGASNLPF  82

Query  310   PDGKCHHggggglggRKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSP  474
             PDGKC          R  P+D     +CTAHS+EYD+ASNSFRP++V +D WCS+G+   
Sbjct  83    PDGKC----------RMDPNDVALKLDCTAHSLEYDIASNSFRPLMVQTDVWCSAGAAMS  132

Query  475   AGTLVQTGGYGEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGR  654
              G LVQTGG+ +G R VR F P  +   DWEEIP+ L   RWY T+ ILPDGRQI++GGR
Sbjct  133   DGALVQTGGFNDGDRRVRIFKPYPNGS-DWEEIPFALAVRRWYPTNQILPDGRQIVIGGR  191

Query  655   RAFNYEFFPKSGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILL  834
             R F+YEF PK+  A   YS PFL +T DP +  ENNLYPFV LNVDGNLF+FANNR+IL 
Sbjct  192   RQFSYEFVPKTNGATKAYSFPFLVETNDPLI--ENNLYPFVFLNVDGNLFVFANNRSILF  249

Query  835   DYVNNVVVRTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAK  1014
             DY  N V++ +P IPGG+PR YPS+GSAVLLPL+NL+  T  AEVLVCGG+PK A+  A 
Sbjct  250   DYARNKVLKIFPAIPGGDPRCYPSTGSAVLLPLRNLQAATIEAEVLVCGGAPKGAFDKAV  309

Query  1015  RNIFVGALNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDL  1194
               IFVGALNTC RI ITDP PEW+ E MP  RVMGDMV+LP G+VLIINGA +G AGWD 
Sbjct  310   NRIFVGALNTCARIKITDPKPEWVMETMPMGRVMGDMVLLPNGDVLIINGAGSGTAGWDN  369

Query  1195  GRNPAFHPVLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTN  1374
              R+P  +P+LYRP+  PGSRF L NP+ IPR+YHS+AVL+ DGRVLV GSNP+  Y FT 
Sbjct  370   ARDPILNPILYRPNDSPGSRFRLLNPSPIPRLYHSTAVLLRDGRVLVGGSNPNVYYNFTG  429

Query  1375  VFFPTELSMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSG-KVDMSQVK  1551
             V FPTEL +EAFSP YLDP++  +RP+I+SP+SQ+ + + + ++V+F V+G  V ++ V+
Sbjct  430   VPFPTELRLEAFSPPYLDPEFENMRPKILSPSSQTTVRHTQQLAVRFNVTGNNVSLNTVE  489

Query  1552  VTMVSPAFSTHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHR  1731
             VTMV+P F+THSFSM+QRLLV+    V   G     + V  P SG +AP GYYLLFVVHR
Sbjct  490   VTMVAPPFNTHSFSMSQRLLVIGGENVTDLGNATCDVHVSIPGSGTIAPYGYYLLFVVHR  549

Query  1732  EIPSKGIWVHI  1764
             EIPS GIW+ I
Sbjct  550   EIPSNGIWIRI  560



>ref|XP_009388162.1| PREDICTED: galactose oxidase-like [Musa acuminata subsp. malaccensis]
Length=544

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/546 (59%), Positives = 399/546 (73%), Gaps = 28/546 (5%)
 Frame = +1

Query  160   TAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggg  339
             T  AA   GGG+W LLQ SIG+SAMHMQLLHND+VV FDRT+ GPSN+SLP GKC     
Sbjct  17    TVVAATAAGGGQWALLQRSIGVSAMHMQLLHNDRVVVFDRTDFGPSNLSLPVGKC-----  71

Query  340   gglggRKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGY  504
                  R  PD+     +CTAHSVEYDVA+N+FRP+++L+D WCSSG+V+P GTLVQTGG+
Sbjct  72    -----RNDPDEKALRVDCTAHSVEYDVAANTFRPLMLLTDAWCSSGTVAPDGTLVQTGGF  126

Query  505   GEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPK  684
              +G R  R F PC+D  C+W E+P  L   RWY+T+ ILPDGR I+VGGRR FNYEF+PK
Sbjct  127   NDGERASRTFRPCDDCRCNWVEVPQALAVRRWYATNQILPDGRAIVVGGRRQFNYEFYPK  186

Query  685   SGPADTF--YSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVV  858
             S  A      +LPFL  T D     ENNLYPFV LN+DGNLF+FANNRAILLDY  N VV
Sbjct  187   SPDASDLRTIALPFLRDTRD---AVENNLYPFVHLNIDGNLFVFANNRAILLDYTKNTVV  243

Query  859   RTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPT-TMAEVLVCGGSPKDAYYNAKRNI-FVG  1032
             +TYP++PGGEPRNYPS+GS+VLLPLK    P+   AEVL+CGG+P  +Y  A ++  FV 
Sbjct  244   KTYPKMPGGEPRNYPSTGSSVLLPLK----PSPKEAEVLICGGAPMGSYVQALQSRGFVR  299

Query  1033  ALNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAF  1212
             AL+TCGRI IT+    W  E MP PRVMGDMV+LP+G VL+INGA  G AGW+L R+P  
Sbjct  300   ALDTCGRIKITEAAASWSMETMPVPRVMGDMVLLPSGEVLMINGAAAGTAGWELARDPVL  359

Query  1213  HPVLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTE  1392
              PV+YRP+ P G+RF++Q+P+  PR+YHS+AVL+ DGRVLV GSNP+  Y F+ V FPTE
Sbjct  360   TPVVYRPERPAGARFDIQSPSTTPRLYHSTAVLLRDGRVLVGGSNPNVNYNFSGVEFPTE  419

Query  1393  LSMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPA  1572
             LS+EAFSP+YL P ++A RP IV+  S   LSYG+  S+QF  +G V    V+VTMV+P+
Sbjct  420   LSLEAFSPAYLSPAHSARRPRIVTSPSPLRLSYGKRFSLQF-TAGAVGDEGVRVTMVAPS  478

Query  1573  FSTHSFSMNQRLLVLNT-VKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKG  1749
             F+THSFSMNQRLLVL T    KAA    Y +  +AP S  LAPSGYY++FVV+  +PS+ 
Sbjct  479   FATHSFSMNQRLLVLETEAAAKAADSGTYQVMAMAPASAILAPSGYYMVFVVNGGVPSES  538

Query  1750  IWVHIQ  1767
              W HIQ
Sbjct  539   NWAHIQ  544



>ref|XP_010916153.1| PREDICTED: galactose oxidase-like [Elaeis guineensis]
Length=541

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/525 (61%), Positives = 387/525 (74%), Gaps = 13/525 (2%)
 Frame = +1

Query  196   WNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPDDN  375
             W+LLQ SIG+SAMHMQLLHND+V+ FDRT+ G SN+SLPDGKC +         K    +
Sbjct  29    WDLLQRSIGVSAMHMQLLHNDRVIIFDRTDFGRSNLSLPDGKCRNDPN-----EKVLKID  83

Query  376   CTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCNDAE  555
             CTAHS EYD+A+N+FRP+++L+D WCSSG+V+P G L+QTGG+ +G R VR F PCND  
Sbjct  84    CTAHSAEYDLATNTFRPLMILTDSWCSSGTVAPDGRLIQTGGWNDGDRAVRTFVPCNDGS  143

Query  556   CDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPAD-TFYSLPFLAQT  732
             CDW E P GL   RWY+T+ ILPDGR IIVGGR+ FN+EF PK  P+D T + LPFL  T
Sbjct  144   CDWSEDPQGLAARRWYATNQILPDGRAIIVGGRKQFNFEFHPKPNPSDLTTFPLPFLQAT  203

Query  733   TDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYPSSG  912
              D     E+NLYPFV LN+DGNLFIFANNRAILLDY  N VVRTYPE+PGG+PRNYPSSG
Sbjct  204   KD---DVEDNLYPFVHLNIDGNLFIFANNRAILLDYTKNAVVRTYPEMPGGDPRNYPSSG  260

Query  913   SAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEWITE  1092
             S+VLLPLK      T AEVLVCGG+P  +Y +A+ + ++ AL TCGRI ITD +P W  E
Sbjct  261   SSVLLPLKP---SATEAEVLVCGGAPMGSYTSAREDNYMQALKTCGRIKITDQSPSWSME  317

Query  1093  EMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFELQNP  1272
              MP PRVMGDM++LP+G VL++NGA  G AGW+LG  P   PVLYRP++  GSRF++QNP
Sbjct  318   TMPTPRVMGDMILLPSGEVLLLNGAAAGTAGWELGHEPVLTPVLYRPESMAGSRFQVQNP  377

Query  1273  NKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAALRP  1452
               IPR+YHSSA+LI DGRVLV GSNPH  Y FT V FPTELS+EAFSP YL  + +  RP
Sbjct  378   ATIPRLYHSSAILIRDGRVLVGGSNPHVYYNFTGVDFPTELSLEAFSPEYLSSENSNSRP  437

Query  1453  EIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNTVKV  1632
             +I   AS   L+YG+  S++F V G +    V VTM +PAFSTHSFSMNQRLL+L T   
Sbjct  438   KIDISASPISLNYGKQFSMRFAV-GAISGGGVTVTMAAPAFSTHSFSMNQRLLILETGTA  496

Query  1633  KAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
              +     Y +  VAP SG LAPSGYYL+FVV+  IPS+G+W HI+
Sbjct  497   LSGDNSSYEVTAVAPASGVLAPSGYYLVFVVNGGIPSEGVWAHIK  541



>gb|KEH24796.1| glyoxal oxidase amino-terminal protein [Medicago truncatula]
Length=516

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/524 (60%), Positives = 391/524 (75%), Gaps = 12/524 (2%)
 Frame = +1

Query  202   LLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPDDNCT  381
             +LQ SIG+ AMHMQLLHND++V FDRT+ G SN+SLP+G+C H     +       D+CT
Sbjct  1     MLQKSIGVVAMHMQLLHNDRIVIFDRTDFGYSNLSLPNGQCRHDPAELVV-----KDDCT  55

Query  382   AHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCNDAECD  561
             AHS+EYDV SN+FRP+ V ++ WCSSGSV P G+LVQTGGY +G R +R +SPC    CD
Sbjct  56    AHSLEYDVLSNTFRPLFVKTNIWCSSGSVRPNGSLVQTGGYNDGNRNIRIYSPC--PTCD  113

Query  562   WEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFLAQTTDP  741
             W EI  GL   RWY+T HILP+G QI+VGGR  FNYEF+PKS   +  YSL FLA+T DP
Sbjct  114   WSEIDGGLSAERWYATSHILPNGSQIVVGGRGQFNYEFYPKSNDINANYSLSFLAETNDP  173

Query  742   GLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYPSSGSAV  921
                 ENNLYPFV LNVDGNLFI ANN++IL DY   +VV+T+PE+PGG+PRNYPS+GSAV
Sbjct  174   E--QENNLYPFVFLNVDGNLFIMANNKSILFDYTKGMVVKTFPEVPGGDPRNYPSTGSAV  231

Query  922   LLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEWITEEMP  1101
             LLPLKNL+     AEVLVCGG+ + +Y  +K+ +F+ ALNTC RI ITDPNP+W  E MP
Sbjct  232   LLPLKNLEAKNLEAEVLVCGGASRGSYLQSKKEVFLKALNTCARIKITDPNPQWDMETMP  291

Query  1102  FPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFELQNPNKI  1281
              PRVM DMV+LP GN+LIINGA++G +GW+ GR+PA  P LYR + P GSRF+LQ  ++ 
Sbjct  292   SPRVMSDMVMLPNGNILIINGASSGTSGWEQGRDPALTPFLYRTNNPIGSRFKLQRSSET  351

Query  1282  PRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAALRPEIV  1461
             PRMYHS+AVL+ DGRVLV GSNPH+ Y FTNV FPTELS+EA+SPSYL  + +  RP+I+
Sbjct  352   PRMYHSTAVLVRDGRVLVGGSNPHSGYSFTNVLFPTELSIEAYSPSYLSDRLSNYRPKIM  411

Query  1462  S--PASQSGLSYGEVVSVQFKVSGKVD-MSQVKVTMVSPAFSTHSFSMNQRLLVLNTVKV  1632
             S    +Q  L YG+ + +QF+V+  +  ++ V VTM+ P F+THSFSMNQRLLVL   KV
Sbjct  412   SLDSKTQMELKYGQKLELQFQVNRTLKYLNLVHVTMLLPPFNTHSFSMNQRLLVLEQNKV  471

Query  1633  KAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
                    Y I+V  P+S  LAP G+YLLFVV+ +IPS+GIWVHI
Sbjct  472   NRVNGTTYEIEVTVPNSPILAPPGFYLLFVVNAQIPSEGIWVHI  515



>ref|XP_004164439.1| PREDICTED: galactose oxidase-like [Cucumis sativus]
Length=561

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/551 (58%), Positives = 396/551 (72%), Gaps = 20/551 (4%)
 Frame = +1

Query  133   QTFHNRGF-FTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISL  309
             QT     F F  + +     G+WNLLQ  IG+  MHMQLLH+D+VV FDRT+ G SN+  
Sbjct  23    QTLQFADFLFLVSQSQPIDSGRWNLLQEDIGVLPMHMQLLHSDRVVIFDRTDFGASNLPF  82

Query  310   PDGKCHHggggglggRKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSP  474
             PDGKC          R  P+D     +CTAHS+EYD+ASNSFRP++V +D WCS+G+   
Sbjct  83    PDGKC----------RMDPNDVALKLDCTAHSLEYDIASNSFRPLMVQTDVWCSAGAAMS  132

Query  475   AGTLVQTGGYGEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGR  654
              G LVQTGG+ +G R VR F P  +   DWEEIP+ L   RWY T+ ILPDGRQI++GGR
Sbjct  133   DGALVQTGGFNDGDRRVRIFKPYPNGS-DWEEIPFALAVRRWYPTNQILPDGRQIVIGGR  191

Query  655   RAFNYEFFPKSGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILL  834
             R F+YEF PK+  A   YS PFL +T DP +  ENNLYPFV LNVDGNLF+FANNR+IL 
Sbjct  192   RQFSYEFVPKTNGATKAYSFPFLVETNDPLI--ENNLYPFVFLNVDGNLFVFANNRSILF  249

Query  835   DYVNNVVVRTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAK  1014
             DY  N V++ +P IPGG+PR YPS+GSAVLLPL+ L+  T  AEVLVCGG+PK A+  A 
Sbjct  250   DYARNKVLKIFPAIPGGDPRCYPSTGSAVLLPLRKLQAATIEAEVLVCGGAPKGAFDKAV  309

Query  1015  RNIFVGALNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDL  1194
               IFVGALNTC RI ITDP PEW+ E MP  RVMGDMV+LP G+VLIINGA +G AGWD 
Sbjct  310   NRIFVGALNTCARIKITDPKPEWVMETMPMGRVMGDMVLLPNGDVLIINGAGSGTAGWDN  369

Query  1195  GRNPAFHPVLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTN  1374
              R+P  +P+LYRP+  PGSRF L NP+ IPR+YHS+AVL+ DGRVLV GSNP+  Y FT 
Sbjct  370   ARDPILNPILYRPNDSPGSRFRLLNPSPIPRLYHSTAVLLRDGRVLVGGSNPNVYYNFTG  429

Query  1375  VFFPTELSMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSG-KVDMSQVK  1551
             V FPTEL +EAFSP YLDP++  +RP+I+SP+SQ+ + + + ++V+F V+G  V ++ V+
Sbjct  430   VPFPTELRLEAFSPPYLDPEFENMRPKILSPSSQTTVRHTQQLAVRFNVTGNNVSLNTVE  489

Query  1552  VTMVSPAFSTHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHR  1731
             VTMV+P F+THSFSM+QRLLV+    V   G     + V  P SG +AP GYYLLFVVHR
Sbjct  490   VTMVAPPFNTHSFSMSQRLLVIGGENVTDLGNATCDVHVSIPGSGTIAPYGYYLLFVVHR  549

Query  1732  EIPSKGIWVHI  1764
             EIPS GIW+ I
Sbjct  550   EIPSNGIWIRI  560



>ref|XP_004152661.1| PREDICTED: galactose oxidase-like [Cucumis sativus]
Length=561

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/551 (58%), Positives = 396/551 (72%), Gaps = 20/551 (4%)
 Frame = +1

Query  133   QTFHNRGF-FTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISL  309
             QT     F F  + +     G+WNLLQ  IG+  MHMQLLH+D+VV FDRT+ G SN+  
Sbjct  23    QTLQFADFLFLVSQSQPIDSGRWNLLQEDIGVLPMHMQLLHSDRVVIFDRTDFGASNLPF  82

Query  310   PDGKCHHggggglggRKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSP  474
             PDGKC          R  P+D     +CTAHS+EYD+ASNSFRP++V +D WCS+G+   
Sbjct  83    PDGKC----------RMDPNDVALKLDCTAHSLEYDIASNSFRPLMVQTDVWCSAGAAMS  132

Query  475   AGTLVQTGGYGEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGR  654
              G LVQTGG+ +G R VR   P  +   DWEEIP+ L   RWY T+ ILPDGRQI++GGR
Sbjct  133   DGALVQTGGFNDGDRRVRILKPYPNGS-DWEEIPFALAVRRWYPTNQILPDGRQIVIGGR  191

Query  655   RAFNYEFFPKSGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILL  834
             R F+YEF PK+  A   YS PFL +T DP +  ENNLYPFV LNVDGNLF+FANNR+IL 
Sbjct  192   RQFSYEFVPKTNGATKAYSFPFLVETNDPLI--ENNLYPFVFLNVDGNLFVFANNRSILF  249

Query  835   DYVNNVVVRTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAK  1014
             DY  N V++ +P IPGG+PR YPS+GSAVLLPL+NL+  T  AEVLVCGG+PK A+  A 
Sbjct  250   DYARNKVLKIFPAIPGGDPRCYPSTGSAVLLPLRNLQAATIEAEVLVCGGAPKGAFDKAV  309

Query  1015  RNIFVGALNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDL  1194
               IFVGALNTC RI ITDP PEW+ E MP  RVMGDMV+LP G+VLIINGA +G AGWD 
Sbjct  310   NRIFVGALNTCARIKITDPKPEWVMETMPMGRVMGDMVLLPNGDVLIINGAGSGTAGWDN  369

Query  1195  GRNPAFHPVLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTN  1374
              R+P  +P+LYRP+  PGSRF L NP+ IPR+YHS+AVL+ DGRVLV GSNP+  Y FT 
Sbjct  370   ARDPILNPILYRPNDSPGSRFRLLNPSPIPRLYHSTAVLLRDGRVLVGGSNPNVYYNFTG  429

Query  1375  VFFPTELSMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSG-KVDMSQVK  1551
             V FPTEL +EAFSP YLDP++  +RP+I+SP+SQ+ + + + ++V+F V+G  V ++ V+
Sbjct  430   VPFPTELRLEAFSPPYLDPEFENMRPKILSPSSQTTVRHTQQLAVRFNVTGNNVSLNTVE  489

Query  1552  VTMVSPAFSTHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHR  1731
             VTMV+P F+THSFSM+QRLLV+    V   G     + V  P SG +AP GYYLLFVVHR
Sbjct  490   VTMVAPPFNTHSFSMSQRLLVIGGENVTDLGNATCDVHVSIPGSGTIAPYGYYLLFVVHR  549

Query  1732  EIPSKGIWVHI  1764
             EIPS GIW+ I
Sbjct  550   EIPSNGIWIRI  560



>ref|XP_004486272.1| PREDICTED: galactose oxidase-like [Cicer arietinum]
Length=540

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/529 (60%), Positives = 393/529 (74%), Gaps = 13/529 (2%)
 Frame = +1

Query  187   GGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPP  366
             GG+W +LQ +IGI AMHMQLLHND++V FDRT+ G SNISLP+G+C +         K  
Sbjct  21    GGEWKVLQKNIGIVAMHMQLLHNDRIVIFDRTDFGLSNISLPNGRCRYDPS-----EKVV  75

Query  367   DDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCN  546
               +CTAHS+EYDV  N+FRP+ V +D WCSSG+V   G LVQTGGY +G R VR F+PC+
Sbjct  76    KVDCTAHSIEYDVTHNTFRPLFVQTDVWCSSGTVRSDGALVQTGGYSDGERNVRIFTPCH  135

Query  547   DAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKS--GPADTFYSLPF  720
                CDW E+  GL   RWY+T HILPD RQI++GGRR FNYEFFPKS  G A+  Y+LPF
Sbjct  136   T--CDWIELNGGLDTRRWYATSHILPDSRQIVIGGRRQFNYEFFPKSINGRANNVYNLPF  193

Query  721   LAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNY  900
             L +T DP    ENNLYPFV LNVDGNLFI AN++AILLDY  N+VV+T+PE+PGG+PR Y
Sbjct  194   LVETNDPH--QENNLYPFVFLNVDGNLFIMANSKAILLDYTKNMVVKTFPEVPGGDPRCY  251

Query  901   PSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPE  1080
             PS+GSAVLLPL+NL+     AEVLVCGG+P+ ++ N K++ F  ALNTC RI ITDPNP+
Sbjct  252   PSTGSAVLLPLRNLQAAFLEAEVLVCGGAPRGSFNNTKKHEFRQALNTCARIKITDPNPQ  311

Query  1081  WITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFE  1260
             W  E MP  RVM DMV+LP GNVL+INGA+ G AGW+ GRNP   P LY  + P GSRF+
Sbjct  312   WEMETMPGARVMSDMVMLPNGNVLLINGASFGTAGWEQGRNPVLTPFLYETNNPIGSRFK  371

Query  1261  LQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYA  1440
              Q+P+  PRMYHS+A+L+ DGRV+V GSNPH  Y F NV FPTELS+EAFSPSYL+ +Y+
Sbjct  372   KQSPSTTPRMYHSTAILVRDGRVVVGGSNPHVGYSFENVLFPTELSLEAFSPSYLERRYS  431

Query  1441  ALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDM-SQVKVTMVSPAFSTHSFSMNQRLLVL  1617
              LRP I+S   Q  LSYG+ + +QF+++  ++  + V VTM++P+F+THSFSMNQRLLVL
Sbjct  432   HLRPRILS-EPQIKLSYGQKLELQFQMNVTLNYPNLVHVTMLAPSFTTHSFSMNQRLLVL  490

Query  1618  NTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
                KV    ++ YGI V  P S  LAP G+YLLFVV+ +IPS+GIW  I
Sbjct  491   EPNKVGIVQDKTYGIKVTVPGSSTLAPPGFYLLFVVYGKIPSEGIWAQI  539



>emb|CDY44191.1| BnaC05g15480D [Brassica napus]
Length=777

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/530 (61%), Positives = 392/530 (74%), Gaps = 21/530 (4%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GGKWNLL P++GISAMHMQLL ND+VV FDRTN GPSNISLP+G C          R  
Sbjct  28    AGGKWNLLLPNVGISAMHMQLLRNDRVVMFDRTNFGPSNISLPNGNC----------RNN  77

Query  364   PDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
             P D     +CTAHS+EYDVASN+ RP+ V S+ WCSSGSV P G LVQTGG  +G    R
Sbjct  78    PQDPISKIDCTAHSIEYDVASNTIRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKAR  137

Query  529   RFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFY  708
              FSPC D  CDW EI  GL + RWYS++HILPDG+QI++GG+  FNYEFFPK+   +   
Sbjct  138   IFSPCKDKRCDWIEINNGLTKRRWYSSNHILPDGKQIVIGGQGQFNYEFFPKTTSPNVI-  196

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
             +LPFLA+T D   G ENNLYP+V LN DG LFIFANNRAILLDYV N VV+TYP IPGG+
Sbjct  197   ALPFLAETND--RGEENNLYPYVFLNTDGRLFIFANNRAILLDYVKNTVVKTYPAIPGGD  254

Query  889   PRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNA-KRNIFVGALNTCGRIVIT  1065
             PR+YPS+GSAVLLPLKNL+     AEVLVCGG+PK +Y  A +R  FV AL+TC RI I 
Sbjct  255   PRSYPSTGSAVLLPLKNLEAVKIDAEVLVCGGAPKGSYLLAFRRKTFVKALDTCARIKIN  314

Query  1066  DPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPP  1245
             D NP+W+ E+MP  RVMGDM +LP G+VLIING  +G+A W+LGR P   P +Y P+ P 
Sbjct  315   DENPQWMVEKMPRARVMGDMTLLPNGDVLIINGGASGSAAWELGREPVLVPDVYHPENPV  374

Query  1246  GSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYL  1425
              SRFE  NP  IPRMYHS+AVL+ DGRVLV GSNPHA Y FTNV FPTELS+EAFSP YL
Sbjct  375   NSRFESLNPTTIPRMYHSTAVLLRDGRVLVGGSNPHAFYNFTNVLFPTELSLEAFSPGYL  434

Query  1426  DPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQR  1605
             +P++A LRP+I SP SQ  ++Y   + ++FKV+G+V    VKVTMV P+F+THSFSMNQR
Sbjct  435   EPEFAKLRPKIQSPKSQVMITYRMNLKLKFKVAGEVK-GPVKVTMVFPSFTTHSFSMNQR  493

Query  1606  LLVLNTVKVKAAGEE-EYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGI  1752
             LLVL+ V  K +G+   Y ++V  P S N+A  GYY++FVV++ IPS+ +
Sbjct  494   LLVLDNVTFKRSGKSTNYEVEVKTPRSANIALPGYYMVFVVNQNIPSEDL  543



>ref|XP_010539855.1| PREDICTED: galactose oxidase-like [Tarenaya hassleriana]
Length=504

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/529 (60%), Positives = 382/529 (72%), Gaps = 29/529 (5%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
             G G W LL  S+GISAMHMQLLHND+V+ +DRT  GPSN++LP GKC             
Sbjct  4     GEGWWQLLHGSVGISAMHMQLLHNDRVIMYDRTEFGPSNVALPGGKCIGNAA--------  55

Query  364   PDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPC  543
                +CTAHS+EYDV SN FRP+ V S+ WCSSG V+P GTLVQTGG+  G R VR F+PC
Sbjct  56    ---DCTAHSIEYDVISNGFRPLTVQSNIWCSSGYVTPDGTLVQTGGFWTGERRVRLFTPC  112

Query  544   NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFL  723
              +  CDW+E+  GL   RWY+T+HILPDG QII+GGR  FN+EFFPK+   +  Y+LPFL
Sbjct  113   KNNICDWKEVDNGLACKRWYATNHILPDGSQIILGGRDQFNFEFFPKTKYPNA-YNLPFL  171

Query  724   AQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYP  903
             A+T D   G ENNLYPFV LNVDGNLF+FANNRAILLDY  N VV+TYP IPGG+PR+YP
Sbjct  172   AETKD--FGTENNLYPFVFLNVDGNLFVFANNRAILLDYSKNTVVKTYPTIPGGDPRSYP  229

Query  904   SSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEW  1083
             S+GSAVLLPLKNL+     AEVLVCGG+P+ +Y  A +N FV AL+TC RI ITDPNP+W
Sbjct  230   STGSAVLLPLKNLEAINVEAEVLVCGGAPRGSYEQAMKNNFVKALDTCARIKITDPNPQW  289

Query  1084  ITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFEL  1263
               E MP  RVMGDM+ILP G+VLIING  +G A W+LGR+P   P LYRPD P GSRF+ 
Sbjct  290   AIETMPQARVMGDMIILPNGDVLIINGGASGTAAWELGRDPVLAPDLYRPDNPVGSRFKT  349

Query  1264  QNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAA  1443
             QNP  IPRMYHSS VL+ DGRVLV GSNPHA Y FT V FPTELS+EAFSPSYL  +   
Sbjct  350   QNPTTIPRMYHSSTVLLRDGRVLVGGSNPHAYYNFTGVLFPTELSLEAFSPSYLGKEKPC  409

Query  1444  LRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNT  1623
             ++             Y   + + F VSG+V +  VKVTMV P+F+THSFSMNQRLLVL+ 
Sbjct  410   IK-------------YNTTIKLVFAVSGEVKIP-VKVTMVLPSFTTHSFSMNQRLLVLDN  455

Query  1624  VKVKAAGE-EEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             ++    G    Y + V  P S N+AP GYY++FVV+++IPSKGIWV +Q
Sbjct  456   IEFYRKGNTTTYNVVVKTPGSSNIAPPGYYMMFVVNQDIPSKGIWVQLQ  504



>ref|XP_010459669.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=550

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/536 (59%), Positives = 390/536 (73%), Gaps = 22/536 (4%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GG WN+L P++GISAMHMQLL ND+VV FDRTN GPSNISLP+G C          R  
Sbjct  29    AGGSWNVLLPNVGISAMHMQLLRNDRVVMFDRTNFGPSNISLPNGNC----------RDN  78

Query  364   PDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
             P+D     +CTAHS+EYDVA N+ RP+ V S+ WCSSGSV P G LVQTGG  +G    R
Sbjct  79    PNDAVSRMDCTAHSIEYDVAMNTVRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGALKAR  138

Query  529   RFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQ-IIVGGRRAFNYEFFPKSGPADTF  705
              FSPCN+ +CDW EI  GL + RWYS++H+LPDG+Q I++GG+  FNYEFFPK+   +  
Sbjct  139   TFSPCNNDQCDWVEIDNGLSKRRWYSSNHLLPDGKQQIVIGGQGQFNYEFFPKTTNPNVV  198

Query  706   YSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGG  885
              +LPFLA+T D   G ENNLYP+V +N DGNLFIFANNRAILLDYV N VV+T+P IPGG
Sbjct  199   -ALPFLAETND--RGQENNLYPYVFMNTDGNLFIFANNRAILLDYVKNTVVKTFPAIPGG  255

Query  886   EPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNA-KRNIFVGALNTCGRIVI  1062
             +PR+YPS+GSAVLLPLKNL+     AEVLVCGG+PK +Y  A +R  FV AL+TC RI I
Sbjct  256   DPRSYPSTGSAVLLPLKNLEVAKIEAEVLVCGGAPKGSYNLAFRRKTFVKALDTCARIKI  315

Query  1063  TDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAP  1242
              D +P+W  E MP  RVMGDM +LP G+VLIING  +G+A W+LGR P   P +Y P+ P
Sbjct  316   NDADPQWTVETMPHARVMGDMTLLPNGDVLIINGGASGSAAWELGREPVLAPDVYHPENP  375

Query  1243  PGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSY  1422
               +RFE  NP+ IPRMYHS+AVL+ DGRVLV GSNPHA Y+FT V FPTEL +EAFSP Y
Sbjct  376   VNTRFETMNPSTIPRMYHSAAVLLRDGRVLVGGSNPHAFYEFTGVLFPTELRLEAFSPVY  435

Query  1423  LDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQ  1602
             L+ ++A LRP I SP SQS + YG  + V+F V G+V    VKVTMV P+F+THSFSMNQ
Sbjct  436   LEQQFANLRPRIQSPKSQSRIKYGMNLKVKFSVIGEV-TGPVKVTMVFPSFTTHSFSMNQ  494

Query  1603  RLLVLNTVKVKAAGEE-EYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             RLLVL+ VK    G    Y + V  P S  +A  GYY++FVV++ IPS+G+WV +Q
Sbjct  495   RLLVLDNVKFTRKGRSTTYEVQVRTPKSAIIAQPGYYMMFVVNQNIPSEGVWVRLQ  550



>ref|XP_003527665.1| PREDICTED: galactose oxidase-like [Glycine max]
Length=541

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/537 (57%), Positives = 390/537 (73%), Gaps = 10/537 (2%)
 Frame = +1

Query  163   AAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHgggg  342
             +   A    G+W LLQ SIGI AMH+QLL+ND+++ +DRT+ G SN++LP+G C H    
Sbjct  13    SVTEASNSNGQWQLLQKSIGIVAMHVQLLNNDRLIIYDRTDFGFSNLTLPNGTCRHDPSE  72

Query  343   glggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRV  522
              +  +     +CTAHS+EYDVAS++FRP+ V +D WCSSG+    GTL+QTGGY +G R 
Sbjct  73    KVLNQT----DCTAHSLEYDVASDTFRPLFVQTDIWCSSGTTVANGTLIQTGGYNDGERK  128

Query  523   VRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPK--SGPA  696
             +R F+PC    CDW+E    L+  RWYSTDH LPDGRQII+GGRR FNYEF+PK  S   
Sbjct  129   IRSFTPCE--TCDWQETDNALLVKRWYSTDHYLPDGRQIIIGGRRQFNYEFYPKINSAEY  186

Query  697   DTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEI  876
             D  Y LPFL +T D G+  ENNLYPFV LNVDGNLFIFAN+RAIL DY N++VVRTYPEI
Sbjct  187   DKPYVLPFLFETYDKGV--ENNLYPFVFLNVDGNLFIFANSRAILFDYQNDIVVRTYPEI  244

Query  877   PGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRI  1056
             PGG+PR+YPS+GSAVLLPL+NL+ P+  AEVL+CGG+P+ A+    + +F+ AL++C RI
Sbjct  245   PGGDPRSYPSTGSAVLLPLRNLEAPSVEAEVLICGGAPRGAFQLVPQGVFLQALDSCARI  304

Query  1057  VITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPD  1236
             +ITDPN  W  E MP  RVM DMV+LP G++LIINGA  G AGWD    P   PV+Y+ +
Sbjct  305   MITDPNATWTVESMPMGRVMSDMVMLPNGDILIINGAQLGTAGWDKAMEPVLEPVIYKTN  364

Query  1237  APPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSP  1416
                GSRF LQ+ + IPRMYHS+A+L+ DGRVLV GSNPH  Y F+NV +PT+LS+EAFSP
Sbjct  365   GWVGSRFVLQSASSIPRMYHSTAILVRDGRVLVGGSNPHEKYDFSNVSYPTDLSLEAFSP  424

Query  1417  SYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSM  1596
              YLDP+++ LRP IV P S + ++YGE   +  +V+G +    V VTM++P F+THSFSM
Sbjct  425   YYLDPQFSPLRPMIVEPCSHANVTYGEKFKMGIEVNGTLVPELVSVTMLAPPFNTHSFSM  484

Query  1597  NQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             NQRLLVL+  +V   G      +V  P S  LAP  +YLLFVVH++IPS+GIW+ IQ
Sbjct  485   NQRLLVLSIGQVNVTGNWTCEFEVTPPGSAVLAPPTFYLLFVVHQDIPSEGIWIKIQ  541



>ref|XP_010477216.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=550

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/536 (59%), Positives = 389/536 (73%), Gaps = 22/536 (4%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GG WN+L P++GISAMHMQLL ND+VV FDRTN GPSNISLP+G C          R  
Sbjct  29    AGGSWNVLLPNVGISAMHMQLLRNDRVVMFDRTNFGPSNISLPNGNC----------RDN  78

Query  364   PDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
             P+D     +CTAHS+EYDVA N+ RP+ V S+ WCSSGSV P G LVQTGG  +G    R
Sbjct  79    PNDAISRTDCTAHSIEYDVAMNTVRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKAR  138

Query  529   RFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQ-IIVGGRRAFNYEFFPKSGPADTF  705
              FSPCN+ +CDW EI  GL + RWYS++H+LPDG+Q I++GG+  FNYEF+PK+   +  
Sbjct  139   TFSPCNNDQCDWVEIDNGLWKRRWYSSNHLLPDGKQQIVIGGQGQFNYEFYPKTTNPNVV  198

Query  706   YSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGG  885
              +LPFLA+T D   G ENNLYP+V LN DGNLFIFANNRAILLDYV N VV+T+P IPGG
Sbjct  199   -ALPFLAETND--RGQENNLYPYVFLNTDGNLFIFANNRAILLDYVKNTVVKTFPAIPGG  255

Query  886   EPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNA-KRNIFVGALNTCGRIVI  1062
             +PR+YPS+GSAVLLPLKNL+     AEVLVCGG+PK +Y  A +R  FV AL+TC RI I
Sbjct  256   DPRSYPSTGSAVLLPLKNLEADQIEAEVLVCGGAPKGSYNLAFRRKTFVKALDTCARIKI  315

Query  1063  TDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAP  1242
              D +P+W  E MP  RVMGDM +LP G+VLIING  +G+A W+LGR P   P +Y P+ P
Sbjct  316   NDADPQWTVETMPHARVMGDMTLLPNGDVLIINGGASGSAAWELGREPVLAPDVYHPENP  375

Query  1243  PGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSY  1422
               +RFE  NP+ IPRMYHS+AVL+ DGRVLV GSNPHA Y FT   FPTEL +EAFSP+Y
Sbjct  376   VNTRFETMNPSTIPRMYHSAAVLLRDGRVLVGGSNPHAFYVFTGALFPTELRLEAFSPAY  435

Query  1423  LDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQ  1602
             L+P++A LRP I SP SQS + YG  + V+F V  +V    VKVTMV P+F+THSFSMNQ
Sbjct  436   LEPQFATLRPRIQSPKSQSRIKYGMNLKVKFSVVREV-TGPVKVTMVFPSFTTHSFSMNQ  494

Query  1603  RLLVLNTVKVKAAGEE-EYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             RLLVL+ VK    G    Y + V  P S  +A  GYY++FVV++ IPS+G+WV +Q
Sbjct  495   RLLVLDNVKFTRKGRSTTYEVQVRTPKSAIIAQPGYYMIFVVNQNIPSEGVWVRLQ  550



>ref|XP_008775019.1| PREDICTED: galactose oxidase-like [Phoenix dactylifera]
Length=544

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/535 (60%), Positives = 396/535 (74%), Gaps = 15/535 (3%)
 Frame = +1

Query  172   AAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglg  351
             +A  GGG+W+LL  SIG+SAMHMQLLHND+VV FDRT+ G SN+SLP+GKC +       
Sbjct  22    SAAAGGGRWDLLHRSIGVSAMHMQLLHNDRVVIFDRTDFGLSNLSLPNGKCRNDPN----  77

Query  352   gRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRR  531
               K    +CTAHS EYDVA+N+FRP+++L+D WCSSG+V+P G L+QTGG+ +G R VR 
Sbjct  78    -EKVIKIDCTAHSAEYDVATNTFRPLMILTDSWCSSGAVAPDGRLIQTGGWNDGDRAVRT  136

Query  532   FSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPAD-TFY  708
             F PC+D  CDW E+P GL   RWY+T+ ILPDGR IIVGGRR FNYEF PK  P+D T +
Sbjct  137   FVPCDDGSCDWSEVPQGLAARRWYATNQILPDGRAIIVGGRRQFNYEFHPKPNPSDLTTF  196

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
              LPFL  T D     E+NLYPFV LNVDGNLFIFANNRAILLDY  N +VRTYPE+PGG+
Sbjct  197   PLPFLQNTKD---DVEDNLYPFVHLNVDGNLFIFANNRAILLDYTRNAIVRTYPEMPGGD  253

Query  889   PRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKR-NIFVGALNTCGRIVIT  1065
             PRNYPSSGS+VLLPLK      T AEVLVCGG+P  +Y +A+    ++ AL TCGRI IT
Sbjct  254   PRNYPSSGSSVLLPLKP---SATEAEVLVCGGAPVGSYTSARDVKNYMQALKTCGRIKIT  310

Query  1066  DPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPP  1245
             D +P W  E M  PRVMGDM++LPTG VL+INGA  GAAGW+LG  P   PV+Y P++P 
Sbjct  311   DQSPSWSVETMSTPRVMGDMILLPTGEVLLINGAAAGAAGWELGHEPVLTPVVYSPESPA  370

Query  1246  GSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYL  1425
             G+RF++QNP+KIPR+YHSSA+L+ DGRVLV GSNPH  Y FT V FPTELS+EAFSP YL
Sbjct  371   GARFQVQNPSKIPRLYHSSAILLRDGRVLVGGSNPHVYYNFTGVEFPTELSLEAFSPEYL  430

Query  1426  DPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQR  1605
                 +  RP+I + +S   L+YG+  +++F V+  +    V VTM +PAFSTH+FSMNQR
Sbjct  431   TSGSSNSRPKIDNSSSPISLNYGKQFTLRFAVAA-ISGGGVSVTMAAPAFSTHAFSMNQR  489

Query  1606  LLVLNTVKVKAAGEE-EYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             LL+L T K  AAG    Y +  VAP SG LAPSGYY++FVV+  IPS+G+W  IQ
Sbjct  490   LLILETGKALAAGNNGSYEVTAVAPASGILAPSGYYMVFVVNGGIPSEGVWAQIQ  544



>ref|XP_008466667.1| PREDICTED: galactose oxidase-like [Cucumis melo]
Length=655

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/548 (58%), Positives = 395/548 (72%), Gaps = 26/548 (5%)
 Frame = +1

Query  157   FTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHgg  336
             FT AAAA    G W LLQ +IGISAMHMQLLHND+V+ FD T  GPSN+S P  +C    
Sbjct  121   FTQAAAA----GHWKLLQGTIGISAMHMQLLHNDRVIMFDGTGFGPSNLSFPGARCARTY  176

Query  337   ggglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGT  516
              G    R+   D CTAHSVEYDVA+N+FRP+ V +D WCSSG     GTLVQTGG+  G 
Sbjct  177   NG----RRISFD-CTAHSVEYDVATNTFRPLAVQTDMWCSSGGAMRDGTLVQTGGFKAGD  231

Query  517   RVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPK----  684
             R VR F PC    CDWEEIP GL+  RWY+T+HILPDG QII+GGR+ F+YEFFPK    
Sbjct  232   RTVRIFKPC--TSCDWEEIPMGLLTRRWYATNHILPDGSQIIIGGRKRFSYEFFPKPAAF  289

Query  685   ------SGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVN  846
                   +      Y LPFL QT D    AENNLYPFV L++DG+LFIFANNRAIL DY  
Sbjct  290   NWPLAKTNSVPEAYRLPFLMQTNDGH--AENNLYPFVFLHIDGSLFIFANNRAILFDYTK  347

Query  847   NVVVRTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIF  1026
             N V++T+P+IPGG+PRNYPS+GSAV+LPL NL+G     EV+VCGG+PK A+  A+  +F
Sbjct  348   NKVLKTFPKIPGGDPRNYPSTGSAVILPL-NLQGKLLEVEVMVCGGAPKGAHIKARNGVF  406

Query  1027  VGALNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNP  1206
             V ALNTC RI IT PNP+W+ E MP  RVMGDM++LP GNVL+ING + G AGW+L RNP
Sbjct  407   VEALNTCARIKITSPNPKWVLEIMPLSRVMGDMLLLPNGNVLLINGGSFGTAGWELARNP  466

Query  1207  AFHPVLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFP  1386
               +PVLY P+  PGSRFE+ +P+  PRMYHS+A+L+ DGR+LV GSNPH  Y F+   FP
Sbjct  467   VLNPVLYLPNNLPGSRFEVNDPSTTPRMYHSTAILLRDGRILVGGSNPHPGYNFSGFLFP  526

Query  1387  TELSMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVS  1566
             TELS+EAF P YLDP++AALRP I+ P SQ  + +G+ + V+F V  ++D +++ VTM++
Sbjct  527   TELSLEAFHPPYLDPEFAALRPTIIEPRSQIMVFHGQRLKVEFTVIDEMDPTKISVTMLA  586

Query  1567  PAFSTHSFSMNQRLLVL--NTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIP  1740
             P F+THSFSMNQRLLV+    V      E  Y ++V  P SGN+APSG+Y+LFVVH+ +P
Sbjct  587   PPFNTHSFSMNQRLLVVGRGNVTTTIWPELMYEVEVNIPVSGNIAPSGFYILFVVHQCVP  646

Query  1741  SKGIWVHI  1764
             S+GIWV I
Sbjct  647   SEGIWVQI  654



>ref|XP_004147870.1| PREDICTED: galactose oxidase-like [Cucumis sativus]
 ref|XP_004166816.1| PREDICTED: galactose oxidase-like [Cucumis sativus]
Length=537

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/548 (58%), Positives = 394/548 (72%), Gaps = 26/548 (5%)
 Frame = +1

Query  157   FTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHgg  336
             FT AAAA    G W LLQ +IGISAMHMQLLHND+VV FD T  GPSN+S P  +C    
Sbjct  3     FTQAAAA----GHWKLLQGTIGISAMHMQLLHNDRVVMFDGTGFGPSNLSFPTARCARSY  58

Query  337   ggglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGT  516
              G    R+   D CTAHSVEYDVA+N+FRP+ V +D WCSSG     GTLVQTGG+  G 
Sbjct  59    NG----RRISFD-CTAHSVEYDVATNTFRPLAVQTDMWCSSGGAMRDGTLVQTGGFKAGD  113

Query  517   RVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPK----  684
             R VR F PC    CDWEEIP GL+  RWY+T+HILPDG QII+GGR+ F+YEFFPK    
Sbjct  114   RTVRIFKPC--PTCDWEEIPMGLLTRRWYATNHILPDGSQIIIGGRKRFSYEFFPKPAAF  171

Query  685   ------SGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVN  846
                   +      Y LPFL QT D    AENNLYPFV L++DG+LFIFANNRAIL DY  
Sbjct  172   NWPLAKTNSVPEAYRLPFLIQTNDGH--AENNLYPFVFLHIDGSLFIFANNRAILFDYTK  229

Query  847   NVVVRTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIF  1026
             N +++T+P+IPGG+PRNYPS+GSAV+LPL NL+      EV+VCGG+PK A   A+  +F
Sbjct  230   NKILKTFPKIPGGDPRNYPSTGSAVILPL-NLQAKLLEVEVMVCGGAPKGASIKARNGVF  288

Query  1027  VGALNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNP  1206
             V ALNTC RI IT PNP+W+ E MP  RVMGDM++LP GNVL+ING + G AGW+L RNP
Sbjct  289   VEALNTCARIKITSPNPKWLLEIMPLSRVMGDMLLLPNGNVLLINGGSFGTAGWELARNP  348

Query  1207  AFHPVLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFP  1386
               +PVLY P+ P GSRFE+ +P+  PRMYHS+A+L+ DGR+LV GSNP   Y F+ V FP
Sbjct  349   VLNPVLYLPNNPHGSRFEVNDPSTTPRMYHSTAILLRDGRILVGGSNPQPGYNFSGVLFP  408

Query  1387  TELSMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVS  1566
             TELS+EAF P YLDP++AALRP I+ P SQ  + +G+ + V+F V  ++D ++V VTM++
Sbjct  409   TELSLEAFHPPYLDPEFAALRPTIIEPRSQVMVFHGQRLKVEFTVIDELDPTKVSVTMLA  468

Query  1567  PAFSTHSFSMNQRLLVL--NTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIP  1740
             P F+THSFSMNQRLLVL  + V      E  Y ++V  P SGN+APSG+Y+LFVVH+ +P
Sbjct  469   PPFNTHSFSMNQRLLVLGRSNVTTTIWPELMYEVEVNVPVSGNIAPSGFYILFVVHQCVP  528

Query  1741  SKGIWVHI  1764
             S+GIWV I
Sbjct  529   SEGIWVQI  536



>emb|CDY39045.1| BnaA02g17340D [Brassica napus]
Length=555

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/545 (57%), Positives = 398/545 (73%), Gaps = 23/545 (4%)
 Frame = +1

Query  154   FFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHg  333
             +F  A+ A   GG W LL   +GISAMH QLL ND+V+ +DR+N GPS ISLP G C   
Sbjct  27    YFNVASGA---GGTWRLLLNDVGISAMHSQLLINDRVIMYDRSNFGPSKISLPSGAC---  80

Query  334   gggglggRKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTG  498
                    R  P+D     +CTAHS+EYDVA NS RP+ + S+ WCSSG V+P G L+QTG
Sbjct  81    -------RVSPNDVVSKRDCTAHSIEYDVAFNSIRPLTIESNTWCSSGGVTPEGALLQTG  133

Query  499   GYGEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFF  678
             G  EG R  R F PC+D  CDW E+   L   RWY+T+H+LPDGRQII+GGR  FN+EFF
Sbjct  134   GDKEGERKARMFYPCDDESCDWTEVDNALYVRRWYATNHVLPDGRQIIIGGRNQFNFEFF  193

Query  679   PKSGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVV  858
             PK+  A + Y LPFL++T D G   ENNLYPFV LN DGNLFI+ANN+AILLDY  N VV
Sbjct  194   PKT-KAPSLYKLPFLSETYDAG--QENNLYPFVFLNSDGNLFIYANNKAILLDYNKNTVV  250

Query  859   RTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNA-KRNIFVGA  1035
             +TYP+IPGG+PR+YPS+GSAVLLP+KNL+      EVLVCGG+PK +Y  A  +N FV A
Sbjct  251   KTYPKIPGGDPRSYPSTGSAVLLPIKNLEAEVVEMEVLVCGGAPKGSYLLALYKNTFVKA  310

Query  1036  LNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFH  1215
             L+TC RI I D  P+W+ E+MP  RVMGDM++LP G+VL+ING ++G+AGW+LGR P  +
Sbjct  311   LDTCARIKINDDKPQWVLEKMPRSRVMGDMILLPNGHVLLINGGSSGSAGWELGREPVLN  370

Query  1216  PVLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTEL  1395
             P LY PD P GSRF++QNP+ IPRMYHS+A L+ DGRVLV GSNPH  Y FT+V FPTEL
Sbjct  371   PDLYHPDKPVGSRFQVQNPSTIPRMYHSTAGLLRDGRVLVGGSNPHQFYNFTDVLFPTEL  430

Query  1396  SMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDM-SQVKVTMVSPA  1572
              +EAFSPSYL+ +Y ++RP I+S  S S ++YG ++ ++F V G   + S VKVTMV P+
Sbjct  431   RLEAFSPSYLESQYWSIRPRIISLLSHSTVNYGGILRLRFMVFGIGGVRSPVKVTMVFPS  490

Query  1573  FSTHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGI  1752
             F++HSFSM+QRLLVL+ V++   G   Y + V AP S NLAP GYY+ FVV+++IPS+GI
Sbjct  491   FTSHSFSMSQRLLVLDHVELVRIGVWTYEVRVKAPKSKNLAPPGYYMAFVVNQDIPSEGI  550

Query  1753  WVHIQ  1767
             W+ +Q
Sbjct  551   WLRLQ  555



>gb|KGN60010.1| hypothetical protein Csa_3G865940 [Cucumis sativus]
Length=556

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/548 (58%), Positives = 394/548 (72%), Gaps = 26/548 (5%)
 Frame = +1

Query  157   FTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHgg  336
             FT AAAA    G W LLQ +IGISAMHMQLLHND+VV FD T  GPSN+S P  +C    
Sbjct  22    FTQAAAA----GHWKLLQGTIGISAMHMQLLHNDRVVMFDGTGFGPSNLSFPTARCARSY  77

Query  337   ggglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGT  516
              G    R+   D CTAHSVEYDVA+N+FRP+ V +D WCSSG     GTLVQTGG+  G 
Sbjct  78    NG----RRISFD-CTAHSVEYDVATNTFRPLAVQTDMWCSSGGAMRDGTLVQTGGFKAGD  132

Query  517   RVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPK----  684
             R VR F PC    CDWEEIP GL+  RWY+T+HILPDG QII+GGR+ F+YEFFPK    
Sbjct  133   RTVRIFKPC--PTCDWEEIPMGLLTRRWYATNHILPDGSQIIIGGRKRFSYEFFPKPAAF  190

Query  685   ------SGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVN  846
                   +      Y LPFL QT D    AENNLYPFV L++DG+LFIFANNRAIL DY  
Sbjct  191   NWPLAKTNSVPEAYRLPFLIQTNDGH--AENNLYPFVFLHIDGSLFIFANNRAILFDYTK  248

Query  847   NVVVRTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIF  1026
             N +++T+P+IPGG+PRNYPS+GSAV+LPL NL+      EV+VCGG+PK A   A+  +F
Sbjct  249   NKILKTFPKIPGGDPRNYPSTGSAVILPL-NLQAKLLEVEVMVCGGAPKGASIKARNGVF  307

Query  1027  VGALNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNP  1206
             V ALNTC RI IT PNP+W+ E MP  RVMGDM++LP GNVL+ING + G AGW+L RNP
Sbjct  308   VEALNTCARIKITSPNPKWLLEIMPLSRVMGDMLLLPNGNVLLINGGSFGTAGWELARNP  367

Query  1207  AFHPVLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFP  1386
               +PVLY P+ P GSRFE+ +P+  PRMYHS+A+L+ DGR+LV GSNP   Y F+ V FP
Sbjct  368   VLNPVLYLPNNPHGSRFEVNDPSTTPRMYHSTAILLRDGRILVGGSNPQPGYNFSGVLFP  427

Query  1387  TELSMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVS  1566
             TELS+EAF P YLDP++AALRP I+ P SQ  + +G+ + V+F V  ++D ++V VTM++
Sbjct  428   TELSLEAFHPPYLDPEFAALRPTIIEPRSQVMVFHGQRLKVEFTVIDELDPTKVSVTMLA  487

Query  1567  PAFSTHSFSMNQRLLVL--NTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIP  1740
             P F+THSFSMNQRLLVL  + V      E  Y ++V  P SGN+APSG+Y+LFVVH+ +P
Sbjct  488   PPFNTHSFSMNQRLLVLGRSNVTTTIWPELMYEVEVNVPVSGNIAPSGFYILFVVHQCVP  547

Query  1741  SKGIWVHI  1764
             S+GIWV I
Sbjct  548   SEGIWVQI  555



>ref|XP_002893079.1| hypothetical protein ARALYDRAFT_472215 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69338.1| hypothetical protein ARALYDRAFT_472215 [Arabidopsis lyrata subsp. 
lyrata]
Length=549

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/528 (58%), Positives = 387/528 (73%), Gaps = 11/528 (2%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G W  + P++GISAMHMQLLHND+VV +DRTN GPSNISLP+G C       +  R    
Sbjct  31    GLWKYIAPNVGISAMHMQLLHNDRVVMYDRTNFGPSNISLPNGNCRDNPNDIVSKR----  86

Query  370   DNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCND  549
              +CTAHS+EYDVA N+ RP+ V S+ WCSSGSV P G LVQTGG  +G    R FSPC++
Sbjct  87    -DCTAHSIEYDVAMNTVRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKARTFSPCDN  145

Query  550   AECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFLAQ  729
              +CDW EI  GL + RWY+++HILPDG+QI++GG+  FNYEFFPK+   +   +LPFLA+
Sbjct  146   NQCDWVEINNGLTKRRWYASNHILPDGKQIVIGGQAQFNYEFFPKTTNPNVV-ALPFLAE  204

Query  730   TTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYPSS  909
             T D G   ENNLYPFV +N DGNLFIFANN+AILLDYV N VV+T+P IPGG+PRNYPS+
Sbjct  205   THDQG--QENNLYPFVFMNTDGNLFIFANNKAILLDYVKNTVVKTFPAIPGGDPRNYPST  262

Query  910   GSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNA-KRNIFVGALNTCGRIVITDPNPEWI  1086
             GSAVLLPLKNL+      EVLVCGG+PK +Y  A ++  FV AL+TC RI I D NP+W 
Sbjct  263   GSAVLLPLKNLEADQIETEVLVCGGAPKGSYNLAFRKKTFVEALDTCARIKINDANPQWT  322

Query  1087  TEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFELQ  1266
              E MP  RVMGDM++LP G+VLIING + G A W+LGR P   P LY P+ P  SRFE  
Sbjct  323   VENMPHARVMGDMILLPNGDVLIINGGSFGTAAWELGREPVLAPDLYHPENPVNSRFESL  382

Query  1267  NPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAAL  1446
              P  IPRMYHS+A+L+ DGRVLV GSNPHA Y FT V FPTELS+EAFSP YL  +++ L
Sbjct  383   RPTTIPRMYHSAAILLRDGRVLVGGSNPHAFYNFTGVLFPTELSLEAFSPVYLQREFSDL  442

Query  1447  RPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNTV  1626
             RP+I+SP  QS + YG  + ++F V+G+V  + VKVT+V P F+THSF+MNQR+LVL+ V
Sbjct  443   RPKIISPKPQSTIKYGMNLKLKFTVTGEV-TTPVKVTLVFPTFTTHSFAMNQRVLVLDNV  501

Query  1627  KVKAAGEE-EYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             K+   G+   Y + V  P S N+A  GYY++FVV++ IPS+G+WV +Q
Sbjct  502   KLTRKGKSPTYEVQVRTPKSANIAWPGYYMIFVVNQNIPSEGVWVRLQ  549



>ref|NP_173419.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
 gb|AAL24259.1| At1g19900/F6F9_4 [Arabidopsis thaliana]
 gb|AEE29911.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
Length=548

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/532 (58%), Positives = 388/532 (73%), Gaps = 20/532 (4%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G W  + P++GISAMHMQLLHND+VV +DRTN GPSNISLP+G C          R  P 
Sbjct  31    GLWKYIAPNVGISAMHMQLLHNDRVVMYDRTNFGPSNISLPNGNC----------RDNPQ  80

Query  370   D-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
             D     +CTAHS+EYDVA+N+ RP+ V S+ WCSSGSV P G LVQTGG  +G    R F
Sbjct  81    DAVSKIDCTAHSIEYDVATNTIRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKTRTF  140

Query  535   SPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSL  714
             SPCN+ +CDW E+  GL + RWY+++HILPDG+QI++GG+  FNYEFFPK+   +   +L
Sbjct  141   SPCNNNQCDWVEMNNGLKKRRWYASNHILPDGKQIVMGGQGQFNYEFFPKTTNPNVV-AL  199

Query  715   PFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPR  894
             PFLA+T D G   ENNLYPFV +N DGNLF+FANNRAILLDYV N VV+T+P IPGG+PR
Sbjct  200   PFLAETHDQG--QENNLYPFVFMNTDGNLFMFANNRAILLDYVKNTVVKTFPAIPGGDPR  257

Query  895   NYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPN  1074
             NYPS+GSAVLLPLKNL+      EVLVCGG+PK +Y  A++  FV AL+TC RI I D  
Sbjct  258   NYPSTGSAVLLPLKNLEADNVETEVLVCGGAPKGSYNLARKKTFVKALDTCARIKINDAK  317

Query  1075  PEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSR  1254
             PEW  E+MP  RVMGDM+ LP G+VL+ING + G A W+LGR P   P LY P+ P GSR
Sbjct  318   PEWAVEKMPHARVMGDMIPLPNGDVLLINGGSFGTAAWELGRTPVLAPDLYHPENPVGSR  377

Query  1255  FELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPK  1434
             FE   P  IPRMYHS+A+L+ DGRVLV GSNPHA Y +T V FPTELS+EAFSP YL  +
Sbjct  378   FESLRPTTIPRMYHSAAILLRDGRVLVGGSNPHAFYNYTGVLFPTELSLEAFSPVYLQRE  437

Query  1435  YAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLV  1614
             ++ LRP+I+SP  QS + YG  + ++F V+G+V  +  KVTMV P F+THSF+MNQR+LV
Sbjct  438   FSNLRPKIISPEPQSMIKYGTNLKLKFSVTGEV-TTPAKVTMVFPTFTTHSFAMNQRVLV  496

Query  1615  LNTVKVKAAGEE-EYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             L+ VK    G+   Y + V  P S N+A  GYY++FVV+++IPS+G+WV ++
Sbjct  497   LDNVKFTRKGKSPMYEVQVRTPRSANIAWPGYYMIFVVNQDIPSEGVWVKLE  548



>ref|XP_009408991.1| PREDICTED: galactose oxidase-like [Musa acuminata subsp. malaccensis]
Length=540

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/539 (59%), Positives = 394/539 (73%), Gaps = 32/539 (6%)
 Frame = +1

Query  175   AVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglgg  354
             A  GGG+W LLQ SIG+SAMHMQLLHND+VV FDRT+ GPSN+SLPDG+C          
Sbjct  26    AAAGGGEWKLLQHSIGVSAMHMQLLHNDRVVVFDRTDFGPSNLSLPDGRC----------  75

Query  355   RKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTR  519
             R  P+D     +CTAHS EYDV +N+FRP++VL+D WCSSGSV+P GTLVQTGG+ +G R
Sbjct  76    RNDPNDKALPVDCTAHSAEYDVVANAFRPLMVLTDTWCSSGSVAPDGTLVQTGGFNDGER  135

Query  520   VVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPAD  699
               R F PC+D  CDW E    L   RWY+T+ +LPDGR ++VGGRR FNYEF+PK  P+D
Sbjct  136   AARTFRPCDDGSCDWVETAQALAVRRWYATNQVLPDGRAVVVGGRRQFNYEFYPKPDPSD  195

Query  700   -TFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEI  876
              +  +L FL  T D     E+NLYPFV L++DGNLFIFANNRAILLDY  N VVRTYP++
Sbjct  196   MSTIALRFLQDTRD---DVEDNLYPFVHLSIDGNLFIFANNRAILLDYSKNTVVRTYPKM  252

Query  877   PGGEPRNYPSSGSAVLLPLKNLKGPT-TMAEVLVCGGSPKDAYYNA-KRNIFVGALNTCG  1050
             P GEPRNYPSSGS+VLLPLK    P+ T AEVL+CGG+P  +Y  A ++  F+ AL++CG
Sbjct  253   PSGEPRNYPSSGSSVLLPLK----PSPTEAEVLICGGAPAGSYSQALQKKRFLRALDSCG  308

Query  1051  RIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYR  1230
             RI ITD  P W  E MP PRVMGDMV+LP G+VL+INGA  G AGW+LG +P   PV+YR
Sbjct  309   RIKITDAAPSWNMEAMPVPRVMGDMVLLPDGDVLLINGAAAGTAGWELGHDPVLTPVVYR  368

Query  1231  PDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAF  1410
             PD   G+RF++Q+ +  PR+YHS+AVL+ DGRVLV GSNPH  Y F+ V +PTELSMEAF
Sbjct  369   PDGAAGARFDVQSGSTTPRLYHSTAVLLRDGRVLVGGSNPHVKYNFSGVEYPTELSMEAF  428

Query  1411  SPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSF  1590
             SPSYL+ + + LRP+I++P S   L+YG   S+QF V G V    ++VTMV+P+F+THSF
Sbjct  429   SPSYLNSENSRLRPQILTPPSPIQLTYGGRFSLQFSV-GVVSEGGIRVTMVAPSFATHSF  487

Query  1591  SMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             SMNQRLLVL T      G  E  +  VAP S  LAP GYY+++VV+  +PS+GIW HIQ
Sbjct  488   SMNQRLLVLET----EGGMSE--VVAVAPASAILAPPGYYMVYVVNGGVPSEGIWAHIQ  540



>emb|CDY29385.1| BnaA06g14110D [Brassica napus]
Length=505

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/519 (61%), Positives = 383/519 (74%), Gaps = 21/519 (4%)
 Frame = +1

Query  232   MHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPDD-----NCTAHSVE  396
             MHMQLL ND+VV FDRTN GPSNISLP+G C          R  P D     +CTAHS+E
Sbjct  1     MHMQLLRNDRVVMFDRTNFGPSNISLPNGNC----------RNNPQDPVSKIDCTAHSIE  50

Query  397   YDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCNDAECDWEEIP  576
             YDVASN+ RP+ V S+ WCSSGSV P G LVQTGG  +G    R F+PCN+ +CDW EI 
Sbjct  51    YDVASNTIRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKARIFTPCNNKKCDWIEIN  110

Query  577   YGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFLAQTTDPGLGAE  756
              GL + RWYS++HILPDG QI++GG+  FNYEFFPK+   +   +LPFLA+T D   G E
Sbjct  111   NGLTKRRWYSSNHILPDGTQIVIGGQGQFNYEFFPKTTSPNVI-ALPFLAETND--RGEE  167

Query  757   NNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYPSSGSAVLLPLK  936
             NNLYP+V LN DGNLFIFANNRAILLDYV N VV+TYP IPGG+PR+YPS+GSAVLLPLK
Sbjct  168   NNLYPYVFLNNDGNLFIFANNRAILLDYVKNTVVKTYPAIPGGDPRSYPSTGSAVLLPLK  227

Query  937   NLKGPTTMAEVLVCGGSPKDAYYNA-KRNIFVGALNTCGRIVITDPNPEWITEEMPFPRV  1113
             NL+     AEVLVCGG+PK +Y  A +R  FV AL+TC RI I D NP+W  E+MP  RV
Sbjct  228   NLEAAKIDAEVLVCGGAPKGSYLLAFRRKTFVKALDTCARIKINDENPQWTVEKMPRARV  287

Query  1114  MGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFELQNPNKIPRMY  1293
             MGDM +LP G+VLIING  +G+A W+LGR P   P +Y  + P  SRFE  NP  IPRMY
Sbjct  288   MGDMTLLPNGDVLIINGGASGSAAWELGREPVLVPDVYHSENPVNSRFESLNPTTIPRMY  347

Query  1294  HSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAALRPEIVSPAS  1473
             HS+AVL+ DGRVLV GSNPHA Y FTNV FPTELS+EAFSP+YL+P++A  RP+I SP S
Sbjct  348   HSTAVLLRDGRVLVGGSNPHAFYNFTNVLFPTELSLEAFSPAYLEPEFAKFRPKIQSPKS  407

Query  1474  QSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNTVKVKAAGEE-  1650
             Q  ++Y   + ++FKV+G+V    VKVTMV P+F+THSFSMNQRLLVL+ V  K +G+  
Sbjct  408   QVMITYRMDLKLKFKVAGEVK-GPVKVTMVFPSFTTHSFSMNQRLLVLDNVTFKRSGKST  466

Query  1651  EYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
              Y + V  P S N+AP GYY++FVV++ IPS+GIWV +Q
Sbjct  467   NYEVQVKTPRSVNIAPPGYYMMFVVNQNIPSEGIWVRLQ  505



>ref|XP_009106213.1| PREDICTED: galactose oxidase isoform X2 [Brassica rapa]
Length=554

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/544 (58%), Positives = 396/544 (73%), Gaps = 14/544 (3%)
 Frame = +1

Query  139   FHNRGFFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDG  318
             F +  F  A+ A    GG W LL  ++GISAMH QLL ND+V+ +DR+N GPS ISLP+G
Sbjct  24    FLSLSFHVASGA----GGTWKLLLNNVGISAMHSQLLINDRVIMYDRSNFGPSKISLPNG  79

Query  319   KCHHggggglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTG  498
              C       +  R     +CTAHS+EYDVA N  RP+ V S+ WCSSG V+P GTL+QTG
Sbjct  80    TCRDSPNDSVSKR-----DCTAHSIEYDVALNRIRPLTVQSNTWCSSGGVTPDGTLLQTG  134

Query  499   GYGEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFF  678
             G  +G R  R F PC+D  CDW EI   L   RWY+++H+LPDGRQIIVGGR  FN+EFF
Sbjct  135   GDKDGERKARLFYPCDDESCDWSEIDNALNVKRWYASNHVLPDGRQIIVGGRDEFNFEFF  194

Query  679   PKSGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVV  858
             PK+   +T YSL FL++T D  L  ENNLYP V LN DGNLF+FANNRAILLDY  N VV
Sbjct  195   PKTNAPNT-YSLRFLSETND--LDQENNLYPNVFLNTDGNLFVFANNRAILLDYSKNTVV  251

Query  859   RTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNA-KRNIFVGA  1035
             +TYPEIPGGEPR+YPS+GSAVLLP+KNL+      EVLVCGG+PK +Y  A   N FV  
Sbjct  252   KTYPEIPGGEPRSYPSTGSAVLLPIKNLEEEVIELEVLVCGGAPKGSYLLALNENTFVKG  311

Query  1036  LNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFH  1215
             L+TC RI I D NP+W+ E+MP PR+MGDM++LP G VL+ING ++G+AGW+LGR P  +
Sbjct  312   LDTCARIKINDANPKWVLEKMPRPRIMGDMIVLPNGQVLLINGGSSGSAGWELGREPVLN  371

Query  1216  PVLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTEL  1395
             P LY PD P GSRF++QNP+ IPRMYHS+A L+ DGRVLV GSNPH  Y FT V FPTEL
Sbjct  372   PDLYHPDKPVGSRFQIQNPSTIPRMYHSTATLLRDGRVLVGGSNPHEFYNFTGVLFPTEL  431

Query  1396  SMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAF  1575
              +EAFSPSYL+ +Y  +RP I+SP+  S ++YG V+ ++F+V G+V  + VKVTM  P+F
Sbjct  432   RLEAFSPSYLESQYRNIRPRIMSPSLHSTVNYGGVLRLRFRVLGEVK-TPVKVTMAFPSF  490

Query  1576  STHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIW  1755
             +THSFSM+QRLLVL+ V     G+  Y + V  P S NLAP GYY++FVV+++IPS+GIW
Sbjct  491   TTHSFSMSQRLLVLDHVTSLRIGQWTYEVRVKTPRSANLAPPGYYMVFVVNQDIPSEGIW  550

Query  1756  VHIQ  1767
             V +Q
Sbjct  551   VRLQ  554



>emb|CDY47509.1| BnaAnng09070D [Brassica napus]
Length=554

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/544 (58%), Positives = 396/544 (73%), Gaps = 14/544 (3%)
 Frame = +1

Query  139   FHNRGFFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDG  318
             F +  F  A+ A    GG W LL  ++GISAMH QLL ND+V+ +DR+N GPS ISLP+G
Sbjct  24    FLSLSFHVASGA----GGTWKLLLNNVGISAMHSQLLINDRVIMYDRSNFGPSKISLPNG  79

Query  319   KCHHggggglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTG  498
              C       +  R     +CTAHS+EYDVA N  RP+ V S+ WCSSG V+P GTL+QTG
Sbjct  80    TCRDSPNDSVSKR-----DCTAHSIEYDVALNRIRPLTVQSNTWCSSGGVTPDGTLLQTG  134

Query  499   GYGEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFF  678
             G  +G R  R F PC+D  CDW EI   L   RWY+++H+LPDGRQIIVGGR  FN+EFF
Sbjct  135   GDKDGERKARLFYPCDDDSCDWSEIDNALNVKRWYASNHVLPDGRQIIVGGRDEFNFEFF  194

Query  679   PKSGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVV  858
             PK+   +T YSL FL++T D  L  ENNLYP V LN DGNLFIFANNRAILLDY  N VV
Sbjct  195   PKTNAPNT-YSLRFLSETND--LDQENNLYPNVFLNTDGNLFIFANNRAILLDYAKNTVV  251

Query  859   RTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNA-KRNIFVGA  1035
             +TYP+IPGGEPR+YPS+GSAVLLP+KNL+      EVLVCGG+PK +Y  A   N FV  
Sbjct  252   KTYPKIPGGEPRSYPSTGSAVLLPIKNLEEEVIELEVLVCGGAPKGSYLLALNENTFVKG  311

Query  1036  LNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFH  1215
             L+TC RI I D NP+W+ E+MP PR+MGDM++LP G VL+ING ++G+AGW+LGR P  +
Sbjct  312   LDTCARIKINDANPKWVLEKMPRPRIMGDMIVLPNGQVLLINGGSSGSAGWELGREPVLN  371

Query  1216  PVLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTEL  1395
             P LY PD P GSRF++QNP+ IPRMYHS+A L+ DGRVLV GSNPH  Y FT V FPTEL
Sbjct  372   PDLYHPDKPVGSRFQIQNPSTIPRMYHSTATLLRDGRVLVGGSNPHEFYNFTGVLFPTEL  431

Query  1396  SMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAF  1575
              +EAFSPSYL+ +Y  +RP I+SP+  S ++YG V+ ++F+V G+V  + VKVTM  P+F
Sbjct  432   RLEAFSPSYLESQYRNIRPRIMSPSLHSTVNYGGVLRLRFRVLGEVK-TPVKVTMAFPSF  490

Query  1576  STHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIW  1755
             +THSFSM+QRLLVL+ V     G+  Y + V  P S NLAP GYY++FVV+++IPS+GIW
Sbjct  491   TTHSFSMSQRLLVLDHVTSLRIGQWTYEVRVKTPRSANLAPPGYYMVFVVNQDIPSEGIW  550

Query  1756  VHIQ  1767
             V +Q
Sbjct  551   VRLQ  554



>ref|XP_009106212.1| PREDICTED: galactose oxidase isoform X1 [Brassica rapa]
Length=560

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/543 (58%), Positives = 395/543 (73%), Gaps = 14/543 (3%)
 Frame = +1

Query  139   FHNRGFFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDG  318
             F +  F  A+ A    GG W LL  ++GISAMH QLL ND+V+ +DR+N GPS ISLP+G
Sbjct  24    FLSLSFHVASGA----GGTWKLLLNNVGISAMHSQLLINDRVIMYDRSNFGPSKISLPNG  79

Query  319   KCHHggggglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTG  498
              C       +  R     +CTAHS+EYDVA N  RP+ V S+ WCSSG V+P GTL+QTG
Sbjct  80    TCRDSPNDSVSKR-----DCTAHSIEYDVALNRIRPLTVQSNTWCSSGGVTPDGTLLQTG  134

Query  499   GYGEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFF  678
             G  +G R  R F PC+D  CDW EI   L   RWY+++H+LPDGRQIIVGGR  FN+EFF
Sbjct  135   GDKDGERKARLFYPCDDESCDWSEIDNALNVKRWYASNHVLPDGRQIIVGGRDEFNFEFF  194

Query  679   PKSGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVV  858
             PK+   +T YSL FL++T D  L  ENNLYP V LN DGNLF+FANNRAILLDY  N VV
Sbjct  195   PKTNAPNT-YSLRFLSETND--LDQENNLYPNVFLNTDGNLFVFANNRAILLDYSKNTVV  251

Query  859   RTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNA-KRNIFVGA  1035
             +TYPEIPGGEPR+YPS+GSAVLLP+KNL+      EVLVCGG+PK +Y  A   N FV  
Sbjct  252   KTYPEIPGGEPRSYPSTGSAVLLPIKNLEEEVIELEVLVCGGAPKGSYLLALNENTFVKG  311

Query  1036  LNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFH  1215
             L+TC RI I D NP+W+ E+MP PR+MGDM++LP G VL+ING ++G+AGW+LGR P  +
Sbjct  312   LDTCARIKINDANPKWVLEKMPRPRIMGDMIVLPNGQVLLINGGSSGSAGWELGREPVLN  371

Query  1216  PVLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTEL  1395
             P LY PD P GSRF++QNP+ IPRMYHS+A L+ DGRVLV GSNPH  Y FT V FPTEL
Sbjct  372   PDLYHPDKPVGSRFQIQNPSTIPRMYHSTATLLRDGRVLVGGSNPHEFYNFTGVLFPTEL  431

Query  1396  SMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAF  1575
              +EAFSPSYL+ +Y  +RP I+SP+  S ++YG V+ ++F+V G+V  + VKVTM  P+F
Sbjct  432   RLEAFSPSYLESQYRNIRPRIMSPSLHSTVNYGGVLRLRFRVLGEVK-TPVKVTMAFPSF  490

Query  1576  STHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIW  1755
             +THSFSM+QRLLVL+ V     G+  Y + V  P S NLAP GYY++FVV+++IPS+GIW
Sbjct  491   TTHSFSMSQRLLVLDHVTSLRIGQWTYEVRVKTPRSANLAPPGYYMVFVVNQDIPSEGIW  550

Query  1756  VHI  1764
             + +
Sbjct  551   LRL  553



>ref|XP_009128116.1| PREDICTED: galactose oxidase-like [Brassica rapa]
Length=555

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/544 (57%), Positives = 395/544 (73%), Gaps = 23/544 (4%)
 Frame = +1

Query  157   FTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHgg  336
             F  A+ A   GG W LL   +GISAMH QLL ND+V+ +DR+N GPS ISLP G C    
Sbjct  28    FNVASGA---GGTWKLLLNDVGISAMHSQLLINDRVIMYDRSNFGPSKISLPSGAC----  80

Query  337   ggglggRKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGG  501
                   R  P+D     +CTAHS+EYDVA NS RP+ + S+ WCSSG V+P G L+QTGG
Sbjct  81    ------RDSPNDVVSKRDCTAHSIEYDVAFNSIRPLTIESNTWCSSGGVTPEGALLQTGG  134

Query  502   YGEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFP  681
               EG R  R F PC+D  CDW E+   L   RWY+T+H+LPDGRQII+GGR  FN+EFFP
Sbjct  135   DKEGERKARMFYPCDDESCDWTEVDNALYVRRWYATNHVLPDGRQIIIGGRNQFNFEFFP  194

Query  682   KSGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVR  861
             K+  A + Y LPFL++T D G   ENNLYPFV LN DGNLFI+ANN+AILLDY  N VV+
Sbjct  195   KT-KAPSLYKLPFLSETYDAG--QENNLYPFVFLNSDGNLFIYANNKAILLDYNKNTVVK  251

Query  862   TYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNA-KRNIFVGAL  1038
             TYP+IPGG+PR+YPS+GSAVLLP+KNL+      EVLVCGG+PK +Y  A  +N FV AL
Sbjct  252   TYPKIPGGDPRSYPSTGSAVLLPIKNLEAEVVEMEVLVCGGAPKGSYLLALYKNTFVKAL  311

Query  1039  NTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHP  1218
             +TC RI I D  P+W+ E+MP  R MGDM++LP G+VL+ING ++G+AGW+LGR P  +P
Sbjct  312   DTCARIKINDDKPQWVLEKMPRSREMGDMILLPNGHVLLINGGSSGSAGWELGREPVLNP  371

Query  1219  VLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELS  1398
              LY PD P GSRF++QNP+ IPRMYHS+A L+ DGRVLV GSNPH  Y FT+V FPTEL 
Sbjct  372   DLYHPDKPVGSRFQVQNPSTIPRMYHSTAGLLRDGRVLVGGSNPHQFYNFTDVLFPTELR  431

Query  1399  MEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDM-SQVKVTMVSPAF  1575
             +EAFSPSYL+ +Y ++RP I+S  S S ++YG ++ ++F V G   + S VKVTMV P+F
Sbjct  432   LEAFSPSYLESQYWSIRPRIISLLSHSTVNYGGILRLRFMVFGIGGVRSPVKVTMVFPSF  491

Query  1576  STHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIW  1755
             ++HSFSM+QRLLVL+ V++   G   Y + V AP S NLAP GYY+  VV+++IPS+GIW
Sbjct  492   TSHSFSMSQRLLVLDHVELVRIGVWTYEVRVKAPKSKNLAPPGYYMASVVNQDIPSEGIW  551

Query  1756  VHIQ  1767
             + +Q
Sbjct  552   LRLQ  555



>emb|CDY13556.1| BnaC02g23670D [Brassica napus]
Length=554

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/544 (57%), Positives = 396/544 (73%), Gaps = 23/544 (4%)
 Frame = +1

Query  157   FTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHgg  336
             F  A+ A   GG W LL   +GISAMH QLL ND+V+ +DR+N GPS ISLP G C    
Sbjct  27    FNVASGA---GGTWKLLLNEVGISAMHSQLLINDRVIMYDRSNFGPSKISLPSGAC----  79

Query  337   ggglggRKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGG  501
                   R  P+D     +C+AHS+EYDVA NS RP+ + S+ WCSSG V+P G L+QTGG
Sbjct  80    ------RDSPNDVVSKRDCSAHSIEYDVAFNSIRPLTIESNTWCSSGGVTPEGALLQTGG  133

Query  502   YGEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFP  681
               EG R  R F PC+D  CDW E+   L   RWY+T+H+LPDGRQIIVGGR  FN+EFFP
Sbjct  134   DKEGERKARMFYPCDDESCDWTEVDNALNVRRWYATNHVLPDGRQIIVGGRNQFNFEFFP  193

Query  682   KSGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVR  861
             K+  A + Y LPFL++T D  +G ENNLYPF+ LN DGNLFIFANN+AILLDY  N VV+
Sbjct  194   KT-KAPSLYKLPFLSETYD--VGQENNLYPFIFLNSDGNLFIFANNKAILLDYNKNTVVK  250

Query  862   TYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNA-KRNIFVGAL  1038
             TYP+IPGG+PR+YPS+GSAVLLP+KNL+      EVLVCGG+PK +Y  A  +N FV AL
Sbjct  251   TYPKIPGGDPRSYPSTGSAVLLPIKNLEAEVVEMEVLVCGGAPKRSYLLALYKNTFVKAL  310

Query  1039  NTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHP  1218
             +TC RI I D  P+W+ E+MP  RVMGDM++LP G+VL+ING ++G+AGW+LGR P  +P
Sbjct  311   DTCARIKINDDKPQWVLEKMPRSRVMGDMILLPNGHVLLINGGSSGSAGWELGREPVLNP  370

Query  1219  VLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELS  1398
              LY P+   GSRF++QNP+ IPRMYHS+A L+ DGRVLV GSNPH  Y FT+V FPTEL 
Sbjct  371   DLYHPNKLVGSRFQVQNPSTIPRMYHSTAGLLRDGRVLVGGSNPHQFYNFTDVLFPTELR  430

Query  1399  MEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDM-SQVKVTMVSPAF  1575
             +EAFSPSYL+ +Y ++RP I+S  S S ++YG ++ ++F V G   + S VKVTMV P+F
Sbjct  431   LEAFSPSYLESQYWSIRPRIISLLSHSTVNYGGILRLRFMVFGIGGVRSPVKVTMVFPSF  490

Query  1576  STHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIW  1755
             ++HSFSM+QRLLVL+ V++   G   Y + V AP   N+AP GYY+ FVV+++IPS+GIW
Sbjct  491   TSHSFSMSQRLLVLDHVELVRIGVWTYEVRVKAPRYKNIAPPGYYMAFVVNQDIPSEGIW  550

Query  1756  VHIQ  1767
             V +Q
Sbjct  551   VRLQ  554



>ref|XP_003544396.1| PREDICTED: uncharacterized protein LOC100791340 [Glycine max]
Length=551

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/536 (59%), Positives = 387/536 (72%), Gaps = 20/536 (4%)
 Frame = +1

Query  187   GGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPP  366
             GG W +LQ SIGI AMHMQLLH D VV FDRT+ G SN+SLPDG C H            
Sbjct  25    GGHWKVLQQSIGIVAMHMQLLHTDTVVIFDRTDFGLSNLSLPDGLCRHDAAEMAV-----  79

Query  367   DDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPC-  543
               +CTAHS+EYDV+SN+FRP+ + ++ WCSS SV+  GTL+QTGG+ +G + VR FSPC 
Sbjct  80    KTDCTAHSLEYDVSSNTFRPLFLQTNVWCSSASVASDGTLIQTGGFNDGEKKVRTFSPCP  139

Query  544   -NDAECDWEEIPYG-LVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGP-ADTFYSL  714
                A CDW E+P   L   RWYST+H+LPDGRQII+GGRR FNYEFFPK+   A   YSL
Sbjct  140   TTAATCDWLELPSDTLSARRWYSTNHLLPDGRQIIIGGRRQFNYEFFPKTHTRAKNAYSL  199

Query  715   PFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPR  894
             PFL QT DP    ENNLYPFV LNVD  LFIFANNRAIL D+  N VVRT+P +P G+PR
Sbjct  200   PFLVQTNDPH--EENNLYPFVFLNVDSTLFIFANNRAILFDFTKNAVVRTFPTVPHGDPR  257

Query  895   NYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPN  1074
              YPS+GSAVLLPL+N   P + AEVLVCGG+P+ +Y  AK+  F+GALNTC RI ITDP+
Sbjct  258   CYPSTGSAVLLPLRN---PYSEAEVLVCGGAPRGSYNEAKKGNFLGALNTCARIKITDPD  314

Query  1075  PEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSR  1254
             P+W+ E MP  RVMGDM++LP GNVLIINGA +G+AGW+  R+P  +PV+Y PD   GSR
Sbjct  315   PKWVIETMPKARVMGDMILLPNGNVLIINGAGSGSAGWEFARDPVLNPVVYNPDKSTGSR  374

Query  1255  FELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPK  1434
             FE+   +  PRMYHS+A+L+ DGRVLVAGSNPH  Y F+NV FPTELS+EAF P YL+  
Sbjct  375   FEILVESNTPRMYHSTAILLRDGRVLVAGSNPHIGYNFSNVMFPTELSVEAFYPPYLESG  434

Query  1435  YAALRPEIVSPASQ--SGLSYGEVVSVQFKVS-GKVDMSQVKVTMVSPAFSTHSFSMNQR  1605
             Y  +RP IV P S+  + ++YGE V V+ +V+ G +  S V+VT+ +P F+THSFSMNQR
Sbjct  435   YDDVRPRIVFPESEARTKVTYGEKVKVRVQVAGGSLVRSLVRVTVSAPPFNTHSFSMNQR  494

Query  1606  LLVL---NTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             +LVL   N   +       Y I+V  P S  LAP GYYLLFVVH+EIPS+GIW+ I
Sbjct  495   MLVLEPINVTNIVGGPTPTYEIEVTTPGSPVLAPPGYYLLFVVHQEIPSQGIWIQI  550



>emb|CDX73183.1| BnaC06g36310D [Brassica napus]
Length=552

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/539 (58%), Positives = 391/539 (73%), Gaps = 10/539 (2%)
 Frame = +1

Query  154   FFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHg  333
              F +   A   GG W LL  ++GISAMH QLL ND+V+ +DR+N GPS ISLP+G C   
Sbjct  23    LFLSFHVASGAGGTWKLLLNNVGISAMHSQLLINDRVIMYDRSNFGPSKISLPNGTCRDS  82

Query  334   gggglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEG  513
                 +  R     +CTAHS+EYDVA N  RP+ V S+ WCSSG V+P GTL+QTGG  +G
Sbjct  83    PNDSVSKR-----DCTAHSIEYDVALNRVRPLTVQSNTWCSSGGVTPDGTLLQTGGDKDG  137

Query  514   TRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGP  693
              R  R F PC+D  C W EI   L   RWY+++H+LPDGRQIIVGGR  FN+EFFPK+  
Sbjct  138   ERKARLFYPCDDDSCVWSEIDNALNVKRWYASNHVLPDGRQIIVGGRDEFNFEFFPKTNA  197

Query  694   ADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPE  873
              +T YSL FL++T D  L  ENNLYP V LN DGNLFIFANNRAILLDY  N VV+TYPE
Sbjct  198   PNT-YSLRFLSETND--LDQENNLYPNVFLNTDGNLFIFANNRAILLDYSKNTVVKTYPE  254

Query  874   IPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNA-KRNIFVGALNTCG  1050
             IPGG+PR+YPS+GSAVLLP+KNL+      EVLVCGG+PK +Y  A   N FV  L+TC 
Sbjct  255   IPGGDPRSYPSTGSAVLLPIKNLEEEVIELEVLVCGGAPKGSYLLALNENTFVKGLDTCA  314

Query  1051  RIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYR  1230
             RI I D NP+W+ E+MP PR+MGDM+ILP G VL+ING ++G+AGW+LGR P   P LY 
Sbjct  315   RIKINDANPKWVLEKMPRPRIMGDMIILPNGQVLLINGGSSGSAGWELGRKPVLSPDLYH  374

Query  1231  PDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAF  1410
             PD P GSRF++QNP+ IPRMYHS+A L+ DGRVLV GSNPH  Y FT V FPTEL +EAF
Sbjct  375   PDKPIGSRFQVQNPSTIPRMYHSTANLLRDGRVLVGGSNPHEFYNFTGVLFPTELRLEAF  434

Query  1411  SPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSF  1590
             SPSYL+ +Y  +RP I+SP+  S ++YG V+ ++F+V G V  + VKVTM  P+F+THSF
Sbjct  435   SPSYLESQYRNIRPRIMSPSLHSTVNYGGVLRLRFRVLGGVK-TPVKVTMAFPSFTTHSF  493

Query  1591  SMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             SM+QRLLVL+ V     G+  Y + V +P S NLAP GYY++FVV+++IPS+GIWV +Q
Sbjct  494   SMSQRLLVLDHVTSLRIGQWTYEVRVKSPRSANLAPPGYYMVFVVNQDIPSEGIWVRLQ  552



>ref|XP_010670846.1| PREDICTED: galactose oxidase-like [Beta vulgaris subsp. vulgaris]
Length=538

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/530 (58%), Positives = 384/530 (72%), Gaps = 20/530 (4%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G+W LLQ SIGISAMHMQLL +D+V+ +DRT+ GPSNI+ PDG+C             P 
Sbjct  23    GQWQLLQKSIGISAMHMQLLDDDRVIIYDRTDFGPSNITFPDGRCPGN----------PK  72

Query  370   DNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF-SPCN  546
             D CTAHSVEYD  +N+FRP+ +L++ WCSSG+  P GTLVQTGGY  G RVVR F S CN
Sbjct  73    D-CTAHSVEYDSLTNTFRPLTLLTNNWCSSGATLPNGTLVQTGGYRNGDRVVRTFQSSCN  131

Query  547   DAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADT-FYSLPFL  723
                CDW E P  L++ RWY+++H LPDGR I++GG +AFNYEF+PK  P+ +  + LPFL
Sbjct  132   --ACDWVEHPNQLLQRRWYASNHALPDGRVIVIGGTKAFNYEFYPKDTPSSSQLFKLPFL  189

Query  724   AQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYP  903
              QT  P +  ENNLYPFV L+VDGNLFIFANNRAIL DY  +VVVRTYP IPGG+PR+YP
Sbjct  190   EQTNVPKV--ENNLYPFVFLHVDGNLFIFANNRAILFDYAKDVVVRTYPTIPGGDPRSYP  247

Query  904   SSGSAVLLPLKNLK-GPTTMAEVLVCGGSPKDAYYNA-KRNIFVGALNTCGRIVITDPNP  1077
             S+GSAVLLPLK L+ G    AEVL+CGG+P  +Y  A     F+ AL TC R+ ITDPNP
Sbjct  248   STGSAVLLPLKKLELGLDIEAEVLICGGAPVGSYLKALNSRQFLPALRTCARMKITDPNP  307

Query  1078  EWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRF  1257
              W  E MP  RVM DMV+LP  +VL+INGA+ G+AGW+LGR P   PV+Y P+   GSRF
Sbjct  308   SWAIETMPMARVMSDMVVLPNEDVLLINGASKGSAGWELGREPVLTPVIYHPNRASGSRF  367

Query  1258  ELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKY  1437
             E Q+ + IPRMYHS A+++ DGRVLV GSNPH  Y FTNV FPTELS+E FSP YLDP  
Sbjct  368   ENQSSSTIPRMYHSCAIMLRDGRVLVGGSNPHQFYNFTNVLFPTELSLETFSPPYLDPTK  427

Query  1438  AALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVL  1617
             A LRP I+ P S + + YG  ++++F VSG ++++ VKVTM+   F+THSFSM+QRLLVL
Sbjct  428   ARLRPVIIKPISSAKIKYGRFLTIKFSVSGLINLASVKVTMLRAPFNTHSFSMSQRLLVL  487

Query  1618  NTVK-VKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
                K V   G+  + + V  P S N+AP G+Y+LFVVHR IPSKGIWV +
Sbjct  488   TNRKLVSPTGQGRFQVRVRLPGSANIAPPGFYMLFVVHRNIPSKGIWVQL  537



>ref|XP_007160695.1| hypothetical protein PHAVU_001G009200g [Phaseolus vulgaris]
 gb|ESW32689.1| hypothetical protein PHAVU_001G009200g [Phaseolus vulgaris]
Length=552

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/534 (58%), Positives = 381/534 (71%), Gaps = 17/534 (3%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
               G+W LL  +IGI AMHMQLLH D VV FDRT+ G SN+SL  G+C H         K 
Sbjct  28    AAGQWQLLHKTIGIVAMHMQLLHTDTVVIFDRTDFGLSNLSLAGGRCRHDPD-----EKV  82

Query  364   PDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPC  543
                +CTAHSVEYDVASN+FRP+ + ++ WCSS +V+  GTLVQTGG+ +G R VR F PC
Sbjct  83    VKTDCTAHSVEYDVASNTFRPLFLQTNIWCSSAAVAADGTLVQTGGFNDGERTVRTFLPC  142

Query  544   NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKS-GPADTFYSLPF  720
               A CDW E P GL   RWY+T+  LPDGRQII+GGRR FNYEF+PKS   A   YSLPF
Sbjct  143   --ATCDWREFPDGLAVRRWYATNQKLPDGRQIIIGGRRQFNYEFYPKSDATAKNTYSLPF  200

Query  721   LAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNY  900
             L QT DP    ENNLYPFV LNVDG LFIFANNRAILLDY  N VV+T+P IPG +PR Y
Sbjct  201   LVQTNDPS--EENNLYPFVFLNVDGTLFIFANNRAILLDYTKNAVVKTFPNIPGNDPRCY  258

Query  901   PSSGSAVLLPLKNLKGPTTM---AEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDP  1071
             PS+GSAVLLPL++ K P      AEVL+CGG+P+ AY  AK+  F+GAL TC RI ITDP
Sbjct  259   PSTGSAVLLPLRS-KNPNFFSPEAEVLICGGAPRGAYTQAKKGTFIGALRTCARIKITDP  317

Query  1072  NPEWITEEMP--FPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPP  1245
             NP W+ E MP    R+M DM++LP GNVLI+NGA +G+AGW+ GR+P   P +Y PD   
Sbjct  318   NPTWVMETMPGGKGRLMSDMILLPNGNVLIVNGAGSGSAGWEFGRDPVLAPFVYNPDKEF  377

Query  1246  GSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYL  1425
             GSRFE+ N    PRMYHSSAVL+ DGRVLVAGSNPH  Y F++V FPT+LS+EAFSP YL
Sbjct  378   GSRFEILNATNTPRMYHSSAVLVRDGRVLVAGSNPHVGYNFSHVTFPTDLSVEAFSPPYL  437

Query  1426  DPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQR  1605
             +  +  +RP IV P S + ++YG+ V V+  V+  +  S V+VT+++P F+THSFSMNQR
Sbjct  438   EAAFRNVRPRIVGPESGTRVAYGQKVKVRVDVAAALVRSLVRVTVLAPPFATHSFSMNQR  497

Query  1606  LLVLNTVKV-KAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             +LVL    V    G   + ++V AP S  LAP G+YLLFVVH+EIPS+GIW+ I
Sbjct  498   MLVLEPSHVTNVDGPTTFELEVTAPGSPILAPPGFYLLFVVHQEIPSEGIWIQI  551



>ref|XP_009336703.1| PREDICTED: galactose oxidase-like [Pyrus x bretschneideri]
Length=573

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/505 (60%), Positives = 369/505 (73%), Gaps = 23/505 (5%)
 Frame = +1

Query  145   NRGFFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKC  324
             N    TA AA    GGKW +L+ ++GISAMHMQL  ND++V FDRT+ G SN+SL +G C
Sbjct  17    NFSVLTAHAA----GGKWQVLK-NVGISAMHMQLFKNDRIVMFDRTDFGKSNLSLANGNC  71

Query  325   HHggggglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGY  504
                           +++CTAHS E+ V +N+ RP+ VLSD WCSSGS+   G L+QTGG+
Sbjct  72    -------------VNNDCTAHSAEFVVQTNALRPLTVLSDVWCSSGSMDAYGNLIQTGGF  118

Query  505   GEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPK  684
               G R VR F+PC    CDW+E   GL   RWY+T+H+LPDGR+II+GGR  FNYEF PK
Sbjct  119   NSGERRVRVFTPCTG--CDWKETVDGLAVRRWYATNHMLPDGREIIIGGRGQFNYEFSPK  176

Query  685   SGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRT  864
             +      YSLPFL+QT DPG   ENNLYPFV LN DGNLFIFANNRAILLDYV N VV+T
Sbjct  177   TESTSNVYSLPFLSQTNDPG--QENNLYPFVFLNPDGNLFIFANNRAILLDYVKNAVVKT  234

Query  865   YPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNT  1044
             YP+IPGG+PR YPS+GSAVLLPLKNL  P   AEVLVCGG+PK ++  A + +FV ALNT
Sbjct  235   YPQIPGGDPRCYPSTGSAVLLPLKNLTAPAVEAEVLVCGGAPKGSFSQANKGVFVEALNT  294

Query  1045  CGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVL  1224
             C RI ITDPNP+WI E MP  RVMGDM++LP   VLIINGA++GAAGW++GRNP  +PV+
Sbjct  295   CARIKITDPNPQWIVETMPQARVMGDMILLPDSTVLIINGASSGAAGWEIGRNPVLNPVV  354

Query  1225  YRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKF-TNVFFPTELSM  1401
             YRPD   GSRFE QNP  IPRMYHSSA+L+ DGRV+V GSNPH  Y+F +NV FPTEL +
Sbjct  355   YRPDNAIGSRFEQQNPTTIPRMYHSSALLVRDGRVVVGGSNPHDKYQFGSNVLFPTELRL  414

Query  1402  EAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFST  1581
             EAFSP YLD KYA LRP I++P +Q+ + YG  ++VQF ++G   M+ V VTMV+P FST
Sbjct  415   EAFSPEYLDAKYADLRPTIIAPRNQAKIHYGRTLTVQFSLTGTFAMNSVSVTMVAPPFST  474

Query  1582  HSFSMNQRLLVLNTVKVKAAGEEEY  1656
             HSFSMNQRLLVL    V+      Y
Sbjct  475   HSFSMNQRLLVLGAENVQQCNAVSY  499



>ref|XP_010670858.1| PREDICTED: galactose oxidase-like [Beta vulgaris subsp. vulgaris]
Length=545

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/537 (58%), Positives = 386/537 (72%), Gaps = 23/537 (4%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
             GGG+W+LL+ SIGISAMHMQLL++D+V+ +DRT+ G SN+ L    C          R  
Sbjct  21    GGGRWHLLKKSIGISAMHMQLLNDDRVIIYDRTDFGSSNLPLASENC----------RID  70

Query  364   PDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
             P+D     +CTAHS EYD  SN+FRP+ VL+D WCSSG+  P GTL+QTGG+ +G RVVR
Sbjct  71    PNDQALQIDCTAHSAEYDSLSNTFRPLTVLTDTWCSSGTTLPNGTLMQTGGFNDGERVVR  130

Query  529   RFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPA--DT  702
              F P     CDW E P  L+  RWY+T+H+LPDGR II+GGRRA NYEF+PK G +    
Sbjct  131   TFQPSCSG-CDWVEFPNKLLDRRWYATNHVLPDGRSIIIGGRRAPNYEFYPKDGTSFSSQ  189

Query  703   FYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPG  882
              Y LPFL+QT DP    ENNLYP+V L+VDGNLFIFANNRAIL DY NNV+VRTYP IPG
Sbjct  190   LYKLPFLSQTHDPQ--QENNLYPYVFLHVDGNLFIFANNRAILFDYNNNVIVRTYPTIPG  247

Query  883   GEPRNYPSSGSAVLLPLKNLK-GPTTMAEVLVCGGSPKDAYYNA-KRNIFVGALNTCGRI  1056
             G+PR+YPS+GSAVLLPLKNL+ G     EVL+CGG+P  +Y  A     F+ AL TC RI
Sbjct  248   GDPRSYPSTGSAVLLPLKNLELGLNMQFEVLICGGAPLGSYLKALNMGQFLPALKTCARI  307

Query  1057  VITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPD  1236
              I D NP W  E MP  RVMGDM+ILP  +V+IINGA +G AGW+LGR+P   PV+Y PD
Sbjct  308   NINDHNPSWSLETMPMARVMGDMLILPNEDVIIINGAGSGTAGWELGRDPVLSPVIYHPD  367

Query  1237  APPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSP  1416
                GSRF +Q    IPR+YHSSA+L+ DGRV+V GSNPH TY FTNV +PTELS+EAFSP
Sbjct  368   NIRGSRFTVQRSTNIPRLYHSSAILLRDGRVVVGGSNPHRTYNFTNVLYPTELSLEAFSP  427

Query  1417  SYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSM  1596
             SYLDP    +RP I  P S S + YGEV+ V+F + G  ++  +KVTM+ P F+THSFSM
Sbjct  428   SYLDPTKVEIRPIINVPISGSRIRYGEVIKVKFLIVGSNNLDLIKVTMLRPPFNTHSFSM  487

Query  1597  NQRLLVL-NTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             +QRLLVL NT  VK  G  ++ ++++ P S N+AP G+Y+ FVVH+ +PSKG+WV +
Sbjct  488   SQRLLVLTNTKPVKLTGTGQFQVNIMIPGSANIAPPGFYIFFVVHQNVPSKGVWVQL  544



>ref|XP_011045140.1| PREDICTED: galactose oxidase-like [Populus euphratica]
Length=511

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/518 (60%), Positives = 372/518 (72%), Gaps = 16/518 (3%)
 Frame = +1

Query  232   MHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPDDNCTAHSVEYDVAS  411
             MHMQLL+ND+VV +DRT+ G SNISLP GKC +     +        +CTAHSVEYDV +
Sbjct  1     MHMQLLNNDRVVIYDRTDYGKSNISLPHGKCRNNSRELVIKY-----DCTAHSVEYDVLA  55

Query  412   NSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCNDAECDWEEIPYGLVR  591
             N FRP++V +D WCSSG+V P G+L+QTGG+ +G R VR F PCN  +CDW E   GL  
Sbjct  56    NKFRPLMVQTDVWCSSGAVVPDGSLIQTGGFNDGRRKVRTFYPCN-GDCDWVETGDGLKA  114

Query  592   PRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFLAQTTDPGLGAENNLYP  771
              RWY+T+HILPDG+QI++GGRR FNYEF+PK+   +  YSLPFL QT D G+  ENNLYP
Sbjct  115   RRWYATNHILPDGKQIVIGGRRQFNYEFYPKTSSPNV-YSLPFLLQTNDRGI--ENNLYP  171

Query  772   FVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYPSSGSAVLLPLKNLKGP  951
             FV LN DGNLFIFANNRAIL DY    VV+TYP IPGG+PR+YPS+GSAVLLPLKNL   
Sbjct  172   FVFLNSDGNLFIFANNRAILFDYKTGKVVKTYPAIPGGDPRSYPSTGSAVLLPLKNLDAA  231

Query  952   TTMAEVLVCGGSPKDAYYNAKRNI-----FVGALNTCGRIVITDPNPEWITEEMPFPRVM  1116
             T  AEVLVCGG+PK ++  A +       F  AL+TCGRI I +P+P+W+ E MP  RVM
Sbjct  232   TIEAEVLVCGGAPKGSFEMATKRKSAERKFNKALDTCGRIKINEPSPQWVMETMPCARVM  291

Query  1117  GDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFELQNPNKIPRMYH  1296
             GDM +LP G VLIINGA +G AGW+ GR PA  PVLY PD   GSRFE  NP+ IPRMYH
Sbjct  292   GDMTLLPNGVVLIINGAGDGTAGWENGRRPALSPVLYWPDGAAGSRFEQLNPSTIPRMYH  351

Query  1297  SSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAALRPEIVSPASQ  1476
             S+A+L+ DGRVLV GSNPH  Y FT V FPTELS+EAFSP YLD K   LRP+IVS  + 
Sbjct  352   STAILLRDGRVLVGGSNPHIGYDFTGVLFPTELSLEAFSPPYLDSKNKHLRPKIVSSTAS  411

Query  1477  SG--LSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNTVKVKAAGEE  1650
              G  + YG+ + V+FKV GK+    V VTMV+PAF+THSFSMN RLL L    V      
Sbjct  412   KGKYIGYGQKLWVRFKVIGKLKADMVSVTMVAPAFNTHSFSMNHRLLALRNENVTYVRTS  471

Query  1651  EYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
              Y I V  P SG LAPSGYY+L+VVH+ IPS GIWV +
Sbjct  472   IYDIQVTTPSSGYLAPSGYYMLYVVHQYIPSIGIWVKL  509



>ref|XP_008813838.1| PREDICTED: galactose oxidase-like [Phoenix dactylifera]
Length=548

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/540 (58%), Positives = 394/540 (73%), Gaps = 18/540 (3%)
 Frame = +1

Query  163   AAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHgggg  342
             +AA A  GGG+W+LLQ SIG+SAMHMQLLHND+V+ FDRT+ GPSN+SLPDGKC H    
Sbjct  22    SAAEAASGGGRWDLLQRSIGVSAMHMQLLHNDRVIIFDRTDFGPSNLSLPDGKCRHDHH-  80

Query  343   glggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRV  522
                  +    +CTAHS EYDV +N+FRP+ + +D WCSSGSV P G L+QTGG  +G R 
Sbjct  81    ----ERVLKIDCTAHSAEYDVVTNTFRPLTIHTDTWCSSGSVDPDGRLIQTGGSFDGERA  136

Query  523   VRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADT  702
             +R F PC D+ CDW+E+   L  PRWY+T+ ILPDGR II+GGR  F+YEF+PKS P+  
Sbjct  137   IRTFFPCTDSRCDWKEVE-ALAVPRWYATNQILPDGRAIIIGGRLQFSYEFYPKSNPSTA  195

Query  703   -FYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIP  879
                +L FL QT D     ENNLYPFV LNVDGNLFIFANNRAILLDY  N +VRTYP +P
Sbjct  196   GITNLEFLLQTRDV---EENNLYPFVHLNVDGNLFIFANNRAILLDYTKNNIVRTYPPVP  252

Query  880   GGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRN-IFVGALNTCGRI  1056
             GG+PR+YPS+GS+VLLPL++       AEVL+CGG+P+ ++  A +N  FVGAL+TCGRI
Sbjct  253   GGDPRSYPSTGSSVLLPLES---SGEEAEVLICGGAPRGSFMKAIKNEAFVGALSTCGRI  309

Query  1057  VITDPNPEWITEEMPFPRVMGDMVILPTGN-VLIINGATNGAAGWDLGRNPAFHPVLYRP  1233
              ITDP+P W  E MP PRVMGDM++LP+G  VLIINGA  GAAGW+LGR+P   PV+Y P
Sbjct  310   KITDPSPTWFIETMPTPRVMGDMILLPSGKEVLIINGAAAGAAGWELGRSPVMTPVVYCP  369

Query  1234  DAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFS  1413
               P G+RFE+QN +  PR+YHSSA+L+ DGR+LV GSNPH  Y F+ V +PTELS+EAFS
Sbjct  370   GKPVGARFEVQNSSSTPRLYHSSAILLRDGRILVGGSNPHENYVFSGVDYPTELSLEAFS  429

Query  1414  PSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFS  1593
             P YL  +++ LRP I+ P +   L+YG+  S++FK     +   V VTMV+P+FSTHSFS
Sbjct  430   PDYLGAEHSILRPRIIEPRTPLMLNYGKQFSLRFKARLTSN-EGVSVTMVAPSFSTHSFS  488

Query  1594  MNQRLLVLNTVKVKA--AGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             MNQRLL+L + K     +G   + I  VAP S  LAP GYY+ F+V+  IP +GIWVHIQ
Sbjct  489   MNQRLLILKSSKAATIPSGSSTHEIGAVAPKSRILAPPGYYMFFIVNGRIPGEGIWVHIQ  548



>gb|AAG12543.1|AC007797_3 Unknown Protein [Arabidopsis thaliana]
Length=504

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/518 (58%), Positives = 378/518 (73%), Gaps = 20/518 (4%)
 Frame = +1

Query  232   MHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPDD-----NCTAHSVE  396
             MHMQLLHND+VV +DRTN GPSNISLP+G C          R  P D     +CTAHS+E
Sbjct  1     MHMQLLHNDRVVMYDRTNFGPSNISLPNGNC----------RDNPQDAVSKIDCTAHSIE  50

Query  397   YDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCNDAECDWEEIP  576
             YDVA+N+ RP+ V S+ WCSSGSV P G LVQTGG  +G    R FSPCN+ +CDW E+ 
Sbjct  51    YDVATNTIRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKTRTFSPCNNNQCDWVEMN  110

Query  577   YGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFLAQTTDPGLGAE  756
              GL + RWY+++HILPDG+QI++GG+  FNYEFFPK+   +   +LPFLA+T D G   E
Sbjct  111   NGLKKRRWYASNHILPDGKQIVMGGQGQFNYEFFPKTTNPNVV-ALPFLAETHDQG--QE  167

Query  757   NNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYPSSGSAVLLPLK  936
             NNLYPFV +N DGNLF+FANNRAILLDYV N VV+T+P IPGG+PRNYPS+GSAVLLPLK
Sbjct  168   NNLYPFVFMNTDGNLFMFANNRAILLDYVKNTVVKTFPAIPGGDPRNYPSTGSAVLLPLK  227

Query  937   NLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEWITEEMPFPRVM  1116
             NL+      EVLVCGG+PK +Y  A++  FV AL+TC RI I D  PEW  E+MP  RVM
Sbjct  228   NLEADNVETEVLVCGGAPKGSYNLARKKTFVKALDTCARIKINDAKPEWAVEKMPHARVM  287

Query  1117  GDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFELQNPNKIPRMYH  1296
             GDM+ LP G+VL+ING + G A W+LGR P   P LY P+ P GSRFE   P  IPRMYH
Sbjct  288   GDMIPLPNGDVLLINGGSFGTAAWELGRTPVLAPDLYHPENPVGSRFESLRPTTIPRMYH  347

Query  1297  SSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAALRPEIVSPASQ  1476
             S+A+L+ DGRVLV GSNPHA Y +T V FPTELS+EAFSP YL  +++ LRP+I+SP  Q
Sbjct  348   SAAILLRDGRVLVGGSNPHAFYNYTGVLFPTELSLEAFSPVYLQREFSNLRPKIISPEPQ  407

Query  1477  SGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNTVKVKAAGEE-E  1653
             S + YG  + ++F V+G+V  +  KVTMV P F+THSF+MNQR+LVL+ VK    G+   
Sbjct  408   SMIKYGTNLKLKFSVTGEV-TTPAKVTMVFPTFTTHSFAMNQRVLVLDNVKFTRKGKSPM  466

Query  1654  YGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             Y + V  P S N+A  GYY++FVV+++IPS+G+WV ++
Sbjct  467   YEVQVRTPRSANIAWPGYYMIFVVNQDIPSEGVWVKLE  504



>gb|EAY89314.1| hypothetical protein OsI_10817 [Oryza sativa Indica Group]
Length=563

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/550 (58%), Positives = 386/550 (70%), Gaps = 29/550 (5%)
 Frame = +1

Query  169   AAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHgggggl  348
             A A   GG+W++LQ SIG+SAMHMQLLHND+V+ FDRT+ G SN+SLPDG+C        
Sbjct  26    APASGAGGRWDVLQRSIGVSAMHMQLLHNDRVIIFDRTDFGLSNLSLPDGRCRRNPRE--  83

Query  349   ggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
               R  P D CTAHS EYDVASN+FRP+ V +D WCSSG+V+P GTLVQTGG+ +G R VR
Sbjct  84    --RVVPMD-CTAHSAEYDVASNTFRPLFVFTDTWCSSGTVAPDGTLVQTGGWNDGYRNVR  140

Query  529   RFSPCN--DAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPAD-  699
               + C   D  CDW+E    L   RWY+T+ ILPDGR  IVGGRR F YEF+P +  +  
Sbjct  141   TMAACEAGDDTCDWDETQDALAANRWYATNQILPDGRAFIVGGRRQFTYEFYPTADSSGA  200

Query  700   TFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIP  879
             +  SLPFL QT DP    ENNLYPFV LN+DGNLFIFA NRAIL DY  N VVRTYPE+ 
Sbjct  201   SAISLPFLVQTKDP---EENNLYPFVHLNIDGNLFIFAKNRAILFDYKKNKVVRTYPELA  257

Query  880   GGEPRNYPSSGSAVLLPLKNLKGPT-TMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRI  1056
             GG+PRNYPSSGS+VLLPLK    P+ T AEVLVCGG+P  +Y + K   F  AL TCGRI
Sbjct  258   GGDPRNYPSSGSSVLLPLK----PSPTEAEVLVCGGAPAGSYTSTKDGTFSSALVTCGRI  313

Query  1057  VITDPNPEWITEEMPFPRVMGDMVILPTG-NVLIINGATNGAAGWDLGRNPAFHPVLYRP  1233
              ITD  P W+ E MP PRVMGDM++LP G  V+IINGA +G AGW+  + PA+ PV+YRP
Sbjct  314   KITDTAPAWVIETMPSPRVMGDMILLPNGAEVVIINGAMDGTAGWESAKTPAYAPVIYRP  373

Query  1234  DAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFS  1413
             D  PG RFE Q+   I R+YHSSAVL+ DGR+LV GSNPH  Y F+NV +PTELS+EA+S
Sbjct  374   DHSPGDRFEEQSSTDIARLYHSSAVLLRDGRLLVGGSNPHIYYNFSNVQYPTELSLEAYS  433

Query  1414  PSYLDPKYAALRPEIVSPA---SQSGLSYGEVVSVQFKV--------SGKVDMSQVKVTM  1560
             P YLDP   ALRP IV P+   +   ++YG  +++QF V         G   +  V VTM
Sbjct  434   PEYLDPSNDALRPTIVDPSPNGAAVSVTYGASLTLQFAVPAARRARGGGGGGIGLVSVTM  493

Query  1561  VSPAFSTHSFSMNQRLLVLNTVKVKA-AGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREI  1737
             V+P+F+THSF+MNQRLL+L+ VK  A A    Y   VV P +  LAP GYY++FVV+  I
Sbjct  494   VAPSFTTHSFAMNQRLLLLDAVKTAALARASTYQTSVVMPATAALAPPGYYMVFVVNGHI  553

Query  1738  PSKGIWVHIQ  1767
             PS+GIWVHIQ
Sbjct  554   PSEGIWVHIQ  563



>ref|NP_001049609.1| Os03g0258900 [Oryza sativa Japonica Group]
 gb|ABF95066.1| glyoxal oxidase, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF11523.1| Os03g0258900 [Oryza sativa Japonica Group]
 gb|EAZ26322.1| hypothetical protein OsJ_10202 [Oryza sativa Japonica Group]
 dbj|BAH00424.1| unnamed protein product [Oryza sativa Japonica Group]
Length=564

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/551 (58%), Positives = 386/551 (70%), Gaps = 30/551 (5%)
 Frame = +1

Query  169   AAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHgggggl  348
             A A   GG+W++LQ SIG+SAMHMQLLHND+V+ FDRT+ G SN+SLPDG+C        
Sbjct  26    APASGAGGRWDVLQRSIGVSAMHMQLLHNDRVIIFDRTDFGLSNLSLPDGRCRRNPRE--  83

Query  349   ggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
               R  P D CTAHS EYDVASN+FRP+ V +D WCSSG+V+P GTLVQTGG+ +G R VR
Sbjct  84    --RVVPMD-CTAHSAEYDVASNTFRPLFVFTDTWCSSGTVAPDGTLVQTGGWNDGYRNVR  140

Query  529   RFSPCN--DAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPAD-  699
               + C   D  CDW+E    L   RWY+T+ ILPDGR  IVGGRR F YEF+P +  +  
Sbjct  141   TMAACEAGDDTCDWDETQDALAANRWYATNQILPDGRAFIVGGRRQFTYEFYPTADSSGG  200

Query  700   TFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIP  879
             +  SLPFL QT DP    ENNLYPFV LN+DGNLFIFA NRAIL DY  N VVRTYPE+ 
Sbjct  201   SAISLPFLVQTKDP---EENNLYPFVHLNIDGNLFIFAKNRAILFDYKKNKVVRTYPELA  257

Query  880   GGEPRNYPSSGSAVLLPLKNLKGPT-TMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRI  1056
             GG+PRNYPSSGS+VLLPLK    P+ T AEVLVCGG+P  +Y + K   F  AL TCGRI
Sbjct  258   GGDPRNYPSSGSSVLLPLK----PSPTEAEVLVCGGAPAGSYTSTKDGTFSSALVTCGRI  313

Query  1057  VITDPNPEWITEEMPFPRVMGDMVILPTG-NVLIINGATNGAAGWDLGRNPAFHPVLYRP  1233
              ITD  P W+ E MP PRVMGDM++LP G  V+IINGA +G AGW+  + PA+ PV+YRP
Sbjct  314   KITDTAPAWVIETMPSPRVMGDMILLPNGAEVVIINGAMDGTAGWESAKTPAYAPVIYRP  373

Query  1234  DAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFS  1413
             D  PG RFE Q+   I R+YHSSAVL+ DGR+LV GSNPH  Y F+NV +PTELS+EA+S
Sbjct  374   DHSPGDRFEEQSSTDIARLYHSSAVLLRDGRLLVGGSNPHIYYNFSNVQYPTELSLEAYS  433

Query  1414  PSYLDPKYAALRPEIVSPA---SQSGLSYGEVVSVQFKV---------SGKVDMSQVKVT  1557
             P YLDP   ALRP IV P+   +   ++YG  +++QF V          G   +  V VT
Sbjct  434   PEYLDPSNDALRPTIVDPSPNGAAVSVTYGASLTLQFAVPAARRARGGGGGGGIGLVSVT  493

Query  1558  MVSPAFSTHSFSMNQRLLVLNTVKVKA-AGEEEYGIDVVAPDSGNLAPSGYYLLFVVHRE  1734
             MV+P+F+THSF+MNQRLL+L+ VK  A A    Y   VV P +  LAP GYY++FVV+  
Sbjct  494   MVAPSFTTHSFAMNQRLLLLDAVKTAALARASTYQTSVVMPATAALAPPGYYMVFVVNGH  553

Query  1735  IPSKGIWVHIQ  1767
             IPS+GIWVHIQ
Sbjct  554   IPSEGIWVHIQ  564



>ref|XP_009393211.1| PREDICTED: galactose oxidase-like [Musa acuminata subsp. malaccensis]
Length=542

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/549 (57%), Positives = 391/549 (71%), Gaps = 30/549 (5%)
 Frame = +1

Query  154   FFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHg  333
             FF   A A  GGG+W LLQPSIG+SAMHMQLL ND+V+ FDRT+ GPSN+SLP G+C   
Sbjct  12    FFLCLATA-SGGGQWELLQPSIGVSAMHMQLLSNDRVIVFDRTDFGPSNLSLPGGRC---  67

Query  334   gggglggRKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTG  498
                    R  P D     +CTAH+ EYDV SN+ RP+ VL+D WCSSG+VSP G L+QTG
Sbjct  68    -------RNDPRDWTLTVDCTAHAAEYDVPSNAVRPLTVLTDPWCSSGTVSPDGRLIQTG  120

Query  499   GYGEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFF  678
             G  +G R VR   PC+D  CDWEE   GL  PRWY+T+H+LPDGR ++VGGR   NYEF 
Sbjct  121   GANDGERAVRYLDPCHDRLCDWEEDAAGLAAPRWYATNHVLPDGRAVVVGGRSQHNYEFV  180

Query  679   PKSGPADT-FYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVV  855
             PK G AD    SLPFL +T D      NNLYPFV LNVDGNLF+FANNRAILLDY  N +
Sbjct  181   PKLGAADAGAVSLPFLRETRD---AEYNNLYPFVYLNVDGNLFVFANNRAILLDYKTNSI  237

Query  856   VRTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPT-TMAEVLVCGGSPKDAYYNAK-RNIFV  1029
             VRTYP +P G PRNYPS+GS+VLLPL+    P+ + AEVL+CGG+P+ ++  A  + +FV
Sbjct  238   VRTYPTVPDGHPRNYPSTGSSVLLPLQ----PSGSEAEVLICGGAPEGSFTKASTQKVFV  293

Query  1030  GALNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGN-VLIINGATNGAAGWDLGRNP  1206
             GALNTC RI I DP+P W  E MP PRVMGDM++LP+G+ VLIINGA  G++GW+LGR P
Sbjct  294   GALNTCLRIRINDPSPSWSVETMPTPRVMGDMILLPSGDEVLIINGAAAGSSGWELGREP  353

Query  1207  AFHPVLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFP  1386
                PV YR  +P GSRF+++ P  IPRMYHS+A+L+ DGRVLV GSNPHA Y FT V FP
Sbjct  354   VLTPVSYRHGSPAGSRFDVKTPATIPRMYHSTAILLRDGRVLVGGSNPHAFYNFTGVDFP  413

Query  1387  TELSMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVS  1566
             T+LS+EA+SP+YL+   +  RP +    +   L+Y +  S++F V+   +   V VTMV+
Sbjct  414   TDLSLEAYSPAYLEAANSNARPTVTWAGTPVELNYAKPFSLRFSVAAMSEKG-VLVTMVA  472

Query  1567  PAFSTHSFSMNQRLLVLNTVKVKAAGEEE--YGIDVVAPDSGNLAPSGYYLLFVVHREIP  1740
             P+F+THSFSMNQRLL+L +    AA  E   Y +D +AP S  +AP GYY++FVV+  IP
Sbjct  473   PSFATHSFSMNQRLLILESELAAAADAESSLYVVDAMAPSSTFMAPPGYYMVFVVNGGIP  532

Query  1741  SKGIWVHIQ  1767
             S+G+WVHIQ
Sbjct  533   SEGVWVHIQ  541



>ref|XP_007136065.1| hypothetical protein PHAVU_009G014900g [Phaseolus vulgaris]
 gb|ESW08059.1| hypothetical protein PHAVU_009G014900g [Phaseolus vulgaris]
Length=565

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/538 (56%), Positives = 376/538 (70%), Gaps = 20/538 (4%)
 Frame = +1

Query  193   KWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPDD  372
             +W LL  +IGI AMHMQLL+ND+V+ FDRT+ G SN++LP+G C H         K    
Sbjct  35    QWELLHKTIGIVAMHMQLLNNDRVIIFDRTDFGFSNLTLPNGTCRHDLS-----EKVLKT  89

Query  373   NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCNDA  552
             +CTAHS+EYDVASN+FR + V +D WCSSG     GTL+QTGGY +G R +R FSPC  +
Sbjct  90    DCTAHSIEYDVASNTFRALFVQTDVWCSSGGAVADGTLIQTGGYNDGERKIRSFSPCKGS  149

Query  553   E-CDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTF--YSLPFL  723
             E C+W+E    L   RWYST+H LPDGRQII+GGRR FN+EF+PK    D    Y  PFL
Sbjct  150   EDCEWQESDNALAVRRWYSTNHYLPDGRQIIIGGRRQFNFEFYPKRKTEDKNKPYVFPFL  209

Query  724   AQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYP  903
              QT D G  AENNLYPFV+LNVDGNLFIFANNRAIL DY N+ VVRTYPEIPGG+PR YP
Sbjct  210   FQTNDKG--AENNLYPFVVLNVDGNLFIFANNRAILFDYENDAVVRTYPEIPGGDPRCYP  267

Query  904   SSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEW  1083
             S+GSAVLLPLKNL+     AEVLVCGG+ + A+    + +F  AL++C RI ITDPN  W
Sbjct  268   STGSAVLLPLKNLEAARVEAEVLVCGGARRGAFQLVPKGVFSEALDSCARIKITDPNATW  327

Query  1084  ITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPD---------  1236
               E MP  RVM DMV+LP G+VLIINGA +G AGW+   NP   PV+Y+ +         
Sbjct  328   AVETMPMGRVMNDMVMLPNGDVLIINGAQSGTAGWERAENPVLQPVIYKTNGSGSGSGSG  387

Query  1237  -APPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFS  1413
                 GSRF LQ  + IPRMYHS+A+L+ DGRV+V GSNPH  Y F+NV +PTELS+EAFS
Sbjct  388   SGSGGSRFVLQPASDIPRMYHSTAILVRDGRVIVGGSNPHEKYMFSNVAYPTELSLEAFS  447

Query  1414  PSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFS  1593
             P YL  +++ LRP I+ P+S + L YGE   +  KV+G +    + VTM++P F+THSFS
Sbjct  448   PFYLGSQFSDLRPIILEPSSHTNLMYGEKFKMGIKVNGALVPDLLSVTMLAPPFNTHSFS  507

Query  1594  MNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             MNQRLLVL+   VK +G      +V AP S  LAP  +Y+LF VH++IPS+GIW+ IQ
Sbjct  508   MNQRLLVLSVGDVKVSGNSSSEFEVTAPGSAVLAPPTFYMLFAVHQDIPSEGIWIKIQ  565



>ref|XP_006649773.1| PREDICTED: galactose oxidase-like [Oryza brachyantha]
Length=559

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/537 (58%), Positives = 384/537 (72%), Gaps = 23/537 (4%)
 Frame = +1

Query  193   KWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPDD  372
             +W+LLQ SIG+SAMHMQLLHND+V+ FDRT+ G SN+SLPDG+C          R  P D
Sbjct  34    RWDLLQRSIGVSAMHMQLLHNDRVIIFDRTDFGQSNLSLPDGRCRRNPRE----RVVPVD  89

Query  373   NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPC--N  546
              CTAHS EYDVASN+FRP+ V +D WCSSG+V+P GTLVQTGG+ +G R VR  + C  +
Sbjct  90    -CTAHSAEYDVASNTFRPLYVFTDTWCSSGTVAPDGTLVQTGGWNDGYRNVRTMAACEAD  148

Query  547   DAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSL-PFL  723
             D  CDW+E    L   RWY+T+ ILPDGR  IVGGRR F+YEF+PK+ P+DT  +L PFL
Sbjct  149   DDSCDWDETQDALAVSRWYATNQILPDGRAFIVGGRRQFSYEFYPKADPSDTSVTLMPFL  208

Query  724   AQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYP  903
              QT DP    ENNLYPFV LN+DGNLFIFA NRAILLDY  N +VRTYPE+ GG+PRNYP
Sbjct  209   VQTKDP---EENNLYPFVHLNIDGNLFIFAKNRAILLDYKKNKIVRTYPELAGGDPRNYP  265

Query  904   SSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEW  1083
             SSGS+VLLPLK    PT  AEVLVCGG+P  +Y + K   F  AL TCGRI ITD  P W
Sbjct  266   SSGSSVLLPLK--PSPTE-AEVLVCGGAPAGSYNSTKDGTFPSALVTCGRIKITDMAPSW  322

Query  1084  ITEEMPFPRVMGDMVILPTG-NVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFE  1260
             + E MP PRVMGDM++LP G  V+IINGA +G AGW+  + PA  P++YRPD  PG RFE
Sbjct  323   VIETMPSPRVMGDMILLPNGAEVVIINGAMDGTAGWESAKTPALAPLIYRPDHSPGDRFE  382

Query  1261  LQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYA  1440
              Q+   I R+YHSSAVL+ DGR+LV GSNPH  Y F+NV +PTELS+EA+SP YLDP   
Sbjct  383   EQSSTDIARLYHSSAVLLRDGRLLVGGSNPHIYYNFSNVQYPTELSLEAYSPEYLDPSND  442

Query  1441  ALRPEIVSPA---SQSGLSYGEVVSVQFKV----SGKVDMSQVKVTMVSPAFSTHSFSMN  1599
              LRP IV P+   + + ++YG  ++++F V      +  +  +  TMV+P+F+THSF+MN
Sbjct  443   MLRPTIVDPSPTGAPASVTYGASLTLRFTVPASKRSRGGIGPLSATMVAPSFTTHSFAMN  502

Query  1600  QRLLVLNTVKVKA-AGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             QRLL L+ VK  A A    Y   VV P +  LAP GYY++FVV+  IPS+GIWVHIQ
Sbjct  503   QRLLFLDVVKTAALARAGSYQTSVVMPATAVLAPPGYYMVFVVNGHIPSEGIWVHIQ  559



>ref|XP_010416451.1| PREDICTED: galactose oxidase-like isoform X2 [Camelina sativa]
Length=516

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/545 (57%), Positives = 382/545 (70%), Gaps = 57/545 (10%)
 Frame = +1

Query  154   FFTAAAAAVRG-GGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHH  330
             FF  +     G GG W LL P++GISAMH QLLHND+V+ +DRTN GPSNISLP G C  
Sbjct  22    FFLLSCHLTSGAGGTWKLLLPNVGISAMHSQLLHNDRVIMYDRTNFGPSNISLPHGAC--  79

Query  331   ggggglggRKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQT  495
                     R+ P+D     +CTAHSVEY+VA NS RP+ V S+ WCSSG V+P GTL+QT
Sbjct  80    --------RQSPNDAISKTDCTAHSVEYNVALNSIRPLTVQSNTWCSSGGVTPDGTLLQT  131

Query  496   GGYGEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEF  675
             GG  +G    R F+PC+D  CDW E+  GL   RWY+++H+LPDGRQII+GGR  FNYEF
Sbjct  132   GGSRDGELKTRLFAPCDDDSCDWTEVDNGLAAARWYASNHVLPDGRQIIIGGRDQFNYEF  191

Query  676   FPKSGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVV  855
             FPK+  A   Y+LPFL QTTDPG   ENNLYP+V LN DGNLFIFANNRAILL+Y  N V
Sbjct  192   FPKTN-APNLYALPFLTQTTDPG--QENNLYPYVFLNTDGNLFIFANNRAILLNYATNTV  248

Query  856   VRTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGA  1035
             V+TYPEIPGG+PR+YPS+GSAVLLP+KNL     + EVLVCGG+PK              
Sbjct  249   VKTYPEIPGGDPRSYPSTGSAVLLPIKNL-----VLEVLVCGGAPK--------------  289

Query  1036  LNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFH  1215
                               E+MP  RVMGDM +LP G+VL+ING ++G A W+LGR P F+
Sbjct  290   -----------------VEKMPRARVMGDMTLLPDGHVLLINGGSSGTAAWELGREPVFN  332

Query  1216  PVLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTEL  1395
             P +Y PD P GSRFE QN N IPRMYHS+A L+ DGRV+V GSNPHA Y FT V FPTEL
Sbjct  333   PDIYYPDRPVGSRFEPQNANAIPRMYHSTATLLRDGRVIVGGSNPHAYYNFTGVLFPTEL  392

Query  1396  SMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAF  1575
             S+EAFSPSYL+ KY++LRP I+ P  Q+ ++YG+++ ++F V G++  + VKVTMV P+F
Sbjct  393   SLEAFSPSYLESKYSSLRPVIMDPMPQTTINYGQILRLRFTVQGRMK-TPVKVTMVYPSF  451

Query  1576  STHSFSMNQRLLVLNTVKVKAAGEEE-YGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGI  1752
             +THSFSM+QRLLVL+ V     G    Y + V  P S NLAP GYY++FVV++ IPS+G+
Sbjct  452   NTHSFSMSQRLLVLDHVLFLRIGLSRIYEVSVRTPSSVNLAPPGYYMVFVVNQNIPSEGV  511

Query  1753  WVHIQ  1767
             WV +Q
Sbjct  512   WVRLQ  516



>gb|KHG09161.1| galactose oxidase [Gossypium arboreum]
Length=457

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/512 (59%), Positives = 355/512 (69%), Gaps = 55/512 (11%)
 Frame = +1

Query  232   MHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPDDNCTAHSVEYDVAS  411
             MHMQLL ND+VV +DRT+ GPS + L  GKCH+              +CTAHSVEYDV S
Sbjct  1     MHMQLLKNDRVVMYDRTDFGPSTLPLASGKCHNDPTNTAV-----QVDCTAHSVEYDVLS  55

Query  412   NSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCNDAECDWEEIPYGLVR  591
             N FR + V S+ WCSSG V P G LVQTGG+ EG   VR FSPC    CDW E P GL  
Sbjct  56    NKFRALTVQSNVWCSSGGVMPDGKLVQTGGFSEGELRVRVFSPCE--SCDWHETPNGLAA  113

Query  592   PRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFLAQTTDPGLGAENNLYP  771
              RWY+T+H+LPDGRQI+VGGR  FNYEF PK+  ADTF  L FL++T + G+  ENNLYP
Sbjct  114   KRWYATNHVLPDGRQIVVGGREQFNYEFVPKNIAADTF-KLHFLSETNERGV--ENNLYP  170

Query  772   FVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYPSSGSAVLLPLKNLKGP  951
             FV LNVDGNLFIFANNRAILLDYVNN VV+TYP+IPGGEPR+YPS+GSAVLLPLKNL   
Sbjct  171   FVFLNVDGNLFIFANNRAILLDYVNNKVVKTYPKIPGGEPRSYPSTGSAVLLPLKNLTAA  230

Query  952   TTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEWITEEMPFPRVMGDMVI  1131
             T  AEVLVCGG+PK ++  A +  FV ALNTC RI ITDP P+W+ E MP  RVMGDMV+
Sbjct  231   TIQAEVLVCGGAPKGSFVQALQGKFVKALNTCARISITDPKPKWVLETMPLARVMGDMVL  290

Query  1132  LPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFELQNPNKIPRMYHSSAVL  1311
             LP G VL+INGA +G+AGWDLGR+P  +PVLY PD    SRF++ NP KIPRMYHS+AVL
Sbjct  291   LPNGKVLVINGARSGSAGWDLGRDPVLNPVLYMPDNEIESRFKILNPTKIPRMYHSTAVL  350

Query  1312  ITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAALRPEIVSPASQSGLSY  1491
             + DGRVLV GSNPHA Y FT V +PTELS+EAF P YLD K+  LRP IV+P        
Sbjct  351   LRDGRVLVGGSNPHAYYNFTGVLYPTELSLEAFYPGYLDAKFNNLRPTIVAP--------  402

Query  1492  GEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNTVKVKAAGEEEYGIDVV  1671
                                                  +LLVL   KV A+G+  Y I+V+
Sbjct  403   -------------------------------------KLLVLGNDKVMASGKSTYEIEVM  425

Query  1672  APDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
              P SGNLAP+G+YLLFVVH++IPS+GIWVH++
Sbjct  426   TPGSGNLAPAGFYLLFVVHQDIPSQGIWVHLK  457



>ref|XP_002468154.1| hypothetical protein SORBIDRAFT_01g040550 [Sorghum bicolor]
 gb|EER95152.1| hypothetical protein SORBIDRAFT_01g040550 [Sorghum bicolor]
Length=585

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/555 (56%), Positives = 381/555 (69%), Gaps = 31/555 (6%)
 Frame = +1

Query  166   AAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggg  345
             A A+  GGG+W+LLQ SIG+SAMHMQLLHND+V+ FDRT+ G SN+SLPDG C       
Sbjct  38    APASGAGGGRWDLLQRSIGVSAMHMQLLHNDRVIIFDRTDFGSSNLSLPDGHCR----VN  93

Query  346   lggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVV  525
                R  P  +CTAHS EYDVA+N+FRP+ V +D WCSS +V+P GTLVQTGG+ +G R  
Sbjct  94    PRERVLPRGDCTAHSAEYDVAANAFRPLSVFTDTWCSSATVAPDGTLVQTGGWNDGFRNA  153

Query  526   RRFSPC----NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGP  693
             R    C    +D  CDW E    L   RWY+T+ ILPDGR  IVGGRR FNYEF+PK+GP
Sbjct  154   RTMPACGGTGDDKSCDWSEKQDVLAANRWYATNQILPDGRAFIVGGRRQFNYEFYPKAGP  213

Query  694   ADT-FYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYP  870
             +DT    +PFLA+T DP    ENNLYPFV LN+DGNLFIF+NNRA+LLDY +N +VRTYP
Sbjct  214   SDTSVVQMPFLARTKDP---EENNLYPFVHLNIDGNLFIFSNNRAVLLDYKSNKIVRTYP  270

Query  871   EIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAK--RNIFVGALNT  1044
              +  G+PRNYPSSGS+VLLPLK    PT  AEVLVCGG+P  +Y + K     FV AL T
Sbjct  271   MLGDGDPRNYPSSGSSVLLPLK--PNPTE-AEVLVCGGAPAGSYNSTKGGAGTFVPALTT  327

Query  1045  CGRIVITDPNPEWITEEMPFPRVMGDMVILPTG-NVLIINGATNGAAGWDLGRNPAFHPV  1221
             CGRI ITD  P W+ E MP PRVMGDM++LP G  V IINGA +G AGW+  + PA+ PV
Sbjct  328   CGRIKITDAAPAWVIETMPSPRVMGDMILLPNGAEVAIINGAADGTAGWESAKTPAYAPV  387

Query  1222  LYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSM  1401
             +YRPD  PG RFE Q    + R+YHSS VL+ DGR+LV GSNPH  Y F+NV FPT+LS+
Sbjct  388   VYRPDHSPGDRFEEQTATGVARLYHSSVVLLRDGRLLVGGSNPHTYYNFSNVQFPTDLSL  447

Query  1402  EAFSPSYLDPKYAALRPEIVSPA---SQSGLSYGEVVSVQFKVSGK--------VDMSQV  1548
             EAFSP YLD     LRP I+ P+   + S ++YG  +++QF V             +  V
Sbjct  448   EAFSPEYLDASNDMLRPRILDPSPTGAPSSVAYGATMTLQFSVPASARRRRGDAAGLGDV  507

Query  1549  KVTMVSPAFSTHSFSMNQRLLVLNTVK-VKAAGEE-EYGIDVVAPDSGNLAPSGYYLLFV  1722
              VTMV+P+F+THSF+MNQRLL L+  K V   G    +   V  P +  LAP GYY++FV
Sbjct  508   SVTMVAPSFTTHSFAMNQRLLFLDVTKNVAVRGRAGTFNASVTMPATAVLAPPGYYMVFV  567

Query  1723  VHREIPSKGIWVHIQ  1767
             V+  IPS+GIWV IQ
Sbjct  568   VNGHIPSEGIWVQIQ  582



>gb|EMT01589.1| hypothetical protein F775_04099 [Aegilops tauschii]
Length=566

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/558 (56%), Positives = 381/558 (68%), Gaps = 38/558 (7%)
 Frame = +1

Query  166   AAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggg  345
             A A+  GGG+W++LQ SIG+SAMHMQLLHND+V+ FDRT+ G SN+SLPDG+C       
Sbjct  23    APASGGGGGRWDVLQRSIGVSAMHMQLLHNDRVIIFDRTDFGQSNLSLPDGRCRRNPRE-  81

Query  346   lggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVV  525
                R  P D CTAHS EYDVASN+FRP+ V +D WCSSG+V+P GTLVQTGG+ +G R V
Sbjct  82    ---RVLPVD-CTAHSAEYDVASNTFRPLFVFTDTWCSSGTVAPDGTLVQTGGWNDGYRNV  137

Query  526   RRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPK-SGPADT  702
             R    C+   CDW E    L   RWY+T+ ILPDGR  IVGGRR FNYEFFPK      +
Sbjct  138   RAMRACDGGSCDWNETQDALAANRWYATNQILPDGRAFIVGGRRQFNYEFFPKADASDAS  197

Query  703   FYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPG  882
               +LPFL QT DP    ENNLYPFV LN+DGNLFIFA NRA+LLDY  N +VRTYPE+ G
Sbjct  198   AIALPFLVQTRDP---EENNLYPFVHLNIDGNLFIFAKNRAVLLDYKKNKIVRTYPELAG  254

Query  883   GEPRNYPSSGSAVLLPLKNLKGPT-TMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIV  1059
             G+PRNYPSSGS+VLLPLK    P+ T AEVL+CGG+P  +Y + K   F  AL TCGRI 
Sbjct  255   GDPRNYPSSGSSVLLPLK----PSPTEAEVLICGGAPAGSYNSTKEKTFFPALVTCGRIK  310

Query  1060  ITDPNPEWITEEMPFPRVMGDMVILPTG-NVLIINGATNGAAGWDLGRNPAFHPVLYRPD  1236
             ITD +P W+ E M  PRVMGDM++LP G  V+IINGA +G AGW+    PA+ PV+YRPD
Sbjct  311   ITDASPAWVIERMSSPRVMGDMILLPNGAEVVIINGAMDGTAGWEAANTPAYAPVVYRPD  370

Query  1237  APPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSP  1416
               PG RFE Q+   I R+YHSSA+L+ DGRVLV GSNPH  Y F+N  +PTELS+EAFSP
Sbjct  371   HAPGDRFEEQSATDIARLYHSSAILLRDGRVLVGGSNPHIYYNFSNEQYPTELSLEAFSP  430

Query  1417  SYLDPKYAALRPEIVSPASQS---GLSYGEVVSVQFKVSG--------------KVDMSQ  1545
              YLD    ALRP+I  P+       + YG+ +++QF+V                   +  
Sbjct  431   EYLDSSNDALRPKITHPSPADPAVSVKYGDSMTLQFEVPAVAPRRRPRGGGDGDGGSLGL  490

Query  1546  VKVTMVSPAFSTHSFSMNQRLLVLN----TVKVKAAGEEEYGIDVVAPDSGNLAPSGYYL  1713
             V VTMV+P+F+THSF MNQRLL L+    T    AAG   Y   VV P +  LAP GYY+
Sbjct  491   VSVTMVAPSFTTHSFGMNQRLLFLDVAGPTALHGAAG--AYEASVVMPATAVLAPPGYYM  548

Query  1714  LFVVHREIPSKGIWVHIQ  1767
             +FVV+  IPS+G+WVHI+
Sbjct  549   VFVVNGHIPSEGVWVHIE  566



>ref|NP_001149941.1| glyoxal oxidase precursor [Zea mays]
 gb|ACG37287.1| glyoxal oxidase [Zea mays]
Length=579

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/556 (56%), Positives = 383/556 (69%), Gaps = 33/556 (6%)
 Frame = +1

Query  169   AAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHgggggl  348
             A A   GG+W+L Q SIG+SAMHMQLLHND+V+ FDRT+ G SN+SLPDG+C        
Sbjct  32    APASGAGGRWDLQQRSIGVSAMHMQLLHNDRVIIFDRTDFGHSNLSLPDGRCR----VNP  87

Query  349   ggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
               R  P  +CTAHSVEYDVA+N+FRP+ V +D WCSSG+V+P GTLVQTGG+ +G R  R
Sbjct  88    RERVLPQGDCTAHSVEYDVAANAFRPLFVFTDTWCSSGTVAPDGTLVQTGGWNDGFRNAR  147

Query  529   RFSPCNDAE--CDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADT  702
                 C+D +  CDW E    L   RWY+T+ ILPDGR  I+GGRR F+YEF+PK+GP+DT
Sbjct  148   TMPACSDGDESCDWSETQDALSANRWYATNQILPDGRAFIIGGRRQFSYEFYPKAGPSDT  207

Query  703   -FYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIP  879
                 +PFL QT DP    ENNLYPFV LN+DGNLFIF+NNRA+LLDY +N +VRTYP + 
Sbjct  208   SVIPMPFLVQTRDP---EENNLYPFVHLNIDGNLFIFSNNRAVLLDYSSNKIVRTYPVLG  264

Query  880   GGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRN-----IFVGALNT  1044
              G+PRNYPSSGS+VLLPLK    PT  AEVLVCGG+P  +Y + K+       FV AL T
Sbjct  265   DGDPRNYPSSGSSVLLPLK--PNPTE-AEVLVCGGAPAGSYNSTKQQGGTAGAFVPALTT  321

Query  1045  CGRIVITDPNPEWITEEMPFPRVMGDMVILPTG-NVLIINGATNGAAGWDLGRNPAFHPV  1221
             CGRI ITD  P W+ E MP PRVMGDM++LP G  V IINGA +G AGW+  + PA+ PV
Sbjct  322   CGRIKITDATPAWVIETMPSPRVMGDMILLPNGAEVAIINGAADGTAGWESAKTPAYAPV  381

Query  1222  LYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSM  1401
             +YRPD  PG RFE QN   + R+YHSSAVL+ DGR+LV GSNPH  Y F+NV FPT+LS+
Sbjct  382   VYRPDHSPGDRFEEQNAAGVARLYHSSAVLLRDGRLLVGGSNPHTYYNFSNVQFPTDLSL  441

Query  1402  EAFSPSYLDPKYAALRPEIVSPA---SQSGLSYGEVVSVQFKV---------SGKVDMSQ  1545
             EAFSP YLD     LRP I+ P+   + + + YG  ++++F V              +  
Sbjct  442   EAFSPEYLDASNDMLRPRILDPSPTGAPATVGYGATMAIRFLVPALARRRRGGRAGGLGD  501

Query  1546  VKVTMVSPAFSTHSFSMNQRLLVLNTVK-VKAAGEE-EYGIDVVAPDSGNLAPSGYYLLF  1719
             V VTMV+P+F+THSF+MNQRLL L+  K V   G    +   V  P +  LAP GYY+LF
Sbjct  502   VSVTMVAPSFTTHSFAMNQRLLFLDVTKNVAVRGRAGAFSASVTMPATAVLAPPGYYMLF  561

Query  1720  VVHREIPSKGIWVHIQ  1767
             VV+  IPS+GIWV IQ
Sbjct  562   VVNGHIPSEGIWVKIQ  577



>tpg|DAA44472.1| TPA: glyoxal oxidase [Zea mays]
Length=580

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/557 (56%), Positives = 383/557 (69%), Gaps = 34/557 (6%)
 Frame = +1

Query  169   AAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHgggggl  348
             A A   GG+W+L Q SIG+SAMHMQLLHND+V+ FDRT+ G SN+SLPDG+C        
Sbjct  32    APASGAGGRWDLQQRSIGVSAMHMQLLHNDRVIIFDRTDFGHSNLSLPDGRCR----VNP  87

Query  349   ggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
               R  P  +CTAHSVEYDVA+N+FRP+ V +D WCSSG+V+P GTLVQTGG+ +G R  R
Sbjct  88    RERVLPQGDCTAHSVEYDVAANAFRPLFVFTDTWCSSGTVAPDGTLVQTGGWNDGFRNAR  147

Query  529   RFSPCNDAE--CDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADT  702
                 C+D +  CDW E    L   RWY+T+ ILPDGR  I+GGRR F+YEF+PK+GP+DT
Sbjct  148   TMPACSDGDESCDWSETQDALSANRWYATNQILPDGRAFIIGGRRQFSYEFYPKAGPSDT  207

Query  703   -FYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIP  879
                 +PFL QT DP    ENNLYPFV LN+DGNLFIF+NNRA+LLDY +N +VRTYP + 
Sbjct  208   SVIPMPFLVQTRDP---EENNLYPFVHLNIDGNLFIFSNNRAVLLDYSSNKIVRTYPVLG  264

Query  880   GGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRN------IFVGALN  1041
              G+PRNYPSSGS+VLLPLK    PT  AEVLVCGG+P  +Y + K+        FV AL 
Sbjct  265   DGDPRNYPSSGSSVLLPLK--PNPTE-AEVLVCGGAPAGSYNSTKQQQGGTAGAFVPALT  321

Query  1042  TCGRIVITDPNPEWITEEMPFPRVMGDMVILPTG-NVLIINGATNGAAGWDLGRNPAFHP  1218
             TCGRI ITD  P W+ E MP PRVMGDMV+LP G  V IINGA +G AGW+  + PA+ P
Sbjct  322   TCGRIKITDAAPAWVIETMPSPRVMGDMVLLPNGAEVAIINGAADGTAGWESAKTPAYAP  381

Query  1219  VLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELS  1398
             V+YRPD  PG RFE QN   + R+YHSSAVL+ DGR+LV GSNPH  Y F+NV FPT+LS
Sbjct  382   VVYRPDHSPGDRFEEQNAAGVARLYHSSAVLLRDGRLLVGGSNPHTYYNFSNVQFPTDLS  441

Query  1399  MEAFSPSYLDPKYAALRPEIVSPA---SQSGLSYGEVVSVQFKV---------SGKVDMS  1542
             +EAFSP YLD     LRP I+ P+   + + + YG  ++++F V              + 
Sbjct  442   LEAFSPEYLDASNDMLRPRILDPSPTGAPASVGYGATMAIRFLVPALARRRRGGRAGGLG  501

Query  1543  QVKVTMVSPAFSTHSFSMNQRLLVLNTVK-VKAAGEE-EYGIDVVAPDSGNLAPSGYYLL  1716
              V VTMV+P+F+THSF+MNQRLL L+  K V   G    +   V  P +  LAP GYY+L
Sbjct  502   DVSVTMVAPSFTTHSFAMNQRLLFLDVTKNVAVRGRAGAFSASVTMPATAVLAPPGYYML  561

Query  1717  FVVHREIPSKGIWVHIQ  1767
             FVV+  IPS+GIWV IQ
Sbjct  562   FVVNGHIPSEGIWVKIQ  578



>ref|XP_003561804.1| PREDICTED: galactose oxidase-like [Brachypodium distachyon]
Length=569

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/547 (56%), Positives = 376/547 (69%), Gaps = 34/547 (6%)
 Frame = +1

Query  193   KWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPDD  372
             +W++LQ SIG+SAMHMQLL ND+V+ FDRT+ GPSN+SLPDG+C          R  P D
Sbjct  34    RWDILQHSIGVSAMHMQLLRNDRVIIFDRTDFGPSNLSLPDGRCRRNPHE----RVLPVD  89

Query  373   NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCNDA  552
              CTAHS EYDV +N+FRP+ V +D WCSSG+VSP GTLVQTGG+ +G R  R  +PC D 
Sbjct  90    -CTAHSAEYDVRTNAFRPLSVFTDTWCSSGTVSPDGTLVQTGGWNDGYRNARTMAPCVDG  148

Query  553   ECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSG--PADTFYSLPFLA  726
              CDW E    L   RWY+T+ ILPDGR  IVGGRR F+YEF+PK    P+D   +LPFL 
Sbjct  149   TCDWNETQDALAANRWYATNQILPDGRAFIVGGRRQFSYEFYPKQADHPSDAI-ALPFLV  207

Query  727   QTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYPS  906
             QT DP    ENNLYPFV LN+DGNLFIFA NRA+LLDY  N +VRTYPE+ GG+PRNYPS
Sbjct  208   QTKDP---EENNLYPFVHLNIDGNLFIFAKNRAVLLDYKRNKIVRTYPELAGGDPRNYPS  264

Query  907   SGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEWI  1086
             SGS+VLLPLK    PT  AEVLVCGG+P  +Y   K   F  AL TCGRI ITD  P W 
Sbjct  265   SGSSVLLPLK--PSPTE-AEVLVCGGAPAGSYNATKDKSFPPALTTCGRIRITDAAPSWT  321

Query  1087  TEEMPFPRVMGDMVILPTG-NVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFEL  1263
              E MP PRVMGDM++LP G  V IINGAT+G+AGW+    PA+ P++YRPD  PG RFE 
Sbjct  322   IETMPSPRVMGDMILLPNGAEVAIINGATDGSAGWESANTPAYAPLIYRPDHAPGDRFEE  381

Query  1264  QNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAA  1443
             Q+ + I R+YHSSAVL+ DGRVLV GSNPH  Y F+NV +PTELS+EAFSP YLD     
Sbjct  382   QSASGIARLYHSSAVLLRDGRVLVGGSNPHVYYNFSNVRYPTELSLEAFSPEYLDRTNDV  441

Query  1444  LRPEIVSPA---SQSGLSYGEVVSVQFKVSGKVDMSQ--------------VKVTMVSPA  1572
             LRP I  P+   + + ++YG  +++QF V      S               V VTMV+P+
Sbjct  442   LRPAITDPSPTGAPASVTYGGSMTLQFSVPAAPAPSSRRAHGGGGGGGLGFVSVTMVAPS  501

Query  1573  FSTHSFSMNQRLLVLNTVKVKAAGEE--EYGIDVVAPDSGNLAPSGYYLLFVVHREIPSK  1746
             F+THSF MNQRLL L+ ++  A+      Y + VV P +  +AP GYYL+FVV+  IPS+
Sbjct  502   FTTHSFGMNQRLLFLDVLETAASSSTPGAYEVSVVMPATAVIAPPGYYLVFVVNGHIPSE  561

Query  1747  GIWVHIQ  1767
             GIWVHI 
Sbjct  562   GIWVHID  568



>ref|XP_006838081.1| hypothetical protein AMTR_s00225p00021580 [Amborella trichopoda]
 gb|ERN00650.1| hypothetical protein AMTR_s00225p00021580 [Amborella trichopoda]
Length=546

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/537 (54%), Positives = 369/537 (69%), Gaps = 22/537 (4%)
 Frame = +1

Query  175   AVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglgg  354
             A+   G W LLQ + GISAMHM LL N KVV FDRT+ G SN+SLP G+C          
Sbjct  23    AIAQLGSWELLQENAGISAMHMALLSNGKVVMFDRTDFGKSNLSLPAGRC----------  72

Query  355   RKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTR  519
             R  P++     +CTAHS EYD  +NS RP+ V +D WCSSG+++P G L+QTGG+ +G  
Sbjct  73    RSDPNELALTLDCTAHSAEYDPVANSVRPLFVQTDVWCSSGAIAPDGRLIQTGGFNDGDH  132

Query  520   VVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPAD  699
             VVR F PC++  CDWEE P GL   RWY+T+ ILPDGR I++GGRR +NYEF+PKS    
Sbjct  133   VVRVFQPCDN--CDWEEFPSGLAARRWYATNQILPDGRIIVIGGRRQYNYEFYPKSEMTA  190

Query  700   TFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIP  879
               +   FLA+T D     ENNLYPFV L+ DGNLF+FANNR++LLDY  N +V+ +P +P
Sbjct  191   ATFLFRFLAETKD---ANENNLYPFVHLSTDGNLFVFANNRSVLLDYGGNRIVKVFPTMP  247

Query  880   GGEPRNYPSSGSAVLLPLKNLKGPTTM-AEVLVCGGSPKDAYYNAKRNIFVGALNTCGRI  1056
             GG+PRNYPSSGS+ LLPL+     + +  EVLVCGG+P  +Y  A+   FV AL+TCGRI
Sbjct  248   GGDPRNYPSSGSSTLLPLRISPELSAIPVEVLVCGGAPTGSYDQAREGQFVQALDTCGRI  307

Query  1057  VITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPD  1236
              ITDP+P+W  E MP  RVMGDMV+LPTG+VLIINGA+ G AGW+ GRNP   PVLY P 
Sbjct  308   RITDPSPQWQIETMPVARVMGDMVLLPTGDVLIINGASAGTAGWEFGRNPVLSPVLYNPV  367

Query  1237  APPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSP  1416
             AP  +RF      ++PR+YHS+A+L+ DGR+LV GSNPH  Y F+ V FPTEL +E+FSP
Sbjct  368   APSSARFRTLASTQVPRVYHSTAILLPDGRILVGGSNPHVYYNFSGVLFPTELRLESFSP  427

Query  1417  SYLDPKYAALRPEIVSPASQ-SGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFS  1593
              YL P+++ LRP I+ PAS  + + +G+   V+F V   V    + VTMV+P+F+THSFS
Sbjct  428   PYLSPQFSRLRPNIIFPASNPATIRFGQQFQVRFSVESMVGAEGITVTMVAPSFTTHSFS  487

Query  1594  MNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             MNQRLLVL    +       Y  + VAP S  LAP GYYL+FVVH+ +PS  IW  I
Sbjct  488   MNQRLLVLQNTMLTVLSPNVYQANTVAPQSPLLAPPGYYLIFVVHQGVPSSAIWSRI  544



>gb|KFK44113.1| hypothetical protein AALP_AA1G217400 [Arabis alpina]
Length=508

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/534 (56%), Positives = 367/534 (69%), Gaps = 60/534 (11%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GGKWNLL P++GI+AMHMQLL ND+VV FDRTN GPSNISLP+G C          R  
Sbjct  29    AGGKWNLLLPNVGIAAMHMQLLRNDRVVMFDRTNFGPSNISLPNGNC----------RDS  78

Query  364   PDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
             P+D     +CTAHS+EYDVASN+ RP+ V S+ WCSSGSV P G LVQTGG  +G    R
Sbjct  79    PNDIVTKLDCTAHSIEYDVASNTVRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGELKAR  138

Query  529   RFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFY  708
              FSPCN+  CDW E   GL   RWY+++HILPDG+QI+VGG+  FNYEF+PK+  +    
Sbjct  139   TFSPCNNNRCDWVEFSNGLATRRWYASNHILPDGKQIVVGGQGKFNYEFYPKTT-SQNVV  197

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
             +LPFLA+T D   G ENNLYP+V LN DGNLFIFANNRAILLDYV N VV+T+P IPGG+
Sbjct  198   ALPFLAETND--RGEENNLYPYVFLNTDGNLFIFANNRAILLDYVKNTVVKTFPAIPGGD  255

Query  889   PRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITD  1068
             PR+YP +GSAVLLPLKNL+     AE+                                 
Sbjct  256   PRSYPRTGSAVLLPLKNLEAVKIEAEL---------------------------------  282

Query  1069  PNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPG  1248
                     +MP  RVMGDM +LP G+VLIING  +G+A W+LGR P   P LY+P+ P  
Sbjct  283   -------RKMPRARVMGDMTLLPNGDVLIINGGGSGSAAWELGREPVLVPDLYQPENPVN  335

Query  1249  SRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLD  1428
             SRFE  NP  IPRMYHS+A+L+ DGRVLV GSNPHA Y FT V FPTELS+EAFSP YL+
Sbjct  336   SRFESLNPTTIPRMYHSTAILLRDGRVLVGGSNPHAFYNFTGVLFPTELSLEAFSPVYLE  395

Query  1429  PKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRL  1608
             P++A LRP+I+SP S S + Y   + +QFKV+G+V  S VKVTMV P+F+THSFSMNQRL
Sbjct  396   PEFANLRPKIMSPKSPSRIKYRTSLKLQFKVTGEVK-SPVKVTMVFPSFTTHSFSMNQRL  454

Query  1609  LVLNTVKVKAAGEE-EYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             LVL+ VK    G+   Y + V  P S N+AP GYY++FVV++ IPS+G+WV +Q
Sbjct  455   LVLDNVKFTRKGKSMTYEVQVRTPRSANIAPPGYYMIFVVNQNIPSEGVWVRLQ  508



>emb|CDY43432.1| BnaC07g14990D [Brassica napus]
Length=472

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/475 (61%), Positives = 354/475 (75%), Gaps = 14/475 (3%)
 Frame = +1

Query  373   NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCNDA  552
             +CTAHS+EYDVASN FRP+ V S+ WCSSGSV P G LVQTGG  +G    R FSPC+D 
Sbjct  2     DCTAHSIEYDVASNKFRPLTVQSNTWCSSGSVRPDGVLVQTGGDRDGALKARTFSPCDDN  61

Query  553   ECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFLAQT  732
             +CDW EI  GL + RWYS++HILPDG+QI++GGR  FNYEFFPK+   +   +LPFLA+T
Sbjct  62    QCDWVEINNGLAKRRWYSSNHILPDGKQIVIGGRGQFNYEFFPKTTSPNVI-ALPFLAET  120

Query  733   TDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYPSSG  912
             +D G   ENNLYP+V LN DG LFIFANNRAILLDYV N VV+TYP IPGG+PR+YPS+G
Sbjct  121   SDKG--EENNLYPYVFLNTDGRLFIFANNRAILLDYVKNTVVKTYPAIPGGDPRSYPSTG  178

Query  913   SAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRN-IFVGALNTCGRIVITDPNPEWIT  1089
             SAVLLPLKNL+     AEVLVCGG+PK ++  A R   FV AL+TC RI I D +P+W  
Sbjct  179   SAVLLPLKNLEADKIDAEVLVCGGAPKGSFILASRKRTFVKALDTCARIKINDEDPQWTV  238

Query  1090  EEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFELQN  1269
             E+MP  RVMGDM +LP G+VL+ING + G+A W+LGR P   P LY P+    SRFE  N
Sbjct  239   EKMPRARVMGDMTLLPNGDVLLINGGSAGSAAWELGREPVLVPDLYHPENSVNSRFESLN  298

Query  1270  PNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAALR  1449
             PN IPRMYHS+A+L+ DGRVLV GSNPHA Y FT V FPTELS+EAFSP+YL+P++A LR
Sbjct  299   PNTIPRMYHSTAILLRDGRVLVGGSNPHAFYNFTGVLFPTELSLEAFSPAYLEPEFAKLR  358

Query  1450  PEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNTVK  1629
             P+I SP SQS ++YG  + V+F+V+GKV    VKVTMV P+F++HSFSMNQRLLVL+ V+
Sbjct  359   PKIKSPKSQSTITYGMNLKVKFEVAGKVK-GPVKVTMVFPSFTSHSFSMNQRLLVLDNVR  417

Query  1630  VKAAG---------EEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             V+               Y I V  P S  +AP GYY++FVV++ IPS+GIWV +Q
Sbjct  418   VERTSSVFGALFGKSRNYEIQVRTPRSAIIAPPGYYMMFVVNQNIPSEGIWVRLQ  472



>ref|XP_009594288.1| PREDICTED: uncharacterized protein LOC104090813 [Nicotiana tomentosiformis]
Length=581

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/551 (53%), Positives = 394/551 (72%), Gaps = 22/551 (4%)
 Frame = +1

Query  136   TFHNRGFFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPD  315
             T     FFT+  +    GG+W  LQ SIG+SAMHMQLL+N+KVV FDRT+ GPSN+SLPD
Sbjct  46    TIFRPSFFTSTES----GGEWVTLQESIGVSAMHMQLLYNNKVVIFDRTDFGPSNLSLPD  101

Query  316   GKCHHggggglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQT  495
             GKC +            D +CTAHS+ YDV+SN+FRP++V +D WCSSG+V+  GTL+QT
Sbjct  102   GKCRYNDEAL-------DVDCTAHSLLYDVSSNTFRPLMVQTDVWCSSGAVNSDGTLIQT  154

Query  496   GGYGEGTRVVRRFSPCNDAE-CDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYE  672
             GGY  G   +R FSPC+D + CDW E+P  L   RWY++DHILPDGR IIVGGRRAF+YE
Sbjct  155   GGYHAGDHKIRLFSPCDDVDHCDWTELPQNLTVQRWYASDHILPDGRVIIVGGRRAFSYE  214

Query  673   FFPKSGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNV  852
             FFPK+     FY L FL +TTD     ENNLYPF+ +  DGNL+IFAN ++++LDYVNN 
Sbjct  215   FFPKNVNDSVFY-LKFLKETTDHK--EENNLYPFLYILPDGNLYIFANQKSVVLDYVNNK  271

Query  853   VVRTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTT---MAEVLVCGGSPKDAYYNAKRNI  1023
             +V+ +P IPG E R+YP++GS+V+LPL+   G +    + E+++CGG+   AY  A++ +
Sbjct  272   IVKEFPMIPG-EKRSYPATGSSVMLPLRLTTGDSAQNPVVEMMICGGASGGAYIKAQKGV  330

Query  1024  FVGALNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRN  1203
             F+ A +TCGR+ +TDP+P+W+ E MP  RVM DM++LPTG+V+I+NGA+ G AGW+   +
Sbjct  331   FMRASSTCGRMRLTDPDPKWVMEAMPMGRVMPDMLLLPTGDVIILNGASKGTAGWENAFD  390

Query  1204  PAFHPVLYRPDAP-PGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVF  1380
             P  +PVLY P+ P P  RF + NP+ IPRMYHSSA L+ DGR+LV GSNPH  Y FT V 
Sbjct  391   PVLNPVLYSPNEPDPSKRFSVLNPSTIPRMYHSSATLLPDGRILVGGSNPHVRYNFTGVR  450

Query  1381  FPTELSMEAFSPSYLDPKYAALRPEIVSPASQ-SG-LSYGEVVSVQFKVSGKVDMSQVKV  1554
             +PTELS+EAFSP YL P+ + LRP I++   Q SG LSYG+  S+ F +       ++ V
Sbjct  451   YPTELSLEAFSPPYLAPQNSYLRPSILAVEGQISGFLSYGQQFSITFTLGFYQPEEELMV  510

Query  1555  TMVSPAFSTHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHRE  1734
             +M++P+F+THSF MNQRLLVL+ ++++      Y + VVAP S N+AP GYY++FVVH+ 
Sbjct  511   SMIAPSFTTHSFGMNQRLLVLDILEIEQLSMFAYKVTVVAPPSRNIAPPGYYMIFVVHQN  570

Query  1735  IPSKGIWVHIQ  1767
             +P + +WV IQ
Sbjct  571   VPGQCVWVRIQ  581



>ref|XP_009782130.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=588

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/552 (53%), Positives = 394/552 (71%), Gaps = 22/552 (4%)
 Frame = +1

Query  136   TFHNRGFFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPD  315
             T     FFT+  +    GG+W  LQ SIG+SAMHMQLL+N+KVV FDRT+ GPSN+SLPD
Sbjct  51    TIFRPSFFTSTES----GGEWVTLQESIGVSAMHMQLLYNNKVVIFDRTDFGPSNLSLPD  106

Query  316   GKCHHggggglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQT  495
             GKC +            D +CTAHS+ YDV+SN+FRP++V +D WCSSG+V+  GTL+QT
Sbjct  107   GKCRYNDEAL-------DVDCTAHSLLYDVSSNTFRPLMVQTDVWCSSGAVNSDGTLIQT  159

Query  496   GGYGEGTRVVRRFSPCNDAE-CDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYE  672
             GGY  G   +R FSPC+D + CDW E+P  L   RWY++DHILPDGR IIVGGRRAF+YE
Sbjct  160   GGYHAGDHKIRLFSPCDDVDDCDWTELPQNLTVQRWYASDHILPDGRVIIVGGRRAFSYE  219

Query  673   FFPKS-GPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNN  849
             FFPK+    D  + L FL +TTD     ENNLYPF+ +  DGNL++FAN R+++LDYVNN
Sbjct  220   FFPKNVNNNDGVFYLQFLKETTD--FKEENNLYPFLYILPDGNLYMFANQRSVVLDYVNN  277

Query  850   VVVRTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTT---MAEVLVCGGSPKDAYYNAKRN  1020
              +V+ +P IPG E R+YP++GS+V+LPL+   G +    + EV++CGG+   AY  A++ 
Sbjct  278   RIVKEFPVIPG-EKRSYPATGSSVMLPLRLSAGDSAQNPVVEVMICGGASGGAYIKAQKG  336

Query  1021  IFVGALNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGR  1200
             +FV A +TCGR+ +TDP+P+W+ E+MP  RVM DM++LPTG+V+I+NGA+ G AGW+   
Sbjct  337   VFVRASSTCGRMRLTDPDPKWVMEDMPMGRVMPDMLLLPTGDVIILNGASKGTAGWENAF  396

Query  1201  NPAFHPVLYRPDAP-PGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNV  1377
             +P  +PVLY P+ P P  RF + NP+ IPRMYHSS  L+ DGR+LV GSNPH  Y FT V
Sbjct  397   DPVLNPVLYSPNEPDPSKRFSVLNPSTIPRMYHSSVTLLPDGRILVGGSNPHVRYNFTGV  456

Query  1378  FFPTELSMEAFSPSYLDPKYAALRPEIVSPASQ-SG-LSYGEVVSVQFKVSGKVDMSQVK  1551
              +PTELS+EAFSP YL P+ + LRP I++   Q SG LSYG+  S+ F +       ++ 
Sbjct  457   RYPTELSLEAFSPPYLAPQNSHLRPSILAVEGQISGFLSYGQQFSITFTLGFYQPEEELM  516

Query  1552  VTMVSPAFSTHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHR  1731
             V+M++P+F+THSF MNQRLLVL+ ++++      Y + VVAP S N+AP GYY++FVVH+
Sbjct  517   VSMIAPSFTTHSFGMNQRLLVLDILEIEQLSMFAYKVTVVAPPSRNIAPPGYYMIFVVHQ  576

Query  1732  EIPSKGIWVHIQ  1767
              +P + +WV IQ
Sbjct  577   NVPGQCVWVRIQ  588



>emb|CDY43429.1| BnaC07g14960D [Brassica napus]
Length=509

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/542 (55%), Positives = 362/542 (67%), Gaps = 74/542 (14%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GGKW+LL  ++GISAMHMQLL ND+VV FDRTN GPSNISLP+G C          R  
Sbjct  28    AGGKWDLLLSNVGISAMHMQLLPNDRVVMFDRTNFGPSNISLPNGNC----------RNN  77

Query  364   PDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
             P D     +CTAHS+EY+V SN+ RP+ V S+ WCSSGS+   G LVQTGG  +G    R
Sbjct  78    PQDAVSKIDCTAHSIEYNVESNTIRPLTVQSNTWCSSGSLRSDGVLVQTGGDRDGELKAR  137

Query  529   RFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFY  708
              FSPC+D ECDW EI  GL R RWYS++HILPDG+QII+GG+R FNYEFFPK+   +   
Sbjct  138   TFSPCDDNECDWVEINNGLARRRWYSSNHILPDGKQIIIGGQRQFNYEFFPKTTSPNVI-  196

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
              LPFLA+T D   G ENNLYP+V LN DGNLFIFANNRAILLDYVNN VV+TYP IPGG+
Sbjct  197   DLPFLAETND--RGEENNLYPYVFLNTDGNLFIFANNRAILLDYVNNKVVKTYPAIPGGD  254

Query  889   PRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITD  1068
             PR                                               L+TC RI I D
Sbjct  255   PR----------------------------------------------TLDTCARIKIND  268

Query  1069  PNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPG  1248
              +P+W  E+MP  RVMGDM +LP G+VL+ING + G+A W+LGR P F P LY P+ P  
Sbjct  269   EDPQWTVEKMPRARVMGDMTLLPNGDVLLINGGSAGSAAWELGREPVFVPDLYHPENPVN  328

Query  1249  SRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLD  1428
             SRFE  NPN IPRMYHS+A+L+ DGRVLV GSNPH  Y FT V FPTELS+EAFSP+YL+
Sbjct  329   SRFESLNPNTIPRMYHSTAILLRDGRVLVGGSNPHGFYNFTGVLFPTELSLEAFSPAYLE  388

Query  1429  PKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRL  1608
             P++A LRP+I SP SQS ++YG  + V+FKVSGK+    VKVTMV P+F+THSFSMNQRL
Sbjct  389   PEFAKLRPKITSPKSQSTITYGTNLKVKFKVSGKIK-GPVKVTMVFPSFTTHSFSMNQRL  447

Query  1609  LVLNTVKVKAAGE---------EEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVH  1761
             LVL+ VKVK             + Y + V  P S  +AP GYY++FVV+  +PS+GIWV 
Sbjct  448   LVLDNVKVKRTSSVFGALFGKTKHYEVQVRTPKSAIIAPPGYYMMFVVNENVPSEGIWVR  507

Query  1762  IQ  1767
             +Q
Sbjct  508   LQ  509



>ref|XP_004984953.1| PREDICTED: galactose oxidase-like [Setaria italica]
Length=575

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/560 (54%), Positives = 374/560 (67%), Gaps = 32/560 (6%)
 Frame = +1

Query  154   FFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHg  333
             + +  A A   GG+W+LLQ SIG+SAMHMQLLHND+V+ FDRT+ G SN+SLP G+C   
Sbjct  26    YASGIAPASGSGGRWDLLQRSIGVSAMHMQLLHNDRVIIFDRTDFGRSNLSLPGGRCR--  83

Query  334   gggglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEG  513
                    R  P  +CTAHS EYDVA+N+ RP+ V +D WCSSG+V+P GTLVQTGG+ +G
Sbjct  84    --VNPRERALPGGDCTAHSAEYDVAANAARPLFVFTDTWCSSGTVAPDGTLVQTGGWNDG  141

Query  514   TRVVRRFSPCNDAE---CDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPK  684
              R  R    C  ++   CDW E    L   RWY+T+ ILPDGR  I+GGRR F+YEF+PK
Sbjct  142   YRNARTMPVCGGSDGKSCDWSEKQDALAANRWYATNQILPDGRAFIIGGRRQFSYEFYPK  201

Query  685   SGPADT-FYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVR  861
             + P+DT    +PFL QT DP    ENNLYPFV LN+DGNLFIFA NRAILLDY  N V R
Sbjct  202   ADPSDTSVIQMPFLVQTRDP---EENNLYPFVHLNIDGNLFIFAKNRAILLDYKRNKVAR  258

Query  862   TYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAK--RNIFVGA  1035
             TYP +  G+PRNYPSSGS+VLLPLK    PT  AEVLVCGG+P  +Y + K     FV A
Sbjct  259   TYPVLADGDPRNYPSSGSSVLLPLK--PNPTE-AEVLVCGGAPSGSYNSTKGSARTFVPA  315

Query  1036  LNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTG-NVLIINGATNGAAGWDLGRNPAF  1212
             L TCGRI ITDP+P W+ E MP PRVMGDM++LP G  V IINGA +G AGW+    P +
Sbjct  316   LATCGRIKITDPSPAWVIETMPSPRVMGDMILLPNGAEVAIINGAADGTAGWEAAGTPNY  375

Query  1213  HPVLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTE  1392
              PV+YRPD  PG RFE Q    + R+YHSS VL+ DGR+LV GSNPH  Y F+ V FPTE
Sbjct  376   APVIYRPDRSPGDRFEEQAATGVARLYHSSVVLLRDGRLLVGGSNPHTYYNFSGVEFPTE  435

Query  1393  LSMEAFSPSYLDPKYAALRPEIVSPA---SQSGLSYGEVVSVQFKVSGK----------V  1533
             LS+EAFSP YLD     LRP I+ P+   + S +SYG  + +QF V              
Sbjct  436   LSLEAFSPEYLDQSNDMLRPRILDPSPIGAASSVSYGTTLKLQFSVPASARRRRGGAGGF  495

Query  1534  DMSQVKVTMVSPAFSTHSFSMNQRLLVLNTVKVKAAGEEE--YGIDVVAPDSGNLAPSGY  1707
              + +V VTMV+P+F+THSF+MNQRLL L   K  A       Y +    P +  LAP GY
Sbjct  496   GLGEVSVTMVAPSFTTHSFAMNQRLLFLEVGKTAAVRGRAGTYNVSATMPATAVLAPPGY  555

Query  1708  YLLFVVHREIPSKGIWVHIQ  1767
             Y++FVV+  +PS+GIWVHIQ
Sbjct  556   YMVFVVNGHVPSEGIWVHIQ  575



>emb|CDY01390.1| BnaA07g11630D [Brassica napus]
Length=509

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/542 (55%), Positives = 361/542 (67%), Gaps = 74/542 (14%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GGKW+LL  ++GISAMHMQLL ND+VV FDRTN GPSNISLP+G C          R  
Sbjct  28    AGGKWDLLLSNVGISAMHMQLLPNDRVVMFDRTNFGPSNISLPNGNC----------RNN  77

Query  364   PDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
             P D     +CTAHS+EY V SN+ RP+ V S+ WCSSGS+ P G LVQTGG  +G    R
Sbjct  78    PQDAVSKIDCTAHSIEYKVESNTIRPLTVQSNTWCSSGSLRPDGVLVQTGGDRDGELKAR  137

Query  529   RFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFY  708
              F+PC+D ECDW EI  GL R RWYS++HILPDG+QII+GG+R FNYEFFPK+   +   
Sbjct  138   TFTPCSDEECDWVEINNGLARRRWYSSNHILPDGKQIIIGGQRQFNYEFFPKTTSPNVI-  196

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
              LPFLA+T D   G ENNLYP+V LN DGNLFIFANNRAILLDYVNN VV+TYP IPGG+
Sbjct  197   DLPFLAETND--RGEENNLYPYVFLNTDGNLFIFANNRAILLDYVNNKVVKTYPAIPGGD  254

Query  889   PRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITD  1068
             PR                                               L+TC RI I D
Sbjct  255   PR----------------------------------------------TLDTCARIKIND  268

Query  1069  PNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPG  1248
              +P+W  E+MP  RVMGDM +LP G+VL+ING + G+A W+LGR P F P LY P+ P  
Sbjct  269   EDPQWTVEKMPRARVMGDMTLLPNGDVLLINGGSAGSAAWELGREPVFVPDLYHPENPVN  328

Query  1249  SRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLD  1428
             SRFE  NPN IPRMYHS+A+L+ DGRVLV GSNPH  Y FT V FPTELS+EAFSP+YL+
Sbjct  329   SRFESLNPNTIPRMYHSTAILLRDGRVLVGGSNPHGFYNFTGVLFPTELSLEAFSPAYLE  388

Query  1429  PKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRL  1608
             P++A  RP+I SP SQS ++YG  + V+FKVSGK+    VKVTMV P+F+THSFSMNQRL
Sbjct  389   PEFAKFRPKITSPKSQSTITYGTNLKVKFKVSGKIK-GPVKVTMVFPSFTTHSFSMNQRL  447

Query  1609  LVLNTVKVKAAG---------EEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVH  1761
             LVL+ VKVK             + Y + V  P S  +AP GYY++FVV+  +PS+GIWV 
Sbjct  448   LVLDNVKVKRTSSVFGALFGKSKHYEVQVRTPRSAIIAPPGYYMMFVVNENVPSEGIWVR  507

Query  1762  IQ  1767
             +Q
Sbjct  508   LQ  509



>ref|XP_004304717.1| PREDICTED: uncharacterized protein LOC101300467 [Fragaria vesca 
subsp. vesca]
Length=546

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/531 (55%), Positives = 367/531 (69%), Gaps = 21/531 (4%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G+W LLQ SIGISAMHMQLLHN+KV+ FDRT+ G SNISLP GKC          R+ P+
Sbjct  32    GQWRLLQSSIGISAMHMQLLHNNKVIMFDRTDFGASNISLPGGKC----------REDPN  81

Query  370   D-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
             D     +CTAHSV YD+  N+FRP+ + +D WCSSG+V P GTL+QTGGY +G R +R F
Sbjct  82    DTALQRDCTAHSVLYDIGQNTFRPLTIQTDPWCSSGAVLPDGTLLQTGGYNDGDRSLRTF  141

Query  535   SPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSL  714
             SPCND +CDW E P  L+  RWY+++ ILPDGR IIVGGRR +NYEF+P+   + T + L
Sbjct  142   SPCNDEKCDWNEEPNYLLTRRWYASNQILPDGRIIIVGGRRQYNYEFYPRGSSSSTIW-L  200

Query  715   PFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPR  894
               L QT D  +  ENNLYPF+ L  DGNLFIFAN +AIL DY  N VV+  PEIPG +PR
Sbjct  201   EHLRQTRDQRI--ENNLYPFLHLLPDGNLFIFANTKAILFDYKRNAVVKELPEIPGQDPR  258

Query  895   NYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPN  1074
             NYPS+GS+VLLPL     P   AE++VCGG+P+ ++  A+   F   L TCGRI +   N
Sbjct  259   NYPSTGSSVLLPLDE-NQPFLQAEIVVCGGAPRGSFVLAENGTFQKTLGTCGRINMNHAN  317

Query  1075  PEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSR  1254
             P W+ E+MP PR MGDM+ILP G+VLI+NG   G AGW+LGRNP   PV+YRP   PG R
Sbjct  318   PNWVMEDMPVPRAMGDMLILPNGDVLILNGVGLGTAGWELGRNPVTTPVIYRPSELPGRR  377

Query  1255  FELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPK  1434
             F +   +  PR+YHSSAVL+TDGRVLV GSNPH  Y FT V +PT+LS+EAFSP YL   
Sbjct  378   FRVMAESNRPRLYHSSAVLVTDGRVLVGGSNPHVGYNFTGVDYPTDLSLEAFSPPYLARD  437

Query  1435  YAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLV  1614
             Y  +RP IVS     G  Y E  SV F V   V  S V VT+V+P+F+THSF+MNQR++V
Sbjct  438   YETVRPRIVSVLENIG--YREQFSVAFAVPEYVHSSVVSVTLVAPSFTTHSFAMNQRMVV  495

Query  1615  LNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             +   +V+    + Y + V+ P +  +AP GYYLLFVVH +IPS  +WV +Q
Sbjct  496   MKLGEVRELSLDTYEVAVMGPSAKEIAPPGYYLLFVVHADIPSSAMWVKLQ  546



>ref|XP_006357288.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=570

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/529 (54%), Positives = 376/529 (71%), Gaps = 15/529 (3%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             GKW LL  SIGISAMHMQLLHN+KVV FDRT+ G SN+SLP GKC +             
Sbjct  54    GKWILLHKSIGISAMHMQLLHNNKVVIFDRTDFGSSNLSLPRGKCRYNDEAIKV------  107

Query  370   DNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCND  549
              +CTAHS+ Y+VA+N++RP++V +D WCSSG+V+  GTL+QTGGY +G R +R FSPCND
Sbjct  108   -DCTAHSILYNVATNTYRPLMVQTDVWCSSGAVNSNGTLIQTGGYHDGERKIRLFSPCND  166

Query  550   AE-CDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFLA  726
              E CDW E+   L   RWYSTDHILPDGR +I+GGR A++YEFFP++   +  + LPFL 
Sbjct  167   EETCDWTELQQNLTVKRWYSTDHILPDGRIMIIGGRNAYSYEFFPQNSNTNYVFHLPFLK  226

Query  727   QTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYPS  906
             +TTDP    ENNLYPF+ L  DGN++IFAN R+I+LDY  N VVR +P IPG E R+YP+
Sbjct  227   ETTDPK--EENNLYPFLYLLPDGNVYIFANQRSIVLDYAKNRVVREFPVIPG-EKRSYPA  283

Query  907   SGSAVLLPLKNLKGPTT-MAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEW  1083
             +GS+V+LP+K + G  + + EV+VCGG+   A+  A    F+ A  TCGRI ITDP+P+W
Sbjct  284   TGSSVMLPMKLVAGDFSPVVEVMVCGGANGGAFLQAAVGGFMPASRTCGRIKITDPDPKW  343

Query  1084  ITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAP-PGSRFE  1260
             + E+MP  RVM DM++LPTG+V+I+NGA+ G AGW+   +P  +PVLY PD P P  RF 
Sbjct  344   VMEDMPSGRVMPDMLLLPTGDVIILNGASKGTAGWESAIDPVLNPVLYEPDQPDPNKRFS  403

Query  1261  LQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYA  1440
             + NP  IPRMYHSSA L+ DGR+LV GSNPH  Y FT V +PTELS+EAF P YL P ++
Sbjct  404   VLNPTSIPRMYHSSATLLPDGRILVGGSNPHIRYNFTGVKYPTELSLEAFMPPYLSPHHS  463

Query  1441  ALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLN  1620
              LRP   +   +  +SYG+  SV F +    DM +V VTM++P+F+THSF+MNQRLL+L+
Sbjct  464   QLRPS--NTTVEGPVSYGQKFSVTFTLGVSQDMKEVMVTMIAPSFTTHSFAMNQRLLILD  521

Query  1621  TVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
              V+++        I V AP S N+AP GYY++FVVH+ +P   IWV +Q
Sbjct  522   IVEIQQLSSFTQKIMVYAPPSRNIAPLGYYMVFVVHKGVPGHSIWVKMQ  570



>gb|EYU38846.1| hypothetical protein MIMGU_mgv1a027114mg [Erythranthe guttata]
Length=479

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/518 (56%), Positives = 361/518 (70%), Gaps = 47/518 (9%)
 Frame = +1

Query  232   MHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPDDNCTAHSVEYDVAS  411
             MHMQLLH D V+ FDRT+ G SNISLP+G C          +  P D CTAHSV+YDV S
Sbjct  1     MHMQLLHTDHVIMFDRTDFGLSNISLPNGNC----IKNPRSKILPVD-CTAHSVDYDVVS  55

Query  412   NSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCNDAE-----CDWEEIP  576
             NS RP+ VL+D WCSSG+V+P GTLVQTGG+  G RVVR + PC  +      CDW+E+ 
Sbjct  56    NSIRPLTVLTDVWCSSGAVTPDGTLVQTGGFDSGDRVVRLYKPCRSSSNTTTACDWQEVG  115

Query  577   YGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFLAQTTDPGLGAE  756
              GL   RWY+T+HILPDGRQI+    +                                E
Sbjct  116   RGLTVRRWYATNHILPDGRQIVTNDAK-------------------------------IE  144

Query  757   NNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYPSSGSAVLLPLK  936
             NNLYPFV LN DGNLFIFANNRAIL +Y    V+RTYP IPGG+PR+YPS+GSAVLLPLK
Sbjct  145   NNLYPFVFLNGDGNLFIFANNRAILFNYFTGSVIRTYPTIPGGDPRSYPSTGSAVLLPLK  204

Query  937   -NLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEWITEEMPFPRV  1113
              N  G    AEVL+CGG+PK A+  A  + FV AL+TCGRI I DPNP+W+ E MP  RV
Sbjct  205   PNAAG----AEVLLCGGAPKGAFIRANNHDFVPALDTCGRIRIDDPNPQWVMETMPAGRV  260

Query  1114  MGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFELQNPNKIPRMY  1293
             MGDMV+LP G+VLI+NGA +G AGW+ G +PA  PV+YRPD P GSRF  QNP+  PRMY
Sbjct  261   MGDMVLLPNGDVLIVNGAGSGTAGWEFGADPALSPVIYRPDNPIGSRFATQNPSSTPRMY  320

Query  1294  HSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAALRPEIVSPAS  1473
             HS+A+L+ DGRVLV GSNPH  Y FT V +PT+L++E+FSPSYLDPK+  L+P +VSP  
Sbjct  321   HSTAILLRDGRVLVGGSNPHKFYNFTGVLYPTDLTLESFSPSYLDPKFGYLKPRVVSPGP  380

Query  1474  QSGLSYGEVVSVQFKV-SGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNTVKVKAAGEE  1650
             Q+ + YG+ + ++F +  G+++ + V VTMV+P+F+THSFSMNQRLLVL    +K  G+ 
Sbjct  381   QTKIGYGQKLPIRFTIPPGRLNSTSVMVTMVAPSFTTHSFSMNQRLLVLTRADLKPVGKS  440

Query  1651  EYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
              Y I V  P SGNLAP GYY+LFVVH++IPS+G+W+ I
Sbjct  441   TYQIRVDTPGSGNLAPPGYYMLFVVHQDIPSEGVWIQI  478



>emb|CDY53551.1| BnaA09g57100D [Brassica napus]
Length=561

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/536 (55%), Positives = 376/536 (70%), Gaps = 25/536 (5%)
 Frame = +1

Query  187   GGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPP  366
             GG+W+LLQPSIGISAMHMQLLHN+KVV FDRT+ GPSN+SLP   C +            
Sbjct  41    GGRWDLLQPSIGISAMHMQLLHNNKVVIFDRTDYGPSNLSLPSQTCRNATVF--------  92

Query  367   DDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCN  546
               +C+AHS+ YDVASN+FRP+ + SD WCSSGS++ +G+L+QTGGYG G RVVR F+PC+
Sbjct  93    --DCSAHSLLYDVASNTFRPLTLRSDTWCSSGSLNASGSLIQTGGYGVGERVVRIFTPCD  150

Query  547   DAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFLA  726
                CDW E    L   RWYST+ ILPDGR IIVGGRRAF YEF+PK+ P  + + L FLA
Sbjct  151   GVSCDWVENRAYLSSRRWYSTNQILPDGRIIIVGGRRAFTYEFYPKN-PGKSVFILRFLA  209

Query  727   QTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYPS  906
             +T DP    ENNLYPF+ L  DGNLFIFAN R+IL D+VN+ +V+ +P IPGG+ RNYPS
Sbjct  210   ETRDP--NEENNLYPFLHLLPDGNLFIFANRRSILFDFVNHRIVKEFPVIPGGDKRNYPS  267

Query  907   SGSAVLLPLKNLKGPTT----MAEVLVCGGSPKDAYYNAKRNI---FVGALNTCGRIVIT  1065
             +GS+VLLPL +L G        AEV+VCGG+P  A+  A R I   FVGA  TCGR+ +T
Sbjct  268   TGSSVLLPL-SLTGENNRSKIAAEVMVCGGAPPGAFLKAARTIPKVFVGASRTCGRLKVT  326

Query  1066  DPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAP-  1242
             DPNP W+ E+MP PRVM DM++LP G++LIINGA+NG AGW+   N   +P+LY PD P 
Sbjct  327   DPNPSWVMEQMPAPRVMPDMLLLPNGDILIINGASNGTAGWEDATNAVLNPILYMPDEPD  386

Query  1243  PGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSY  1422
             P  RFE+  P +IPRMYHS+++L+ DGRVL+ GSNPH  Y FT   +PTELS+EA+ P Y
Sbjct  387   PTRRFEILAPTRIPRMYHSASLLLADGRVLIGGSNPHRNYNFTARHYPTELSLEAYLPRY  446

Query  1423  LDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVS--GKVDMSQVKVTMVSPAFSTHSFSM  1596
             LDP+Y+ +RP IV+      + YG+  +V F +   G  D  +V V +V+P+FSTHS +M
Sbjct  447   LDPQYSGVRPSIVTVELAGNMLYGKSFAVTFVIPAFGMFD-GRVSVRLVAPSFSTHSTAM  505

Query  1597  NQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             NQR+LVL   +V       Y  DV  P +  +AP GYY++F+VHR  PS  IWV +
Sbjct  506   NQRMLVLRVRRVVQLSVFAYKADVDGPTNSYVAPPGYYMMFMVHRGTPSVAIWVKV  561



>ref|XP_009117902.1| PREDICTED: galactose oxidase-like [Brassica rapa]
Length=559

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/536 (55%), Positives = 376/536 (70%), Gaps = 25/536 (5%)
 Frame = +1

Query  187   GGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPP  366
             GG+W+LLQPSIGISAMHMQLLHN+KVV FDRT+ GPSN+SLP   C +            
Sbjct  39    GGRWDLLQPSIGISAMHMQLLHNNKVVIFDRTDYGPSNLSLPSQTCRNATVF--------  90

Query  367   DDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCN  546
               +C+AHS+ YDVASN+FRP+ + SD WCSSGS++ +G+L+QTGGYG G RVVR F+PC+
Sbjct  91    --DCSAHSLLYDVASNTFRPLTLRSDTWCSSGSLNASGSLIQTGGYGVGERVVRIFTPCD  148

Query  547   DAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFLA  726
                CDW E    L   RWYST+ ILPDGR IIVGGRRAF YEF+PK+ P  + + L FLA
Sbjct  149   GVSCDWVENRAYLSSRRWYSTNQILPDGRIIIVGGRRAFTYEFYPKN-PGKSVFILRFLA  207

Query  727   QTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYPS  906
             +T DP    ENNLYPF+ L  DGNLFIFAN R+IL D+VN+ +V+ +P IPGG+ RNYPS
Sbjct  208   ETRDP--NEENNLYPFLHLLPDGNLFIFANRRSILFDFVNHRIVKEFPVIPGGDKRNYPS  265

Query  907   SGSAVLLPLKNLKGPTT----MAEVLVCGGSPKDAYYNAKRNI---FVGALNTCGRIVIT  1065
             +GS+VLLPL +L G        AEV+VCGG+P  A+  A R I   FVGA  TCGR+ +T
Sbjct  266   TGSSVLLPL-SLTGENNRSKIAAEVMVCGGAPPGAFLKAARTIPKVFVGASRTCGRLKVT  324

Query  1066  DPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAP-  1242
             DPNP W+ E+MP PRVM DM++LP G++LIINGA+NG AGW+   N   +P+LY PD P 
Sbjct  325   DPNPSWVMEQMPAPRVMPDMLLLPNGDILIINGASNGTAGWEDATNAVLNPILYMPDEPD  384

Query  1243  PGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSY  1422
             P  RFE+  P +IPRMYHS+++L+ DGRVL+ GSNPH  Y FT   +PTELS+EA+ P Y
Sbjct  385   PTRRFEILAPTRIPRMYHSASLLLADGRVLIGGSNPHRNYNFTARHYPTELSLEAYLPRY  444

Query  1423  LDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVS--GKVDMSQVKVTMVSPAFSTHSFSM  1596
             LDP+Y+ +RP IV+      + YG+  +V F +   G  D  +V V +V+P+FSTHS +M
Sbjct  445   LDPQYSGVRPSIVTVELAGNMLYGKSFAVTFVIPAFGMFD-GRVSVRLVAPSFSTHSTAM  503

Query  1597  NQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             NQR+LVL   +V       Y  DV  P +  +AP GYY++F+VHR  PS  IWV +
Sbjct  504   NQRMLVLRVRRVVQLSVFAYKADVDGPTNSYVAPPGYYMMFMVHRGTPSVAIWVKV  559



>emb|CDP08591.1| unnamed protein product [Coffea canephora]
Length=548

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/540 (54%), Positives = 374/540 (69%), Gaps = 26/540 (5%)
 Frame = +1

Query  160   TAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggg  339
             T+ A A++G  +W LLQ  IGISAMHMQLLHN++V+ FDRT+ G SNISLP G+C     
Sbjct  29    TSLATAIQG--EWRLLQECIGISAMHMQLLHNNRVIMFDRTDFGNSNISLPGGRC-----  81

Query  340   gglggRKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGY  504
                  R+ P D     +CTAHSV YD+ +N+FRP++V +D WCSSG+V   GTLVQTGGY
Sbjct  82    -----RRDPHDVALKTDCTAHSVLYDIGTNNFRPLMVQTDTWCSSGAVLEDGTLVQTGGY  136

Query  505   GEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPK  684
              +G   VR+FSPC   +CDW E P  L+R RWY+T+ ILPDGR IIVGGR  FNYEF+  
Sbjct  137   NDGDHAVRKFSPCGGEDCDWVEFPNALMRRRWYATNQILPDGRIIIVGGRGQFNYEFY--  194

Query  685   SGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRT  864
             S PA   Y L FL +T D G   ENNLYPF+ L  DGNLFIFAN R+IL DY  + VVR 
Sbjct  195   SQPATVSYDLEFLKETKDEG---ENNLYPFLHLLPDGNLFIFANTRSILFDYRQSKVVRE  251

Query  865   YPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNT  1044
             +P+IPG   RNYPSSGS+VLLP+ N  GP   AE++VCGG+P  A+ +A++  F+ A +T
Sbjct  252   FPQIPGDASRNYPSSGSSVLLPI-NENGPIE-AEIMVCGGAPHGAFTSARQGYFIRASST  309

Query  1045  CGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVL  1224
             CGR+ +TD NP W  E MP  RVMGDM++LPTG+V+IINGA++G AGW+  RNP   PV+
Sbjct  310   CGRLKVTDQNPAWEMETMPMARVMGDMLLLPTGDVIIINGASSGTAGWENARNPVTRPVI  369

Query  1225  YRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSME  1404
             Y+P A   +RF +    + PRMYHSSA L+ DGRVLV GSNPH  YKFT V FPT+LS+E
Sbjct  370   YKPRAMQHNRFSVMETAQRPRMYHSSATLLIDGRVLVGGSNPHVYYKFTGVQFPTDLSLE  429

Query  1405  AFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTH  1584
             AFSP YL   +  +RP IV  A    ++Y    SV F V+  + ++ + V +++P+F+TH
Sbjct  430   AFSPPYLAQLHDPVRPRIVGMAEN--ITYQRKFSVTFSVNNFLKVASLSVRIIAPSFTTH  487

Query  1585  SFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             SFSMNQR+L+L  V+        Y I  + P S  +AP GYY+LFVVH +IPS G+WV++
Sbjct  488   SFSMNQRMLILKFVEAVNVASSTYRITAIGPSSPEIAPKGYYMLFVVHEDIPSTGMWVNV  547



>ref|XP_007030653.1| Glyoxal oxidase-related protein [Theobroma cacao]
 gb|EOY11155.1| Glyoxal oxidase-related protein [Theobroma cacao]
Length=558

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/542 (53%), Positives = 377/542 (70%), Gaps = 31/542 (6%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G W LL  S+GISAMHMQLLHN+KV+ FDRT+ GPSN+SLP G C          R  P 
Sbjct  32    GAWQLLHASVGISAMHMQLLHNNKVIIFDRTDFGPSNLSLPSGLC----------RIDPS  81

Query  370   D-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
             D     +CTAHS+ YD+++N+FRP++V +D WCSSG+V P GTLVQTGGY +G R +R F
Sbjct  82    DIVLQTDCTAHSILYDISTNAFRPLMVQTDTWCSSGAVLPNGTLVQTGGYNDGDRNIRTF  141

Query  535   SPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPK-------SGP  693
             +PC D  CDW E P  L++ RWY+++ ILPDGR IIVGGRR FNYEF+P+       S  
Sbjct  142   TPCTDEYCDWIEFPQSLLQRRWYASNQILPDGRIIIVGGRRQFNYEFYPQNIEGKSSSSS  201

Query  694   ADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPE  873
              D  + L FL +T D  +  ENNLYPF+ L  DGNLFIFAN R+ILLDY  N VV+ +P+
Sbjct  202   TDHIFGLNFLRETNDYQM--ENNLYPFLHLLPDGNLFIFANTRSILLDYNQNRVVKEFPQ  259

Query  874   IPGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGR  1053
             IPGG+PRNYPSSGS+VLLPL + +      E++VCGG+PK ++  A +  F+ A +TCGR
Sbjct  260   IPGGDPRNYPSSGSSVLLPLDD-QNEAIEPEIMVCGGAPKGSFTQATQGNFIRATSTCGR  318

Query  1054  IVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYR-  1230
             + ++  NP W+ E+MP PRVMGDM++LP+G+VLIINGA  G AGW+LGR P   P++YR 
Sbjct  319   LKVSHANPSWVMEDMPVPRVMGDMILLPSGDVLIINGAEMGTAGWELGRGPVTRPIIYRT  378

Query  1231  PDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAF  1410
              D  P  RF + +P+  PR+YHSSA L+TDGR+LV GSNPH  Y FTNV FPT+LS+E+F
Sbjct  379   SDDRPDWRFSVMSPSPRPRLYHSSATLLTDGRILVGGSNPHVFYNFTNVEFPTDLSLESF  438

Query  1411  SPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSF  1590
             SP YL P+Y  +RP+I+S   +  + YG+   + F V   +  S + V +V+P+F+THSF
Sbjct  439   SPPYLSPEYDPIRPQILSLDEK--IRYGKSFWLSFSVKDYLTASVLSVRIVAPSFTTHSF  496

Query  1591  SMNQRLLVLNTVKVKAA---GEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVH  1761
             +MNQR++VL  V V          YG+ +V P +  +AP GYYLLFV+H  IPS G+WV 
Sbjct  497   AMNQRMVVLKIVGVTTLLPPAPYAYGLSMVGPSTAAIAPPGYYLLFVLHAGIPSSGMWVK  556

Query  1762  IQ  1767
             I+
Sbjct  557   IE  558



>ref|XP_009619752.1| PREDICTED: galactose oxidase-like [Nicotiana tomentosiformis]
Length=598

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/529 (53%), Positives = 381/529 (72%), Gaps = 15/529 (3%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             GKW LLQ SIG+SAMHMQLLHN+KVV FDRT+ G SN+SLP G+C +             
Sbjct  82    GKWILLQKSIGVSAMHMQLLHNNKVVIFDRTDFGASNLSLPQGQCRYNDEAIRV------  135

Query  370   DNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPC-N  546
              +CTAHS+ YDVA+N++RP++V +D WCSSG+V+P GTL+QTGGY  G R +R FSPC N
Sbjct  136   -DCTAHSILYDVATNTYRPLMVHTDVWCSSGAVNPNGTLIQTGGYHAGERKIRLFSPCIN  194

Query  547   DAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFLA  726
             D  CDW E+P  L   RWY++DHILPDGR IIVGGRRAF+YEFFP++   +  + LPFL 
Sbjct  195   DEHCDWTELPQNLTVKRWYASDHILPDGRVIIVGGRRAFSYEFFPQNSQNNGIFYLPFLK  254

Query  727   QTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYPS  906
             +TTDP    ENNLYPF+ L  DGN++IFAN R+++LDYVNN ++R +P IP GE R YP+
Sbjct  255   ETTDPK--EENNLYPFLYLLPDGNIYIFANQRSVVLDYVNNKIIREFPLIP-GEKRTYPA  311

Query  907   SGSAVLLPLKNLKGPTT-MAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEW  1083
             +GS+V+LP+K +   ++ + EV+VCGG+   A+  A++ +F+ A  TCGR+ ITD +P W
Sbjct  312   TGSSVMLPMKLVASASSPVVEVMVCGGANGGAFTQAEKGVFLPASRTCGRMRITDLDPVW  371

Query  1084  ITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAP-PGSRFE  1260
             I E+MP  RVM DM++LPTG+V+I+NGA+ G AGW+   +P  +PVLY+P+ P P  RF 
Sbjct  372   IMEDMPMGRVMPDMLLLPTGDVIILNGASKGTAGWESAIDPVLNPVLYKPNEPDPSKRFT  431

Query  1261  LQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYA  1440
             +  P+ IPRMYHS+A L+ DGR+LV GSNPH  Y FT V +PTELS+EAF P YL P+++
Sbjct  432   VLKPSNIPRMYHSAATLLPDGRILVGGSNPHIRYNFTGVQYPTELSLEAFRPPYLAPEHS  491

Query  1441  ALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLN  1620
              LRP I++   +  +SYG+  S+ F +       ++ V+M++P+F+THSF+MNQRLL+L+
Sbjct  492   HLRPSILT--VEGPVSYGQKFSITFTLGFFQPAKELMVSMIAPSFTTHSFAMNQRLLILD  549

Query  1621  TVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
              V+V+        I V AP S N+AP GYY++FVVH+ +P    W+ +Q
Sbjct  550   VVEVQRLSLFAQKITVCAPPSRNIAPPGYYMVFVVHKGVPGHSSWIRMQ  598



>ref|XP_010652487.1| PREDICTED: galactose oxidase [Vitis vinifera]
Length=563

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/550 (53%), Positives = 375/550 (68%), Gaps = 25/550 (5%)
 Frame = +1

Query  157   FTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHgg  336
             F  +  +   GG W LL  SIGISAMHMQ+LHN+K++ FDRT+ G SN+SLPDG C    
Sbjct  26    FDISTPSSNNGGSWFLLHSSIGISAMHMQILHNNKIIIFDRTDFGASNLSLPDGHC----  81

Query  337   ggglggRKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGG  501
                   R  P+D     +CTAHS+ YDV  NS RP+++ +D WCSSGSV   GTL+QTGG
Sbjct  82    ------RSDPNDMALKVDCTAHSLLYDVLLNSIRPLMLQTDTWCSSGSVIADGTLIQTGG  135

Query  502   YGEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFP  681
             Y +G RV R F+PCND +CDW+E+P  L   RWY+++ ILPDGR I+VGGR AF+YEFFP
Sbjct  136   YNDGERVARTFTPCNDDQCDWKELPEYLSVRRWYASNQILPDGRIIVVGGRNAFSYEFFP  195

Query  682   KSGPADTF---YSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNV  852
             K+    T    Y L FL  T DP    ENNLYPF+ L  DGNLFIFAN R+I  DY  N 
Sbjct  196   KNTLNSTSQPNYYLKFLKDTRDP--KEENNLYPFLHLLPDGNLFIFANKRSISFDYTQNR  253

Query  853   VVRTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTTMA---EVLVCGGSPKDAYYNAKRNI  1023
             VV+ +P IPG + R+YPS+GS+V+LPL+   G  + +   E+LVCGG+PK +Y  A+R  
Sbjct  254   VVKEFPVIPGEDSRSYPSTGSSVMLPLRLTSGNQSQSPEVEILVCGGAPKGSYSKAERGT  313

Query  1024  FVGALNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRN  1203
             ++ A  TCGRI +TDPNP+W+ E+MP PRVM DM+ILPTG+VL+INGA+NG AGW+ GRN
Sbjct  314   YISASKTCGRIKVTDPNPKWVMEQMPMPRVMSDMIILPTGDVLLINGASNGTAGWEDGRN  373

Query  1204  PAFHPVLYRPDAP-PGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVF  1380
             P  +PVLYR  A  P  RF + NP++ PRMYHS AVL+ DGRV+V GSNPH  Y FT   
Sbjct  374   PVLNPVLYRSYASDPSQRFWVLNPSRTPRMYHSGAVLVPDGRVIVGGSNPHRVYNFTAYP  433

Query  1381  FPTELSMEAFSPSYLDPKYAALRPEIVSPAS-QSGLSYGEVVSVQFKVSGKVDMSQVKVT  1557
             +PTEL +EAFSP YL P+Y+ LRP I+S  + Q+ L Y    S+   +S  +    ++V 
Sbjct  434   YPTELGLEAFSPPYLAPRYSYLRPSILSIETPQNVLLYRGSFSISLTLSLYLRSRGIEVM  493

Query  1558  MVSPAFSTHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREI  1737
             +++P+F+THSF+MNQR +VLN   +       Y + V  P    +AP GYY+LFVVH   
Sbjct  494   IMTPSFTTHSFAMNQRAVVLNVTSMAQLSLFAYKLVVSGPQKTAIAPPGYYMLFVVHAGT  553

Query  1738  PSKGIWVHIQ  1767
             PS+G+WV +Q
Sbjct  554   PSQGVWVKVQ  563



>emb|CDX81637.1| BnaC08g39640D [Brassica napus]
Length=558

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/536 (54%), Positives = 374/536 (70%), Gaps = 25/536 (5%)
 Frame = +1

Query  187   GGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPP  366
             GG+W+LLQPS+GISAMHMQLLHN+KVV FDRT+ GPSN+SLP   C +            
Sbjct  38    GGRWDLLQPSVGISAMHMQLLHNNKVVIFDRTDYGPSNLSLPSQTCRNATVF--------  89

Query  367   DDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCN  546
               +C+AHS+ YDVASN+FRP+ + SD WCSSGS++ +G+L+QTGGYG G RVVR F+PC+
Sbjct  90    --DCSAHSLLYDVASNTFRPLTLRSDTWCSSGSLNASGSLIQTGGYGVGERVVRIFTPCD  147

Query  547   DAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFLA  726
                CDW E    L   RWYST+ ILPDGR IIVGGRRAF YEF+PK+ P  + + L FLA
Sbjct  148   GVSCDWVENRAYLSSRRWYSTNQILPDGRIIIVGGRRAFTYEFYPKN-PGKSVFILRFLA  206

Query  727   QTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYPS  906
             +T DP    ENNLYPF+ L  DGNLFIFAN R+IL D+VN+ +V+ +P IPGG+ RNYPS
Sbjct  207   ETRDP--NEENNLYPFLHLLPDGNLFIFANRRSILFDFVNHRIVKEFPVIPGGDKRNYPS  264

Query  907   SGSAVLLPLKNLKGPTT----MAEVLVCGGSPKDAYYNAKR---NIFVGALNTCGRIVIT  1065
             +GS+VLLPL +L G        AEV+VCGG+P  A+  A R    IFVGA  TCGR+ +T
Sbjct  265   TGSSVLLPL-SLTGENNRSKIAAEVMVCGGAPHGAFLKAARTIPKIFVGASRTCGRLKVT  323

Query  1066  DPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAP-  1242
             DPNP W+ E+MP PRVM DM++LP G+VLIINGA+NG AGW+       +P+LY P  P 
Sbjct  324   DPNPSWVMEQMPAPRVMPDMLLLPNGDVLIINGASNGTAGWEDATKAVLNPILYLPGEPD  383

Query  1243  PGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSY  1422
             P  RFE+  P +IPRMYHS+++L+ DGRVL+ GSNPH  Y FT   +PTELS+EA+ P Y
Sbjct  384   PTRRFEILAPTRIPRMYHSASLLLADGRVLIGGSNPHRNYNFTARHYPTELSLEAYLPRY  443

Query  1423  LDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVS--GKVDMSQVKVTMVSPAFSTHSFSM  1596
             LDP+Y+ +RP IV+      + YG+  +V F +   G  D  +V V +V+P+FSTHS +M
Sbjct  444   LDPQYSGVRPSIVTVELAGNMLYGKSFAVTFVIPAFGMFD-GRVSVRLVAPSFSTHSTAM  502

Query  1597  NQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             NQR+LVL   +V       Y  DV  P +  +AP GYY++F+VHR  PS  IWV +
Sbjct  503   NQRMLVLRVRRVVQLSVFAYKADVDGPTNSYVAPPGYYMMFMVHRGTPSVAIWVKV  558



>ref|XP_010476497.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=564

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/543 (54%), Positives = 377/543 (69%), Gaps = 28/543 (5%)
 Frame = +1

Query  175   AVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglgg  354
             A+  GG+W+LLQPS+GISAMHMQLLHN+KVV FDRT+ GPSN++LP   C +        
Sbjct  37    AILTGGRWDLLQPSVGISAMHMQLLHNNKVVIFDRTDYGPSNLTLPPHLCQNATVF----  92

Query  355   RKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
                   +C+AHS+ YDVASN+FRP+ +  D WCSSGS++ +G+L+QTGGYG G R VR F
Sbjct  93    ------DCSAHSLLYDVASNTFRPLTLRYDTWCSSGSLNASGSLIQTGGYGSGERTVRVF  146

Query  535   SPCN---DAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTF  705
             +PC+      CDW E    L   RWYST+ ILPDGR IIVGGRRAF YEF+PK+ P  + 
Sbjct  147   TPCDGVGSLSCDWVENRAYLSSRRWYSTNQILPDGRIIIVGGRRAFTYEFYPKN-PGKSV  205

Query  706   YSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGG  885
             ++L FLA+T DP    ENNLYPF+ L  DGNLFIFAN R+IL D+VN+ +++ +P IPGG
Sbjct  206   FNLRFLAETRDPN--EENNLYPFLHLLPDGNLFIFANRRSILFDFVNHRIIKEFPVIPGG  263

Query  886   EPRNYPSSGSAVLLPLKNLKGPTT----MAEVLVCGGSPKDAYYNAKR---NIFVGALNT  1044
             + RNYPS+GS+VLLPL  L G +      AEV+VCGG+P  A++ A R    IFVG   +
Sbjct  264   DKRNYPSTGSSVLLPLL-LTGESNRSKIAAEVMVCGGAPPGAFFKAARTIPKIFVGGSRS  322

Query  1045  CGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVL  1224
             CGR+ +TDPNP WI E+MP PRVMGDM++LP G+VLIINGA NG AGW+   N   +P+L
Sbjct  323   CGRLKVTDPNPRWIMEQMPSPRVMGDMLLLPNGDVLIINGAANGTAGWEDATNAVLNPIL  382

Query  1225  YRPDAP-PGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSM  1401
             Y PD P P  RFE+  P +IPRMYHS+++L++DGRVLV GSNPH  Y FT   +PTELS+
Sbjct  383   YLPDEPDPTRRFEILAPTRIPRMYHSASLLLSDGRVLVGGSNPHRNYNFTARSYPTELSL  442

Query  1402  EAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVS--GKVDMSQVKVTMVSPAF  1575
             EA+ P YLDP+Y  +RP I++      + YG+  +V F +   G  D   V V +V+P+F
Sbjct  443   EAYLPRYLDPQYVRVRPTIITVELAGNMLYGQGFAVTFAIPAFGMFD-GGVSVRLVAPSF  501

Query  1576  STHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIW  1755
             STHS +MNQR+LVL   +V       Y  DV  P +  +AP GYY++FVVHR IPS  +W
Sbjct  502   STHSTAMNQRMLVLRVRRVSQLSVFAYKADVEGPTNSYVAPPGYYMMFVVHRGIPSVAVW  561

Query  1756  VHI  1764
             V I
Sbjct  562   VKI  564



>ref|XP_008218222.1| PREDICTED: galactose oxidase [Prunus mume]
Length=553

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/535 (54%), Positives = 369/535 (69%), Gaps = 25/535 (5%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G+W+LL  SIGISAMHMQLL  + V+ FDRT+ G SNISLP  +C H           P+
Sbjct  35    GQWHLLHSSIGISAMHMQLLRTNMVIMFDRTDYGRSNISLPRRQCRHD----------PN  84

Query  370   D-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
             D     +CTAHS+ YD+ +N+ RP+ V +D WCSSG+V P GTLVQTGGY +G  VVR F
Sbjct  85    DTLLKVDCTAHSILYDIGTNTLRPLTVQTDTWCSSGAVFPDGTLVQTGGYNDGDHVVRTF  144

Query  535   SPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKS--GPADTFY  708
             +PC    CDW E P  LV+ RWY+++ ILPDGR IIVGGRR FNYEF+P+S   P  TF+
Sbjct  145   TPCTGDNCDWLEFPNYLVQRRWYASNQILPDGRIIIVGGRRQFNYEFYPRSFQNPPRTFW  204

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
              L  L QT D     ENNLYPF+ L  DGNLFIFAN ++IL +Y  NVVVR +PEIPGGE
Sbjct  205   -LDILRQTKDQD---ENNLYPFLHLLPDGNLFIFANTKSILFNYNQNVVVREFPEIPGGE  260

Query  889   PRNYPSSGSAVLLPLKNLK--GPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVI  1062
             PRNYPS+GS+VLLPL   K       AE++VCGG+P++++  A R  F+ AL TCGR+ +
Sbjct  261   PRNYPSTGSSVLLPLDENKPANVNIEAEIMVCGGAPRNSFVLASRGEFIDALGTCGRLKV  320

Query  1063  TDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAP  1242
             +D NP W+ EEMP PRVM DM++LPTG+V+IINGA  G AGW+ GR+P   PV+YRP   
Sbjct  321   SDQNPSWVMEEMPVPRVMADMLLLPTGDVVIINGAALGTAGWEYGRDPVTKPVIYRPSEN  380

Query  1243  PGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSY  1422
             P  RF +   ++ PR+YHS+AVL+ DGRVLV+GSNPH  Y FT V +PT+LS+EAFSP Y
Sbjct  381   PNRRFSVMAGSQRPRLYHSAAVLVPDGRVLVSGSNPHVYYNFTCVEYPTDLSLEAFSPPY  440

Query  1423  LDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQ  1602
                +Y   RP IVS   +  L Y +  SV F V   + +S + V +V+P+F+THSF+MNQ
Sbjct  441   TSVEYEPARPRIVS--VKEVLGYRQFFSVAFAVPELLSVSVLSVRLVAPSFTTHSFAMNQ  498

Query  1603  RLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             R++V+  + V     E Y I +V P +G +AP GYYLLFVVH +IPS   WV +Q
Sbjct  499   RMIVMKLIGVTRVAPETYEISLVGPSTGEIAPPGYYLLFVVHADIPSSAAWVKLQ  553



>ref|XP_009779182.1| PREDICTED: galactose oxidase-like [Nicotiana sylvestris]
Length=596

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/529 (53%), Positives = 379/529 (72%), Gaps = 15/529 (3%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             GKW LLQ SIG+SAMHMQLLHN+KVV FDRT+ G SN+SLP G+C +             
Sbjct  80    GKWILLQKSIGVSAMHMQLLHNNKVVIFDRTDFGASNLSLPQGQCRYNDEAIRV------  133

Query  370   DNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCN-  546
              +CTAHS+ YDVA+N++RP++V +D WCSSG+V+P GTL+QTGGY  G R +R FSPCN 
Sbjct  134   -DCTAHSILYDVATNTYRPLMVTTDVWCSSGAVNPNGTLIQTGGYHAGERKIRLFSPCNN  192

Query  547   DAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFLA  726
             D  CDW E+P  L   RWYS+DHILPDGR IIVGGRRAF+YEFFP++   +  + LPFL 
Sbjct  193   DEHCDWTELPQNLTVKRWYSSDHILPDGRVIIVGGRRAFSYEFFPQNSQNNGIFYLPFLK  252

Query  727   QTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYPS  906
             +TTDP    ENNLYPF+ L  DGN++IFAN R+I+LDYVNN ++R +P IP GE R YP+
Sbjct  253   ETTDPK--EENNLYPFLYLLPDGNIYIFANQRSIVLDYVNNKIIREFPPIP-GEKRTYPA  309

Query  907   SGSAVLLPLKNLKGPTT-MAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEW  1083
             +GS+V+LP+K +   ++ + EV+VCGG+   A+  A++ +F+ A  TCGR+ ITDP+P W
Sbjct  310   TGSSVMLPMKLVASASSPVVEVMVCGGANGGAFSQAEKGVFLPASRTCGRMRITDPDPVW  369

Query  1084  ITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGS-RFE  1260
             + E+MP  RVM DM++LPTG+V+I+NGA+ G AGW+   +P  +PVLY+P+    S RF 
Sbjct  370   VMEDMPMGRVMPDMLLLPTGDVIILNGASKGTAGWESAIDPVLNPVLYKPNELDLSKRFT  429

Query  1261  LQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYA  1440
             +  P+ IPRMYHS+A L+ DGR++V GSNPH  Y FT V +PTELS+EAF P YL P+++
Sbjct  430   VLKPSNIPRMYHSAATLLPDGRIVVGGSNPHIRYNFTGVQYPTELSLEAFRPPYLAPEHS  489

Query  1441  ALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLN  1620
              LRP I++   +  +SYG+  S+ F +       ++ V+M+ P+F+THSF+MNQRLL+L+
Sbjct  490   HLRPSILT--VEGPVSYGQKFSITFTLGFYQPAKELMVSMIPPSFTTHSFAMNQRLLILD  547

Query  1621  TVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
              V V+        I V AP S N+AP GYY++FVVHR +P    W+ +Q
Sbjct  548   VVGVQRLSLFAQKITVCAPPSRNIAPPGYYMVFVVHRGVPGHSSWIRMQ  596



>ref|XP_006471853.1| PREDICTED: galactose oxidase-like [Citrus sinensis]
 gb|KDO53324.1| hypothetical protein CISIN_1g041651mg [Citrus sinensis]
Length=557

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/535 (54%), Positives = 376/535 (70%), Gaps = 24/535 (4%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G+WNLL  SIGISAMHMQLLH+++V+ FDRT+ G SN+SL  G+C          R  P 
Sbjct  38    GEWNLLHESIGISAMHMQLLHDNRVIMFDRTDFGQSNLSLSSGRC----------RFDPY  87

Query  370   D-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
             D     +CTAHS+ YDVA+N++RP++V +D WCSSGSV P GTLVQ+GGY +G  VVR F
Sbjct  88    DTVLHTDCTAHSILYDVATNAYRPLMVQTDTWCSSGSVLPNGTLVQSGGYNDGDHVVRTF  147

Query  535   SPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTF---  705
             +PC+D +CDW E+P  L   RWY+T+ ILPDGR II+GGRR FNYEF+PKS    +F   
Sbjct  148   TPCDDDQCDWIELPQHLSERRWYATNQILPDGRIIIIGGRRQFNYEFYPKSDEDLSFPQT  207

Query  706   YSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGG  885
             + L FL +T D    AENNLYPFV L  DGNLFIFAN R+IL DY  N V++ YPEIPG 
Sbjct  208   FMLHFLLETRD---YAENNLYPFVHLLPDGNLFIFANTRSILFDYKQNKVLKEYPEIPGA  264

Query  886   EPRNYPSSGSAVLLPLKNLKGPTTM-AEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVI  1062
             +PRNYPS+GS+VLLPL    G T++ AE+++CGG+   ++  A + +F+ A++TCGR+V+
Sbjct  265   DPRNYPSTGSSVLLPLDERNGSTSVQAEIMICGGAQNASFALATQGVFIRAISTCGRLVV  324

Query  1063  TDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAP  1242
             +  NP W+ EEMP PRVMGDM++LP G+V+IINGA  G AGW+L R P   P++YRP   
Sbjct  325   SHANPSWVMEEMPLPRVMGDMILLPNGDVIIINGAQLGTAGWELARGPMTRPIIYRPSEQ  384

Query  1243  PGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSY  1422
                RF +  P+  PRMYHSSA+L+TDGRVL+ GSNPH  Y FTNV +PT+LS+EA+SP Y
Sbjct  385   TSRRFSVMEPSTRPRMYHSSAILLTDGRVLIGGSNPHIYYNFTNVVYPTDLSLEAYSPPY  444

Query  1423  LDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQ  1602
             L  +YA +RP+I+S     G  Y     V+F V   +    V V +++P+F+THSF MNQ
Sbjct  445   LSAEYATVRPKILSLNETIG--YKATFQVRFSVEEYLSAGVVSVRLIAPSFTTHSFGMNQ  502

Query  1603  RLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             R++VL  ++V       Y +  VAP +  +AP GYYLLFVVH EIPS G+WV ++
Sbjct  503   RMVVLKILEVSHVTSYVYHLAAVAPSTAEIAPPGYYLLFVVHAEIPSSGMWVKME  557



>ref|XP_004239377.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=567

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/529 (54%), Positives = 372/529 (70%), Gaps = 15/529 (3%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             GKW LL  SIGISAMHMQLLHN+KVV FDRT+ G SN+SLP  KC +             
Sbjct  51    GKWILLHKSIGISAMHMQLLHNNKVVIFDRTDFGSSNLSLPHDKCRYNDEAIKV------  104

Query  370   DNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCND  549
              +CTAHS+ Y+VA+N++RP+ V +D WCSSG+V+P GTL+QTGGY  G R +R FSPC D
Sbjct  105   -DCTAHSILYNVATNTYRPLTVQTDVWCSSGAVNPNGTLIQTGGYHAGERKIRLFSPCFD  163

Query  550   AE-CDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFLA  726
              E CDW E+   L   RWYSTDHILPDGR +I+GGR A++YEFFP+S   D  + LPFL 
Sbjct  164   EETCDWTELQQNLTVKRWYSTDHILPDGRIMIIGGRNAYSYEFFPQSSETDVVFHLPFLK  223

Query  727   QTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYPS  906
             +TTDP    ENNLYPF+ L  DGN++IFAN R+I LDY  N VVR +P IPG E R+YP+
Sbjct  224   ETTDPK--EENNLYPFLYLLPDGNVYIFANQRSISLDYAKNKVVREFPVIPG-EKRSYPA  280

Query  907   SGSAVLLPLKNLKGPTTMA-EVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEW  1083
             +GS+V+LP+K + G  + A EV+VCGG+   A+ +A    F+ A  TCGRI ITDP+P+W
Sbjct  281   TGSSVMLPMKLVAGDFSPAVEVMVCGGANGGAFLHAAVGGFMPASRTCGRIKITDPDPKW  340

Query  1084  ITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAP-PGSRFE  1260
             + E+MP  RVM DM++LPTG+V+++NGA+ G AGW+   +P  +P LY P  P P  RF 
Sbjct  341   VMEDMPSGRVMLDMLLLPTGDVILLNGASKGTAGWESAIDPVLNPFLYEPGQPDPNERFS  400

Query  1261  LQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYA  1440
             + +P  IPRMYHSSA L+ DGR+LV GSNPH  Y FT V +PTELS+EAF P YL P ++
Sbjct  401   VLDPTSIPRMYHSSATLMPDGRILVGGSNPHIRYNFTGVKYPTELSLEAFLPPYLSPHHS  460

Query  1441  ALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLN  1620
              LRP   +   +  +SYG+  S+ F +    D ++V VTMV+P+F+THSF+MNQRLL+L+
Sbjct  461   NLRPS--NTTVEGPVSYGQEFSITFTLGVSQDTNEVMVTMVAPSFTTHSFAMNQRLLILD  518

Query  1621  TVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
              VK++     +  I V AP S N+AP GYY++FVVH+ +P   IWV ++
Sbjct  519   IVKIQQVSSFDQKITVYAPPSRNIAPPGYYMVFVVHQGVPGHSIWVKME  567



>ref|XP_008221748.1| PREDICTED: galactose oxidase [Prunus mume]
Length=585

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/545 (53%), Positives = 375/545 (69%), Gaps = 15/545 (3%)
 Frame = +1

Query  163   AAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGK-CHHggg  339
             A  + V  GG+W LL  SIG+SAMHMQLL NDKV+ FDRT++GPSN S P G  C     
Sbjct  46    ATTSNVSAGGQWVLLHKSIGVSAMHMQLLKNDKVILFDRTDMGPSNFSFPSGTGCRKYND  105

Query  340   gglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTR  519
                  R   D  CTAHS++YD+ S + RP+ V SD WCSSG++ P GTL+QTGGYG G R
Sbjct  106   THHRNRTITD--CTAHSLQYDIISGNIRPLYVSSDTWCSSGALDPNGTLIQTGGYGSGIR  163

Query  520   VVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPAD  699
              +R  +PC+D +C+W E+P  L   RWY++  ILPDGR I+VGGRRAF+YEF+PK+    
Sbjct  164   KIRTVAPCDDGKCEWTELPVNLADGRWYASTQILPDGRVIVVGGRRAFSYEFYPKTDDVS  223

Query  700   T-FYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEI  876
             +  Y L FLA+TTDP    ENNLYPF+ L  DG+LFIFANNR+ILLDY  N VV+  P I
Sbjct  224   SKRYYLSFLAETTDP--YEENNLYPFLHLLPDGSLFIFANNRSILLDYKQNRVVKELPVI  281

Query  877   PGGEPRNYPSSGSAVLLPLKNLKGPTT-----MAEVLVCGGSPKDAYYNAKRN-IFVGAL  1038
             P G  R YPS+GS+VLLPLK +KG         AEVL+CGGSP  A+  +  N +FV A 
Sbjct  282   PDGIKRTYPSTGSSVLLPLK-MKGSLDGSDKPEAEVLICGGSPPGAFNMSNLNRVFVSAS  340

Query  1039  NTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHP  1218
             N+CGRI +TDPNP+W+ EEMP PRVM DM++LPTG+V+I+NGA+NG AGW+   NP F+P
Sbjct  341   NSCGRIKLTDPNPKWVMEEMPMPRVMSDMLLLPTGDVIILNGASNGTAGWEDAANPVFNP  400

Query  1219  VLYRPDAP-PGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTEL  1395
             VLY+   P P  RF + NP+  PRMYHSSA+L+ DGR+LV GSNPH  Y FT   FPT+L
Sbjct  401   VLYKTYEPDPNLRFVVLNPSSTPRMYHSSALLLPDGRILVGGSNPHEVYNFTARPFPTDL  460

Query  1396  SMEAFSPSYLDPKYAALRPEIVSPASQSGL-SYGEVVSVQFKVSGKVDMSQVKVTMVSPA  1572
             S+EA+ P YL P  AALRP I++  ++ G+ SYG++ SV F +S       + V +++P+
Sbjct  461   SLEAYQPPYLGPLLAALRPSILTIEARDGIVSYGQMFSVTFMLSVYRADPGISVVLITPS  520

Query  1573  FSTHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGI  1752
             F+THSFSMNQR++VL+  +++      Y I    P    +AP GYY+LF+VH   PS  +
Sbjct  521   FTTHSFSMNQRMVVLDVARLENLSALAYKIAAYGPPKTTVAPPGYYMLFLVHAGTPSHAV  580

Query  1753  WVHIQ  1767
             WV +Q
Sbjct  581   WVKVQ  585



>ref|XP_010458940.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=564

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/543 (54%), Positives = 377/543 (69%), Gaps = 28/543 (5%)
 Frame = +1

Query  175   AVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglgg  354
             A+  GG+W+LLQPS+GISAMHMQLLHN+KVV FDRT+ GPSN++LP   C +        
Sbjct  37    AILTGGRWDLLQPSVGISAMHMQLLHNNKVVIFDRTDYGPSNLTLPPHLCQNATVF----  92

Query  355   RKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
                   +C+AHS+ YDVASN+FRP+ +  D WCSSGS++ +G+L+QTGGYG G R VR F
Sbjct  93    ------DCSAHSLLYDVASNTFRPLTLRYDTWCSSGSLNASGSLIQTGGYGSGERTVRVF  146

Query  535   SPCN---DAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTF  705
             +PC+      CDW E    L   RWYST+ ILPDGR IIVGGRRAF+YEF+PK+ P  + 
Sbjct  147   TPCDGVGSLSCDWVENRAYLSSRRWYSTNQILPDGRIIIVGGRRAFSYEFYPKN-PGKSV  205

Query  706   YSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGG  885
             ++L FLA+T DP    ENNLYPF+ L  DGNLFIFAN R+IL D+VN+ +++ +P IPGG
Sbjct  206   FNLRFLAETRDPN--EENNLYPFLHLLPDGNLFIFANRRSILFDFVNHRIIKEFPAIPGG  263

Query  886   EPRNYPSSGSAVLLPLKNLKGPTT----MAEVLVCGGSPKDAYYNAKR---NIFVGALNT  1044
             + RNYPS+GS+VLLPL  L G +      AEV+VCGG+P  A++ A R    IFVG   +
Sbjct  264   DKRNYPSTGSSVLLPLL-LTGESNRSKIAAEVMVCGGAPPGAFFKAARTIPKIFVGGSRS  322

Query  1045  CGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVL  1224
             CGR+ +TDPNP WI E+MP PRVMGDM++LP G+VLIINGA NG AGW+   N   +PVL
Sbjct  323   CGRLKVTDPNPRWIMEQMPSPRVMGDMLLLPNGDVLIINGAANGTAGWEDATNAVLNPVL  382

Query  1225  YRPDAP-PGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSM  1401
             Y PD P P  RFE+  P +IPRMYHS+++L++DGRVLV GSNPH  Y FT   +PTELS+
Sbjct  383   YLPDEPDPTRRFEILAPTRIPRMYHSASLLLSDGRVLVGGSNPHRNYNFTASPYPTELSL  442

Query  1402  EAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVS--GKVDMSQVKVTMVSPAF  1575
             EA+ P YLDP+Y  +RP I++      +  G+  +V F +   G  D   V V +V+P+F
Sbjct  443   EAYLPRYLDPQYVRVRPTIITVELAGKMLNGQGFAVTFVIPAFGMFD-GGVSVRLVAPSF  501

Query  1576  STHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIW  1755
             STHS +MNQR+LVL   +V       Y  DV  P +  +AP GYY++FVVHR IPS  +W
Sbjct  502   STHSTAMNQRMLVLRVRRVSQLSVFAYKADVEGPTNSYVAPPGYYMMFVVHRGIPSVAVW  561

Query  1756  VHI  1764
             V I
Sbjct  562   VKI  564



>ref|XP_011071032.1| PREDICTED: galactose oxidase-like [Sesamum indicum]
Length=607

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/555 (51%), Positives = 378/555 (68%), Gaps = 26/555 (5%)
 Frame = +1

Query  130   PQTFHNRGFFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISL  309
             P T HN       +  + GGG+W+LLQ +IG+SAMHMQLL+N+KV+ FDRT+ GPSN++L
Sbjct  70    PTTSHN-------SDTMVGGGEWSLLQETIGVSAMHMQLLYNNKVLIFDRTDFGPSNLTL  122

Query  310   PDGKCHHggggglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLV  489
             P GKC H              +CTAHS+ YDVASN++RP+LV +D WCSSG+V+  GTL+
Sbjct  123   PSGKCRHSDEAV-------SQDCTAHSLLYDVASNTYRPLLVKTDVWCSSGAVNSEGTLI  175

Query  490   QTGGYGEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNY  669
             QTGGY  G   +R F PC+D +CDW E+   L   RWYS+DHILPDGR IIVGGR +F+Y
Sbjct  176   QTGGYHGGGHKIRLFRPCDDDQCDWIELHQNLTVHRWYSSDHILPDGRVIIVGGRSSFSY  235

Query  670   EFFPKSGPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNN  849
             EFFPK+   ++FY  PFL +TTD  +  ENNLYPF+ L  DGNLF+FAN R++LL+Y  N
Sbjct  236   EFFPKNTFENSFYYFPFLKETTD--MKEENNLYPFLYLLPDGNLFVFANQRSVLLNYKKN  293

Query  850   VVVRTYPEIPGGEPRNYPSSGSAVLLPLKNLKGPTT------MAEVLVCGGSPKDAYYNA  1011
              +V+ +P IP GE R YP++GS+V+LPLK   G           EV+VCGG+   AY  A
Sbjct  294   KIVKEFPVIP-GEKRTYPATGSSVMLPLKLTAGEWDDSPSHPEVEVMVCGGARGGAYMKA  352

Query  1012  KRNIFVGALNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWD  1191
                ++V A ++CGRI +TD  P+W  E+MP  RVM DM++LPTG+V+I+NGA NG AGW+
Sbjct  353   VEGLYVAASSSCGRIRVTDQEPKWEMEDMPMGRVMPDMLLLPTGDVIIVNGAANGTAGWE  412

Query  1192  LGRNPAFHPVLYRPDAP-PGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKF  1368
                NP  +PV+Y+P  P P  RF + NP KI RMYHS+A L+ DGRVLV GSNPH  Y F
Sbjct  413   CAINPVLNPVIYKPYEPDPTKRFSVLNPTKIARMYHSAATLLPDGRVLVGGSNPHVRYNF  472

Query  1369  TNVFFPTELSMEAFSPSYLDPKYAALRPEIVSPA--SQSGLSYGEVVSVQFKVSGKVDMS  1542
             T V +PTELS+EAFSP YL  ++A LRP I+S    S + +SYG+  ++ F +     + 
Sbjct  473   TGVRYPTELSLEAFSPPYLASEHAHLRPSILSTEGPSNNVISYGQQFAITFTLGMYQHVG  532

Query  1543  QVKVTMVSPAFSTHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFV  1722
             +  V M +P+F+THSF+MNQRLLVL  V        ++ + V AP + N+AP GYY+LFV
Sbjct  533   EYMVAMAAPSFTTHSFAMNQRLLVLYVVNAHQLSAFDHKVTVYAPPTANIAPPGYYMLFV  592

Query  1723  VHREIPSKGIWVHIQ  1767
             VH+ +P   +W+ I+
Sbjct  593   VHQGVPGHCVWIRIK  607



>ref|XP_010256224.1| PREDICTED: galactose oxidase [Nelumbo nucifera]
Length=554

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/534 (53%), Positives = 373/534 (70%), Gaps = 25/534 (5%)
 Frame = +1

Query  193   KWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPDD  372
             +W LL  +IG+SAMHMQLLHN+KVV FDRT+ GPSN+SLP G+C          R  P+D
Sbjct  37    QWRLLHTNIGLSAMHMQLLHNNKVVMFDRTDFGPSNLSLPPGRC----------RFDPND  86

Query  373   -----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFS  537
                  +CTAHS+ YDVA+N+ RP++V +D WCSSG++ P GTL+QTGGY +G R +R+ +
Sbjct  87    TALKIDCTAHSLLYDVATNTIRPLMVQTDTWCSSGALLPDGTLLQTGGYNDGDRAIRQLT  146

Query  538   PCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLP  717
             PCN+ ECDW E P  L   RWY+T+ ILPDGR II+GGRR F+YEF+P+   +++F+ L 
Sbjct  147   PCNNDECDWIESPGYLSAKRWYATNQILPDGRVIILGGRREFSYEFYPRGSSSNSFW-LN  205

Query  718   FLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRN  897
             FL +T D     ENNLYPF+ L  DGNLFIFAN R+I  DYV+N VVR +P I GGEPRN
Sbjct  206   FLRETRD---NDENNLYPFLHLLPDGNLFIFANTRSISFDYVHNRVVREFPPITGGEPRN  262

Query  898   YPSSGSAVLLPLKNL---KGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITD  1068
             YPSSGS+VLLPL+     +G  T AEVL+CGG+P  ++  A R  F+ A +TCGR+ +TD
Sbjct  263   YPSSGSSVLLPLQLFDENRGTGTPAEVLICGGAPAGSFSQAGRGRFIRACSTCGRLKVTD  322

Query  1069  PNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRP-DAPP  1245
              +P+WI EEMP  RVMGDM++LPTG+V+IINGA  G AGW+  R+P   PV+YR  ++  
Sbjct  323   HDPKWIMEEMPMARVMGDMLLLPTGDVIIINGACYGTAGWENARDPVTKPVIYRTYESAN  382

Query  1246  GSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYL  1425
               RF +  P+  PR+YHS+AVL+ DGR+LV GSNPH  Y+FT   +PT+LS+E+FSP YL
Sbjct  383   NQRFSVMQPSPTPRLYHSTAVLLPDGRILVGGSNPHPIYRFTGAEYPTDLSLESFSPPYL  442

Query  1426  DPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQR  1605
               ++A  RP IV  A+   L YGE+++V F V      + + VT+V+P+F+THS +MNQR
Sbjct  443   AREHAETRPTIV--ATGEVLKYGELLTVDFTVQEYQSATALSVTIVAPSFTTHSVAMNQR  500

Query  1606  LLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             L+VL    V       Y +    P S  +APSGYYLLFVVH  IPS  +WV IQ
Sbjct  501   LVVLRVADVSHISAHRYQLKAHGPPSATIAPSGYYLLFVVHAGIPSSAVWVKIQ  554



>ref|XP_010496071.1| PREDICTED: galactose oxidase-like [Camelina sativa]
Length=564

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/543 (54%), Positives = 376/543 (69%), Gaps = 28/543 (5%)
 Frame = +1

Query  175   AVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglgg  354
             A+  GG+W+LLQPS+GISAMHMQLLHN+KVV FDRT+ GPSN++LP   C +        
Sbjct  37    AILTGGRWDLLQPSVGISAMHMQLLHNNKVVIFDRTDYGPSNLTLPPHLCQNATVF----  92

Query  355   RKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
                   +C+AHS+ YDVASN+FRP+ +  D WCSSGS++ +G+L+QTGGYG G R VR F
Sbjct  93    ------DCSAHSILYDVASNTFRPLTLRYDTWCSSGSLNASGSLIQTGGYGSGERTVRVF  146

Query  535   SPCN---DAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTF  705
             +PC+      CDW E    L   RWYST+ ILPDGR IIVGGRRAF YEF+PK+ P  + 
Sbjct  147   TPCDGVGSLSCDWVENRAYLSSRRWYSTNQILPDGRIIIVGGRRAFTYEFYPKN-PGKSV  205

Query  706   YSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGG  885
             ++L FLA+T DP    ENNLYPF+ L  DGNLFIFAN R+IL D+VN+ +++ +P IPGG
Sbjct  206   FNLRFLAETRDPN--EENNLYPFLHLLPDGNLFIFANRRSILFDFVNHRIIKEFPVIPGG  263

Query  886   EPRNYPSSGSAVLLPLKNLKGPTT----MAEVLVCGGSPKDAYYNAKR---NIFVGALNT  1044
             + RNYPS+GS+VLLPL  L G +      AEV+VCGG+P  A++ A R    IFVG   +
Sbjct  264   DKRNYPSTGSSVLLPLL-LTGESNRSKIAAEVMVCGGAPPGAFFKAARTIPKIFVGGSRS  322

Query  1045  CGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVL  1224
             CGR+ +TDPNP WI E+MP PRVMGDM++LP G+VLIINGA NG AGW+   N   +PVL
Sbjct  323   CGRLKVTDPNPRWIMEQMPSPRVMGDMLLLPNGDVLIINGAANGTAGWEDATNAVLNPVL  382

Query  1225  YRPDAP-PGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSM  1401
             Y PD P P  RFE+  P +IPRMYHS+++L++DGRVLV GSNPH  Y FT   +PTELS+
Sbjct  383   YLPDEPDPTRRFEILAPTRIPRMYHSASLLLSDGRVLVGGSNPHRNYNFTASPYPTELSL  442

Query  1402  EAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVS--GKVDMSQVKVTMVSPAF  1575
             EA+ P YLDP+Y  +RP I++      +  G+  +V F +   G  D   V V +V+P+F
Sbjct  443   EAYLPRYLDPQYVRVRPTIITVELAGKMLNGQGFAVTFVIPAFGMFD-GGVSVRLVAPSF  501

Query  1576  STHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIW  1755
             STHS +MNQR+LVL   +V       Y  DV  P +  +AP GYY++FVVHR IPS  +W
Sbjct  502   STHSTAMNQRMLVLRVRRVSQLSVFAYKADVEGPTNSYVAPPGYYMMFVVHRGIPSVAVW  561

Query  1756  VHI  1764
             V I
Sbjct  562   VKI  564



>ref|XP_007208189.1| hypothetical protein PRUPE_ppa020922mg, partial [Prunus persica]
 gb|EMJ09388.1| hypothetical protein PRUPE_ppa020922mg, partial [Prunus persica]
Length=528

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/536 (54%), Positives = 373/536 (70%), Gaps = 27/536 (5%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G+W+LL  SIGISAMHMQLL  + V+ FDRT+ GPSNISLP  +C H           P+
Sbjct  10    GQWHLLHSSIGISAMHMQLLRTNMVIMFDRTDYGPSNISLPGRQCRHD----------PN  59

Query  370   D-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
             D     +CTAHS+ YD+ +N+ RP+ V +D WCSSG+V P GTLVQTGGY +G  VVR F
Sbjct  60    DTLLKVDCTAHSILYDIGTNTLRPLNVQTDTWCSSGAVFPDGTLVQTGGYNDGDHVVRTF  119

Query  535   SPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKS--GPADTFY  708
             +PC    CDW E P  LV+ RWY+++ ILPDGR IIVGGRR FNYEF+P++   P  TF+
Sbjct  120   TPCTGDNCDWLEFPNYLVQRRWYASNQILPDGRIIIVGGRRQFNYEFYPRNFQDPPRTFW  179

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
              L  L QT D     ENNLYPF+ L  DGNLFIFAN ++IL +Y  NVVVR +PEIPGGE
Sbjct  180   -LDILRQTRDQD---ENNLYPFLHLLPDGNLFIFANTKSILFNYNQNVVVREFPEIPGGE  235

Query  889   PRNYPSSGSAVLLPLKNLKGPTTM---AEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIV  1059
             PRNYPS+GS+VLLPL   K P+ +   AE++VCGG+P++++  A    F+ AL TCGR+ 
Sbjct  236   PRNYPSTGSSVLLPLDENK-PSNVNIEAEIIVCGGAPRNSFVLASGGEFIDALGTCGRLK  294

Query  1060  ITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDA  1239
             ++  NP W+ EEMP PRVM DM++LPTG+V+IINGA+ G AGW+ GR+P   PV+YRP  
Sbjct  295   VSGQNPYWVMEEMPVPRVMADMLLLPTGDVIIINGASLGTAGWEYGRDPVTKPVIYRPSE  354

Query  1240  PPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPS  1419
              P  RF +   ++ PR+YHS+AVL+ DGRVLV GSNPH  Y FT V +PT+LS+EAFSP 
Sbjct  355   KPNRRFSVMAGSQRPRLYHSAAVLVPDGRVLVGGSNPHVYYNFTCVEYPTDLSLEAFSPP  414

Query  1420  YLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMN  1599
             Y+  +Y  +RP IVS   +  L Y +  SV F V   + +S + V +V+P+F+THSF+MN
Sbjct  415   YMSVEYEPVRPRIVS--VKEVLGYRQFFSVAFAVPELLSVSVLSVRLVAPSFTTHSFAMN  472

Query  1600  QRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             QR++V+  + V     E Y I +V P +G +AP GYYLLFVVH +IPS   WV +Q
Sbjct  473   QRMIVMKLIGVTRVAPETYEISLVGPSTGEIAPPGYYLLFVVHADIPSSAAWVKLQ  528



>ref|XP_010242442.1| PREDICTED: galactose oxidase [Nelumbo nucifera]
Length=573

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/547 (54%), Positives = 377/547 (69%), Gaps = 35/547 (6%)
 Frame = +1

Query  187   GGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPP  366
             GGKW LL  SIG+SAMHMQLLHNDKV+ FDRT+ GPSN+SL  G+C          R  P
Sbjct  40    GGKWVLLHTSIGLSAMHMQLLHNDKVLMFDRTDFGPSNLSLSFGRC----------RFDP  89

Query  367   DD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRR  531
             +D     +CTAHS+ YD+ +N+FRP++V +D WCSSGSV P GTLVQTGGY +G RV+R 
Sbjct  90    NDVALNIDCTAHSLIYDIPTNTFRPLMVQTDTWCSSGSVLPNGTLVQTGGYNDGDRVIRT  149

Query  532   FSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFP-----KSGPA  696
             FSPC D  CDW E+P  L   RWY+++ ILPDGR IIVGGR+ FNYEF+P     +S P+
Sbjct  150   FSPCIDDLCDWTELPEYLSSRRWYASNQILPDGRIIIVGGRKVFNYEFYPTNLVNESAPS  209

Query  697   DTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEI  876
             +  Y L FL +T DP    ENNLYPF+ L  DGNLFIFAN R+IL  +  N V+R +P I
Sbjct  210   N--YYLSFLEETRDP--YEENNLYPFLHLLPDGNLFIFANTRSILFSHTRNRVLREFPAI  265

Query  877   PGGEPRNYPSSGSAVLLPLKNLKGPTTM---AEVLVCGGSPKDAYYNAKRNIFVGALNTC  1047
             PGG  RNYPSSGS+VLLP+    G  T    AEV+VCGG+P  A+  A+  I+VGA N+C
Sbjct  266   PGGHKRNYPSSGSSVLLPINLAGGNATQSPEAEVMVCGGAPPGAFDQAEVGIYVGASNSC  325

Query  1048  GRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLY  1227
             GR+ +TDP P+W+ EEMP  RVM DM++LPTG VLIINGA NG AGW+   NP  +PVLY
Sbjct  326   GRLKVTDPKPKWVMEEMPMGRVMSDMLLLPTGEVLIINGAANGTAGWENAINPVLNPVLY  385

Query  1228  RP-DAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFT-NVFFPTELSM  1401
                +  P  RF++ N + IPR+YHS+AVL+ DGR+LV GSNPH  Y FT +V +PTELS+
Sbjct  386   LTYEQDPSRRFKVLNGSPIPRLYHSAAVLLPDGRILVGGSNPHRLYNFTDDVRYPTELSL  445

Query  1402  EAFSPSYLDPKYAALRPEIVS---PASQSGLSYGEVVSVQFKVSGKVDMSQ---VKVTMV  1563
             EAF P YL  +YA LRP IVS     + S +SYG+  SV F +S    + Q   V VT++
Sbjct  446   EAFLPHYLAAQYALLRPLIVSVGPNGTSSSISYGQKFSVTFALSVAYRIEQDISVSVTLI  505

Query  1564  SPAFSTHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPS  1743
             +P+F+TH+F MNQRL+VLN + +       Y  D+  P + ++AP GYY+LFVV+  IPS
Sbjct  506   APSFTTHAFGMNQRLVVLNVISLLQVFTSAYQADLDGPTTSSVAPPGYYMLFVVYAGIPS  565

Query  1744  KGIWVHI  1764
              G WV I
Sbjct  566   HGFWVKI  572



>ref|XP_008389005.1| PREDICTED: galactose oxidase [Malus domestica]
Length=556

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/538 (53%), Positives = 371/538 (69%), Gaps = 29/538 (5%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G+W+LL  S+GISAMHMQLL  +KV+ FDRT+ GPSNISLP G+C          R+ P+
Sbjct  36    GQWHLLHSSVGISAMHMQLLRTNKVIMFDRTDYGPSNISLPRGQC----------RRDPN  85

Query  370   D-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
             D     +CTAHS+ YD+ SN+FRP+ V +D WCSSGS+ P GTLVQTGGY +G RVVR F
Sbjct  86    DTVLKVDCTAHSILYDLGSNTFRPLTVHTDTWCSSGSILPDGTLVQTGGYNDGDRVVRTF  145

Query  535   SPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKS-----GPAD  699
             SPCN+  CDW E+P  L++ RWY+T+ ILPDGR IIVGGRR FNYEF+P+S     GP  
Sbjct  146   SPCNNDNCDWLELPNYLIQRRWYATNQILPDGRVIIVGGRRQFNYEFYPRSSQNQGGPHT  205

Query  700   TFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIP  879
              +  L FL QTTD     ENNLYPF+ L  DGNLFIFAN ++I+ DY  N VVR  P+IP
Sbjct  206   IW--LEFLRQTTDQD---ENNLYPFLHLLPDGNLFIFANAKSIIFDYSQNAVVRELPDIP  260

Query  880   GGEPRNYPSSGSAVLLPL-KNLKGPTTM-AEVLVCGGSPKDAYYNAKRNIFVGALNTCGR  1053
             GG+PRNYPS+GS+VLLPL +N      M  E++VCGG+P++++  A    F+ AL TCGR
Sbjct  261   GGDPRNYPSTGSSVLLPLDENTPSNGNMEVEIMVCGGTPRNSHVLALHGEFISALGTCGR  320

Query  1054  IVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRP  1233
             + + DPNP W+ E MP PRVM DM++LPTG+V+IINGA  GAAGW+ GR+P   PV+YRP
Sbjct  321   LNVYDPNPRWVVEFMPVPRVMADMLLLPTGDVIIINGAALGAAGWENGRDPVTTPVIYRP  380

Query  1234  DAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFS  1413
                   RF +   +   R+YHS+AVL+ DGR+LV GSNPH  Y FT V +PT+LS+EAFS
Sbjct  381   SEVLNRRFSVMTGSSRARLYHSAAVLVPDGRILVGGSNPHIYYNFTGVEYPTDLSLEAFS  440

Query  1414  PSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFS  1593
             P YL  +Y  +RP I   A +    Y +++SV+  V   + +  +   +V+P+F+THSF+
Sbjct  441   PPYLSDEYDPVRPRIA--AIEDVFGYRQLISVEILVPEFLSVRVLSARLVAPSFTTHSFA  498

Query  1594  MNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             MNQR++VL  + V       Y + +V P +  +AP GYYLLFVVH +IPS   WV +Q
Sbjct  499   MNQRMVVLKLIGVTHVAAGTYRVSLVGPSTAEIAPPGYYLLFVVHSDIPSSAAWVRVQ  556



>gb|EYU23055.1| hypothetical protein MIMGU_mgv1a021812mg, partial [Erythranthe 
guttata]
Length=517

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/531 (54%), Positives = 360/531 (68%), Gaps = 22/531 (4%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G+W LL  SIGISAMHMQLL N+K+V FDRT+ GPSN+SLPDG+C          R  P+
Sbjct  4     GEWRLLHESIGISAMHMQLLKNNKLVIFDRTDFGPSNLSLPDGRC----------RSDPN  53

Query  370   D-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
             D     +CTAHS+ YD+ SNSFRP+ +L+D WCSSG+V P GTLVQTGG+ +G  V R  
Sbjct  54    DEVLVRDCTAHSIMYDIGSNSFRPLTILTDTWCSSGTVLPDGTLVQTGGFNDGDHVTRTL  113

Query  535   SPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSL  714
             +PC    CDW E P  L R RWY+T+ ILPDGR IIVGGR  FNYEF+P++   D    L
Sbjct  114   APCARKNCDWNEFPDSLSRRRWYATNQILPDGRIIIVGGRAQFNYEFYPRNY-GDGSIRL  172

Query  715   PFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPR  894
              FL +  D   G+ENNLYPF+ L  DGNLF+FAN R+I+LDY  + VVR +P I GG+ R
Sbjct  173   RFLKEARD---GSENNLYPFLHLLPDGNLFVFANTRSIVLDYKRHRVVREFPAIHGGDSR  229

Query  895   NYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPN  1074
             NYPSSGS+VLLP+     P  + EVL+CGG+  +AY  A +  F+ A +TCGR+ I+D +
Sbjct  230   NYPSSGSSVLLPIDENVTPVRV-EVLICGGAKNNAYEQADQGTFLRASSTCGRLRISDRH  288

Query  1075  PEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSR  1254
             P W  E MP PRVMGDMV+LP G+V+IINGA +GAAGW+ GRNP   PV+YRPD   G+R
Sbjct  289   PAWKMEAMPMPRVMGDMVLLPNGDVIIINGAGSGAAGWEAGRNPVTRPVIYRPDGGSGNR  348

Query  1255  FELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPK  1434
             F +   +  PRMYHS+AVLI DGRV V G NPH  Y F+ V FPT+LS+E+FSP YL P 
Sbjct  349   FSVMAASGRPRMYHSTAVLIPDGRVFVGGGNPHIYYNFSGVDFPTDLSLESFSPPYLSPH  408

Query  1435  YAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLV  1614
             Y  LRP IV    +  L Y     V+F+V     MS+V V +V+P F+THSFSMNQR++V
Sbjct  409   YDRLRPRIVE--IEETLGYTAPFLVRFRVPEFRRMSEVSVRIVAPPFNTHSFSMNQRMVV  466

Query  1615  LNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             L   +    G + Y +    P +  +AP GYYLLF+VH  IPS G W+ IQ
Sbjct  467   LRWDEAAYIGGDVYEVAAFGPSTAEIAPPGYYLLFLVHSGIPSSGAWIKIQ  517



>ref|NP_172895.2| glyoxal oxidase-related protein [Arabidopsis thaliana]
 gb|AAF43943.1|AC012188_20 Weak similarity to glyoxal oxidase (glx2) from Phanerochaete 
chrysosporium gb|L47287 [Arabidopsis thaliana]
 gb|AEE29162.1| glyoxal oxidase-related protein [Arabidopsis thaliana]
Length=564

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/543 (53%), Positives = 378/543 (70%), Gaps = 27/543 (5%)
 Frame = +1

Query  175   AVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglgg  354
             A+  GG+W+LLQPS+GISAMHMQLLHN+KVV FDRT+ GPSN+SLP   C +        
Sbjct  36    AILTGGRWDLLQPSVGISAMHMQLLHNNKVVIFDRTDYGPSNVSLPSQTCQNATVF----  91

Query  355   RKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
                   +C+AHS+ YDVASN+FRP+ +  D WCSSGS++ +G+L+QTGGYG G R VR F
Sbjct  92    ------DCSAHSILYDVASNTFRPLTLRYDTWCSSGSLNASGSLIQTGGYGNGERTVRVF  145

Query  535   SPCN----DAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADT  702
             +PC+       CDW E    L   RWYST+ ILPDGR IIVGGRRAFNYEF+PK  P ++
Sbjct  146   TPCDGGVGSVSCDWIENRAYLSSRRWYSTNQILPDGRIIIVGGRRAFNYEFYPKD-PGES  204

Query  703   FYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPG  882
              ++L FLA+T DP    ENNLYPF+ L  DGNLFIFAN R+IL D+VN+ +++ +P+IPG
Sbjct  205   VFNLRFLAETRDPN--EENNLYPFLHLLPDGNLFIFANRRSILFDFVNHRIIKEFPQIPG  262

Query  883   GEPRNYPSSGSAVLLPL---KNLKGPTTMAEVLVCGGSPKDAYYNAKR---NIFVGALNT  1044
             G+ RNYPS+GS+VLLPL    ++      AEV+VCGG+P  A++ A R    IFV    T
Sbjct  263   GDKRNYPSTGSSVLLPLFLTGDINRTKITAEVMVCGGAPPGAFFKAARTIPKIFVAGSRT  322

Query  1045  CGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVL  1224
             CGR+ +TDP+P+W+ E+MP PRVM DM++LP G+VLIINGA NG AGW+   N   +P+L
Sbjct  323   CGRLKVTDPDPKWVMEQMPSPRVMSDMLLLPNGDVLIINGAANGTAGWEDATNAVLNPIL  382

Query  1225  YRPDAPPGSR-FELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSM  1401
             Y P+ P  +R FE+  P +IPRMYHS+++L++DGRVLV GSNPH  Y FT   +PTELS+
Sbjct  383   YLPEEPDQTRRFEILTPTRIPRMYHSASLLLSDGRVLVGGSNPHRNYNFTARPYPTELSL  442

Query  1402  EAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVS--GKVDMSQVKVTMVSPAF  1575
             EA+ P YLDP+YA +RP I++      + YG+  +V F +   G  D   V V +V+P+F
Sbjct  443   EAYLPRYLDPQYARVRPTIITVELAGNMLYGQAFAVTFAIPAFGMFD-GGVSVRLVAPSF  501

Query  1576  STHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIW  1755
             STHS +MNQRLLVL   +V       Y  DV  P +  +AP GYY++FVVHR IPS  +W
Sbjct  502   STHSTAMNQRLLVLRVRRVSQLSVFAYKADVDGPTNSYVAPPGYYMMFVVHRGIPSVAVW  561

Query  1756  VHI  1764
             V I
Sbjct  562   VKI  564



>gb|KDP25206.1| hypothetical protein JCGZ_20362 [Jatropha curcas]
Length=545

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/545 (53%), Positives = 378/545 (69%), Gaps = 23/545 (4%)
 Frame = +1

Query  154   FFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHg  333
              F +A       G+W LL+ SIGIS+MHMQL+ NDK++ FDRT+ GPSN+SLP+GKC   
Sbjct  17    LFISAIGDPLYRGRWKLLKRSIGISSMHMQLVPNDKIITFDRTDFGPSNLSLPEGKC---  73

Query  334   gggglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEG  513
                     +  +++C AHSVE+D  + + RP+ +L+D WCSSGS+SP GTL+Q+GGYG G
Sbjct  74    ------ISESQNNDCFAHSVEFDPLNRNVRPLTILTDTWCSSGSLSPDGTLMQSGGYGLG  127

Query  514   TRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGP  693
              RVVR F PC  A+CDW E P GL+ PRWY+++ +LPDG+ I+VGGR  FNYEF PKS  
Sbjct  128   ERVVRTFKPC--ADCDWVEDPNGLISPRWYASNQVLPDGKIIVVGGRYQFNYEFIPKSSI  185

Query  694   ADT-FYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYP  870
              D   Y LPFL +T    L   NNLYPF+ L+ DGNLFIFAN+RAILLDYVNN VV+ YP
Sbjct  186   NDQKLYQLPFLKETRYSPL-IPNNLYPFLHLSPDGNLFIFANDRAILLDYVNNKVVKNYP  244

Query  871   EIPGGEPRNYPSSGSAVLLPL--KNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNT  1044
              +PGG  RNYPS+GS+VLLPL   N    +  AEV++CGG+  D+       I++ A  +
Sbjct  245   VMPGGISRNYPSTGSSVLLPLVLHNNFSSSPNAEVVICGGTLPDSNEQTNAGIYIAASKS  304

Query  1045  CGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVL  1224
             CGRI I   NP W  EEMP  RVMGDM++LPTG+VLIINGA NG AGW+  R P  +PVL
Sbjct  305   CGRIAINKENPVWEMEEMPVRRVMGDMIMLPTGDVLIINGAANGTAGWNAAREPVLNPVL  364

Query  1225  YRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSME  1404
             YRP+  P +RFEL +P+ IPR+YHS+A L++DGRVLV GSNP+  Y FT + +PTELS+E
Sbjct  365   YRPNI-PTNRFELMSPSPIPRLYHSAAHLLSDGRVLVGGSNPNRNYNFTAI-YPTELSLE  422

Query  1405  AFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQF--KVSGKVDMSQVKVTMVSPAFS  1578
             AF P YL P  +  RP I     ++ L Y +  ++ F  K    V++ ++ VTMV+P+F+
Sbjct  423   AFYPPYLSPNTS--RPAITEINPEANLRYKQKFTMGFESKTEKMVNLQKIYVTMVAPSFT  480

Query  1579  THSFSMNQRLLV--LNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGI  1752
             THSF+MNQRLLV  L+   V+  G  +Y + V  P +G LAP GYY LFVVH  +PS+G+
Sbjct  481   THSFAMNQRLLVLALDNNGVQKVGTGKYSVQVNTPVTGALAPPGYYQLFVVHEGVPSRGM  540

Query  1753  WVHIQ  1767
             WVHI+
Sbjct  541   WVHIK  545



>gb|EYU22441.1| hypothetical protein MIMGU_mgv1a024085mg [Erythranthe guttata]
Length=596

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/537 (51%), Positives = 370/537 (69%), Gaps = 16/537 (3%)
 Frame = +1

Query  169   AAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHgggggl  348
             +AA  G G+W+LLQ S+G+SAMHMQLLHN+K+V FDR + G SN+SLP GKC        
Sbjct  71    SAATPGVGEWSLLQESVGVSAMHMQLLHNNKIVIFDRADFGSSNLSLPAGKCRFDP----  126

Query  349   ggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
                +    +CTAHS+ YDV SN++RP++V +D WCSSG+V+  GTLVQTGGY +G + +R
Sbjct  127   ---RAAKHDCTAHSLLYDVDSNTYRPLMVQTDVWCSSGAVNSLGTLVQTGGYHDGYKKIR  183

Query  529   RFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFY  708
              F+PCND  CDW E+P  L   RWY +DHILPD R I+VGGRRA++YEFFP +   +  +
Sbjct  184   TFTPCNDDTCDWVELPLNLTVQRWYGSDHILPDDRVIVVGGRRAYSYEFFPNND--NRVF  241

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
               P L +TTDP    ENNLYPF+ L  DGNLF+FAN R++LLDY N+ +VR YPEIP GE
Sbjct  242   PFPLLKETTDP--KEENNLYPFLHLLPDGNLFVFANRRSLLLDYKNDRIVREYPEIP-GE  298

Query  889   PRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITD  1068
              RNYP++GS+V+LPLK         E+L+CGG+   AY  A R  F+ A  +CGRI +TD
Sbjct  299   KRNYPATGSSVMLPLKLGNSSYPTVEILICGGARGGAYLKALRGRFMAASKSCGRIRVTD  358

Query  1069  PNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAP-P  1245
             P P W+ E+MP  RVM DM++LPTG+V+I+NGA  G+AGW+ G  P   PV+Y PD P P
Sbjct  359   PEPVWVMEDMPLRRVMPDMLLLPTGDVIIVNGAARGSAGWECGDEPVLSPVMYYPDEPDP  418

Query  1246  GSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYL  1425
               RF   +P+  PRMYHS+A+L+ DGR+LV GSNPH  Y FT   +PT+LS+EA+SP YL
Sbjct  419   AKRFSALSPSTKPRMYHSAAILLPDGRILVGGSNPHVKYNFTAEKYPTDLSLEAYSPPYL  478

Query  1426  DPKYAALRPEIVS--PASQSGLSYGEVVSVQFKVSG-KVDMSQVKVTMVSPAFSTHSFSM  1596
               +YA LRP I+S      + ++YG+  ++ F + G ++   +  VTMV+P+F+THSF+M
Sbjct  479   GTEYAHLRPSILSIDGTEDNAVAYGQQFTISFSLGGFQLVPGEYLVTMVAPSFTTHSFAM  538

Query  1597  NQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             NQRLLVL     +      Y + V AP + N+AP GYY+LFVVH+ +P   +W+ + 
Sbjct  539   NQRLLVLYVSAEQQIAPFAYKVTVNAPPTANIAPPGYYMLFVVHQGVPCHSVWIKLH  595



>ref|XP_009606830.1| PREDICTED: galactose oxidase [Nicotiana tomentosiformis]
Length=556

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/529 (53%), Positives = 361/529 (68%), Gaps = 14/529 (3%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G+W LL  SIG+SAMHMQLL N+KVV FDRT+ G SN+SLP G+C +     +       
Sbjct  34    GEWRLLHESIGVSAMHMQLLRNNKVVIFDRTDFGRSNLSLPGGRCRYDSHDLVIR-----  88

Query  370   DNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCND  549
             ++C+AHSV YDV SN+FRP++V +D WCSSG+V P GTLVQTGGY +G  ++R  +PC  
Sbjct  89    EDCSAHSVLYDVGSNTFRPLMVQTDTWCSSGAVLPDGTLVQTGGYNDGDHIIRTLAPCTG  148

Query  550   AECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFLAQ  729
               CDW E P  L++ RWYSTDHILPD R I++GGR   NYEF+PK+  + + + L FL+ 
Sbjct  149   ENCDWVEFPRTLIQRRWYSTDHILPDARIIVIGGRNQHNYEFYPKNPSSFSAFWLQFLSD  208

Query  730   TTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYPSS  909
             T D     ENNLYPFV L  DGNLFIFAN RAI+LDY  N VVR  P IPG EPRNYPS+
Sbjct  209   TRDGD--NENNLYPFVFLLPDGNLFIFANTRAIILDYKKNEVVRELPSIPGNEPRNYPST  266

Query  910   GSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDP---NPE  1080
             GSAVLLPL   +     AE++VCGG+P+ A+      +++ AL++CGRI I+D    +  
Sbjct  267   GSAVLLPLD--ENSPMQAEIMVCGGAPRRAFGLTDYGVYMTALSSCGRITISDDHVNDGS  324

Query  1081  WITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFE  1260
             W  E+MP PRVM DM+ILP G++++INGA  G AGW+  RNP   PV+YRP+    +RF 
Sbjct  325   WKMEQMPTPRVMSDMLILPNGDIILINGAARGTAGWENARNPVTRPVIYRPNRAENNRFS  384

Query  1261  LQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYA  1440
             +   +  PR+YHS+A+L+TDGRVLV GSNPH  Y FT V FPT+LS+EAFSP YL P+YA
Sbjct  385   VMEASLKPRLYHSTAILLTDGRVLVGGSNPHKFYNFTGVEFPTDLSLEAFSPPYLAPEYA  444

Query  1441  ALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLN  1620
              L+P ++S      L Y +  SV F V   + M  V V +V+P+F+THSFSMNQR++VL 
Sbjct  445   PLKPTVLS--IDEILIYKQPFSVTFTVPKFLKMGIVLVRIVAPSFTTHSFSMNQRMVVLK  502

Query  1621  TVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             ++ V    +  Y      P +  +AP GYY+LFVVH  IPS G+WV IQ
Sbjct  503   SIAVSTVTDNTYRFTAFGPSTKEIAPPGYYMLFVVHAGIPSSGVWVQIQ  551



>ref|XP_002890054.1| hypothetical protein ARALYDRAFT_888820 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66313.1| hypothetical protein ARALYDRAFT_888820 [Arabidopsis lyrata subsp. 
lyrata]
Length=564

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/544 (54%), Positives = 380/544 (70%), Gaps = 29/544 (5%)
 Frame = +1

Query  175   AVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglgg  354
             A+  GG+W+LLQPS+GISAMHMQLLHN+KVV FDRT+ GPSN+SLP   C +G       
Sbjct  36    AILTGGRWDLLQPSVGISAMHMQLLHNNKVVIFDRTDYGPSNLSLPSQTCQNGTVF----  91

Query  355   RKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
                   +C+AHS+ YDVASN++RP+ +  D WCSSGS++ +G+L+QTGGYG G R VR F
Sbjct  92    ------DCSAHSILYDVASNTYRPLTLRYDTWCSSGSLNASGSLIQTGGYGAGERTVRIF  145

Query  535   SPCNDA----ECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADT  702
             +PC++      CDW E    L   RWYST+ ILPDGR IIVGGRRAF YEF+PK+ P ++
Sbjct  146   TPCDEGVGSVSCDWVENRAYLSSRRWYSTNQILPDGRIIIVGGRRAFTYEFYPKN-PGES  204

Query  703   FYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPG  882
              ++L FLA+T DP    ENNLYPF+ L  DGNLFIFAN R+IL D+VN+ +++ +P IPG
Sbjct  205   VFNLRFLAETRDPN--EENNLYPFLHLLPDGNLFIFANRRSILFDFVNHRIIKEFPVIPG  262

Query  883   GEPRNYPSSGSAVLLPLKNLKGPTT----MAEVLVCGGSPKDAYYNAKR---NIFVGALN  1041
             G+ RNYPS+GS+VLLP+  L G       MAEV+VCGG+P  A+  A R    IFVGA  
Sbjct  263   GDKRNYPSTGSSVLLPIF-LTGENNRSKIMAEVMVCGGAPPGAFLKAARTIPKIFVGASR  321

Query  1042  TCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPV  1221
             TCGR+ +TDPNP+W+ E+MP PRVM DM++LP G+VLIINGA NG AGW+   N   +P+
Sbjct  322   TCGRLKVTDPNPKWVMEQMPSPRVMSDMLLLPNGDVLIINGAANGTAGWEDATNAVLNPI  381

Query  1222  LYRPDAP-PGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELS  1398
             LY PD P P  RFE+  P +IPRMYH++++L++DGRVLV GSNPH  Y FT   +PTELS
Sbjct  382   LYLPDEPDPTRRFEILTPTRIPRMYHAASLLLSDGRVLVGGSNPHRNYNFTARPYPTELS  441

Query  1399  MEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVS--GKVDMSQVKVTMVSPA  1572
             +EA+ P YLDP+YA +RP I++      + YG+  +V F +   G  D     V +V+P+
Sbjct  442   LEAYLPRYLDPQYARVRPTIITVELAGNMLYGQAFAVTFAIPAFGMFD-GGASVRLVAPS  500

Query  1573  FSTHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGI  1752
             FSTHS +MNQRLLVL   +V       Y  DV  P +  +AP GYY++FVVHR IPS  +
Sbjct  501   FSTHSTAMNQRLLVLRVRRVSQLSVFAYKADVDGPTNSYVAPPGYYMMFVVHRGIPSVAV  560

Query  1753  WVHI  1764
             WV I
Sbjct  561   WVKI  564



>ref|XP_004237211.1| PREDICTED: galactose oxidase-like [Solanum lycopersicum]
Length=572

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/528 (54%), Positives = 373/528 (71%), Gaps = 13/528 (2%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G+W LL  SIG+SAMHMQLL+N+KV+ FDRT+ G SN+SLP GKC              D
Sbjct  56    GEWVLLHESIGVSAMHMQLLYNNKVIIFDRTDFGASNLSLPQGKCRFDDEVL-------D  108

Query  370   DNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCND  549
              +C+AHSV YD+ SN++RP++V +D WCSSG+++  GTL+QTGGY  G R +R FSPC D
Sbjct  109   VDCSAHSVLYDILSNTYRPLMVQTDVWCSSGALNSDGTLIQTGGYHTGDRKIRLFSPC-D  167

Query  550   AECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTF-YSLPFLA  726
              +CDW E+P  L   RWY++DHILPDGR IIVGGR+AF+YEFFPK+   +   + LPFL 
Sbjct  168   GDCDWTELPQNLTVQRWYASDHILPDGRVIIVGGRKAFSYEFFPKTMDENGGGFQLPFLV  227

Query  727   QTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYPS  906
             +TTDP    ENNLYPF+ +  +GNL+IF+N R+I LDYVN+ V+R +P IPG E R+YP+
Sbjct  228   ETTDPI--EENNLYPFLYILPNGNLYIFSNQRSIELDYVNHNVLREFPMIPG-EKRSYPA  284

Query  907   SGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEWI  1086
             +GS+V+LPL+  +G   + EV++CGG+   AY  A    F    ++CGR+ ITDP+P+W+
Sbjct  285   TGSSVMLPLRLRQGQEPVVEVMICGGAWGGAYVKALEGEFWRGSSSCGRMRITDPDPKWV  344

Query  1087  TEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAP-PGSRFEL  1263
              EEMP  RVM DM++LPTGNVLI+NGA NGAAGW+   +P  +PVLYRPD P P  RF +
Sbjct  345   MEEMPLGRVMPDMLLLPTGNVLILNGAANGAAGWENAIDPVLNPVLYRPDEPDPRRRFTV  404

Query  1264  QNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAA  1443
               P KI RMYHSSA+L+ DGR+LV GSNPHATY FT V +PTELS+EAFSP YL  +YA 
Sbjct  405   LTPTKIARMYHSSAILLPDGRILVGGSNPHATYNFTGVKYPTELSLEAFSPPYLATQYAH  464

Query  1444  LRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNT  1623
             LRP   +      +SY +  S+ F +      ++  V+M+ P+F+THSF MNQRLL L  
Sbjct  465   LRPLNQAIDVGQVISYDQQFSITFTLPFPQPDAEFMVSMIPPSFTTHSFGMNQRLLFLEI  524

Query  1624  VKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             V+V+      Y + V AP + N+AP GYY++FVVH+ +PS  +WV IQ
Sbjct  525   VRVERFFMFGYRVIVFAPPTRNVAPPGYYMVFVVHQGVPSHSVWVKIQ  572



>ref|XP_006344285.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=574

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/529 (53%), Positives = 373/529 (71%), Gaps = 13/529 (2%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G+W LL  SIG+SAMHMQLL+N+KV+ FDRT+ G SN+SLP GKC              D
Sbjct  56    GEWVLLHESIGVSAMHMQLLYNNKVIIFDRTDFGASNLSLPQGKCRFDDEVL-------D  108

Query  370   DNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCN-  546
              +C+AHSV YD+ SN++RP++V +D WCSSG+++  GTL+QTGGY  G R +R FSPC+ 
Sbjct  109   VDCSAHSVLYDILSNTYRPLMVQTDVWCSSGALNSDGTLIQTGGYHAGDRKIRLFSPCDG  168

Query  547   DAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADT-FYSLPFL  723
             D +CDW E+P  L   RWY++DHILPDGR IIVGGR+AF+YEFFPK+   +   + LPFL
Sbjct  169   DVDCDWTELPQNLTVQRWYASDHILPDGRVIIVGGRKAFSYEFFPKTMDDNGGVFHLPFL  228

Query  724   AQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYP  903
              +TTDP    ENNLYPF+ +  +GNL+IF+N R+I+LDYVN+ V+R +P IPG E R+YP
Sbjct  229   VETTDPM--EENNLYPFLYILPNGNLYIFSNQRSIVLDYVNHNVLREFPMIPG-EKRSYP  285

Query  904   SSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEW  1083
             ++GS+V+LPL+  +G   + EV++CGG+   AY  A    F    ++CGR+ +TDP+P+W
Sbjct  286   ATGSSVMLPLRLRQGQELVVEVMICGGAWGGAYVKALEGEFWRGSSSCGRMTLTDPDPKW  345

Query  1084  ITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAP-PGSRFE  1260
             + EEMP  RVM DM++LPTG+VLI+NGA NGAAGW+   +P  +PVLYRPD P P  RF 
Sbjct  346   VMEEMPSGRVMPDMLLLPTGDVLILNGAANGAAGWENAIDPVLNPVLYRPDEPDPRRRFT  405

Query  1261  LQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYA  1440
             +  P  I RMYHSSA+L+ DGR+LV GSNPHATY FT V +PTELS+EAFSP YL  +YA
Sbjct  406   VLTPTTIARMYHSSAILLPDGRILVGGSNPHATYNFTGVKYPTELSLEAFSPPYLATQYA  465

Query  1441  ALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLN  1620
              LRP   +      LSYG+  S+ F +      ++  V+M+ P+F+THSF MNQRLL L 
Sbjct  466   HLRPLNQAVDVGQVLSYGQQFSITFTLPFPQPDAEFMVSMIPPSFTTHSFGMNQRLLFLE  525

Query  1621  TVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
              V V+      Y + V AP + N+AP GYY++FVVH+ +P   +WV IQ
Sbjct  526   IVGVERLFMFGYRVIVFAPPTRNIAPPGYYMVFVVHQGVPGHSVWVKIQ  574



>ref|XP_009364601.1| PREDICTED: galactose oxidase [Pyrus x bretschneideri]
Length=556

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/538 (52%), Positives = 365/538 (68%), Gaps = 29/538 (5%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G+W LL  S+GISAMHMQLL  +KV+ FDRT+ GPSNISLP G+C          R+ P+
Sbjct  36    GQWRLLHSSVGISAMHMQLLRTNKVIMFDRTDYGPSNISLPRGQC----------RRDPN  85

Query  370   D-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
             D     +CTAHS+ YD+ SN+FRP+ V +D WCSSGSV P GTLVQTGGY +G RVVR F
Sbjct  86    DTVLKVDCTAHSILYDLGSNTFRPLTVHTDTWCSSGSVLPDGTLVQTGGYNDGDRVVRTF  145

Query  535   SPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKS-----GPAD  699
             SPCN+  CDW E+P  L++ RWY+T+ ILPDGR IIVGGR+ FNYEF+P+S     GP  
Sbjct  146   SPCNNDNCDWLELPNYLIQRRWYATNQILPDGRVIIVGGRQQFNYEFYPRSSQNQGGPRT  205

Query  700   TFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIP  879
              +  L FL QTTD     ENNLYPF+ L  DGNLFIFAN ++I+ DY  N +VR  P IP
Sbjct  206   IW--LEFLRQTTDQD---ENNLYPFLHLLPDGNLFIFANTKSIIFDYSQNAIVRELPNIP  260

Query  880   GGEPRNYPSSGSAVLLPL--KNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGR  1053
             GG+PRNYPS+GS+VLLPL        +   E++VCGG+P+ +Y  A    F+ AL TCGR
Sbjct  261   GGDPRNYPSTGSSVLLPLDENTPSNGSIEVEIMVCGGAPRKSYVLALHGEFINALGTCGR  320

Query  1054  IVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRP  1233
             + + DPNP W+ E MP PRVM DM++LPTG+V+IINGA  GAAGW+ GR+P   PV+YRP
Sbjct  321   LNVYDPNPRWVVELMPVPRVMADMLLLPTGDVVIINGAAQGAAGWENGRDPVTTPVIYRP  380

Query  1234  DAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFS  1413
                   RF +   +   R+YHS+AVL+ DGR+LV GSNPHA Y FT V + T+LS+EAFS
Sbjct  381   SEVLNHRFSVMIGSPRARLYHSTAVLVPDGRILVGGSNPHAYYNFTGVEYQTDLSLEAFS  440

Query  1414  PSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFS  1593
             P YL  +Y  +RP I   A    + Y +++SV+  V     +  +   +V+P+F+THSF+
Sbjct  441   PPYLSEEYDPVRPRIA--AIDVVIGYRQLISVEILVPESQSVRVLSARLVAPSFTTHSFA  498

Query  1594  MNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             MNQR+++L  + V       Y + +V P +  +AP GYYLLFVVH +IPS   WV +Q
Sbjct  499   MNQRMVILKLIGVTHVAAGTYRVSLVGPSTAEIAPPGYYLLFVVHADIPSSAAWVRVQ  556



>ref|XP_007227672.1| hypothetical protein PRUPE_ppa026498mg, partial [Prunus persica]
 gb|EMJ28871.1| hypothetical protein PRUPE_ppa026498mg, partial [Prunus persica]
Length=552

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/544 (53%), Positives = 371/544 (68%), Gaps = 13/544 (2%)
 Frame = +1

Query  163   AAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGK-CHHggg  339
             A  + V  GG+W LL  SIG+SAMHMQLL NDKV+ FDRT++G SN S P G  C     
Sbjct  13    ATTSNVSAGGQWVLLHKSIGVSAMHMQLLKNDKVILFDRTDMGLSNFSFPSGTGCRKYND  72

Query  340   gglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTR  519
                  R   D  CTAHS++YDV S + RP+ V SD WCSSG++ P GTL+QTGGYG G R
Sbjct  73    THHRNRTITD--CTAHSLQYDVISGNIRPLYVSSDTWCSSGALDPNGTLIQTGGYGPGIR  130

Query  520   VVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPAD  699
              +R  +PC+D +C+W E+P  L   RWY++  ILPDGR I+VGGRRAF+YEF+PK+    
Sbjct  131   KIRTVAPCDDGKCEWTELPVNLADGRWYASTQILPDGRVIVVGGRRAFSYEFYPKTDDVS  190

Query  700   T-FYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEI  876
             +  Y L FLA+TTDP    ENNLYPF+ L  DGNLFIFANNR+ILLDY  N VV+  P I
Sbjct  191   SKRYYLSFLAETTDP--YEENNLYPFLHLLPDGNLFIFANNRSILLDYKQNRVVKELPVI  248

Query  877   PGGEPRNYPSSGSAVLLPLK---NLKGPTT-MAEVLVCGGSPKDAYYNAKRN-IFVGALN  1041
             P G  R YPS+GS+VLLPLK   +L G     AEVL+CGGSP  A+  +  N +FV A N
Sbjct  249   PDGIKRTYPSTGSSVLLPLKMNGSLDGSDKPEAEVLICGGSPPGAFNMSNLNRVFVSASN  308

Query  1042  TCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPV  1221
             +CGRI +TDP+P+W+ EEMP PRVM DM++LPTG+V+I+NGA+NG AGW+   NP F+PV
Sbjct  309   SCGRIKLTDPDPKWVMEEMPMPRVMSDMLLLPTGDVIILNGASNGTAGWEDAANPVFNPV  368

Query  1222  LYRPDAP-PGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELS  1398
             LY+   P P  RF + NP+  PRMYHSSA+L+ DG +LV GSNPH  Y FT   FPT+LS
Sbjct  369   LYKTYEPDPNLRFVVLNPSSTPRMYHSSALLLPDGSILVGGSNPHEMYNFTARPFPTDLS  428

Query  1399  MEAFSPSYLDPKYAALRPEIVS-PASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAF  1575
             +EA+ P YL P  A LRP I++  A  S +SYG++ SV F +S       + V +++P+F
Sbjct  429   LEAYQPPYLGPLLAVLRPSILTIEARDSIVSYGQMFSVTFMLSVYRADPGISVVLITPSF  488

Query  1576  STHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIW  1755
             +THSFSMNQR++VL+  +++      Y I    P    +AP GYY+LF+VH   PS  +W
Sbjct  489   TTHSFSMNQRMVVLDVARLENLSAFAYKIAAYGPPKTTVAPPGYYMLFLVHAGTPSHAVW  548

Query  1756  VHIQ  1767
             V +Q
Sbjct  549   VKVQ  552



>gb|KDP21232.1| hypothetical protein JCGZ_21703 [Jatropha curcas]
Length=559

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/535 (52%), Positives = 363/535 (68%), Gaps = 19/535 (4%)
 Frame = +1

Query  187   GGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPP  366
             GG W LLQ SIG+SAMH+Q+L N+K++ FDRT+ G SNISLP+GKC +         KP 
Sbjct  36    GGSWVLLQESIGVSAMHIQVLKNNKIIIFDRTDFGISNISLPNGKCRYNDKYV----KPK  91

Query  367   DDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCN  546
             D  C+AHSV YD+A+NS RP+++L++ WCSSGSV   GTL+QTGG   G +V+R F+PC+
Sbjct  92    D--CSAHSVLYDIATNSVRPLMILTNTWCSSGSVDAQGTLIQTGGSSGGEKVIRSFTPCD  149

Query  547   DAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFLA  726
             D  CDW E+   L+  RWY+++ ILPDGR IIVGGRR F YEF+PK          PFL 
Sbjct  150   DDSCDWVELSIPLLSRRWYASNQILPDGRIIIVGGRRVFTYEFYPKESEISDNVLFPFLV  209

Query  727   QTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYPS  906
             QT DP    ENNLYPF+ L  DGNLFIFANNR+IL DY  N V++ YP +PGG  RN+P 
Sbjct  210   QTRDPK--EENNLYPFLHLLPDGNLFIFANNRSILFDYTRNEVLKEYPVLPGGS-RNFPC  266

Query  907   SGSAVLLPLKNLKG------PTTMAEVLVCGGSPKDAYYNA-KRNIFVGALNTCGRIVIT  1065
             +GS+VLLPL+   G      P T  E+++CGGS   AY  A   +++V A  TCGR+ ++
Sbjct  267   TGSSVLLPLRLTGGIDVNKIPET--EIMICGGSRPGAYTKAYTEHVYVEATRTCGRLKVS  324

Query  1066  DPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPP  1245
             DP PEWI E MP PRVM DM++LPTG+V+IINGA NG AGWD+  NP   PVLY P   P
Sbjct  325   DPKPEWIMELMPMPRVMNDMLLLPTGDVIIINGAANGTAGWDVAVNPVLFPVLYLPKEVP  384

Query  1246  GSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYL  1425
               RF + NP  IPRMYHS+A L+ DGR+LV GSNPHA Y FT   + TELS+EAF P YL
Sbjct  385   TRRFVVMNPTNIPRMYHSTAALLPDGRILVGGSNPHARYNFTAYPYKTELSLEAFYPPYL  444

Query  1426  DPKYAALRPEIVSPASQSG-LSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQ  1602
             DP Y   RP I++  S  G +SY E+ SV F +        + V +++P+F+THSF+MNQ
Sbjct  445   DPMYTVFRPSILTVESVEGTVSYNEMFSVTFVLKVYRSDLGISVVLIAPSFTTHSFAMNQ  504

Query  1603  RLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             R++VL T+ V+      Y ++V+ P + N+ P GYY+LF+V+  +PS  +W  ++
Sbjct  505   RMVVLKTISVEQLSAFGYKVNVIGPTNVNVVPPGYYMLFLVNAGVPSHAVWAKLK  559



>ref|XP_007039386.1| Glyoxal oxidase-related protein [Theobroma cacao]
 gb|EOY23887.1| Glyoxal oxidase-related protein [Theobroma cacao]
Length=569

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/550 (54%), Positives = 369/550 (67%), Gaps = 27/550 (5%)
 Frame = +1

Query  154   FFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHg  333
              F  A  A    GKW LL+ SIGISAMHM LL N+++V FDRT+ GPSNI+LP GKC   
Sbjct  32    LFNLALGAQTYQGKWKLLKRSIGISAMHMALLPNERIVTFDRTDFGPSNITLPQGKC---  88

Query  334   gggglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEG  513
                    +     +C AHSVE+D A+ + RP+ +LSD WCSSG++S  GTLVQ+GGY  G
Sbjct  89    ------MKDLQSSDCFAHSVEFDPATRAVRPLTILSDTWCSSGALSQDGTLVQSGGYRLG  142

Query  514   TRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGP  693
              +VVR F PC D  CDWEE   GL+ PRWY+++ ILPDG+ I+VGGR  F YEF PK+  
Sbjct  143   EKVVRYFKPCMD--CDWEEDQNGLLSPRWYASNQILPDGKIIVVGGRYQFTYEFIPKASS  200

Query  694   ADT-FYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYP  870
             +D   Y LPFL +T    L   NNLYPF+ L+ DGNLF+FAN+R ILLDYVNN V+RTYP
Sbjct  201   SDQRLYQLPFLKETRYSPL-VSNNLYPFLHLSTDGNLFVFANDRGILLDYVNNKVIRTYP  259

Query  871   EIPGGEPRNYPSSGSAVLLPLKNLKG------PTTMAEVLVCGGSPKDAYYNAKRNIFVG  1032
              +PGG   NYPS+GS+VLLPLK L         T  AEVL+CGG+P D+   A   IFV 
Sbjct  260   VMPGGFSHNYPSTGSSVLLPLKLLSTDNENNTSTPDAEVLICGGTPPDSNEKANIGIFVP  319

Query  1033  ALNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAF  1212
             A   CGR++IT  +PEW  EEMP  RVMGDM++LPTG+VLIINGA  G+AGW + R P  
Sbjct  320   ASRYCGRLIITAASPEWEMEEMPINRVMGDMIMLPTGDVLIINGAAKGSAGWGVARKPVL  379

Query  1213  HPVLYRPDAPPGS----RFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVF  1380
             +PVLYRP   P S    RFE+ +P+ IPR+YHS+A L++DGRVLV GSNP+  Y F+   
Sbjct  380   NPVLYRPADNPSSDKNTRFEVLSPSMIPRLYHSTAQLLSDGRVLVGGSNPNMNYNFS-AL  438

Query  1381  FPTELSMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTM  1560
             +PTELS+EAF P YL       RP I++      L Y + VS++F + G V+   V VTM
Sbjct  439   YPTELSLEAFYPPYLSSTKP--RPSILAVRPGLKLGYKQKVSLEFTLEGNVNQGDVYVTM  496

Query  1561  VSPAFSTHSFSMNQRLLVLNTVK-VKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREI  1737
             V+P+F+THS +MNQRLLVL   + VK      Y +   AP++  LAP GYY LF+VH  I
Sbjct  497   VAPSFTTHSIAMNQRLLVLALDEGVKKTPSGNYLVKGYAPETAALAPPGYYQLFLVHEGI  556

Query  1738  PSKGIWVHIQ  1767
             PSKG WVHI+
Sbjct  557   PSKGTWVHIK  566



>ref|XP_009801814.1| PREDICTED: galactose oxidase [Nicotiana sylvestris]
Length=560

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/536 (51%), Positives = 362/536 (68%), Gaps = 18/536 (3%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G+W LL  SIG+SAMHMQLL N+KVV FDRT+ G SN+SLP G+C +     +       
Sbjct  34    GEWRLLHESIGVSAMHMQLLRNNKVVIFDRTDFGRSNLSLPGGRCRYDSHDLVI-----S  88

Query  370   DNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCND  549
             ++C+AHSV YDV SN+FRP++V +D WCSSG+V P GTLVQTGGY +G  ++R  +PC  
Sbjct  89    EDCSAHSVLYDVGSNTFRPLMVQTDTWCSSGAVLPDGTLVQTGGYNDGDHIIRTLAPCTG  148

Query  550   AECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPAD----TFYSLP  717
               CDW E+P  L++ RWYSTDHILPD R I++GGR   NYEF+PK+   D    + + L 
Sbjct  149   KNCDWVELPRTLIQRRWYSTDHILPDARIIVIGGRNQHNYEFYPKNSRDDPSSFSAFWLQ  208

Query  718   FLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRN  897
             FL+ T D     ENNLYPFV L  DGNLFIFAN R I+LDY  + VVR  P IPG EPRN
Sbjct  209   FLSDTRDGD--NENNLYPFVFLLPDGNLFIFANTRTIILDYKKHEVVRELPSIPGNEPRN  266

Query  898   YPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITD---  1068
             YPS+GSAVLLPL   +     AE++VCGG+P+ A+      +++ AL++CGRI I+D   
Sbjct  267   YPSTGSAVLLPLD--ENRPMQAEIMVCGGAPRRAFGLTDYGVYMTALSSCGRITISDDHV  324

Query  1069  PNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPG  1248
              +  W  E+MP PRVM DM+ILP+G++++INGA  G AGW+  RNP   P++YRP+    
Sbjct  325   SDSSWKMEQMPTPRVMSDMLILPSGDIILINGAARGTAGWENARNPVTRPMIYRPNRAEN  384

Query  1249  SRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLD  1428
             +RF +   +  PR+YHS+A+L+TDGRVLV GSNPH  Y FT V FPT+LS+E+FSP YL 
Sbjct  385   NRFSVMEASTRPRLYHSTAILLTDGRVLVGGSNPHKFYNFTGVDFPTDLSLESFSPPYLA  444

Query  1429  PKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRL  1608
             P+YA L+P ++S      L Y +  SV F V   + M  V V +V+P+F+THSFSMNQR+
Sbjct  445   PEYAPLKPTVLS--IDDILMYKQPFSVTFTVPKFLKMGIVSVRIVAPSFTTHSFSMNQRM  502

Query  1609  LVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ*IN  1776
             +VL  V +    +  Y      P +  +AP GYY+LFVVH  IPS G+WV I  I+
Sbjct  503   VVLKRVAISTVSDNTYRFIAFGPSTKEIAPPGYYMLFVVHAGIPSSGVWVKIHDIS  558



>gb|KFK43688.1| hypothetical protein AALP_AA1G160100 [Arabis alpina]
Length=560

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/536 (55%), Positives = 373/536 (70%), Gaps = 25/536 (5%)
 Frame = +1

Query  187   GGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPP  366
             GG+W+LLQPS+GISAMHMQLLHN+KVV FDRT+ GPSN+ LP   C +            
Sbjct  40    GGRWDLLQPSVGISAMHMQLLHNNKVVIFDRTDYGPSNLLLPPQTCQNATVF--------  91

Query  367   DDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCN  546
               +C+AHS+ YDVASN+FRP+ +  D WCSSGS++ +G+L+QTGGYG G + VR F+PC+
Sbjct  92    --DCSAHSLLYDVASNTFRPLTLRYDTWCSSGSLNASGSLIQTGGYGVGEKAVRIFTPCD  149

Query  547   DAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFLA  726
                CDW E    L   RWYST+ ILPDGR IIVGGRRAF YEF+PK+     FY L FL 
Sbjct  150   GVSCDWVENRAYLSSRRWYSTNQILPDGRIIIVGGRRAFTYEFYPKNPRKSVFY-LRFLV  208

Query  727   QTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYPS  906
             +T DP    ENNLYPF+ L  DGNLFIFAN R+IL D+VN+ +++ +PEIPGG+ RNYPS
Sbjct  209   ETKDP--NEENNLYPFLHLLPDGNLFIFANRRSILFDFVNHRIIKEFPEIPGGDRRNYPS  266

Query  907   SGSAVLLPL----KNLKGPTTMAEVLVCGGSPKDAYYNAKR---NIFVGALNTCGRIVIT  1065
             +GS+VLLPL    +N +  TT AEV+VCGG+P  A+  A R    IFVGA  TCGR+ +T
Sbjct  267   TGSSVLLPLYLTQENNRSQTT-AEVMVCGGAPPGAFLKAARTIPQIFVGASRTCGRLKVT  325

Query  1066  DPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAP-  1242
             DPN  W+ E+MP PRVM DM++LP G+VLIINGATNG AGW+   N   +P+LY PD P 
Sbjct  326   DPNATWVMEQMPSPRVMPDMILLPNGDVLIINGATNGTAGWEDATNAVLNPILYLPDEPD  385

Query  1243  PGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSY  1422
             P  RFE+  P  IPRMYHS+++L++DGRVLV GSNPH  Y FT   +PTELS+EA+ P Y
Sbjct  386   PTRRFEVLAPAWIPRMYHSASLLLSDGRVLVGGSNPHRNYNFTARPYPTELSLEAYHPRY  445

Query  1423  LDPKYAALRPEIVSPASQSGLSYGEVVSVQFKV--SGKVDMSQVKVTMVSPAFSTHSFSM  1596
             LDP+YA +RP I++      + YG+  +V F +   G  D   V V +V+P+FSTHS +M
Sbjct  446   LDPQYARVRPSILTVELAGNMLYGKNFTVTFVIPAYGMFD-GVVSVRLVAPSFSTHSTAM  504

Query  1597  NQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             NQRLLVL   +V       Y  DV  P +  +AP GYY++FVVHR IPS  +WV +
Sbjct  505   NQRLLVLRVRRVNQLSVFAYKADVDGPINSYVAPPGYYMMFVVHRGIPSVAVWVKL  560



>ref|XP_010660091.1| PREDICTED: galactose oxidase [Vitis vinifera]
Length=544

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/537 (53%), Positives = 358/537 (67%), Gaps = 12/537 (2%)
 Frame = +1

Query  157   FTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHgg  336
             F+    A    G+W+LL  SIGISAMHMQLL N+KVV FDRT+ GPSN+SLP   C H  
Sbjct  20    FSQTLPATVNQGEWHLLHASIGISAMHMQLLWNNKVVIFDRTDFGPSNLSLPPHLCRHDP  79

Query  337   ggglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGT  516
                         +CTAHS+ Y V +N+FRP+ V +D WCSSGSV P GTL QTGG+ +G 
Sbjct  80    RDHAL-----QTDCTAHSLLYCVDTNTFRPLKVQTDTWCSSGSVLPNGTLTQTGGFNDGD  134

Query  517   RVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPA  696
              V+R F+PC+D  CDW E P  L + RWY+++ ILPDGR IIVGGRR FNYEF+P+S   
Sbjct  135   HVLRMFTPCDDYSCDWVEFPGYLSQRRWYASNQILPDGRIIIVGGRRQFNYEFYPRSSRG  194

Query  697   DTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEI  876
                Y+L FL +T D     ENNLYPF+ L  DGNLFIFAN R+I LDY  N VV+ +P I
Sbjct  195   SNLYTLDFLRETRD---AHENNLYPFLHLLPDGNLFIFANTRSISLDYKRNRVVQEFPPI  251

Query  877   PGGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRI  1056
              GGEPRNYPSSGS+V+LP+   +     AEVLVCGG+P  A   A R  FV A  TCGR+
Sbjct  252   TGGEPRNYPSSGSSVMLPINETQA--IEAEVLVCGGAPPGAVSQALRGNFVSASLTCGRL  309

Query  1057  VITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPD  1236
              +TD NP W+ EEMP  RVMGDM++LPTG+V+IINGA  GAAGW+ GR+P  +PV+Y P 
Sbjct  310   KVTDENPNWVMEEMPVARVMGDMLLLPTGDVIIINGARLGAAGWEYGRSPVTNPVIYLPF  369

Query  1237  APPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSP  1416
                  RF + + +  PRMYHSSAVL+ DGR+LV GSNPH  Y FTNV +PT+LS+EA+SP
Sbjct  370   GDVNRRFLVMSGSIRPRMYHSSAVLLPDGRILVGGSNPHVYYNFTNVLYPTDLSLEAYSP  429

Query  1417  SYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSM  1596
              Y  P +++LRP I+S      L YG+  S+ F V    +   +   +V+P+F+TH+ +M
Sbjct  430   PYTSPAFSSLRPHILS--LDENLLYGQSFSIVFNVCEYTNDRVLSANIVAPSFTTHTVAM  487

Query  1597  NQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             NQR++VL    V       Y + VV P +  +AP GYY+LFVVH  IPS G WV I 
Sbjct  488   NQRMVVLRVESVMQEVGNTYRLSVVGPSTPEIAPPGYYMLFVVHSGIPSHGSWVKIH  544



>ref|XP_011010793.1| PREDICTED: galactose oxidase [Populus euphratica]
Length=544

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/535 (52%), Positives = 376/535 (70%), Gaps = 19/535 (4%)
 Frame = +1

Query  187   GGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPP  366
             GG W +LQ SIGISAMHMQ+L N+KV+ FDRT+ G SN+SLPDG+C +         KP 
Sbjct  19    GGNWVVLQESIGISAMHMQVLRNNKVIMFDRTDFGRSNLSLPDGECRYKDEVV----KPK  74

Query  367   DDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCN  546
             D  CTAH+V YD+ASN+FRP++V ++ WCSSGS+  +G L+QTGGY  G  V+R F+PC 
Sbjct  75    D--CTAHAVLYDIASNTFRPLMVQTNTWCSSGSLDSSGNLIQTGGYKAGEAVIRSFTPCG  132

Query  547   DAECDWEEIPYGLV-RPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFL  723
             D  CDW E+   ++   RWY+++ +LPDGR IIVGGRRAF YEF+PK+      ++LPFL
Sbjct  133   DDSCDWVELTNQVLWNRRWYASNQLLPDGRIIIVGGRRAFTYEFYPKNPQERDNFTLPFL  192

Query  724   AQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYP  903
               T DP    E NLYPF+ L  DGNLFIFANNR+I LDY  N V++ YP +P G+ RNYP
Sbjct  193   IHTRDPQ--EEINLYPFLHLLPDGNLFIFANNRSISLDYKRNKVIKEYPVMPVGDRRNYP  250

Query  904   SSGSAVLLPLKNLKGPTTM-----AEVLVCGGSPKDAYYNAKR-NIFVGALNTCGRIVIT  1065
              +GS+VLLPL+ L G T +     AEV++CGG+ K AY  +   +I+  A  TCGR+ +T
Sbjct  251   CTGSSVLLPLR-LTGITNVTDHPEAEVMICGGAQKGAYIKSNYLHIYEQASTTCGRLKVT  309

Query  1066  DPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPP  1245
             D  PEW+ E MP PR+M DM++LPTG+++IINGATNG+AGW+   NP ++PVLY+PD  P
Sbjct  310   DTKPEWVMELMPIPRIMNDMLLLPTGDLIIINGATNGSAGWNDAMNPVYNPVLYQPDEDP  369

Query  1246  GSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYL  1425
               RF + + +KI R+YHS+A L+ DGR+LV GSNPH  Y  T   +PTELS+EAF   YL
Sbjct  370   TRRFVVLSSSKIARLYHSTAALLPDGRILVGGSNPHQRYNMTGKPYPTELSLEAFYLHYL  429

Query  1426  DPKYAALRPEIVS-PASQSGLSYGEVVSVQFKVSG-KVDMSQVKVTMVSPAFSTHSFSMN  1599
             DP+Y+ LRP I++   S   +SYGE+ SV F  S  ++D+  V VT+++P+F+THSF MN
Sbjct  430   DPQYSYLRPSILTVELSDRAVSYGEMFSVTFVCSSYRLDLG-VSVTVIAPSFTTHSFGMN  488

Query  1600  QRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             QR++VLN + V       Y  +V+ P + N+AP GYY++FVVH  IPS  +WV++
Sbjct  489   QRMVVLNVLSVVQLSMFAYKANVIGPINVNVAPPGYYMMFVVHAGIPSNAVWVNV  543



>ref|XP_009360496.1| PREDICTED: LOW QUALITY PROTEIN: galactose oxidase [Pyrus x bretschneideri]
Length=579

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/545 (52%), Positives = 372/545 (68%), Gaps = 19/545 (3%)
 Frame = +1

Query  160   TAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGK-CHHgg  336
             T   + V  GG+W LL  SIG+SAMHMQLL ND+V+ FDRT++GPSN+SLPDG  C    
Sbjct  45    TTKNSNVSDGGEWVLLHKSIGVSAMHMQLLINDRVIIFDRTDMGPSNLSLPDGTACRQYI  104

Query  337   ggglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGE-G  513
                        ++CTAHS+ YD+A+++FRP+ V S+FW SSG++ P GTLVQTGGYG+ G
Sbjct  105   AHNRTL-----NDCTAHSLLYDLATDTFRPLFVSSEFWXSSGALEPNGTLVQTGGYGDIG  159

Query  514   TRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGP  693
              R +R FSPCND  C W E    L   RWY+T+ ILPDGR I+VGGRRAF+YEF+PK   
Sbjct  160   IRKIRAFSPCNDGSCQWVESRKKLSDNRWYATNQILPDGRVIVVGGRRAFSYEFYPKKN-  218

Query  694   ADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPE  873
              D ++   FLA+T D G   ENNLYPF+ L  DGNLFIFANNR+IL DY NN +V+  P 
Sbjct  219   -DEWFYFRFLAETNDQG--EENNLYPFLHLLPDGNLFIFANNRSILFDYNNNRIVKELPG  275

Query  874   IPGGEPRNYPSSGSAVLLPLKN----LKGPTTMAEVLVCGGSPKDAYYNAK-RNIFVGAL  1038
             +P    RNYPS+GS+VLLPLK      +      E+L+CGG+P  A++ AK  N+ V A 
Sbjct  276   MPVAVKRNYPSTGSSVLLPLKMNWILSESGLPQVEILICGGAPPGAFHKAKYENVHVFAS  335

Query  1039  NTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHP  1218
             N+CGRI ++DP+P+W+ EEMP PRVM DM++LPTG+VLIINGA+NG AGW+   NP F+P
Sbjct  336   NSCGRIKLSDPDPKWVMEEMPMPRVMSDMLLLPTGDVLIINGASNGTAGWENAENPVFNP  395

Query  1219  VLYRP-DAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTEL  1395
             VLYR  ++ P  RF +  P  IPRMYHSS +L+ DGRVLV GSNPH  Y F    FPT+L
Sbjct  396   VLYRTYESDPEHRFVVLKPAGIPRMYHSSTILVPDGRVLVGGSNPHEMYSFKRA-FPTDL  454

Query  1396  SMEAFSPSYLDPKYAALRPEIVSPASQSG-LSYGEVVSVQFKVSGKVDMSQVKVTMVSPA  1572
             S+EAF P YL P +A+LRP I++  ++   +SYG+  SV F +S       + V +V+P+
Sbjct  455   SLEAFHPPYLAPLFASLRPSILTVETRDDTVSYGQEFSVTFVLSEYRADPGITVALVTPS  514

Query  1573  FSTHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGI  1752
             F+THSF+MNQR++VL+  ++       Y I    P    +AP GYYLLF+VH   PS G+
Sbjct  515   FTTHSFAMNQRMVVLDVARLVHLSTSAYKITAYGPPKNTVAPPGYYLLFLVHAGTPSHGV  574

Query  1753  WVHIQ  1767
             WV +Q
Sbjct  575   WVRVQ  579



>ref|XP_010554972.1| PREDICTED: galactose oxidase [Tarenaya hassleriana]
Length=565

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/538 (55%), Positives = 375/538 (70%), Gaps = 28/538 (5%)
 Frame = +1

Query  187   GGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPP  366
             GG+W+LLQPSIG+SAMHMQLLHN+KVV FDRT+ GPSN+SLP   C             P
Sbjct  41    GGRWDLLQPSIGVSAMHMQLLHNNKVVVFDRTDSGPSNLSLPSQSC-------------P  87

Query  367   DD---NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFS  537
             DD   +C+AHS+ YDV SN+FRP+ + SD WCSSGS+   G+L+QTGGYG G R VRRF 
Sbjct  88    DDVVFDCSAHSILYDVVSNTFRPLTLRSDTWCSSGSLDSDGSLIQTGGYGAGDRAVRRFD  147

Query  538   PC--NDAE-CDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFY  708
             PC  ND   CDW E    L   RWYST+ ILPDGR IIVGGRRAF YEF+PK+     FY
Sbjct  148   PCFPNDVVLCDWAENSTYLSSRRWYSTNQILPDGRIIIVGGRRAFTYEFYPKNLDKPIFY  207

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
              L FLA+T DP    ENNLYPF+ L  DGNLFIFAN R+IL D+VN+ VV+ +PEIPGG+
Sbjct  208   -LRFLAETRDPI--EENNLYPFLHLLPDGNLFIFANRRSILFDFVNHTVVKEFPEIPGGD  264

Query  889   PRNYPSSGSAVLLPL-KNLKGPTTMAEVLVCGGSPKDAYYNAKR---NIFVGALNTCGRI  1056
              RNYPS+GS+VLLPL  + +  TT AE+++CGG+P  ++  A R    IFV A  TCGR+
Sbjct  265   KRNYPSTGSSVLLPLWLDRESRTTAAEIMICGGAPPGSFLKAARTIPKIFVEASRTCGRL  324

Query  1057  VITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPD  1236
              +TDPNP W+ E+MP PRVM DM++LPTG+V+IINGATNG AGW+   N   +P LY PD
Sbjct  325   RVTDPNPRWVMEQMPAPRVMSDMILLPTGDVIIINGATNGTAGWEDSTNAMLNPFLYSPD  384

Query  1237  AP-PGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFS  1413
              P P  RF++  P  IPRMYHS+A+L+ DGR+LV GSNPH  Y FT   +PTELS+EA+ 
Sbjct  385   EPDPTRRFQILAPTLIPRMYHSAALLLPDGRILVGGSNPHRNYNFTTRPYPTELSLEAYL  444

Query  1414  PSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGK-VDMSQVKVTMVSPAFSTHSF  1590
             P YLDP+++ LRP +++      +SYG   SV F +    V    + V +V+P+FSTHS 
Sbjct  445   PRYLDPRFSRLRPSVLTVEMAGTMSYGNGFSVNFVIPAYGVFDGGISVRLVAPSFSTHST  504

Query  1591  SMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             +MNQRL+VL   +V       Y  DV  P + N+AP GYY++FVVHR IPS+ +WV +
Sbjct  505   AMNQRLVVLRVRRVMQLSVFAYKADVDGPSNANVAPPGYYMMFVVHRGIPSEAVWVKV  562



>ref|XP_006304526.1| hypothetical protein CARUB_v10011386mg [Capsella rubella]
 gb|EOA37424.1| hypothetical protein CARUB_v10011386mg [Capsella rubella]
Length=563

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/543 (54%), Positives = 375/543 (69%), Gaps = 28/543 (5%)
 Frame = +1

Query  175   AVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglgg  354
             A+  GG+W+LLQPS+GISAMHMQLLHN+KVV FDRT+ GPSN++LP   C +        
Sbjct  36    AILTGGRWDLLQPSVGISAMHMQLLHNNKVVIFDRTDYGPSNLTLPPHLCQNANVF----  91

Query  355   RKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
                   +C+AHS+ YDVASN+FRP+ +  D WCSSGS++ +G+L+QTGGYG G R VR F
Sbjct  92    ------DCSAHSLLYDVASNTFRPLTLRYDTWCSSGSLNASGSLIQTGGYGAGERTVRVF  145

Query  535   SPCNDA---ECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTF  705
             +PC+      CDW E    L   RWYST+ ILPDGR IIVGGRR+F+YEF+PK+    + 
Sbjct  146   TPCDGVGAVSCDWVENRAYLSSRRWYSTNQILPDGRIIIVGGRRSFSYEFYPKN-TGKSV  204

Query  706   YSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGG  885
             ++L FLA+T DP    ENNLYPF+ L  DGNLFIFAN R+IL D+VN+ +++ +P IPGG
Sbjct  205   FNLSFLAETRDPN--QENNLYPFLHLLPDGNLFIFANRRSILFDFVNHRIIKEFPVIPGG  262

Query  886   EPRNYPSSGSAVLLPLKNLKGPTT----MAEVLVCGGSPKDAYYNAKR---NIFVGALNT  1044
             + RNYPS+GS+VLLPL  L G        AEV+VCGG+P  A+  A R    IFVG   T
Sbjct  263   DKRNYPSTGSSVLLPLL-LTGENNRSKIAAEVMVCGGAPPGAFLKAARTIPKIFVGGSRT  321

Query  1045  CGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVL  1224
             CGR+ +TDPNP W+ E+MP PRVMGDM++LPTG+VLIINGA NG AGW+   N   +P+L
Sbjct  322   CGRLKVTDPNPIWVMEQMPSPRVMGDMLLLPTGDVLIINGAANGTAGWEDATNAVLNPIL  381

Query  1225  YRPDAP-PGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSM  1401
             Y PD P P  RFE+  P + PRMYHS+++L+ DGRVLV GSNPH  Y FT   +PTELS+
Sbjct  382   YLPDEPDPTRRFEILAPTRTPRMYHSASLLLYDGRVLVGGSNPHRNYNFTARPYPTELSL  441

Query  1402  EAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVS--GKVDMSQVKVTMVSPAF  1575
             EA+ P YLDP+YA +RP I++      + YG+  +V F +   G  D   V V +V+P+F
Sbjct  442   EAYLPRYLDPQYARVRPTIITVELAGNMLYGQGFAVTFAIPAFGMFD-GGVSVRLVAPSF  500

Query  1576  STHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIW  1755
             STHS +MNQRLLVL   +V       Y  DV  P +  +AP GYY++FVVHR IPS  +W
Sbjct  501   STHSTAMNQRLLVLRVRRVSQLSVFAYKADVEGPTNSYVAPPGYYMMFVVHRGIPSVAVW  560

Query  1756  VHI  1764
             V I
Sbjct  561   VKI  563



>ref|XP_002520142.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42197.1| conserved hypothetical protein [Ricinus communis]
Length=567

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/539 (53%), Positives = 371/539 (69%), Gaps = 24/539 (4%)
 Frame = +1

Query  187   GGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPP  366
             GG+W LLQ SIGISAMH+Q+L N+KV+ FDRT+ G SN+SLP GKC       +      
Sbjct  41    GGRWVLLQESIGISAMHIQVLKNNKVIMFDRTDFGHSNLSLPYGKCRFNDEAVML-----  95

Query  367   DDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCN  546
               +CTAHSV YD+A+N+FRP++++++ WCSSGS+   G LVQTGG G+G RVVR F+PC+
Sbjct  96    --DCTAHSVLYDIATNTFRPLMIITNTWCSSGSLDSNGVLVQTGGDGKGERVVRTFTPCD  153

Query  547   DAECDWEEIPYG---LVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPK-SGPADTFYSL  714
             D  CDW E+      L+  RWYS++ ILPDGR IIVGGRR F YEF+PK S       +L
Sbjct  154   DDSCDWVELSNSSSTLLNRRWYSSNQILPDGRIIIVGGRRVFTYEFYPKGSSLVRDNMTL  213

Query  715   PFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPR  894
             PFL +T DP    ENNLYPF+ L  DGNLFIFANNR+IL DY  N+V++ +P +PGG  R
Sbjct  214   PFLVKTRDPL--EENNLYPFLHLLPDGNLFIFANNRSILFDYSRNLVIKEFPVLPGGS-R  270

Query  895   NYPSSGSAVLLPLKNLKGP-------TTMAEVLVCGGSPKDAYYNAK-RNIFVGALNTCG  1050
             N+P +GS+VLLPL+  +G           AEV+VCGGS   AY  A   NI++ A  TCG
Sbjct  271   NFPCTGSSVLLPLRINRGNGVGVNNYMAEAEVMVCGGSQPGAYLKAHLENIYMEASRTCG  330

Query  1051  RIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYR  1230
             R+ +TDPNPEW+ E MP PR+M D+++LPTG+V+IINGA NG+AGW+   NP FHPVLY 
Sbjct  331   RLKVTDPNPEWVIEFMPMPRIMNDLLLLPTGDVIIINGAANGSAGWNDAVNPVFHPVLYL  390

Query  1231  PDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAF  1410
              +A P  RF + NP  IPRMYHS+A L+ DGR+LV GSNPH TY FT   + TE+S+EAF
Sbjct  391   TEADPTQRFIVLNPTTIPRMYHSTAALLPDGRILVGGSNPHPTYNFTAYPYRTEMSLEAF  450

Query  1411  SPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSF  1590
              P YLD  +A LRP I++   +  +SY  + SV F ++   +   + V +++ +F+THSF
Sbjct  451   YPPYLDSIHAPLRPSILT--VEGAVSYNWMFSVTFVLTLYREDLGIGVKLMTASFNTHSF  508

Query  1591  SMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
              MNQR++VL  V V    E  + ++VV P + N+AP GYY+LFVVH  IPS  +WV +Q
Sbjct  509   GMNQRMIVLKVVSVWRLSEFAHKVNVVGPTNVNVAPPGYYMLFVVHAGIPSHAVWVKVQ  567



>ref|XP_002518913.1| Galactose oxidase precursor, putative [Ricinus communis]
 gb|EEF43446.1| Galactose oxidase precursor, putative [Ricinus communis]
Length=546

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/548 (53%), Positives = 368/548 (67%), Gaps = 27/548 (5%)
 Frame = +1

Query  154   FFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHg  333
              F ++    +  G+W LL+ SIGISAMHMQLL NDK++AFDRTN GPSN+SLP GKC   
Sbjct  16    LFLSSIEGQQYQGRWKLLKRSIGISAMHMQLLPNDKIIAFDRTNFGPSNLSLPQGKCPTE  75

Query  334   gggglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEG  513
                          +C AHSVE+D  + + RP+ +L+D WCSSG +S  G L+Q+GGY  G
Sbjct  76    SQTT---------DCFAHSVEFDPFNRNIRPLTILTDTWCSSGGLSQDGVLLQSGGYRFG  126

Query  514   TRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGP  693
              RVVR F PC    CDW E P GL+ PRWY+++ +LPDGR IIVGGR  +NYEF PK+  
Sbjct  127   ERVVRTFKPCE--SCDWTEDPKGLISPRWYASNQVLPDGRFIIVGGRYQYNYEFIPKTSS  184

Query  694   AD-TFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYP  870
             +D T Y LPFL +T    L   NNLYPF+ L+ DGNLFIFAN+RA+LLDY  N VVR YP
Sbjct  185   SDQTLYQLPFLKETRYSPL-IPNNLYPFLHLSPDGNLFIFANDRAVLLDYAKNKVVRNYP  243

Query  871   EIPGGEPRNYPSSGSAVLLPLKNLKGPTTM--AEVLVCGGSPKDAYYNAKRNIFVGALNT  1044
              +PG   RNYPS+GS+VLLPL  +   +T   AEVL+CGG+  D+   A    +V A  +
Sbjct  244   VMPGNVSRNYPSTGSSVLLPLVLVSNYSTNPDAEVLICGGTSPDSNQKADAGQYVDASKS  303

Query  1045  CGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVL  1224
             CGR+VIT  NP W  EEMP  RVMGDM++LPTG VLIINGA  G AGW+  R P  +P+L
Sbjct  304   CGRLVITSANPSWEMEEMPKNRVMGDMIMLPTGEVLIINGAAKGTAGWNAAREPVLNPIL  363

Query  1225  YRPDAPPG---SRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTEL  1395
             YRPD       SRFE+ +P+ IPR+YHS+A L++DGRVLV GSNP+  Y FT V +PTEL
Sbjct  364   YRPDVEKNSNTSRFEIMSPSPIPRLYHSAAHLLSDGRVLVGGSNPNRNYNFTTV-YPTEL  422

Query  1396  SMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAF  1575
             S+EAF P YL       RP I +      L Y +  S++F++  + D   + +TMV+P+F
Sbjct  423   SLEAFYPPYLSSNIP--RPNITAIKPGGNLDYKQKFSMEFQLKNQEDPRNICITMVAPSF  480

Query  1576  STHSFSMNQRLLVL----NTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPS  1743
             +THSF+MNQRLLVL    N  K  A+G  +Y ++V AP +  LAP GYY LFVVH  +PS
Sbjct  481   TTHSFAMNQRLLVLGLDNNGTKKVASG--KYVVNVNAPGTAALAPPGYYQLFVVHEGVPS  538

Query  1744  KGIWVHIQ  1767
             +GIWVHI+
Sbjct  539   RGIWVHIK  546



>ref|XP_006343542.1| PREDICTED: galactose oxidase-like [Solanum tuberosum]
Length=553

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/526 (52%), Positives = 358/526 (68%), Gaps = 11/526 (2%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G+W LL  SIGI+AMHMQLLHN+KVV FDRT+ G SN+SLP G+C +     +  +    
Sbjct  36    GEWRLLHKSIGITAMHMQLLHNNKVVIFDRTDFGRSNLSLPRGRCRYNSHDLVLHK----  91

Query  370   DNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCND  549
              +C+AHSV YD+ASN+FRP++V +D WCSSG+V P GTLVQTGGY +G  ++R  +PC  
Sbjct  92    -DCSAHSVLYDIASNTFRPLMVQTDTWCSSGAVLPNGTLVQTGGYNDGDHIIRTIAPCTG  150

Query  550   AECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFLAQ  729
               CDW E+P  L++ RWYSTDHILPD R I++GGR+ +NYEF+PK+   ++ + L FL  
Sbjct  151   ENCDWFELPRTLIQRRWYSTDHILPDARIIVIGGRKQYNYEFYPKNSRGNSAFRLQFLKS  210

Query  730   TTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYPSS  909
             T D     ENNLYPFV L  DGNL IF+N RAI+L+Y  N VVR  P IPG EPRNYPS+
Sbjct  211   TQDRK--DENNLYPFVFLLPDGNLLIFSNTRAIILNYKKNQVVRELPSIPGDEPRNYPST  268

Query  910   GSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEWIT  1089
             GSAVLLPL   +     AE++VCGG+P+ AY      +++ AL++CGRI + D +  W  
Sbjct  269   GSAVLLPLD--ENRPMEAEIMVCGGAPRRAYGLTANMVYMKALSSCGRINVRDDHGRWKM  326

Query  1090  EEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFELQN  1269
             E MP PRVM DM+ILP G++LIINGA+ G AGWD  R+P   PV+YRP+    +RF +  
Sbjct  327   ETMPTPRVMSDMLILPNGDILIINGASRGTAGWDNARSPVTRPVIYRPNMRRHNRFSIMK  386

Query  1270  PNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAALR  1449
              +  PR+YHSSA+L+TDGRVLV GSNP   Y FT V FPT+LS+EAF P +L  K+  L+
Sbjct  387   ASSRPRLYHSSAILMTDGRVLVGGSNPQENYNFTGVEFPTDLSLEAFYPPFLARKHKHLK  446

Query  1450  PEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNTVK  1629
             P ++S    + L Y +  S  F V   + M  V + +++P+F+THSFSMNQR++VL  V 
Sbjct  447   PTVLS--IDAILIYKKSFSATFTVPRFLRMGTVSIRIIAPSFTTHSFSMNQRMVVLKGVV  504

Query  1630  VKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             V A     Y      P +  +AP GYYLLFVVH  IPS G+WV IQ
Sbjct  505   VVAVSANTYRFTAFGPSTKEIAPPGYYLLFVVHAGIPSSGMWVKIQ  550



>ref|XP_006378160.1| glyoxal oxidase-related family protein [Populus trichocarpa]
 gb|ERP55957.1| glyoxal oxidase-related family protein [Populus trichocarpa]
Length=544

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/535 (53%), Positives = 378/535 (71%), Gaps = 19/535 (4%)
 Frame = +1

Query  187   GGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPP  366
             GG W +LQ SIGISAMHMQ+L N+KV+ FDRT+ G SN+SLPDGKC +         KP 
Sbjct  19    GGNWVVLQESIGISAMHMQVLRNNKVIMFDRTDFGRSNLSLPDGKCRYKDEAV----KPK  74

Query  367   DDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCN  546
             D  CTAH+V YD+ASN+FRP++V +D WCSSGS+  +G L+QTGGY  G  V+R F+PC+
Sbjct  75    D--CTAHAVLYDIASNTFRPLMVQTDTWCSSGSLDSSGNLIQTGGYKAGEAVIRSFTPCD  132

Query  547   DAECDWEEIPYGLV-RPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFL  723
             D  CDW E+   ++   RWY+++ +LPDGR IIVGGRRAF YEF+PK+      ++LPFL
Sbjct  133   DDSCDWVELSNQVLWNRRWYASNQLLPDGRIIIVGGRRAFTYEFYPKNPQERDNFTLPFL  192

Query  724   AQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYP  903
               T DP    E NLYPF+ L  DGNLFIFANNR+I LDY  N V++ YP +P G+ RNYP
Sbjct  193   IHTRDPQ--EEINLYPFLHLLPDGNLFIFANNRSISLDYKRNKVIKEYPVMPVGDRRNYP  250

Query  904   SSGSAVLLPLKNLKGPTTM-----AEVLVCGGSPKDAYYNAKR-NIFVGALNTCGRIVIT  1065
              +GS+VLLPL+ L G T +     AEV++CGG+ K AY  +   +I+  A  TCGR+ +T
Sbjct  251   CTGSSVLLPLR-LTGITNVTDHPEAEVMICGGAQKGAYIKSNYLHIYGQASTTCGRLKVT  309

Query  1066  DPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPP  1245
             DP PEW+ E MP PR+M DM++LPTG+++IINGATNG+AGW+   NP ++PVLY+PD  P
Sbjct  310   DPKPEWVMELMPIPRIMNDMLLLPTGDLIIINGATNGSAGWNDAMNPVYNPVLYQPDEDP  369

Query  1246  GSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYL  1425
               RF + + +KI R+YHS+A L+ DGR+LV GSNPH  Y  T   +PTELS+EAF   YL
Sbjct  370   TRRFVVLSSSKIARLYHSTAALLPDGRILVGGSNPHQGYNMTGKPYPTELSLEAFYLHYL  429

Query  1426  DPKYAALRPEIVS-PASQSGLSYGEVVSVQFKVSG-KVDMSQVKVTMVSPAFSTHSFSMN  1599
             DP+YA LRP I++   S   +SYGE+ SV F  S  ++D+  V VT+++P+F+THSF MN
Sbjct  430   DPQYAYLRPSILTVELSDRAVSYGELFSVTFVCSSYRLDLG-VSVTVIAPSFTTHSFGMN  488

Query  1600  QRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             QR++VLN V V       Y  +V+ P + N+AP GYY++FVVH  IPS  +WV++
Sbjct  489   QRMVVLNVVSVVQLSMFAYKANVIGPINVNVAPPGYYMMFVVHAGIPSNAVWVNV  543



>ref|XP_004243010.2| PREDICTED: galactose oxidase [Solanum lycopersicum]
Length=527

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/527 (53%), Positives = 360/527 (68%), Gaps = 13/527 (2%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G+W LL  SIGI+AMHMQLLHN+KVV FDRT+ G SN+SLP G+C +        +    
Sbjct  10    GEWRLLHESIGITAMHMQLLHNNKVVIFDRTDFGHSNLSLPRGRCRYNSHDLALQK----  65

Query  370   DNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCND  549
              +C+AHSV YD+ SN+FRP++V +D WCSSG+V P GTLVQTGG+ +G  +VR  +PC D
Sbjct  66    -DCSAHSVLYDIVSNTFRPLMVQTDTWCSSGAVLPNGTLVQTGGFNDGDHIVRSLAPCTD  124

Query  550   AECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFLAQ  729
               CDW E+P  LV+ RWYSTDHILPD R I++GGR+ +NYEF+PK+   D+ +SL FL  
Sbjct  125   ENCDWFELPRTLVQRRWYSTDHILPDARIIVIGGRKQYNYEFYPKNSRGDSAFSLQFLKS  184

Query  730   TTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYPSS  909
             T +     ENNLYPFV L  DGNL IFAN RAI+L+Y  N VVR  P IPG EPRNYPS+
Sbjct  185   TLE---RYENNLYPFVFLLPDGNLVIFANTRAIILNYKENQVVRELPSIPGDEPRNYPST  241

Query  910   GSAVLLPLKNLKGPTTMAEVLVCGGSPKDAY-YNAKRNIFVGALNTCGRIVITDPNPEWI  1086
             GSAVLLPL   +     AE++VCGG+P+ AY Y  K  +++ AL++CGRI + D +  W 
Sbjct  242   GSAVLLPLD--ENRPMEAEIMVCGGAPRRAYRYADKYKMYMKALSSCGRINVIDDHGIWE  299

Query  1087  TEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFELQ  1266
              E MP  RVM DM+ILP G+++IINGA+ G AGW+   +P   PV+YRP+    +RF + 
Sbjct  300   METMPTRRVMSDMLILPDGDIIIINGASRGTAGWNNAISPVTTPVIYRPNVRRDNRFSIM  359

Query  1267  NPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAAL  1446
                  PR+YHSSA+L+TDGRVLV GSNP   Y FT V FPT+LS+EAFSP YL  K++ L
Sbjct  360   KAASRPRLYHSSAILMTDGRVLVGGSNPQEYYNFTGVEFPTDLSLEAFSPPYLARKHSHL  419

Query  1447  RPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNTV  1626
             +P ++S      L+Y    S  F V   + +  V + +++P+F+THSFSMNQR++VL  V
Sbjct  420   KPTVLS--IDEILTYKSSFSATFTVPTFLRIGTVSIRIIAPSFTTHSFSMNQRMVVLKGV  477

Query  1627  KVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
              V A  +  Y     AP +  +AP GYY+LFVVH  IPS G+WV IQ
Sbjct  478   VVVAISDNSYKFTAFAPSTKEIAPPGYYMLFVVHAGIPSSGVWVKIQ  524



>ref|XP_006577272.1| PREDICTED: galactose oxidase-like [Glycine max]
Length=550

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/548 (52%), Positives = 371/548 (68%), Gaps = 27/548 (5%)
 Frame = +1

Query  154   FFTAA--AAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCH  327
             FF A   ++A    G+WNLLQPSIGIS MHMQLLHNDK++ FDRT+ G S + L +G+C 
Sbjct  18    FFQAQPLSSAFANQGQWNLLQPSIGISPMHMQLLHNDKIIMFDRTDFGHSYLPLSNGRC-  76

Query  328   HggggglggRKPPDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQ  492
                      R  P++     +C+AHSV YDVA+N+FRP+++ +D WCSSGSV P GTLVQ
Sbjct  77    ---------RMDPNEIALKVDCSAHSVLYDVATNTFRPLMIQTDTWCSSGSVLPNGTLVQ  127

Query  493   TGGYGEGTRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYE  672
             TGGY +G R +R F+PC    CDW E P  L + RWY+T+ ILPD R I+VGGRR FNYE
Sbjct  128   TGGYNDGERSIRMFTPCFGETCDWVEFPGLLSQRRWYATNQILPDARVIVVGGRRQFNYE  187

Query  673   FFPKSGPADTFYS---LPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYV  843
             F PK+   ++  S   L FL QT+D    +ENNLYPFV L  DGNLFIFAN +++L DY 
Sbjct  188   FLPKTPSPNSSPSSIPLNFLQQTSD---RSENNLYPFVHLLPDGNLFIFANTKSVLFDYK  244

Query  844   NNVVVRTYPEIPGGEPRNYPSSGSAVLLPL-KNLKGPTTMAEVLVCGGSPKDAYYNAKRN  1020
              N V+R +P IPGG+PRNYPSSGS+VLLPL +NL   +   EV+VCGG+P+ ++ NA R 
Sbjct  245   QNSVIREFPPIPGGDPRNYPSSGSSVLLPLDENLD--SLEPEVVVCGGAPRGSFENAARG  302

Query  1021  IFVGALNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGR  1200
              FV AL TCGRI +TD NP W+ + MP PR MGDM++LP G+V+IINGA  G AGW+ G 
Sbjct  303   NFVQALGTCGRIKVTDSNPNWVMQNMPMPRAMGDMLLLPNGDVVIINGAGAGTAGWEHGH  362

Query  1201  NPAFHPVLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVF  1380
             +P   PV++RP +   ++F +  P   PR+YHSSAVL+ DGRVLV GSNPH  Y FT V 
Sbjct  363   DPVLSPVIFRP-SETVNQFSVMAPASRPRLYHSSAVLLRDGRVLVGGSNPHVFYNFTGVE  421

Query  1381  FPTELSMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTM  1560
             +PT+LS+EAFSP YL P +A +RP I    + + L Y     V F V     +S+V + +
Sbjct  422   YPTDLSLEAFSPPYLAPDFAPVRPVIRYITNNNVLGYRVFCYVTFTVPNYASVSEVSIRI  481

Query  1561  VSPAFSTHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIP  1740
             V+P+F+THSF  NQR++VL    V     E Y   V+ P +  +AP GYYLLFVVH+ +P
Sbjct  482   VAPSFTTHSFGQNQRMVVLKLSAVTYLAGEAYYATVMGPSTAEIAPPGYYLLFVVHKGVP  541

Query  1741  SKGIWVHI  1764
             S G WV +
Sbjct  542   SWGSWVQV  549



>ref|XP_006849170.1| hypothetical protein AMTR_s00027p00175370 [Amborella trichopoda]
 gb|ERN10751.1| hypothetical protein AMTR_s00027p00175370 [Amborella trichopoda]
Length=560

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/537 (52%), Positives = 369/537 (69%), Gaps = 20/537 (4%)
 Frame = +1

Query  172   AAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglg  351
             A   GGG+W LL+ SIGISAMHM LL N++V+ FDRT+ GPSN+SLP+G+C         
Sbjct  35    ALASGGGQWKLLKRSIGISAMHMALLPNNRVIMFDRTDFGPSNVSLPNGRCRKDRHD---  91

Query  352   gRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRR  531
               +    +C AHSVE +  ++  RP+ +L+D WCSSG+++P G L+QTGG  +G RVVR 
Sbjct  92    --RALQTDCWAHSVELNWVTHGVRPLTILTDTWCSSGALAPDGHLIQTGGSNDGERVVRT  149

Query  532   FSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPAD-TFY  708
             FSPC  A CDW E+P GL  PRWY+++ ILPDGR I+VGGR  FNYEF PK+ P++ + Y
Sbjct  150   FSPC--ATCDWAELPDGLAMPRWYASNQILPDGRIIVVGGRGQFNYEFVPKTDPSEHSMY  207

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
              L FL++T D     ENNLYPF+ L  DG LF+FAN +AI LDY+ + VVRT+P +PG E
Sbjct  208   PLEFLSETRD---DCENNLYPFLHLLPDGTLFLFANTKAISLDYITHRVVRTFPALPG-E  263

Query  889   PRNYPSSGSAVLLPL---KNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIV  1059
              RNYPS+GS+ +LPL    N   P   AEVLVCGG+P  + + A + +F+ A  TCGRI 
Sbjct  264   SRNYPSTGSSTMLPLILAVNSTQPVD-AEVLVCGGAPSHSNFQANKGVFLPASRTCGRIK  322

Query  1060  ITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDA  1239
              TD +PEW  E MP  RVMGDMV+LPTG +LIINGA  G AGW +GR+P   PVLY+PDA
Sbjct  323   ATDESPEWSIETMPLKRVMGDMVMLPTGEILIINGAGKGTAGWGVGRDPVLCPVLYKPDA  382

Query  1240  PPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPS  1419
             P G RFE+ +P+  PR+YHSSA L++DGRVLV GSNP+  Y F+ V FPTELS+E FSP 
Sbjct  383   PIGHRFEVLSPSSTPRLYHSSAQLLSDGRVLVGGSNPNRGYNFSGVLFPTELSLEFFSPP  442

Query  1420  YLDPKYAALRPEIVSPASQSGLSYGEVVSVQF--KVSGKVDMSQVKVTMVSPAFSTHSFS  1593
             Y+  K++  RP+I S      +SY +   + F  +      + ++ VTMV+P+F+THS S
Sbjct  443   YIKLKWS--RPKITSLKPGRTMSYTQHFYINFYSRKQSTKGVDEILVTMVAPSFTTHSVS  500

Query  1594  MNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             MNQRLLVL  + ++   +  Y ++ V P S  LAP GYYLLF+VH   PS+G+WV +
Sbjct  501   MNQRLLVLRVMGLEGGHDGAYRVECVPPVSAVLAPPGYYLLFLVHGGSPSRGVWVRL  557



>ref|XP_006438575.1| hypothetical protein CICLE_v10031195mg [Citrus clementina]
 gb|ESR51815.1| hypothetical protein CICLE_v10031195mg [Citrus clementina]
Length=535

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/541 (53%), Positives = 373/541 (69%), Gaps = 25/541 (5%)
 Frame = +1

Query  181   RGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRK  360
             + GG+W LLQ SIGISAMHMQ+L+NDKV+ FDRT++GPSN+SLP  KC          RK
Sbjct  4     KSGGQWVLLQSSIGISAMHMQVLNNDKVIIFDRTDMGPSNLSLPIDKC----------RK  53

Query  361   PPDD---NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRR  531
               D    +CTAHSV YD+ASN+FRP+L+ +D WCSSG+V   GTLVQTGGY  G RV+R 
Sbjct  54    EGDVGQLDCTAHSVLYDIASNTFRPLLLQTDTWCSSGAVLSDGTLVQTGGYNVGDRVIRL  113

Query  532   FSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYS  711
             F+PCN+  CDW E+   L   RWY+++ ILPD R I+VGGRR F YEF+PK     +   
Sbjct  114   FTPCNNEGCDWVELSKNLWDRRWYASNQILPDNRIIVVGGRRVFTYEFYPKIDSLSSSLY  173

Query  712   LPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEP  891
             L FL +T DP  G ENNLYPF+ L  DGNLFIFAN R+IL DY+NN +V+ +P IPG + 
Sbjct  174   LRFLIETRDP--GEENNLYPFLHLLPDGNLFIFANRRSILFDYINNKLVKEFPVIPGNDK  231

Query  892   RNYPSSGSAVLLPLK-------NLKGPTTMAEVLVCGGSPKDAYYNA-KRNIFVGALNTC  1047
             RNYPS+GS++LLP+K       N       AEV+VCGG+P  A+  + K +++V A  TC
Sbjct  232   RNYPSTGSSILLPVKLSAGSDGNGTAVLPDAEVMVCGGAPAGAFIKSDKESVYVEASRTC  291

Query  1048  GRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLY  1227
             GR+ +TD  P W  E MP PRVM DM++LP+G+V+IINGA+NG AGW+    P  +PVLY
Sbjct  292   GRLKVTDKYPVWSMEFMPMPRVMSDMLLLPSGDVIIINGASNGTAGWEDAVGPNLNPVLY  351

Query  1228  RPD-APPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSME  1404
              PD   P  RF + NP+KIPRMYHSSAV++ DGR+LV GSNPH  Y FT   +PT+LS+E
Sbjct  352   SPDEEEPDRRFVVLNPSKIPRMYHSSAVVLPDGRILVGGSNPHRRYNFTAYPYPTDLSLE  411

Query  1405  AFSPSYLDPKYAALRPEIVSPAS-QSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFST  1581
             AF P YLDP+ A +RP I+S  S    +SY EV SV F++S      ++ V++++P+F+T
Sbjct  412   AFHPHYLDPENAYMRPSILSLESIGRTVSYNEVFSVTFELSSYSPSGEISVSLMTPSFTT  471

Query  1582  HSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVH  1761
             HSF+MNQRL+VLN V V       Y + V  P +  +AP GYY++FVVH  IPS  +WV 
Sbjct  472   HSFAMNQRLVVLNVVSVSQLSVYAYKVVVNGPPTATVAPPGYYMMFVVHAGIPSHAVWVK  531

Query  1762  I  1764
             +
Sbjct  532   V  532



>ref|XP_006417012.1| hypothetical protein EUTSA_v10007241mg [Eutrema salsugineum]
 gb|ESQ35365.1| hypothetical protein EUTSA_v10007241mg [Eutrema salsugineum]
Length=564

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/543 (54%), Positives = 373/543 (69%), Gaps = 27/543 (5%)
 Frame = +1

Query  175   AVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglgg  354
             A+  GG+W+LLQPS+GISAMHMQLLHN+KVV FDRT+ GPSN+ LP   C +        
Sbjct  36    AILAGGRWDLLQPSVGISAMHMQLLHNNKVVIFDRTDYGPSNLPLPPQMCRNATVF----  91

Query  355   RKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
                   +C+AHS+ YDVASN+FR + +  D WCSSGS++ +G+L+QTGGYG G R VR F
Sbjct  92    ------DCSAHSLLYDVASNTFRALTLRYDTWCSSGSLNASGSLIQTGGYGVGERAVRVF  145

Query  535   SPCN----DAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADT  702
             +PC+       CDW E    L   RWYST+ ILPDGR IIVGGRRAF+YEF+PK+ P  +
Sbjct  146   TPCDGVGGSVSCDWVENRAYLSSRRWYSTNQILPDGRIIIVGGRRAFSYEFYPKN-PGKS  204

Query  703   FYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPG  882
              + L FLA+T DP    ENNLYPF+ L  DGNLFIFAN R+IL D+VN+ +V+ +P IPG
Sbjct  205   VFYLRFLAETRDPK--EENNLYPFLHLLPDGNLFIFANRRSILFDFVNHRIVKEFPVIPG  262

Query  883   GEPRNYPSSGSAVLLPLKNLKGPTT----MAEVLVCGGSPKDAYYNAKR---NIFVGALN  1041
             G+ RNYPS+GS+VLLPL  L G        AEV+VCGG+P  A+  A R    IFVG+  
Sbjct  263   GDKRNYPSTGSSVLLPLF-LTGENNRSKIAAEVMVCGGAPPGAFLKAARTIPKIFVGSSR  321

Query  1042  TCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPV  1221
             TCGR+ +TD NP+W+ E+MP PRVM DM++LP GNVLIINGA NG AGW+   N   +P+
Sbjct  322   TCGRLKVTDRNPQWVMEQMPSPRVMPDMLLLPNGNVLIINGAANGTAGWEDATNAVLNPI  381

Query  1222  LYRPDAP-PGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELS  1398
             LY PD P P  RFE+  P +IPRMYHS+++L+ DGRVLV GSNPH  Y FT   +PTELS
Sbjct  382   LYLPDEPDPTRRFEILAPTRIPRMYHSASLLLPDGRVLVGGSNPHRNYNFTARPYPTELS  441

Query  1399  MEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSG-KVDMSQVKVTMVSPAF  1575
             +EA+ P YLDP+ A +RP I++      + YG+  SV F +    +   +V V +V+P+F
Sbjct  442   LEAYLPRYLDPQNAGVRPTILTVELAGNMLYGKAFSVTFVIPAFGMFNGEVSVRLVAPSF  501

Query  1576  STHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIW  1755
             STHS +MNQRLLVL   +V       Y  DV  P +  +AP GYY++FVVHR IPS GIW
Sbjct  502   STHSTAMNQRLLVLRVRRVAQLSVFAYKADVDGPTNSYVAPPGYYMMFVVHRGIPSVGIW  561

Query  1756  VHI  1764
             V +
Sbjct  562   VRL  564



>ref|XP_006483245.1| PREDICTED: galactose oxidase-like [Citrus sinensis]
Length=575

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/541 (53%), Positives = 374/541 (69%), Gaps = 25/541 (5%)
 Frame = +1

Query  181   RGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRK  360
             + GG+W LLQ SIGISAMHMQ+L+NDKV+ FDRT++GPSN+SLP  KC          RK
Sbjct  44    KSGGQWVLLQSSIGISAMHMQVLNNDKVIIFDRTDMGPSNLSLPIDKC----------RK  93

Query  361   PPDD---NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRR  531
               D    +CTAHSV YD+ASN+FRP+L+ +D WCSSG+V   GTLVQTGGY  G RV+R 
Sbjct  94    EGDVGQLDCTAHSVLYDIASNTFRPLLLQTDTWCSSGAVLSDGTLVQTGGYNVGDRVIRL  153

Query  532   FSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYS  711
             F+PCN+  CDW E+   L   RWY+++ ILPD R I+VGGRR F YEF+PK     +   
Sbjct  154   FTPCNNEGCDWVELSKNLWDRRWYASNQILPDNRIIVVGGRRVFTYEFYPKIDSLSSSLY  213

Query  712   LPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEP  891
             L FL +T DP  G ENNLYPF+ L  DGNLFIFAN R+IL DY+NN +V+ +P IPG + 
Sbjct  214   LRFLIETRDP--GEENNLYPFLHLLPDGNLFIFANRRSILFDYINNKLVKEFPVIPGNDK  271

Query  892   RNYPSSGSAVLLPLK-------NLKGPTTMAEVLVCGGSPKDAYYNA-KRNIFVGALNTC  1047
             RNYPS+GS++LLP+K       N       AEV+VCGG+P  A+  + K +++V A  TC
Sbjct  272   RNYPSTGSSILLPVKLSAGSDGNGTAVLPDAEVMVCGGAPAGAFIKSDKESVYVEASRTC  331

Query  1048  GRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLY  1227
             GR+ +TD  P W  E MP PRVM DM++LP+G+V+IINGA+NG AGW+    P  +PVLY
Sbjct  332   GRLKVTDKYPVWSMEFMPMPRVMSDMLLLPSGDVIIINGASNGTAGWEDAVGPNLNPVLY  391

Query  1228  RPD-APPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSME  1404
              PD   P  RF + NP+KIPRMYHSSAV++ DGR+LV GSNPH  Y FT   +PT+LS+E
Sbjct  392   SPDEEEPDRRFVVLNPSKIPRMYHSSAVVLPDGRILVGGSNPHRRYNFTAYPYPTDLSLE  451

Query  1405  AFSPSYLDPKYAALRPEIVSPAS-QSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFST  1581
             AF P YLDP+ A +RP I+S  S    +SY EV+SV F++S      ++ V++++P+F+T
Sbjct  452   AFHPHYLDPENAYMRPSILSLESIGRTVSYNEVLSVTFELSSYSPSGEISVSLMTPSFTT  511

Query  1582  HSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVH  1761
             HSF+MNQRL+VLN V V       Y + V  P +  +AP GYY++FVVH  IPS  +WV 
Sbjct  512   HSFAMNQRLVVLNVVSVSQLSVYAYKVVVNGPPTATVAPPGYYMMFVVHAGIPSHAVWVK  571

Query  1762  I  1764
             +
Sbjct  572   V  572



>ref|XP_003553749.1| PREDICTED: galactose oxidase-like [Glycine max]
Length=552

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/535 (53%), Positives = 362/535 (68%), Gaps = 25/535 (5%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G+WNL+QPS+GISAMHMQLLHNDK++ FDRT+ G S + L +G+C          R  P+
Sbjct  34    GQWNLVQPSVGISAMHMQLLHNDKIIMFDRTDFGHSYLPLSNGRC----------RMDPN  83

Query  370   D-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
             D     +C+AHSV YDV +N+ RP+++ +D WCSSGSV P GTL+QTGGY +G R +R F
Sbjct  84    DIALKVDCSAHSVLYDVPTNTLRPLMIQTDTWCSSGSVLPNGTLIQTGGYNDGERSIRMF  143

Query  535   SPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYS-  711
             +PC D  CDW E P  L + RWY+T+ ILPD R I+VGGRR FNYEF PK+   ++  S 
Sbjct  144   TPCFDETCDWVEFPGLLSQRRWYATNQILPDARVIVVGGRRQFNYEFLPKTPSPNSSPSS  203

Query  712   --LPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGG  885
               L FL QT+D    +ENNLYPFV L  DGNLFIFAN +++L DY  N V++ +P IPGG
Sbjct  204   IPLNFLQQTSD---RSENNLYPFVHLLPDGNLFIFANTKSVLFDYKQNSVIKEFPPIPGG  260

Query  886   EPRNYPSSGSAVLLPL-KNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVI  1062
             +PRNYPSSGS+VLLPL +NL   +  AEV+VCGG+P+ ++ +A R  FV AL TCGRI +
Sbjct  261   DPRNYPSSGSSVLLPLDENLA--SLEAEVVVCGGAPRGSFESAARGNFVQALGTCGRIKV  318

Query  1063  TDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAP  1242
             TDPNP W+ E MP PR MGDM++LP G+V+I NG   G AGW+ G +P   PVL+RP + 
Sbjct  319   TDPNPNWVMENMPMPRAMGDMLLLPNGDVVITNGVGAGTAGWEHGHDPVLTPVLFRP-SE  377

Query  1243  PGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSY  1422
               +RF +  P   PR+YHSSAVL+ DGRVLV GSNPH  Y FT V +PT+LS+EAFSP Y
Sbjct  378   TVNRFSVMAPASRPRLYHSSAVLLRDGRVLVGGSNPHVFYNFTGVEYPTDLSLEAFSPPY  437

Query  1423  LDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQ  1602
             L   +  +RP I    + + L Y     V F V      S+V V +V+P+F+THSF  NQ
Sbjct  438   LALDFDPVRPTIRYITNNNVLGYRVFCYVTFTVPNFASASEVSVKIVAPSFTTHSFGQNQ  497

Query  1603  RLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             R++VL    V     E Y   VV P +  +AP GYYLLFVVH+ +PS G WV + 
Sbjct  498   RMVVLKLSGVTYLAGEAYYATVVGPSTAEIAPPGYYLLFVVHKGVPSSGSWVQVM  552



>ref|XP_004494672.1| PREDICTED: galactose oxidase-like [Cicer arietinum]
Length=559

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/538 (52%), Positives = 357/538 (66%), Gaps = 28/538 (5%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G+WNLLQP+IGISAMHMQL HNDK++ FDRT+ GPSN+ L +G+C          R  P 
Sbjct  38    GQWNLLQPTIGISAMHMQLTHNDKIIIFDRTDFGPSNLPLSNGEC----------RMDPY  87

Query  370   D-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
             D     +CTAHSV YD+ +N+FR + + +D WCSSGSV P GTL+QTGG+ +G R +R F
Sbjct  88    DTALKTDCTAHSVLYDIYTNTFRSLTIQTDTWCSSGSVLPNGTLIQTGGFNDGERRIRMF  147

Query  535   SPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKS----GPADT  702
             +PC    CDW E P  L+  RWY+T+ ILPD R II+GGR+ FNYEFFPK+      + +
Sbjct  148   TPCFHENCDWIEFPSYLIERRWYATNQILPDNRVIIIGGRKQFNYEFFPKTITSSESSPS  207

Query  703   FYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPG  882
                LPFL +T DP    ENNLYPFV L  +GNLFIFAN R+ILLDY  N VV+ +PEI G
Sbjct  208   SIHLPFLQETNDPN---ENNLYPFVHLLPNGNLFIFANKRSILLDYKQNRVVKEFPEISG  264

Query  883   GEPRNYPSSGSAVLLPL-KNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIV  1059
             G+PRNYPSSGS+VLLPL +NL   +  AE++VCGG+P+ A+  A +  F+ ALNTCG + 
Sbjct  265   GDPRNYPSSGSSVLLPLDENLN--SIEAEIMVCGGAPRGAFEEASKGNFIQALNTCGFLK  322

Query  1060  ITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPD-  1236
             +TD NP WI + MP  RVMGDM+ILP G+++IING   G AGW+ GR P   PV+YR   
Sbjct  323   VTDSNPNWIMKNMPIARVMGDMLILPNGDIIIINGVELGTAGWENGRRPVLTPVIYRSSV  382

Query  1237  -APPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFS  1413
                   RF +      PR+YHSSAV++ DGRVLV GSNPH  Y F+ V FPT+LS+EAFS
Sbjct  383   TVTESQRFSIMQRASRPRLYHSSAVVLRDGRVLVGGSNPHVNYNFSGVEFPTDLSLEAFS  442

Query  1414  PSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFS  1593
             P YL P++  +RP I+   +   L Y     V F V      S V V +++P+FSTHS+ 
Sbjct  443   PPYLSPEFDPVRP-IIRHVTSYILGYRVFYYVTFTVGKFGSASDVSVRILAPSFSTHSYG  501

Query  1594  MNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             MNQR++VL  + V       Y   VV P +  +AP GYY+LF+VH  +PS G WV + 
Sbjct  502   MNQRMVVLKLIGVTEVNFGTYYATVVGPSTQEIAPPGYYILFLVHEGVPSSGTWVQLM  559



>ref|XP_006433075.1| hypothetical protein CICLE_v10000768mg [Citrus clementina]
 gb|ESR46315.1| hypothetical protein CICLE_v10000768mg [Citrus clementina]
Length=546

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/535 (52%), Positives = 365/535 (68%), Gaps = 35/535 (7%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G+WNLL  SIGISAMHMQLLH+++V+ FDRT+ G SN+SL  G+C          R  P 
Sbjct  38    GEWNLLHESIGISAMHMQLLHDNRVIMFDRTDFGQSNLSLSSGRC----------RFDPY  87

Query  370   D-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
             D     +CTAHS+ YDVA+N++RP++V +D WCSSGSV P GTLVQ+GGY +G  VVR F
Sbjct  88    DTVLHTDCTAHSILYDVATNAYRPLMVQTDTWCSSGSVLPNGTLVQSGGYNDGDHVVRTF  147

Query  535   SPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTF---  705
             +PC+D +CDW E+P  L   RWY+T+ ILPDGR II+GGRR FNYEF+PKS    +F   
Sbjct  148   TPCDDDQCDWIELPQHLSERRWYATNQILPDGRIIIIGGRRQFNYEFYPKSDEDLSFPQT  207

Query  706   YSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGG  885
             + L FL +T D    AENNLYPFV L  DGNLFIFAN R+IL DY  N V++ YPEIPG 
Sbjct  208   FMLHFLLETRD---YAENNLYPFVHLLPDGNLFIFANTRSILFDYKQNKVLKEYPEIPGA  264

Query  886   EPRNYPSSGSAVLLPLKNLKGPTTM-AEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVI  1062
             +PRNYPS+GS+VLLPL    G T++ AE+++CGG+   ++  A + +F+ A++TCGR+V+
Sbjct  265   DPRNYPSTGSSVLLPLDERNGSTSVQAEIMICGGAQNASFALATQGVFIRAISTCGRLVV  324

Query  1063  TDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAP  1242
             +  NP W+ EEMP PRVMGDM++LP G+V+IINGA  G AGW+L R P   P++YRP   
Sbjct  325   SHANPSWVMEEMPLPRVMGDMILLPNGDVIIINGAQLGTAGWELARGPMTRPIIYRPSEQ  384

Query  1243  PGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSY  1422
                RF +  P+  PRMYHSSA+            NPH  Y FTNV +PT+LS+EA+SP Y
Sbjct  385   TSRRFSVMEPSTRPRMYHSSAIF-----------NPHIYYNFTNVVYPTDLSLEAYSPPY  433

Query  1423  LDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQ  1602
             L  +YA +RP+I+S     G  Y     V+F V   +    V V +++P+F+THSF MNQ
Sbjct  434   LSAEYATVRPKILSLNETIG--YKATFQVRFSVEEYLSAGVVSVRLIAPSFTTHSFGMNQ  491

Query  1603  RLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             R++VL  ++V       Y +  VAP +  +AP GYYLLFVVH EIPS G+WV ++
Sbjct  492   RMVVLKILEVSHVTSYVYHLAAVAPSTAEIAPPGYYLLFVVHAEIPSSGMWVKME  546



>ref|XP_006382737.1| glyoxal oxidase-related family protein [Populus trichocarpa]
 gb|ERP60534.1| glyoxal oxidase-related family protein [Populus trichocarpa]
Length=550

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/530 (54%), Positives = 358/530 (68%), Gaps = 19/530 (4%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G+W+LL  S+GISAMHMQL+H++KVV +DRT+ GPSNISLP G C            P D
Sbjct  36    GRWDLLSESVGISAMHMQLMHDNKVVIYDRTDFGPSNISLPGGLCR---------ADPYD  86

Query  370   D----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFS  537
             D    +CTAHS+ YD  ++++RP+++ +D WCSSG+V P GTLVQTGG+ +G  V R F+
Sbjct  87    DALKIDCTAHSILYDTITDTYRPLMIQTDTWCSSGAVLPNGTLVQTGGFHDGDNVTRMFT  146

Query  538   PCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLP  717
             PC +  CDW E P  L R RWY+T+ ILPDGR II+GGRR FNYEFFP+S P  TF  L 
Sbjct  147   PCTNDSCDWVEFPKYLSRRRWYATNQILPDGRIIIIGGRREFNYEFFPRSSPRRTF-QLS  205

Query  718   FLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRN  897
             FL +T +  +  ENNLYPF  L  DGNLFIFAN R+IL DY  N VVR +P IPGG+PRN
Sbjct  206   FLRETREGDV--ENNLYPFAHLLPDGNLFIFANTRSILFDYNQNRVVREFPSIPGGDPRN  263

Query  898   YPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNP  1077
             YPS+GS+VLLPL   +      EVLVCGG+P  A+  A R  FV A  TCGR+ +TD N 
Sbjct  264   YPSTGSSVLLPLDENEYRID-PEVLVCGGAPNGAFQLAARGTFVRATPTCGRLRVTDQNA  322

Query  1078  EWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRF  1257
              W+ E MP PR MGDM++LPTG+V++ING   G AGW+LGR PA  PV+Y P  P   RF
Sbjct  323   SWVMETMPIPRAMGDMLLLPTGDVIVINGVQLGTAGWELGRLPATRPVIYHPSHPSDQRF  382

Query  1258  ELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKY  1437
              +  P+  PRMYHS+A+L+ DGRVLV G NPH  Y FTNV +PT+LS+E FSP YL   Y
Sbjct  383   SVMPPSPRPRMYHSAAILLADGRVLVGGGNPHVYYNFTNVVYPTDLSLETFSPPYLSTDY  442

Query  1438  AALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVL  1617
             A++RP I+S      +S G+   V F V   +  S + V +V+P+F+THSFSMNQR++VL
Sbjct  443   ASVRPVILS--VDGTISRGQRFLVSFSVEEYLTQSVLSVRIVAPSFTTHSFSMNQRMVVL  500

Query  1618  NTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
                 +       Y   V  P S  +AP GYY+LFVVH  IPS G+WV IQ
Sbjct  501   KIDDIIYDDTSSYTSSVFGPSSSEIAPPGYYMLFVVHSGIPSSGVWVRIQ  550



>ref|XP_006849171.1| hypothetical protein AMTR_s00027p00177380 [Amborella trichopoda]
 gb|ERN10752.1| hypothetical protein AMTR_s00027p00177380 [Amborella trichopoda]
Length=557

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/539 (52%), Positives = 367/539 (68%), Gaps = 30/539 (6%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
             GGG+W L++ SIGISAMHM LL ND+V+ FDRT+ GPSN+SLP G+C          RK 
Sbjct  38    GGGEWKLMKRSIGISAMHMALLPNDRVIIFDRTDFGPSNVSLPKGRC----------RKD  87

Query  364   PDD-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
             P D     +C AHSVE D+ +++ R + + +D WCSSG+++P G L+QTGG+ +G RVVR
Sbjct  88    PHDQALQTDCWAHSVELDLVTHAVRSLTLQTDTWCSSGALAPDGHLIQTGGFNDGERVVR  147

Query  529   RFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTF-  705
              FSPC+D  CDW E P GL   RWY+++ ILPDGR I+VGGR+ F+YEF PK+ P++   
Sbjct  148   TFSPCSD--CDWAETPDGLAVRRWYASNQILPDGRIIVVGGRKEFSYEFVPKTDPSEQCT  205

Query  706   YSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGG  885
             Y L FL++T D     ENNLYPFV L  DG LF+F+N +AI LDY+ + VVRT+P +  G
Sbjct  206   YPLDFLSETRDE---CENNLYPFVHLLPDGTLFLFSNTKAISLDYMTHRVVRTFPAL-SG  261

Query  886   EPRNYPSSGSAVLLPL---KNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRI  1056
             E RNYPS+GS+ +LPL    N   P   AEVLVCGG+P  + + A + +F+ A  TCGRI
Sbjct  262   ESRNYPSTGSSAMLPLILAVNSTQPVD-AEVLVCGGAPSHSNFQANKGLFLPASRTCGRI  320

Query  1057  VITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPD  1236
               TD +PEW  E MP  RVMGDM++LPTG VLIINGA  G AGW +GR+P   PVLY+PD
Sbjct  321   KATDDSPEWSIEAMPLNRVMGDMIMLPTGEVLIINGARKGTAGWGVGRDPVLSPVLYKPD  380

Query  1237  APPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSP  1416
              P G RFE+ +P  IPR+YHSSA L+ DGRVLV GSNP+  Y F+ V FPTELS++ FSP
Sbjct  381   EPIGHRFEVLSPASIPRLYHSSAHLLPDGRVLVGGSNPNMRYNFSGVLFPTELSLDIFSP  440

Query  1417  SYLDPKYAALRPEIVSPASQSGLSYGE--VVSVQFKVSGKVDMSQVKVTMVSPAFSTHSF  1590
              Y+  K  + RP I S      LSY +   ++++ K      +  + VTMV+P+F+THS 
Sbjct  441   PYM--KLKSSRPRITSIKPGRTLSYSQHFFINIEMKEKAIKGVDTILVTMVAPSFTTHSV  498

Query  1591  SMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             SMNQRLLVL  + +K   +  Y ++ V P S  LAP GYYLL++VH   PS+G+WV ++
Sbjct  499   SMNQRLLVLTVMGLKGGHDGSYRVECVPPGSAVLAPPGYYLLYLVHGGSPSRGVWVRLR  557



>ref|XP_011073112.1| PREDICTED: galactose oxidase [Sesamum indicum]
Length=549

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/532 (51%), Positives = 352/532 (66%), Gaps = 23/532 (4%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G+W+LL  SIGISAMHMQLL N+KVV FDRT+ GPSNISL   +C          R  P+
Sbjct  35    GEWHLLHRSIGISAMHMQLLKNNKVVIFDRTDFGPSNISLSGRRC----------RFDPN  84

Query  370   D-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
             D     +CTAHS+ YD+ +N FR + V +D WCSSG++ P GTLVQTGGY +G  V+R  
Sbjct  85    DRVLKKDCTAHSILYDIRTNGFRTLTVQTDTWCSSGALLPDGTLVQTGGYNDGDHVIRIL  144

Query  535   SPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADT-FYS  711
              PCN   CDW E P  L R RWY+++ ILPDGR IIVGGR  FNYEF+P   P+ +  + 
Sbjct  145   VPCNGGNCDWVEFPRSLSRRRWYASNQILPDGRVIIVGGRAQFNYEFYPGHSPSSSKSFR  204

Query  712   LPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEP  891
             L FL +T D   G ENNLYPF+ L  DGNLF+FAN R+I+ +Y  N +VR +P IPG +P
Sbjct  205   LNFLRETKD---GHENNLYPFLHLLPDGNLFVFANTRSIVFNYKRNQIVREFPAIPGADP  261

Query  892   RNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDP  1071
             RNYPSSGS+VLLP+   +    + E+++CGG+ ++A+  A R +F  A +TCGR+ IT  
Sbjct  262   RNYPSSGSSVLLPID--ENAPVVPEIMICGGATRNAFELANRGVFQRACSTCGRLKITKE  319

Query  1072  NPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGS  1251
              P W  E MP PRVM DM+ILP G V+IINGA +G AGW+  +NP   P++Y P+   G 
Sbjct  320   EPAWKIENMPMPRVMSDMLILPDGYVIIINGARSGTAGWEYAKNPVTRPLIYNPNGKAGV  379

Query  1252  RFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDP  1431
             RF +   +  PR+YHS+AVL+TDGR+LV GSNPH  Y FT V +PT+LS+E+FSP YL P
Sbjct  380   RFSIMAASSRPRLYHSTAVLLTDGRILVGGSNPHKYYNFTGVDYPTDLSLESFSPPYLSP  439

Query  1432  KYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLL  1611
              Y  LRP I+   +   + Y    S+ F V   V  S V V +V+P+F+THSFSMNQR++
Sbjct  440   VYDRLRPRIIR--TYEIIRYKNAFSLTFTVQRFVKTSAVSVRIVAPSFNTHSFSMNQRMV  497

Query  1612  VLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             VL   +V   G   Y +    P    +AP GYYLLF++H  IPS G+WV IQ
Sbjct  498   VLKGARVSRVGPNVYRVAASGPSKPEIAPPGYYLLFLLHAGIPSSGMWVKIQ  549



>ref|XP_010674901.1| PREDICTED: galactose oxidase [Beta vulgaris subsp. vulgaris]
Length=549

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/532 (52%), Positives = 357/532 (67%), Gaps = 19/532 (4%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G+W +LQ +IGISAMHMQL+ N+KV+ FDRT+ GPSN+SLP G+C +     +       
Sbjct  31    GEWQVLQENIGISAMHMQLMQNNKVIMFDRTDFGPSNLSLPFGRCRNDSSDIVLKI----  86

Query  370   DNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCND  549
              +CTAHSV YD+A+N+FRP+ V +D WCSSGS+ P G+LVQTGGY +G RVVR+F+PC D
Sbjct  87    -DCTAHSVVYDIATNTFRPLTVNTDTWCSSGSLLPDGSLVQTGGYNDGDRVVRKFTPCKD  145

Query  550   AECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSG-----PADTFYSL  714
               CDW E P  L   RWY+T+ ILPDGR II+GGRR F YEFFP +         TF+ L
Sbjct  146   DNCDWIEYPNYLSDRRWYATNQILPDGRVIIIGGRRVFTYEFFPSNSNSFPTSTSTFW-L  204

Query  715   PFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPR  894
              FL +T D     ENNLYPFV L   GNLFIFAN RAIL DY  NVVV+  P I GG PR
Sbjct  205   NFLLETHD---DEENNLYPFVHLLPTGNLFIFANTRAILFDYTLNVVVKELPSIDGGNPR  261

Query  895   NYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRN-IFVGALNTCGRIVITDP  1071
             NYPS+GS+VLLP+   K     AE+++CGGS   A+  A  N  F+ A + CGRI +TD 
Sbjct  262   NYPSTGSSVLLPIDENK--PIEAEIMICGGSQHGAFTQASTNRSFIRASSNCGRIKVTDE  319

Query  1072  NPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGS  1251
             NP W  E+MP PRVMGDM++LPTG++LI+NGA  G AGW+   NP   PV+YR       
Sbjct  320   NPHWNMEDMPMPRVMGDMLLLPTGDILIVNGAELGTAGWENAANPVTTPVIYRLYDNTDK  379

Query  1252  RFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDP  1431
             RF + + +  PRMYHS+A+L+TDGR+LV GSNPH  Y FTNV +PT+LS+EA+SP YL  
Sbjct  380   RFYVMSSSPRPRMYHSAAILLTDGRILVGGSNPHIYYNFTNVEYPTDLSLEAYSPPYLAI  439

Query  1432  KYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLL  1611
             +YA +RP I+      G  Y +  +V F V        V V +V+P+F+THS +MNQR++
Sbjct  440   EYAPMRPNIIYGDQVVG--YEQPFTVTFNVQQYQADEVVSVNLVAPSFTTHSLAMNQRMV  497

Query  1612  VLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             VL   K+       + + ++ P + N+AP GYYLLFVVH  IPS G+WV IQ
Sbjct  498   VLRISKISQLSLGMFNVGLMGPTTTNIAPPGYYLLFVVHAGIPSSGLWVKIQ  549



>ref|XP_006389311.1| glyoxal oxidase-related family protein [Populus trichocarpa]
 gb|ERP48225.1| glyoxal oxidase-related family protein [Populus trichocarpa]
Length=551

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/532 (52%), Positives = 367/532 (69%), Gaps = 21/532 (4%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G+W LL  ++GISAMHMQL+H++KVV FDRT+ GPSNISLP G+C          R  P 
Sbjct  35    GRWRLLHANVGISAMHMQLMHDNKVVIFDRTDFGPSNISLPGGRC----------RIDPS  84

Query  370   D-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
             D     +CTAHS+ YD+ ++++RP++V +D WCSSG+V P GTLVQTGG+ +G  V R +
Sbjct  85    DEALKIDCTAHSILYDIITDTYRPLMVQTDTWCSSGAVLPNGTLVQTGGFHDGDNVTRMY  144

Query  535   SPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSL  714
             + C D  CDW E P  L R RWY+T+ ILPDGR II+GGRR F+YEFFP+  P    + L
Sbjct  145   TSCPDDICDWVEYPNYLSRRRWYATNQILPDGRIIIIGGRREFSYEFFPRPSPRRQTFQL  204

Query  715   PFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPR  894
               L +T +  +  ENNLYP+V L  DGNLFIFAN R+IL DY  N VVR +P IPGG+PR
Sbjct  205   RLLIETREGNV--ENNLYPYVHLFPDGNLFIFANTRSILFDYNQNRVVREFPRIPGGDPR  262

Query  895   NYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPN  1074
             NYPS+GS+VLLPL   +  +   EVLVCGG+P+ AY  A R  +V A++TCGR+ ITD N
Sbjct  263   NYPSTGSSVLLPLDENEH-SIDPEVLVCGGAPRGAYQQALRGTYVRAISTCGRLRITDQN  321

Query  1075  PEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSR  1254
               W+ + MP PRVMGDM++LPTG+V+IING  +G AGW+LGR  A  PV+Y P  P   R
Sbjct  322   ASWVMDTMPIPRVMGDMLLLPTGDVIIINGGQSGTAGWELGRQAATRPVMYHPSNPSDQR  381

Query  1255  FELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPK  1434
             F +  P+  PRMYHS+A+L+TDGRVLV G NPH  Y F++VF+PT+LS+E FSP YL  +
Sbjct  382   FSVMEPSPRPRMYHSAAILLTDGRVLVGGGNPHIYYNFSDVFYPTDLSLETFSPPYLSTQ  441

Query  1435  YAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLV  1614
             YA++RP I+S      +S G+   + F V   +  S + V +V+P+F+THS+SMNQR++V
Sbjct  442   YASIRPVILS--VDDTVSPGQRFLLSFSVGEYIAGSVLSVRIVAPSFTTHSYSMNQRMVV  499

Query  1615  LNTVK-VKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             L   + +       Y + VV P S  +AP GYYLL+VVH  IPS G+WV +Q
Sbjct  500   LRIDEIIDNETSSSYTLSVVGPSSAEIAPPGYYLLYVVHSGIPSSGVWVRLQ  551



>gb|KFK35620.1| hypothetical protein AALP_AA4G014800 [Arabis alpina]
Length=549

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/533 (51%), Positives = 358/533 (67%), Gaps = 25/533 (5%)
 Frame = +1

Query  193   KWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPDD  372
             +W +LQPSIGISAMHMQLLHN  V+ FDRT+ G SNISL  G C          R  P D
Sbjct  34    RWEVLQPSIGISAMHMQLLHNGMVIMFDRTDFGNSNISLAGGMC----------RYDPSD  83

Query  373   -----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFS  537
                  +C+AHSV YDVASN++RP+ V +D WCSSGSV P GTLVQTGGY +G R  R F+
Sbjct  84    TAVKFDCSAHSVLYDVASNTYRPLKVQTDTWCSSGSVLPNGTLVQTGGYNDGDRAARMFT  143

Query  538   PCNDAE-CDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSL  714
             PC  +E CDW E P  L + RWY+T+ ILPDGR I+VGGRR FN+E FP++         
Sbjct  144   PCGFSETCDWIEFPQYLTQRRWYATNQILPDGRIIVVGGRRQFNFEIFPRADYRSIESRF  203

Query  715   PFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPR  894
              FL +TTD     ENNLYPF+ L  DGNLF+FAN R+I+ DY  N +VR +PEIPGG+PR
Sbjct  204   EFLRETTDGS--NENNLYPFLHLLPDGNLFVFANTRSIVFDYKRNRIVREFPEIPGGDPR  261

Query  895   NYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNI-FVGALNTCGRIVITDP  1071
             NYPSSGS++LLPL         AE++VCGG+PK A+   K    F  A +TCGR+ +T  
Sbjct  262   NYPSSGSSILLPLDETNNVDLEAEIMVCGGAPKGAFSGVKNGRGFARATSTCGRLKLTGA  321

Query  1072  NPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGS  1251
             NP W  E MP PRVMGDM++LPTG+V+I+NGA  G AGW+  R+P   PV+Y P      
Sbjct  322   NPSWEMETMPLPRVMGDMLLLPTGDVIIVNGAGTGTAGWENARDPLTRPVIYYPFE---R  378

Query  1252  RFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDP  1431
             RF + +    PRMYHSSAVL+ DGR+LV GSNPH  Y FTNV +PTELS+EA+SP YL  
Sbjct  379   RFSVMSTASRPRMYHSSAVLLADGRILVGGSNPHVYYNFTNVEYPTELSLEAYSPPYLSF  438

Query  1432  KYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLL  1611
                ++RP+I++  S   ++Y  + ++ F ++  + +  + V +V+P+F+THSF+MNQR++
Sbjct  439   TSDSIRPKILT--SGKVVNYKTLFNLSFSIAQFLTIDLLSVRIVAPSFTTHSFAMNQRMV  496

Query  1612  VLNTVKVKAAG-EEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             +L  + V   G    Y I+V+ P +  +AP GYY++F+VH  +PS G WV I+
Sbjct  497   ILKLISVARDGLTNSYRINVLGPSTAEIAPPGYYMMFLVHSGVPSSGTWVQIE  549



>ref|XP_007147126.1| hypothetical protein PHAVU_006G098100g [Phaseolus vulgaris]
 gb|ESW19120.1| hypothetical protein PHAVU_006G098100g [Phaseolus vulgaris]
Length=552

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/534 (51%), Positives = 358/534 (67%), Gaps = 23/534 (4%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G+W LL PSIGIS MHMQLLHNDKV+ FDRT+ G S + L +G+C          R  P 
Sbjct  34    GQWQLLHPSIGISPMHMQLLHNDKVIMFDRTDFGHSYLPLSNGRC----------RMDPF  83

Query  370   D-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
             D     +C+AHS  YDVA+N+ RP+++ +D WCSSG+V P GTL+QTGGY +G R +R F
Sbjct  84    DIALKLDCSAHSALYDVATNTLRPLMIQTDTWCSSGAVLPNGTLIQTGGYNDGERNIRMF  143

Query  535   SPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYS-  711
             +PC D  CDW E P  L + RWY+T+ ILPD R I+VGGRR FNYEF PK+   +++ S 
Sbjct  144   TPCFDETCDWVEFPRLLSQRRWYATNQILPDARVIVVGGRRQFNYEFLPKTANPNSYPSS  203

Query  712   --LPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGG  885
               L FL +T+D    +ENNLYPFV L  DGNLFIFAN +++L DY  N V++ +P IPG 
Sbjct  204   VPLNFLQRTSD---TSENNLYPFVHLLPDGNLFIFANTKSVLFDYKLNSVIKEFPPIPGE  260

Query  886   EPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVIT  1065
             +PRNYPSSGS+VLLPL     P   AEV+VCGG+P+ ++ +A R  F+ AL +CGR+ +T
Sbjct  261   DPRNYPSSGSSVLLPLDENLVPL-QAEVVVCGGAPRGSFESALRGSFMQALASCGRLRLT  319

Query  1066  DPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPP  1245
              PNP W+ E MP PR MGDM++LP G+V+IING   G AGW+ GR P   P+++RP +  
Sbjct  320   HPNPNWVMENMPMPRAMGDMLLLPNGDVVIINGVGAGTAGWEHGREPVLTPLIFRP-SET  378

Query  1246  GSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYL  1425
              +RF +  P   PR+YHSSAVL+ DGRVLV GSNPH  Y FT V +PT+LS+EAFSP YL
Sbjct  379   VNRFSIMAPASRPRLYHSSAVLLKDGRVLVGGSNPHVFYNFTGVEYPTDLSLEAFSPPYL  438

Query  1426  DPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQR  1605
              P++  +RP I    + + L +     V F VS     S V + +++P+F+THSF  NQR
Sbjct  439   APEFNPVRPTIRYVTNNNVLGFRTFCYVTFSVSDFGSASDVSIRILAPSFTTHSFGQNQR  498

Query  1606  LLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             ++VL    V   G E Y   VV P +  +AP GYY+LFVVH+ +PS G WV + 
Sbjct  499   MVVLKLRGVTYLGGEAYYATVVGPSTAEIAPPGYYILFVVHKGVPSSGWWVQVM  552



>ref|XP_010532190.1| PREDICTED: galactose oxidase [Tarenaya hassleriana]
Length=555

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/534 (51%), Positives = 359/534 (67%), Gaps = 26/534 (5%)
 Frame = +1

Query  193   KWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPDD  372
             +W LLQ +IGISAMHMQLLHND V+ FDRT+ G SNISLP G C          R  P D
Sbjct  39    RWQLLQSNIGISAMHMQLLHNDMVIMFDRTDFGTSNISLPGGLC----------RYDPYD  88

Query  373   -----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFS  537
                  +CTAHSV YDV SN++RP+ V +D WCSSGSV P GTLVQTGGY +G RV+R F+
Sbjct  89    TAVKFDCTAHSVIYDVVSNTYRPLKVQTDTWCSSGSVLPNGTLVQTGGYNDGERVMRMFT  148

Query  538   PCNDAE-CDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSL  714
             PC   E CDW E P  L   RWY+T+ ILPDGR I+VGGRR FN+EFFP+       +  
Sbjct  149   PCGYGETCDWIEFPRYLANRRWYATNQILPDGRIIVVGGRRQFNFEFFPRVQSNIRGFRF  208

Query  715   PFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPR  894
              FL +T+D     ENNLYPFV L  DGNLF+FAN R+IL DY  N + + YPEIPGG+PR
Sbjct  209   DFLRETSDGS--NENNLYPFVHLLPDGNLFVFANTRSILFDYRRNKITKEYPEIPGGDPR  266

Query  895   NYPSSGSAVLLPLKNLKGP--TTMAEVLVCGGSPKDAYYNA-KRNIFVGALNTCGRIVIT  1065
             NYPSSGS++LLPL+    P  +   EV+VCGG+PK ++  A K+  F  A++TCGR+ +T
Sbjct  267   NYPSSGSSILLPLQETYNPNKSIEVEVMVCGGAPKGSFTKANKQQTFARAVSTCGRMRLT  326

Query  1066  DPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPP  1245
             D NP W  E MP PRVM DM++LPTG+V+I+NGA +G AGW+   +P   P++YRP    
Sbjct  327   DENPSWQMETMPLPRVMSDMLLLPTGDVIIVNGAASGTAGWENAHDPVTRPIIYRPY---  383

Query  1246  GSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYL  1425
               RF + + +  PRMYHSSA+L++DGR+LV GSNPH  Y FTNV +PT+LS+E +SP Y+
Sbjct  384   DHRFSVMSTSARPRMYHSSAILLSDGRILVGGSNPHIYYNFTNVEYPTDLSLEVYSPPYI  443

Query  1426  DPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQR  1605
                Y   RP+I++      L+Y  +  + F +   + + ++ V ++SP+F+THSF+MNQR
Sbjct  444   SSIYDPFRPKILN--YDKILNYERLNILCFSIQEFISLDRLSVRIISPSFTTHSFAMNQR  501

Query  1606  LLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             ++VL   +V       Y I    P +  +AP GYY++FVVH  +PS G+WV ++
Sbjct  502   MVVLRLHEVAHHESGPYWITAFGPSTAEIAPPGYYMMFVVHAGVPSSGVWVKLE  555



>gb|EPS72896.1| hypothetical protein M569_01859, partial [Genlisea aurea]
Length=516

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/528 (51%), Positives = 358/528 (68%), Gaps = 14/528 (3%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
              GG+W LLQ SIGISAMHMQLL++D+VV FDRT+ GPSN+SLP+G+C +     +  +  
Sbjct  2     AGGEWRLLQRSIGISAMHMQLLNDDRVVVFDRTDFGPSNLSLPNGRCRYDSHEMVSKK--  59

Query  364   PDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPC  543
                +CTAHSV YDV+SN+FR + V +D WCSSG+V P GTL+Q GG+ +G + VR  SPC
Sbjct  60    ---DCTAHSVLYDVSSNTFRALTVQTDPWCSSGAVLPNGTLLQIGGFNDGAQTVRMQSPC  116

Query  544   NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFL  723
             +  +CDW E P  L R RWY+T  ILPDG  I+VGGRR ++YEF+P+   + +F    FL
Sbjct  117   SGGDCDWVEFPRVLSRRRWYATAQILPDGDVIVVGGRREYSYEFWPRRSDSGSF-EFDFL  175

Query  724   AQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYP  903
              +T+D    +ENNLYPFV L  DGNLFIFAN R++L DY  N VVR +PEI GG+ RNYP
Sbjct  176   RETSD---DSENNLYPFVHLLPDGNLFIFANTRSVLFDYRRNDVVREFPEIRGGDARNYP  232

Query  904   SSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEW  1083
             SSG++VLLP+      +  +E+++CGG+   AY  A R  F  A +TC R+ +    PEW
Sbjct  233   SSGASVLLPIDETAAESN-SEIMICGGASPAAYQAALRGTFRRATSTCARLNLAAREPEW  291

Query  1084  ITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRFEL  1263
               E MP PRVM DM+ILPTG+ LI+NGAT+GAAGW+  R+P+  P++YRP+  P  RF +
Sbjct  292   KLEHMPTPRVMSDMLILPTGDFLIVNGATSGAAGWENARDPSMRPLIYRPNEQPDGRFSV  351

Query  1264  QNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAA  1443
                ++ PR+YHS+AVL+ DGR+LV GSNPH  Y FT V +PT+LS+E+FSP YL P    
Sbjct  352   MAESQRPRLYHSTAVLLADGRILVGGSNPHEYYNFTGVDYPTDLSLESFSPPYLSPDNDH  411

Query  1444  LRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNT  1623
             LRP I    +   LSY +  +V F     ++ S V V +++P FSTHSFSMNQR++VL  
Sbjct  412   LRPRITD--ADRILSYHKPFTVDFTAE-SLNPSAVTVRLLAPPFSTHSFSMNQRMVVLKI  468

Query  1624  VKVKA-AGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
               +   +      ++  AP +  +AP GYYLLFVVH EIPS G W+ I
Sbjct  469   AAISCDSSRMRCHVNAAAPSTAEIAPPGYYLLFVVHCEIPSHGSWIKI  516



>ref|XP_007046239.1| Glyoxal oxidase-related protein, putative [Theobroma cacao]
 gb|EOY02071.1| Glyoxal oxidase-related protein, putative [Theobroma cacao]
Length=557

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/542 (51%), Positives = 370/542 (68%), Gaps = 27/542 (5%)
 Frame = +1

Query  163   AAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGK-CHHggg  339
              ++ +V  GG W LLQPS+GISAMH+QLL N+KV+ FDRT+ GPSN+SLP G  C     
Sbjct  36    TSSLSVVSGGYWQLLQPSVGISAMHVQLLPNNKVIIFDRTDSGPSNLSLPAGSFC-----  90

Query  340   gglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTR  519
                     P ++CTAHS+ YDV SN+FRP+ VL+D WCSSGS+ P GTL+QTGGY +G  
Sbjct  91    --------PKNDCTAHSLLYDVVSNTFRPLHVLTDTWCSSGSLDPNGTLIQTGGYNDGDH  142

Query  520   VVRRFSPCNDAECDWEEI-PYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKS---  687
             V+R FSPC+   CDW E+    L+  RWY+T+ +LPDGR II+GGRR F YEF+PK+   
Sbjct  143   VIRIFSPCDTYACDWYELTATHLIDRRWYATNQVLPDGRIIILGGRRVFTYEFYPKNDFV  202

Query  688   GPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTY  867
                 +FY L FL +T DP    ENNLYPF+ L  DGNLFIFAN ++IL DY   +V+R +
Sbjct  203   SNNKSFY-LRFLVETRDP---EENNLYPFLHLLPDGNLFIFANQKSILFDYKKGIVLRQF  258

Query  868   PEIPGGEPRNYPSSGSAVLLPLK-NLKGPTTMAEVLVCGGSPKDAYYNA-KRNIFVGALN  1041
             P +PG + RNYPS+GS+V+LPL+ +  GP  + EVLVCGG+P  A+  A K  +FV A  
Sbjct  259   PLMPGDDKRNYPSTGSSVMLPLRLSWTGPP-VVEVLVCGGAPAGAFLKADKMKVFVEASR  317

Query  1042  TCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPV  1221
             TCGR+ + DPNP+W+ E MP PRVM DM++LPTG+V+IINGA NG AGW+   N   +PV
Sbjct  318   TCGRLKVNDPNPQWLIEFMPIPRVMSDMILLPTGDVIIINGAANGTAGWENAVNAVLNPV  377

Query  1222  LYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSM  1401
             LY  +  P  RF +  P+KIPRMYHS+A+L+ DGR+LV GSNPH  Y FT   +PT+LS+
Sbjct  378   LYSVNEVPLRRFTVLAPSKIPRMYHSAALLLPDGRILVGGSNPHTRYVFTGP-YPTDLSL  436

Query  1402  EAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFST  1581
             EA++P Y+DPK+ +LRP ++S    + L YG+   V F +          V +V+P+F+T
Sbjct  437   EAYNPYYMDPKFNSLRPSVLSLEPGNALVYGQRFGVSFSLP-LYKQGAAYVALVAPSFTT  495

Query  1582  HSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVH  1761
             HS  MNQR+++L+T  V       + + VV P + ++AP GYY+LFVVH  IPS  +WV 
Sbjct  496   HSIGMNQRVVILSTASVVQLSMFNHKLVVVGPTNASVAPPGYYMLFVVHSGIPSHAVWVK  555

Query  1762  IQ  1767
             + 
Sbjct  556   VM  557



>ref|XP_011003791.1| PREDICTED: galactose oxidase-like [Populus euphratica]
Length=551

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/532 (52%), Positives = 365/532 (69%), Gaps = 21/532 (4%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G W LLQ ++GISAMHMQL+H++KVV FDRT+ GPSNISLP G+C          R  P 
Sbjct  35    GNWRLLQANVGISAMHMQLMHDNKVVIFDRTDFGPSNISLPGGRC----------RIDPS  84

Query  370   D-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
             D     +CTAHS+ YD+ ++++RP++V +D WCSSG+V P GTLVQTGG+ +G  V R +
Sbjct  85    DEALKIDCTAHSILYDIITDTYRPLMVQTDTWCSSGAVLPNGTLVQTGGFHDGDNVTRMY  144

Query  535   SPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSL  714
             + C +  CDW E P  L R RWY+T+ ILPDGR II+GGRR F+YEFFP+  P    + L
Sbjct  145   TSCPNDSCDWVEYPNYLSRRRWYATNQILPDGRIIIIGGRREFSYEFFPRPSPRRQTFQL  204

Query  715   PFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPR  894
               L +T +  +  ENNLYP+V L  DGNLFIFAN ++IL DY  N VVR +P IPGG+PR
Sbjct  205   RLLIETREGNV--ENNLYPYVHLLPDGNLFIFANTQSILFDYNQNRVVREFPRIPGGDPR  262

Query  895   NYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPN  1074
             NYPS+GS+VLLPL   +  +   EVLVCGG+P+ AY  A R  ++ A++TCGR+ ITD N
Sbjct  263   NYPSTGSSVLLPLDENEH-SIDPEVLVCGGAPRGAYQQALRGTYIRAISTCGRLRITDQN  321

Query  1075  PEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSR  1254
               W+ E MP PRVMGDM++LPTG+V+IING   G AGW+LGR  A  PV+Y P  P   R
Sbjct  322   ASWVMETMPIPRVMGDMLLLPTGDVIIINGGQLGTAGWELGRQAATRPVMYHPSNPSDQR  381

Query  1255  FELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPK  1434
             F +  P+  PRMYHS+A+L+TDGRVLV G NPH  Y F++VF+PT+LS+E FSP YL  +
Sbjct  382   FSVMEPSPRPRMYHSAAILLTDGRVLVGGGNPHIYYNFSDVFYPTDLSLETFSPPYLSTQ  441

Query  1435  YAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLV  1614
             YA++RP I+S      +S G+   + F V   +  S + V +V+P+F+THS+SMNQR++V
Sbjct  442   YASIRPVILS--VDDTVSPGQRFLLSFSVGEYIAGSVLSVRIVAPSFTTHSYSMNQRMVV  499

Query  1615  LNTVK-VKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             L     +       Y + VV P S  +AP GYYLL+VVH  IPS G+WV +Q
Sbjct  500   LRIDGIIHNETSSSYTLSVVGPSSAEIAPPGYYLLYVVHSGIPSSGVWVRLQ  551



>ref|XP_003626387.1| Galactose oxidase [Medicago truncatula]
 gb|AES82605.1| glyoxal oxidase amino-terminal protein [Medicago truncatula]
Length=570

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/537 (51%), Positives = 357/537 (66%), Gaps = 26/537 (5%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G+W L+QP+IGISAMHMQL HN+K++ FDRT+ GPSN+ L +G+C          R  P 
Sbjct  49    GEWELIQPTIGISAMHMQLSHNNKIIIFDRTDFGPSNLPLSNGRC----------RMDPF  98

Query  370   D-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
             D     +CTAHSV YD+A+N+FR + V +D WCSSGSV   GTLVQTGG+ +G R +R F
Sbjct  99    DTALKIDCTAHSVLYDIATNTFRSLTVQTDTWCSSGSVLSNGTLVQTGGFNDGERRIRMF  158

Query  535   SPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYS-  711
             +PC +  CDW E P  L   RWY+T+ ILPD R II+GGRR FNYEF PK+  + +  S 
Sbjct  159   TPCFNENCDWIEFPSYLSERRWYATNQILPDNRIIIIGGRRQFNYEFIPKTTTSSSSSSS  218

Query  712   ----LPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIP  879
                 L FL +T DP   +ENNLYPFV L  +GNLFIFAN R+IL DY  NVVV+ +PEIP
Sbjct  219   SSIHLSFLQETNDP---SENNLYPFVHLLPNGNLFIFANTRSILFDYKQNVVVKEFPEIP  275

Query  880   GGEPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIV  1059
             GG+P NYPSSGS+VLLPL      +  A +++CGG+P+ ++  AK   F+ AL TCG + 
Sbjct  276   GGDPHNYPSSGSSVLLPLDE-NQISMEATIMICGGAPRGSFEAAKGKNFMPALKTCGFLK  334

Query  1060  ITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYR-PD  1236
             +TD NP WI E MP  RVMGDM+ILP G+V+IINGA +G AGW+ GR P   PV++R  +
Sbjct  335   VTDSNPSWIIENMPMARVMGDMLILPNGDVIIINGAGSGTAGWENGRQPVLTPVIFRSSE  394

Query  1237  APPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSP  1416
                  RF + +P   PR+YHSSA+++ DGRVLV GSNPH  Y FT V FPT+LS+EAFSP
Sbjct  395   TKSDKRFSVMSPASRPRLYHSSAIVLRDGRVLVGGSNPHVNYNFTGVEFPTDLSLEAFSP  454

Query  1417  SYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSM  1596
              YL  ++  +RP I    +   L Y     V F V+     S+V V +++P+F+THSF M
Sbjct  455   PYLSLEFDLVRPTIWH-VTNKILGYRVFYYVTFTVAKFASASEVSVRLLAPSFTTHSFGM  513

Query  1597  NQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             NQR++VL  + V     + Y   VV P +  +AP GYYLLF+VH  +PS G WV + 
Sbjct  514   NQRMVVLKLIGVTMVNLDIYYATVVGPSTQEIAPPGYYLLFLVHAGVPSSGEWVQLM  570



>emb|CDP00283.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/524 (51%), Positives = 364/524 (69%), Gaps = 21/524 (4%)
 Frame = +1

Query  232   MHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPDDNCTAHSVEYDVAS  411
             MHMQLL+N+KVV FDRT+ G SNISLP G+C     G L        +CTAHSV YD+ +
Sbjct  1     MHMQLLYNNKVVIFDRTDFGRSNISLPFGRCRFSVDGKLRI------DCTAHSVIYDIVT  54

Query  412   NSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCNDAECDWEEIPYGLVR  591
             N+FRP++V +D WCSS +V+P G LVQTGGY  G   +R F+PCN+  CDW E+P  L  
Sbjct  55    NTFRPLMVQTDVWCSSAAVNPDGVLVQTGGYRGGADKIRLFTPCNNDFCDWIELPQNLTV  114

Query  592   PRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSG---PADTFYSLPFLAQTTDPGLGAENN  762
              RWY++D ILPDGR IIVGGRRAF+YEFFPK+         Y L FL +T+DP    ENN
Sbjct  115   RRWYASDQILPDGRIIIVGGRRAFSYEFFPKNSVFFSNAEVYWLQFLKETSDP--REENN  172

Query  763   LYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYPSSGSAVLLPLK--  936
             LYPF+ L  DGNLF+FAN  +++LDYVNN ++R +P IP GE R+YPS+GS+VLLPL+  
Sbjct  173   LYPFLHLLPDGNLFVFANQHSVILDYVNNKILRKFPPIP-GEKRSYPSTGSSVLLPLRLT  231

Query  937   ----NLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNPEWITEEMPF  1104
                  L  P+   EV++CGG+   +Y  A+  ++V A  +CGR+ +TDP+PEW  E MP 
Sbjct  232   GSGSRLGSPSPEVEVMICGGANGGSYIQARLGVYVAASKSCGRLRVTDPDPEWEMETMPM  291

Query  1105  PRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRP-DAPPGSRFELQNPNKI  1281
              RVM DM++LPTG+VLI+NGA+ G+AGW+L  +P  HPVLYRP +  P  RF + NP   
Sbjct  292   NRVMPDMLLLPTGDVLILNGASKGSAGWELADDPVLHPVLYRPSEMDPQQRFTVLNPTVN  351

Query  1282  PRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKYAALRPEIV  1461
             PR+YHS+AVL+ DGRVLV GSNPHA Y+FT V +PT+L++EAF P YL P+Y+ LRP I+
Sbjct  352   PRLYHSAAVLLPDGRVLVGGSNPHALYRFTGVKYPTDLTLEAFLPPYLGPQYSQLRPSIL  411

Query  1462  S--PASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVLNTVKVK  1635
             +    + + +SYG+  S+ F +         +VTM++P+F+THSF+MNQRL++L+ V  +
Sbjct  412   TFEGPTDNIISYGQQFSITFTLGLHPPGQDFRVTMIAPSFTTHSFAMNQRLVMLDVVGYQ  471

Query  1636  AAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
                   + + V AP + N+AP GYY+ FVV+  IPS G+W+ ++
Sbjct  472   QLSAFAFKVTVCAPPTRNIAPPGYYMTFVVNGGIPSTGVWIRMK  515



>ref|XP_010523439.1| PREDICTED: galactose oxidase-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010523440.1| PREDICTED: galactose oxidase-like isoform X2 [Tarenaya hassleriana]
Length=565

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/544 (53%), Positives = 380/544 (70%), Gaps = 30/544 (6%)
 Frame = +1

Query  172   AAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglg  351
             A +  GG W+LLQ S+G+SAMHMQLLHN+KVV FDRT+ GPSN+SLP G C         
Sbjct  38    AEILAGGSWDLLQRSVGVSAMHMQLLHNNKVVIFDRTDTGPSNLSLPSGSC---------  88

Query  352   gRKPPDD---NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRV  522
                 PDD   +C+AHS+ YDV SN++RP+ +LSD WCSSGS+  +G+L+QTGGYG G R 
Sbjct  89    ----PDDAVYDCSAHSLLYDVVSNTYRPLSLLSDTWCSSGSLDSSGSLIQTGGYGAGIRA  144

Query  523   VRRFSPC---NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGP  693
             VR+ +PC   +D  CDW E    L   RWYST+ ILPDGR IIVGGRRAF YEF+PK+ P
Sbjct  145   VRKITPCFGNDDVFCDWTENNTYLSFRRWYSTNQILPDGRIIIVGGRRAFTYEFYPKN-P  203

Query  694   ADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPE  873
                 ++L FLA+T DP    ENNLYPF+ L  +GNLF+FAN R+I+LD+VN+ VV+ +P+
Sbjct  204   DKPIFNLGFLAETRDPL--EENNLYPFLHLLPNGNLFVFANRRSIMLDFVNHSVVKEFPD  261

Query  874   IPGGEPRNYPSSGSAVLLPLKNLKGPT--TMAEVLVCGGSPKDAYYNAKRNI---FVGAL  1038
             IPGG  RNYPS+GS+VLLPL  L G T  T AE+++CGG+P  ++  A + I   FV A 
Sbjct  262   IPGGGKRNYPSTGSSVLLPLW-LAGETQPTTAEIMICGGAPTGSFLKAAKTIPKVFVEAS  320

Query  1039  NTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHP  1218
              TCGRI +TDP+P W+ E+MP PRVM DM++LPTG+V+IINGA NG AGW+   N   +P
Sbjct  321   RTCGRIRVTDPDPRWVMEKMPAPRVMPDMIMLPTGDVVIINGAANGTAGWEDATNAVLNP  380

Query  1219  VLYRPDAPPGS-RFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTEL  1395
             VLY PD P  + RF++  P +IPRMYHS+A+L+ DGR+LV GSNPH  Y FT   +PTEL
Sbjct  381   VLYSPDEPDLTRRFQILAPTRIPRMYHSAALLLPDGRILVGGSNPHRNYNFTARPYPTEL  440

Query  1396  SMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSG-KVDMSQVKVTMVSPA  1572
             S+EA+ P YL+P++A +RP +++      +SYG   SV F +    V    + V +++P+
Sbjct  441   SLEAYHPRYLEPRFARVRPSVLTVEMAGKMSYGNGFSVNFVIPAYGVYGGGISVRLIAPS  500

Query  1573  FSTHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGI  1752
             FSTHS +MNQRLLVL   +V       Y  DV  P + N+AP GYY+LFVVHR IPS+ +
Sbjct  501   FSTHSTAMNQRLLVLRVRRVVQLSVFAYKADVDGPANANVAPPGYYMLFVVHRGIPSEAV  560

Query  1753  WVHI  1764
             WV +
Sbjct  561   WVKV  564



>ref|XP_006828863.1| hypothetical protein AMTR_s00001p00165980 [Amborella trichopoda]
 gb|ERM96279.1| hypothetical protein AMTR_s00001p00165980 [Amborella trichopoda]
Length=546

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/536 (53%), Positives = 358/536 (67%), Gaps = 26/536 (5%)
 Frame = +1

Query  184   GGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKP  363
             GGG W +LQ SIGISAMHMQL+ NDKVV FDRT+ G SNISLP G+C          ++ 
Sbjct  29    GGGAWEVLQQSIGISAMHMQLMPNDKVVMFDRTDFGSSNISLPSGQCR-----TDPHQEA  83

Query  364   PDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPC  543
                +C+AHSVEY +A+NS RP+ + +D WCSSGS+   G L+QTGG+ +G RVVR  S C
Sbjct  84    LTHDCSAHSVEYTIATNSIRPLTIQTDTWCSSGSLDRNGQLIQTGGFRDGDRVVRTISSC  143

Query  544   NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLPFL  723
             +   CDW E P  L   RWY+TD ILPDGR IIVGGRR +NYEF+P+  P    + L FL
Sbjct  144   D--ACDWTEYPENLAVRRWYATDLILPDGRIIIVGGRRQYNYEFYPQQNP--NLFELGFL  199

Query  724   AQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYP  903
              +T+D     ENNLYPF+ L  DG LFIF N RA+L DY  N V+R  P IPGGEPRNYP
Sbjct  200   RETSDQD---ENNLYPFLHLLPDGTLFIFTNTRAVLFDYNGNRVLRELPAIPGGEPRNYP  256

Query  904   SSGSAVLLPLK--NLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNP  1077
             SSGS+VLLPL      G  T  E+L+CGG+P  ++  A +  F+ A +TCGRI   DP  
Sbjct  257   SSGSSVLLPLTLTGEAGQETDPEILLCGGAPFGSFDKAVQGEFLEASSTCGRIRPMDPQA  316

Query  1078  EWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRF  1257
             +W  E MP  RVMGDM++LP G VLIINGA NG AGW+ GRNP   PV+Y P  P G RF
Sbjct  317   QWAMETMPMGRVMGDMLLLPNGEVLIINGAGNGTAGWEFGRNPVKTPVIYSPSLPLGQRF  376

Query  1258  ELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKY  1437
             ++ NP+  PR+YHS+A +I DGRVLV GSNPH  Y+F N  FPT+LS+EAF P YL  ++
Sbjct  377   QVLNPSSTPRLYHSTATVIPDGRVLVGGSNPHTLYQFYNQEFPTDLSLEAFLPPYLSMQH  436

Query  1438  AALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVL  1617
                RP IVS  +Q  LSY +   V + ++  + M ++ V +++P+F+THSF MNQRLL L
Sbjct  437   LTRRPRIVSSYTQP-LSYAQPTEVMYFLADPLPMGEITVRLLAPSFTTHSFGMNQRLLTL  495

Query  1618  NTVKVKAAGEE------EYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
                  K AGE        Y + V+AP + N+AP GYY++FVVH  +PS G+WV +Q
Sbjct  496   -----KVAGEVVQLSLFTYRVTVLAPPNPNIAPPGYYMMFVVHSGVPSAGVWVQMQ  546



>tpg|DAA44471.1| TPA: hypothetical protein ZEAMMB73_122663 [Zea mays]
Length=548

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/555 (52%), Positives = 357/555 (64%), Gaps = 62/555 (11%)
 Frame = +1

Query  169   AAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHgggggl  348
             A A   GG+W+L Q SIG+SAMHMQLLHND+V+ FDRT+ G SN+SLPDG+C        
Sbjct  32    APASGAGGRWDLQQRSIGVSAMHMQLLHNDRVIIFDRTDFGHSNLSLPDGRCR----VNP  87

Query  349   ggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVR  528
               R  P  +CTAHSVEYDVA+N+FR    +    CS G                      
Sbjct  88    RERVLPQGDCTAHSVEYDVAANAFRNARTMPA--CSDG----------------------  123

Query  529   RFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADT-F  705
                   D  CDW E    L   RWY+T+ ILPDGR  I+GGRR F+YEF+PK+GP+DT  
Sbjct  124   ------DESCDWSETQDALSANRWYATNQILPDGRAFIIGGRRQFSYEFYPKAGPSDTSV  177

Query  706   YSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGG  885
               +PFL QT DP    ENNLYPFV LN+DGNLFIF+NNRA+LLDY +N +VRTYP +  G
Sbjct  178   IPMPFLVQTRDP---EENNLYPFVHLNIDGNLFIFSNNRAVLLDYSSNKIVRTYPVLGDG  234

Query  886   EPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRN------IFVGALNTC  1047
             +PRNYPSSGS+VLLPLK    PT  AEVLVCGG+P  +Y + K+        FV AL TC
Sbjct  235   DPRNYPSSGSSVLLPLK--PNPTE-AEVLVCGGAPAGSYNSTKQQQGGTAGAFVPALTTC  291

Query  1048  GRIVITDPNPEWITEEMPFPRVMGDMVILPTG-NVLIINGATNGAAGWDLGRNPAFHPVL  1224
             GRI ITD  P W+ E MP PRVMGDMV+LP G  V IINGA +G AGW+  + PA+ PV+
Sbjct  292   GRIKITDAAPAWVIETMPSPRVMGDMVLLPNGAEVAIINGAADGTAGWESAKTPAYAPVV  351

Query  1225  YRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSME  1404
             YRPD  PG RFE QN   + R+YHSSAVL+ DGR+LV GSNPH  Y F+NV FPT+LS+E
Sbjct  352   YRPDHSPGDRFEEQNAAGVARLYHSSAVLLRDGRLLVGGSNPHTYYNFSNVQFPTDLSLE  411

Query  1405  AFSPSYLDPKYAALRPEIVSPA---SQSGLSYGEVVSVQFKV---------SGKVDMSQV  1548
             AFSP YLD     LRP I+ P+   + + + YG  ++++F V              +  V
Sbjct  412   AFSPEYLDASNDMLRPRILDPSPTGAPASVGYGATMAIRFLVPALARRRRGGRAGGLGDV  471

Query  1549  KVTMVSPAFSTHSFSMNQRLLVLNTVK-VKAAGEE-EYGIDVVAPDSGNLAPSGYYLLFV  1722
              VTMV+P+F+THSF+MNQRLL L+  K V   G    +   V  P +  LAP GYY+LFV
Sbjct  472   SVTMVAPSFTTHSFAMNQRLLFLDVTKNVAVRGRAGAFSASVTMPATAVLAPPGYYMLFV  531

Query  1723  VHREIPSKGIWVHIQ  1767
             V+  IPS+GIWV IQ
Sbjct  532   VNGHIPSEGIWVKIQ  546



>ref|XP_008340335.1| PREDICTED: uncharacterized protein LOC103403295 [Malus domestica]
Length=940

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/544 (51%), Positives = 370/544 (68%), Gaps = 20/544 (4%)
 Frame = +1

Query  160   TAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGK-CHHgg  336
             T   + V  GG+W LL  SIG+SAMHMQLL NDKV+ FD T++GPSN+SLPDG  C H  
Sbjct  45    TTKISNVSDGGEWVLLHKSIGVSAMHMQLLKNDKVIIFDWTDMGPSNLSLPDGAACRHYL  104

Query  337   ggglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGE-G  513
                        ++CTAHS+ YD+A+++ RP+ V S+ WCSSG++   G LVQTGGYG+ G
Sbjct  105   FHNRTI-----NDCTAHSLIYDLATDTSRPLFVASETWCSSGALDANGALVQTGGYGDNG  159

Query  514   TRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGP  693
              R +R FSPC+D  C W E+P  L   RWY+++ ILPDGR I+VGGR+AF YEF+PK   
Sbjct  160   IRRIRTFSPCDDDSCQWVELPTNLSDRRWYASNQILPDGRVIVVGGRKAFTYEFYPKKND  219

Query  694   A--DTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTY  867
                D  +   FLA+T D G   ENNLYPF+ L  DGNLFIFANNR+IL D+ NN +V+  
Sbjct  220   ESYDKLFYFRFLAETNDQG--EENNLYPFLHLLPDGNLFIFANNRSILFDHSNNRIVKEL  277

Query  868   PEIPGGEPRNYPSSGSAVLLPLKNLKGPTT-----MAEVLVCGGSPKDAYYNAKRNIFVG  1032
             P +P    RNYPS+GS+VLLPLK + G  +       E+L+CGG+   A+  +K  I VG
Sbjct  278   PGMPVAVKRNYPSTGSSVLLPLK-MNGVLSGSGLPEVEILICGGALPGAFNLSKNKIHVG  336

Query  1033  ALNTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAF  1212
             A N+CGRI ++DP+P+W+ EEMP PRVM DM++LPTG+V+IINGA+NG AGWD   NP F
Sbjct  337   ASNSCGRIKLSDPHPKWVMEEMPMPRVMSDMLLLPTGDVIIINGASNGTAGWDAAENPVF  396

Query  1213  HPVLYRP-DAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPT  1389
             +PVLYR  ++ P  RF + NP+ IPRMYHS+A+L+ DG++LV GSNPH  Y F    FPT
Sbjct  397   NPVLYRTYESNPDRRFVVLNPSSIPRMYHSAALLVPDGKILVGGSNPHNEYNFRRA-FPT  455

Query  1390  ELSMEAFSPSYLDPKYAALRPEIVSPASQSG-LSYGEVVSVQFKVSGKVDMSQVKVTMVS  1566
             +LS++AF P YL P +A LRP I+S  ++   +SYG+  SV F +S      ++ V +V+
Sbjct  456   DLSLQAFHPPYLGPLFAPLRPSILSVETRDDTVSYGQEFSVTFVLSVYRADPRISVALVT  515

Query  1567  PAFSTHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSK  1746
             P+F+THSF+MNQR++VL+   ++      Y I    P    +AP GYYLLF+VH   PS 
Sbjct  516   PSFTTHSFAMNQRMVVLDVALLEHLSTTAYKITAYGPPKNTVAPPGYYLLFLVHAGTPSH  575

Query  1747  GIWV  1758
             G+WV
Sbjct  576   GVWV  579



>ref|XP_009119411.1| PREDICTED: galactose oxidase [Brassica rapa]
Length=552

 Score =   538 bits (1385),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 275/536 (51%), Positives = 359/536 (67%), Gaps = 31/536 (6%)
 Frame = +1

Query  193   KWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPDD  372
             +W +L PSIGISAMHMQLLHN  V+ FDRT+ G SN+SLP G C          R  P D
Sbjct  37    RWEVLLPSIGISAMHMQLLHNGMVIMFDRTDFGISNLSLPGGMC----------RFDPSD  86

Query  373   -----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFS  537
                  +C+AHSV YDV SN++R + V +D WCSSGSV P GTLVQTGGY +G R  R F+
Sbjct  87    TAVKFDCSAHSVLYDVVSNTYRALKVQTDTWCSSGSVLPNGTLVQTGGYNDGERAARMFT  146

Query  538   PCNDAE-CDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYS-  711
             PC  +E CDW E P  L + RWY+T+ ILPDGR I+VGGRR FN+E FP+  P    Y  
Sbjct  147   PCGYSETCDWIEFPQYLAQRRWYATNQILPDGRIIVVGGRRQFNFEIFPR--PDSHGYRG  204

Query  712   --LPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGG  885
                 FL +TTD    +ENNLYPF+ L  DGNLF+FAN R+I+ DY  N +VR +PEIP G
Sbjct  205   SRFDFLRETTDGS--SENNLYPFLYLLPDGNLFVFANTRSIVFDYKRNRIVREFPEIPDG  262

Query  886   EPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAK-RNIFVGALNTCGRIVI  1062
             +PRNYPSSGS++L PL   K     AE++VCGG+PKDA+  AK +  F  A +TCGR+ +
Sbjct  263   DPRNYPSSGSSILFPLDESKN-IMEAEIMVCGGAPKDAFPRAKSQQGFTRATSTCGRLRL  321

Query  1063  TDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAP  1242
             T PNP W  E MP PRVMGDM++LPTG+++I+NGA  G AGW+  R+P   PV+Y P   
Sbjct  322   TSPNPIWEMETMPLPRVMGDMLLLPTGDIIIVNGAGAGTAGWENARDPVTRPVIYHPF--  379

Query  1243  PGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSY  1422
                RF + + +  PRMYHSSAVL+ DGRVLV GSNPH  Y FTNV +PTELS+EA+SP Y
Sbjct  380   -DHRFSIMSTSSCPRMYHSSAVLLPDGRVLVGGSNPHIYYNFTNVEYPTELSLEAYSPPY  438

Query  1423  LDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQ  1602
             L     ++RP I++  +   +SY  + +V F +   + +  + V +V+P+F+THSF+MNQ
Sbjct  439   LSFTSDSIRPHILT--NDKVISYKRLFNVHFSIPQFLTIDLLSVRIVAPSFTTHSFAMNQ  496

Query  1603  RLLVLNTVKVKAAG-EEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             R+++L  + V        Y +DV+ P +  +AP GYY++F+VH  IPS G WV I+
Sbjct  497   RMVILKLLSVTHEDLTNSYKLDVLGPSTAEIAPPGYYMIFLVHAGIPSSGFWVQIE  552



>ref|XP_004489989.1| PREDICTED: uncharacterized protein LOC101500908 [Cicer arietinum]
Length=599

 Score =   539 bits (1389),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 275/538 (51%), Positives = 363/538 (67%), Gaps = 24/538 (4%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G W  LQ SIGISAMHMQ++ ++KV+ FDRT+ GPSNISL +G C          R  P 
Sbjct  72    GHWVQLQTSIGISAMHMQVMKDNKVIIFDRTDFGPSNISLSNGHC----------RYNPR  121

Query  370   D-----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRF  534
             D     +CTAHS+ YD++SN+ RP+ + +D WCSSG+++  GTL+QTGG+ +G   +R F
Sbjct  122   DISLKLDCTAHSILYDISSNTLRPLTLQTDAWCSSGALNVNGTLIQTGGFNDGYNKLRTF  181

Query  535   SPC-NDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYS  711
             +PC     CDW E+P  L   RWY+++ ILP+GR I+VGGR +F+YEF PKS    +F+ 
Sbjct  182   TPCPQTNNCDWNELPQNLTSSRWYASNQILPNGRIIVVGGRSSFSYEFVPKSLNDVSFFY  241

Query  712   LPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEP  891
             L FL  T D   G ENNLYPF+ L  DGNLFIFAN R+IL DY  N V++ +P IPG E 
Sbjct  242   LRFLQITRDSNPGEENNLYPFLHLLPDGNLFIFANRRSILFDYNRNRVIKEFPIIPGEEK  301

Query  892   RNYPSSGSAVLLPLKNL----KGPTTMAEVLVCGGSPKDAYYNA-KRNIFVGALNTCGRI  1056
             RNYPS+GS+V+LPL NL     G     E++VCGG+   A+  A K  +FV A  TCGR+
Sbjct  302   RNYPSTGSSVMLPL-NLTGLGNGSLLEVEIMVCGGAFPGAFELANKHKVFVEASRTCGRL  360

Query  1057  VITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPD  1236
              ++D  PEW+ E MP PRVM DM++LPTGN++I+NGA NG AGW+   NP F+PVLYRP 
Sbjct  361   KVSDLKPEWVMEVMPMPRVMPDMILLPTGNLIILNGAGNGTAGWENAANPVFYPVLYRPG  420

Query  1237  -APPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFS  1413
              A P  RF+L  P   PRMYHSSAVL+ DGR+LV GSNPH  Y F +  +PTELS++A+ 
Sbjct  421   LADPLPRFQLLAPASTPRMYHSSAVLLPDGRILVGGSNPHRIYDFRSYPYPTELSLDAYY  480

Query  1414  PSYLDPKYAALRPEIVS-PASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSF  1590
             P YL P++  LRP I+S  A  +  SYG + SV F +    +++ +KVTMV+P+F+THSF
Sbjct  481   PDYLGPEFGGLRPVIMSVEAVYNTASYGGLFSVTFALREVREINGIKVTMVAPSFTTHSF  540

Query  1591  SMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             +MNQR+LVL    ++  G   Y   +  P S  +AP GYY+L+VVH  IPS  +WVH+
Sbjct  541   AMNQRVLVLEMTAMEEVGNLVYKATIRGPTSLTVAPPGYYMLYVVHAGIPSVAVWVHV  598



>ref|XP_011026783.1| PREDICTED: galactose oxidase-like [Populus euphratica]
Length=547

 Score =   537 bits (1383),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 283/547 (52%), Positives = 361/547 (66%), Gaps = 24/547 (4%)
 Frame = +1

Query  154   FFTAAAAAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHg  333
              FT A  +    GKW LL+ SIGISAMHMQLL NDK++AFD    GPSNISLP GKC   
Sbjct  16    LFTLALGSQTHRGKWKLLKRSIGISAMHMQLLPNDKIIAFDWKGSGPSNISLPGGKC---  72

Query  334   gggglggRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEG  513
                          +C +HSVE+D +S   RP+ + +D WCSSG++ P G L+Q+GG+  G
Sbjct  73    -----VVDSETTTDCYSHSVEFDPSSRRIRPLTITTDTWCSSGALLPNGILIQSGGFRLG  127

Query  514   TRVVRRFSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGP  693
              RVVR F+PC  A CDW E   GL+  RWY+++ ILP+G+ I+VGG   FNYEF PK+  
Sbjct  128   DRVVRSFTPC--ANCDWVEKKNGLITSRWYASNQILPNGKIIVVGGLNQFNYEFIPKTST  185

Query  694   AD-TFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYP  870
             +D T Y LPFL +T    L   NNLYPF+ L   G LFIFAN+RAILLD+VNN VV+ YP
Sbjct  186   SDQTLYQLPFLKETRYSPL-IPNNLYPFLHLTPGGKLFIFANDRAILLDHVNNKVVKNYP  244

Query  871   EIPGGEPRNYPSSGSAVLLPL---KNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALN  1041
              +PGG  RNYPS+GS+VLLPL    N       AEV +CGG+  D+   A   +F+ A  
Sbjct  245   VMPGGVSRNYPSTGSSVLLPLILSSNFNNHPE-AEVFICGGTVPDSNQMANVGVFIAASK  303

Query  1042  TCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPV  1221
             +CGR+VIT  NP W  EEMP  R+MGDM++LPTG+VLIINGA  G+AGW  GR P  +PV
Sbjct  304   SCGRLVITANNPSWEMEEMPLNRLMGDMILLPTGDVLIINGAAKGSAGWYAGREPVLNPV  363

Query  1222  LYRPDAP---PGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTE  1392
             LYRPDAP     SRFE+ +P+KIPR+YHS+A L++DGRVLV GSNP++ Y FT   +PTE
Sbjct  364   LYRPDAPITAKTSRFEIMSPSKIPRLYHSTAHLLSDGRVLVGGSNPNSNYNFT-ALYPTE  422

Query  1393  LSMEAFSPSYLDPKYAALRPEIVSPASQSGLSYGEVVSVQFKV-SGKVDMSQVKVTMVSP  1569
             LS+E F P Y  P  +  RP I      + L Y +  S+ F +     ++ ++ VTMV+P
Sbjct  423   LSVEVFYPPYFSPNVS--RPLISKINPGTNLEYKQKFSMHFHIHQWHEELGKIYVTMVAP  480

Query  1570  AFSTHSFSMNQRLLVLNT-VKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSK  1746
             +F++HS+SMNQRLLVL    + +      Y +DV AP +  LAP GYY LFVVH  +PSK
Sbjct  481   SFTSHSYSMNQRLLVLALDSEAQKVDFSNYVVDVHAPATATLAPPGYYQLFVVHEGVPSK  540

Query  1747  GIWVHIQ  1767
             G WVHI+
Sbjct  541   GTWVHIK  547



>ref|XP_004298452.1| PREDICTED: galactose oxidase-like [Fragaria vesca subsp. vesca]
Length=576

 Score =   538 bits (1386),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 277/542 (51%), Positives = 364/542 (67%), Gaps = 16/542 (3%)
 Frame = +1

Query  172   AAVRGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglg  351
             AA   GG+W LL  +IG+SAMHMQLL N+KVV FDRT++GPSN + PDG        G  
Sbjct  41    AAPYDGGQWILLHKNIGVSAMHMQLLKNNKVVLFDRTDMGPSNATYPDGAVQ---CRGYS  97

Query  352   gRKPPDDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRR  531
              +     +CT HS+ YDVAS++FR ++V SD WCSSG+V P G LVQTGGYG G + +R 
Sbjct  98    VKNRTVTDCTPHSLLYDVASDTFRALVVNSDTWCSSGAVDPNGNLVQTGGYGTGIQTIRT  157

Query  532   FSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADT-FY  708
             FSPC+D  C W+E+   L+  RWY+T+ ILPDGR I+VGGRRAF+YEF+PK+    +  Y
Sbjct  158   FSPCDDDTCQWDEMETKLLAHRWYATNQILPDGRVIVVGGRRAFSYEFYPKADDMSSRLY  217

Query  709   SLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGE  888
              + FL +T DP    ENNLYPF+ L  DGNLF+FANNR++L +Y +N VV+ +P + GG 
Sbjct  218   YMRFLWETADP--YEENNLYPFLHLLPDGNLFVFANNRSVLFNYTSNAVVKEFPAMRGGV  275

Query  889   PRNYPSSGSAVLLPLKN---LKGPTT-MAEVLVCGGSPKDAYYNAKRN---IFVGALNTC  1047
              R+YP++GS+VLLPLK    L G      EVL+CGGS   AY  +  N   ++VGA  +C
Sbjct  276   KRSYPATGSSVLLPLKMDAVLDGSGRPEVEVLICGGSYGGAYNKSNLNRVKVYVGASASC  335

Query  1048  GRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLY  1227
             GRI ++DP+PEW  EEMP PRVMGDM++LP G+V+I+NGA NG AGW+   NP  HPV+Y
Sbjct  336   GRIRLSDPDPEWAMEEMPRPRVMGDMLLLPNGDVIILNGAANGTAGWEDAINPVLHPVMY  395

Query  1228  RPDAP-PGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSME  1404
             +   P P  RF   NP  IPRMYHSS +L+ DGR+LV GSNPH  Y F    FPTELS+E
Sbjct  396   KTYEPDPRRRFVTLNPTTIPRMYHSSCLLLPDGRILVGGSNPHEMYNFRRA-FPTELSLE  454

Query  1405  AFSPSYLDPKYAALRPEIVS-PASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFST  1581
             A+ P YL    A LRP I+S  A ++ +SYG+  SV F +S       + V +V+P+F+T
Sbjct  455   AYLPPYLSSTAAPLRPTIISIEARENIVSYGQEFSVNFGLSVYRPDVAISVALVAPSFTT  514

Query  1582  HSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVH  1761
             HS +MNQR++VL    +K     +Y I    P S  +AP GYY++F+VH  IP + +WV 
Sbjct  515   HSLAMNQRVVVLEVASLKRLSVFDYKITARGPPSSTVAPPGYYMVFIVHAGIPGQALWVK  574

Query  1762  IQ  1767
             +Q
Sbjct  575   VQ  576



>gb|KDO82728.1| hypothetical protein CISIN_1g048017mg [Citrus sinensis]
Length=566

 Score =   537 bits (1384),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 281/540 (52%), Positives = 365/540 (68%), Gaps = 37/540 (7%)
 Frame = +1

Query  181   RGGGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRK  360
             + GG+W LLQ SIGISAMHMQ+L+NDKV+ FDRT++GPSN+SLP  KC          RK
Sbjct  49    KSGGQWVLLQSSIGISAMHMQVLNNDKVIIFDRTDMGPSNLSLPIDKC----------RK  98

Query  361   PPDD---NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRR  531
               D    +CTAHSV YD+ASN+FRP+L+ +D WCSSG+V   GTLVQTGGY  G RV+R 
Sbjct  99    EGDVGQLDCTAHSVLYDIASNTFRPLLLQTDTWCSSGAVLSDGTLVQTGGYNVGDRVIRL  158

Query  532   FSPCNDAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYS  711
             F+PCND  CDW E+   L   RWY+++ ILPD R I+VGGRR F YEF+PK     +   
Sbjct  159   FTPCNDEGCDWVELSKNLWDRRWYASNQILPDNRIIVVGGRRVFTYEFYPKIDSLSSSLY  218

Query  712   LPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEP  891
             L FL +T DP  G ENNLYPF+ L  DGNLFIFAN R+IL DY+NN +V+ +P IPG + 
Sbjct  219   LRFLIETRDP--GEENNLYPFLHLLPDGNLFIFANRRSILFDYINNKLVKEFPVIPGNDK  276

Query  892   RNYPSSGSAVLLPLK-------NLKGPTTMAEVLVCGGSPKDAYYNA-KRNIFVGALNTC  1047
             RNYPS+GS++LLP+K       N       AEV+VCGG+P  A+  + K +++V A  TC
Sbjct  277   RNYPSTGSSILLPVKLSAGSDGNGTAALPDAEVMVCGGAPAGAFIKSDKESVYVEASRTC  336

Query  1048  GRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLY  1227
             GR+ +TD  P W  E MP PRVM DM++LP+G+V+IINGA+NG AGW+            
Sbjct  337   GRLKVTDKYPVWSMEFMPMPRVMSDMLLLPSGDVIIINGASNGTAGWEDAEE--------  388

Query  1228  RPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEA  1407
                  P  RF + NP+KIPRMYHSSAV++ DGR+LV GSNPH  Y FT   +PT+LS+EA
Sbjct  389   -----PDRRFVVLNPSKIPRMYHSSAVVLPDGRILVGGSNPHRRYNFTAYPYPTDLSLEA  443

Query  1408  FSPSYLDPKYAALRPEIVSPAS-QSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTH  1584
             F P YLDP+ A +RP I+S  S    +SY EV +V F++S      ++ V++++P+F+TH
Sbjct  444   FHPHYLDPENAYMRPSILSLESIDRTVSYNEVFAVTFELSSYSPSGEISVSLMTPSFTTH  503

Query  1585  SFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             SF+MNQRL+VLN V V       Y + V  P +  +AP GYY++FVVH  IPS  +WV +
Sbjct  504   SFAMNQRLVVLNVVSVSQLSVYAYKVVVNGPPTATVAPPGYYMMFVVHAGIPSHAVWVKV  563



>ref|XP_010041767.1| PREDICTED: galactose oxidase [Eucalyptus grandis]
 gb|KCW84906.1| hypothetical protein EUGRSUZ_B01735 [Eucalyptus grandis]
Length=551

 Score =   536 bits (1382),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 281/531 (53%), Positives = 364/531 (69%), Gaps = 18/531 (3%)
 Frame = +1

Query  190   GKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPD  369
             G+W LL+PSIGISAMHMQLL N+KVV FDRT+ GPSNISLP G+C +             
Sbjct  34    GEWRLLRPSIGISAMHMQLLRNNKVVVFDRTDFGPSNISLPGGRCRYDSNDTALKV----  89

Query  370   DNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCND  549
              +CTAHSV YDV +NSFRP++V +D WCSSG+VSP G+LVQTGG+ +G   VR F+PCN 
Sbjct  90    -DCTAHSVLYDVETNSFRPLMVQTDTWCSSGAVSPGGSLVQTGGFNDGDHAVRIFTPCNA  148

Query  550   AECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPK-----SGPADTFYSL  714
               CDW E P  L R RWY+T+ ILPDGR II+GGRR FNYEF+PK     S  + +F+ L
Sbjct  149   DSCDWVEYPGYLSRRRWYATNQILPDGRIIIIGGRREFNYEFYPKNEDPYSASSGSFW-L  207

Query  715   PFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPR  894
              FL +T D    +ENNLYPFV L  DGNLFIFAN R+I LDY  N VV+ +P IP  +PR
Sbjct  208   QFLLETRDE---SENNLYPFVHLLPDGNLFIFANTRSISLDYNRNRVVKEFPPIPISDPR  264

Query  895   NYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPN  1074
             NYPSSGS+VLLP+   +     AE+++CGG+P+ A+  A R  FV A ++CGR+ ++D +
Sbjct  265   NYPSSGSSVLLPID--ENQAIEAEIMICGGAPRGAFAEAGRGNFVRASSSCGRLRVSDED  322

Query  1075  PEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSR  1254
             P W+ E MP  RVMGDM++L TG+V+IING   G AGW+LG++P   PV+YRP+  P  R
Sbjct  323   PRWVMENMPIARVMGDMLLLATGDVIIINGVERGTAGWELGQSPVTRPVVYRPNGNPDWR  382

Query  1255  FELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPK  1434
             F + + + IPR+YHSSA+L+ DGRVLV GSNPH  Y F NV +PT+LS+EAFSP YL  +
Sbjct  383   FSVMSASPIPRLYHSSAILLADGRVLVGGSNPHRYYNFANVEYPTDLSLEAFSPPYLSIE  442

Query  1435  YAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLV  1614
             +   RP+I S      L  G+  S+ F V   +  + + V +V+P+F+THS +MNQR++V
Sbjct  443   HKPFRPQISS--VNEILMLGQPFSLTFFVPLYLSENLLSVRIVAPSFTTHSLAMNQRMVV  500

Query  1615  LNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             L  V V     + Y +  V P +  + P GYY+LFVVH  IPS G WV IQ
Sbjct  501   LKLVGVSRLTPDSYQLTAVGPSTAEIGPPGYYMLFVVHAGIPSWGSWVKIQ  551



>ref|XP_006290310.1| hypothetical protein CARUB_v10019204mg [Capsella rubella]
 gb|EOA23208.1| hypothetical protein CARUB_v10019204mg [Capsella rubella]
Length=547

 Score =   536 bits (1381),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 265/531 (50%), Positives = 351/531 (66%), Gaps = 26/531 (5%)
 Frame = +1

Query  193   KWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPDD  372
             +W +L PSIGISAMHMQLLHN  V+ FDRT+ G SN+SLP G C +          P D 
Sbjct  37    RWEMLLPSIGISAMHMQLLHNGMVIMFDRTDFGTSNVSLPGGVCRY---------DPTDT  87

Query  373   ----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSP  540
                 +C+AHSV YDV SN+FRP+ V +D WCSSG+V P GTLVQTGGY +G R  R F+P
Sbjct  88    AVKFDCSAHSVLYDVVSNTFRPLQVQTDTWCSSGAVLPNGTLVQTGGYNDGERAARTFTP  147

Query  541   CNDAE-CDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYSLP  717
             C  +E CDW E P  L + RWY+T+ ILPDGR I+VGGRR FN+EFFP+           
Sbjct  148   CGYSETCDWIEFPQYLSQRRWYATNQILPDGRIIVVGGRRQFNFEFFPRHSSRSRSSRFE  207

Query  718   FLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRN  897
             FL +T+D     ENNLYPF+ L  DGNLF+FAN R+I+ DY  N VV+ +PEIPGG+PRN
Sbjct  208   FLRETSDGS--NENNLYPFIHLLPDGNLFVFANTRSIVFDYKRNRVVKEFPEIPGGDPRN  265

Query  898   YPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNP  1077
             YPSSGS++L PL    G     E++VCGGSP+  +       F  A +TCGR+ ++D NP
Sbjct  266   YPSSGSSILFPLDETNGTDVQVEIMVCGGSPRGGFSRG----FTRATSTCGRLKLSDQNP  321

Query  1078  EWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRF  1257
              W  E MP PRVMGDM++LPTG+V+I+NGA  G AGW+  R+P   P++Y P       F
Sbjct  322   SWEMETMPLPRVMGDMLLLPTGDVIIVNGAGTGTAGWEKARDPVIQPLIYHPF---DRLF  378

Query  1258  ELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKY  1437
              + +    PRMYHSSAVL+ DGRVLV GSNPH  Y FTNV +PT+LS+EA+SP YL    
Sbjct  379   SVMSTPTRPRMYHSSAVLLPDGRVLVGGSNPHVYYNFTNVEYPTDLSLEAYSPPYLSFTS  438

Query  1438  AALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQRLLVL  1617
               +RP+I++  S   L Y  + ++ F +   + +  + V +V+P+F+THSF+MNQR+++L
Sbjct  439   DPIRPKILT--SDKVLGYKRLFNIDFSIPQFLTVDLLSVRIVAPSFTTHSFAMNQRMVIL  496

Query  1618  NTVKV-KAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             N + V +      Y ++V+ P +  +AP GYY++F+VH  IPS   WV I+
Sbjct  497   NLLSVTRDQLTNSYRVNVLGPSTAEIAPPGYYMMFLVHAGIPSSAAWVQIE  547



>ref|XP_006833409.1| hypothetical protein AMTR_s00109p00131490 [Amborella trichopoda]
 gb|ERM98687.1| hypothetical protein AMTR_s00109p00131490 [Amborella trichopoda]
Length=603

 Score =   537 bits (1384),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 276/530 (52%), Positives = 356/530 (67%), Gaps = 16/530 (3%)
 Frame = +1

Query  187   GGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPP  366
              G W L   + GISAMH+QL+ + KVV FD +  GPS I L  G+C          R+  
Sbjct  85    AGSWELASANTGISAMHVQLMPSGKVVMFDASVFGPSKIKLDGGRCR----IDKRERRKG  140

Query  367   DDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSPCN  546
             +++C AH+VEYDV + + RP++V ++ WCSSG++   G L+QTGG+ EG  VVR +  C 
Sbjct  141   NNDCWAHAVEYDVDTAAVRPLMVKTNTWCSSGALGADGRLIQTGGFNEGGNVVRLYESCK  200

Query  547   DAECDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPAD-TFYSLPFL  723
             D  CDW E P  L   RWYS+DHILPDG  IIVGGRR F+YEF P  G ++   Y LPFL
Sbjct  201   D--CDWVEKPNSLSGQRWYSSDHILPDGNVIIVGGRRKFSYEFIPAEGNSELKVYDLPFL  258

Query  724   AQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGGEPRNYP  903
              +TTD     ENNLYPF+ L+ DGNLF+FAN+R+ILLDY NN +VRT+P +PGG  RNYP
Sbjct  259   KETTD---DVENNLYPFLHLSTDGNLFVFANDRSILLDYKNNRIVRTFPVLPGGS-RNYP  314

Query  904   SSGSAVLLPLKNLKGPTTM--AEVLVCGGSPKDAYYNAKRNIFVGALNTCGRIVITDPNP  1077
             +SGSAVLLP++ L+G   +  +EVL+CGG+  ++   A R +FV AL+TCGRI ITDPN 
Sbjct  315   ASGSAVLLPIR-LRGRENLIPSEVLICGGATPESASQADRGVFVDALDTCGRITITDPNS  373

Query  1078  EWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAPPGSRF  1257
             +W  E MP  RVMGDM+ILP   VLIINGA +G +GW   RNP   PVLY P  P   RF
Sbjct  374   QWKIERMPSRRVMGDMLILPNAQVLIINGAKSGTSGWSFARNPNLSPVLYNPRNPRNQRF  433

Query  1258  ELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSYLDPKY  1437
             +  NP+ IPRMYHSS V++ DG+VL+AGSN +  Y +T++ +PTEL  E FSP YLDP  
Sbjct  434   QTLNPSTIPRMYHSSGVVLPDGKVLIAGSNTNPKYNYTSL-YPTELRAEKFSPPYLDPSL  492

Query  1438  AALRPEIVSPASQSGLSYGEVVSVQFKVSGK-VDMSQVKVTMVSPAFSTHSFSMNQRLLV  1614
             A+ RP I++      L+YG    +Q  +S + V  + + VTM +P F+THS+S NQR+LV
Sbjct  493   ASHRPNILTELMPKALAYGGGFKIQISLSDQIVADTDLSVTMYAPPFTTHSYSQNQRMLV  552

Query  1615  LNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHI  1764
             L    V+      Y I VVAP S  +AP GYYLLFVVH  +PS+G+WVHI
Sbjct  553   LRMNDVEQVAPGTYQISVVAPPSAVVAPPGYYLLFVVHFGVPSEGVWVHI  602



>emb|CDY62245.1| BnaC01g42480D [Brassica napus]
Length=552

 Score =   535 bits (1379),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 274/536 (51%), Positives = 358/536 (67%), Gaps = 31/536 (6%)
 Frame = +1

Query  193   KWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPDD  372
             +W +L PS+GISAMHMQLLHN  V+ FDRT+ G SN+SLP G C          R  P D
Sbjct  37    RWEVLLPSVGISAMHMQLLHNGMVIMFDRTDFGISNLSLPGGMC----------RFDPSD  86

Query  373   -----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFS  537
                  +C+AHSV YDV SN++R + V +D WCSSGSV P GTLVQTGGY +G R  R F+
Sbjct  87    TAVKFDCSAHSVLYDVVSNTYRALKVQTDTWCSSGSVLPNGTLVQTGGYNDGERAARMFT  146

Query  538   PCNDAE-CDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYS-  711
             PC  +E CDW E P  L + RWY+T+ ILPDGR I+VGGRR FN+E FP+  P    Y  
Sbjct  147   PCGYSETCDWIEFPQYLAQRRWYATNQILPDGRIIVVGGRRQFNFEIFPR--PDSHRYRG  204

Query  712   --LPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGG  885
                 FL +TTD    +ENNLYPF+ L  DGNLF+FAN R+I+ DY  N +VR +PEIPGG
Sbjct  205   SRFDFLRETTDGS--SENNLYPFLYLLPDGNLFVFANTRSIVFDYKRNRIVREFPEIPGG  262

Query  886   EPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAK-RNIFVGALNTCGRIVI  1062
             +PRNYPSSGS++L PL   K     AE++VCGG+PKDA+  AK +  F  A +TCGR+ +
Sbjct  263   DPRNYPSSGSSILFPLDESKN-IMEAEIMVCGGAPKDAFPRAKSQQGFTCATSTCGRLRL  321

Query  1063  TDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAP  1242
             T PNP W  E MP PRVMGDM++LPTG+++I+NGA  G AGW+  R+P   PV+Y P   
Sbjct  322   TSPNPIWEMETMPLPRVMGDMLLLPTGDIIIVNGAGAGTAGWENARDPVTRPVIYHPF--  379

Query  1243  PGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSY  1422
                RF + + +   RMYHSSAVL+ DGRVLV GSNPH  Y FTNV +PTELS+EA+SP Y
Sbjct  380   -DRRFSIMSTSSRSRMYHSSAVLLPDGRVLVGGSNPHIYYNFTNVEYPTELSLEAYSPPY  438

Query  1423  LDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQ  1602
             L     ++RP I++  +   +SY  + +V F +   + +  + V +V+P+F+THSF+MNQ
Sbjct  439   LSFTSDSIRPHILT--NDKVISYKRLFNVNFSIPQFLTIDLLSVRIVAPSFTTHSFAMNQ  496

Query  1603  RLLVLNTVKVKAAG-EEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             R+++L  + V        Y ID + P +  +AP GYY++F+VH  IPS G WV I+
Sbjct  497   RMVILKLLSVTHEDLTNSYKIDALGPSTAEIAPPGYYMIFLVHAGIPSSGFWVQIE  552



>ref|XP_010096335.1| hypothetical protein L484_021082 [Morus notabilis]
 gb|EXB63810.1| hypothetical protein L484_021082 [Morus notabilis]
Length=588

 Score =   536 bits (1381),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 281/544 (52%), Positives = 363/544 (67%), Gaps = 24/544 (4%)
 Frame = +1

Query  187   GGKWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPP  366
             GG W LL  SIG+SAMHMQLL N KVV FD   +GPSN++LP+ +C          R+  
Sbjct  52    GGNWILLHSSIGVSAMHMQLLRNGKVVIFDGIEVGPSNLTLPNNQCLRITNN----RRQV  107

Query  367   DDNCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFSP-C  543
               +CTAHSV YDV SN+FRP+ + ++ WCSSGSV+  GTLVQTGGYG+G R +R FSP C
Sbjct  108   VTDCTAHSVLYDVISNTFRPLTLRTNTWCSSGSVASDGTLVQTGGYGDGIRKIRTFSPFC  167

Query  544   ----ND-------AECDWEEIP-YGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKS  687
                 ND       + CDW E     L   RWYS+  +LPDGR IIVGGR+AF+YEFFPK+
Sbjct  168   IQYQNDVVVSDGSSSCDWTEFAGISLADRRWYSSSQVLPDGRLIIVGGRQAFSYEFFPKN  227

Query  688   GPADTFYSLPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTY  867
                D  + L FL +T DP    ENNLYPF+ L  DGNLFIFANNR+I LDY  N +V+ +
Sbjct  228   PQNDRSFYLRFLFETMDPY--EENNLYPFLHLLPDGNLFIFANNRSISLDYNRNRIVKEF  285

Query  868   PEIPGGEPRNYPSSGSAVLLPLKNLKGPTTM--AEVLVCGGSPKDAY-YNAKRNIFVGAL  1038
             P IPGG  R+YPS+GS+VLLPL+ L     +  AEV++CGGS   A+  + K  +F+ A 
Sbjct  286   PIIPGGYKRSYPSTGSSVLLPLR-LHADVAIPEAEVIICGGSQSGAFTMSNKARVFLPAA  344

Query  1039  NTCGRIVITDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHP  1218
              +CGRI +TD +P+W+ E MP PRVM DM+ILPTG+V+IINGA NG AGW+   NP  +P
Sbjct  345   RSCGRIKVTDSDPKWVMEYMPMPRVMPDMLILPTGDVIIINGAGNGTAGWNDAVNPVLNP  404

Query  1219  VLYRPDAPPGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELS  1398
             VLYR     G RF + NP  IPRMYHSSAVL+  G +LV GSNPH  Y FT   FPTELS
Sbjct  405   VLYRTGKRYGRRFSVLNPTAIPRMYHSSAVLLPSGGILVGGSNPHRKYNFTADLFPTELS  464

Query  1399  MEAFSPSYLDPKYAALRPEIVS-PASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAF  1575
             +E + P YLD +YA++RP I++   +   +SYG++ SV F +     +  V V +V+P+F
Sbjct  465   LEVYQPYYLDTQYASMRPSILTIETNMQVVSYGQMFSVTFVLPMYRPIPGVSVALVTPSF  524

Query  1576  STHSFSMNQRLLVLNTVKVKAAGEEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIW  1755
             STHSF+MNQR+LVL+    +      Y I    P +  +AP GYY+LF+VH  +PS+G+W
Sbjct  525   STHSFAMNQRMLVLDVAGFERLSIVAYKITAHGPPTSAVAPPGYYMLFLVHSGVPSEGVW  584

Query  1756  VHIQ  1767
             V ++
Sbjct  585   VKVE  588



>ref|XP_006392509.1| hypothetical protein EUTSA_v10023396mg [Eutrema salsugineum]
 gb|ESQ29795.1| hypothetical protein EUTSA_v10023396mg [Eutrema salsugineum]
Length=548

 Score =   534 bits (1375),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 275/536 (51%), Positives = 359/536 (67%), Gaps = 31/536 (6%)
 Frame = +1

Query  193   KWNLLQPSIGISAMHMQLLHNDKVVAFDRTNIGPSNISLPDGKCHHggggglggRKPPDD  372
             +W LL P+IGISAMHMQLLHN  V+ FDRT+ G SN+SLP G C          R  P D
Sbjct  33    RWELLVPNIGISAMHMQLLHNGMVIMFDRTDFGVSNLSLPGGIC----------RFDPSD  82

Query  373   -----NCTAHSVEYDVASNSFRPVLVLSDFWCSSGSVSPAGTLVQTGGYGEGTRVVRRFS  537
                  +C+AHSV YDV SN++R + V +D WCSSGSV P GTLVQTGGY +G R  R FS
Sbjct  83    TAVKFDCSAHSVLYDVVSNTYRALKVQTDTWCSSGSVLPNGTLVQTGGYNDGERATRMFS  142

Query  538   PCNDAE-CDWEEIPYGLVRPRWYSTDHILPDGRQIIVGGRRAFNYEFFPKSGPADTFYS-  711
             PC   E CDW E P  L + RWY+T+ ILPDGR I+VGGRR FN+EFFP+  P    Y  
Sbjct  143   PCGYGETCDWIEFPQYLAQRRWYATNQILPDGRIIVVGGRRQFNFEFFPR--PDHHRYRG  200

Query  712   --LPFLAQTTDPGLGAENNLYPFVLLNVDGNLFIFANNRAILLDYVNNVVVRTYPEIPGG  885
                 FL +TTD     ENNLYPF+ L  DGNLF+FAN R+I+ DY +N +VR +PEIPGG
Sbjct  201   SRFDFLRETTDGS--NENNLYPFLHLLPDGNLFVFANTRSIVFDYKSNRIVREFPEIPGG  258

Query  886   EPRNYPSSGSAVLLPLKNLKGPTTMAEVLVCGGSPKDAYYNAK-RNIFVGALNTCGRIVI  1062
             +PRNYPSSGS++L P+   K  T   E++VCGG+PK A+  AK ++ F  A++TCGR+ +
Sbjct  259   DPRNYPSSGSSILFPIDETKN-TMEVEIMVCGGAPKGAFSRAKSQHGFTRAISTCGRLKL  317

Query  1063  TDPNPEWITEEMPFPRVMGDMVILPTGNVLIINGATNGAAGWDLGRNPAFHPVLYRPDAP  1242
             TD NP W  E MP PRVMGDM++LPTGNV+I+NGA  G AGW+   +P   PV+Y P   
Sbjct  318   TDQNPSWEMETMPLPRVMGDMLLLPTGNVIIVNGAGAGTAGWENACDPVTRPVIYHPF--  375

Query  1243  PGSRFELQNPNKIPRMYHSSAVLITDGRVLVAGSNPHATYKFTNVFFPTELSMEAFSPSY  1422
                RF + + +  PRMYHSSAVL+ DGRVLV GSNPH  Y FTNV +PTELS+EA+SP Y
Sbjct  376   -DRRFSIMSTSSRPRMYHSSAVLLPDGRVLVGGSNPHIYYNFTNVEYPTELSLEAYSPPY  434

Query  1423  LDPKYAALRPEIVSPASQSGLSYGEVVSVQFKVSGKVDMSQVKVTMVSPAFSTHSFSMNQ  1602
             L     ++RP+I++  +   +SY  + +V F +   +    + V +V+P+F+THS +MNQ
Sbjct  435   LSFTSDSIRPKILT--NDKVVSYKRLFNVDFSIPQFLTTDLLSVRIVAPSFTTHSLAMNQ  492

Query  1603  RLLVLNTVKVKAAG-EEEYGIDVVAPDSGNLAPSGYYLLFVVHREIPSKGIWVHIQ  1767
             R+++L  + V   G    Y I+ + P +  +AP GYY++F+VH  +PS G WV I+
Sbjct  493   RMVILKLLSVTREGLTNSYRINALGPSTAEIAPPGYYMMFLVHAGVPSVGAWVQIE  548



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6314516345676